data_1PMN
# 
_entry.id   1PMN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PMN         
RCSB  RCSB019429   
WWPDB D_1000019429 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PMQ 'JNK3 in complex with an imidazole-pyrimidine inhibitor' unspecified 
PDB 1PMU 'JNK3 in complex with a phenantroline inhibitor'         unspecified 
PDB 1PMV 'JNK3 in complex with a dihydroanthrapyrazole inhibitor' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PMN 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scapin, G.'     1 
'Patel, S.B.'    2 
'Lisnock, J.'    3 
'Becker, J.W.'   4 
'LoGrasso, P.V.' 5 
# 
_citation.id                        primary 
_citation.title                     
'The structure of JNK3 in complex with small molecule inhibitors: structural basis for potency and selectivity' 
_citation.journal_abbrev            Chem.Biol. 
_citation.journal_volume            10 
_citation.page_first                705 
_citation.page_last                 712 
_citation.year                      2003 
_citation.journal_id_ASTM           CBOLE2 
_citation.country                   UK 
_citation.journal_id_ISSN           1074-5521 
_citation.journal_id_CSD            2050 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12954329 
_citation.pdbx_database_id_DOI      '10.1016/S1074-5521(03)00159-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Scapin, G.'     1 
primary 'Patel, S.B.'    2 
primary 'Lisnock, J.'    3 
primary 'Becker, J.W.'   4 
primary 'LoGrasso, P.V.' 5 
# 
_cell.entry_id           1PMN 
_cell.length_a           53.075 
_cell.length_b           71.341 
_cell.length_c           107.174 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PMN 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mitogen-activated protein kinase 10' 42001.641 1   2.7.1.- ? ? ? 
2 non-polymer syn 
'CYCLOPROPYL-{4-[5-(3,4-DICHLOROPHENYL)-2-[(1-METHYL)-PIPERIDIN]-4-YL-3-PROPYL-3H-IMIDAZOL-4-YL]-PYRIMIDIN-2-YL}AMINE' 485.452   1 
?       ? ? ? 
3 water       nat water 18.015    197 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Stress-activated protein kinase JNK3, c-Jun N-terminal kinase 3, MAP kinase p49 3F12' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVV
KSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIE
QLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVV
KSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIE
QLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   SER n 
1 6   LYS n 
1 7   VAL n 
1 8   ASP n 
1 9   ASN n 
1 10  GLN n 
1 11  PHE n 
1 12  TYR n 
1 13  SER n 
1 14  VAL n 
1 15  GLU n 
1 16  VAL n 
1 17  GLY n 
1 18  ASP n 
1 19  SER n 
1 20  THR n 
1 21  PHE n 
1 22  THR n 
1 23  VAL n 
1 24  LEU n 
1 25  LYS n 
1 26  ARG n 
1 27  TYR n 
1 28  GLN n 
1 29  ASN n 
1 30  LEU n 
1 31  LYS n 
1 32  PRO n 
1 33  ILE n 
1 34  GLY n 
1 35  SER n 
1 36  GLY n 
1 37  ALA n 
1 38  GLN n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  CYS n 
1 43  ALA n 
1 44  ALA n 
1 45  TYR n 
1 46  ASP n 
1 47  ALA n 
1 48  VAL n 
1 49  LEU n 
1 50  ASP n 
1 51  ARG n 
1 52  ASN n 
1 53  VAL n 
1 54  ALA n 
1 55  ILE n 
1 56  LYS n 
1 57  LYS n 
1 58  LEU n 
1 59  SER n 
1 60  ARG n 
1 61  PRO n 
1 62  PHE n 
1 63  GLN n 
1 64  ASN n 
1 65  GLN n 
1 66  THR n 
1 67  HIS n 
1 68  ALA n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  TYR n 
1 73  ARG n 
1 74  GLU n 
1 75  LEU n 
1 76  VAL n 
1 77  LEU n 
1 78  MET n 
1 79  LYS n 
1 80  CYS n 
1 81  VAL n 
1 82  ASN n 
1 83  HIS n 
1 84  LYS n 
1 85  ASN n 
1 86  ILE n 
1 87  ILE n 
1 88  SER n 
1 89  LEU n 
1 90  LEU n 
1 91  ASN n 
1 92  VAL n 
1 93  PHE n 
1 94  THR n 
1 95  PRO n 
1 96  GLN n 
1 97  LYS n 
1 98  THR n 
1 99  LEU n 
1 100 GLU n 
1 101 GLU n 
1 102 PHE n 
1 103 GLN n 
1 104 ASP n 
1 105 VAL n 
1 106 TYR n 
1 107 LEU n 
1 108 VAL n 
1 109 MET n 
1 110 GLU n 
1 111 LEU n 
1 112 MET n 
1 113 ASP n 
1 114 ALA n 
1 115 ASN n 
1 116 LEU n 
1 117 CYS n 
1 118 GLN n 
1 119 VAL n 
1 120 ILE n 
1 121 GLN n 
1 122 MET n 
1 123 GLU n 
1 124 LEU n 
1 125 ASP n 
1 126 HIS n 
1 127 GLU n 
1 128 ARG n 
1 129 MET n 
1 130 SER n 
1 131 TYR n 
1 132 LEU n 
1 133 LEU n 
1 134 TYR n 
1 135 GLN n 
1 136 MET n 
1 137 LEU n 
1 138 CYS n 
1 139 GLY n 
1 140 ILE n 
1 141 LYS n 
1 142 HIS n 
1 143 LEU n 
1 144 HIS n 
1 145 SER n 
1 146 ALA n 
1 147 GLY n 
1 148 ILE n 
1 149 ILE n 
1 150 HIS n 
1 151 ARG n 
1 152 ASP n 
1 153 LEU n 
1 154 LYS n 
1 155 PRO n 
1 156 SER n 
1 157 ASN n 
1 158 ILE n 
1 159 VAL n 
1 160 VAL n 
1 161 LYS n 
1 162 SER n 
1 163 ASP n 
1 164 CYS n 
1 165 THR n 
1 166 LEU n 
1 167 LYS n 
1 168 ILE n 
1 169 LEU n 
1 170 ASP n 
1 171 PHE n 
1 172 GLY n 
1 173 LEU n 
1 174 ALA n 
1 175 ARG n 
1 176 THR n 
1 177 ALA n 
1 178 GLY n 
1 179 THR n 
1 180 SER n 
1 181 PHE n 
1 182 MET n 
1 183 MET n 
1 184 THR n 
1 185 PRO n 
1 186 TYR n 
1 187 VAL n 
1 188 VAL n 
1 189 THR n 
1 190 ARG n 
1 191 TYR n 
1 192 TYR n 
1 193 ARG n 
1 194 ALA n 
1 195 PRO n 
1 196 GLU n 
1 197 VAL n 
1 198 ILE n 
1 199 LEU n 
1 200 GLY n 
1 201 MET n 
1 202 GLY n 
1 203 TYR n 
1 204 LYS n 
1 205 GLU n 
1 206 ASN n 
1 207 VAL n 
1 208 ASP n 
1 209 ILE n 
1 210 TRP n 
1 211 SER n 
1 212 VAL n 
1 213 GLY n 
1 214 CYS n 
1 215 ILE n 
1 216 MET n 
1 217 GLY n 
1 218 GLU n 
1 219 MET n 
1 220 VAL n 
1 221 ARG n 
1 222 HIS n 
1 223 LYS n 
1 224 ILE n 
1 225 LEU n 
1 226 PHE n 
1 227 PRO n 
1 228 GLY n 
1 229 ARG n 
1 230 ASP n 
1 231 TYR n 
1 232 ILE n 
1 233 ASP n 
1 234 GLN n 
1 235 TRP n 
1 236 ASN n 
1 237 LYS n 
1 238 VAL n 
1 239 ILE n 
1 240 GLU n 
1 241 GLN n 
1 242 LEU n 
1 243 GLY n 
1 244 THR n 
1 245 PRO n 
1 246 CYS n 
1 247 PRO n 
1 248 GLU n 
1 249 PHE n 
1 250 MET n 
1 251 LYS n 
1 252 LYS n 
1 253 LEU n 
1 254 GLN n 
1 255 PRO n 
1 256 THR n 
1 257 VAL n 
1 258 ARG n 
1 259 ASN n 
1 260 TYR n 
1 261 VAL n 
1 262 GLU n 
1 263 ASN n 
1 264 ARG n 
1 265 PRO n 
1 266 LYS n 
1 267 TYR n 
1 268 ALA n 
1 269 GLY n 
1 270 LEU n 
1 271 THR n 
1 272 PHE n 
1 273 PRO n 
1 274 LYS n 
1 275 LEU n 
1 276 PHE n 
1 277 PRO n 
1 278 ASP n 
1 279 SER n 
1 280 LEU n 
1 281 PHE n 
1 282 PRO n 
1 283 ALA n 
1 284 ASP n 
1 285 SER n 
1 286 GLU n 
1 287 HIS n 
1 288 ASN n 
1 289 LYS n 
1 290 LEU n 
1 291 LYS n 
1 292 ALA n 
1 293 SER n 
1 294 GLN n 
1 295 ALA n 
1 296 ARG n 
1 297 ASP n 
1 298 LEU n 
1 299 LEU n 
1 300 SER n 
1 301 LYS n 
1 302 MET n 
1 303 LEU n 
1 304 VAL n 
1 305 ILE n 
1 306 ASP n 
1 307 PRO n 
1 308 ALA n 
1 309 LYS n 
1 310 ARG n 
1 311 ILE n 
1 312 SER n 
1 313 VAL n 
1 314 ASP n 
1 315 ASP n 
1 316 ALA n 
1 317 LEU n 
1 318 GLN n 
1 319 HIS n 
1 320 PRO n 
1 321 TYR n 
1 322 ILE n 
1 323 ASN n 
1 324 VAL n 
1 325 TRP n 
1 326 TYR n 
1 327 ASP n 
1 328 PRO n 
1 329 ALA n 
1 330 GLU n 
1 331 VAL n 
1 332 GLU n 
1 333 ALA n 
1 334 PRO n 
1 335 PRO n 
1 336 PRO n 
1 337 GLN n 
1 338 ILE n 
1 339 TYR n 
1 340 ASP n 
1 341 LYS n 
1 342 GLN n 
1 343 LEU n 
1 344 ASP n 
1 345 GLU n 
1 346 ARG n 
1 347 GLU n 
1 348 HIS n 
1 349 THR n 
1 350 ILE n 
1 351 GLU n 
1 352 GLU n 
1 353 TRP n 
1 354 LYS n 
1 355 GLU n 
1 356 LEU n 
1 357 ILE n 
1 358 TYR n 
1 359 LYS n 
1 360 GLU n 
1 361 VAL n 
1 362 MET n 
1 363 ASN n 
1 364 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 MK10_HUMAN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BLD21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MK10_HUMAN 
_struct_ref.pdbx_db_accession          P53779 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVN
HKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKS
DCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQL
GTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYI
NVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNS
;
_struct_ref.pdbx_align_begin           40 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1PMN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 364 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P53779 
_struct_ref_seq.db_align_beg                  40 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  401 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       40 
_struct_ref_seq.pdbx_auth_seq_align_end       401 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PMN MET A 1 ? UNP P53779 ? ? 'CLONING ARTIFACT' 38 1 
1 1PMN ALA A 2 ? UNP P53779 ? ? 'CLONING ARTIFACT' 39 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
984 non-polymer         . 
'CYCLOPROPYL-{4-[5-(3,4-DICHLOROPHENYL)-2-[(1-METHYL)-PIPERIDIN]-4-YL-3-PROPYL-3H-IMIDAZOL-4-YL]-PYRIMIDIN-2-YL}AMINE' ? 
'C25 H30 Cl2 N6' 485.452 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PMN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   49.05 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG MMe 550, Ethylene glycol, Hepes, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-03-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1PMN 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             22.0 
_reflns.number_all                   21324 
_reflns.number_obs                   21026 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.059 
_reflns.pdbx_netI_over_sigmaI        8.6 
_reflns.B_iso_Wilson_estimate        30.9 
_reflns.pdbx_redundancy              6.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.197 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        5.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3483 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PMN 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             22.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_number_reflns_all                     21296 
_refine.ls_number_reflns_obs                     21024 
_refine.ls_number_reflns_R_free                  1037 
_refine.ls_percent_reflns_obs                    98.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.231 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JNK' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    Mask 
_refine.solvent_model_param_bsol                 52.9 
_refine.solvent_model_param_ksol                 0.396 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Restrained 
_refine.B_iso_mean                               34.9 
_refine.aniso_B[1][1]                            -16.3 
_refine.aniso_B[1][2]                            0.0 
_refine.aniso_B[1][3]                            0.0 
_refine.aniso_B[2][2]                            7.07 
_refine.aniso_B[2][3]                            0.0 
_refine.aniso_B[3][3]                            9.26 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1PMN 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.34 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.37 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2774 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             197 
_refine_hist.number_atoms_total               3004 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        22.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.012 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.47  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.4  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.0   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.3   1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.2   2   ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2     2   ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.9   2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.28 
_refine_ls_shell.number_reflns_R_work             1957 
_refine_ls_shell.R_factor_R_work                  0.311 
_refine_ls_shell.percent_reflns_obs               98.5 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.number_reflns_obs                2071 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1PMN 
_struct.title                     'Crystal structure of JNK3 in complex with an imidazole-pyrimidine inhibitor' 
_struct.pdbx_descriptor           'Mitogen-activated protein kinase 10 (E.C.2.7.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PMN 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'MAP kinase, apoptosis, inhibition, transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? VAL A 81  ? ASN A 101 VAL A 118 1 ? 18 
HELX_P HELX_P2  2  LEU A 116 ? GLN A 121 ? LEU A 153 GLN A 158 1 ? 6  
HELX_P HELX_P3  3  ASP A 125 ? ALA A 146 ? ASP A 162 ALA A 183 1 ? 22 
HELX_P HELX_P4  4  LYS A 154 ? SER A 156 ? LYS A 191 SER A 193 5 ? 3  
HELX_P HELX_P5  5  ALA A 194 ? LEU A 199 ? ALA A 231 LEU A 236 1 ? 6  
HELX_P HELX_P6  6  ASN A 206 ? HIS A 222 ? ASN A 243 HIS A 259 1 ? 17 
HELX_P HELX_P7  7  ASP A 230 ? GLY A 243 ? ASP A 267 GLY A 280 1 ? 14 
HELX_P HELX_P8  8  CYS A 246 ? LYS A 252 ? CYS A 283 LYS A 289 1 ? 7  
HELX_P HELX_P9  9  GLN A 254 ? ASN A 263 ? GLN A 291 ASN A 300 1 ? 10 
HELX_P HELX_P10 10 THR A 271 ? PHE A 276 ? THR A 308 PHE A 313 1 ? 6  
HELX_P HELX_P11 11 PRO A 277 ? PHE A 281 ? PRO A 314 PHE A 318 5 ? 5  
HELX_P HELX_P12 12 SER A 285 ? LEU A 303 ? SER A 322 LEU A 340 1 ? 19 
HELX_P HELX_P13 13 SER A 312 ? LEU A 317 ? SER A 349 LEU A 354 1 ? 6  
HELX_P HELX_P14 14 HIS A 319 ? VAL A 324 ? HIS A 356 VAL A 361 1 ? 6  
HELX_P HELX_P15 15 ASP A 327 ? GLU A 332 ? ASP A 364 GLU A 369 1 ? 6  
HELX_P HELX_P16 16 THR A 349 ? ASN A 363 ? THR A 386 ASN A 400 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 11  ? VAL A 16  ? PHE A 48  VAL A 53  
A 2 SER A 19  ? LEU A 24  ? SER A 56  LEU A 61  
B 1 TYR A 27  ? SER A 35  ? TYR A 64  SER A 72  
B 2 ILE A 40  ? ASP A 46  ? ILE A 77  ASP A 83  
B 3 ARG A 51  ? SER A 59  ? ARG A 88  SER A 96  
B 4 ASP A 104 ? GLU A 110 ? ASP A 141 GLU A 147 
B 5 ASN A 91  ? PHE A 93  ? ASN A 128 PHE A 130 
C 1 ALA A 114 ? ASN A 115 ? ALA A 151 ASN A 152 
C 2 ILE A 158 ? VAL A 160 ? ILE A 195 VAL A 197 
C 3 LEU A 166 ? ILE A 168 ? LEU A 203 ILE A 205 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 16  ? N VAL A 53  O SER A 19  ? O SER A 56  
B 1 2 N GLY A 34  ? N GLY A 71  O VAL A 41  ? O VAL A 78  
B 2 3 N ALA A 44  ? N ALA A 81  O VAL A 53  ? O VAL A 90  
B 3 4 N LEU A 58  ? N LEU A 95  O VAL A 105 ? O VAL A 142 
B 4 5 O TYR A 106 ? O TYR A 143 N PHE A 93  ? N PHE A 130 
C 1 2 N ALA A 114 ? N ALA A 151 O VAL A 160 ? O VAL A 197 
C 2 3 N VAL A 159 ? N VAL A 196 O LYS A 167 ? O LYS A 204 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    16 
_struct_site.details              'BINDING SITE FOR RESIDUE 984 A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 ILE A 33  ? ILE A 70  . ? 1_555 ? 
2  AC1 16 SER A 35  ? SER A 72  . ? 1_555 ? 
3  AC1 16 VAL A 41  ? VAL A 78  . ? 1_555 ? 
4  AC1 16 ALA A 54  ? ALA A 91  . ? 1_555 ? 
5  AC1 16 ILE A 55  ? ILE A 92  . ? 1_555 ? 
6  AC1 16 LYS A 56  ? LYS A 93  . ? 1_555 ? 
7  AC1 16 ILE A 87  ? ILE A 124 . ? 1_555 ? 
8  AC1 16 LEU A 89  ? LEU A 126 . ? 1_555 ? 
9  AC1 16 LEU A 107 ? LEU A 144 . ? 1_555 ? 
10 AC1 16 MET A 109 ? MET A 146 . ? 1_555 ? 
11 AC1 16 MET A 112 ? MET A 149 . ? 1_555 ? 
12 AC1 16 ASP A 113 ? ASP A 150 . ? 1_555 ? 
13 AC1 16 ALA A 114 ? ALA A 151 . ? 1_555 ? 
14 AC1 16 SER A 156 ? SER A 193 . ? 1_555 ? 
15 AC1 16 ASN A 157 ? ASN A 194 . ? 1_555 ? 
16 AC1 16 HOH C .   ? HOH A 673 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1PMN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PMN 
_atom_sites.fract_transf_matrix[1][1]   0.018841 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014017 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009331 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ASP A 1 8   ? 22.373 11.673  63.100 1.00 58.27 ? 45  ASP A N    1 
ATOM   2    C  CA   . ASP A 1 8   ? 21.387 10.676  62.579 1.00 58.39 ? 45  ASP A CA   1 
ATOM   3    C  C    . ASP A 1 8   ? 20.794 11.247  61.291 1.00 55.86 ? 45  ASP A C    1 
ATOM   4    O  O    . ASP A 1 8   ? 19.573 11.267  61.076 1.00 56.00 ? 45  ASP A O    1 
ATOM   5    C  CB   . ASP A 1 8   ? 20.284 10.424  63.623 1.00 60.21 ? 45  ASP A CB   1 
ATOM   6    C  CG   . ASP A 1 8   ? 19.504 9.144   63.342 1.00 62.73 ? 45  ASP A CG   1 
ATOM   7    O  OD1  . ASP A 1 8   ? 20.162 8.129   63.005 1.00 63.28 ? 45  ASP A OD1  1 
ATOM   8    O  OD2  . ASP A 1 8   ? 18.251 9.139   63.461 1.00 63.29 ? 45  ASP A OD2  1 
ATOM   9    N  N    . ASN A 1 9   ? 21.689 11.704  60.428 1.00 52.42 ? 46  ASN A N    1 
ATOM   10   C  CA   . ASN A 1 9   ? 21.282 12.314  59.183 1.00 48.91 ? 46  ASN A CA   1 
ATOM   11   C  C    . ASN A 1 9   ? 20.776 11.299  58.168 1.00 45.04 ? 46  ASN A C    1 
ATOM   12   O  O    . ASN A 1 9   ? 21.270 10.176  58.104 1.00 42.57 ? 46  ASN A O    1 
ATOM   13   C  CB   . ASN A 1 9   ? 22.458 13.087  58.601 1.00 52.05 ? 46  ASN A CB   1 
ATOM   14   C  CG   . ASN A 1 9   ? 22.046 14.429  58.033 1.00 54.06 ? 46  ASN A CG   1 
ATOM   15   O  OD1  . ASN A 1 9   ? 21.655 15.350  58.769 1.00 55.17 ? 46  ASN A OD1  1 
ATOM   16   N  ND2  . ASN A 1 9   ? 22.132 14.554  56.719 1.00 55.36 ? 46  ASN A ND2  1 
ATOM   17   N  N    . GLN A 1 10  ? 19.776 11.711  57.388 1.00 41.24 ? 47  GLN A N    1 
ATOM   18   C  CA   . GLN A 1 10  ? 19.202 10.876  56.337 1.00 37.83 ? 47  GLN A CA   1 
ATOM   19   C  C    . GLN A 1 10  ? 20.173 10.805  55.141 1.00 35.21 ? 47  GLN A C    1 
ATOM   20   O  O    . GLN A 1 10  ? 19.966 10.033  54.214 1.00 34.89 ? 47  GLN A O    1 
ATOM   21   C  CB   . GLN A 1 10  ? 17.868 11.464  55.844 1.00 36.84 ? 47  GLN A CB   1 
ATOM   22   C  CG   . GLN A 1 10  ? 16.663 11.243  56.761 1.00 37.96 ? 47  GLN A CG   1 
ATOM   23   C  CD   . GLN A 1 10  ? 15.413 12.028  56.298 1.00 39.57 ? 47  GLN A CD   1 
ATOM   24   O  OE1  . GLN A 1 10  ? 15.525 13.175  55.855 1.00 42.92 ? 47  GLN A OE1  1 
ATOM   25   N  NE2  . GLN A 1 10  ? 14.228 11.418  56.412 1.00 37.35 ? 47  GLN A NE2  1 
ATOM   26   N  N    . PHE A 1 11  ? 21.247 11.580  55.185 1.00 33.17 ? 48  PHE A N    1 
ATOM   27   C  CA   . PHE A 1 11  ? 22.189 11.643  54.075 1.00 32.36 ? 48  PHE A CA   1 
ATOM   28   C  C    . PHE A 1 11  ? 23.580 11.171  54.435 1.00 32.98 ? 48  PHE A C    1 
ATOM   29   O  O    . PHE A 1 11  ? 23.887 10.938  55.594 1.00 33.47 ? 48  PHE A O    1 
ATOM   30   C  CB   . PHE A 1 11  ? 22.297 13.098  53.586 1.00 31.22 ? 48  PHE A CB   1 
ATOM   31   C  CG   . PHE A 1 11  ? 20.969 13.743  53.243 1.00 29.10 ? 48  PHE A CG   1 
ATOM   32   C  CD1  . PHE A 1 11  ? 20.420 13.623  51.963 1.00 27.98 ? 48  PHE A CD1  1 
ATOM   33   C  CD2  . PHE A 1 11  ? 20.252 14.438  54.210 1.00 27.01 ? 48  PHE A CD2  1 
ATOM   34   C  CE1  . PHE A 1 11  ? 19.173 14.186  51.663 1.00 27.62 ? 48  PHE A CE1  1 
ATOM   35   C  CE2  . PHE A 1 11  ? 19.006 15.005  53.919 1.00 27.19 ? 48  PHE A CE2  1 
ATOM   36   C  CZ   . PHE A 1 11  ? 18.462 14.877  52.649 1.00 25.92 ? 48  PHE A CZ   1 
ATOM   37   N  N    . TYR A 1 12  ? 24.426 11.042  53.424 1.00 33.14 ? 49  TYR A N    1 
ATOM   38   C  CA   . TYR A 1 12  ? 25.805 10.656  53.635 1.00 32.81 ? 49  TYR A CA   1 
ATOM   39   C  C    . TYR A 1 12  ? 26.562 11.151  52.422 1.00 34.33 ? 49  TYR A C    1 
ATOM   40   O  O    . TYR A 1 12  ? 25.983 11.337  51.363 1.00 34.62 ? 49  TYR A O    1 
ATOM   41   C  CB   . TYR A 1 12  ? 25.943 9.137   53.820 1.00 30.67 ? 49  TYR A CB   1 
ATOM   42   C  CG   . TYR A 1 12  ? 25.911 8.299   52.569 1.00 29.72 ? 49  TYR A CG   1 
ATOM   43   C  CD1  . TYR A 1 12  ? 24.702 7.964   51.948 1.00 27.79 ? 49  TYR A CD1  1 
ATOM   44   C  CD2  . TYR A 1 12  ? 27.094 7.809   52.023 1.00 27.27 ? 49  TYR A CD2  1 
ATOM   45   C  CE1  . TYR A 1 12  ? 24.683 7.158   50.812 1.00 28.42 ? 49  TYR A CE1  1 
ATOM   46   C  CE2  . TYR A 1 12  ? 27.091 7.007   50.896 1.00 29.20 ? 49  TYR A CE2  1 
ATOM   47   C  CZ   . TYR A 1 12  ? 25.888 6.684   50.288 1.00 29.07 ? 49  TYR A CZ   1 
ATOM   48   O  OH   . TYR A 1 12  ? 25.912 5.919   49.140 1.00 29.19 ? 49  TYR A OH   1 
ATOM   49   N  N    . SER A 1 13  ? 27.854 11.386  52.571 1.00 36.26 ? 50  SER A N    1 
ATOM   50   C  CA   . SER A 1 13  ? 28.634 11.910  51.469 1.00 39.09 ? 50  SER A CA   1 
ATOM   51   C  C    . SER A 1 13  ? 29.648 10.962  50.870 1.00 41.28 ? 50  SER A C    1 
ATOM   52   O  O    . SER A 1 13  ? 30.318 10.222  51.588 1.00 42.11 ? 50  SER A O    1 
ATOM   53   C  CB   . SER A 1 13  ? 29.342 13.176  51.920 1.00 38.76 ? 50  SER A CB   1 
ATOM   54   O  OG   . SER A 1 13  ? 28.394 14.123  52.326 1.00 39.45 ? 50  SER A OG   1 
ATOM   55   N  N    . VAL A 1 14  ? 29.777 11.020  49.547 1.00 42.88 ? 51  VAL A N    1 
ATOM   56   C  CA   . VAL A 1 14  ? 30.712 10.167  48.834 1.00 45.15 ? 51  VAL A CA   1 
ATOM   57   C  C    . VAL A 1 14  ? 31.546 10.978  47.864 1.00 45.78 ? 51  VAL A C    1 
ATOM   58   O  O    . VAL A 1 14  ? 31.063 11.940  47.260 1.00 45.95 ? 51  VAL A O    1 
ATOM   59   C  CB   . VAL A 1 14  ? 29.982 9.089   48.021 1.00 45.64 ? 51  VAL A CB   1 
ATOM   60   C  CG1  . VAL A 1 14  ? 30.817 7.808   48.005 1.00 46.87 ? 51  VAL A CG1  1 
ATOM   61   C  CG2  . VAL A 1 14  ? 28.595 8.848   48.596 1.00 45.19 ? 51  VAL A CG2  1 
ATOM   62   N  N    . GLU A 1 15  ? 32.798 10.570  47.704 1.00 47.46 ? 52  GLU A N    1 
ATOM   63   C  CA   . GLU A 1 15  ? 33.714 11.254  46.800 1.00 48.97 ? 52  GLU A CA   1 
ATOM   64   C  C    . GLU A 1 15  ? 33.596 10.657  45.395 1.00 49.46 ? 52  GLU A C    1 
ATOM   65   O  O    . GLU A 1 15  ? 33.821 9.463   45.221 1.00 49.53 ? 52  GLU A O    1 
ATOM   66   C  CB   . GLU A 1 15  ? 35.151 11.078  47.295 1.00 49.76 ? 52  GLU A CB   1 
ATOM   67   C  CG   . GLU A 1 15  ? 36.091 12.200  46.875 1.00 51.02 ? 52  GLU A CG   1 
ATOM   68   C  CD   . GLU A 1 15  ? 35.903 13.447  47.734 1.00 52.49 ? 52  GLU A CD   1 
ATOM   69   O  OE1  . GLU A 1 15  ? 36.060 13.327  48.975 1.00 51.68 ? 52  GLU A OE1  1 
ATOM   70   O  OE2  . GLU A 1 15  ? 35.601 14.542  47.184 1.00 52.57 ? 52  GLU A OE2  1 
ATOM   71   N  N    . VAL A 1 16  ? 33.220 11.479  44.411 1.00 50.46 ? 53  VAL A N    1 
ATOM   72   C  CA   . VAL A 1 16  ? 33.115 11.042  43.007 1.00 51.40 ? 53  VAL A CA   1 
ATOM   73   C  C    . VAL A 1 16  ? 33.888 12.066  42.171 1.00 51.42 ? 53  VAL A C    1 
ATOM   74   O  O    . VAL A 1 16  ? 33.408 13.166  41.923 1.00 51.36 ? 53  VAL A O    1 
ATOM   75   C  CB   . VAL A 1 16  ? 31.634 10.945  42.499 1.00 51.08 ? 53  VAL A CB   1 
ATOM   76   C  CG1  . VAL A 1 16  ? 30.850 9.955   43.353 1.00 49.76 ? 53  VAL A CG1  1 
ATOM   77   C  CG2  . VAL A 1 16  ? 30.972 12.293  42.534 1.00 51.49 ? 53  VAL A CG2  1 
ATOM   78   N  N    . GLY A 1 17  ? 35.097 11.696  41.748 1.00 52.38 ? 54  GLY A N    1 
ATOM   79   C  CA   . GLY A 1 17  ? 35.935 12.622  41.000 1.00 53.30 ? 54  GLY A CA   1 
ATOM   80   C  C    . GLY A 1 17  ? 36.415 13.679  41.986 1.00 53.73 ? 54  GLY A C    1 
ATOM   81   O  O    . GLY A 1 17  ? 36.670 13.366  43.146 1.00 53.65 ? 54  GLY A O    1 
ATOM   82   N  N    . ASP A 1 18  ? 36.540 14.927  41.550 1.00 54.71 ? 55  ASP A N    1 
ATOM   83   C  CA   . ASP A 1 18  ? 36.961 15.985  42.463 1.00 55.29 ? 55  ASP A CA   1 
ATOM   84   C  C    . ASP A 1 18  ? 35.677 16.565  43.061 1.00 55.28 ? 55  ASP A C    1 
ATOM   85   O  O    . ASP A 1 18  ? 35.666 17.672  43.625 1.00 56.15 ? 55  ASP A O    1 
ATOM   86   C  CB   . ASP A 1 18  ? 37.745 17.072  41.715 1.00 57.23 ? 55  ASP A CB   1 
ATOM   87   C  CG   . ASP A 1 18  ? 36.941 17.701  40.576 1.00 59.71 ? 55  ASP A CG   1 
ATOM   88   O  OD1  . ASP A 1 18  ? 36.730 17.021  39.541 1.00 61.62 ? 55  ASP A OD1  1 
ATOM   89   O  OD2  . ASP A 1 18  ? 36.510 18.876  40.711 1.00 60.57 ? 55  ASP A OD2  1 
ATOM   90   N  N    . SER A 1 19  ? 34.594 15.794  42.937 1.00 53.83 ? 56  SER A N    1 
ATOM   91   C  CA   . SER A 1 19  ? 33.276 16.197  43.435 1.00 51.22 ? 56  SER A CA   1 
ATOM   92   C  C    . SER A 1 19  ? 32.749 15.322  44.575 1.00 48.90 ? 56  SER A C    1 
ATOM   93   O  O    . SER A 1 19  ? 33.134 14.151  44.714 1.00 49.45 ? 56  SER A O    1 
ATOM   94   C  CB   . SER A 1 19  ? 32.269 16.180  42.281 1.00 51.85 ? 56  SER A CB   1 
ATOM   95   O  OG   . SER A 1 19  ? 30.979 16.551  42.736 1.00 54.85 ? 56  SER A OG   1 
ATOM   96   N  N    . THR A 1 20  ? 31.860 15.894  45.384 1.00 44.47 ? 57  THR A N    1 
ATOM   97   C  CA   . THR A 1 20  ? 31.268 15.168  46.501 1.00 40.58 ? 57  THR A CA   1 
ATOM   98   C  C    . THR A 1 20  ? 29.753 15.012  46.325 1.00 37.35 ? 57  THR A C    1 
ATOM   99   O  O    . THR A 1 20  ? 29.052 15.990  46.106 1.00 36.16 ? 57  THR A O    1 
ATOM   100  C  CB   . THR A 1 20  ? 31.547 15.899  47.852 1.00 41.92 ? 57  THR A CB   1 
ATOM   101  O  OG1  . THR A 1 20  ? 32.943 15.801  48.172 1.00 41.32 ? 57  THR A OG1  1 
ATOM   102  C  CG2  . THR A 1 20  ? 30.714 15.288  48.989 1.00 40.60 ? 57  THR A CG2  1 
ATOM   103  N  N    . PHE A 1 21  ? 29.263 13.781  46.431 1.00 34.03 ? 58  PHE A N    1 
ATOM   104  C  CA   . PHE A 1 21  ? 27.833 13.498  46.314 1.00 32.16 ? 58  PHE A CA   1 
ATOM   105  C  C    . PHE A 1 21  ? 27.223 13.240  47.702 1.00 30.85 ? 58  PHE A C    1 
ATOM   106  O  O    . PHE A 1 21  ? 27.572 12.258  48.358 1.00 31.19 ? 58  PHE A O    1 
ATOM   107  C  CB   . PHE A 1 21  ? 27.602 12.258  45.434 1.00 30.38 ? 58  PHE A CB   1 
ATOM   108  C  CG   . PHE A 1 21  ? 27.212 12.570  44.004 1.00 29.46 ? 58  PHE A CG   1 
ATOM   109  C  CD1  . PHE A 1 21  ? 28.064 13.278  43.162 1.00 28.19 ? 58  PHE A CD1  1 
ATOM   110  C  CD2  . PHE A 1 21  ? 25.972 12.146  43.496 1.00 28.69 ? 58  PHE A CD2  1 
ATOM   111  C  CE1  . PHE A 1 21  ? 27.689 13.567  41.846 1.00 26.00 ? 58  PHE A CE1  1 
ATOM   112  C  CE2  . PHE A 1 21  ? 25.594 12.434  42.188 1.00 24.30 ? 58  PHE A CE2  1 
ATOM   113  C  CZ   . PHE A 1 21  ? 26.445 13.136  41.368 1.00 25.24 ? 58  PHE A CZ   1 
ATOM   114  N  N    . THR A 1 22  ? 26.331 14.119  48.153 1.00 28.30 ? 59  THR A N    1 
ATOM   115  C  CA   . THR A 1 22  ? 25.682 13.946  49.458 1.00 27.75 ? 59  THR A CA   1 
ATOM   116  C  C    . THR A 1 22  ? 24.259 13.481  49.163 1.00 27.56 ? 59  THR A C    1 
ATOM   117  O  O    . THR A 1 22  ? 23.398 14.288  48.771 1.00 27.53 ? 59  THR A O    1 
ATOM   118  C  CB   . THR A 1 22  ? 25.611 15.274  50.246 1.00 26.74 ? 59  THR A CB   1 
ATOM   119  O  OG1  . THR A 1 22  ? 26.936 15.756  50.520 1.00 26.91 ? 59  THR A OG1  1 
ATOM   120  C  CG2  . THR A 1 22  ? 24.857 15.071  51.539 1.00 26.71 ? 59  THR A CG2  1 
ATOM   121  N  N    . VAL A 1 23  ? 24.002 12.191  49.358 1.00 25.91 ? 60  VAL A N    1 
ATOM   122  C  CA   . VAL A 1 23  ? 22.691 11.644  49.042 1.00 24.58 ? 60  VAL A CA   1 
ATOM   123  C  C    . VAL A 1 23  ? 21.972 10.881  50.163 1.00 25.30 ? 60  VAL A C    1 
ATOM   124  O  O    . VAL A 1 23  ? 22.554 10.571  51.195 1.00 24.36 ? 60  VAL A O    1 
ATOM   125  C  CB   . VAL A 1 23  ? 22.816 10.738  47.783 1.00 22.73 ? 60  VAL A CB   1 
ATOM   126  C  CG1  . VAL A 1 23  ? 23.294 11.585  46.579 1.00 21.94 ? 60  VAL A CG1  1 
ATOM   127  C  CG2  . VAL A 1 23  ? 23.814 9.620   48.031 1.00 21.98 ? 60  VAL A CG2  1 
ATOM   128  N  N    . LEU A 1 24  ? 20.685 10.609  49.956 1.00 25.34 ? 61  LEU A N    1 
ATOM   129  C  CA   . LEU A 1 24  ? 19.910 9.859   50.931 1.00 25.48 ? 61  LEU A CA   1 
ATOM   130  C  C    . LEU A 1 24  ? 20.541 8.477   51.056 1.00 25.76 ? 61  LEU A C    1 
ATOM   131  O  O    . LEU A 1 24  ? 21.011 7.903   50.060 1.00 25.78 ? 61  LEU A O    1 
ATOM   132  C  CB   . LEU A 1 24  ? 18.459 9.724   50.466 1.00 24.16 ? 61  LEU A CB   1 
ATOM   133  C  CG   . LEU A 1 24  ? 17.732 11.056  50.486 1.00 24.15 ? 61  LEU A CG   1 
ATOM   134  C  CD1  . LEU A 1 24  ? 16.480 11.000  49.625 1.00 23.62 ? 61  LEU A CD1  1 
ATOM   135  C  CD2  . LEU A 1 24  ? 17.399 11.387  51.916 1.00 24.96 ? 61  LEU A CD2  1 
ATOM   136  N  N    . LYS A 1 25  ? 20.532 7.935   52.268 1.00 25.69 ? 62  LYS A N    1 
ATOM   137  C  CA   . LYS A 1 25  ? 21.136 6.631   52.526 1.00 25.80 ? 62  LYS A CA   1 
ATOM   138  C  C    . LYS A 1 25  ? 20.577 5.473   51.722 1.00 23.57 ? 62  LYS A C    1 
ATOM   139  O  O    . LYS A 1 25  ? 21.229 4.447   51.630 1.00 24.26 ? 62  LYS A O    1 
ATOM   140  C  CB   . LYS A 1 25  ? 21.055 6.303   54.020 1.00 27.84 ? 62  LYS A CB   1 
ATOM   141  C  CG   . LYS A 1 25  ? 21.922 7.182   54.923 1.00 30.40 ? 62  LYS A CG   1 
ATOM   142  C  CD   . LYS A 1 25  ? 21.581 6.856   56.383 1.00 32.85 ? 62  LYS A CD   1 
ATOM   143  C  CE   . LYS A 1 25  ? 22.755 7.018   57.331 1.00 35.41 ? 62  LYS A CE   1 
ATOM   144  N  NZ   . LYS A 1 25  ? 23.149 8.427   57.489 1.00 36.76 ? 62  LYS A NZ   1 
ATOM   145  N  N    . ARG A 1 26  ? 19.387 5.626   51.147 1.00 22.08 ? 63  ARG A N    1 
ATOM   146  C  CA   . ARG A 1 26  ? 18.784 4.562   50.342 1.00 21.83 ? 63  ARG A CA   1 
ATOM   147  C  C    . ARG A 1 26  ? 19.587 4.295   49.077 1.00 24.48 ? 63  ARG A C    1 
ATOM   148  O  O    . ARG A 1 26  ? 19.559 3.179   48.536 1.00 24.22 ? 63  ARG A O    1 
ATOM   149  C  CB   . ARG A 1 26  ? 17.374 4.945   49.916 1.00 19.26 ? 63  ARG A CB   1 
ATOM   150  C  CG   . ARG A 1 26  ? 17.360 6.243   49.106 1.00 18.73 ? 63  ARG A CG   1 
ATOM   151  C  CD   . ARG A 1 26  ? 15.939 6.724   48.832 1.00 16.25 ? 63  ARG A CD   1 
ATOM   152  N  NE   . ARG A 1 26  ? 15.232 5.823   47.929 1.00 19.20 ? 63  ARG A NE   1 
ATOM   153  C  CZ   . ARG A 1 26  ? 13.925 5.886   47.701 1.00 18.41 ? 63  ARG A CZ   1 
ATOM   154  N  NH1  . ARG A 1 26  ? 13.205 6.806   48.325 1.00 18.58 ? 63  ARG A NH1  1 
ATOM   155  N  NH2  . ARG A 1 26  ? 13.341 5.049   46.844 1.00 18.52 ? 63  ARG A NH2  1 
ATOM   156  N  N    . TYR A 1 27  ? 20.273 5.330   48.590 1.00 24.90 ? 64  TYR A N    1 
ATOM   157  C  CA   . TYR A 1 27  ? 21.084 5.221   47.379 1.00 25.75 ? 64  TYR A CA   1 
ATOM   158  C  C    . TYR A 1 27  ? 22.498 4.762   47.749 1.00 28.08 ? 64  TYR A C    1 
ATOM   159  O  O    . TYR A 1 27  ? 23.201 5.435   48.506 1.00 26.13 ? 64  TYR A O    1 
ATOM   160  C  CB   . TYR A 1 27  ? 21.104 6.577   46.650 1.00 21.98 ? 64  TYR A CB   1 
ATOM   161  C  CG   . TYR A 1 27  ? 19.720 7.036   46.293 1.00 17.56 ? 64  TYR A CG   1 
ATOM   162  C  CD1  . TYR A 1 27  ? 18.887 6.236   45.516 1.00 17.29 ? 64  TYR A CD1  1 
ATOM   163  C  CD2  . TYR A 1 27  ? 19.215 8.251   46.769 1.00 17.66 ? 64  TYR A CD2  1 
ATOM   164  C  CE1  . TYR A 1 27  ? 17.569 6.624   45.214 1.00 14.68 ? 64  TYR A CE1  1 
ATOM   165  C  CE2  . TYR A 1 27  ? 17.893 8.646   46.474 1.00 17.61 ? 64  TYR A CE2  1 
ATOM   166  C  CZ   . TYR A 1 27  ? 17.079 7.818   45.694 1.00 17.14 ? 64  TYR A CZ   1 
ATOM   167  O  OH   . TYR A 1 27  ? 15.773 8.188   45.412 1.00 20.57 ? 64  TYR A OH   1 
ATOM   168  N  N    . GLN A 1 28  ? 22.898 3.609   47.208 1.00 30.06 ? 65  GLN A N    1 
ATOM   169  C  CA   . GLN A 1 28  ? 24.200 3.038   47.514 1.00 33.46 ? 65  GLN A CA   1 
ATOM   170  C  C    . GLN A 1 28  ? 25.046 2.614   46.322 1.00 33.44 ? 65  GLN A C    1 
ATOM   171  O  O    . GLN A 1 28  ? 24.550 2.390   45.220 1.00 33.71 ? 65  GLN A O    1 
ATOM   172  C  CB   . GLN A 1 28  ? 24.017 1.822   48.419 1.00 37.81 ? 65  GLN A CB   1 
ATOM   173  C  CG   . GLN A 1 28  ? 23.218 2.104   49.686 1.00 45.02 ? 65  GLN A CG   1 
ATOM   174  C  CD   . GLN A 1 28  ? 23.165 0.905   50.600 1.00 50.36 ? 65  GLN A CD   1 
ATOM   175  O  OE1  . GLN A 1 28  ? 22.526 -0.122  50.278 1.00 52.34 ? 65  GLN A OE1  1 
ATOM   176  N  NE2  . GLN A 1 28  ? 23.849 1.009   51.752 1.00 53.32 ? 65  GLN A NE2  1 
ATOM   177  N  N    . ASN A 1 29  ? 26.342 2.506   46.590 1.00 34.14 ? 66  ASN A N    1 
ATOM   178  C  CA   . ASN A 1 29  ? 27.334 2.078   45.632 1.00 33.98 ? 66  ASN A CA   1 
ATOM   179  C  C    . ASN A 1 29  ? 27.419 2.967   44.389 1.00 34.41 ? 66  ASN A C    1 
ATOM   180  O  O    . ASN A 1 29  ? 27.491 2.465   43.269 1.00 34.22 ? 66  ASN A O    1 
ATOM   181  C  CB   . ASN A 1 29  ? 27.036 0.630   45.253 1.00 34.30 ? 66  ASN A CB   1 
ATOM   182  C  CG   . ASN A 1 29  ? 28.145 0.006   44.429 1.00 36.48 ? 66  ASN A CG   1 
ATOM   183  O  OD1  . ASN A 1 29  ? 29.329 0.336   44.621 1.00 34.85 ? 66  ASN A OD1  1 
ATOM   184  N  ND2  . ASN A 1 29  ? 27.779 -0.908  43.514 1.00 35.35 ? 66  ASN A ND2  1 
ATOM   185  N  N    . LEU A 1 30  ? 27.425 4.281   44.602 1.00 34.15 ? 67  LEU A N    1 
ATOM   186  C  CA   . LEU A 1 30  ? 27.489 5.241   43.517 1.00 35.57 ? 67  LEU A CA   1 
ATOM   187  C  C    . LEU A 1 30  ? 28.658 4.956   42.576 1.00 38.44 ? 67  LEU A C    1 
ATOM   188  O  O    . LEU A 1 30  ? 29.706 4.446   42.990 1.00 38.88 ? 67  LEU A O    1 
ATOM   189  C  CB   . LEU A 1 30  ? 27.591 6.668   44.060 1.00 35.14 ? 67  LEU A CB   1 
ATOM   190  C  CG   . LEU A 1 30  ? 26.273 7.375   44.415 1.00 37.02 ? 67  LEU A CG   1 
ATOM   191  C  CD1  . LEU A 1 30  ? 25.586 6.703   45.593 1.00 37.26 ? 67  LEU A CD1  1 
ATOM   192  C  CD2  . LEU A 1 30  ? 26.560 8.822   44.736 1.00 36.24 ? 67  LEU A CD2  1 
ATOM   193  N  N    . LYS A 1 31  ? 28.474 5.291   41.304 1.00 37.89 ? 68  LYS A N    1 
ATOM   194  C  CA   . LYS A 1 31  ? 29.501 5.064   40.314 1.00 39.18 ? 68  LYS A CA   1 
ATOM   195  C  C    . LYS A 1 31  ? 29.300 6.100   39.209 1.00 38.86 ? 68  LYS A C    1 
ATOM   196  O  O    . LYS A 1 31  ? 28.222 6.191   38.620 1.00 38.00 ? 68  LYS A O    1 
ATOM   197  C  CB   . LYS A 1 31  ? 29.353 3.649   39.762 1.00 40.47 ? 68  LYS A CB   1 
ATOM   198  C  CG   . LYS A 1 31  ? 30.655 2.987   39.398 1.00 43.12 ? 68  LYS A CG   1 
ATOM   199  C  CD   . LYS A 1 31  ? 30.437 1.714   38.574 1.00 44.04 ? 68  LYS A CD   1 
ATOM   200  C  CE   . LYS A 1 31  ? 30.335 2.004   37.063 1.00 44.91 ? 68  LYS A CE   1 
ATOM   201  N  NZ   . LYS A 1 31  ? 28.988 1.683   36.470 1.00 45.41 ? 68  LYS A NZ   1 
ATOM   202  N  N    . PRO A 1 32  ? 30.336 6.912   38.930 1.00 39.38 ? 69  PRO A N    1 
ATOM   203  C  CA   . PRO A 1 32  ? 30.306 7.961   37.899 1.00 38.09 ? 69  PRO A CA   1 
ATOM   204  C  C    . PRO A 1 32  ? 30.021 7.338   36.537 1.00 37.88 ? 69  PRO A C    1 
ATOM   205  O  O    . PRO A 1 32  ? 30.601 6.306   36.209 1.00 37.38 ? 69  PRO A O    1 
ATOM   206  C  CB   . PRO A 1 32  ? 31.718 8.548   37.965 1.00 39.04 ? 69  PRO A CB   1 
ATOM   207  C  CG   . PRO A 1 32  ? 32.155 8.253   39.377 1.00 39.90 ? 69  PRO A CG   1 
ATOM   208  C  CD   . PRO A 1 32  ? 31.653 6.862   39.589 1.00 39.39 ? 69  PRO A CD   1 
ATOM   209  N  N    . ILE A 1 33  ? 29.130 7.937   35.751 1.00 37.35 ? 70  ILE A N    1 
ATOM   210  C  CA   . ILE A 1 33  ? 28.831 7.383   34.436 1.00 37.17 ? 70  ILE A CA   1 
ATOM   211  C  C    . ILE A 1 33  ? 28.733 8.479   33.403 1.00 38.36 ? 70  ILE A C    1 
ATOM   212  O  O    . ILE A 1 33  ? 28.622 8.209   32.210 1.00 39.35 ? 70  ILE A O    1 
ATOM   213  C  CB   . ILE A 1 33  ? 27.505 6.568   34.415 1.00 35.99 ? 70  ILE A CB   1 
ATOM   214  C  CG1  . ILE A 1 33  ? 26.311 7.469   34.734 1.00 35.09 ? 70  ILE A CG1  1 
ATOM   215  C  CG2  . ILE A 1 33  ? 27.561 5.438   35.437 1.00 36.65 ? 70  ILE A CG2  1 
ATOM   216  C  CD1  . ILE A 1 33  ? 24.978 6.704   34.773 1.00 30.71 ? 70  ILE A CD1  1 
ATOM   217  N  N    . GLY A 1 34  ? 28.772 9.721   33.856 1.00 39.49 ? 71  GLY A N    1 
ATOM   218  C  CA   . GLY A 1 34  ? 28.687 10.834  32.930 1.00 41.14 ? 71  GLY A CA   1 
ATOM   219  C  C    . GLY A 1 34  ? 28.735 12.197  33.602 1.00 42.74 ? 71  GLY A C    1 
ATOM   220  O  O    . GLY A 1 34  ? 28.365 12.355  34.773 1.00 41.66 ? 71  GLY A O    1 
ATOM   221  N  N    . SER A 1 35  ? 29.193 13.193  32.853 1.00 44.22 ? 72  SER A N    1 
ATOM   222  C  CA   . SER A 1 35  ? 29.279 14.546  33.374 1.00 46.16 ? 72  SER A CA   1 
ATOM   223  C  C    . SER A 1 35  ? 28.960 15.523  32.253 1.00 46.99 ? 72  SER A C    1 
ATOM   224  O  O    . SER A 1 35  ? 28.844 15.147  31.079 1.00 47.07 ? 72  SER A O    1 
ATOM   225  C  CB   . SER A 1 35  ? 30.681 14.836  33.936 1.00 46.72 ? 72  SER A CB   1 
ATOM   226  O  OG   . SER A 1 35  ? 31.640 14.880  32.892 1.00 49.46 ? 72  SER A OG   1 
ATOM   227  N  N    . GLY A 1 36  ? 28.821 16.784  32.628 1.00 47.62 ? 73  GLY A N    1 
ATOM   228  C  CA   . GLY A 1 36  ? 28.500 17.804  31.656 1.00 48.27 ? 73  GLY A CA   1 
ATOM   229  C  C    . GLY A 1 36  ? 28.546 19.170  32.309 1.00 49.28 ? 73  GLY A C    1 
ATOM   230  O  O    . GLY A 1 36  ? 28.864 19.306  33.508 1.00 48.65 ? 73  GLY A O    1 
ATOM   231  N  N    . ALA A 1 37  ? 28.210 20.186  31.522 1.00 49.69 ? 74  ALA A N    1 
ATOM   232  C  CA   . ALA A 1 37  ? 28.230 21.556  32.004 1.00 51.06 ? 74  ALA A CA   1 
ATOM   233  C  C    . ALA A 1 37  ? 27.037 21.899  32.911 1.00 51.66 ? 74  ALA A C    1 
ATOM   234  O  O    . ALA A 1 37  ? 26.987 22.994  33.477 1.00 52.76 ? 74  ALA A O    1 
ATOM   235  C  CB   . ALA A 1 37  ? 28.293 22.530  30.807 1.00 50.77 ? 74  ALA A CB   1 
ATOM   236  N  N    . GLN A 1 38  ? 26.083 20.975  33.047 1.00 50.73 ? 75  GLN A N    1 
ATOM   237  C  CA   . GLN A 1 38  ? 24.907 21.215  33.889 1.00 49.20 ? 75  GLN A CA   1 
ATOM   238  C  C    . GLN A 1 38  ? 24.925 20.292  35.104 1.00 46.83 ? 75  GLN A C    1 
ATOM   239  O  O    . GLN A 1 38  ? 24.177 20.491  36.046 1.00 47.18 ? 75  GLN A O    1 
ATOM   240  C  CB   . GLN A 1 38  ? 23.595 20.978  33.112 1.00 51.56 ? 75  GLN A CB   1 
ATOM   241  C  CG   . GLN A 1 38  ? 23.506 21.572  31.685 1.00 53.14 ? 75  GLN A CG   1 
ATOM   242  C  CD   . GLN A 1 38  ? 23.644 23.093  31.624 1.00 53.89 ? 75  GLN A CD   1 
ATOM   243  O  OE1  . GLN A 1 38  ? 23.579 23.785  32.643 1.00 53.77 ? 75  GLN A OE1  1 
ATOM   244  N  NE2  . GLN A 1 38  ? 23.825 23.618  30.414 1.00 53.69 ? 75  GLN A NE2  1 
ATOM   245  N  N    . GLY A 1 39  ? 25.765 19.265  35.076 1.00 45.38 ? 76  GLY A N    1 
ATOM   246  C  CA   . GLY A 1 39  ? 25.825 18.364  36.215 1.00 42.83 ? 76  GLY A CA   1 
ATOM   247  C  C    . GLY A 1 39  ? 26.572 17.053  36.008 1.00 40.66 ? 76  GLY A C    1 
ATOM   248  O  O    . GLY A 1 39  ? 27.016 16.735  34.894 1.00 40.59 ? 76  GLY A O    1 
ATOM   249  N  N    . ILE A 1 40  ? 26.693 16.292  37.098 1.00 37.11 ? 77  ILE A N    1 
ATOM   250  C  CA   . ILE A 1 40  ? 27.381 15.002  37.117 1.00 33.58 ? 77  ILE A CA   1 
ATOM   251  C  C    . ILE A 1 40  ? 26.379 13.886  37.332 1.00 31.03 ? 77  ILE A C    1 
ATOM   252  O  O    . ILE A 1 40  ? 25.523 13.989  38.209 1.00 30.01 ? 77  ILE A O    1 
ATOM   253  C  CB   . ILE A 1 40  ? 28.383 14.932  38.287 1.00 34.52 ? 77  ILE A CB   1 
ATOM   254  C  CG1  . ILE A 1 40  ? 29.275 16.183  38.283 1.00 35.90 ? 77  ILE A CG1  1 
ATOM   255  C  CG2  . ILE A 1 40  ? 29.126 13.633  38.254 1.00 32.13 ? 77  ILE A CG2  1 
ATOM   256  C  CD1  . ILE A 1 40  ? 29.571 16.741  36.870 1.00 37.77 ? 77  ILE A CD1  1 
ATOM   257  N  N    . VAL A 1 41  ? 26.498 12.816  36.557 1.00 27.19 ? 78  VAL A N    1 
ATOM   258  C  CA   . VAL A 1 41  ? 25.586 11.695  36.714 1.00 26.21 ? 78  VAL A CA   1 
ATOM   259  C  C    . VAL A 1 41  ? 26.282 10.449  37.279 1.00 26.30 ? 78  VAL A C    1 
ATOM   260  O  O    . VAL A 1 41  ? 27.434 10.161  36.944 1.00 26.12 ? 78  VAL A O    1 
ATOM   261  C  CB   . VAL A 1 41  ? 24.909 11.333  35.384 1.00 25.66 ? 78  VAL A CB   1 
ATOM   262  C  CG1  . VAL A 1 41  ? 23.979 10.150  35.608 1.00 25.30 ? 78  VAL A CG1  1 
ATOM   263  C  CG2  . VAL A 1 41  ? 24.111 12.533  34.862 1.00 24.47 ? 78  VAL A CG2  1 
ATOM   264  N  N    . CYS A 1 42  ? 25.569 9.738   38.149 1.00 24.54 ? 79  CYS A N    1 
ATOM   265  C  CA   . CYS A 1 42  ? 26.060 8.522   38.789 1.00 25.07 ? 79  CYS A CA   1 
ATOM   266  C  C    . CYS A 1 42  ? 25.037 7.406   38.723 1.00 23.96 ? 79  CYS A C    1 
ATOM   267  O  O    . CYS A 1 42  ? 23.818 7.656   38.718 1.00 24.06 ? 79  CYS A O    1 
ATOM   268  C  CB   . CYS A 1 42  ? 26.352 8.753   40.285 1.00 27.21 ? 79  CYS A CB   1 
ATOM   269  S  SG   . CYS A 1 42  ? 27.965 9.446   40.724 1.00 34.10 ? 79  CYS A SG   1 
ATOM   270  N  N    . ALA A 1 43  ? 25.533 6.175   38.666 1.00 23.67 ? 80  ALA A N    1 
ATOM   271  C  CA   . ALA A 1 43  ? 24.665 4.992   38.703 1.00 24.01 ? 80  ALA A CA   1 
ATOM   272  C  C    . ALA A 1 43  ? 24.663 4.622   40.186 1.00 24.24 ? 80  ALA A C    1 
ATOM   273  O  O    . ALA A 1 43  ? 25.624 4.923   40.904 1.00 24.08 ? 80  ALA A O    1 
ATOM   274  C  CB   . ALA A 1 43  ? 25.253 3.842   37.893 1.00 22.40 ? 80  ALA A CB   1 
ATOM   275  N  N    . ALA A 1 44  ? 23.594 3.973   40.632 1.00 23.93 ? 81  ALA A N    1 
ATOM   276  C  CA   . ALA A 1 44  ? 23.459 3.574   42.018 1.00 23.24 ? 81  ALA A CA   1 
ATOM   277  C  C    . ALA A 1 44  ? 22.332 2.585   42.218 1.00 24.34 ? 81  ALA A C    1 
ATOM   278  O  O    . ALA A 1 44  ? 21.447 2.431   41.353 1.00 24.92 ? 81  ALA A O    1 
ATOM   279  C  CB   . ALA A 1 44  ? 23.192 4.797   42.907 1.00 22.88 ? 81  ALA A CB   1 
ATOM   280  N  N    . TYR A 1 45  ? 22.377 1.914   43.372 1.00 24.26 ? 82  TYR A N    1 
ATOM   281  C  CA   . TYR A 1 45  ? 21.337 0.968   43.764 1.00 23.78 ? 82  TYR A CA   1 
ATOM   282  C  C    . TYR A 1 45  ? 20.443 1.671   44.780 1.00 22.51 ? 82  TYR A C    1 
ATOM   283  O  O    . TYR A 1 45  ? 20.917 2.234   45.748 1.00 22.56 ? 82  TYR A O    1 
ATOM   284  C  CB   . TYR A 1 45  ? 21.955 -0.280  44.403 1.00 24.96 ? 82  TYR A CB   1 
ATOM   285  C  CG   . TYR A 1 45  ? 20.938 -1.249  44.996 1.00 25.77 ? 82  TYR A CG   1 
ATOM   286  C  CD1  . TYR A 1 45  ? 20.041 -1.944  44.178 1.00 25.74 ? 82  TYR A CD1  1 
ATOM   287  C  CD2  . TYR A 1 45  ? 20.863 -1.452  46.375 1.00 24.22 ? 82  TYR A CD2  1 
ATOM   288  C  CE1  . TYR A 1 45  ? 19.083 -2.818  44.721 1.00 26.78 ? 82  TYR A CE1  1 
ATOM   289  C  CE2  . TYR A 1 45  ? 19.916 -2.322  46.928 1.00 26.56 ? 82  TYR A CE2  1 
ATOM   290  C  CZ   . TYR A 1 45  ? 19.027 -2.995  46.092 1.00 28.35 ? 82  TYR A CZ   1 
ATOM   291  O  OH   . TYR A 1 45  ? 18.059 -3.802  46.626 1.00 28.06 ? 82  TYR A OH   1 
ATOM   292  N  N    . ASP A 1 46  ? 19.147 1.641   44.538 1.00 22.08 ? 83  ASP A N    1 
ATOM   293  C  CA   . ASP A 1 46  ? 18.188 2.246   45.433 1.00 20.96 ? 83  ASP A CA   1 
ATOM   294  C  C    . ASP A 1 46  ? 17.619 1.091   46.281 1.00 23.35 ? 83  ASP A C    1 
ATOM   295  O  O    . ASP A 1 46  ? 16.727 0.347   45.835 1.00 22.16 ? 83  ASP A O    1 
ATOM   296  C  CB   . ASP A 1 46  ? 17.102 2.916   44.599 1.00 19.23 ? 83  ASP A CB   1 
ATOM   297  C  CG   . ASP A 1 46  ? 15.938 3.408   45.418 1.00 20.98 ? 83  ASP A CG   1 
ATOM   298  O  OD1  . ASP A 1 46  ? 15.823 3.068   46.607 1.00 25.68 ? 83  ASP A OD1  1 
ATOM   299  O  OD2  . ASP A 1 46  ? 15.097 4.143   44.867 1.00 22.57 ? 83  ASP A OD2  1 
ATOM   300  N  N    . ALA A 1 47  ? 18.130 0.958   47.506 1.00 25.23 ? 84  ALA A N    1 
ATOM   301  C  CA   . ALA A 1 47  ? 17.707 -0.109  48.427 1.00 25.28 ? 84  ALA A CA   1 
ATOM   302  C  C    . ALA A 1 47  ? 16.229 -0.098  48.814 1.00 25.26 ? 84  ALA A C    1 
ATOM   303  O  O    . ALA A 1 47  ? 15.705 -1.099  49.279 1.00 26.04 ? 84  ALA A O    1 
ATOM   304  C  CB   . ALA A 1 47  ? 18.561 -0.091  49.679 1.00 24.36 ? 84  ALA A CB   1 
ATOM   305  N  N    . VAL A 1 48  ? 15.547 1.019   48.633 1.00 26.24 ? 85  VAL A N    1 
ATOM   306  C  CA   . VAL A 1 48  ? 14.130 1.042   48.965 1.00 25.51 ? 85  VAL A CA   1 
ATOM   307  C  C    . VAL A 1 48  ? 13.295 0.464   47.823 1.00 26.26 ? 85  VAL A C    1 
ATOM   308  O  O    . VAL A 1 48  ? 12.304 -0.259  48.046 1.00 25.59 ? 85  VAL A O    1 
ATOM   309  C  CB   . VAL A 1 48  ? 13.670 2.473   49.273 1.00 26.12 ? 85  VAL A CB   1 
ATOM   310  C  CG1  . VAL A 1 48  ? 12.138 2.565   49.291 1.00 23.93 ? 85  VAL A CG1  1 
ATOM   311  C  CG2  . VAL A 1 48  ? 14.236 2.893   50.624 1.00 24.85 ? 85  VAL A CG2  1 
ATOM   312  N  N    . LEU A 1 49  ? 13.688 0.768   46.590 1.00 25.30 ? 86  LEU A N    1 
ATOM   313  C  CA   . LEU A 1 49  ? 12.932 0.254   45.449 1.00 26.29 ? 86  LEU A CA   1 
ATOM   314  C  C    . LEU A 1 49  ? 13.561 -1.049  44.955 1.00 25.29 ? 86  LEU A C    1 
ATOM   315  O  O    . LEU A 1 49  ? 13.013 -1.714  44.082 1.00 26.96 ? 86  LEU A O    1 
ATOM   316  C  CB   . LEU A 1 49  ? 12.909 1.288   44.309 1.00 25.55 ? 86  LEU A CB   1 
ATOM   317  C  CG   . LEU A 1 49  ? 12.121 2.587   44.423 1.00 25.77 ? 86  LEU A CG   1 
ATOM   318  C  CD1  . LEU A 1 49  ? 12.483 3.423   43.205 1.00 25.54 ? 86  LEU A CD1  1 
ATOM   319  C  CD2  . LEU A 1 49  ? 10.596 2.341   44.457 1.00 23.94 ? 86  LEU A CD2  1 
ATOM   320  N  N    . ASP A 1 50  ? 14.705 -1.412  45.523 1.00 25.94 ? 87  ASP A N    1 
ATOM   321  C  CA   . ASP A 1 50  ? 15.408 -2.619  45.096 1.00 27.32 ? 87  ASP A CA   1 
ATOM   322  C  C    . ASP A 1 50  ? 15.536 -2.550  43.566 1.00 27.90 ? 87  ASP A C    1 
ATOM   323  O  O    . ASP A 1 50  ? 15.229 -3.496  42.850 1.00 29.20 ? 87  ASP A O    1 
ATOM   324  C  CB   . ASP A 1 50  ? 14.613 -3.859  45.517 1.00 28.30 ? 87  ASP A CB   1 
ATOM   325  C  CG   . ASP A 1 50  ? 15.310 -5.161  45.144 1.00 28.28 ? 87  ASP A CG   1 
ATOM   326  O  OD1  . ASP A 1 50  ? 16.561 -5.245  45.267 1.00 27.19 ? 87  ASP A OD1  1 
ATOM   327  O  OD2  . ASP A 1 50  ? 14.594 -6.109  44.745 1.00 29.23 ? 87  ASP A OD2  1 
ATOM   328  N  N    . ARG A 1 51  ? 16.005 -1.408  43.087 1.00 28.08 ? 88  ARG A N    1 
ATOM   329  C  CA   . ARG A 1 51  ? 16.138 -1.152  41.665 1.00 29.64 ? 88  ARG A CA   1 
ATOM   330  C  C    . ARG A 1 51  ? 17.354 -0.244  41.446 1.00 27.51 ? 88  ARG A C    1 
ATOM   331  O  O    . ARG A 1 51  ? 17.749 0.502   42.345 1.00 25.42 ? 88  ARG A O    1 
ATOM   332  C  CB   . ARG A 1 51  ? 14.868 -0.430  41.201 1.00 32.25 ? 88  ARG A CB   1 
ATOM   333  C  CG   . ARG A 1 51  ? 14.655 -0.351  39.720 1.00 37.47 ? 88  ARG A CG   1 
ATOM   334  C  CD   . ARG A 1 51  ? 13.638 0.721   39.379 1.00 39.84 ? 88  ARG A CD   1 
ATOM   335  N  NE   . ARG A 1 51  ? 12.419 0.608   40.175 1.00 44.56 ? 88  ARG A NE   1 
ATOM   336  C  CZ   . ARG A 1 51  ? 11.325 1.343   39.977 1.00 44.62 ? 88  ARG A CZ   1 
ATOM   337  N  NH1  . ARG A 1 51  ? 11.291 2.238   39.000 1.00 45.23 ? 88  ARG A NH1  1 
ATOM   338  N  NH2  . ARG A 1 51  ? 10.274 1.202   40.773 1.00 44.40 ? 88  ARG A NH2  1 
ATOM   339  N  N    . ASN A 1 52  ? 17.944 -0.292  40.256 1.00 26.56 ? 89  ASN A N    1 
ATOM   340  C  CA   . ASN A 1 52  ? 19.091 0.580   39.966 1.00 24.83 ? 89  ASN A CA   1 
ATOM   341  C  C    . ASN A 1 52  ? 18.522 1.877   39.464 1.00 21.24 ? 89  ASN A C    1 
ATOM   342  O  O    . ASN A 1 52  ? 17.457 1.899   38.860 1.00 20.94 ? 89  ASN A O    1 
ATOM   343  C  CB   . ASN A 1 52  ? 19.986 -0.015  38.895 1.00 27.58 ? 89  ASN A CB   1 
ATOM   344  C  CG   . ASN A 1 52  ? 20.693 -1.254  39.364 1.00 29.66 ? 89  ASN A CG   1 
ATOM   345  O  OD1  . ASN A 1 52  ? 20.868 -2.191  38.604 1.00 33.16 ? 89  ASN A OD1  1 
ATOM   346  N  ND2  . ASN A 1 52  ? 21.126 -1.260  40.615 1.00 31.35 ? 89  ASN A ND2  1 
ATOM   347  N  N    . VAL A 1 53  ? 19.236 2.959   39.727 1.00 19.58 ? 90  VAL A N    1 
ATOM   348  C  CA   . VAL A 1 53  ? 18.801 4.286   39.340 1.00 16.57 ? 90  VAL A CA   1 
ATOM   349  C  C    . VAL A 1 53  ? 19.994 5.147   38.948 1.00 17.90 ? 90  VAL A C    1 
ATOM   350  O  O    . VAL A 1 53  ? 21.152 4.797   39.233 1.00 15.60 ? 90  VAL A O    1 
ATOM   351  C  CB   . VAL A 1 53  ? 18.108 5.000   40.526 1.00 17.94 ? 90  VAL A CB   1 
ATOM   352  C  CG1  . VAL A 1 53  ? 16.828 4.242   40.958 1.00 16.64 ? 90  VAL A CG1  1 
ATOM   353  C  CG2  . VAL A 1 53  ? 19.099 5.113   41.689 1.00 15.85 ? 90  VAL A CG2  1 
ATOM   354  N  N    . ALA A 1 54  ? 19.699 6.269   38.290 1.00 17.48 ? 91  ALA A N    1 
ATOM   355  C  CA   . ALA A 1 54  ? 20.725 7.238   37.912 1.00 18.49 ? 91  ALA A CA   1 
ATOM   356  C  C    . ALA A 1 54  ? 20.384 8.451   38.745 1.00 18.49 ? 91  ALA A C    1 
ATOM   357  O  O    . ALA A 1 54  ? 19.197 8.770   38.939 1.00 15.90 ? 91  ALA A O    1 
ATOM   358  C  CB   . ALA A 1 54  ? 20.652 7.591   36.442 1.00 16.88 ? 91  ALA A CB   1 
ATOM   359  N  N    . ILE A 1 55  ? 21.429 9.119   39.221 1.00 18.61 ? 92  ILE A N    1 
ATOM   360  C  CA   . ILE A 1 55  ? 21.320 10.301  40.070 1.00 17.47 ? 92  ILE A CA   1 
ATOM   361  C  C    . ILE A 1 55  ? 22.163 11.405  39.485 1.00 18.58 ? 92  ILE A C    1 
ATOM   362  O  O    . ILE A 1 55  ? 23.363 11.234  39.250 1.00 19.19 ? 92  ILE A O    1 
ATOM   363  C  CB   . ILE A 1 55  ? 21.878 10.031  41.485 1.00 17.67 ? 92  ILE A CB   1 
ATOM   364  C  CG1  . ILE A 1 55  ? 21.173 8.820   42.110 1.00 17.82 ? 92  ILE A CG1  1 
ATOM   365  C  CG2  . ILE A 1 55  ? 21.734 11.269  42.363 1.00 16.43 ? 92  ILE A CG2  1 
ATOM   366  C  CD1  . ILE A 1 55  ? 21.854 8.307   43.382 1.00 17.15 ? 92  ILE A CD1  1 
ATOM   367  N  N    . LYS A 1 56  ? 21.554 12.557  39.276 1.00 20.28 ? 93  LYS A N    1 
ATOM   368  C  CA   . LYS A 1 56  ? 22.276 13.686  38.710 1.00 21.04 ? 93  LYS A CA   1 
ATOM   369  C  C    . LYS A 1 56  ? 22.309 14.829  39.725 1.00 20.51 ? 93  LYS A C    1 
ATOM   370  O  O    . LYS A 1 56  ? 21.295 15.166  40.337 1.00 20.49 ? 93  LYS A O    1 
ATOM   371  C  CB   . LYS A 1 56  ? 21.575 14.114  37.409 1.00 21.27 ? 93  LYS A CB   1 
ATOM   372  C  CG   . LYS A 1 56  ? 22.000 15.442  36.763 1.00 23.64 ? 93  LYS A CG   1 
ATOM   373  C  CD   . LYS A 1 56  ? 21.105 15.747  35.514 1.00 23.03 ? 93  LYS A CD   1 
ATOM   374  C  CE   . LYS A 1 56  ? 21.573 16.964  34.736 1.00 28.06 ? 93  LYS A CE   1 
ATOM   375  N  NZ   . LYS A 1 56  ? 20.616 17.371  33.653 1.00 28.03 ? 93  LYS A NZ   1 
ATOM   376  N  N    . LYS A 1 57  ? 23.490 15.401  39.903 1.00 20.33 ? 94  LYS A N    1 
ATOM   377  C  CA   . LYS A 1 57  ? 23.681 16.518  40.812 1.00 22.26 ? 94  LYS A CA   1 
ATOM   378  C  C    . LYS A 1 57  ? 23.774 17.877  40.101 1.00 22.41 ? 94  LYS A C    1 
ATOM   379  O  O    . LYS A 1 57  ? 24.631 18.075  39.250 1.00 25.22 ? 94  LYS A O    1 
ATOM   380  C  CB   . LYS A 1 57  ? 24.970 16.326  41.616 1.00 24.03 ? 94  LYS A CB   1 
ATOM   381  C  CG   . LYS A 1 57  ? 25.295 17.478  42.545 1.00 24.91 ? 94  LYS A CG   1 
ATOM   382  C  CD   . LYS A 1 57  ? 26.713 17.388  43.051 1.00 27.05 ? 94  LYS A CD   1 
ATOM   383  C  CE   . LYS A 1 57  ? 26.927 18.417  44.124 1.00 27.26 ? 94  LYS A CE   1 
ATOM   384  N  NZ   . LYS A 1 57  ? 28.292 18.371  44.677 1.00 29.30 ? 94  LYS A NZ   1 
ATOM   385  N  N    . LEU A 1 58  ? 22.897 18.807  40.442 1.00 23.28 ? 95  LEU A N    1 
ATOM   386  C  CA   . LEU A 1 58  ? 22.989 20.144  39.866 1.00 24.53 ? 95  LEU A CA   1 
ATOM   387  C  C    . LEU A 1 58  ? 23.666 20.953  40.964 1.00 24.16 ? 95  LEU A C    1 
ATOM   388  O  O    . LEU A 1 58  ? 23.115 21.130  42.053 1.00 23.98 ? 95  LEU A O    1 
ATOM   389  C  CB   . LEU A 1 58  ? 21.617 20.740  39.574 1.00 24.67 ? 95  LEU A CB   1 
ATOM   390  C  CG   . LEU A 1 58  ? 20.694 19.918  38.693 1.00 25.89 ? 95  LEU A CG   1 
ATOM   391  C  CD1  . LEU A 1 58  ? 19.444 20.726  38.449 1.00 24.57 ? 95  LEU A CD1  1 
ATOM   392  C  CD2  . LEU A 1 58  ? 21.392 19.565  37.370 1.00 28.27 ? 95  LEU A CD2  1 
ATOM   393  N  N    . SER A 1 59  ? 24.881 21.407  40.697 1.00 25.79 ? 96  SER A N    1 
ATOM   394  C  CA   . SER A 1 59  ? 25.622 22.184  41.675 1.00 25.14 ? 96  SER A CA   1 
ATOM   395  C  C    . SER A 1 59  ? 25.299 23.653  41.506 1.00 23.76 ? 96  SER A C    1 
ATOM   396  O  O    . SER A 1 59  ? 25.540 24.221  40.456 1.00 22.39 ? 96  SER A O    1 
ATOM   397  C  CB   . SER A 1 59  ? 27.117 21.951  41.494 1.00 27.41 ? 96  SER A CB   1 
ATOM   398  O  OG   . SER A 1 59  ? 27.844 22.863  42.320 1.00 34.21 ? 96  SER A OG   1 
ATOM   399  N  N    . ARG A 1 60  ? 24.751 24.263  42.551 1.00 25.12 ? 97  ARG A N    1 
ATOM   400  C  CA   . ARG A 1 60  ? 24.362 25.673  42.511 1.00 26.15 ? 97  ARG A CA   1 
ATOM   401  C  C    . ARG A 1 60  ? 23.813 26.078  41.134 1.00 27.03 ? 97  ARG A C    1 
ATOM   402  O  O    . ARG A 1 60  ? 24.370 26.947  40.456 1.00 27.91 ? 97  ARG A O    1 
ATOM   403  C  CB   . ARG A 1 60  ? 25.555 26.552  42.881 1.00 27.39 ? 97  ARG A CB   1 
ATOM   404  C  CG   . ARG A 1 60  ? 26.106 26.292  44.273 1.00 29.07 ? 97  ARG A CG   1 
ATOM   405  C  CD   . ARG A 1 60  ? 27.214 27.300  44.618 1.00 31.16 ? 97  ARG A CD   1 
ATOM   406  N  NE   . ARG A 1 60  ? 26.680 28.649  44.785 1.00 32.40 ? 97  ARG A NE   1 
ATOM   407  C  CZ   . ARG A 1 60  ? 26.128 29.126  45.901 1.00 33.73 ? 97  ARG A CZ   1 
ATOM   408  N  NH1  . ARG A 1 60  ? 26.025 28.374  46.995 1.00 35.81 ? 97  ARG A NH1  1 
ATOM   409  N  NH2  . ARG A 1 60  ? 25.663 30.364  45.916 1.00 35.07 ? 97  ARG A NH2  1 
ATOM   410  N  N    . PRO A 1 61  ? 22.693 25.462  40.715 1.00 26.43 ? 98  PRO A N    1 
ATOM   411  C  CA   . PRO A 1 61  ? 22.059 25.741  39.419 1.00 26.21 ? 98  PRO A CA   1 
ATOM   412  C  C    . PRO A 1 61  ? 21.590 27.190  39.221 1.00 25.64 ? 98  PRO A C    1 
ATOM   413  O  O    . PRO A 1 61  ? 21.287 27.628  38.105 1.00 23.74 ? 98  PRO A O    1 
ATOM   414  C  CB   . PRO A 1 61  ? 20.916 24.721  39.384 1.00 25.90 ? 98  PRO A CB   1 
ATOM   415  C  CG   . PRO A 1 61  ? 20.558 24.585  40.847 1.00 25.12 ? 98  PRO A CG   1 
ATOM   416  C  CD   . PRO A 1 61  ? 21.918 24.455  41.462 1.00 25.28 ? 98  PRO A CD   1 
ATOM   417  N  N    . PHE A 1 62  ? 21.537 27.927  40.314 1.00 24.70 ? 99  PHE A N    1 
ATOM   418  C  CA   . PHE A 1 62  ? 21.124 29.301  40.262 1.00 24.61 ? 99  PHE A CA   1 
ATOM   419  C  C    . PHE A 1 62  ? 22.320 30.214  40.033 1.00 25.82 ? 99  PHE A C    1 
ATOM   420  O  O    . PHE A 1 62  ? 22.143 31.417  39.999 1.00 24.93 ? 99  PHE A O    1 
ATOM   421  C  CB   . PHE A 1 62  ? 20.444 29.675  41.569 1.00 24.66 ? 99  PHE A CB   1 
ATOM   422  C  CG   . PHE A 1 62  ? 21.194 29.202  42.789 1.00 24.97 ? 99  PHE A CG   1 
ATOM   423  C  CD1  . PHE A 1 62  ? 22.260 29.938  43.310 1.00 25.83 ? 99  PHE A CD1  1 
ATOM   424  C  CD2  . PHE A 1 62  ? 20.854 27.991  43.400 1.00 24.59 ? 99  PHE A CD2  1 
ATOM   425  C  CE1  . PHE A 1 62  ? 22.975 29.469  44.423 1.00 27.44 ? 99  PHE A CE1  1 
ATOM   426  C  CE2  . PHE A 1 62  ? 21.555 27.518  44.502 1.00 24.48 ? 99  PHE A CE2  1 
ATOM   427  C  CZ   . PHE A 1 62  ? 22.618 28.250  45.020 1.00 25.48 ? 99  PHE A CZ   1 
ATOM   428  N  N    . GLN A 1 63  ? 23.522 29.647  39.859 1.00 25.83 ? 100 GLN A N    1 
ATOM   429  C  CA   . GLN A 1 63  ? 24.720 30.455  39.665 1.00 27.05 ? 100 GLN A CA   1 
ATOM   430  C  C    . GLN A 1 63  ? 24.676 31.488  38.529 1.00 28.75 ? 100 GLN A C    1 
ATOM   431  O  O    . GLN A 1 63  ? 25.301 32.542  38.650 1.00 29.96 ? 100 GLN A O    1 
ATOM   432  C  CB   . GLN A 1 63  ? 25.949 29.567  39.533 1.00 29.02 ? 100 GLN A CB   1 
ATOM   433  C  CG   . GLN A 1 63  ? 25.936 28.578  38.416 1.00 30.59 ? 100 GLN A CG   1 
ATOM   434  C  CD   . GLN A 1 63  ? 27.223 27.804  38.405 1.00 33.56 ? 100 GLN A CD   1 
ATOM   435  O  OE1  . GLN A 1 63  ? 28.183 28.189  37.750 1.00 33.59 ? 100 GLN A OE1  1 
ATOM   436  N  NE2  . GLN A 1 63  ? 27.270 26.728  39.175 1.00 33.32 ? 100 GLN A NE2  1 
ATOM   437  N  N    . ASN A 1 64  ? 23.983 31.197  37.424 1.00 28.81 ? 101 ASN A N    1 
ATOM   438  C  CA   . ASN A 1 64  ? 23.796 32.175  36.344 1.00 29.24 ? 101 ASN A CA   1 
ATOM   439  C  C    . ASN A 1 64  ? 22.442 31.924  35.670 1.00 32.64 ? 101 ASN A C    1 
ATOM   440  O  O    . ASN A 1 64  ? 21.787 30.910  35.935 1.00 31.76 ? 101 ASN A O    1 
ATOM   441  C  CB   . ASN A 1 64  ? 24.948 32.157  35.329 1.00 29.73 ? 101 ASN A CB   1 
ATOM   442  C  CG   . ASN A 1 64  ? 25.064 30.853  34.559 1.00 28.17 ? 101 ASN A CG   1 
ATOM   443  O  OD1  . ASN A 1 64  ? 24.139 30.442  33.881 1.00 27.58 ? 101 ASN A OD1  1 
ATOM   444  N  ND2  . ASN A 1 64  ? 26.227 30.207  34.650 1.00 26.31 ? 101 ASN A ND2  1 
ATOM   445  N  N    . GLN A 1 65  ? 21.999 32.851  34.827 1.00 34.35 ? 102 GLN A N    1 
ATOM   446  C  CA   . GLN A 1 65  ? 20.704 32.714  34.148 1.00 36.53 ? 102 GLN A CA   1 
ATOM   447  C  C    . GLN A 1 65  ? 20.589 31.480  33.277 1.00 35.57 ? 102 GLN A C    1 
ATOM   448  O  O    . GLN A 1 65  ? 19.528 30.853  33.210 1.00 36.35 ? 102 GLN A O    1 
ATOM   449  C  CB   . GLN A 1 65  ? 20.432 33.930  33.275 1.00 39.29 ? 102 GLN A CB   1 
ATOM   450  C  CG   . GLN A 1 65  ? 20.554 35.216  34.033 1.00 44.76 ? 102 GLN A CG   1 
ATOM   451  C  CD   . GLN A 1 65  ? 19.263 35.988  34.062 1.00 47.62 ? 102 GLN A CD   1 
ATOM   452  O  OE1  . GLN A 1 65  ? 18.207 35.457  34.445 1.00 48.60 ? 102 GLN A OE1  1 
ATOM   453  N  NE2  . GLN A 1 65  ? 19.332 37.261  33.663 1.00 47.53 ? 102 GLN A NE2  1 
ATOM   454  N  N    . THR A 1 66  ? 21.670 31.156  32.586 1.00 34.42 ? 103 THR A N    1 
ATOM   455  C  CA   . THR A 1 66  ? 21.698 29.995  31.718 1.00 34.44 ? 103 THR A CA   1 
ATOM   456  C  C    . THR A 1 66  ? 21.300 28.764  32.534 1.00 33.49 ? 103 THR A C    1 
ATOM   457  O  O    . THR A 1 66  ? 20.230 28.191  32.336 1.00 34.67 ? 103 THR A O    1 
ATOM   458  C  CB   . THR A 1 66  ? 23.124 29.820  31.109 1.00 36.76 ? 103 THR A CB   1 
ATOM   459  O  OG1  . THR A 1 66  ? 23.460 30.987  30.338 1.00 39.10 ? 103 THR A OG1  1 
ATOM   460  C  CG2  . THR A 1 66  ? 23.198 28.583  30.201 1.00 37.34 ? 103 THR A CG2  1 
ATOM   461  N  N    . HIS A 1 67  ? 22.143 28.362  33.475 1.00 32.68 ? 104 HIS A N    1 
ATOM   462  C  CA   . HIS A 1 67  ? 21.835 27.193  34.310 1.00 30.92 ? 104 HIS A CA   1 
ATOM   463  C  C    . HIS A 1 67  ? 20.479 27.254  35.004 1.00 28.93 ? 104 HIS A C    1 
ATOM   464  O  O    . HIS A 1 67  ? 19.782 26.246  35.090 1.00 26.53 ? 104 HIS A O    1 
ATOM   465  C  CB   . HIS A 1 67  ? 22.878 27.037  35.402 1.00 32.78 ? 104 HIS A CB   1 
ATOM   466  C  CG   . HIS A 1 67  ? 24.210 26.602  34.899 1.00 35.67 ? 104 HIS A CG   1 
ATOM   467  N  ND1  . HIS A 1 67  ? 25.321 26.537  35.707 1.00 38.01 ? 104 HIS A ND1  1 
ATOM   468  C  CD2  . HIS A 1 67  ? 24.609 26.198  33.672 1.00 38.42 ? 104 HIS A CD2  1 
ATOM   469  C  CE1  . HIS A 1 67  ? 26.353 26.113  34.997 1.00 39.38 ? 104 HIS A CE1  1 
ATOM   470  N  NE2  . HIS A 1 67  ? 25.947 25.899  33.759 1.00 39.21 ? 104 HIS A NE2  1 
ATOM   471  N  N    . ALA A 1 68  ? 20.132 28.440  35.506 1.00 26.15 ? 105 ALA A N    1 
ATOM   472  C  CA   . ALA A 1 68  ? 18.904 28.636  36.266 1.00 26.51 ? 105 ALA A CA   1 
ATOM   473  C  C    . ALA A 1 68  ? 17.639 28.416  35.485 1.00 27.32 ? 105 ALA A C    1 
ATOM   474  O  O    . ALA A 1 68  ? 16.752 27.689  35.926 1.00 27.19 ? 105 ALA A O    1 
ATOM   475  C  CB   . ALA A 1 68  ? 18.889 30.037  36.903 1.00 24.81 ? 105 ALA A CB   1 
ATOM   476  N  N    . LYS A 1 69  ? 17.551 29.058  34.332 1.00 29.26 ? 106 LYS A N    1 
ATOM   477  C  CA   . LYS A 1 69  ? 16.381 28.940  33.484 1.00 31.46 ? 106 LYS A CA   1 
ATOM   478  C  C    . LYS A 1 69  ? 16.127 27.485  33.114 1.00 31.59 ? 106 LYS A C    1 
ATOM   479  O  O    . LYS A 1 69  ? 15.001 26.998  33.189 1.00 33.24 ? 106 LYS A O    1 
ATOM   480  C  CB   . LYS A 1 69  ? 16.584 29.771  32.217 1.00 33.16 ? 106 LYS A CB   1 
ATOM   481  C  CG   . LYS A 1 69  ? 15.303 30.357  31.672 1.00 37.74 ? 106 LYS A CG   1 
ATOM   482  C  CD   . LYS A 1 69  ? 15.519 31.119  30.363 1.00 40.45 ? 106 LYS A CD   1 
ATOM   483  C  CE   . LYS A 1 69  ? 14.231 31.787  29.900 1.00 42.77 ? 106 LYS A CE   1 
ATOM   484  N  NZ   . LYS A 1 69  ? 13.101 30.805  29.788 1.00 44.15 ? 106 LYS A NZ   1 
ATOM   485  N  N    . ARG A 1 70  ? 17.178 26.794  32.704 1.00 30.24 ? 107 ARG A N    1 
ATOM   486  C  CA   . ARG A 1 70  ? 17.069 25.394  32.323 1.00 30.68 ? 107 ARG A CA   1 
ATOM   487  C  C    . ARG A 1 70  ? 16.619 24.499  33.489 1.00 28.96 ? 107 ARG A C    1 
ATOM   488  O  O    . ARG A 1 70  ? 15.642 23.758  33.377 1.00 27.11 ? 107 ARG A O    1 
ATOM   489  C  CB   . ARG A 1 70  ? 18.416 24.930  31.775 1.00 33.53 ? 107 ARG A CB   1 
ATOM   490  C  CG   . ARG A 1 70  ? 18.396 23.611  31.044 1.00 39.39 ? 107 ARG A CG   1 
ATOM   491  C  CD   . ARG A 1 70  ? 19.729 23.440  30.362 1.00 45.42 ? 107 ARG A CD   1 
ATOM   492  N  NE   . ARG A 1 70  ? 19.763 22.288  29.470 1.00 50.08 ? 107 ARG A NE   1 
ATOM   493  C  CZ   . ARG A 1 70  ? 19.830 21.029  29.883 1.00 53.51 ? 107 ARG A CZ   1 
ATOM   494  N  NH1  . ARG A 1 70  ? 19.869 20.774  31.190 1.00 54.25 ? 107 ARG A NH1  1 
ATOM   495  N  NH2  . ARG A 1 70  ? 19.863 20.032  28.990 1.00 54.03 ? 107 ARG A NH2  1 
ATOM   496  N  N    . ALA A 1 71  ? 17.322 24.575  34.613 1.00 27.81 ? 108 ALA A N    1 
ATOM   497  C  CA   . ALA A 1 71  ? 16.958 23.761  35.768 1.00 27.38 ? 108 ALA A CA   1 
ATOM   498  C  C    . ALA A 1 71  ? 15.490 23.946  36.205 1.00 28.08 ? 108 ALA A C    1 
ATOM   499  O  O    . ALA A 1 71  ? 14.759 22.967  36.465 1.00 26.57 ? 108 ALA A O    1 
ATOM   500  C  CB   . ALA A 1 71  ? 17.883 24.064  36.913 1.00 26.40 ? 108 ALA A CB   1 
ATOM   501  N  N    . TYR A 1 72  ? 15.054 25.199  36.248 1.00 27.39 ? 109 TYR A N    1 
ATOM   502  C  CA   . TYR A 1 72  ? 13.699 25.520  36.661 1.00 29.03 ? 109 TYR A CA   1 
ATOM   503  C  C    . TYR A 1 72  ? 12.690 25.019  35.650 1.00 29.87 ? 109 TYR A C    1 
ATOM   504  O  O    . TYR A 1 72  ? 11.715 24.384  36.031 1.00 30.69 ? 109 TYR A O    1 
ATOM   505  C  CB   . TYR A 1 72  ? 13.532 27.031  36.869 1.00 30.90 ? 109 TYR A CB   1 
ATOM   506  C  CG   . TYR A 1 72  ? 12.127 27.439  37.262 1.00 32.89 ? 109 TYR A CG   1 
ATOM   507  C  CD1  . TYR A 1 72  ? 11.611 27.119  38.520 1.00 33.61 ? 109 TYR A CD1  1 
ATOM   508  C  CD2  . TYR A 1 72  ? 11.300 28.129  36.366 1.00 32.96 ? 109 TYR A CD2  1 
ATOM   509  C  CE1  . TYR A 1 72  ? 10.307 27.473  38.880 1.00 34.14 ? 109 TYR A CE1  1 
ATOM   510  C  CE2  . TYR A 1 72  ? 9.994  28.487  36.715 1.00 34.19 ? 109 TYR A CE2  1 
ATOM   511  C  CZ   . TYR A 1 72  ? 9.502  28.156  37.974 1.00 35.72 ? 109 TYR A CZ   1 
ATOM   512  O  OH   . TYR A 1 72  ? 8.200  28.493  38.334 1.00 38.96 ? 109 TYR A OH   1 
ATOM   513  N  N    . ARG A 1 73  ? 12.926 25.302  34.370 1.00 30.56 ? 110 ARG A N    1 
ATOM   514  C  CA   . ARG A 1 73  ? 12.037 24.848  33.297 1.00 30.18 ? 110 ARG A CA   1 
ATOM   515  C  C    . ARG A 1 73  ? 11.879 23.331  33.352 1.00 29.57 ? 110 ARG A C    1 
ATOM   516  O  O    . ARG A 1 73  ? 10.770 22.800  33.361 1.00 29.19 ? 110 ARG A O    1 
ATOM   517  C  CB   . ARG A 1 73  ? 12.619 25.233  31.930 1.00 30.60 ? 110 ARG A CB   1 
ATOM   518  C  CG   . ARG A 1 73  ? 11.857 24.718  30.699 1.00 33.31 ? 110 ARG A CG   1 
ATOM   519  C  CD   . ARG A 1 73  ? 12.018 25.704  29.511 1.00 35.70 ? 110 ARG A CD   1 
ATOM   520  N  NE   . ARG A 1 73  ? 11.200 25.378  28.335 1.00 37.26 ? 110 ARG A NE   1 
ATOM   521  C  CZ   . ARG A 1 73  ? 11.463 24.390  27.481 1.00 38.14 ? 110 ARG A CZ   1 
ATOM   522  N  NH1  . ARG A 1 73  ? 12.531 23.624  27.664 1.00 37.91 ? 110 ARG A NH1  1 
ATOM   523  N  NH2  . ARG A 1 73  ? 10.660 24.165  26.446 1.00 36.92 ? 110 ARG A NH2  1 
ATOM   524  N  N    . GLU A 1 74  ? 12.999 22.635  33.399 1.00 27.70 ? 111 GLU A N    1 
ATOM   525  C  CA   . GLU A 1 74  ? 12.947 21.202  33.412 1.00 28.11 ? 111 GLU A CA   1 
ATOM   526  C  C    . GLU A 1 74  ? 12.286 20.660  34.679 1.00 27.36 ? 111 GLU A C    1 
ATOM   527  O  O    . GLU A 1 74  ? 11.587 19.647  34.631 1.00 25.97 ? 111 GLU A O    1 
ATOM   528  C  CB   . GLU A 1 74  ? 14.359 20.674  33.163 1.00 29.18 ? 111 GLU A CB   1 
ATOM   529  C  CG   . GLU A 1 74  ? 14.968 21.420  31.954 1.00 33.10 ? 111 GLU A CG   1 
ATOM   530  C  CD   . GLU A 1 74  ? 15.987 20.637  31.144 1.00 34.96 ? 111 GLU A CD   1 
ATOM   531  O  OE1  . GLU A 1 74  ? 16.873 19.999  31.745 1.00 34.42 ? 111 GLU A OE1  1 
ATOM   532  O  OE2  . GLU A 1 74  ? 15.911 20.681  29.888 1.00 37.13 ? 111 GLU A OE2  1 
ATOM   533  N  N    . LEU A 1 75  ? 12.472 21.334  35.808 1.00 27.18 ? 112 LEU A N    1 
ATOM   534  C  CA   . LEU A 1 75  ? 11.828 20.881  37.047 1.00 28.16 ? 112 LEU A CA   1 
ATOM   535  C  C    . LEU A 1 75  ? 10.325 21.025  36.910 1.00 28.04 ? 112 LEU A C    1 
ATOM   536  O  O    . LEU A 1 75  ? 9.558  20.173  37.346 1.00 27.63 ? 112 LEU A O    1 
ATOM   537  C  CB   . LEU A 1 75  ? 12.282 21.703  38.252 1.00 27.58 ? 112 LEU A CB   1 
ATOM   538  C  CG   . LEU A 1 75  ? 13.533 21.229  38.976 1.00 29.26 ? 112 LEU A CG   1 
ATOM   539  C  CD1  . LEU A 1 75  ? 13.826 22.128  40.224 1.00 28.71 ? 112 LEU A CD1  1 
ATOM   540  C  CD2  . LEU A 1 75  ? 13.319 19.773  39.376 1.00 29.17 ? 112 LEU A CD2  1 
ATOM   541  N  N    . VAL A 1 76  ? 9.913  22.115  36.286 1.00 29.76 ? 113 VAL A N    1 
ATOM   542  C  CA   . VAL A 1 76  ? 8.500  22.374  36.079 1.00 32.90 ? 113 VAL A CA   1 
ATOM   543  C  C    . VAL A 1 76  ? 7.918  21.469  34.973 1.00 33.94 ? 113 VAL A C    1 
ATOM   544  O  O    . VAL A 1 76  ? 6.843  20.886  35.137 1.00 33.96 ? 113 VAL A O    1 
ATOM   545  C  CB   . VAL A 1 76  ? 8.288  23.849  35.711 1.00 33.99 ? 113 VAL A CB   1 
ATOM   546  C  CG1  . VAL A 1 76  ? 6.850  24.067  35.244 1.00 35.42 ? 113 VAL A CG1  1 
ATOM   547  C  CG2  . VAL A 1 76  ? 8.617  24.730  36.913 1.00 32.99 ? 113 VAL A CG2  1 
ATOM   548  N  N    . LEU A 1 77  ? 8.640  21.340  33.863 1.00 33.93 ? 114 LEU A N    1 
ATOM   549  C  CA   . LEU A 1 77  ? 8.176  20.522  32.754 1.00 35.26 ? 114 LEU A CA   1 
ATOM   550  C  C    . LEU A 1 77  ? 7.987  19.075  33.107 1.00 36.52 ? 114 LEU A C    1 
ATOM   551  O  O    . LEU A 1 77  ? 7.015  18.450  32.689 1.00 37.46 ? 114 LEU A O    1 
ATOM   552  C  CB   . LEU A 1 77  ? 9.123  20.636  31.558 1.00 33.65 ? 114 LEU A CB   1 
ATOM   553  C  CG   . LEU A 1 77  ? 8.873  21.986  30.898 1.00 33.41 ? 114 LEU A CG   1 
ATOM   554  C  CD1  . LEU A 1 77  ? 9.623  22.099  29.591 1.00 32.40 ? 114 LEU A CD1  1 
ATOM   555  C  CD2  . LEU A 1 77  ? 7.353  22.151  30.679 1.00 33.20 ? 114 LEU A CD2  1 
ATOM   556  N  N    . MET A 1 78  ? 8.900  18.531  33.890 1.00 38.47 ? 115 MET A N    1 
ATOM   557  C  CA   . MET A 1 78  ? 8.784  17.140  34.240 1.00 41.15 ? 115 MET A CA   1 
ATOM   558  C  C    . MET A 1 78  ? 7.454  16.810  34.877 1.00 43.17 ? 115 MET A C    1 
ATOM   559  O  O    . MET A 1 78  ? 7.080  15.637  34.961 1.00 44.19 ? 115 MET A O    1 
ATOM   560  C  CB   . MET A 1 78  ? 9.948  16.717  35.131 1.00 40.25 ? 115 MET A CB   1 
ATOM   561  C  CG   . MET A 1 78  ? 10.932 15.823  34.373 1.00 40.56 ? 115 MET A CG   1 
ATOM   562  S  SD   . MET A 1 78  ? 12.630 16.073  34.932 1.00 43.32 ? 115 MET A SD   1 
ATOM   563  C  CE   . MET A 1 78  ? 13.184 17.423  33.876 1.00 45.82 ? 115 MET A CE   1 
ATOM   564  N  N    . LYS A 1 79  ? 6.737  17.839  35.320 1.00 44.74 ? 116 LYS A N    1 
ATOM   565  C  CA   . LYS A 1 79  ? 5.418  17.652  35.925 1.00 46.20 ? 116 LYS A CA   1 
ATOM   566  C  C    . LYS A 1 79  ? 4.324  17.774  34.856 1.00 46.10 ? 116 LYS A C    1 
ATOM   567  O  O    . LYS A 1 79  ? 3.233  17.262  35.028 1.00 46.63 ? 116 LYS A O    1 
ATOM   568  C  CB   . LYS A 1 79  ? 5.185  18.694  37.027 1.00 49.46 ? 116 LYS A CB   1 
ATOM   569  C  CG   . LYS A 1 79  ? 6.090  18.554  38.274 1.00 52.82 ? 116 LYS A CG   1 
ATOM   570  C  CD   . LYS A 1 79  ? 6.113  19.876  39.067 1.00 55.73 ? 116 LYS A CD   1 
ATOM   571  C  CE   . LYS A 1 79  ? 6.863  19.757  40.403 1.00 58.67 ? 116 LYS A CE   1 
ATOM   572  N  NZ   . LYS A 1 79  ? 8.288  19.312  40.261 1.00 60.57 ? 116 LYS A NZ   1 
ATOM   573  N  N    . CYS A 1 80  ? 4.619  18.449  33.750 1.00 45.93 ? 117 CYS A N    1 
ATOM   574  C  CA   . CYS A 1 80  ? 3.638  18.617  32.672 1.00 45.46 ? 117 CYS A CA   1 
ATOM   575  C  C    . CYS A 1 80  ? 3.625  17.450  31.681 1.00 44.14 ? 117 CYS A C    1 
ATOM   576  O  O    . CYS A 1 80  ? 2.894  17.495  30.681 1.00 44.95 ? 117 CYS A O    1 
ATOM   577  C  CB   . CYS A 1 80  ? 3.909  19.900  31.879 1.00 46.28 ? 117 CYS A CB   1 
ATOM   578  S  SG   . CYS A 1 80  ? 3.724  21.434  32.807 1.00 51.98 ? 117 CYS A SG   1 
ATOM   579  N  N    . VAL A 1 81  ? 4.425  16.416  31.943 1.00 40.70 ? 118 VAL A N    1 
ATOM   580  C  CA   . VAL A 1 81  ? 4.480  15.279  31.039 1.00 36.80 ? 118 VAL A CA   1 
ATOM   581  C  C    . VAL A 1 81  ? 4.353  13.927  31.704 1.00 35.36 ? 118 VAL A C    1 
ATOM   582  O  O    . VAL A 1 81  ? 4.840  13.697  32.803 1.00 34.62 ? 118 VAL A O    1 
ATOM   583  C  CB   . VAL A 1 81  ? 5.760  15.312  30.228 1.00 35.70 ? 118 VAL A CB   1 
ATOM   584  C  CG1  . VAL A 1 81  ? 5.747  16.532  29.311 1.00 35.06 ? 118 VAL A CG1  1 
ATOM   585  C  CG2  . VAL A 1 81  ? 6.938  15.365  31.152 1.00 34.34 ? 118 VAL A CG2  1 
ATOM   586  N  N    . ASN A 1 82  ? 3.699  13.011  31.018 1.00 34.02 ? 119 ASN A N    1 
ATOM   587  C  CA   . ASN A 1 82  ? 3.514  11.688  31.584 1.00 34.71 ? 119 ASN A CA   1 
ATOM   588  C  C    . ASN A 1 82  ? 3.552  10.645  30.476 1.00 32.68 ? 119 ASN A C    1 
ATOM   589  O  O    . ASN A 1 82  ? 2.508  10.138  30.036 1.00 32.37 ? 119 ASN A O    1 
ATOM   590  C  CB   . ASN A 1 82  ? 2.173  11.651  32.311 1.00 36.42 ? 119 ASN A CB   1 
ATOM   591  C  CG   . ASN A 1 82  ? 1.849  10.284  32.837 1.00 40.60 ? 119 ASN A CG   1 
ATOM   592  O  OD1  . ASN A 1 82  ? 2.701  9.627   33.448 1.00 41.46 ? 119 ASN A OD1  1 
ATOM   593  N  ND2  . ASN A 1 82  ? 0.603  9.833   32.610 1.00 42.96 ? 119 ASN A ND2  1 
ATOM   594  N  N    . HIS A 1 83  ? 4.758  10.288  30.051 1.00 29.97 ? 120 HIS A N    1 
ATOM   595  C  CA   . HIS A 1 83  ? 4.888  9.371   28.933 1.00 27.29 ? 120 HIS A CA   1 
ATOM   596  C  C    . HIS A 1 83  ? 6.114  8.494   29.076 1.00 26.30 ? 120 HIS A C    1 
ATOM   597  O  O    . HIS A 1 83  ? 7.159  8.950   29.521 1.00 25.30 ? 120 HIS A O    1 
ATOM   598  C  CB   . HIS A 1 83  ? 4.949  10.207  27.663 1.00 25.53 ? 120 HIS A CB   1 
ATOM   599  C  CG   . HIS A 1 83  ? 4.726  9.421   26.420 1.00 26.21 ? 120 HIS A CG   1 
ATOM   600  N  ND1  . HIS A 1 83  ? 5.667  8.554   25.916 1.00 26.99 ? 120 HIS A ND1  1 
ATOM   601  C  CD2  . HIS A 1 83  ? 3.636  9.301   25.628 1.00 26.82 ? 120 HIS A CD2  1 
ATOM   602  C  CE1  . HIS A 1 83  ? 5.164  7.924   24.868 1.00 27.94 ? 120 HIS A CE1  1 
ATOM   603  N  NE2  . HIS A 1 83  ? 3.934  8.359   24.672 1.00 27.99 ? 120 HIS A NE2  1 
ATOM   604  N  N    . LYS A 1 84  ? 5.991  7.236   28.675 1.00 25.74 ? 121 LYS A N    1 
ATOM   605  C  CA   . LYS A 1 84  ? 7.094  6.308   28.853 1.00 25.04 ? 121 LYS A CA   1 
ATOM   606  C  C    . LYS A 1 84  ? 8.342  6.622   28.024 1.00 24.31 ? 121 LYS A C    1 
ATOM   607  O  O    . LYS A 1 84  ? 9.419  6.101   28.316 1.00 22.74 ? 121 LYS A O    1 
ATOM   608  C  CB   . LYS A 1 84  ? 6.631  4.879   28.572 1.00 23.92 ? 121 LYS A CB   1 
ATOM   609  C  CG   . LYS A 1 84  ? 6.259  4.632   27.143 1.00 26.30 ? 121 LYS A CG   1 
ATOM   610  C  CD   . LYS A 1 84  ? 6.099  3.145   26.908 1.00 29.42 ? 121 LYS A CD   1 
ATOM   611  C  CE   . LYS A 1 84  ? 5.017  2.846   25.883 1.00 29.39 ? 121 LYS A CE   1 
ATOM   612  N  NZ   . LYS A 1 84  ? 4.819  1.347   25.743 1.00 30.72 ? 121 LYS A NZ   1 
ATOM   613  N  N    . ASN A 1 85  ? 8.198  7.473   27.010 1.00 22.60 ? 122 ASN A N    1 
ATOM   614  C  CA   . ASN A 1 85  ? 9.313  7.827   26.168 1.00 20.92 ? 122 ASN A CA   1 
ATOM   615  C  C    . ASN A 1 85  ? 9.917  9.172   26.536 1.00 20.84 ? 122 ASN A C    1 
ATOM   616  O  O    . ASN A 1 85  ? 10.764 9.702   25.814 1.00 20.73 ? 122 ASN A O    1 
ATOM   617  C  CB   . ASN A 1 85  ? 8.877  7.811   24.703 1.00 19.09 ? 122 ASN A CB   1 
ATOM   618  C  CG   . ASN A 1 85  ? 8.543  6.418   24.214 1.00 18.46 ? 122 ASN A CG   1 
ATOM   619  O  OD1  . ASN A 1 85  ? 7.567  6.226   23.493 1.00 19.16 ? 122 ASN A OD1  1 
ATOM   620  N  ND2  . ASN A 1 85  ? 9.338  5.440   24.615 1.00 17.61 ? 122 ASN A ND2  1 
ATOM   621  N  N    . ILE A 1 86  ? 9.492  9.702   27.676 1.00 20.51 ? 123 ILE A N    1 
ATOM   622  C  CA   . ILE A 1 86  ? 9.964  10.990  28.175 1.00 21.34 ? 123 ILE A CA   1 
ATOM   623  C  C    . ILE A 1 86  ? 10.436 10.757  29.601 1.00 22.18 ? 123 ILE A C    1 
ATOM   624  O  O    . ILE A 1 86  ? 9.840  9.970   30.329 1.00 19.99 ? 123 ILE A O    1 
ATOM   625  C  CB   . ILE A 1 86  ? 8.833  12.054  28.229 1.00 23.28 ? 123 ILE A CB   1 
ATOM   626  C  CG1  . ILE A 1 86  ? 8.260  12.303  26.840 1.00 23.39 ? 123 ILE A CG1  1 
ATOM   627  C  CG2  . ILE A 1 86  ? 9.365  13.358  28.837 1.00 23.71 ? 123 ILE A CG2  1 
ATOM   628  C  CD1  . ILE A 1 86  ? 9.264  12.801  25.803 1.00 24.08 ? 123 ILE A CD1  1 
ATOM   629  N  N    . ILE A 1 87  ? 11.518 11.427  29.991 1.00 21.56 ? 124 ILE A N    1 
ATOM   630  C  CA   . ILE A 1 87  ? 12.047 11.269  31.331 1.00 21.50 ? 124 ILE A CA   1 
ATOM   631  C  C    . ILE A 1 87  ? 10.991 11.532  32.397 1.00 21.78 ? 124 ILE A C    1 
ATOM   632  O  O    . ILE A 1 87  ? 10.184 12.450  32.268 1.00 20.41 ? 124 ILE A O    1 
ATOM   633  C  CB   . ILE A 1 87  ? 13.239 12.246  31.582 1.00 20.82 ? 124 ILE A CB   1 
ATOM   634  C  CG1  . ILE A 1 87  ? 13.777 12.065  32.998 1.00 23.39 ? 124 ILE A CG1  1 
ATOM   635  C  CG2  . ILE A 1 87  ? 12.805 13.684  31.390 1.00 16.90 ? 124 ILE A CG2  1 
ATOM   636  C  CD1  . ILE A 1 87  ? 14.857 13.072  33.392 1.00 25.48 ? 124 ILE A CD1  1 
ATOM   637  N  N    . SER A 1 88  ? 10.992 10.711  33.447 1.00 24.13 ? 125 SER A N    1 
ATOM   638  C  CA   . SER A 1 88  ? 10.098 10.934  34.591 1.00 25.29 ? 125 SER A CA   1 
ATOM   639  C  C    . SER A 1 88  ? 10.941 10.716  35.833 1.00 25.04 ? 125 SER A C    1 
ATOM   640  O  O    . SER A 1 88  ? 11.700 9.766   35.911 1.00 25.06 ? 125 SER A O    1 
ATOM   641  C  CB   . SER A 1 88  ? 8.902  9.984   34.602 1.00 24.55 ? 125 SER A CB   1 
ATOM   642  O  OG   . SER A 1 88  ? 9.301  8.689   34.251 1.00 29.35 ? 125 SER A OG   1 
ATOM   643  N  N    . LEU A 1 89  ? 10.810 11.613  36.801 1.00 25.00 ? 126 LEU A N    1 
ATOM   644  C  CA   . LEU A 1 89  ? 11.575 11.519  38.023 1.00 24.24 ? 126 LEU A CA   1 
ATOM   645  C  C    . LEU A 1 89  ? 11.011 10.527  39.039 1.00 24.47 ? 126 LEU A C    1 
ATOM   646  O  O    . LEU A 1 89  ? 9.788  10.366  39.182 1.00 22.35 ? 126 LEU A O    1 
ATOM   647  C  CB   . LEU A 1 89  ? 11.661 12.893  38.677 1.00 26.72 ? 126 LEU A CB   1 
ATOM   648  C  CG   . LEU A 1 89  ? 12.400 13.973  37.904 1.00 27.38 ? 126 LEU A CG   1 
ATOM   649  C  CD1  . LEU A 1 89  ? 12.103 15.293  38.563 1.00 27.72 ? 126 LEU A CD1  1 
ATOM   650  C  CD2  . LEU A 1 89  ? 13.888 13.713  37.913 1.00 28.24 ? 126 LEU A CD2  1 
ATOM   651  N  N    . LEU A 1 90  ? 11.931 9.886   39.754 1.00 24.46 ? 127 LEU A N    1 
ATOM   652  C  CA   . LEU A 1 90  ? 11.614 8.932   40.812 1.00 24.16 ? 127 LEU A CA   1 
ATOM   653  C  C    . LEU A 1 90  ? 11.747 9.706   42.123 1.00 24.66 ? 127 LEU A C    1 
ATOM   654  O  O    . LEU A 1 90  ? 11.038 9.453   43.099 1.00 26.72 ? 127 LEU A O    1 
ATOM   655  C  CB   . LEU A 1 90  ? 12.638 7.807   40.795 1.00 24.34 ? 127 LEU A CB   1 
ATOM   656  C  CG   . LEU A 1 90  ? 12.269 6.371   40.390 1.00 26.25 ? 127 LEU A CG   1 
ATOM   657  C  CD1  . LEU A 1 90  ? 11.102 6.349   39.423 1.00 24.03 ? 127 LEU A CD1  1 
ATOM   658  C  CD2  . LEU A 1 90  ? 13.517 5.700   39.817 1.00 21.43 ? 127 LEU A CD2  1 
ATOM   659  N  N    . ASN A 1 91  ? 12.656 10.668  42.126 1.00 23.90 ? 128 ASN A N    1 
ATOM   660  C  CA   . ASN A 1 91  ? 12.927 11.451  43.322 1.00 24.14 ? 128 ASN A CA   1 
ATOM   661  C  C    . ASN A 1 91  ? 13.728 12.718  42.978 1.00 24.42 ? 128 ASN A C    1 
ATOM   662  O  O    . ASN A 1 91  ? 14.440 12.789  41.969 1.00 24.64 ? 128 ASN A O    1 
ATOM   663  C  CB   . ASN A 1 91  ? 13.733 10.586  44.317 1.00 21.11 ? 128 ASN A CB   1 
ATOM   664  C  CG   . ASN A 1 91  ? 13.516 10.991  45.783 1.00 21.81 ? 128 ASN A CG   1 
ATOM   665  O  OD1  . ASN A 1 91  ? 12.893 12.012  46.074 1.00 23.27 ? 128 ASN A OD1  1 
ATOM   666  N  ND2  . ASN A 1 91  ? 14.038 10.185  46.708 1.00 21.49 ? 128 ASN A ND2  1 
ATOM   667  N  N    . VAL A 1 92  ? 13.586 13.721  43.827 1.00 24.51 ? 129 VAL A N    1 
ATOM   668  C  CA   . VAL A 1 92  ? 14.304 14.977  43.681 1.00 25.20 ? 129 VAL A CA   1 
ATOM   669  C  C    . VAL A 1 92  ? 14.507 15.412  45.112 1.00 24.02 ? 129 VAL A C    1 
ATOM   670  O  O    . VAL A 1 92  ? 13.588 15.324  45.926 1.00 23.15 ? 129 VAL A O    1 
ATOM   671  C  CB   . VAL A 1 92  ? 13.479 16.051  42.906 1.00 27.23 ? 129 VAL A CB   1 
ATOM   672  C  CG1  . VAL A 1 92  ? 12.060 16.037  43.382 1.00 29.00 ? 129 VAL A CG1  1 
ATOM   673  C  CG2  . VAL A 1 92  ? 14.079 17.458  43.142 1.00 27.74 ? 129 VAL A CG2  1 
ATOM   674  N  N    . PHE A 1 93  ? 15.711 15.856  45.441 1.00 21.78 ? 130 PHE A N    1 
ATOM   675  C  CA   . PHE A 1 93  ? 15.934 16.257  46.802 1.00 20.57 ? 130 PHE A CA   1 
ATOM   676  C  C    . PHE A 1 93  ? 17.124 17.159  46.939 1.00 20.33 ? 130 PHE A C    1 
ATOM   677  O  O    . PHE A 1 93  ? 17.934 17.254  46.037 1.00 21.13 ? 130 PHE A O    1 
ATOM   678  C  CB   . PHE A 1 93  ? 16.130 15.002  47.670 1.00 19.32 ? 130 PHE A CB   1 
ATOM   679  C  CG   . PHE A 1 93  ? 17.411 14.249  47.379 1.00 18.12 ? 130 PHE A CG   1 
ATOM   680  C  CD1  . PHE A 1 93  ? 18.631 14.708  47.870 1.00 15.41 ? 130 PHE A CD1  1 
ATOM   681  C  CD2  . PHE A 1 93  ? 17.396 13.071  46.628 1.00 16.21 ? 130 PHE A CD2  1 
ATOM   682  C  CE1  . PHE A 1 93  ? 19.819 14.003  47.615 1.00 16.66 ? 130 PHE A CE1  1 
ATOM   683  C  CE2  . PHE A 1 93  ? 18.573 12.363  46.372 1.00 15.93 ? 130 PHE A CE2  1 
ATOM   684  C  CZ   . PHE A 1 93  ? 19.789 12.818  46.860 1.00 15.90 ? 130 PHE A CZ   1 
ATOM   685  N  N    . THR A 1 94  ? 17.224 17.813  48.093 1.00 22.49 ? 131 THR A N    1 
ATOM   686  C  CA   . THR A 1 94  ? 18.349 18.670  48.404 1.00 23.05 ? 131 THR A CA   1 
ATOM   687  C  C    . THR A 1 94  ? 18.767 18.351  49.825 1.00 24.77 ? 131 THR A C    1 
ATOM   688  O  O    . THR A 1 94  ? 17.915 18.261  50.716 1.00 23.27 ? 131 THR A O    1 
ATOM   689  C  CB   . THR A 1 94  ? 17.980 20.177  48.298 1.00 24.98 ? 131 THR A CB   1 
ATOM   690  O  OG1  . THR A 1 94  ? 19.090 20.966  48.724 1.00 25.27 ? 131 THR A OG1  1 
ATOM   691  C  CG2  . THR A 1 94  ? 16.793 20.526  49.174 1.00 25.46 ? 131 THR A CG2  1 
ATOM   692  N  N    . PRO A 1 95  ? 20.081 18.150  50.052 1.00 26.24 ? 132 PRO A N    1 
ATOM   693  C  CA   . PRO A 1 95  ? 20.634 17.846  51.381 1.00 26.21 ? 132 PRO A CA   1 
ATOM   694  C  C    . PRO A 1 95  ? 20.543 19.072  52.296 1.00 27.52 ? 132 PRO A C    1 
ATOM   695  O  O    . PRO A 1 95  ? 20.526 18.921  53.505 1.00 29.27 ? 132 PRO A O    1 
ATOM   696  C  CB   . PRO A 1 95  ? 22.102 17.502  51.100 1.00 25.74 ? 132 PRO A CB   1 
ATOM   697  C  CG   . PRO A 1 95  ? 22.161 17.237  49.648 1.00 25.03 ? 132 PRO A CG   1 
ATOM   698  C  CD   . PRO A 1 95  ? 21.146 18.139  49.034 1.00 26.37 ? 132 PRO A CD   1 
ATOM   699  N  N    . GLN A 1 96  ? 20.496 20.275  51.720 1.00 27.49 ? 133 GLN A N    1 
ATOM   700  C  CA   . GLN A 1 96  ? 20.420 21.509  52.504 1.00 28.87 ? 133 GLN A CA   1 
ATOM   701  C  C    . GLN A 1 96  ? 19.049 21.763  53.095 1.00 29.65 ? 133 GLN A C    1 
ATOM   702  O  O    . GLN A 1 96  ? 18.036 21.657  52.409 1.00 26.97 ? 133 GLN A O    1 
ATOM   703  C  CB   . GLN A 1 96  ? 20.840 22.720  51.671 1.00 29.02 ? 133 GLN A CB   1 
ATOM   704  C  CG   . GLN A 1 96  ? 22.319 22.717  51.274 1.00 27.50 ? 133 GLN A CG   1 
ATOM   705  C  CD   . GLN A 1 96  ? 22.597 21.897  50.018 1.00 28.31 ? 133 GLN A CD   1 
ATOM   706  O  OE1  . GLN A 1 96  ? 21.843 21.956  49.052 1.00 25.64 ? 133 GLN A OE1  1 
ATOM   707  N  NE2  . GLN A 1 96  ? 23.700 21.148  50.020 1.00 27.84 ? 133 GLN A NE2  1 
ATOM   708  N  N    . LYS A 1 97  ? 19.046 22.179  54.362 1.00 31.71 ? 134 LYS A N    1 
ATOM   709  C  CA   . LYS A 1 97  ? 17.822 22.380  55.123 1.00 33.04 ? 134 LYS A CA   1 
ATOM   710  C  C    . LYS A 1 97  ? 17.082 23.692  54.998 1.00 32.23 ? 134 LYS A C    1 
ATOM   711  O  O    . LYS A 1 97  ? 15.892 23.758  55.291 1.00 33.41 ? 134 LYS A O    1 
ATOM   712  C  CB   . LYS A 1 97  ? 18.129 22.101  56.590 1.00 36.08 ? 134 LYS A CB   1 
ATOM   713  C  CG   . LYS A 1 97  ? 18.948 20.829  56.812 1.00 40.21 ? 134 LYS A CG   1 
ATOM   714  C  CD   . LYS A 1 97  ? 19.898 20.971  58.025 1.00 44.58 ? 134 LYS A CD   1 
ATOM   715  C  CE   . LYS A 1 97  ? 20.618 19.648  58.356 1.00 46.81 ? 134 LYS A CE   1 
ATOM   716  N  NZ   . LYS A 1 97  ? 21.572 19.738  59.520 1.00 47.93 ? 134 LYS A NZ   1 
ATOM   717  N  N    . THR A 1 98  ? 17.763 24.749  54.592 1.00 32.55 ? 135 THR A N    1 
ATOM   718  C  CA   . THR A 1 98  ? 17.078 26.032  54.435 1.00 31.12 ? 135 THR A CA   1 
ATOM   719  C  C    . THR A 1 98  ? 17.488 26.724  53.147 1.00 31.16 ? 135 THR A C    1 
ATOM   720  O  O    . THR A 1 98  ? 18.528 26.413  52.573 1.00 29.90 ? 135 THR A O    1 
ATOM   721  C  CB   . THR A 1 98  ? 17.388 26.996  55.597 1.00 31.35 ? 135 THR A CB   1 
ATOM   722  O  OG1  . THR A 1 98  ? 18.776 27.363  55.557 1.00 30.26 ? 135 THR A OG1  1 
ATOM   723  C  CG2  . THR A 1 98  ? 17.068 26.338  56.935 1.00 32.18 ? 135 THR A CG2  1 
ATOM   724  N  N    . LEU A 1 99  ? 16.677 27.688  52.725 1.00 30.89 ? 136 LEU A N    1 
ATOM   725  C  CA   . LEU A 1 99  ? 16.939 28.448  51.520 1.00 31.91 ? 136 LEU A CA   1 
ATOM   726  C  C    . LEU A 1 99  ? 18.311 29.118  51.587 1.00 33.41 ? 136 LEU A C    1 
ATOM   727  O  O    . LEU A 1 99  ? 19.067 29.145  50.602 1.00 32.67 ? 136 LEU A O    1 
ATOM   728  C  CB   . LEU A 1 99  ? 15.843 29.497  51.321 1.00 31.72 ? 136 LEU A CB   1 
ATOM   729  C  CG   . LEU A 1 99  ? 16.029 30.512  50.187 1.00 31.93 ? 136 LEU A CG   1 
ATOM   730  C  CD1  . LEU A 1 99  ? 16.209 29.795  48.867 1.00 31.78 ? 136 LEU A CD1  1 
ATOM   731  C  CD2  . LEU A 1 99  ? 14.811 31.449  50.133 1.00 32.29 ? 136 LEU A CD2  1 
ATOM   732  N  N    . GLU A 1 100 ? 18.638 29.651  52.758 1.00 35.10 ? 137 GLU A N    1 
ATOM   733  C  CA   . GLU A 1 100 ? 19.922 30.320  52.959 1.00 35.99 ? 137 GLU A CA   1 
ATOM   734  C  C    . GLU A 1 100 ? 21.054 29.360  52.641 1.00 34.59 ? 137 GLU A C    1 
ATOM   735  O  O    . GLU A 1 100 ? 21.972 29.705  51.907 1.00 35.13 ? 137 GLU A O    1 
ATOM   736  C  CB   . GLU A 1 100 ? 20.038 30.815  54.411 1.00 36.50 ? 137 GLU A CB   1 
ATOM   737  C  CG   . GLU A 1 100 ? 19.164 32.021  54.723 1.00 39.93 ? 137 GLU A CG   1 
ATOM   738  C  CD   . GLU A 1 100 ? 17.727 31.844  54.256 1.00 41.68 ? 137 GLU A CD   1 
ATOM   739  O  OE1  . GLU A 1 100 ? 17.050 30.910  54.751 1.00 41.27 ? 137 GLU A OE1  1 
ATOM   740  O  OE2  . GLU A 1 100 ? 17.282 32.636  53.384 1.00 42.94 ? 137 GLU A OE2  1 
ATOM   741  N  N    . GLU A 1 101 ? 20.953 28.153  53.192 1.00 34.29 ? 138 GLU A N    1 
ATOM   742  C  CA   . GLU A 1 101 ? 21.945 27.099  53.015 1.00 33.90 ? 138 GLU A CA   1 
ATOM   743  C  C    . GLU A 1 101 ? 21.891 26.370  51.671 1.00 31.93 ? 138 GLU A C    1 
ATOM   744  O  O    . GLU A 1 101 ? 22.850 25.689  51.305 1.00 32.63 ? 138 GLU A O    1 
ATOM   745  C  CB   . GLU A 1 101 ? 21.793 26.071  54.130 1.00 34.75 ? 138 GLU A CB   1 
ATOM   746  C  CG   . GLU A 1 101 ? 21.628 26.677  55.506 1.00 38.18 ? 138 GLU A CG   1 
ATOM   747  C  CD   . GLU A 1 101 ? 21.211 25.635  56.522 1.00 41.53 ? 138 GLU A CD   1 
ATOM   748  O  OE1  . GLU A 1 101 ? 22.048 24.760  56.854 1.00 43.02 ? 138 GLU A OE1  1 
ATOM   749  O  OE2  . GLU A 1 101 ? 20.040 25.676  56.972 1.00 41.98 ? 138 GLU A OE2  1 
ATOM   750  N  N    . PHE A 1 102 ? 20.783 26.521  50.949 1.00 30.52 ? 139 PHE A N    1 
ATOM   751  C  CA   . PHE A 1 102 ? 20.552 25.870  49.648 1.00 29.97 ? 139 PHE A CA   1 
ATOM   752  C  C    . PHE A 1 102 ? 21.676 25.993  48.617 1.00 30.31 ? 139 PHE A C    1 
ATOM   753  O  O    . PHE A 1 102 ? 22.118 27.093  48.274 1.00 30.71 ? 139 PHE A O    1 
ATOM   754  C  CB   . PHE A 1 102 ? 19.236 26.401  49.047 1.00 28.49 ? 139 PHE A CB   1 
ATOM   755  C  CG   . PHE A 1 102 ? 18.817 25.728  47.758 1.00 26.72 ? 139 PHE A CG   1 
ATOM   756  C  CD1  . PHE A 1 102 ? 18.754 24.342  47.657 1.00 25.29 ? 139 PHE A CD1  1 
ATOM   757  C  CD2  . PHE A 1 102 ? 18.464 26.490  46.648 1.00 26.90 ? 139 PHE A CD2  1 
ATOM   758  C  CE1  . PHE A 1 102 ? 18.349 23.727  46.472 1.00 24.70 ? 139 PHE A CE1  1 
ATOM   759  C  CE2  . PHE A 1 102 ? 18.054 25.883  45.453 1.00 24.79 ? 139 PHE A CE2  1 
ATOM   760  C  CZ   . PHE A 1 102 ? 18.001 24.500  45.371 1.00 25.04 ? 139 PHE A CZ   1 
ATOM   761  N  N    . GLN A 1 103 ? 22.132 24.856  48.107 1.00 31.21 ? 140 GLN A N    1 
ATOM   762  C  CA   . GLN A 1 103 ? 23.200 24.860  47.113 1.00 30.77 ? 140 GLN A CA   1 
ATOM   763  C  C    . GLN A 1 103 ? 23.019 23.895  45.942 1.00 29.27 ? 140 GLN A C    1 
ATOM   764  O  O    . GLN A 1 103 ? 23.174 24.282  44.786 1.00 29.12 ? 140 GLN A O    1 
ATOM   765  C  CB   . GLN A 1 103 ? 24.533 24.544  47.786 1.00 33.33 ? 140 GLN A CB   1 
ATOM   766  C  CG   . GLN A 1 103 ? 25.305 25.751  48.280 1.00 39.94 ? 140 GLN A CG   1 
ATOM   767  C  CD   . GLN A 1 103 ? 26.764 25.398  48.526 1.00 41.99 ? 140 GLN A CD   1 
ATOM   768  O  OE1  . GLN A 1 103 ? 27.081 24.640  49.444 1.00 43.75 ? 140 GLN A OE1  1 
ATOM   769  N  NE2  . GLN A 1 103 ? 27.658 25.935  47.693 1.00 43.37 ? 140 GLN A NE2  1 
ATOM   770  N  N    . ASP A 1 104 ? 22.697 22.638  46.247 1.00 26.92 ? 141 ASP A N    1 
ATOM   771  C  CA   . ASP A 1 104 ? 22.570 21.609  45.220 1.00 24.94 ? 141 ASP A CA   1 
ATOM   772  C  C    . ASP A 1 104 ? 21.238 20.884  45.168 1.00 24.81 ? 141 ASP A C    1 
ATOM   773  O  O    . ASP A 1 104 ? 20.582 20.706  46.185 1.00 25.20 ? 141 ASP A O    1 
ATOM   774  C  CB   . ASP A 1 104 ? 23.669 20.569  45.415 1.00 23.90 ? 141 ASP A CB   1 
ATOM   775  C  CG   . ASP A 1 104 ? 25.011 21.201  45.737 1.00 24.46 ? 141 ASP A CG   1 
ATOM   776  O  OD1  . ASP A 1 104 ? 25.372 22.174  45.054 1.00 24.03 ? 141 ASP A OD1  1 
ATOM   777  O  OD2  . ASP A 1 104 ? 25.706 20.731  46.664 1.00 26.65 ? 141 ASP A OD2  1 
ATOM   778  N  N    . VAL A 1 105 ? 20.863 20.453  43.966 1.00 24.28 ? 142 VAL A N    1 
ATOM   779  C  CA   . VAL A 1 105 ? 19.630 19.716  43.740 1.00 23.49 ? 142 VAL A CA   1 
ATOM   780  C  C    . VAL A 1 105 ? 20.020 18.376  43.145 1.00 23.91 ? 142 VAL A C    1 
ATOM   781  O  O    . VAL A 1 105 ? 20.788 18.342  42.181 1.00 24.71 ? 142 VAL A O    1 
ATOM   782  C  CB   . VAL A 1 105 ? 18.729 20.430  42.704 1.00 24.32 ? 142 VAL A CB   1 
ATOM   783  C  CG1  . VAL A 1 105 ? 17.549 19.525  42.307 1.00 22.07 ? 142 VAL A CG1  1 
ATOM   784  C  CG2  . VAL A 1 105 ? 18.252 21.776  43.263 1.00 22.02 ? 142 VAL A CG2  1 
ATOM   785  N  N    . TYR A 1 106 ? 19.499 17.281  43.710 1.00 22.12 ? 143 TYR A N    1 
ATOM   786  C  CA   . TYR A 1 106 ? 19.751 15.921  43.202 1.00 19.48 ? 143 TYR A CA   1 
ATOM   787  C  C    . TYR A 1 106 ? 18.514 15.376  42.507 1.00 18.10 ? 143 TYR A C    1 
ATOM   788  O  O    . TYR A 1 106 ? 17.434 15.383  43.072 1.00 18.20 ? 143 TYR A O    1 
ATOM   789  C  CB   . TYR A 1 106 ? 20.131 14.974  44.345 1.00 18.12 ? 143 TYR A CB   1 
ATOM   790  C  CG   . TYR A 1 106 ? 21.463 15.313  44.923 1.00 16.47 ? 143 TYR A CG   1 
ATOM   791  C  CD1  . TYR A 1 106 ? 22.615 14.672  44.491 1.00 15.11 ? 143 TYR A CD1  1 
ATOM   792  C  CD2  . TYR A 1 106 ? 21.588 16.353  45.837 1.00 17.69 ? 143 TYR A CD2  1 
ATOM   793  C  CE1  . TYR A 1 106 ? 23.872 15.067  44.967 1.00 16.74 ? 143 TYR A CE1  1 
ATOM   794  C  CE2  . TYR A 1 106 ? 22.832 16.756  46.311 1.00 15.38 ? 143 TYR A CE2  1 
ATOM   795  C  CZ   . TYR A 1 106 ? 23.967 16.109  45.878 1.00 16.41 ? 143 TYR A CZ   1 
ATOM   796  O  OH   . TYR A 1 106 ? 25.204 16.493  46.380 1.00 20.34 ? 143 TYR A OH   1 
ATOM   797  N  N    . LEU A 1 107 ? 18.685 14.883  41.291 1.00 16.84 ? 144 LEU A N    1 
ATOM   798  C  CA   . LEU A 1 107 ? 17.570 14.343  40.529 1.00 18.24 ? 144 LEU A CA   1 
ATOM   799  C  C    . LEU A 1 107 ? 17.776 12.845  40.359 1.00 18.31 ? 144 LEU A C    1 
ATOM   800  O  O    . LEU A 1 107 ? 18.885 12.390  40.093 1.00 17.91 ? 144 LEU A O    1 
ATOM   801  C  CB   . LEU A 1 107 ? 17.462 15.024  39.143 1.00 14.29 ? 144 LEU A CB   1 
ATOM   802  C  CG   . LEU A 1 107 ? 17.257 16.547  39.163 1.00 16.87 ? 144 LEU A CG   1 
ATOM   803  C  CD1  . LEU A 1 107 ? 17.242 17.095  37.730 1.00 15.36 ? 144 LEU A CD1  1 
ATOM   804  C  CD2  . LEU A 1 107 ? 15.923 16.874  39.881 1.00 15.04 ? 144 LEU A CD2  1 
ATOM   805  N  N    . VAL A 1 108 ? 16.696 12.080  40.486 1.00 18.83 ? 145 VAL A N    1 
ATOM   806  C  CA   . VAL A 1 108 ? 16.796 10.629  40.381 1.00 16.50 ? 145 VAL A CA   1 
ATOM   807  C  C    . VAL A 1 108 ? 15.810 10.026  39.397 1.00 18.66 ? 145 VAL A C    1 
ATOM   808  O  O    . VAL A 1 108 ? 14.601 10.358  39.392 1.00 18.13 ? 145 VAL A O    1 
ATOM   809  C  CB   . VAL A 1 108 ? 16.552 9.961   41.759 1.00 15.66 ? 145 VAL A CB   1 
ATOM   810  C  CG1  . VAL A 1 108 ? 16.800 8.458   41.676 1.00 14.96 ? 145 VAL A CG1  1 
ATOM   811  C  CG2  . VAL A 1 108 ? 17.455 10.567  42.797 1.00 16.33 ? 145 VAL A CG2  1 
ATOM   812  N  N    . MET A 1 109 ? 16.312 9.124   38.558 1.00 16.35 ? 146 MET A N    1 
ATOM   813  C  CA   . MET A 1 109 ? 15.443 8.447   37.602 1.00 17.21 ? 146 MET A CA   1 
ATOM   814  C  C    . MET A 1 109 ? 15.923 7.024   37.403 1.00 18.56 ? 146 MET A C    1 
ATOM   815  O  O    . MET A 1 109 ? 16.984 6.630   37.906 1.00 20.02 ? 146 MET A O    1 
ATOM   816  C  CB   . MET A 1 109 ? 15.428 9.162   36.242 1.00 18.18 ? 146 MET A CB   1 
ATOM   817  C  CG   . MET A 1 109 ? 16.674 8.966   35.404 1.00 16.50 ? 146 MET A CG   1 
ATOM   818  S  SD   . MET A 1 109 ? 16.481 9.752   33.745 1.00 22.63 ? 146 MET A SD   1 
ATOM   819  C  CE   . MET A 1 109 ? 15.357 8.570   32.976 1.00 16.42 ? 146 MET A CE   1 
ATOM   820  N  N    . GLU A 1 110 ? 15.137 6.258   36.659 1.00 19.47 ? 147 GLU A N    1 
ATOM   821  C  CA   . GLU A 1 110 ? 15.464 4.876   36.346 1.00 20.70 ? 147 GLU A CA   1 
ATOM   822  C  C    . GLU A 1 110 ? 16.762 4.763   35.551 1.00 19.38 ? 147 GLU A C    1 
ATOM   823  O  O    . GLU A 1 110 ? 16.989 5.488   34.569 1.00 17.13 ? 147 GLU A O    1 
ATOM   824  C  CB   . GLU A 1 110 ? 14.296 4.248   35.589 1.00 22.15 ? 147 GLU A CB   1 
ATOM   825  C  CG   . GLU A 1 110 ? 14.621 3.530   34.331 1.00 28.20 ? 147 GLU A CG   1 
ATOM   826  C  CD   . GLU A 1 110 ? 13.459 2.672   33.873 1.00 31.30 ? 147 GLU A CD   1 
ATOM   827  O  OE1  . GLU A 1 110 ? 12.299 3.153   33.918 1.00 34.45 ? 147 GLU A OE1  1 
ATOM   828  O  OE2  . GLU A 1 110 ? 13.709 1.518   33.475 1.00 33.09 ? 147 GLU A OE2  1 
ATOM   829  N  N    . LEU A 1 111 ? 17.615 3.843   35.982 1.00 18.35 ? 148 LEU A N    1 
ATOM   830  C  CA   . LEU A 1 111 ? 18.886 3.664   35.312 1.00 19.59 ? 148 LEU A CA   1 
ATOM   831  C  C    . LEU A 1 111 ? 18.751 3.018   33.931 1.00 19.67 ? 148 LEU A C    1 
ATOM   832  O  O    . LEU A 1 111 ? 18.282 1.890   33.783 1.00 20.69 ? 148 LEU A O    1 
ATOM   833  C  CB   . LEU A 1 111 ? 19.860 2.836   36.177 1.00 18.03 ? 148 LEU A CB   1 
ATOM   834  C  CG   . LEU A 1 111 ? 21.228 2.577   35.525 1.00 20.57 ? 148 LEU A CG   1 
ATOM   835  C  CD1  . LEU A 1 111 ? 22.019 3.877   35.477 1.00 20.20 ? 148 LEU A CD1  1 
ATOM   836  C  CD2  . LEU A 1 111 ? 22.004 1.528   36.296 1.00 19.60 ? 148 LEU A CD2  1 
ATOM   837  N  N    . MET A 1 112 ? 19.211 3.764   32.937 1.00 18.56 ? 149 MET A N    1 
ATOM   838  C  CA   . MET A 1 112 ? 19.202 3.328   31.565 1.00 20.12 ? 149 MET A CA   1 
ATOM   839  C  C    . MET A 1 112 ? 20.597 2.708   31.253 1.00 21.35 ? 149 MET A C    1 
ATOM   840  O  O    . MET A 1 112 ? 21.545 2.876   32.024 1.00 20.64 ? 149 MET A O    1 
ATOM   841  C  CB   . MET A 1 112 ? 18.858 4.515   30.664 1.00 17.76 ? 149 MET A CB   1 
ATOM   842  C  CG   . MET A 1 112 ? 17.542 5.174   31.043 1.00 16.08 ? 149 MET A CG   1 
ATOM   843  S  SD   . MET A 1 112 ? 16.182 4.033   30.714 1.00 19.11 ? 149 MET A SD   1 
ATOM   844  C  CE   . MET A 1 112 ? 16.112 4.192   28.903 1.00 14.95 ? 149 MET A CE   1 
ATOM   845  N  N    . ASP A 1 113 ? 20.693 1.972   30.146 1.00 22.37 ? 150 ASP A N    1 
ATOM   846  C  CA   . ASP A 1 113 ? 21.917 1.272   29.778 1.00 23.41 ? 150 ASP A CA   1 
ATOM   847  C  C    . ASP A 1 113 ? 22.889 1.956   28.861 1.00 24.51 ? 150 ASP A C    1 
ATOM   848  O  O    . ASP A 1 113 ? 24.088 1.642   28.892 1.00 22.76 ? 150 ASP A O    1 
ATOM   849  C  CB   . ASP A 1 113 ? 21.575 -0.092  29.167 1.00 25.73 ? 150 ASP A CB   1 
ATOM   850  C  CG   . ASP A 1 113 ? 20.814 -0.989  30.131 1.00 27.35 ? 150 ASP A CG   1 
ATOM   851  O  OD1  . ASP A 1 113 ? 21.215 -1.041  31.307 1.00 29.50 ? 150 ASP A OD1  1 
ATOM   852  O  OD2  . ASP A 1 113 ? 19.826 -1.643  29.718 1.00 29.14 ? 150 ASP A OD2  1 
ATOM   853  N  N    . ALA A 1 114 ? 22.397 2.868   28.022 1.00 22.96 ? 151 ALA A N    1 
ATOM   854  C  CA   . ALA A 1 114 ? 23.293 3.527   27.093 1.00 21.43 ? 151 ALA A CA   1 
ATOM   855  C  C    . ALA A 1 114 ? 22.635 4.738   26.461 1.00 19.84 ? 151 ALA A C    1 
ATOM   856  O  O    . ALA A 1 114 ? 21.405 4.870   26.468 1.00 20.15 ? 151 ALA A O    1 
ATOM   857  C  CB   . ALA A 1 114 ? 23.715 2.513   26.003 1.00 22.16 ? 151 ALA A CB   1 
ATOM   858  N  N    . ASN A 1 115 ? 23.451 5.647   25.947 1.00 18.22 ? 152 ASN A N    1 
ATOM   859  C  CA   . ASN A 1 115 ? 22.889 6.799   25.269 1.00 18.62 ? 152 ASN A CA   1 
ATOM   860  C  C    . ASN A 1 115 ? 22.831 6.489   23.764 1.00 17.99 ? 152 ASN A C    1 
ATOM   861  O  O    . ASN A 1 115 ? 23.336 5.458   23.324 1.00 18.03 ? 152 ASN A O    1 
ATOM   862  C  CB   . ASN A 1 115 ? 23.681 8.072   25.568 1.00 18.81 ? 152 ASN A CB   1 
ATOM   863  C  CG   . ASN A 1 115 ? 25.050 8.069   24.943 1.00 22.45 ? 152 ASN A CG   1 
ATOM   864  O  OD1  . ASN A 1 115 ? 25.352 7.249   24.066 1.00 22.97 ? 152 ASN A OD1  1 
ATOM   865  N  ND2  . ASN A 1 115 ? 25.881 9.008   25.363 1.00 21.33 ? 152 ASN A ND2  1 
ATOM   866  N  N    . LEU A 1 116 ? 22.212 7.364   22.977 1.00 17.80 ? 153 LEU A N    1 
ATOM   867  C  CA   . LEU A 1 116 ? 22.045 7.103   21.549 1.00 18.27 ? 153 LEU A CA   1 
ATOM   868  C  C    . LEU A 1 116 ? 23.326 7.200   20.737 1.00 19.20 ? 153 LEU A C    1 
ATOM   869  O  O    . LEU A 1 116 ? 23.404 6.633   19.655 1.00 18.71 ? 153 LEU A O    1 
ATOM   870  C  CB   . LEU A 1 116 ? 20.966 8.024   20.959 1.00 17.22 ? 153 LEU A CB   1 
ATOM   871  C  CG   . LEU A 1 116 ? 20.170 7.496   19.755 1.00 19.06 ? 153 LEU A CG   1 
ATOM   872  C  CD1  . LEU A 1 116 ? 19.452 6.226   20.115 1.00 15.73 ? 153 LEU A CD1  1 
ATOM   873  C  CD2  . LEU A 1 116 ? 19.163 8.553   19.307 1.00 17.05 ? 153 LEU A CD2  1 
ATOM   874  N  N    . CYS A 1 117 ? 24.318 7.919   21.249 1.00 17.95 ? 154 CYS A N    1 
ATOM   875  C  CA   . CYS A 1 117 ? 25.591 8.017   20.560 1.00 21.44 ? 154 CYS A CA   1 
ATOM   876  C  C    . CYS A 1 117 ? 26.166 6.605   20.441 1.00 21.17 ? 154 CYS A C    1 
ATOM   877  O  O    . CYS A 1 117 ? 26.674 6.240   19.397 1.00 22.21 ? 154 CYS A O    1 
ATOM   878  C  CB   . CYS A 1 117 ? 26.576 8.881   21.338 1.00 21.16 ? 154 CYS A CB   1 
ATOM   879  S  SG   . CYS A 1 117 ? 26.108 10.589  21.560 1.00 24.86 ? 154 CYS A SG   1 
ATOM   880  N  N    . GLN A 1 118 ? 26.067 5.812   21.504 1.00 21.53 ? 155 GLN A N    1 
ATOM   881  C  CA   . GLN A 1 118 ? 26.588 4.448   21.486 1.00 22.31 ? 155 GLN A CA   1 
ATOM   882  C  C    . GLN A 1 118 ? 25.834 3.578   20.481 1.00 22.68 ? 155 GLN A C    1 
ATOM   883  O  O    . GLN A 1 118 ? 26.424 2.756   19.789 1.00 23.91 ? 155 GLN A O    1 
ATOM   884  C  CB   . GLN A 1 118 ? 26.482 3.835   22.885 1.00 23.24 ? 155 GLN A CB   1 
ATOM   885  C  CG   . GLN A 1 118 ? 27.376 4.493   23.927 1.00 24.10 ? 155 GLN A CG   1 
ATOM   886  C  CD   . GLN A 1 118 ? 27.066 4.015   25.358 1.00 26.44 ? 155 GLN A CD   1 
ATOM   887  O  OE1  . GLN A 1 118 ? 26.451 4.735   26.144 1.00 26.86 ? 155 GLN A OE1  1 
ATOM   888  N  NE2  . GLN A 1 118 ? 27.477 2.795   25.681 1.00 24.60 ? 155 GLN A NE2  1 
ATOM   889  N  N    . VAL A 1 119 ? 24.524 3.780   20.403 1.00 22.08 ? 156 VAL A N    1 
ATOM   890  C  CA   . VAL A 1 119 ? 23.667 3.028   19.503 1.00 22.68 ? 156 VAL A CA   1 
ATOM   891  C  C    . VAL A 1 119 ? 23.986 3.357   18.047 1.00 24.00 ? 156 VAL A C    1 
ATOM   892  O  O    . VAL A 1 119 ? 23.924 2.488   17.180 1.00 26.00 ? 156 VAL A O    1 
ATOM   893  C  CB   . VAL A 1 119 ? 22.167 3.346   19.786 1.00 22.58 ? 156 VAL A CB   1 
ATOM   894  C  CG1  . VAL A 1 119 ? 21.268 2.621   18.778 1.00 23.17 ? 156 VAL A CG1  1 
ATOM   895  C  CG2  . VAL A 1 119 ? 21.806 2.918   21.204 1.00 22.34 ? 156 VAL A CG2  1 
ATOM   896  N  N    . ILE A 1 120 ? 24.302 4.624   17.786 1.00 24.02 ? 157 ILE A N    1 
ATOM   897  C  CA   . ILE A 1 120 ? 24.649 5.104   16.452 1.00 24.55 ? 157 ILE A CA   1 
ATOM   898  C  C    . ILE A 1 120 ? 25.930 4.411   15.984 1.00 25.43 ? 157 ILE A C    1 
ATOM   899  O  O    . ILE A 1 120 ? 26.107 4.123   14.801 1.00 24.64 ? 157 ILE A O    1 
ATOM   900  C  CB   . ILE A 1 120 ? 24.829 6.667   16.488 1.00 22.24 ? 157 ILE A CB   1 
ATOM   901  C  CG1  . ILE A 1 120 ? 23.463 7.346   16.409 1.00 22.98 ? 157 ILE A CG1  1 
ATOM   902  C  CG2  . ILE A 1 120 ? 25.707 7.139   15.369 1.00 23.42 ? 157 ILE A CG2  1 
ATOM   903  C  CD1  . ILE A 1 120 ? 23.432 8.779   16.954 1.00 18.82 ? 157 ILE A CD1  1 
ATOM   904  N  N    . GLN A 1 121 ? 26.822 4.142   16.927 1.00 27.94 ? 158 GLN A N    1 
ATOM   905  C  CA   . GLN A 1 121 ? 28.076 3.472   16.605 1.00 31.39 ? 158 GLN A CA   1 
ATOM   906  C  C    . GLN A 1 121 ? 27.862 2.024   16.187 1.00 31.87 ? 158 GLN A C    1 
ATOM   907  O  O    . GLN A 1 121 ? 28.773 1.401   15.660 1.00 34.34 ? 158 GLN A O    1 
ATOM   908  C  CB   . GLN A 1 121 ? 29.014 3.483   17.797 1.00 33.16 ? 158 GLN A CB   1 
ATOM   909  C  CG   . GLN A 1 121 ? 29.960 4.643   17.834 1.00 37.98 ? 158 GLN A CG   1 
ATOM   910  C  CD   . GLN A 1 121 ? 30.718 4.683   19.139 1.00 41.70 ? 158 GLN A CD   1 
ATOM   911  O  OE1  . GLN A 1 121 ? 31.848 5.177   19.209 1.00 46.59 ? 158 GLN A OE1  1 
ATOM   912  N  NE2  . GLN A 1 121 ? 30.093 4.166   20.195 1.00 43.91 ? 158 GLN A NE2  1 
ATOM   913  N  N    . MET A 1 122 ? 26.680 1.469   16.416 1.00 31.39 ? 159 MET A N    1 
ATOM   914  C  CA   . MET A 1 122 ? 26.500 0.090   16.013 1.00 32.83 ? 159 MET A CA   1 
ATOM   915  C  C    . MET A 1 122 ? 25.654 -0.112  14.782 1.00 33.20 ? 159 MET A C    1 
ATOM   916  O  O    . MET A 1 122 ? 24.924 0.779   14.349 1.00 32.64 ? 159 MET A O    1 
ATOM   917  C  CB   . MET A 1 122 ? 25.954 -0.766  17.173 1.00 34.07 ? 159 MET A CB   1 
ATOM   918  C  CG   . MET A 1 122 ? 24.799 -0.179  17.944 1.00 36.83 ? 159 MET A CG   1 
ATOM   919  S  SD   . MET A 1 122 ? 24.360 -1.116  19.452 1.00 38.63 ? 159 MET A SD   1 
ATOM   920  C  CE   . MET A 1 122 ? 25.797 -0.798  20.439 1.00 38.96 ? 159 MET A CE   1 
ATOM   921  N  N    . GLU A 1 123 ? 25.793 -1.290  14.188 1.00 32.37 ? 160 GLU A N    1 
ATOM   922  C  CA   . GLU A 1 123 ? 24.995 -1.647  13.037 1.00 32.86 ? 160 GLU A CA   1 
ATOM   923  C  C    . GLU A 1 123 ? 23.671 -2.119  13.620 1.00 32.75 ? 160 GLU A C    1 
ATOM   924  O  O    . GLU A 1 123 ? 23.643 -2.945  14.528 1.00 33.65 ? 160 GLU A O    1 
ATOM   925  C  CB   . GLU A 1 123 ? 25.667 -2.779  12.283 1.00 34.40 ? 160 GLU A CB   1 
ATOM   926  C  CG   . GLU A 1 123 ? 25.724 -2.569  10.806 1.00 38.87 ? 160 GLU A CG   1 
ATOM   927  C  CD   . GLU A 1 123 ? 26.705 -3.504  10.137 1.00 42.02 ? 160 GLU A CD   1 
ATOM   928  O  OE1  . GLU A 1 123 ? 26.577 -4.729  10.355 1.00 42.20 ? 160 GLU A OE1  1 
ATOM   929  O  OE2  . GLU A 1 123 ? 27.593 -3.014  9.396  1.00 42.83 ? 160 GLU A OE2  1 
ATOM   930  N  N    . LEU A 1 124 ? 22.564 -1.597  13.124 1.00 32.80 ? 161 LEU A N    1 
ATOM   931  C  CA   . LEU A 1 124 ? 21.256 -2.021  13.648 1.00 33.32 ? 161 LEU A CA   1 
ATOM   932  C  C    . LEU A 1 124 ? 20.318 -2.611  12.581 1.00 33.05 ? 161 LEU A C    1 
ATOM   933  O  O    . LEU A 1 124 ? 20.287 -2.168  11.435 1.00 32.54 ? 161 LEU A O    1 
ATOM   934  C  CB   . LEU A 1 124 ? 20.545 -0.836  14.296 1.00 31.95 ? 161 LEU A CB   1 
ATOM   935  C  CG   . LEU A 1 124 ? 21.068 -0.280  15.592 1.00 31.50 ? 161 LEU A CG   1 
ATOM   936  C  CD1  . LEU A 1 124 ? 20.406 1.063   15.838 1.00 30.01 ? 161 LEU A CD1  1 
ATOM   937  C  CD2  . LEU A 1 124 ? 20.784 -1.286  16.708 1.00 31.35 ? 161 LEU A CD2  1 
ATOM   938  N  N    . ASP A 1 125 ? 19.538 -3.602  12.969 1.00 32.87 ? 162 ASP A N    1 
ATOM   939  C  CA   . ASP A 1 125 ? 18.613 -4.157  12.023 1.00 33.12 ? 162 ASP A CA   1 
ATOM   940  C  C    . ASP A 1 125 ? 17.513 -3.097  11.873 1.00 32.53 ? 162 ASP A C    1 
ATOM   941  O  O    . ASP A 1 125 ? 17.496 -2.109  12.612 1.00 31.09 ? 162 ASP A O    1 
ATOM   942  C  CB   . ASP A 1 125 ? 18.031 -5.473  12.532 1.00 34.78 ? 162 ASP A CB   1 
ATOM   943  C  CG   . ASP A 1 125 ? 17.382 -5.333  13.862 1.00 36.70 ? 162 ASP A CG   1 
ATOM   944  O  OD1  . ASP A 1 125 ? 18.075 -5.519  14.880 1.00 38.11 ? 162 ASP A OD1  1 
ATOM   945  O  OD2  . ASP A 1 125 ? 16.174 -5.025  13.897 1.00 39.33 ? 162 ASP A OD2  1 
ATOM   946  N  N    . HIS A 1 126 ? 16.618 -3.304  10.905 1.00 30.21 ? 163 HIS A N    1 
ATOM   947  C  CA   . HIS A 1 126 ? 15.515 -2.394  10.627 1.00 27.96 ? 163 HIS A CA   1 
ATOM   948  C  C    . HIS A 1 126 ? 14.484 -2.375  11.730 1.00 27.22 ? 163 HIS A C    1 
ATOM   949  O  O    . HIS A 1 126 ? 13.862 -1.342  11.994 1.00 25.13 ? 163 HIS A O    1 
ATOM   950  C  CB   . HIS A 1 126 ? 14.847 -2.792  9.321  1.00 25.88 ? 163 HIS A CB   1 
ATOM   951  C  CG   . HIS A 1 126 ? 15.657 -2.447  8.122  1.00 26.51 ? 163 HIS A CG   1 
ATOM   952  N  ND1  . HIS A 1 126 ? 15.928 -1.146  7.764  1.00 26.38 ? 163 HIS A ND1  1 
ATOM   953  C  CD2  . HIS A 1 126 ? 16.287 -3.231  7.213  1.00 26.91 ? 163 HIS A CD2  1 
ATOM   954  C  CE1  . HIS A 1 126 ? 16.696 -1.142  6.688  1.00 27.96 ? 163 HIS A CE1  1 
ATOM   955  N  NE2  . HIS A 1 126 ? 16.927 -2.395  6.335  1.00 26.34 ? 163 HIS A NE2  1 
ATOM   956  N  N    . GLU A 1 127 ? 14.300 -3.532  12.361 1.00 27.50 ? 164 GLU A N    1 
ATOM   957  C  CA   . GLU A 1 127 ? 13.366 -3.659  13.456 1.00 29.12 ? 164 GLU A CA   1 
ATOM   958  C  C    . GLU A 1 127 ? 13.723 -2.749  14.633 1.00 27.97 ? 164 GLU A C    1 
ATOM   959  O  O    . GLU A 1 127 ? 12.850 -2.098  15.219 1.00 26.68 ? 164 GLU A O    1 
ATOM   960  C  CB   . GLU A 1 127 ? 13.305 -5.102  13.940 1.00 32.79 ? 164 GLU A CB   1 
ATOM   961  C  CG   . GLU A 1 127 ? 12.373 -5.236  15.137 1.00 38.60 ? 164 GLU A CG   1 
ATOM   962  C  CD   . GLU A 1 127 ? 12.336 -6.639  15.702 1.00 41.89 ? 164 GLU A CD   1 
ATOM   963  O  OE1  . GLU A 1 127 ? 13.433 -7.241  15.861 1.00 43.09 ? 164 GLU A OE1  1 
ATOM   964  O  OE2  . GLU A 1 127 ? 11.213 -7.129  15.995 1.00 42.10 ? 164 GLU A OE2  1 
ATOM   965  N  N    . ARG A 1 128 ? 15.004 -2.699  14.981 1.00 27.83 ? 165 ARG A N    1 
ATOM   966  C  CA   . ARG A 1 128 ? 15.432 -1.867  16.099 1.00 28.36 ? 165 ARG A CA   1 
ATOM   967  C  C    . ARG A 1 128 ? 15.491 -0.385  15.719 1.00 26.76 ? 165 ARG A C    1 
ATOM   968  O  O    . ARG A 1 128 ? 15.070 0.477   16.494 1.00 24.36 ? 165 ARG A O    1 
ATOM   969  C  CB   . ARG A 1 128 ? 16.789 -2.353  16.623 1.00 32.08 ? 165 ARG A CB   1 
ATOM   970  C  CG   . ARG A 1 128 ? 16.708 -3.731  17.298 1.00 37.49 ? 165 ARG A CG   1 
ATOM   971  C  CD   . ARG A 1 128 ? 17.942 -4.037  18.150 1.00 40.36 ? 165 ARG A CD   1 
ATOM   972  N  NE   . ARG A 1 128 ? 17.777 -5.249  18.954 1.00 44.02 ? 165 ARG A NE   1 
ATOM   973  C  CZ   . ARG A 1 128 ? 17.952 -6.489  18.503 1.00 46.11 ? 165 ARG A CZ   1 
ATOM   974  N  NH1  . ARG A 1 128 ? 18.303 -6.697  17.239 1.00 46.45 ? 165 ARG A NH1  1 
ATOM   975  N  NH2  . ARG A 1 128 ? 17.785 -7.525  19.321 1.00 46.85 ? 165 ARG A NH2  1 
ATOM   976  N  N    . MET A 1 129 ? 15.985 -0.084  14.518 1.00 24.97 ? 166 MET A N    1 
ATOM   977  C  CA   . MET A 1 129 ? 16.069 1.299   14.114 1.00 23.23 ? 166 MET A CA   1 
ATOM   978  C  C    . MET A 1 129 ? 14.677 1.895   14.043 1.00 21.60 ? 166 MET A C    1 
ATOM   979  O  O    . MET A 1 129 ? 14.430 2.969   14.591 1.00 19.15 ? 166 MET A O    1 
ATOM   980  C  CB   . MET A 1 129 ? 16.762 1.448   12.770 1.00 26.75 ? 166 MET A CB   1 
ATOM   981  C  CG   . MET A 1 129 ? 16.925 2.902   12.396 1.00 31.11 ? 166 MET A CG   1 
ATOM   982  S  SD   . MET A 1 129 ? 17.961 3.146   10.981 1.00 39.21 ? 166 MET A SD   1 
ATOM   983  C  CE   . MET A 1 129 ? 19.517 2.252   11.530 1.00 37.89 ? 166 MET A CE   1 
ATOM   984  N  N    . SER A 1 130 ? 13.750 1.200   13.391 1.00 21.33 ? 167 SER A N    1 
ATOM   985  C  CA   . SER A 1 130 ? 12.392 1.737   13.294 1.00 20.90 ? 167 SER A CA   1 
ATOM   986  C  C    . SER A 1 130 ? 11.709 1.810   14.656 1.00 18.93 ? 167 SER A C    1 
ATOM   987  O  O    . SER A 1 130 ? 10.924 2.718   14.896 1.00 22.51 ? 167 SER A O    1 
ATOM   988  C  CB   . SER A 1 130 ? 11.539 0.908   12.307 1.00 19.24 ? 167 SER A CB   1 
ATOM   989  O  OG   . SER A 1 130 ? 11.303 -0.402  12.785 1.00 18.82 ? 167 SER A OG   1 
ATOM   990  N  N    . TYR A 1 131 ? 11.992 0.870   15.555 1.00 19.02 ? 168 TYR A N    1 
ATOM   991  C  CA   . TYR A 1 131 ? 11.358 0.901   16.875 1.00 16.69 ? 168 TYR A CA   1 
ATOM   992  C  C    . TYR A 1 131 ? 11.893 2.123   17.643 1.00 17.86 ? 168 TYR A C    1 
ATOM   993  O  O    . TYR A 1 131 ? 11.130 2.871   18.250 1.00 18.66 ? 168 TYR A O    1 
ATOM   994  C  CB   . TYR A 1 131 ? 11.601 -0.409  17.628 1.00 17.26 ? 168 TYR A CB   1 
ATOM   995  C  CG   . TYR A 1 131 ? 10.867 -0.476  18.960 1.00 19.94 ? 168 TYR A CG   1 
ATOM   996  C  CD1  . TYR A 1 131 ? 9.490  -0.228  19.043 1.00 20.81 ? 168 TYR A CD1  1 
ATOM   997  C  CD2  . TYR A 1 131 ? 11.553 -0.744  20.140 1.00 20.17 ? 168 TYR A CD2  1 
ATOM   998  C  CE1  . TYR A 1 131 ? 8.817  -0.242  20.290 1.00 20.17 ? 168 TYR A CE1  1 
ATOM   999  C  CE2  . TYR A 1 131 ? 10.903 -0.763  21.392 1.00 21.55 ? 168 TYR A CE2  1 
ATOM   1000 C  CZ   . TYR A 1 131 ? 9.525  -0.507  21.455 1.00 23.33 ? 168 TYR A CZ   1 
ATOM   1001 O  OH   . TYR A 1 131 ? 8.885  -0.499  22.679 1.00 20.77 ? 168 TYR A OH   1 
ATOM   1002 N  N    . LEU A 1 132 ? 13.201 2.341   17.592 1.00 17.72 ? 169 LEU A N    1 
ATOM   1003 C  CA   . LEU A 1 132 ? 13.782 3.507   18.211 1.00 18.26 ? 169 LEU A CA   1 
ATOM   1004 C  C    . LEU A 1 132 ? 13.152 4.775   17.625 1.00 19.36 ? 169 LEU A C    1 
ATOM   1005 O  O    . LEU A 1 132 ? 12.675 5.654   18.361 1.00 19.81 ? 169 LEU A O    1 
ATOM   1006 C  CB   . LEU A 1 132 ? 15.293 3.525   17.979 1.00 20.19 ? 169 LEU A CB   1 
ATOM   1007 C  CG   . LEU A 1 132 ? 16.047 2.417   18.680 1.00 17.68 ? 169 LEU A CG   1 
ATOM   1008 C  CD1  . LEU A 1 132 ? 17.533 2.466   18.289 1.00 21.31 ? 169 LEU A CD1  1 
ATOM   1009 C  CD2  . LEU A 1 132 ? 15.880 2.601   20.175 1.00 18.32 ? 169 LEU A CD2  1 
ATOM   1010 N  N    . LEU A 1 133 ? 13.150 4.894   16.301 1.00 20.23 ? 170 LEU A N    1 
ATOM   1011 C  CA   . LEU A 1 133 ? 12.564 6.085   15.682 1.00 18.77 ? 170 LEU A CA   1 
ATOM   1012 C  C    . LEU A 1 133 ? 11.094 6.251   16.108 1.00 19.14 ? 170 LEU A C    1 
ATOM   1013 O  O    . LEU A 1 133 ? 10.642 7.350   16.402 1.00 20.01 ? 170 LEU A O    1 
ATOM   1014 C  CB   . LEU A 1 133 ? 12.669 5.986   14.153 1.00 17.54 ? 170 LEU A CB   1 
ATOM   1015 C  CG   . LEU A 1 133 ? 13.865 6.575   13.376 1.00 20.75 ? 170 LEU A CG   1 
ATOM   1016 C  CD1  . LEU A 1 133 ? 14.673 7.478   14.248 1.00 20.37 ? 170 LEU A CD1  1 
ATOM   1017 C  CD2  . LEU A 1 133 ? 14.724 5.473   12.771 1.00 20.03 ? 170 LEU A CD2  1 
ATOM   1018 N  N    . TYR A 1 134 ? 10.351 5.157   16.138 1.00 18.58 ? 171 TYR A N    1 
ATOM   1019 C  CA   . TYR A 1 134 ? 8.956  5.229   16.533 1.00 20.45 ? 171 TYR A CA   1 
ATOM   1020 C  C    . TYR A 1 134 ? 8.808  5.838   17.950 1.00 20.07 ? 171 TYR A C    1 
ATOM   1021 O  O    . TYR A 1 134 ? 7.862  6.588   18.235 1.00 19.73 ? 171 TYR A O    1 
ATOM   1022 C  CB   . TYR A 1 134 ? 8.346  3.816   16.469 1.00 20.21 ? 171 TYR A CB   1 
ATOM   1023 C  CG   . TYR A 1 134 ? 7.016  3.655   17.181 1.00 23.27 ? 171 TYR A CG   1 
ATOM   1024 C  CD1  . TYR A 1 134 ? 5.846  4.217   16.662 1.00 24.02 ? 171 TYR A CD1  1 
ATOM   1025 C  CD2  . TYR A 1 134 ? 6.931  2.960   18.399 1.00 22.18 ? 171 TYR A CD2  1 
ATOM   1026 C  CE1  . TYR A 1 134 ? 4.615  4.099   17.343 1.00 23.99 ? 171 TYR A CE1  1 
ATOM   1027 C  CE2  . TYR A 1 134 ? 5.713  2.832   19.087 1.00 22.35 ? 171 TYR A CE2  1 
ATOM   1028 C  CZ   . TYR A 1 134 ? 4.558  3.409   18.552 1.00 25.03 ? 171 TYR A CZ   1 
ATOM   1029 O  OH   . TYR A 1 134 ? 3.365  3.306   19.233 1.00 26.02 ? 171 TYR A OH   1 
ATOM   1030 N  N    . GLN A 1 135 ? 9.745  5.510   18.834 1.00 19.33 ? 172 GLN A N    1 
ATOM   1031 C  CA   . GLN A 1 135 ? 9.692  6.012   20.206 1.00 19.33 ? 172 GLN A CA   1 
ATOM   1032 C  C    . GLN A 1 135 ? 10.029 7.470   20.285 1.00 19.95 ? 172 GLN A C    1 
ATOM   1033 O  O    . GLN A 1 135 ? 9.420  8.207   21.053 1.00 20.01 ? 172 GLN A O    1 
ATOM   1034 C  CB   . GLN A 1 135 ? 10.617 5.203   21.101 1.00 17.58 ? 172 GLN A CB   1 
ATOM   1035 C  CG   . GLN A 1 135 ? 10.067 3.823   21.295 1.00 20.21 ? 172 GLN A CG   1 
ATOM   1036 C  CD   . GLN A 1 135 ? 10.960 2.931   22.068 1.00 16.83 ? 172 GLN A CD   1 
ATOM   1037 O  OE1  . GLN A 1 135 ? 10.903 2.876   23.298 1.00 18.75 ? 172 GLN A OE1  1 
ATOM   1038 N  NE2  . GLN A 1 135 ? 11.808 2.204   21.352 1.00 18.84 ? 172 GLN A NE2  1 
ATOM   1039 N  N    . MET A 1 136 ? 11.002 7.896   19.490 1.00 19.74 ? 173 MET A N    1 
ATOM   1040 C  CA   . MET A 1 136 ? 11.371 9.296   19.482 1.00 19.93 ? 173 MET A CA   1 
ATOM   1041 C  C    . MET A 1 136 ? 10.127 10.057  19.057 1.00 19.18 ? 173 MET A C    1 
ATOM   1042 O  O    . MET A 1 136 ? 9.773  11.070  19.644 1.00 20.86 ? 173 MET A O    1 
ATOM   1043 C  CB   . MET A 1 136 ? 12.506 9.524   18.483 1.00 18.59 ? 173 MET A CB   1 
ATOM   1044 C  CG   . MET A 1 136 ? 13.839 9.020   18.989 1.00 21.29 ? 173 MET A CG   1 
ATOM   1045 S  SD   . MET A 1 136 ? 15.149 9.242   17.798 1.00 24.93 ? 173 MET A SD   1 
ATOM   1046 C  CE   . MET A 1 136 ? 15.570 7.582   17.492 1.00 22.75 ? 173 MET A CE   1 
ATOM   1047 N  N    . LEU A 1 137 ? 9.451  9.548   18.037 1.00 20.55 ? 174 LEU A N    1 
ATOM   1048 C  CA   . LEU A 1 137 ? 8.259  10.223  17.522 1.00 21.59 ? 174 LEU A CA   1 
ATOM   1049 C  C    . LEU A 1 137 ? 7.116  10.283  18.523 1.00 22.65 ? 174 LEU A C    1 
ATOM   1050 O  O    . LEU A 1 137 ? 6.456  11.310  18.622 1.00 24.89 ? 174 LEU A O    1 
ATOM   1051 C  CB   . LEU A 1 137 ? 7.792  9.564   16.216 1.00 19.98 ? 174 LEU A CB   1 
ATOM   1052 C  CG   . LEU A 1 137 ? 8.711  9.748   15.010 1.00 18.68 ? 174 LEU A CG   1 
ATOM   1053 C  CD1  . LEU A 1 137 ? 8.315  8.782   13.862 1.00 18.46 ? 174 LEU A CD1  1 
ATOM   1054 C  CD2  . LEU A 1 137 ? 8.638  11.188  14.539 1.00 16.37 ? 174 LEU A CD2  1 
ATOM   1055 N  N    . CYS A 1 138 ? 6.891  9.202   19.273 1.00 22.89 ? 175 CYS A N    1 
ATOM   1056 C  CA   . CYS A 1 138 ? 5.819  9.171   20.265 1.00 22.94 ? 175 CYS A CA   1 
ATOM   1057 C  C    . CYS A 1 138 ? 6.140  10.157  21.389 1.00 23.05 ? 175 CYS A C    1 
ATOM   1058 O  O    . CYS A 1 138 ? 5.257  10.804  21.939 1.00 21.86 ? 175 CYS A O    1 
ATOM   1059 C  CB   . CYS A 1 138 ? 5.657  7.760   20.877 1.00 25.55 ? 175 CYS A CB   1 
ATOM   1060 S  SG   . CYS A 1 138 ? 4.968  6.408   19.815 1.00 29.61 ? 175 CYS A SG   1 
ATOM   1061 N  N    . GLY A 1 139 ? 7.412  10.258  21.754 1.00 22.70 ? 176 GLY A N    1 
ATOM   1062 C  CA   . GLY A 1 139 ? 7.776  11.192  22.804 1.00 21.14 ? 176 GLY A CA   1 
ATOM   1063 C  C    . GLY A 1 139 ? 7.588  12.618  22.319 1.00 22.14 ? 176 GLY A C    1 
ATOM   1064 O  O    . GLY A 1 139 ? 6.977  13.442  22.997 1.00 23.96 ? 176 GLY A O    1 
ATOM   1065 N  N    . ILE A 1 140 ? 8.107  12.912  21.132 1.00 22.34 ? 177 ILE A N    1 
ATOM   1066 C  CA   . ILE A 1 140 ? 8.012  14.248  20.550 1.00 23.51 ? 177 ILE A CA   1 
ATOM   1067 C  C    . ILE A 1 140 ? 6.536  14.656  20.387 1.00 24.71 ? 177 ILE A C    1 
ATOM   1068 O  O    . ILE A 1 140 ? 6.141  15.809  20.628 1.00 22.75 ? 177 ILE A O    1 
ATOM   1069 C  CB   . ILE A 1 140 ? 8.756  14.246  19.202 1.00 23.56 ? 177 ILE A CB   1 
ATOM   1070 C  CG1  . ILE A 1 140 ? 10.248 14.013  19.475 1.00 24.42 ? 177 ILE A CG1  1 
ATOM   1071 C  CG2  . ILE A 1 140 ? 8.540  15.524  18.450 1.00 22.51 ? 177 ILE A CG2  1 
ATOM   1072 C  CD1  . ILE A 1 140 ? 11.011 13.597  18.250 1.00 28.63 ? 177 ILE A CD1  1 
ATOM   1073 N  N    . LYS A 1 141 ? 5.717  13.694  19.990 1.00 26.44 ? 178 LYS A N    1 
ATOM   1074 C  CA   . LYS A 1 141 ? 4.298  13.954  19.811 1.00 28.52 ? 178 LYS A CA   1 
ATOM   1075 C  C    . LYS A 1 141 ? 3.692  14.308  21.162 1.00 28.79 ? 178 LYS A C    1 
ATOM   1076 O  O    . LYS A 1 141 ? 2.844  15.202  21.266 1.00 29.91 ? 178 LYS A O    1 
ATOM   1077 C  CB   . LYS A 1 141 ? 3.631  12.714  19.256 1.00 30.58 ? 178 LYS A CB   1 
ATOM   1078 C  CG   . LYS A 1 141 ? 2.402  13.039  18.497 1.00 36.34 ? 178 LYS A CG   1 
ATOM   1079 C  CD   . LYS A 1 141 ? 1.227  12.393  19.137 1.00 38.30 ? 178 LYS A CD   1 
ATOM   1080 C  CE   . LYS A 1 141 ? 0.026  12.502  18.233 1.00 41.82 ? 178 LYS A CE   1 
ATOM   1081 N  NZ   . LYS A 1 141 ? -1.058 11.690  18.829 1.00 44.12 ? 178 LYS A NZ   1 
ATOM   1082 N  N    . HIS A 1 142 ? 4.131  13.606  22.202 1.00 28.21 ? 179 HIS A N    1 
ATOM   1083 C  CA   . HIS A 1 142 ? 3.631  13.873  23.548 1.00 29.26 ? 179 HIS A CA   1 
ATOM   1084 C  C    . HIS A 1 142 ? 4.015  15.277  24.001 1.00 28.97 ? 179 HIS A C    1 
ATOM   1085 O  O    . HIS A 1 142 ? 3.202  15.991  24.585 1.00 28.53 ? 179 HIS A O    1 
ATOM   1086 C  CB   . HIS A 1 142 ? 4.178  12.865  24.553 1.00 30.92 ? 179 HIS A CB   1 
ATOM   1087 C  CG   . HIS A 1 142 ? 3.492  12.911  25.884 1.00 33.50 ? 179 HIS A CG   1 
ATOM   1088 N  ND1  . HIS A 1 142 ? 2.186  12.503  26.064 1.00 35.71 ? 179 HIS A ND1  1 
ATOM   1089 C  CD2  . HIS A 1 142 ? 3.931  13.307  27.102 1.00 33.72 ? 179 HIS A CD2  1 
ATOM   1090 C  CE1  . HIS A 1 142 ? 1.853  12.641  27.334 1.00 35.22 ? 179 HIS A CE1  1 
ATOM   1091 N  NE2  . HIS A 1 142 ? 2.894  13.128  27.986 1.00 35.64 ? 179 HIS A NE2  1 
ATOM   1092 N  N    . LEU A 1 143 ? 5.260  15.666  23.743 1.00 27.37 ? 180 LEU A N    1 
ATOM   1093 C  CA   . LEU A 1 143 ? 5.706  16.995  24.119 1.00 26.79 ? 180 LEU A CA   1 
ATOM   1094 C  C    . LEU A 1 143 ? 4.900  18.018  23.359 1.00 26.64 ? 180 LEU A C    1 
ATOM   1095 O  O    . LEU A 1 143 ? 4.443  18.993  23.930 1.00 28.08 ? 180 LEU A O    1 
ATOM   1096 C  CB   . LEU A 1 143 ? 7.190  17.186  23.799 1.00 24.12 ? 180 LEU A CB   1 
ATOM   1097 C  CG   . LEU A 1 143 ? 8.137  16.364  24.684 1.00 22.26 ? 180 LEU A CG   1 
ATOM   1098 C  CD1  . LEU A 1 143 ? 9.563  16.598  24.253 1.00 20.34 ? 180 LEU A CD1  1 
ATOM   1099 C  CD2  . LEU A 1 143 ? 7.942  16.736  26.137 1.00 16.82 ? 180 LEU A CD2  1 
ATOM   1100 N  N    . HIS A 1 144 ? 4.729  17.808  22.058 1.00 29.34 ? 181 HIS A N    1 
ATOM   1101 C  CA   . HIS A 1 144 ? 3.961  18.762  21.264 1.00 29.69 ? 181 HIS A CA   1 
ATOM   1102 C  C    . HIS A 1 144 ? 2.568  18.899  21.827 1.00 31.49 ? 181 HIS A C    1 
ATOM   1103 O  O    . HIS A 1 144 ? 2.050  20.004  21.911 1.00 31.32 ? 181 HIS A O    1 
ATOM   1104 C  CB   . HIS A 1 144 ? 3.884  18.328  19.814 1.00 29.28 ? 181 HIS A CB   1 
ATOM   1105 C  CG   . HIS A 1 144 ? 5.186  18.444  19.099 1.00 26.43 ? 181 HIS A CG   1 
ATOM   1106 N  ND1  . HIS A 1 144 ? 5.424  17.835  17.892 1.00 23.79 ? 181 HIS A ND1  1 
ATOM   1107 C  CD2  . HIS A 1 144 ? 6.342  19.062  19.445 1.00 28.27 ? 181 HIS A CD2  1 
ATOM   1108 C  CE1  . HIS A 1 144 ? 6.673  18.064  17.522 1.00 27.65 ? 181 HIS A CE1  1 
ATOM   1109 N  NE2  . HIS A 1 144 ? 7.254  18.807  18.447 1.00 26.58 ? 181 HIS A NE2  1 
ATOM   1110 N  N    . SER A 1 145 ? 1.964  17.785  22.225 1.00 32.47 ? 182 SER A N    1 
ATOM   1111 C  CA   . SER A 1 145 ? 0.625  17.854  22.789 1.00 33.65 ? 182 SER A CA   1 
ATOM   1112 C  C    . SER A 1 145 ? 0.602  18.707  24.063 1.00 33.46 ? 182 SER A C    1 
ATOM   1113 O  O    . SER A 1 145 ? -0.418 19.317  24.398 1.00 33.43 ? 182 SER A O    1 
ATOM   1114 C  CB   . SER A 1 145 ? 0.088  16.447  23.081 1.00 33.53 ? 182 SER A CB   1 
ATOM   1115 O  OG   . SER A 1 145 ? 0.678  15.886  24.247 1.00 34.93 ? 182 SER A OG   1 
ATOM   1116 N  N    . ALA A 1 146 ? 1.723  18.772  24.773 1.00 33.75 ? 183 ALA A N    1 
ATOM   1117 C  CA   . ALA A 1 146 ? 1.754  19.572  25.999 1.00 33.74 ? 183 ALA A CA   1 
ATOM   1118 C  C    . ALA A 1 146 ? 2.226  21.000  25.753 1.00 33.84 ? 183 ALA A C    1 
ATOM   1119 O  O    . ALA A 1 146 ? 2.532  21.721  26.707 1.00 35.23 ? 183 ALA A O    1 
ATOM   1120 C  CB   . ALA A 1 146 ? 2.638  18.901  27.039 1.00 34.07 ? 183 ALA A CB   1 
ATOM   1121 N  N    . GLY A 1 147 ? 2.286  21.401  24.481 1.00 32.45 ? 184 GLY A N    1 
ATOM   1122 C  CA   . GLY A 1 147 ? 2.719  22.744  24.126 1.00 30.97 ? 184 GLY A CA   1 
ATOM   1123 C  C    . GLY A 1 147 ? 4.232  22.936  24.170 1.00 30.43 ? 184 GLY A C    1 
ATOM   1124 O  O    . GLY A 1 147 ? 4.751  24.060  24.169 1.00 30.71 ? 184 GLY A O    1 
ATOM   1125 N  N    . ILE A 1 148 ? 4.955  21.828  24.194 1.00 29.01 ? 185 ILE A N    1 
ATOM   1126 C  CA   . ILE A 1 148 ? 6.415  21.880  24.262 1.00 25.08 ? 185 ILE A CA   1 
ATOM   1127 C  C    . ILE A 1 148 ? 7.033  21.488  22.926 1.00 24.06 ? 185 ILE A C    1 
ATOM   1128 O  O    . ILE A 1 148 ? 6.928  20.340  22.509 1.00 26.21 ? 185 ILE A O    1 
ATOM   1129 C  CB   . ILE A 1 148 ? 6.944  20.904  25.346 1.00 23.59 ? 185 ILE A CB   1 
ATOM   1130 C  CG1  . ILE A 1 148 ? 6.291  21.227  26.691 1.00 23.45 ? 185 ILE A CG1  1 
ATOM   1131 C  CG2  . ILE A 1 148 ? 8.482  20.971  25.437 1.00 22.06 ? 185 ILE A CG2  1 
ATOM   1132 C  CD1  . ILE A 1 148 ? 6.360  20.059  27.698 1.00 21.49 ? 185 ILE A CD1  1 
ATOM   1133 N  N    . ILE A 1 149 ? 7.641  22.448  22.238 1.00 24.36 ? 186 ILE A N    1 
ATOM   1134 C  CA   . ILE A 1 149 ? 8.340  22.172  20.976 1.00 24.79 ? 186 ILE A CA   1 
ATOM   1135 C  C    . ILE A 1 149 ? 9.800  22.164  21.449 1.00 23.83 ? 186 ILE A C    1 
ATOM   1136 O  O    . ILE A 1 149 ? 10.272 23.132  22.038 1.00 24.83 ? 186 ILE A O    1 
ATOM   1137 C  CB   . ILE A 1 149 ? 8.055  23.264  19.928 1.00 24.96 ? 186 ILE A CB   1 
ATOM   1138 C  CG1  . ILE A 1 149 ? 6.543  23.274  19.644 1.00 24.49 ? 186 ILE A CG1  1 
ATOM   1139 C  CG2  . ILE A 1 149 ? 8.790  22.971  18.640 1.00 23.39 ? 186 ILE A CG2  1 
ATOM   1140 C  CD1  . ILE A 1 149 ? 6.137  24.152  18.502 1.00 23.01 ? 186 ILE A CD1  1 
ATOM   1141 N  N    . HIS A 1 150 ? 10.481 21.040  21.249 1.00 23.12 ? 187 HIS A N    1 
ATOM   1142 C  CA   . HIS A 1 150 ? 11.851 20.848  21.744 1.00 21.97 ? 187 HIS A CA   1 
ATOM   1143 C  C    . HIS A 1 150 ? 12.903 21.721  21.096 1.00 21.90 ? 187 HIS A C    1 
ATOM   1144 O  O    . HIS A 1 150 ? 13.522 22.541  21.776 1.00 22.32 ? 187 HIS A O    1 
ATOM   1145 C  CB   . HIS A 1 150 ? 12.210 19.362  21.630 1.00 19.39 ? 187 HIS A CB   1 
ATOM   1146 C  CG   . HIS A 1 150 ? 13.320 18.922  22.529 1.00 17.04 ? 187 HIS A CG   1 
ATOM   1147 N  ND1  . HIS A 1 150 ? 14.630 19.307  22.335 1.00 15.36 ? 187 HIS A ND1  1 
ATOM   1148 C  CD2  . HIS A 1 150 ? 13.333 18.059  23.573 1.00 17.17 ? 187 HIS A CD2  1 
ATOM   1149 C  CE1  . HIS A 1 150 ? 15.402 18.693  23.212 1.00 17.17 ? 187 HIS A CE1  1 
ATOM   1150 N  NE2  . HIS A 1 150 ? 14.642 17.926  23.977 1.00 15.95 ? 187 HIS A NE2  1 
ATOM   1151 N  N    . ARG A 1 151 ? 13.089 21.541  19.788 1.00 23.53 ? 188 ARG A N    1 
ATOM   1152 C  CA   . ARG A 1 151 ? 14.023 22.324  18.985 1.00 23.73 ? 188 ARG A CA   1 
ATOM   1153 C  C    . ARG A 1 151 ? 15.493 22.010  19.189 1.00 23.25 ? 188 ARG A C    1 
ATOM   1154 O  O    . ARG A 1 151 ? 16.353 22.539  18.476 1.00 23.73 ? 188 ARG A O    1 
ATOM   1155 C  CB   . ARG A 1 151 ? 13.786 23.812  19.210 1.00 26.79 ? 188 ARG A CB   1 
ATOM   1156 C  CG   . ARG A 1 151 ? 12.537 24.330  18.519 1.00 33.56 ? 188 ARG A CG   1 
ATOM   1157 C  CD   . ARG A 1 151 ? 11.955 25.479  19.308 1.00 37.51 ? 188 ARG A CD   1 
ATOM   1158 N  NE   . ARG A 1 151 ? 12.930 26.549  19.384 1.00 41.71 ? 188 ARG A NE   1 
ATOM   1159 C  CZ   . ARG A 1 151 ? 12.912 27.512  20.291 1.00 42.77 ? 188 ARG A CZ   1 
ATOM   1160 N  NH1  . ARG A 1 151 ? 11.960 27.537  21.206 1.00 43.83 ? 188 ARG A NH1  1 
ATOM   1161 N  NH2  . ARG A 1 151 ? 13.860 28.438  20.284 1.00 44.65 ? 188 ARG A NH2  1 
ATOM   1162 N  N    . ASP A 1 152 ? 15.806 21.164  20.157 1.00 21.83 ? 189 ASP A N    1 
ATOM   1163 C  CA   . ASP A 1 152 ? 17.204 20.836  20.333 1.00 21.17 ? 189 ASP A CA   1 
ATOM   1164 C  C    . ASP A 1 152 ? 17.443 19.374  20.609 1.00 20.63 ? 189 ASP A C    1 
ATOM   1165 O  O    . ASP A 1 152 ? 18.283 19.020  21.417 1.00 22.35 ? 189 ASP A O    1 
ATOM   1166 C  CB   . ASP A 1 152 ? 17.848 21.705  21.419 1.00 21.26 ? 189 ASP A CB   1 
ATOM   1167 C  CG   . ASP A 1 152 ? 19.382 21.797  21.254 1.00 24.03 ? 189 ASP A CG   1 
ATOM   1168 O  OD1  . ASP A 1 152 ? 19.838 21.611  20.119 1.00 25.46 ? 189 ASP A OD1  1 
ATOM   1169 O  OD2  . ASP A 1 152 ? 20.129 22.061  22.222 1.00 22.96 ? 189 ASP A OD2  1 
ATOM   1170 N  N    . LEU A 1 153 ? 16.732 18.505  19.908 1.00 20.87 ? 190 LEU A N    1 
ATOM   1171 C  CA   . LEU A 1 153 ? 16.932 17.076  20.119 1.00 20.60 ? 190 LEU A CA   1 
ATOM   1172 C  C    . LEU A 1 153 ? 18.310 16.649  19.657 1.00 20.77 ? 190 LEU A C    1 
ATOM   1173 O  O    . LEU A 1 153 ? 18.743 17.037  18.555 1.00 21.57 ? 190 LEU A O    1 
ATOM   1174 C  CB   . LEU A 1 153 ? 15.914 16.282  19.334 1.00 20.57 ? 190 LEU A CB   1 
ATOM   1175 C  CG   . LEU A 1 153 ? 14.556 16.182  19.976 1.00 23.75 ? 190 LEU A CG   1 
ATOM   1176 C  CD1  . LEU A 1 153 ? 13.519 15.819  18.900 1.00 25.23 ? 190 LEU A CD1  1 
ATOM   1177 C  CD2  . LEU A 1 153 ? 14.641 15.157  21.106 1.00 21.44 ? 190 LEU A CD2  1 
ATOM   1178 N  N    . LYS A 1 154 ? 18.983 15.835  20.471 1.00 17.51 ? 191 LYS A N    1 
ATOM   1179 C  CA   . LYS A 1 154 ? 20.297 15.349  20.102 1.00 15.56 ? 191 LYS A CA   1 
ATOM   1180 C  C    . LYS A 1 154 ? 20.552 13.985  20.710 1.00 15.45 ? 191 LYS A C    1 
ATOM   1181 O  O    . LYS A 1 154 ? 20.001 13.639  21.755 1.00 15.92 ? 191 LYS A O    1 
ATOM   1182 C  CB   . LYS A 1 154 ? 21.371 16.342  20.503 1.00 15.68 ? 191 LYS A CB   1 
ATOM   1183 C  CG   . LYS A 1 154 ? 21.554 16.516  21.953 1.00 14.98 ? 191 LYS A CG   1 
ATOM   1184 C  CD   . LYS A 1 154 ? 22.410 17.757  22.202 1.00 20.12 ? 191 LYS A CD   1 
ATOM   1185 C  CE   . LYS A 1 154 ? 21.699 19.017  21.782 1.00 20.73 ? 191 LYS A CE   1 
ATOM   1186 N  NZ   . LYS A 1 154 ? 22.410 20.288  22.215 1.00 23.18 ? 191 LYS A NZ   1 
ATOM   1187 N  N    . PRO A 1 155 ? 21.436 13.195  20.083 1.00 15.19 ? 192 PRO A N    1 
ATOM   1188 C  CA   . PRO A 1 155 ? 21.665 11.863  20.643 1.00 14.63 ? 192 PRO A CA   1 
ATOM   1189 C  C    . PRO A 1 155 ? 22.227 11.782  22.049 1.00 16.88 ? 192 PRO A C    1 
ATOM   1190 O  O    . PRO A 1 155 ? 21.928 10.847  22.771 1.00 18.07 ? 192 PRO A O    1 
ATOM   1191 C  CB   . PRO A 1 155 ? 22.555 11.187  19.598 1.00 11.91 ? 192 PRO A CB   1 
ATOM   1192 C  CG   . PRO A 1 155 ? 22.307 11.979  18.330 1.00 11.55 ? 192 PRO A CG   1 
ATOM   1193 C  CD   . PRO A 1 155 ? 22.165 13.397  18.817 1.00 12.03 ? 192 PRO A CD   1 
ATOM   1194 N  N    . SER A 1 156 ? 23.018 12.757  22.462 1.00 18.35 ? 193 SER A N    1 
ATOM   1195 C  CA   . SER A 1 156 ? 23.587 12.645  23.783 1.00 19.43 ? 193 SER A CA   1 
ATOM   1196 C  C    . SER A 1 156 ? 22.512 12.757  24.869 1.00 19.92 ? 193 SER A C    1 
ATOM   1197 O  O    . SER A 1 156 ? 22.706 12.303  26.002 1.00 20.73 ? 193 SER A O    1 
ATOM   1198 C  CB   . SER A 1 156 ? 24.681 13.686  23.964 1.00 19.73 ? 193 SER A CB   1 
ATOM   1199 O  OG   . SER A 1 156 ? 24.156 14.995  23.961 1.00 21.16 ? 193 SER A OG   1 
ATOM   1200 N  N    . ASN A 1 157 ? 21.375 13.346  24.512 1.00 19.71 ? 194 ASN A N    1 
ATOM   1201 C  CA   . ASN A 1 157 ? 20.255 13.505  25.430 1.00 19.00 ? 194 ASN A CA   1 
ATOM   1202 C  C    . ASN A 1 157 ? 19.174 12.438  25.283 1.00 17.73 ? 194 ASN A C    1 
ATOM   1203 O  O    . ASN A 1 157 ? 18.064 12.612  25.776 1.00 17.69 ? 194 ASN A O    1 
ATOM   1204 C  CB   . ASN A 1 157 ? 19.619 14.892  25.267 1.00 20.05 ? 194 ASN A CB   1 
ATOM   1205 C  CG   . ASN A 1 157 ? 20.449 15.984  25.925 1.00 22.01 ? 194 ASN A CG   1 
ATOM   1206 O  OD1  . ASN A 1 157 ? 20.983 15.779  27.013 1.00 23.06 ? 194 ASN A OD1  1 
ATOM   1207 N  ND2  . ASN A 1 157 ? 20.560 17.142  25.270 1.00 21.41 ? 194 ASN A ND2  1 
ATOM   1208 N  N    . ILE A 1 158 ? 19.479 11.336  24.614 1.00 17.38 ? 195 ILE A N    1 
ATOM   1209 C  CA   . ILE A 1 158 ? 18.485 10.280  24.469 1.00 18.41 ? 195 ILE A CA   1 
ATOM   1210 C  C    . ILE A 1 158 ? 19.153 9.015   25.007 1.00 20.45 ? 195 ILE A C    1 
ATOM   1211 O  O    . ILE A 1 158 ? 20.323 8.747   24.682 1.00 21.69 ? 195 ILE A O    1 
ATOM   1212 C  CB   . ILE A 1 158 ? 18.074 10.130  22.967 1.00 16.05 ? 195 ILE A CB   1 
ATOM   1213 C  CG1  . ILE A 1 158 ? 17.410 11.428  22.480 1.00 15.56 ? 195 ILE A CG1  1 
ATOM   1214 C  CG2  . ILE A 1 158 ? 17.158 8.941   22.778 1.00 16.36 ? 195 ILE A CG2  1 
ATOM   1215 C  CD1  . ILE A 1 158 ? 17.195 11.478  20.953 1.00 16.66 ? 195 ILE A CD1  1 
ATOM   1216 N  N    . VAL A 1 159 ? 18.442 8.269   25.853 1.00 19.66 ? 196 VAL A N    1 
ATOM   1217 C  CA   . VAL A 1 159 ? 18.974 7.037   26.440 1.00 19.57 ? 196 VAL A CA   1 
ATOM   1218 C  C    . VAL A 1 159 ? 18.123 5.841   26.094 1.00 20.73 ? 196 VAL A C    1 
ATOM   1219 O  O    . VAL A 1 159 ? 16.927 5.962   25.778 1.00 21.21 ? 196 VAL A O    1 
ATOM   1220 C  CB   . VAL A 1 159 ? 19.093 7.115   27.980 1.00 19.28 ? 196 VAL A CB   1 
ATOM   1221 C  CG1  . VAL A 1 159 ? 20.335 7.882   28.350 1.00 21.12 ? 196 VAL A CG1  1 
ATOM   1222 C  CG2  . VAL A 1 159 ? 17.864 7.784   28.576 1.00 17.57 ? 196 VAL A CG2  1 
ATOM   1223 N  N    . VAL A 1 160 ? 18.755 4.678   26.152 1.00 21.59 ? 197 VAL A N    1 
ATOM   1224 C  CA   . VAL A 1 160 ? 18.092 3.440   25.805 1.00 21.98 ? 197 VAL A CA   1 
ATOM   1225 C  C    . VAL A 1 160 ? 18.459 2.325   26.774 1.00 22.96 ? 197 VAL A C    1 
ATOM   1226 O  O    . VAL A 1 160 ? 19.371 2.463   27.592 1.00 23.28 ? 197 VAL A O    1 
ATOM   1227 C  CB   . VAL A 1 160 ? 18.508 2.975   24.376 1.00 21.57 ? 197 VAL A CB   1 
ATOM   1228 C  CG1  . VAL A 1 160 ? 18.318 4.096   23.382 1.00 21.49 ? 197 VAL A CG1  1 
ATOM   1229 C  CG2  . VAL A 1 160 ? 19.992 2.530   24.366 1.00 21.38 ? 197 VAL A CG2  1 
ATOM   1230 N  N    . LYS A 1 161 ? 17.718 1.230   26.677 1.00 23.42 ? 198 LYS A N    1 
ATOM   1231 C  CA   . LYS A 1 161 ? 17.987 0.050   27.475 1.00 24.84 ? 198 LYS A CA   1 
ATOM   1232 C  C    . LYS A 1 161 ? 18.258 -1.098  26.524 1.00 23.76 ? 198 LYS A C    1 
ATOM   1233 O  O    . LYS A 1 161 ? 18.076 -0.970  25.310 1.00 21.93 ? 198 LYS A O    1 
ATOM   1234 C  CB   . LYS A 1 161 ? 16.817 -0.303  28.391 1.00 26.20 ? 198 LYS A CB   1 
ATOM   1235 C  CG   . LYS A 1 161 ? 16.736 0.591   29.596 1.00 31.70 ? 198 LYS A CG   1 
ATOM   1236 C  CD   . LYS A 1 161 ? 15.940 -0.045  30.721 1.00 36.12 ? 198 LYS A CD   1 
ATOM   1237 C  CE   . LYS A 1 161 ? 14.519 -0.311  30.299 1.00 39.03 ? 198 LYS A CE   1 
ATOM   1238 N  NZ   . LYS A 1 161 ? 13.804 -1.126  31.333 1.00 43.26 ? 198 LYS A NZ   1 
ATOM   1239 N  N    . SER A 1 162 ? 18.705 -2.222  27.069 1.00 23.91 ? 199 SER A N    1 
ATOM   1240 C  CA   . SER A 1 162 ? 19.002 -3.384  26.240 1.00 24.96 ? 199 SER A CA   1 
ATOM   1241 C  C    . SER A 1 162 ? 17.770 -3.894  25.517 1.00 23.93 ? 199 SER A C    1 
ATOM   1242 O  O    . SER A 1 162 ? 17.889 -4.404  24.429 1.00 25.99 ? 199 SER A O    1 
ATOM   1243 C  CB   . SER A 1 162 ? 19.632 -4.499  27.094 1.00 26.49 ? 199 SER A CB   1 
ATOM   1244 O  OG   . SER A 1 162 ? 20.922 -4.100  27.515 1.00 29.54 ? 199 SER A OG   1 
ATOM   1245 N  N    . ASP A 1 163 ? 16.585 -3.755  26.111 1.00 25.65 ? 200 ASP A N    1 
ATOM   1246 C  CA   . ASP A 1 163 ? 15.353 -4.219  25.465 1.00 25.23 ? 200 ASP A CA   1 
ATOM   1247 C  C    . ASP A 1 163 ? 14.849 -3.265  24.396 1.00 26.66 ? 200 ASP A C    1 
ATOM   1248 O  O    . ASP A 1 163 ? 13.699 -3.348  23.958 1.00 25.81 ? 200 ASP A O    1 
ATOM   1249 C  CB   . ASP A 1 163 ? 14.253 -4.435  26.501 1.00 27.08 ? 200 ASP A CB   1 
ATOM   1250 C  CG   . ASP A 1 163 ? 13.720 -3.137  27.085 1.00 28.31 ? 200 ASP A CG   1 
ATOM   1251 O  OD1  . ASP A 1 163 ? 14.344 -2.065  26.903 1.00 26.71 ? 200 ASP A OD1  1 
ATOM   1252 O  OD2  . ASP A 1 163 ? 12.659 -3.198  27.749 1.00 29.40 ? 200 ASP A OD2  1 
ATOM   1253 N  N    . CYS A 1 164 ? 15.707 -2.332  24.007 1.00 28.55 ? 201 CYS A N    1 
ATOM   1254 C  CA   . CYS A 1 164 ? 15.389 -1.358  22.971 1.00 30.08 ? 201 CYS A CA   1 
ATOM   1255 C  C    . CYS A 1 164 ? 14.454 -0.216  23.360 1.00 28.37 ? 201 CYS A C    1 
ATOM   1256 O  O    . CYS A 1 164 ? 14.023 0.551   22.486 1.00 27.30 ? 201 CYS A O    1 
ATOM   1257 C  CB   . CYS A 1 164 ? 14.818 -2.084  21.745 1.00 33.68 ? 201 CYS A CB   1 
ATOM   1258 S  SG   . CYS A 1 164 ? 15.525 -1.538  20.207 1.00 41.00 ? 201 CYS A SG   1 
ATOM   1259 N  N    . THR A 1 165 ? 14.130 -0.089  24.644 1.00 26.82 ? 202 THR A N    1 
ATOM   1260 C  CA   . THR A 1 165 ? 13.236 0.994   25.064 1.00 26.27 ? 202 THR A CA   1 
ATOM   1261 C  C    . THR A 1 165 ? 14.006 2.290   25.144 1.00 23.84 ? 202 THR A C    1 
ATOM   1262 O  O    . THR A 1 165 ? 15.198 2.290   25.435 1.00 22.69 ? 202 THR A O    1 
ATOM   1263 C  CB   . THR A 1 165 ? 12.542 0.688   26.400 1.00 27.10 ? 202 THR A CB   1 
ATOM   1264 O  OG1  . THR A 1 165 ? 13.478 0.091   27.320 1.00 28.66 ? 202 THR A OG1  1 
ATOM   1265 C  CG2  . THR A 1 165 ? 11.367 -0.247  26.132 1.00 27.25 ? 202 THR A CG2  1 
ATOM   1266 N  N    . LEU A 1 166 ? 13.307 3.386   24.868 1.00 22.06 ? 203 LEU A N    1 
ATOM   1267 C  CA   . LEU A 1 166 ? 13.921 4.706   24.798 1.00 19.26 ? 203 LEU A CA   1 
ATOM   1268 C  C    . LEU A 1 166 ? 13.266 5.848   25.570 1.00 18.24 ? 203 LEU A C    1 
ATOM   1269 O  O    . LEU A 1 166 ? 12.030 5.915   25.698 1.00 20.41 ? 203 LEU A O    1 
ATOM   1270 C  CB   . LEU A 1 166 ? 14.008 5.107   23.315 1.00 17.84 ? 203 LEU A CB   1 
ATOM   1271 C  CG   . LEU A 1 166 ? 14.609 6.456   22.858 1.00 18.80 ? 203 LEU A CG   1 
ATOM   1272 C  CD1  . LEU A 1 166 ? 15.002 6.359   21.412 1.00 15.96 ? 203 LEU A CD1  1 
ATOM   1273 C  CD2  . LEU A 1 166 ? 13.617 7.592   23.034 1.00 18.96 ? 203 LEU A CD2  1 
ATOM   1274 N  N    . LYS A 1 167 ? 14.099 6.758   26.067 1.00 15.97 ? 204 LYS A N    1 
ATOM   1275 C  CA   . LYS A 1 167 ? 13.620 7.944   26.781 1.00 16.19 ? 204 LYS A CA   1 
ATOM   1276 C  C    . LYS A 1 167 ? 14.373 9.198   26.334 1.00 17.57 ? 204 LYS A C    1 
ATOM   1277 O  O    . LYS A 1 167 ? 15.603 9.184   26.169 1.00 17.83 ? 204 LYS A O    1 
ATOM   1278 C  CB   . LYS A 1 167 ? 13.756 7.787   28.305 1.00 15.51 ? 204 LYS A CB   1 
ATOM   1279 C  CG   . LYS A 1 167 ? 12.947 6.625   28.890 1.00 15.50 ? 204 LYS A CG   1 
ATOM   1280 C  CD   . LYS A 1 167 ? 12.834 6.707   30.402 1.00 21.15 ? 204 LYS A CD   1 
ATOM   1281 C  CE   . LYS A 1 167 ? 12.188 5.457   30.994 1.00 21.17 ? 204 LYS A CE   1 
ATOM   1282 N  NZ   . LYS A 1 167 ? 10.737 5.348   30.608 1.00 23.43 ? 204 LYS A NZ   1 
ATOM   1283 N  N    . ILE A 1 168 ? 13.622 10.271  26.095 1.00 15.90 ? 205 ILE A N    1 
ATOM   1284 C  CA   . ILE A 1 168 ? 14.228 11.553  25.730 1.00 16.29 ? 205 ILE A CA   1 
ATOM   1285 C  C    . ILE A 1 168 ? 14.390 12.199  27.119 1.00 17.30 ? 205 ILE A C    1 
ATOM   1286 O  O    . ILE A 1 168 ? 13.451 12.193  27.912 1.00 18.90 ? 205 ILE A O    1 
ATOM   1287 C  CB   . ILE A 1 168 ? 13.278 12.383  24.833 1.00 14.50 ? 205 ILE A CB   1 
ATOM   1288 C  CG1  . ILE A 1 168 ? 13.134 11.698  23.478 1.00 13.96 ? 205 ILE A CG1  1 
ATOM   1289 C  CG2  . ILE A 1 168 ? 13.739 13.853  24.746 1.00 10.84 ? 205 ILE A CG2  1 
ATOM   1290 C  CD1  . ILE A 1 168 ? 11.981 12.279  22.641 1.00 13.99 ? 205 ILE A CD1  1 
ATOM   1291 N  N    . LEU A 1 169 ? 15.557 12.761  27.405 1.00 16.71 ? 206 LEU A N    1 
ATOM   1292 C  CA   . LEU A 1 169 ? 15.855 13.317  28.728 1.00 16.65 ? 206 LEU A CA   1 
ATOM   1293 C  C    . LEU A 1 169 ? 15.634 14.808  29.028 1.00 17.38 ? 206 LEU A C    1 
ATOM   1294 O  O    . LEU A 1 169 ? 15.577 15.193  30.195 1.00 16.66 ? 206 LEU A O    1 
ATOM   1295 C  CB   . LEU A 1 169 ? 17.330 13.011  29.089 1.00 15.64 ? 206 LEU A CB   1 
ATOM   1296 C  CG   . LEU A 1 169 ? 17.950 11.602  29.102 1.00 14.05 ? 206 LEU A CG   1 
ATOM   1297 C  CD1  . LEU A 1 169 ? 19.479 11.757  29.108 1.00 13.88 ? 206 LEU A CD1  1 
ATOM   1298 C  CD2  . LEU A 1 169 ? 17.518 10.807  30.322 1.00 12.64 ? 206 LEU A CD2  1 
ATOM   1299 N  N    . ASP A 1 170 ? 15.517 15.651  28.012 1.00 16.32 ? 207 ASP A N    1 
ATOM   1300 C  CA   . ASP A 1 170 ? 15.410 17.067  28.286 1.00 16.88 ? 207 ASP A CA   1 
ATOM   1301 C  C    . ASP A 1 170 ? 14.249 17.716  27.532 1.00 18.75 ? 207 ASP A C    1 
ATOM   1302 O  O    . ASP A 1 170 ? 13.603 17.063  26.704 1.00 16.33 ? 207 ASP A O    1 
ATOM   1303 C  CB   . ASP A 1 170 ? 16.749 17.738  27.929 1.00 17.96 ? 207 ASP A CB   1 
ATOM   1304 C  CG   . ASP A 1 170 ? 16.987 17.822  26.410 1.00 21.76 ? 207 ASP A CG   1 
ATOM   1305 O  OD1  . ASP A 1 170 ? 16.852 16.816  25.689 1.00 19.48 ? 207 ASP A OD1  1 
ATOM   1306 O  OD2  . ASP A 1 170 ? 17.309 18.922  25.913 1.00 27.87 ? 207 ASP A OD2  1 
ATOM   1307 N  N    . PHE A 1 171 ? 13.991 18.995  27.811 1.00 17.49 ? 208 PHE A N    1 
ATOM   1308 C  CA   . PHE A 1 171 ? 12.886 19.671  27.164 1.00 20.38 ? 208 PHE A CA   1 
ATOM   1309 C  C    . PHE A 1 171 ? 13.239 20.735  26.124 1.00 21.09 ? 208 PHE A C    1 
ATOM   1310 O  O    . PHE A 1 171 ? 12.374 21.478  25.670 1.00 21.77 ? 208 PHE A O    1 
ATOM   1311 C  CB   . PHE A 1 171 ? 11.931 20.213  28.227 1.00 20.80 ? 208 PHE A CB   1 
ATOM   1312 C  CG   . PHE A 1 171 ? 11.403 19.146  29.122 1.00 23.20 ? 208 PHE A CG   1 
ATOM   1313 C  CD1  . PHE A 1 171 ? 12.083 18.789  30.280 1.00 22.00 ? 208 PHE A CD1  1 
ATOM   1314 C  CD2  . PHE A 1 171 ? 10.290 18.404  28.744 1.00 22.27 ? 208 PHE A CD2  1 
ATOM   1315 C  CE1  . PHE A 1 171 ? 11.670 17.700  31.035 1.00 24.06 ? 208 PHE A CE1  1 
ATOM   1316 C  CE2  . PHE A 1 171 ? 9.873  17.309  29.500 1.00 23.17 ? 208 PHE A CE2  1 
ATOM   1317 C  CZ   . PHE A 1 171 ? 10.560 16.951  30.647 1.00 23.10 ? 208 PHE A CZ   1 
ATOM   1318 N  N    . GLY A 1 172 ? 14.502 20.780  25.727 1.00 19.74 ? 209 GLY A N    1 
ATOM   1319 C  CA   . GLY A 1 172 ? 14.901 21.711  24.693 1.00 21.72 ? 209 GLY A CA   1 
ATOM   1320 C  C    . GLY A 1 172 ? 15.165 23.142  25.076 1.00 24.61 ? 209 GLY A C    1 
ATOM   1321 O  O    . GLY A 1 172 ? 15.481 23.448  26.221 1.00 23.78 ? 209 GLY A O    1 
ATOM   1322 N  N    . LEU A 1 173 ? 15.024 24.007  24.075 1.00 28.47 ? 210 LEU A N    1 
ATOM   1323 C  CA   . LEU A 1 173 ? 15.235 25.447  24.191 1.00 32.58 ? 210 LEU A CA   1 
ATOM   1324 C  C    . LEU A 1 173 ? 14.022 26.177  24.779 1.00 34.51 ? 210 LEU A C    1 
ATOM   1325 O  O    . LEU A 1 173 ? 12.891 25.726  24.670 1.00 34.99 ? 210 LEU A O    1 
ATOM   1326 C  CB   . LEU A 1 173 ? 15.534 26.025  22.799 1.00 31.36 ? 210 LEU A CB   1 
ATOM   1327 C  CG   . LEU A 1 173 ? 16.560 25.250  21.955 1.00 33.30 ? 210 LEU A CG   1 
ATOM   1328 C  CD1  . LEU A 1 173 ? 16.792 25.942  20.602 1.00 33.19 ? 210 LEU A CD1  1 
ATOM   1329 C  CD2  . LEU A 1 173 ? 17.864 25.156  22.730 1.00 32.81 ? 210 LEU A CD2  1 
ATOM   1330 N  N    . ALA A 1 174 ? 14.267 27.323  25.392 1.00 38.00 ? 211 ALA A N    1 
ATOM   1331 C  CA   . ALA A 1 174 ? 13.183 28.121  25.950 1.00 40.91 ? 211 ALA A CA   1 
ATOM   1332 C  C    . ALA A 1 174 ? 12.619 29.044  24.856 1.00 42.03 ? 211 ALA A C    1 
ATOM   1333 O  O    . ALA A 1 174 ? 12.499 28.600  23.691 1.00 41.81 ? 211 ALA A O    1 
ATOM   1334 C  CB   . ALA A 1 174 ? 13.699 28.944  27.119 1.00 42.60 ? 211 ALA A CB   1 
ATOM   1335 N  N    . SER A 1 180 ? 22.063 32.421  25.996 1.00 55.47 ? 217 SER A N    1 
ATOM   1336 C  CA   . SER A 1 180 ? 22.863 33.572  26.497 1.00 56.30 ? 217 SER A CA   1 
ATOM   1337 C  C    . SER A 1 180 ? 24.315 33.169  26.801 1.00 56.56 ? 217 SER A C    1 
ATOM   1338 O  O    . SER A 1 180 ? 24.804 32.148  26.296 1.00 57.27 ? 217 SER A O    1 
ATOM   1339 C  CB   . SER A 1 180 ? 22.205 34.154  27.751 1.00 57.02 ? 217 SER A CB   1 
ATOM   1340 O  OG   . SER A 1 180 ? 22.100 33.173  28.772 1.00 57.66 ? 217 SER A OG   1 
ATOM   1341 N  N    . PHE A 1 181 ? 24.989 33.947  27.649 1.00 55.73 ? 218 PHE A N    1 
ATOM   1342 C  CA   . PHE A 1 181 ? 26.399 33.687  27.972 1.00 55.61 ? 218 PHE A CA   1 
ATOM   1343 C  C    . PHE A 1 181 ? 26.738 32.769  29.158 1.00 56.78 ? 218 PHE A C    1 
ATOM   1344 O  O    . PHE A 1 181 ? 26.047 32.753  30.188 1.00 57.30 ? 218 PHE A O    1 
ATOM   1345 C  CB   . PHE A 1 181 ? 27.136 35.020  28.172 1.00 52.67 ? 218 PHE A CB   1 
ATOM   1346 C  CG   . PHE A 1 181 ? 28.605 34.869  28.449 1.00 50.35 ? 218 PHE A CG   1 
ATOM   1347 C  CD1  . PHE A 1 181 ? 29.451 34.359  27.483 1.00 49.29 ? 218 PHE A CD1  1 
ATOM   1348 C  CD2  . PHE A 1 181 ? 29.150 35.282  29.657 1.00 49.43 ? 218 PHE A CD2  1 
ATOM   1349 C  CE1  . PHE A 1 181 ? 30.829 34.276  27.704 1.00 47.92 ? 218 PHE A CE1  1 
ATOM   1350 C  CE2  . PHE A 1 181 ? 30.525 35.202  29.886 1.00 47.86 ? 218 PHE A CE2  1 
ATOM   1351 C  CZ   . PHE A 1 181 ? 31.361 34.697  28.905 1.00 46.95 ? 218 PHE A CZ   1 
ATOM   1352 N  N    . MET A 1 182 ? 27.832 32.024  28.997 1.00 57.42 ? 219 MET A N    1 
ATOM   1353 C  CA   . MET A 1 182 ? 28.339 31.114  30.022 1.00 58.56 ? 219 MET A CA   1 
ATOM   1354 C  C    . MET A 1 182 ? 29.837 30.968  29.803 1.00 58.22 ? 219 MET A C    1 
ATOM   1355 O  O    . MET A 1 182 ? 30.319 31.150  28.685 1.00 57.71 ? 219 MET A O    1 
ATOM   1356 C  CB   . MET A 1 182 ? 27.690 29.737  29.895 1.00 60.34 ? 219 MET A CB   1 
ATOM   1357 C  CG   . MET A 1 182 ? 26.902 29.285  31.116 1.00 61.73 ? 219 MET A CG   1 
ATOM   1358 S  SD   . MET A 1 182 ? 26.926 27.474  31.274 1.00 64.30 ? 219 MET A SD   1 
ATOM   1359 C  CE   . MET A 1 182 ? 26.238 26.938  29.691 1.00 63.58 ? 219 MET A CE   1 
ATOM   1360 N  N    . MET A 1 183 ? 30.570 30.626  30.858 1.00 58.36 ? 220 MET A N    1 
ATOM   1361 C  CA   . MET A 1 183 ? 32.020 30.447  30.749 1.00 59.22 ? 220 MET A CA   1 
ATOM   1362 C  C    . MET A 1 183 ? 32.436 28.981  30.906 1.00 60.19 ? 220 MET A C    1 
ATOM   1363 O  O    . MET A 1 183 ? 33.519 28.687  31.405 1.00 60.99 ? 220 MET A O    1 
ATOM   1364 C  CB   . MET A 1 183 ? 32.750 31.301  31.799 1.00 58.38 ? 220 MET A CB   1 
ATOM   1365 C  CG   . MET A 1 183 ? 32.698 32.807  31.539 1.00 57.16 ? 220 MET A CG   1 
ATOM   1366 S  SD   . MET A 1 183 ? 34.098 33.701  32.273 1.00 56.64 ? 220 MET A SD   1 
ATOM   1367 C  CE   . MET A 1 183 ? 33.303 35.228  32.705 1.00 55.89 ? 220 MET A CE   1 
ATOM   1368 N  N    . THR A 1 184 ? 31.565 28.067  30.493 1.00 61.19 ? 221 THR A N    1 
ATOM   1369 C  CA   . THR A 1 184 ? 31.850 26.641  30.592 1.00 62.00 ? 221 THR A CA   1 
ATOM   1370 C  C    . THR A 1 184 ? 33.019 26.261  29.681 1.00 62.37 ? 221 THR A C    1 
ATOM   1371 O  O    . THR A 1 184 ? 33.215 26.865  28.615 1.00 62.47 ? 221 THR A O    1 
ATOM   1372 C  CB   . THR A 1 184 ? 30.594 25.792  30.202 1.00 63.18 ? 221 THR A CB   1 
ATOM   1373 O  OG1  . THR A 1 184 ? 29.635 25.844  31.273 1.00 64.25 ? 221 THR A OG1  1 
ATOM   1374 C  CG2  . THR A 1 184 ? 30.977 24.311  29.903 1.00 62.98 ? 221 THR A CG2  1 
ATOM   1375 N  N    . PRO A 1 185 ? 33.831 25.272  30.105 1.00 62.02 ? 222 PRO A N    1 
ATOM   1376 C  CA   . PRO A 1 185 ? 34.967 24.848  29.283 1.00 61.69 ? 222 PRO A CA   1 
ATOM   1377 C  C    . PRO A 1 185 ? 34.507 24.227  27.949 1.00 61.79 ? 222 PRO A C    1 
ATOM   1378 O  O    . PRO A 1 185 ? 35.294 24.123  27.001 1.00 62.17 ? 222 PRO A O    1 
ATOM   1379 C  CB   . PRO A 1 185 ? 35.690 23.836  30.185 1.00 61.76 ? 222 PRO A CB   1 
ATOM   1380 C  CG   . PRO A 1 185 ? 35.383 24.345  31.590 1.00 61.86 ? 222 PRO A CG   1 
ATOM   1381 C  CD   . PRO A 1 185 ? 33.902 24.670  31.454 1.00 62.09 ? 222 PRO A CD   1 
ATOM   1382 N  N    . TYR A 1 186 ? 33.239 23.827  27.860 1.00 60.82 ? 223 TYR A N    1 
ATOM   1383 C  CA   . TYR A 1 186 ? 32.764 23.213  26.620 1.00 61.05 ? 223 TYR A CA   1 
ATOM   1384 C  C    . TYR A 1 186 ? 31.506 23.820  26.004 1.00 59.74 ? 223 TYR A C    1 
ATOM   1385 O  O    . TYR A 1 186 ? 30.569 24.211  26.718 1.00 60.33 ? 223 TYR A O    1 
ATOM   1386 C  CB   . TYR A 1 186 ? 32.586 21.705  26.835 1.00 62.94 ? 223 TYR A CB   1 
ATOM   1387 C  CG   . TYR A 1 186 ? 33.825 21.077  27.446 1.00 64.41 ? 223 TYR A CG   1 
ATOM   1388 C  CD1  . TYR A 1 186 ? 33.794 20.537  28.735 1.00 64.75 ? 223 TYR A CD1  1 
ATOM   1389 C  CD2  . TYR A 1 186 ? 35.053 21.102  26.769 1.00 64.54 ? 223 TYR A CD2  1 
ATOM   1390 C  CE1  . TYR A 1 186 ? 34.954 20.044  29.343 1.00 64.85 ? 223 TYR A CE1  1 
ATOM   1391 C  CE2  . TYR A 1 186 ? 36.221 20.611  27.367 1.00 64.69 ? 223 TYR A CE2  1 
ATOM   1392 C  CZ   . TYR A 1 186 ? 36.164 20.086  28.654 1.00 64.99 ? 223 TYR A CZ   1 
ATOM   1393 O  OH   . TYR A 1 186 ? 37.312 19.611  29.256 1.00 65.30 ? 223 TYR A OH   1 
ATOM   1394 N  N    . VAL A 1 187 ? 31.509 23.880  24.669 1.00 57.56 ? 224 VAL A N    1 
ATOM   1395 C  CA   . VAL A 1 187 ? 30.417 24.453  23.881 1.00 55.41 ? 224 VAL A CA   1 
ATOM   1396 C  C    . VAL A 1 187 ? 29.202 23.525  23.734 1.00 52.89 ? 224 VAL A C    1 
ATOM   1397 O  O    . VAL A 1 187 ? 29.159 22.417  24.285 1.00 52.73 ? 224 VAL A O    1 
ATOM   1398 C  CB   . VAL A 1 187 ? 30.917 24.871  22.449 1.00 55.98 ? 224 VAL A CB   1 
ATOM   1399 C  CG1  . VAL A 1 187 ? 30.999 23.640  21.534 1.00 55.68 ? 224 VAL A CG1  1 
ATOM   1400 C  CG2  . VAL A 1 187 ? 30.015 25.964  21.861 1.00 56.27 ? 224 VAL A CG2  1 
ATOM   1401 N  N    . VAL A 1 188 ? 28.219 23.992  22.970 1.00 49.15 ? 225 VAL A N    1 
ATOM   1402 C  CA   . VAL A 1 188 ? 26.994 23.246  22.751 1.00 45.18 ? 225 VAL A CA   1 
ATOM   1403 C  C    . VAL A 1 188 ? 27.016 22.579  21.368 1.00 42.57 ? 225 VAL A C    1 
ATOM   1404 O  O    . VAL A 1 188 ? 27.643 23.078  20.437 1.00 41.45 ? 225 VAL A O    1 
ATOM   1405 C  CB   . VAL A 1 188 ? 25.774 24.195  22.879 1.00 45.47 ? 225 VAL A CB   1 
ATOM   1406 C  CG1  . VAL A 1 188 ? 24.489 23.387  22.942 1.00 46.46 ? 225 VAL A CG1  1 
ATOM   1407 C  CG2  . VAL A 1 188 ? 25.916 25.062  24.130 1.00 43.74 ? 225 VAL A CG2  1 
ATOM   1408 N  N    . THR A 1 189 ? 26.341 21.439  21.253 1.00 40.15 ? 226 THR A N    1 
ATOM   1409 C  CA   . THR A 1 189 ? 26.267 20.675  20.002 1.00 37.85 ? 226 THR A CA   1 
ATOM   1410 C  C    . THR A 1 189 ? 25.053 21.150  19.221 1.00 36.52 ? 226 THR A C    1 
ATOM   1411 O  O    . THR A 1 189 ? 23.927 20.954  19.671 1.00 36.34 ? 226 THR A O    1 
ATOM   1412 C  CB   . THR A 1 189 ? 26.061 19.186  20.279 1.00 38.12 ? 226 THR A CB   1 
ATOM   1413 O  OG1  . THR A 1 189 ? 27.009 18.751  21.258 1.00 38.68 ? 226 THR A OG1  1 
ATOM   1414 C  CG2  . THR A 1 189 ? 26.239 18.361  18.978 1.00 38.52 ? 226 THR A CG2  1 
ATOM   1415 N  N    . ARG A 1 190 ? 25.276 21.746  18.053 1.00 35.42 ? 227 ARG A N    1 
ATOM   1416 C  CA   . ARG A 1 190 ? 24.186 22.272  17.240 1.00 34.00 ? 227 ARG A CA   1 
ATOM   1417 C  C    . ARG A 1 190 ? 23.877 21.527  15.929 1.00 31.02 ? 227 ARG A C    1 
ATOM   1418 O  O    . ARG A 1 190 ? 22.913 21.860  15.227 1.00 30.18 ? 227 ARG A O    1 
ATOM   1419 C  CB   . ARG A 1 190 ? 24.461 23.761  16.978 1.00 36.88 ? 227 ARG A CB   1 
ATOM   1420 C  CG   . ARG A 1 190 ? 24.286 24.635  18.235 1.00 41.99 ? 227 ARG A CG   1 
ATOM   1421 C  CD   . ARG A 1 190 ? 24.772 26.069  18.020 1.00 45.17 ? 227 ARG A CD   1 
ATOM   1422 N  NE   . ARG A 1 190 ? 26.195 26.084  17.687 1.00 48.32 ? 227 ARG A NE   1 
ATOM   1423 C  CZ   . ARG A 1 190 ? 27.156 26.557  18.476 1.00 50.36 ? 227 ARG A CZ   1 
ATOM   1424 N  NH1  . ARG A 1 190 ? 26.859 27.079  19.665 1.00 50.73 ? 227 ARG A NH1  1 
ATOM   1425 N  NH2  . ARG A 1 190 ? 28.423 26.469  18.082 1.00 49.91 ? 227 ARG A NH2  1 
ATOM   1426 N  N    . TYR A 1 191 ? 24.663 20.490  15.633 1.00 28.10 ? 228 TYR A N    1 
ATOM   1427 C  CA   . TYR A 1 191 ? 24.517 19.685  14.411 1.00 25.13 ? 228 TYR A CA   1 
ATOM   1428 C  C    . TYR A 1 191 ? 23.093 19.176  14.043 1.00 22.50 ? 228 TYR A C    1 
ATOM   1429 O  O    . TYR A 1 191 ? 22.826 18.845  12.885 1.00 19.42 ? 228 TYR A O    1 
ATOM   1430 C  CB   . TYR A 1 191 ? 25.449 18.467  14.493 1.00 26.77 ? 228 TYR A CB   1 
ATOM   1431 C  CG   . TYR A 1 191 ? 26.842 18.756  15.004 1.00 29.76 ? 228 TYR A CG   1 
ATOM   1432 C  CD1  . TYR A 1 191 ? 27.560 19.867  14.554 1.00 30.31 ? 228 TYR A CD1  1 
ATOM   1433 C  CD2  . TYR A 1 191 ? 27.469 17.882  15.887 1.00 30.62 ? 228 TYR A CD2  1 
ATOM   1434 C  CE1  . TYR A 1 191 ? 28.864 20.098  14.961 1.00 33.67 ? 228 TYR A CE1  1 
ATOM   1435 C  CE2  . TYR A 1 191 ? 28.774 18.100  16.302 1.00 33.29 ? 228 TYR A CE2  1 
ATOM   1436 C  CZ   . TYR A 1 191 ? 29.469 19.209  15.830 1.00 34.32 ? 228 TYR A CZ   1 
ATOM   1437 O  OH   . TYR A 1 191 ? 30.777 19.402  16.202 1.00 37.27 ? 228 TYR A OH   1 
ATOM   1438 N  N    . TYR A 1 192 ? 22.194 19.107  15.022 1.00 20.69 ? 229 TYR A N    1 
ATOM   1439 C  CA   . TYR A 1 192 ? 20.834 18.586  14.801 1.00 17.71 ? 229 TYR A CA   1 
ATOM   1440 C  C    . TYR A 1 192 ? 19.736 19.660  14.776 1.00 18.24 ? 229 TYR A C    1 
ATOM   1441 O  O    . TYR A 1 192 ? 18.558 19.333  14.730 1.00 17.43 ? 229 TYR A O    1 
ATOM   1442 C  CB   . TYR A 1 192 ? 20.505 17.554  15.893 1.00 15.95 ? 229 TYR A CB   1 
ATOM   1443 C  CG   . TYR A 1 192 ? 21.605 16.545  16.114 1.00 15.65 ? 229 TYR A CG   1 
ATOM   1444 C  CD1  . TYR A 1 192 ? 22.702 16.834  16.946 1.00 17.07 ? 229 TYR A CD1  1 
ATOM   1445 C  CD2  . TYR A 1 192 ? 21.624 15.355  15.390 1.00 17.11 ? 229 TYR A CD2  1 
ATOM   1446 C  CE1  . TYR A 1 192 ? 23.806 15.958  17.029 1.00 18.96 ? 229 TYR A CE1  1 
ATOM   1447 C  CE2  . TYR A 1 192 ? 22.705 14.474  15.462 1.00 18.30 ? 229 TYR A CE2  1 
ATOM   1448 C  CZ   . TYR A 1 192 ? 23.803 14.781  16.279 1.00 19.77 ? 229 TYR A CZ   1 
ATOM   1449 O  OH   . TYR A 1 192 ? 24.882 13.912  16.308 1.00 19.41 ? 229 TYR A OH   1 
ATOM   1450 N  N    . ARG A 1 193 ? 20.123 20.930  14.812 1.00 17.35 ? 230 ARG A N    1 
ATOM   1451 C  CA   . ARG A 1 193 ? 19.150 22.009  14.808 1.00 19.39 ? 230 ARG A CA   1 
ATOM   1452 C  C    . ARG A 1 193 ? 18.659 22.266  13.400 1.00 18.54 ? 230 ARG A C    1 
ATOM   1453 O  O    . ARG A 1 193 ? 19.445 22.223  12.458 1.00 17.02 ? 230 ARG A O    1 
ATOM   1454 C  CB   . ARG A 1 193 ? 19.764 23.283  15.393 1.00 19.55 ? 230 ARG A CB   1 
ATOM   1455 C  CG   . ARG A 1 193 ? 20.261 23.069  16.807 1.00 20.15 ? 230 ARG A CG   1 
ATOM   1456 C  CD   . ARG A 1 193 ? 20.680 24.337  17.496 1.00 22.02 ? 230 ARG A CD   1 
ATOM   1457 N  NE   . ARG A 1 193 ? 20.885 24.051  18.910 1.00 24.63 ? 230 ARG A NE   1 
ATOM   1458 C  CZ   . ARG A 1 193 ? 21.229 24.943  19.834 1.00 26.05 ? 230 ARG A CZ   1 
ATOM   1459 N  NH1  . ARG A 1 193 ? 21.409 26.221  19.518 1.00 26.63 ? 230 ARG A NH1  1 
ATOM   1460 N  NH2  . ARG A 1 193 ? 21.419 24.540  21.082 1.00 25.17 ? 230 ARG A NH2  1 
ATOM   1461 N  N    . ALA A 1 194 ? 17.356 22.529  13.275 1.00 18.24 ? 231 ALA A N    1 
ATOM   1462 C  CA   . ALA A 1 194 ? 16.698 22.774  11.992 1.00 18.32 ? 231 ALA A CA   1 
ATOM   1463 C  C    . ALA A 1 194 ? 17.100 24.093  11.388 1.00 19.58 ? 231 ALA A C    1 
ATOM   1464 O  O    . ALA A 1 194 ? 17.588 24.970  12.094 1.00 20.05 ? 231 ALA A O    1 
ATOM   1465 C  CB   . ALA A 1 194 ? 15.190 22.748  12.174 1.00 18.94 ? 231 ALA A CB   1 
ATOM   1466 N  N    . PRO A 1 195 ? 16.908 24.245  10.060 1.00 19.82 ? 232 PRO A N    1 
ATOM   1467 C  CA   . PRO A 1 195 ? 17.230 25.457  9.296  1.00 19.94 ? 232 PRO A CA   1 
ATOM   1468 C  C    . PRO A 1 195 ? 16.620 26.658  9.985  1.00 22.89 ? 232 PRO A C    1 
ATOM   1469 O  O    . PRO A 1 195 ? 17.264 27.687  10.160 1.00 22.20 ? 232 PRO A O    1 
ATOM   1470 C  CB   . PRO A 1 195 ? 16.572 25.187  7.950  1.00 20.48 ? 232 PRO A CB   1 
ATOM   1471 C  CG   . PRO A 1 195 ? 16.833 23.710  7.755  1.00 18.24 ? 232 PRO A CG   1 
ATOM   1472 C  CD   . PRO A 1 195 ? 16.517 23.149  9.154  1.00 19.32 ? 232 PRO A CD   1 
ATOM   1473 N  N    . GLU A 1 196 ? 15.369 26.492  10.405 1.00 24.79 ? 233 GLU A N    1 
ATOM   1474 C  CA   . GLU A 1 196 ? 14.642 27.549  11.074 1.00 26.85 ? 233 GLU A CA   1 
ATOM   1475 C  C    . GLU A 1 196 ? 15.274 27.968  12.401 1.00 28.49 ? 233 GLU A C    1 
ATOM   1476 O  O    . GLU A 1 196 ? 15.202 29.140  12.782 1.00 28.55 ? 233 GLU A O    1 
ATOM   1477 C  CB   . GLU A 1 196 ? 13.159 27.162  11.241 1.00 27.22 ? 233 GLU A CB   1 
ATOM   1478 C  CG   . GLU A 1 196 ? 12.911 25.789  11.787 1.00 28.70 ? 233 GLU A CG   1 
ATOM   1479 C  CD   . GLU A 1 196 ? 12.696 24.741  10.709 1.00 26.26 ? 233 GLU A CD   1 
ATOM   1480 O  OE1  . GLU A 1 196 ? 13.581 24.549  9.842  1.00 26.53 ? 233 GLU A OE1  1 
ATOM   1481 O  OE2  . GLU A 1 196 ? 11.629 24.103  10.753 1.00 23.32 ? 233 GLU A OE2  1 
ATOM   1482 N  N    . VAL A 1 197 ? 15.904 27.032  13.103 1.00 27.91 ? 234 VAL A N    1 
ATOM   1483 C  CA   . VAL A 1 197 ? 16.585 27.383  14.342 1.00 27.65 ? 234 VAL A CA   1 
ATOM   1484 C  C    . VAL A 1 197 ? 17.926 28.047  13.964 1.00 28.92 ? 234 VAL A C    1 
ATOM   1485 O  O    . VAL A 1 197 ? 18.324 29.061  14.538 1.00 29.79 ? 234 VAL A O    1 
ATOM   1486 C  CB   . VAL A 1 197 ? 16.876 26.132  15.202 1.00 27.72 ? 234 VAL A CB   1 
ATOM   1487 C  CG1  . VAL A 1 197 ? 17.587 26.536  16.482 1.00 22.42 ? 234 VAL A CG1  1 
ATOM   1488 C  CG2  . VAL A 1 197 ? 15.551 25.396  15.515 1.00 25.67 ? 234 VAL A CG2  1 
ATOM   1489 N  N    . ILE A 1 198 ? 18.603 27.462  12.985 1.00 28.88 ? 235 ILE A N    1 
ATOM   1490 C  CA   . ILE A 1 198 ? 19.892 27.940  12.489 1.00 28.96 ? 235 ILE A CA   1 
ATOM   1491 C  C    . ILE A 1 198 ? 19.818 29.313  11.825 1.00 30.44 ? 235 ILE A C    1 
ATOM   1492 O  O    . ILE A 1 198 ? 20.772 30.082  11.867 1.00 30.66 ? 235 ILE A O    1 
ATOM   1493 C  CB   . ILE A 1 198 ? 20.444 26.980  11.423 1.00 27.28 ? 235 ILE A CB   1 
ATOM   1494 C  CG1  . ILE A 1 198 ? 20.700 25.613  12.030 1.00 26.63 ? 235 ILE A CG1  1 
ATOM   1495 C  CG2  . ILE A 1 198 ? 21.730 27.517  10.846 1.00 28.56 ? 235 ILE A CG2  1 
ATOM   1496 C  CD1  . ILE A 1 198 ? 21.102 24.571  11.008 1.00 25.33 ? 235 ILE A CD1  1 
ATOM   1497 N  N    . LEU A 1 199 ? 18.690 29.606  11.191 1.00 31.53 ? 236 LEU A N    1 
ATOM   1498 C  CA   . LEU A 1 199 ? 18.537 30.863  10.479 1.00 32.71 ? 236 LEU A CA   1 
ATOM   1499 C  C    . LEU A 1 199 ? 17.595 31.802  11.219 1.00 33.78 ? 236 LEU A C    1 
ATOM   1500 O  O    . LEU A 1 199 ? 17.175 32.836  10.701 1.00 34.71 ? 236 LEU A O    1 
ATOM   1501 C  CB   . LEU A 1 199 ? 18.037 30.592  9.048  1.00 29.54 ? 236 LEU A CB   1 
ATOM   1502 C  CG   . LEU A 1 199 ? 18.946 29.739  8.153  1.00 29.45 ? 236 LEU A CG   1 
ATOM   1503 C  CD1  . LEU A 1 199 ? 18.292 29.511  6.821  1.00 28.77 ? 236 LEU A CD1  1 
ATOM   1504 C  CD2  . LEU A 1 199 ? 20.299 30.413  7.948  1.00 28.53 ? 236 LEU A CD2  1 
ATOM   1505 N  N    . GLY A 1 200 ? 17.281 31.432  12.448 1.00 34.92 ? 237 GLY A N    1 
ATOM   1506 C  CA   . GLY A 1 200 ? 16.398 32.244  13.255 1.00 35.95 ? 237 GLY A CA   1 
ATOM   1507 C  C    . GLY A 1 200 ? 15.110 32.672  12.571 1.00 36.86 ? 237 GLY A C    1 
ATOM   1508 O  O    . GLY A 1 200 ? 14.921 33.847  12.287 1.00 38.04 ? 237 GLY A O    1 
ATOM   1509 N  N    . MET A 1 201 ? 14.211 31.742  12.292 1.00 35.96 ? 238 MET A N    1 
ATOM   1510 C  CA   . MET A 1 201 ? 12.958 32.139  11.673 1.00 35.76 ? 238 MET A CA   1 
ATOM   1511 C  C    . MET A 1 201 ? 11.815 31.600  12.533 1.00 34.52 ? 238 MET A C    1 
ATOM   1512 O  O    . MET A 1 201 ? 12.057 31.038  13.606 1.00 34.34 ? 238 MET A O    1 
ATOM   1513 C  CB   . MET A 1 201 ? 12.883 31.664  10.196 1.00 35.98 ? 238 MET A CB   1 
ATOM   1514 C  CG   . MET A 1 201 ? 13.234 30.223  9.919  1.00 37.89 ? 238 MET A CG   1 
ATOM   1515 S  SD   . MET A 1 201 ? 13.824 29.874  8.198  1.00 37.99 ? 238 MET A SD   1 
ATOM   1516 C  CE   . MET A 1 201 ? 12.195 29.548  7.365  1.00 39.22 ? 238 MET A CE   1 
ATOM   1517 N  N    . GLY A 1 202 ? 10.572 31.804  12.109 1.00 33.46 ? 239 GLY A N    1 
ATOM   1518 C  CA   . GLY A 1 202 ? 9.469  31.282  12.891 1.00 31.00 ? 239 GLY A CA   1 
ATOM   1519 C  C    . GLY A 1 202 ? 9.522  29.773  12.775 1.00 30.22 ? 239 GLY A C    1 
ATOM   1520 O  O    . GLY A 1 202 ? 10.239 29.235  11.928 1.00 31.16 ? 239 GLY A O    1 
ATOM   1521 N  N    . TYR A 1 203 ? 8.778  29.062  13.601 1.00 29.12 ? 240 TYR A N    1 
ATOM   1522 C  CA   . TYR A 1 203 ? 8.813  27.611  13.496 1.00 27.90 ? 240 TYR A CA   1 
ATOM   1523 C  C    . TYR A 1 203 ? 7.527  27.011  14.025 1.00 27.69 ? 240 TYR A C    1 
ATOM   1524 O  O    . TYR A 1 203 ? 6.760  27.685  14.708 1.00 28.40 ? 240 TYR A O    1 
ATOM   1525 C  CB   . TYR A 1 203 ? 10.022 27.066  14.262 1.00 26.65 ? 240 TYR A CB   1 
ATOM   1526 C  CG   . TYR A 1 203 ? 9.961  27.331  15.747 1.00 26.09 ? 240 TYR A CG   1 
ATOM   1527 C  CD1  . TYR A 1 203 ? 9.271  26.463  16.591 1.00 27.12 ? 240 TYR A CD1  1 
ATOM   1528 C  CD2  . TYR A 1 203 ? 10.548 28.469  16.305 1.00 26.20 ? 240 TYR A CD2  1 
ATOM   1529 C  CE1  . TYR A 1 203 ? 9.161  26.719  17.949 1.00 30.03 ? 240 TYR A CE1  1 
ATOM   1530 C  CE2  . TYR A 1 203 ? 10.442 28.735  17.678 1.00 27.38 ? 240 TYR A CE2  1 
ATOM   1531 C  CZ   . TYR A 1 203 ? 9.747  27.857  18.485 1.00 28.38 ? 240 TYR A CZ   1 
ATOM   1532 O  OH   . TYR A 1 203 ? 9.615  28.082  19.836 1.00 33.77 ? 240 TYR A OH   1 
ATOM   1533 N  N    . LYS A 1 204 ? 7.307  25.744  13.695 1.00 26.86 ? 241 LYS A N    1 
ATOM   1534 C  CA   . LYS A 1 204 ? 6.126  25.008  14.115 1.00 28.49 ? 241 LYS A CA   1 
ATOM   1535 C  C    . LYS A 1 204 ? 6.572  23.641  14.687 1.00 27.98 ? 241 LYS A C    1 
ATOM   1536 O  O    . LYS A 1 204 ? 7.771  23.367  14.817 1.00 26.06 ? 241 LYS A O    1 
ATOM   1537 C  CB   . LYS A 1 204 ? 5.184  24.806  12.916 1.00 31.17 ? 241 LYS A CB   1 
ATOM   1538 C  CG   . LYS A 1 204 ? 5.881  24.048  11.774 1.00 34.29 ? 241 LYS A CG   1 
ATOM   1539 C  CD   . LYS A 1 204 ? 5.339  24.337  10.362 1.00 37.93 ? 241 LYS A CD   1 
ATOM   1540 C  CE   . LYS A 1 204 ? 4.008  23.651  10.088 1.00 38.22 ? 241 LYS A CE   1 
ATOM   1541 N  NZ   . LYS A 1 204 ? 3.779  23.502  8.608  1.00 37.75 ? 241 LYS A NZ   1 
ATOM   1542 N  N    . GLU A 1 205 ? 5.600  22.800  15.029 1.00 26.46 ? 242 GLU A N    1 
ATOM   1543 C  CA   . GLU A 1 205 ? 5.873  21.492  15.597 1.00 25.77 ? 242 GLU A CA   1 
ATOM   1544 C  C    . GLU A 1 205 ? 6.907  20.676  14.837 1.00 23.72 ? 242 GLU A C    1 
ATOM   1545 O  O    . GLU A 1 205 ? 7.734  20.005  15.450 1.00 23.25 ? 242 GLU A O    1 
ATOM   1546 C  CB   . GLU A 1 205 ? 4.591  20.666  15.677 1.00 26.98 ? 242 GLU A CB   1 
ATOM   1547 C  CG   . GLU A 1 205 ? 3.654  20.992  16.826 1.00 30.99 ? 242 GLU A CG   1 
ATOM   1548 C  CD   . GLU A 1 205 ? 3.054  22.373  16.752 1.00 34.12 ? 242 GLU A CD   1 
ATOM   1549 O  OE1  . GLU A 1 205 ? 3.238  23.090  15.733 1.00 36.03 ? 242 GLU A OE1  1 
ATOM   1550 O  OE2  . GLU A 1 205 ? 2.379  22.742  17.736 1.00 37.32 ? 242 GLU A OE2  1 
ATOM   1551 N  N    . ASN A 1 206 ? 6.879  20.717  13.509 1.00 22.57 ? 243 ASN A N    1 
ATOM   1552 C  CA   . ASN A 1 206 ? 7.809  19.879  12.761 1.00 19.81 ? 243 ASN A CA   1 
ATOM   1553 C  C    . ASN A 1 206 ? 9.262  20.332  12.710 1.00 20.49 ? 243 ASN A C    1 
ATOM   1554 O  O    . ASN A 1 206 ? 10.076 19.781  11.963 1.00 15.90 ? 243 ASN A O    1 
ATOM   1555 C  CB   . ASN A 1 206 ? 7.268  19.589  11.357 1.00 20.50 ? 243 ASN A CB   1 
ATOM   1556 C  CG   . ASN A 1 206 ? 7.425  20.747  10.396 1.00 21.22 ? 243 ASN A CG   1 
ATOM   1557 O  OD1  . ASN A 1 206 ? 7.621  21.893  10.782 1.00 21.31 ? 243 ASN A OD1  1 
ATOM   1558 N  ND2  . ASN A 1 206 ? 7.325  20.438  9.116  1.00 22.20 ? 243 ASN A ND2  1 
ATOM   1559 N  N    . VAL A 1 207 ? 9.589  21.359  13.487 1.00 20.24 ? 244 VAL A N    1 
ATOM   1560 C  CA   . VAL A 1 207 ? 10.976 21.778  13.569 1.00 21.65 ? 244 VAL A CA   1 
ATOM   1561 C  C    . VAL A 1 207 ? 11.756 20.567  14.170 1.00 22.44 ? 244 VAL A C    1 
ATOM   1562 O  O    . VAL A 1 207 ? 12.937 20.361  13.873 1.00 23.71 ? 244 VAL A O    1 
ATOM   1563 C  CB   . VAL A 1 207 ? 11.132 23.019  14.502 1.00 21.04 ? 244 VAL A CB   1 
ATOM   1564 C  CG1  . VAL A 1 207 ? 10.607 22.712  15.904 1.00 21.80 ? 244 VAL A CG1  1 
ATOM   1565 C  CG2  . VAL A 1 207 ? 12.600 23.449  14.558 1.00 22.30 ? 244 VAL A CG2  1 
ATOM   1566 N  N    . ASP A 1 208 ? 11.083 19.762  15.003 1.00 20.56 ? 245 ASP A N    1 
ATOM   1567 C  CA   . ASP A 1 208 ? 11.706 18.593  15.638 1.00 20.10 ? 245 ASP A CA   1 
ATOM   1568 C  C    . ASP A 1 208 ? 11.902 17.415  14.686 1.00 20.71 ? 245 ASP A C    1 
ATOM   1569 O  O    . ASP A 1 208 ? 12.759 16.555  14.932 1.00 20.19 ? 245 ASP A O    1 
ATOM   1570 C  CB   . ASP A 1 208 ? 10.895 18.128  16.852 1.00 18.92 ? 245 ASP A CB   1 
ATOM   1571 C  CG   . ASP A 1 208 ? 10.941 19.117  17.996 1.00 20.53 ? 245 ASP A CG   1 
ATOM   1572 O  OD1  . ASP A 1 208 ? 12.020 19.726  18.222 1.00 17.09 ? 245 ASP A OD1  1 
ATOM   1573 O  OD2  . ASP A 1 208 ? 9.907  19.274  18.691 1.00 19.69 ? 245 ASP A OD2  1 
ATOM   1574 N  N    . ILE A 1 209 ? 11.126 17.379  13.598 1.00 18.78 ? 246 ILE A N    1 
ATOM   1575 C  CA   . ILE A 1 209 ? 11.251 16.304  12.604 1.00 18.73 ? 246 ILE A CA   1 
ATOM   1576 C  C    . ILE A 1 209 ? 12.604 16.378  11.877 1.00 19.28 ? 246 ILE A C    1 
ATOM   1577 O  O    . ILE A 1 209 ? 13.104 15.363  11.384 1.00 20.10 ? 246 ILE A O    1 
ATOM   1578 C  CB   . ILE A 1 209 ? 10.077 16.351  11.537 1.00 17.91 ? 246 ILE A CB   1 
ATOM   1579 C  CG1  . ILE A 1 209 ? 8.781  15.845  12.173 1.00 17.33 ? 246 ILE A CG1  1 
ATOM   1580 C  CG2  . ILE A 1 209 ? 10.423 15.506  10.275 1.00 14.54 ? 246 ILE A CG2  1 
ATOM   1581 C  CD1  . ILE A 1 209 ? 8.803  14.317  12.523 1.00 19.65 ? 246 ILE A CD1  1 
ATOM   1582 N  N    . TRP A 1 210 ? 13.181 17.576  11.786 1.00 19.17 ? 247 TRP A N    1 
ATOM   1583 C  CA   . TRP A 1 210 ? 14.470 17.740  11.131 1.00 18.30 ? 247 TRP A CA   1 
ATOM   1584 C  C    . TRP A 1 210 ? 15.520 17.068  11.985 1.00 18.00 ? 247 TRP A C    1 
ATOM   1585 O  O    . TRP A 1 210 ? 16.419 16.407  11.467 1.00 20.15 ? 247 TRP A O    1 
ATOM   1586 C  CB   . TRP A 1 210 ? 14.826 19.218  10.957 1.00 15.92 ? 247 TRP A CB   1 
ATOM   1587 C  CG   . TRP A 1 210 ? 16.232 19.411  10.469 1.00 16.92 ? 247 TRP A CG   1 
ATOM   1588 C  CD1  . TRP A 1 210 ? 17.378 19.478  11.230 1.00 16.89 ? 247 TRP A CD1  1 
ATOM   1589 C  CD2  . TRP A 1 210 ? 16.652 19.553  9.104  1.00 16.50 ? 247 TRP A CD2  1 
ATOM   1590 N  NE1  . TRP A 1 210 ? 18.477 19.653  10.415 1.00 14.92 ? 247 TRP A NE1  1 
ATOM   1591 C  CE2  . TRP A 1 210 ? 18.057 19.698  9.108  1.00 15.56 ? 247 TRP A CE2  1 
ATOM   1592 C  CE3  . TRP A 1 210 ? 15.975 19.577  7.876  1.00 17.82 ? 247 TRP A CE3  1 
ATOM   1593 C  CZ2  . TRP A 1 210 ? 18.796 19.860  7.925  1.00 15.01 ? 247 TRP A CZ2  1 
ATOM   1594 C  CZ3  . TRP A 1 210 ? 16.709 19.739  6.706  1.00 16.39 ? 247 TRP A CZ3  1 
ATOM   1595 C  CH2  . TRP A 1 210 ? 18.105 19.877  6.740  1.00 14.39 ? 247 TRP A CH2  1 
ATOM   1596 N  N    . SER A 1 211 ? 15.392 17.232  13.296 1.00 16.96 ? 248 SER A N    1 
ATOM   1597 C  CA   . SER A 1 211 ? 16.338 16.626  14.219 1.00 16.34 ? 248 SER A CA   1 
ATOM   1598 C  C    . SER A 1 211 ? 16.232 15.103  14.192 1.00 17.09 ? 248 SER A C    1 
ATOM   1599 O  O    . SER A 1 211 ? 17.261 14.411  14.241 1.00 14.87 ? 248 SER A O    1 
ATOM   1600 C  CB   . SER A 1 211 ? 16.115 17.173  15.622 1.00 14.00 ? 248 SER A CB   1 
ATOM   1601 O  OG   . SER A 1 211 ? 16.303 18.578  15.595 1.00 12.76 ? 248 SER A OG   1 
ATOM   1602 N  N    . VAL A 1 212 ? 15.006 14.571  14.068 1.00 15.71 ? 249 VAL A N    1 
ATOM   1603 C  CA   . VAL A 1 212 ? 14.838 13.114  14.011 1.00 15.81 ? 249 VAL A CA   1 
ATOM   1604 C  C    . VAL A 1 212 ? 15.546 12.561  12.762 1.00 16.35 ? 249 VAL A C    1 
ATOM   1605 O  O    . VAL A 1 212 ? 16.142 11.492  12.818 1.00 18.13 ? 249 VAL A O    1 
ATOM   1606 C  CB   . VAL A 1 212 ? 13.333 12.691  14.011 1.00 14.93 ? 249 VAL A CB   1 
ATOM   1607 C  CG1  . VAL A 1 212 ? 13.198 11.184  13.701 1.00 13.28 ? 249 VAL A CG1  1 
ATOM   1608 C  CG2  . VAL A 1 212 ? 12.729 12.966  15.383 1.00 13.33 ? 249 VAL A CG2  1 
ATOM   1609 N  N    . GLY A 1 213 ? 15.506 13.311  11.656 1.00 16.17 ? 250 GLY A N    1 
ATOM   1610 C  CA   . GLY A 1 213 ? 16.138 12.884  10.416 1.00 14.31 ? 250 GLY A CA   1 
ATOM   1611 C  C    . GLY A 1 213 ? 17.668 12.962  10.439 1.00 15.85 ? 250 GLY A C    1 
ATOM   1612 O  O    . GLY A 1 213 ? 18.348 12.211  9.745  1.00 12.14 ? 250 GLY A O    1 
ATOM   1613 N  N    . CYS A 1 214 ? 18.215 13.876  11.233 1.00 14.65 ? 251 CYS A N    1 
ATOM   1614 C  CA   . CYS A 1 214 ? 19.670 14.010  11.357 1.00 16.69 ? 251 CYS A CA   1 
ATOM   1615 C  C    . CYS A 1 214 ? 20.170 12.807  12.157 1.00 15.23 ? 251 CYS A C    1 
ATOM   1616 O  O    . CYS A 1 214 ? 21.257 12.306  11.928 1.00 14.42 ? 251 CYS A O    1 
ATOM   1617 C  CB   . CYS A 1 214 ? 20.032 15.321  12.091 1.00 16.40 ? 251 CYS A CB   1 
ATOM   1618 S  SG   . CYS A 1 214 ? 19.758 16.891  11.152 1.00 20.87 ? 251 CYS A SG   1 
ATOM   1619 N  N    . ILE A 1 215 ? 19.344 12.349  13.083 1.00 17.07 ? 252 ILE A N    1 
ATOM   1620 C  CA   . ILE A 1 215 ? 19.670 11.197  13.904 1.00 17.50 ? 252 ILE A CA   1 
ATOM   1621 C  C    . ILE A 1 215 ? 19.558 9.918   13.079 1.00 18.38 ? 252 ILE A C    1 
ATOM   1622 O  O    . ILE A 1 215 ? 20.485 9.110   13.036 1.00 17.44 ? 252 ILE A O    1 
ATOM   1623 C  CB   . ILE A 1 215 ? 18.749 11.168  15.130 1.00 17.04 ? 252 ILE A CB   1 
ATOM   1624 C  CG1  . ILE A 1 215 ? 19.110 12.348  16.029 1.00 18.25 ? 252 ILE A CG1  1 
ATOM   1625 C  CG2  . ILE A 1 215 ? 18.854 9.877   15.859 1.00 16.68 ? 252 ILE A CG2  1 
ATOM   1626 C  CD1  . ILE A 1 215 ? 18.376 12.390  17.345 1.00 20.96 ? 252 ILE A CD1  1 
ATOM   1627 N  N    . MET A 1 216 ? 18.441 9.762   12.383 1.00 17.77 ? 253 MET A N    1 
ATOM   1628 C  CA   . MET A 1 216 ? 18.231 8.581   11.562 1.00 19.23 ? 253 MET A CA   1 
ATOM   1629 C  C    . MET A 1 216 ? 19.290 8.451   10.473 1.00 19.71 ? 253 MET A C    1 
ATOM   1630 O  O    . MET A 1 216 ? 19.737 7.349   10.168 1.00 19.57 ? 253 MET A O    1 
ATOM   1631 C  CB   . MET A 1 216 ? 16.848 8.637   10.931 1.00 18.46 ? 253 MET A CB   1 
ATOM   1632 C  CG   . MET A 1 216 ? 16.528 7.443   10.061 1.00 19.59 ? 253 MET A CG   1 
ATOM   1633 S  SD   . MET A 1 216 ? 15.026 7.831   9.163  1.00 21.74 ? 253 MET A SD   1 
ATOM   1634 C  CE   . MET A 1 216 ? 14.377 6.344   8.903  1.00 22.05 ? 253 MET A CE   1 
ATOM   1635 N  N    . GLY A 1 217 ? 19.669 9.584   9.887  1.00 18.65 ? 254 GLY A N    1 
ATOM   1636 C  CA   . GLY A 1 217 ? 20.674 9.584   8.848  1.00 21.77 ? 254 GLY A CA   1 
ATOM   1637 C  C    . GLY A 1 217 ? 22.028 9.200   9.418  1.00 23.22 ? 254 GLY A C    1 
ATOM   1638 O  O    . GLY A 1 217 ? 22.816 8.518   8.761  1.00 23.89 ? 254 GLY A O    1 
ATOM   1639 N  N    . GLU A 1 218 ? 22.305 9.654   10.637 1.00 24.41 ? 255 GLU A N    1 
ATOM   1640 C  CA   . GLU A 1 218 ? 23.554 9.331   11.297 1.00 25.87 ? 255 GLU A CA   1 
ATOM   1641 C  C    . GLU A 1 218 ? 23.585 7.841   11.665 1.00 27.13 ? 255 GLU A C    1 
ATOM   1642 O  O    . GLU A 1 218 ? 24.635 7.212   11.600 1.00 28.44 ? 255 GLU A O    1 
ATOM   1643 C  CB   . GLU A 1 218 ? 23.747 10.186  12.554 1.00 24.24 ? 255 GLU A CB   1 
ATOM   1644 C  CG   . GLU A 1 218 ? 25.180 10.148  13.026 1.00 26.13 ? 255 GLU A CG   1 
ATOM   1645 C  CD   . GLU A 1 218 ? 25.471 11.036  14.208 1.00 25.55 ? 255 GLU A CD   1 
ATOM   1646 O  OE1  . GLU A 1 218 ? 24.909 12.141  14.306 1.00 28.28 ? 255 GLU A OE1  1 
ATOM   1647 O  OE2  . GLU A 1 218 ? 26.303 10.629  15.028 1.00 26.09 ? 255 GLU A OE2  1 
ATOM   1648 N  N    . MET A 1 219 ? 22.444 7.272   12.046 1.00 27.78 ? 256 MET A N    1 
ATOM   1649 C  CA   . MET A 1 219 ? 22.410 5.853   12.391 1.00 28.11 ? 256 MET A CA   1 
ATOM   1650 C  C    . MET A 1 219 ? 22.768 5.025   11.179 1.00 29.47 ? 256 MET A C    1 
ATOM   1651 O  O    . MET A 1 219 ? 23.300 3.925   11.301 1.00 30.55 ? 256 MET A O    1 
ATOM   1652 C  CB   . MET A 1 219 ? 21.023 5.442   12.862 1.00 28.94 ? 256 MET A CB   1 
ATOM   1653 C  CG   . MET A 1 219 ? 20.594 6.146   14.087 1.00 29.52 ? 256 MET A CG   1 
ATOM   1654 S  SD   . MET A 1 219 ? 18.900 5.813   14.389 1.00 34.57 ? 256 MET A SD   1 
ATOM   1655 C  CE   . MET A 1 219 ? 18.997 5.296   16.042 1.00 29.21 ? 256 MET A CE   1 
ATOM   1656 N  N    . VAL A 1 220 ? 22.471 5.558   10.004 1.00 28.92 ? 257 VAL A N    1 
ATOM   1657 C  CA   . VAL A 1 220 ? 22.762 4.859   8.769  1.00 30.50 ? 257 VAL A CA   1 
ATOM   1658 C  C    . VAL A 1 220 ? 24.188 5.097   8.273  1.00 32.56 ? 257 VAL A C    1 
ATOM   1659 O  O    . VAL A 1 220 ? 24.965 4.161   8.075  1.00 32.76 ? 257 VAL A O    1 
ATOM   1660 C  CB   . VAL A 1 220 ? 21.795 5.302   7.674  1.00 29.63 ? 257 VAL A CB   1 
ATOM   1661 C  CG1  . VAL A 1 220 ? 22.160 4.654   6.380  1.00 29.13 ? 257 VAL A CG1  1 
ATOM   1662 C  CG2  . VAL A 1 220 ? 20.365 4.941   8.077  1.00 28.85 ? 257 VAL A CG2  1 
ATOM   1663 N  N    . ARG A 1 221 ? 24.517 6.365   8.072  1.00 34.25 ? 258 ARG A N    1 
ATOM   1664 C  CA   . ARG A 1 221 ? 25.820 6.757   7.567  1.00 34.65 ? 258 ARG A CA   1 
ATOM   1665 C  C    . ARG A 1 221 ? 26.931 6.630   8.610  1.00 35.29 ? 258 ARG A C    1 
ATOM   1666 O  O    . ARG A 1 221 ? 28.106 6.582   8.258  1.00 35.21 ? 258 ARG A O    1 
ATOM   1667 C  CB   . ARG A 1 221 ? 25.738 8.193   7.039  1.00 34.44 ? 258 ARG A CB   1 
ATOM   1668 C  CG   . ARG A 1 221 ? 27.022 8.696   6.446  1.00 34.27 ? 258 ARG A CG   1 
ATOM   1669 C  CD   . ARG A 1 221 ? 26.915 10.134  6.049  1.00 34.45 ? 258 ARG A CD   1 
ATOM   1670 N  NE   . ARG A 1 221 ? 25.971 10.355  4.963  1.00 35.27 ? 258 ARG A NE   1 
ATOM   1671 C  CZ   . ARG A 1 221 ? 25.757 11.549  4.419  1.00 35.60 ? 258 ARG A CZ   1 
ATOM   1672 N  NH1  . ARG A 1 221 ? 26.430 12.599  4.870  1.00 36.76 ? 258 ARG A NH1  1 
ATOM   1673 N  NH2  . ARG A 1 221 ? 24.855 11.704  3.450  1.00 35.46 ? 258 ARG A NH2  1 
ATOM   1674 N  N    . HIS A 1 222 ? 26.547 6.565   9.884  1.00 35.23 ? 259 HIS A N    1 
ATOM   1675 C  CA   . HIS A 1 222 ? 27.492 6.457   10.995 1.00 35.73 ? 259 HIS A CA   1 
ATOM   1676 C  C    . HIS A 1 222 ? 28.426 7.648   11.089 1.00 36.34 ? 259 HIS A C    1 
ATOM   1677 O  O    . HIS A 1 222 ? 29.584 7.527   11.490 1.00 38.83 ? 259 HIS A O    1 
ATOM   1678 C  CB   . HIS A 1 222 ? 28.305 5.167   10.893 1.00 34.08 ? 259 HIS A CB   1 
ATOM   1679 C  CG   . HIS A 1 222 ? 27.482 3.933   11.079 1.00 31.13 ? 259 HIS A CG   1 
ATOM   1680 N  ND1  . HIS A 1 222 ? 26.842 3.641   12.260 1.00 27.86 ? 259 HIS A ND1  1 
ATOM   1681 C  CD2  . HIS A 1 222 ? 27.145 2.950   10.211 1.00 29.06 ? 259 HIS A CD2  1 
ATOM   1682 C  CE1  . HIS A 1 222 ? 26.141 2.532   12.114 1.00 29.09 ? 259 HIS A CE1  1 
ATOM   1683 N  NE2  . HIS A 1 222 ? 26.307 2.095   10.880 1.00 29.62 ? 259 HIS A NE2  1 
ATOM   1684 N  N    . LYS A 1 223 ? 27.910 8.804   10.712 1.00 35.80 ? 260 LYS A N    1 
ATOM   1685 C  CA   . LYS A 1 223 ? 28.680 10.026  10.772 1.00 33.53 ? 260 LYS A CA   1 
ATOM   1686 C  C    . LYS A 1 223 ? 27.729 11.190  10.849 1.00 30.61 ? 260 LYS A C    1 
ATOM   1687 O  O    . LYS A 1 223 ? 26.670 11.159  10.224 1.00 31.86 ? 260 LYS A O    1 
ATOM   1688 C  CB   . LYS A 1 223 ? 29.532 10.191  9.519  1.00 34.90 ? 260 LYS A CB   1 
ATOM   1689 C  CG   . LYS A 1 223 ? 30.775 9.314   9.461  1.00 39.20 ? 260 LYS A CG   1 
ATOM   1690 C  CD   . LYS A 1 223 ? 31.737 9.858   8.402  1.00 38.83 ? 260 LYS A CD   1 
ATOM   1691 C  CE   . LYS A 1 223 ? 32.360 8.747   7.565  1.00 39.61 ? 260 LYS A CE   1 
ATOM   1692 N  NZ   . LYS A 1 223 ? 32.779 9.291   6.246  1.00 40.30 ? 260 LYS A NZ   1 
ATOM   1693 N  N    . ILE A 1 224 ? 28.112 12.215  11.598 1.00 26.89 ? 261 ILE A N    1 
ATOM   1694 C  CA   . ILE A 1 224 ? 27.306 13.429  11.715 1.00 25.87 ? 261 ILE A CA   1 
ATOM   1695 C  C    . ILE A 1 224 ? 27.064 14.005  10.301 1.00 26.50 ? 261 ILE A C    1 
ATOM   1696 O  O    . ILE A 1 224 ? 28.005 14.327  9.570  1.00 25.67 ? 261 ILE A O    1 
ATOM   1697 C  CB   . ILE A 1 224 ? 28.035 14.467  12.597 1.00 25.05 ? 261 ILE A CB   1 
ATOM   1698 C  CG1  . ILE A 1 224 ? 28.312 13.852  13.972 1.00 24.63 ? 261 ILE A CG1  1 
ATOM   1699 C  CG2  . ILE A 1 224 ? 27.191 15.731  12.753 1.00 24.41 ? 261 ILE A CG2  1 
ATOM   1700 C  CD1  . ILE A 1 224 ? 29.407 14.549  14.743 1.00 23.12 ? 261 ILE A CD1  1 
ATOM   1701 N  N    . LEU A 1 225 ? 25.800 14.126  9.916  1.00 25.32 ? 262 LEU A N    1 
ATOM   1702 C  CA   . LEU A 1 225 ? 25.458 14.636  8.595  1.00 25.86 ? 262 LEU A CA   1 
ATOM   1703 C  C    . LEU A 1 225 ? 25.877 16.082  8.297  1.00 27.72 ? 262 LEU A C    1 
ATOM   1704 O  O    . LEU A 1 225 ? 26.339 16.385  7.193  1.00 26.97 ? 262 LEU A O    1 
ATOM   1705 C  CB   . LEU A 1 225 ? 23.947 14.519  8.369  1.00 25.07 ? 262 LEU A CB   1 
ATOM   1706 C  CG   . LEU A 1 225 ? 23.253 13.170  8.548  1.00 25.05 ? 262 LEU A CG   1 
ATOM   1707 C  CD1  . LEU A 1 225 ? 21.823 13.293  8.047  1.00 22.65 ? 262 LEU A CD1  1 
ATOM   1708 C  CD2  . LEU A 1 225 ? 23.998 12.084  7.784  1.00 24.75 ? 262 LEU A CD2  1 
ATOM   1709 N  N    . PHE A 1 226 ? 25.700 16.977  9.271  1.00 27.41 ? 263 PHE A N    1 
ATOM   1710 C  CA   . PHE A 1 226 ? 26.005 18.385  9.069  1.00 28.20 ? 263 PHE A CA   1 
ATOM   1711 C  C    . PHE A 1 226 ? 26.917 18.963  10.143 1.00 29.35 ? 263 PHE A C    1 
ATOM   1712 O  O    . PHE A 1 226 ? 26.485 19.795  10.938 1.00 27.95 ? 263 PHE A O    1 
ATOM   1713 C  CB   . PHE A 1 226 ? 24.689 19.172  9.024  1.00 27.87 ? 263 PHE A CB   1 
ATOM   1714 C  CG   . PHE A 1 226 ? 23.653 18.564  8.096  1.00 28.78 ? 263 PHE A CG   1 
ATOM   1715 C  CD1  . PHE A 1 226 ? 23.952 18.329  6.749  1.00 27.72 ? 263 PHE A CD1  1 
ATOM   1716 C  CD2  . PHE A 1 226 ? 22.382 18.212  8.569  1.00 26.70 ? 263 PHE A CD2  1 
ATOM   1717 C  CE1  . PHE A 1 226 ? 22.982 17.742  5.880  1.00 29.49 ? 263 PHE A CE1  1 
ATOM   1718 C  CE2  . PHE A 1 226 ? 21.416 17.632  7.712  1.00 26.11 ? 263 PHE A CE2  1 
ATOM   1719 C  CZ   . PHE A 1 226 ? 21.703 17.393  6.377  1.00 26.47 ? 263 PHE A CZ   1 
ATOM   1720 N  N    . PRO A 1 227 ? 28.202 18.550  10.166 1.00 30.98 ? 264 PRO A N    1 
ATOM   1721 C  CA   . PRO A 1 227 ? 29.138 19.057  11.178 1.00 32.78 ? 264 PRO A CA   1 
ATOM   1722 C  C    . PRO A 1 227 ? 29.460 20.517  10.951 1.00 35.25 ? 264 PRO A C    1 
ATOM   1723 O  O    . PRO A 1 227 ? 28.834 21.183  10.124 1.00 36.77 ? 264 PRO A O    1 
ATOM   1724 C  CB   . PRO A 1 227 ? 30.374 18.179  10.986 1.00 32.21 ? 264 PRO A CB   1 
ATOM   1725 C  CG   . PRO A 1 227 ? 29.869 16.996  10.184 1.00 31.81 ? 264 PRO A CG   1 
ATOM   1726 C  CD   . PRO A 1 227 ? 28.897 17.631  9.250  1.00 31.08 ? 264 PRO A CD   1 
ATOM   1727 N  N    . GLY A 1 228 ? 30.447 21.024  11.672 1.00 37.67 ? 265 GLY A N    1 
ATOM   1728 C  CA   . GLY A 1 228 ? 30.820 22.412  11.471 1.00 38.79 ? 265 GLY A CA   1 
ATOM   1729 C  C    . GLY A 1 228 ? 31.134 23.160  12.743 1.00 39.67 ? 265 GLY A C    1 
ATOM   1730 O  O    . GLY A 1 228 ? 30.456 22.973  13.751 1.00 41.37 ? 265 GLY A O    1 
ATOM   1731 N  N    . ARG A 1 229 ? 32.154 24.014  12.683 1.00 39.69 ? 266 ARG A N    1 
ATOM   1732 C  CA   . ARG A 1 229 ? 32.570 24.805  13.826 1.00 39.79 ? 266 ARG A CA   1 
ATOM   1733 C  C    . ARG A 1 229 ? 31.418 25.675  14.319 1.00 39.85 ? 266 ARG A C    1 
ATOM   1734 O  O    . ARG A 1 229 ? 31.246 25.891  15.526 1.00 39.55 ? 266 ARG A O    1 
ATOM   1735 C  CB   . ARG A 1 229 ? 33.740 25.721  13.448 1.00 41.46 ? 266 ARG A CB   1 
ATOM   1736 C  CG   . ARG A 1 229 ? 35.080 25.032  13.189 1.00 43.22 ? 266 ARG A CG   1 
ATOM   1737 C  CD   . ARG A 1 229 ? 36.079 26.029  12.569 1.00 44.07 ? 266 ARG A CD   1 
ATOM   1738 N  NE   . ARG A 1 229 ? 35.575 26.628  11.324 1.00 45.16 ? 266 ARG A NE   1 
ATOM   1739 C  CZ   . ARG A 1 229 ? 36.247 27.488  10.550 1.00 44.82 ? 266 ARG A CZ   1 
ATOM   1740 N  NH1  . ARG A 1 229 ? 37.478 27.887  10.864 1.00 43.27 ? 266 ARG A NH1  1 
ATOM   1741 N  NH2  . ARG A 1 229 ? 35.687 27.938  9.434  1.00 44.06 ? 266 ARG A NH2  1 
ATOM   1742 N  N    . ASP A 1 230 ? 30.630 26.185  13.381 1.00 38.36 ? 267 ASP A N    1 
ATOM   1743 C  CA   . ASP A 1 230 ? 29.532 27.058  13.748 1.00 37.41 ? 267 ASP A CA   1 
ATOM   1744 C  C    . ASP A 1 230 ? 28.418 27.012  12.717 1.00 36.44 ? 267 ASP A C    1 
ATOM   1745 O  O    . ASP A 1 230 ? 28.489 26.272  11.743 1.00 34.36 ? 267 ASP A O    1 
ATOM   1746 C  CB   . ASP A 1 230 ? 30.063 28.481  13.880 1.00 40.53 ? 267 ASP A CB   1 
ATOM   1747 C  CG   . ASP A 1 230 ? 30.472 29.072  12.540 1.00 41.87 ? 267 ASP A CG   1 
ATOM   1748 O  OD1  . ASP A 1 230 ? 31.152 28.383  11.725 1.00 41.42 ? 267 ASP A OD1  1 
ATOM   1749 O  OD2  . ASP A 1 230 ? 30.113 30.241  12.310 1.00 44.07 ? 267 ASP A OD2  1 
ATOM   1750 N  N    . TYR A 1 231 ? 27.391 27.819  12.929 1.00 36.56 ? 268 TYR A N    1 
ATOM   1751 C  CA   . TYR A 1 231 ? 26.267 27.836  12.011 1.00 37.65 ? 268 TYR A CA   1 
ATOM   1752 C  C    . TYR A 1 231 ? 26.650 28.145  10.546 1.00 37.53 ? 268 TYR A C    1 
ATOM   1753 O  O    . TYR A 1 231 ? 25.893 27.814  9.622  1.00 37.27 ? 268 TYR A O    1 
ATOM   1754 C  CB   . TYR A 1 231 ? 25.204 28.838  12.498 1.00 38.10 ? 268 TYR A CB   1 
ATOM   1755 C  CG   . TYR A 1 231 ? 24.364 28.411  13.705 1.00 39.02 ? 268 TYR A CG   1 
ATOM   1756 C  CD1  . TYR A 1 231 ? 24.163 27.057  14.028 1.00 38.90 ? 268 TYR A CD1  1 
ATOM   1757 C  CD2  . TYR A 1 231 ? 23.697 29.367  14.474 1.00 38.63 ? 268 TYR A CD2  1 
ATOM   1758 C  CE1  . TYR A 1 231 ? 23.306 26.672  15.092 1.00 38.45 ? 268 TYR A CE1  1 
ATOM   1759 C  CE2  . TYR A 1 231 ? 22.841 28.995  15.527 1.00 39.96 ? 268 TYR A CE2  1 
ATOM   1760 C  CZ   . TYR A 1 231 ? 22.645 27.645  15.829 1.00 39.12 ? 268 TYR A CZ   1 
ATOM   1761 O  OH   . TYR A 1 231 ? 21.746 27.288  16.819 1.00 37.22 ? 268 TYR A OH   1 
ATOM   1762 N  N    . ILE A 1 232 ? 27.809 28.775  10.326 1.00 38.07 ? 269 ILE A N    1 
ATOM   1763 C  CA   . ILE A 1 232 ? 28.247 29.123  8.960  1.00 37.07 ? 269 ILE A CA   1 
ATOM   1764 C  C    . ILE A 1 232 ? 28.588 27.825  8.269  1.00 36.68 ? 269 ILE A C    1 
ATOM   1765 O  O    . ILE A 1 232 ? 27.998 27.492  7.243  1.00 37.62 ? 269 ILE A O    1 
ATOM   1766 C  CB   . ILE A 1 232 ? 29.502 30.046  8.933  1.00 36.69 ? 269 ILE A CB   1 
ATOM   1767 C  CG1  . ILE A 1 232 ? 29.196 31.403  9.597  1.00 37.45 ? 269 ILE A CG1  1 
ATOM   1768 C  CG2  . ILE A 1 232 ? 29.944 30.270  7.488  1.00 34.38 ? 269 ILE A CG2  1 
ATOM   1769 C  CD1  . ILE A 1 232 ? 28.252 32.338  8.809  1.00 36.57 ? 269 ILE A CD1  1 
ATOM   1770 N  N    . ASP A 1 233 ? 29.540 27.096  8.848  1.00 36.36 ? 270 ASP A N    1 
ATOM   1771 C  CA   . ASP A 1 233 ? 29.964 25.795  8.338  1.00 36.95 ? 270 ASP A CA   1 
ATOM   1772 C  C    . ASP A 1 233 ? 28.779 24.853  8.179  1.00 36.35 ? 270 ASP A C    1 
ATOM   1773 O  O    . ASP A 1 233 ? 28.608 24.220  7.137  1.00 36.75 ? 270 ASP A O    1 
ATOM   1774 C  CB   . ASP A 1 233 ? 30.941 25.137  9.308  1.00 37.00 ? 270 ASP A CB   1 
ATOM   1775 C  CG   . ASP A 1 233 ? 32.363 25.526  9.057  1.00 40.27 ? 270 ASP A CG   1 
ATOM   1776 O  OD1  . ASP A 1 233 ? 32.599 26.540  8.352  1.00 41.45 ? 270 ASP A OD1  1 
ATOM   1777 O  OD2  . ASP A 1 233 ? 33.259 24.810  9.576  1.00 41.08 ? 270 ASP A OD2  1 
ATOM   1778 N  N    . GLN A 1 234 ? 27.980 24.744  9.238  1.00 36.10 ? 271 GLN A N    1 
ATOM   1779 C  CA   . GLN A 1 234 ? 26.812 23.854  9.250  1.00 35.92 ? 271 GLN A CA   1 
ATOM   1780 C  C    . GLN A 1 234 ? 25.893 24.076  8.052  1.00 33.67 ? 271 GLN A C    1 
ATOM   1781 O  O    . GLN A 1 234 ? 25.543 23.128  7.346  1.00 33.01 ? 271 GLN A O    1 
ATOM   1782 C  CB   . GLN A 1 234 ? 26.028 24.046  10.549 1.00 35.99 ? 271 GLN A CB   1 
ATOM   1783 C  CG   . GLN A 1 234 ? 25.279 22.798  10.990 1.00 39.96 ? 271 GLN A CG   1 
ATOM   1784 C  CD   . GLN A 1 234 ? 24.715 22.944  12.382 1.00 42.56 ? 271 GLN A CD   1 
ATOM   1785 O  OE1  . GLN A 1 234 ? 25.418 23.372  13.314 1.00 43.17 ? 271 GLN A OE1  1 
ATOM   1786 N  NE2  . GLN A 1 234 ? 23.441 22.596  12.542 1.00 44.92 ? 271 GLN A NE2  1 
ATOM   1787 N  N    . TRP A 1 235 ? 25.500 25.330  7.843  1.00 32.03 ? 272 TRP A N    1 
ATOM   1788 C  CA   . TRP A 1 235 ? 24.644 25.673  6.723  1.00 31.62 ? 272 TRP A CA   1 
ATOM   1789 C  C    . TRP A 1 235 ? 25.291 25.257  5.395  1.00 31.64 ? 272 TRP A C    1 
ATOM   1790 O  O    . TRP A 1 235 ? 24.588 24.839  4.470  1.00 29.71 ? 272 TRP A O    1 
ATOM   1791 C  CB   . TRP A 1 235 ? 24.349 27.165  6.709  1.00 31.67 ? 272 TRP A CB   1 
ATOM   1792 C  CG   . TRP A 1 235 ? 23.435 27.539  5.580  1.00 34.53 ? 272 TRP A CG   1 
ATOM   1793 C  CD1  . TRP A 1 235 ? 23.769 28.221  4.441  1.00 34.23 ? 272 TRP A CD1  1 
ATOM   1794 C  CD2  . TRP A 1 235 ? 22.047 27.195  5.447  1.00 33.31 ? 272 TRP A CD2  1 
ATOM   1795 N  NE1  . TRP A 1 235 ? 22.678 28.320  3.611  1.00 33.97 ? 272 TRP A NE1  1 
ATOM   1796 C  CE2  . TRP A 1 235 ? 21.609 27.699  4.201  1.00 33.94 ? 272 TRP A CE2  1 
ATOM   1797 C  CE3  . TRP A 1 235 ? 21.134 26.508  6.255  1.00 32.47 ? 272 TRP A CE3  1 
ATOM   1798 C  CZ2  . TRP A 1 235 ? 20.295 27.541  3.747  1.00 33.70 ? 272 TRP A CZ2  1 
ATOM   1799 C  CZ3  . TRP A 1 235 ? 19.821 26.352  5.797  1.00 32.62 ? 272 TRP A CZ3  1 
ATOM   1800 C  CH2  . TRP A 1 235 ? 19.421 26.865  4.557  1.00 33.13 ? 272 TRP A CH2  1 
ATOM   1801 N  N    . ASN A 1 236 ? 26.620 25.369  5.295  1.00 30.76 ? 273 ASN A N    1 
ATOM   1802 C  CA   . ASN A 1 236 ? 27.292 24.956  4.062  1.00 32.27 ? 273 ASN A CA   1 
ATOM   1803 C  C    . ASN A 1 236 ? 27.126 23.453  3.883  1.00 32.28 ? 273 ASN A C    1 
ATOM   1804 O  O    . ASN A 1 236 ? 26.897 22.982  2.771  1.00 31.77 ? 273 ASN A O    1 
ATOM   1805 C  CB   . ASN A 1 236 ? 28.792 25.307  4.057  1.00 32.63 ? 273 ASN A CB   1 
ATOM   1806 C  CG   . ASN A 1 236 ? 29.047 26.811  3.997  1.00 33.60 ? 273 ASN A CG   1 
ATOM   1807 O  OD1  . ASN A 1 236 ? 28.167 27.592  3.615  1.00 33.50 ? 273 ASN A OD1  1 
ATOM   1808 N  ND2  . ASN A 1 236 ? 30.261 27.221  4.365  1.00 32.02 ? 273 ASN A ND2  1 
ATOM   1809 N  N    . LYS A 1 237 ? 27.235 22.692  4.967  1.00 31.91 ? 274 LYS A N    1 
ATOM   1810 C  CA   . LYS A 1 237 ? 27.053 21.247  4.862  1.00 32.56 ? 274 LYS A CA   1 
ATOM   1811 C  C    . LYS A 1 237 ? 25.595 20.924  4.484  1.00 32.40 ? 274 LYS A C    1 
ATOM   1812 O  O    . LYS A 1 237 ? 25.324 19.979  3.744  1.00 34.52 ? 274 LYS A O    1 
ATOM   1813 C  CB   . LYS A 1 237 ? 27.432 20.566  6.185  1.00 33.16 ? 274 LYS A CB   1 
ATOM   1814 C  CG   . LYS A 1 237 ? 28.916 20.531  6.467  1.00 33.51 ? 274 LYS A CG   1 
ATOM   1815 C  CD   . LYS A 1 237 ? 29.633 19.783  5.337  1.00 37.18 ? 274 LYS A CD   1 
ATOM   1816 C  CE   . LYS A 1 237 ? 31.130 19.593  5.640  1.00 39.12 ? 274 LYS A CE   1 
ATOM   1817 N  NZ   . LYS A 1 237 ? 31.918 19.006  4.495  1.00 39.80 ? 274 LYS A NZ   1 
ATOM   1818 N  N    . VAL A 1 238 ? 24.643 21.707  4.968  1.00 31.35 ? 275 VAL A N    1 
ATOM   1819 C  CA   . VAL A 1 238 ? 23.261 21.415  4.608  1.00 32.05 ? 275 VAL A CA   1 
ATOM   1820 C  C    . VAL A 1 238 ? 22.960 21.604  3.107  1.00 33.28 ? 275 VAL A C    1 
ATOM   1821 O  O    . VAL A 1 238 ? 22.369 20.724  2.477  1.00 31.65 ? 275 VAL A O    1 
ATOM   1822 C  CB   . VAL A 1 238 ? 22.275 22.283  5.406  1.00 31.40 ? 275 VAL A CB   1 
ATOM   1823 C  CG1  . VAL A 1 238 ? 20.836 22.022  4.921  1.00 33.50 ? 275 VAL A CG1  1 
ATOM   1824 C  CG2  . VAL A 1 238 ? 22.401 21.974  6.878  1.00 29.35 ? 275 VAL A CG2  1 
ATOM   1825 N  N    . ILE A 1 239 ? 23.366 22.739  2.531  1.00 34.12 ? 276 ILE A N    1 
ATOM   1826 C  CA   . ILE A 1 239 ? 23.069 22.996  1.126  1.00 34.66 ? 276 ILE A CA   1 
ATOM   1827 C  C    . ILE A 1 239 ? 23.900 22.175  0.142  1.00 36.44 ? 276 ILE A C    1 
ATOM   1828 O  O    . ILE A 1 239 ? 23.426 21.846  -0.947 1.00 37.86 ? 276 ILE A O    1 
ATOM   1829 C  CB   . ILE A 1 239 ? 23.173 24.505  0.799  1.00 32.65 ? 276 ILE A CB   1 
ATOM   1830 C  CG1  . ILE A 1 239 ? 24.552 25.038  1.179  1.00 30.92 ? 276 ILE A CG1  1 
ATOM   1831 C  CG2  . ILE A 1 239 ? 22.060 25.263  1.526  1.00 31.43 ? 276 ILE A CG2  1 
ATOM   1832 C  CD1  . ILE A 1 239 ? 24.737 26.488  0.877  1.00 25.87 ? 276 ILE A CD1  1 
ATOM   1833 N  N    . GLU A 1 240 ? 25.124 21.824  0.525  1.00 38.38 ? 277 GLU A N    1 
ATOM   1834 C  CA   . GLU A 1 240 ? 25.991 21.018  -0.334 1.00 39.80 ? 277 GLU A CA   1 
ATOM   1835 C  C    . GLU A 1 240 ? 25.440 19.602  -0.527 1.00 40.15 ? 277 GLU A C    1 
ATOM   1836 O  O    . GLU A 1 240 ? 25.824 18.921  -1.475 1.00 42.22 ? 277 GLU A O    1 
ATOM   1837 C  CB   . GLU A 1 240 ? 27.387 20.884  0.267  1.00 41.80 ? 277 GLU A CB   1 
ATOM   1838 C  CG   . GLU A 1 240 ? 28.214 22.147  0.293  1.00 45.23 ? 277 GLU A CG   1 
ATOM   1839 C  CD   . GLU A 1 240 ? 29.476 21.986  1.132  1.00 46.91 ? 277 GLU A CD   1 
ATOM   1840 O  OE1  . GLU A 1 240 ? 30.328 22.913  1.136  1.00 48.52 ? 277 GLU A OE1  1 
ATOM   1841 O  OE2  . GLU A 1 240 ? 29.616 20.930  1.794  1.00 47.45 ? 277 GLU A OE2  1 
ATOM   1842 N  N    . GLN A 1 241 ? 24.581 19.144  0.387  1.00 38.29 ? 278 GLN A N    1 
ATOM   1843 C  CA   . GLN A 1 241 ? 24.013 17.810  0.280  1.00 35.94 ? 278 GLN A CA   1 
ATOM   1844 C  C    . GLN A 1 241 ? 22.561 17.874  -0.142 1.00 35.62 ? 278 GLN A C    1 
ATOM   1845 O  O    . GLN A 1 241 ? 22.122 17.107  -0.998 1.00 36.45 ? 278 GLN A O    1 
ATOM   1846 C  CB   . GLN A 1 241 ? 24.130 17.042  1.608  1.00 36.59 ? 278 GLN A CB   1 
ATOM   1847 C  CG   . GLN A 1 241 ? 25.561 16.726  2.023  1.00 36.42 ? 278 GLN A CG   1 
ATOM   1848 C  CD   . GLN A 1 241 ? 25.653 15.984  3.347  1.00 36.52 ? 278 GLN A CD   1 
ATOM   1849 O  OE1  . GLN A 1 241 ? 25.412 14.777  3.417  1.00 37.23 ? 278 GLN A OE1  1 
ATOM   1850 N  NE2  . GLN A 1 241 ? 26.000 16.708  4.408  1.00 36.00 ? 278 GLN A NE2  1 
ATOM   1851 N  N    . LEU A 1 242 ? 21.794 18.789  0.422  1.00 34.28 ? 279 LEU A N    1 
ATOM   1852 C  CA   . LEU A 1 242 ? 20.387 18.831  0.032  1.00 34.90 ? 279 LEU A CA   1 
ATOM   1853 C  C    . LEU A 1 242 ? 20.106 19.884  -1.028 1.00 36.04 ? 279 LEU A C    1 
ATOM   1854 O  O    . LEU A 1 242 ? 19.021 19.908  -1.604 1.00 34.96 ? 279 LEU A O    1 
ATOM   1855 C  CB   . LEU A 1 242 ? 19.496 19.079  1.257  1.00 32.39 ? 279 LEU A CB   1 
ATOM   1856 C  CG   . LEU A 1 242 ? 19.724 18.170  2.479  1.00 31.66 ? 279 LEU A CG   1 
ATOM   1857 C  CD1  . LEU A 1 242 ? 18.707 18.541  3.555  1.00 28.73 ? 279 LEU A CD1  1 
ATOM   1858 C  CD2  . LEU A 1 242 ? 19.595 16.683  2.095  1.00 29.75 ? 279 LEU A CD2  1 
ATOM   1859 N  N    . GLY A 1 243 ? 21.081 20.755  -1.277 1.00 37.14 ? 280 GLY A N    1 
ATOM   1860 C  CA   . GLY A 1 243 ? 20.894 21.798  -2.270 1.00 37.74 ? 280 GLY A CA   1 
ATOM   1861 C  C    . GLY A 1 243 ? 20.272 23.063  -1.713 1.00 39.13 ? 280 GLY A C    1 
ATOM   1862 O  O    . GLY A 1 243 ? 19.698 23.069  -0.622 1.00 39.43 ? 280 GLY A O    1 
ATOM   1863 N  N    . THR A 1 244 ? 20.400 24.140  -2.480 1.00 39.31 ? 281 THR A N    1 
ATOM   1864 C  CA   . THR A 1 244 ? 19.877 25.444  -2.129 1.00 40.99 ? 281 THR A CA   1 
ATOM   1865 C  C    . THR A 1 244 ? 18.359 25.412  -2.002 1.00 43.11 ? 281 THR A C    1 
ATOM   1866 O  O    . THR A 1 244 ? 17.669 24.913  -2.881 1.00 43.91 ? 281 THR A O    1 
ATOM   1867 C  CB   . THR A 1 244 ? 20.226 26.485  -3.229 1.00 42.08 ? 281 THR A CB   1 
ATOM   1868 O  OG1  . THR A 1 244 ? 21.648 26.546  -3.419 1.00 41.02 ? 281 THR A OG1  1 
ATOM   1869 C  CG2  . THR A 1 244 ? 19.678 27.872  -2.852 1.00 41.81 ? 281 THR A CG2  1 
ATOM   1870 N  N    . PRO A 1 245 ? 17.815 25.985  -0.924 1.00 44.56 ? 282 PRO A N    1 
ATOM   1871 C  CA   . PRO A 1 245 ? 16.366 26.018  -0.700 1.00 45.90 ? 282 PRO A CA   1 
ATOM   1872 C  C    . PRO A 1 245 ? 15.624 26.691  -1.871 1.00 48.11 ? 282 PRO A C    1 
ATOM   1873 O  O    . PRO A 1 245 ? 16.216 27.457  -2.638 1.00 47.31 ? 282 PRO A O    1 
ATOM   1874 C  CB   . PRO A 1 245 ? 16.225 26.859  0.571  1.00 45.12 ? 282 PRO A CB   1 
ATOM   1875 C  CG   . PRO A 1 245 ? 17.530 26.759  1.231  1.00 45.26 ? 282 PRO A CG   1 
ATOM   1876 C  CD   . PRO A 1 245 ? 18.533 26.722  0.131  1.00 44.65 ? 282 PRO A CD   1 
ATOM   1877 N  N    . CYS A 1 246 ? 14.321 26.431  -1.975 1.00 50.20 ? 283 CYS A N    1 
ATOM   1878 C  CA   . CYS A 1 246 ? 13.495 27.035  -3.019 1.00 51.78 ? 283 CYS A CA   1 
ATOM   1879 C  C    . CYS A 1 246 ? 13.322 28.542  -2.759 1.00 52.58 ? 283 CYS A C    1 
ATOM   1880 O  O    . CYS A 1 246 ? 13.327 29.001  -1.604 1.00 52.71 ? 283 CYS A O    1 
ATOM   1881 C  CB   . CYS A 1 246 ? 12.115 26.359  -3.076 1.00 52.28 ? 283 CYS A CB   1 
ATOM   1882 S  SG   . CYS A 1 246 ? 11.130 26.435  -1.528 1.00 55.14 ? 283 CYS A SG   1 
ATOM   1883 N  N    . PRO A 1 247 ? 13.179 29.333  -3.839 1.00 52.62 ? 284 PRO A N    1 
ATOM   1884 C  CA   . PRO A 1 247 ? 13.003 30.784  -3.744 1.00 52.01 ? 284 PRO A CA   1 
ATOM   1885 C  C    . PRO A 1 247 ? 12.011 31.217  -2.670 1.00 51.15 ? 284 PRO A C    1 
ATOM   1886 O  O    . PRO A 1 247 ? 12.309 32.132  -1.895 1.00 52.35 ? 284 PRO A O    1 
ATOM   1887 C  CB   . PRO A 1 247 ? 12.565 31.165  -5.158 1.00 52.54 ? 284 PRO A CB   1 
ATOM   1888 C  CG   . PRO A 1 247 ? 13.445 30.249  -5.996 1.00 52.06 ? 284 PRO A CG   1 
ATOM   1889 C  CD   . PRO A 1 247 ? 13.323 28.913  -5.249 1.00 52.90 ? 284 PRO A CD   1 
ATOM   1890 N  N    . GLU A 1 248 ? 10.849 30.562  -2.604 1.00 50.18 ? 285 GLU A N    1 
ATOM   1891 C  CA   . GLU A 1 248 ? 9.831  30.903  -1.600 1.00 48.57 ? 285 GLU A CA   1 
ATOM   1892 C  C    . GLU A 1 248 ? 10.359 30.827  -0.172 1.00 48.44 ? 285 GLU A C    1 
ATOM   1893 O  O    . GLU A 1 248 ? 10.058 31.703  0.642  1.00 50.60 ? 285 GLU A O    1 
ATOM   1894 C  CB   . GLU A 1 248 ? 8.630  29.993  -1.747 1.00 49.36 ? 285 GLU A CB   1 
ATOM   1895 N  N    . PHE A 1 249 ? 11.143 29.787  0.132  1.00 46.45 ? 286 PHE A N    1 
ATOM   1896 C  CA   . PHE A 1 249 ? 11.721 29.598  1.466  1.00 44.26 ? 286 PHE A CA   1 
ATOM   1897 C  C    . PHE A 1 249 ? 12.419 30.884  1.914  1.00 44.50 ? 286 PHE A C    1 
ATOM   1898 O  O    . PHE A 1 249 ? 12.312 31.292  3.067  1.00 42.90 ? 286 PHE A O    1 
ATOM   1899 C  CB   . PHE A 1 249 ? 12.734 28.444  1.453  1.00 42.38 ? 286 PHE A CB   1 
ATOM   1900 C  CG   . PHE A 1 249 ? 13.391 28.179  2.797  1.00 39.44 ? 286 PHE A CG   1 
ATOM   1901 C  CD1  . PHE A 1 249 ? 12.647 27.701  3.874  1.00 38.25 ? 286 PHE A CD1  1 
ATOM   1902 C  CD2  . PHE A 1 249 ? 14.756 28.411  2.984  1.00 36.73 ? 286 PHE A CD2  1 
ATOM   1903 C  CE1  . PHE A 1 249 ? 13.263 27.460  5.116  1.00 37.34 ? 286 PHE A CE1  1 
ATOM   1904 C  CE2  . PHE A 1 249 ? 15.361 28.172  4.218  1.00 34.77 ? 286 PHE A CE2  1 
ATOM   1905 C  CZ   . PHE A 1 249 ? 14.618 27.700  5.280  1.00 33.62 ? 286 PHE A CZ   1 
ATOM   1906 N  N    . MET A 1 250 ? 13.123 31.519  0.983  1.00 46.23 ? 287 MET A N    1 
ATOM   1907 C  CA   . MET A 1 250 ? 13.838 32.757  1.266  1.00 48.10 ? 287 MET A CA   1 
ATOM   1908 C  C    . MET A 1 250 ? 12.934 33.885  1.793  1.00 49.61 ? 287 MET A C    1 
ATOM   1909 O  O    . MET A 1 250 ? 13.322 34.607  2.722  1.00 50.19 ? 287 MET A O    1 
ATOM   1910 C  CB   . MET A 1 250 ? 14.569 33.228  0.012  1.00 46.88 ? 287 MET A CB   1 
ATOM   1911 C  CG   . MET A 1 250 ? 15.412 32.149  -0.646 1.00 47.59 ? 287 MET A CG   1 
ATOM   1912 S  SD   . MET A 1 250 ? 16.572 31.376  0.506  1.00 48.34 ? 287 MET A SD   1 
ATOM   1913 C  CE   . MET A 1 250 ? 17.918 30.750  -0.628 1.00 45.11 ? 287 MET A CE   1 
ATOM   1914 N  N    . LYS A 1 251 ? 11.730 34.017  1.232  1.00 50.80 ? 288 LYS A N    1 
ATOM   1915 C  CA   . LYS A 1 251 ? 10.803 35.077  1.649  1.00 52.07 ? 288 LYS A CA   1 
ATOM   1916 C  C    . LYS A 1 251 ? 10.431 34.969  3.109  1.00 52.63 ? 288 LYS A C    1 
ATOM   1917 O  O    . LYS A 1 251 ? 9.886  35.913  3.702  1.00 52.76 ? 288 LYS A O    1 
ATOM   1918 C  CB   . LYS A 1 251 ? 9.525  35.057  0.797  1.00 54.38 ? 288 LYS A CB   1 
ATOM   1919 C  CG   . LYS A 1 251 ? 9.767  34.994  -0.721 1.00 57.06 ? 288 LYS A CG   1 
ATOM   1920 C  CD   . LYS A 1 251 ? 10.620 36.169  -1.240 1.00 59.10 ? 288 LYS A CD   1 
ATOM   1921 C  CE   . LYS A 1 251 ? 12.120 35.992  -0.960 1.00 58.98 ? 288 LYS A CE   1 
ATOM   1922 N  NZ   . LYS A 1 251 ? 12.957 37.127  -1.507 1.00 60.01 ? 288 LYS A NZ   1 
ATOM   1923 N  N    . LYS A 1 252 ? 10.736 33.815  3.691  1.00 52.09 ? 289 LYS A N    1 
ATOM   1924 C  CA   . LYS A 1 252 ? 10.447 33.569  5.092  1.00 51.52 ? 289 LYS A CA   1 
ATOM   1925 C  C    . LYS A 1 252 ? 11.620 34.038  5.970  1.00 50.76 ? 289 LYS A C    1 
ATOM   1926 O  O    . LYS A 1 252 ? 11.541 34.006  7.203  1.00 49.95 ? 289 LYS A O    1 
ATOM   1927 C  CB   . LYS A 1 252 ? 10.195 32.070  5.284  1.00 53.49 ? 289 LYS A CB   1 
ATOM   1928 C  CG   . LYS A 1 252 ? 9.250  31.475  4.221  1.00 55.50 ? 289 LYS A CG   1 
ATOM   1929 C  CD   . LYS A 1 252 ? 7.936  32.244  4.197  1.00 56.29 ? 289 LYS A CD   1 
ATOM   1930 C  CE   . LYS A 1 252 ? 6.996  31.738  3.133  1.00 57.82 ? 289 LYS A CE   1 
ATOM   1931 N  NZ   . LYS A 1 252 ? 5.761  32.592  3.171  1.00 58.68 ? 289 LYS A NZ   1 
ATOM   1932 N  N    . LEU A 1 253 ? 12.696 34.478  5.316  1.00 49.39 ? 290 LEU A N    1 
ATOM   1933 C  CA   . LEU A 1 253 ? 13.913 34.937  5.996  1.00 49.44 ? 290 LEU A CA   1 
ATOM   1934 C  C    . LEU A 1 253 ? 13.995 36.444  6.300  1.00 49.89 ? 290 LEU A C    1 
ATOM   1935 O  O    . LEU A 1 253 ? 13.449 37.264  5.553  1.00 50.41 ? 290 LEU A O    1 
ATOM   1936 C  CB   . LEU A 1 253 ? 15.139 34.547  5.157  1.00 46.19 ? 290 LEU A CB   1 
ATOM   1937 C  CG   . LEU A 1 253 ? 15.327 33.048  4.959  1.00 44.77 ? 290 LEU A CG   1 
ATOM   1938 C  CD1  . LEU A 1 253 ? 16.450 32.810  3.996  1.00 42.54 ? 290 LEU A CD1  1 
ATOM   1939 C  CD2  . LEU A 1 253 ? 15.622 32.387  6.311  1.00 44.06 ? 290 LEU A CD2  1 
ATOM   1940 N  N    . GLN A 1 254 ? 14.682 36.794  7.396  1.00 49.95 ? 291 GLN A N    1 
ATOM   1941 C  CA   . GLN A 1 254 ? 14.902 38.198  7.777  1.00 49.90 ? 291 GLN A CA   1 
ATOM   1942 C  C    . GLN A 1 254 ? 15.712 38.772  6.606  1.00 49.32 ? 291 GLN A C    1 
ATOM   1943 O  O    . GLN A 1 254 ? 16.586 38.096  6.055  1.00 49.37 ? 291 GLN A O    1 
ATOM   1944 C  CB   . GLN A 1 254 ? 15.708 38.274  9.094  1.00 51.44 ? 291 GLN A CB   1 
ATOM   1945 C  CG   . GLN A 1 254 ? 16.733 39.428  9.188  1.00 53.93 ? 291 GLN A CG   1 
ATOM   1946 C  CD   . GLN A 1 254 ? 16.221 40.646  9.956  1.00 53.57 ? 291 GLN A CD   1 
ATOM   1947 O  OE1  . GLN A 1 254 ? 16.535 41.791  9.614  1.00 52.76 ? 291 GLN A OE1  1 
ATOM   1948 N  NE2  . GLN A 1 254 ? 15.445 40.399  11.008 1.00 54.93 ? 291 GLN A NE2  1 
ATOM   1949 N  N    . PRO A 1 255 ? 15.428 40.018  6.198  1.00 48.58 ? 292 PRO A N    1 
ATOM   1950 C  CA   . PRO A 1 255 ? 16.151 40.633  5.077  1.00 47.65 ? 292 PRO A CA   1 
ATOM   1951 C  C    . PRO A 1 255 ? 17.671 40.485  5.114  1.00 45.87 ? 292 PRO A C    1 
ATOM   1952 O  O    . PRO A 1 255 ? 18.313 40.335  4.080  1.00 45.94 ? 292 PRO A O    1 
ATOM   1953 C  CB   . PRO A 1 255 ? 15.710 42.092  5.148  1.00 48.14 ? 292 PRO A CB   1 
ATOM   1954 C  CG   . PRO A 1 255 ? 14.292 41.975  5.672  1.00 49.14 ? 292 PRO A CG   1 
ATOM   1955 C  CD   . PRO A 1 255 ? 14.459 40.962  6.787  1.00 49.12 ? 292 PRO A CD   1 
ATOM   1956 N  N    . THR A 1 256 ? 18.241 40.546  6.311  1.00 45.36 ? 293 THR A N    1 
ATOM   1957 C  CA   . THR A 1 256 ? 19.685 40.412  6.499  1.00 44.69 ? 293 THR A CA   1 
ATOM   1958 C  C    . THR A 1 256 ? 20.155 38.988  6.227  1.00 43.14 ? 293 THR A C    1 
ATOM   1959 O  O    . THR A 1 256 ? 21.023 38.762  5.388  1.00 43.41 ? 293 THR A O    1 
ATOM   1960 C  CB   . THR A 1 256 ? 20.083 40.758  7.928  1.00 45.88 ? 293 THR A CB   1 
ATOM   1961 O  OG1  . THR A 1 256 ? 19.406 41.956  8.334  1.00 48.18 ? 293 THR A OG1  1 
ATOM   1962 C  CG2  . THR A 1 256 ? 21.584 40.971  8.005  1.00 45.57 ? 293 THR A CG2  1 
ATOM   1963 N  N    . VAL A 1 257 ? 19.588 38.034  6.960  1.00 41.86 ? 294 VAL A N    1 
ATOM   1964 C  CA   . VAL A 1 257 ? 19.912 36.617  6.799  1.00 40.23 ? 294 VAL A CA   1 
ATOM   1965 C  C    . VAL A 1 257 ? 19.638 36.221  5.363  1.00 40.76 ? 294 VAL A C    1 
ATOM   1966 O  O    . VAL A 1 257 ? 20.473 35.597  4.693  1.00 40.02 ? 294 VAL A O    1 
ATOM   1967 C  CB   . VAL A 1 257 ? 19.015 35.731  7.679  1.00 39.37 ? 294 VAL A CB   1 
ATOM   1968 C  CG1  . VAL A 1 257 ? 19.341 34.265  7.446  1.00 37.30 ? 294 VAL A CG1  1 
ATOM   1969 C  CG2  . VAL A 1 257 ? 19.173 36.120  9.136  1.00 39.37 ? 294 VAL A CG2  1 
ATOM   1970 N  N    . ARG A 1 258 ? 18.439 36.571  4.909  1.00 41.15 ? 295 ARG A N    1 
ATOM   1971 C  CA   . ARG A 1 258 ? 18.019 36.277  3.550  1.00 42.14 ? 295 ARG A CA   1 
ATOM   1972 C  C    . ARG A 1 258 ? 19.107 36.702  2.555  1.00 40.66 ? 295 ARG A C    1 
ATOM   1973 O  O    . ARG A 1 258 ? 19.445 35.966  1.631  1.00 41.02 ? 295 ARG A O    1 
ATOM   1974 C  CB   . ARG A 1 258 ? 16.690 36.993  3.257  1.00 44.27 ? 295 ARG A CB   1 
ATOM   1975 C  CG   . ARG A 1 258 ? 16.227 36.817  1.828  1.00 48.91 ? 295 ARG A CG   1 
ATOM   1976 C  CD   . ARG A 1 258 ? 14.708 36.950  1.646  1.00 52.39 ? 295 ARG A CD   1 
ATOM   1977 N  NE   . ARG A 1 258 ? 14.162 38.142  2.286  1.00 55.22 ? 295 ARG A NE   1 
ATOM   1978 C  CZ   . ARG A 1 258 ? 13.164 38.875  1.796  1.00 57.18 ? 295 ARG A CZ   1 
ATOM   1979 N  NH1  . ARG A 1 258 ? 12.584 38.549  0.637  1.00 55.49 ? 295 ARG A NH1  1 
ATOM   1980 N  NH2  . ARG A 1 258 ? 12.748 39.944  2.478  1.00 57.89 ? 295 ARG A NH2  1 
ATOM   1981 N  N    . ASN A 1 259 ? 19.657 37.894  2.760  1.00 40.69 ? 296 ASN A N    1 
ATOM   1982 C  CA   . ASN A 1 259 ? 20.715 38.429  1.903  1.00 39.86 ? 296 ASN A CA   1 
ATOM   1983 C  C    . ASN A 1 259 ? 21.855 37.422  1.899  1.00 38.70 ? 296 ASN A C    1 
ATOM   1984 O  O    . ASN A 1 259 ? 22.304 36.981  0.848  1.00 38.46 ? 296 ASN A O    1 
ATOM   1985 C  CB   . ASN A 1 259 ? 21.186 39.768  2.477  1.00 41.30 ? 296 ASN A CB   1 
ATOM   1986 C  CG   . ASN A 1 259 ? 22.219 40.456  1.612  1.00 42.27 ? 296 ASN A CG   1 
ATOM   1987 O  OD1  . ASN A 1 259 ? 23.373 40.018  1.507  1.00 42.79 ? 296 ASN A OD1  1 
ATOM   1988 N  ND2  . ASN A 1 259 ? 21.809 41.549  0.983  1.00 43.74 ? 296 ASN A ND2  1 
ATOM   1989 N  N    . TYR A 1 260 ? 22.299 37.044  3.098  1.00 39.40 ? 297 TYR A N    1 
ATOM   1990 C  CA   . TYR A 1 260 ? 23.383 36.070  3.279  1.00 38.48 ? 297 TYR A CA   1 
ATOM   1991 C  C    . TYR A 1 260 ? 23.139 34.706  2.616  1.00 37.34 ? 297 TYR A C    1 
ATOM   1992 O  O    . TYR A 1 260 ? 24.032 34.169  1.973  1.00 37.69 ? 297 TYR A O    1 
ATOM   1993 C  CB   . TYR A 1 260 ? 23.656 35.849  4.775  1.00 38.05 ? 297 TYR A CB   1 
ATOM   1994 C  CG   . TYR A 1 260 ? 24.667 34.751  5.021  1.00 38.31 ? 297 TYR A CG   1 
ATOM   1995 C  CD1  . TYR A 1 260 ? 25.988 34.888  4.589  1.00 37.87 ? 297 TYR A CD1  1 
ATOM   1996 C  CD2  . TYR A 1 260 ? 24.289 33.550  5.618  1.00 37.88 ? 297 TYR A CD2  1 
ATOM   1997 C  CE1  . TYR A 1 260 ? 26.902 33.856  4.741  1.00 38.31 ? 297 TYR A CE1  1 
ATOM   1998 C  CE2  . TYR A 1 260 ? 25.196 32.513  5.772  1.00 38.14 ? 297 TYR A CE2  1 
ATOM   1999 C  CZ   . TYR A 1 260 ? 26.501 32.676  5.329  1.00 37.61 ? 297 TYR A CZ   1 
ATOM   2000 O  OH   . TYR A 1 260 ? 27.413 31.655  5.463  1.00 39.44 ? 297 TYR A OH   1 
ATOM   2001 N  N    . VAL A 1 261 ? 21.949 34.134  2.777  1.00 38.44 ? 298 VAL A N    1 
ATOM   2002 C  CA   . VAL A 1 261 ? 21.686 32.823  2.176  1.00 40.06 ? 298 VAL A CA   1 
ATOM   2003 C  C    . VAL A 1 261 ? 21.399 32.945  0.693  1.00 41.35 ? 298 VAL A C    1 
ATOM   2004 O  O    . VAL A 1 261 ? 21.757 32.048  -0.086 1.00 40.61 ? 298 VAL A O    1 
ATOM   2005 C  CB   . VAL A 1 261 ? 20.499 32.080  2.846  1.00 40.08 ? 298 VAL A CB   1 
ATOM   2006 C  CG1  . VAL A 1 261 ? 20.826 31.777  4.312  1.00 39.33 ? 298 VAL A CG1  1 
ATOM   2007 C  CG2  . VAL A 1 261 ? 19.241 32.912  2.742  1.00 40.44 ? 298 VAL A CG2  1 
ATOM   2008 N  N    . GLU A 1 262 ? 20.772 34.059  0.299  1.00 42.84 ? 299 GLU A N    1 
ATOM   2009 C  CA   . GLU A 1 262 ? 20.446 34.274  -1.111 1.00 44.50 ? 299 GLU A CA   1 
ATOM   2010 C  C    . GLU A 1 262 ? 21.714 34.539  -1.876 1.00 43.91 ? 299 GLU A C    1 
ATOM   2011 O  O    . GLU A 1 262 ? 21.784 34.241  -3.059 1.00 43.83 ? 299 GLU A O    1 
ATOM   2012 C  CB   . GLU A 1 262 ? 19.459 35.445  -1.307 1.00 45.17 ? 299 GLU A CB   1 
ATOM   2013 C  CG   . GLU A 1 262 ? 18.069 35.173  -0.714 1.00 49.61 ? 299 GLU A CG   1 
ATOM   2014 C  CD   . GLU A 1 262 ? 17.081 36.311  -0.927 1.00 50.66 ? 299 GLU A CD   1 
ATOM   2015 O  OE1  . GLU A 1 262 ? 17.457 37.483  -0.712 1.00 52.70 ? 299 GLU A OE1  1 
ATOM   2016 O  OE2  . GLU A 1 262 ? 15.918 36.040  -1.292 1.00 52.62 ? 299 GLU A OE2  1 
ATOM   2017 N  N    . ASN A 1 263 ? 22.724 35.075  -1.192 1.00 45.54 ? 300 ASN A N    1 
ATOM   2018 C  CA   . ASN A 1 263 ? 24.004 35.381  -1.837 1.00 46.48 ? 300 ASN A CA   1 
ATOM   2019 C  C    . ASN A 1 263 ? 25.059 34.325  -1.620 1.00 46.33 ? 300 ASN A C    1 
ATOM   2020 O  O    . ASN A 1 263 ? 26.250 34.554  -1.840 1.00 47.44 ? 300 ASN A O    1 
ATOM   2021 C  CB   . ASN A 1 263 ? 24.538 36.742  -1.384 1.00 47.74 ? 300 ASN A CB   1 
ATOM   2022 C  CG   . ASN A 1 263 ? 23.709 37.891  -1.926 1.00 48.11 ? 300 ASN A CG   1 
ATOM   2023 O  OD1  . ASN A 1 263 ? 23.272 37.862  -3.079 1.00 49.38 ? 300 ASN A OD1  1 
ATOM   2024 N  ND2  . ASN A 1 263 ? 23.499 38.913  -1.107 1.00 49.15 ? 300 ASN A ND2  1 
ATOM   2025 N  N    . ARG A 1 264 ? 24.615 33.159  -1.183 1.00 47.00 ? 301 ARG A N    1 
ATOM   2026 C  CA   . ARG A 1 264 ? 25.498 32.019  -0.945 1.00 46.80 ? 301 ARG A CA   1 
ATOM   2027 C  C    . ARG A 1 264 ? 25.523 31.228  -2.278 1.00 46.54 ? 301 ARG A C    1 
ATOM   2028 O  O    . ARG A 1 264 ? 24.550 31.298  -3.047 1.00 45.05 ? 301 ARG A O    1 
ATOM   2029 C  CB   . ARG A 1 264 ? 24.870 31.158  0.166  1.00 47.77 ? 301 ARG A CB   1 
ATOM   2030 C  CG   . ARG A 1 264 ? 25.855 30.373  1.007  1.00 48.57 ? 301 ARG A CG   1 
ATOM   2031 C  CD   . ARG A 1 264 ? 26.517 31.240  2.068  1.00 49.61 ? 301 ARG A CD   1 
ATOM   2032 N  NE   . ARG A 1 264 ? 27.792 30.656  2.495  1.00 52.81 ? 301 ARG A NE   1 
ATOM   2033 C  CZ   . ARG A 1 264 ? 28.915 30.689  1.777  1.00 54.11 ? 301 ARG A CZ   1 
ATOM   2034 N  NH1  . ARG A 1 264 ? 28.922 31.296  0.595  1.00 55.83 ? 301 ARG A NH1  1 
ATOM   2035 N  NH2  . ARG A 1 264 ? 30.023 30.088  2.219  1.00 54.22 ? 301 ARG A NH2  1 
ATOM   2036 N  N    . PRO A 1 265 ? 26.625 30.496  -2.583 1.00 45.68 ? 302 PRO A N    1 
ATOM   2037 C  CA   . PRO A 1 265 ? 26.731 29.699  -3.821 1.00 47.24 ? 302 PRO A CA   1 
ATOM   2038 C  C    . PRO A 1 265 ? 25.519 28.762  -3.969 1.00 48.65 ? 302 PRO A C    1 
ATOM   2039 O  O    . PRO A 1 265 ? 25.104 28.117  -2.990 1.00 49.63 ? 302 PRO A O    1 
ATOM   2040 C  CB   . PRO A 1 265 ? 28.027 28.909  -3.618 1.00 45.74 ? 302 PRO A CB   1 
ATOM   2041 C  CG   . PRO A 1 265 ? 28.874 29.911  -2.906 1.00 45.83 ? 302 PRO A CG   1 
ATOM   2042 C  CD   . PRO A 1 265 ? 27.919 30.516  -1.877 1.00 46.10 ? 302 PRO A CD   1 
ATOM   2043 N  N    . LYS A 1 266 ? 24.958 28.679  -5.174 1.00 48.61 ? 303 LYS A N    1 
ATOM   2044 C  CA   . LYS A 1 266 ? 23.791 27.833  -5.401 1.00 49.94 ? 303 LYS A CA   1 
ATOM   2045 C  C    . LYS A 1 266 ? 24.144 26.375  -5.710 1.00 49.58 ? 303 LYS A C    1 
ATOM   2046 O  O    . LYS A 1 266 ? 24.740 26.094  -6.737 1.00 50.21 ? 303 LYS A O    1 
ATOM   2047 C  CB   . LYS A 1 266 ? 22.936 28.436  -6.530 1.00 50.66 ? 303 LYS A CB   1 
ATOM   2048 C  CG   . LYS A 1 266 ? 22.636 29.929  -6.331 1.00 52.24 ? 303 LYS A CG   1 
ATOM   2049 C  CD   . LYS A 1 266 ? 21.357 30.379  -7.063 1.00 53.61 ? 303 LYS A CD   1 
ATOM   2050 C  CE   . LYS A 1 266 ? 21.468 30.330  -8.588 1.00 54.68 ? 303 LYS A CE   1 
ATOM   2051 N  NZ   . LYS A 1 266 ? 21.616 28.945  -9.155 1.00 53.74 ? 303 LYS A NZ   1 
ATOM   2052 N  N    . TYR A 1 267 ? 23.770 25.452  -4.817 1.00 49.77 ? 304 TYR A N    1 
ATOM   2053 C  CA   . TYR A 1 267 ? 24.039 24.017  -5.000 1.00 48.16 ? 304 TYR A CA   1 
ATOM   2054 C  C    . TYR A 1 267 ? 22.820 23.258  -5.540 1.00 46.54 ? 304 TYR A C    1 
ATOM   2055 O  O    . TYR A 1 267 ? 21.675 23.587  -5.229 1.00 44.69 ? 304 TYR A O    1 
ATOM   2056 C  CB   . TYR A 1 267 ? 24.477 23.389  -3.679 1.00 50.04 ? 304 TYR A CB   1 
ATOM   2057 C  CG   . TYR A 1 267 ? 25.899 23.710  -3.272 1.00 52.28 ? 304 TYR A CG   1 
ATOM   2058 C  CD1  . TYR A 1 267 ? 26.947 22.849  -3.598 1.00 52.37 ? 304 TYR A CD1  1 
ATOM   2059 C  CD2  . TYR A 1 267 ? 26.194 24.864  -2.530 1.00 53.32 ? 304 TYR A CD2  1 
ATOM   2060 C  CE1  . TYR A 1 267 ? 28.259 23.119  -3.190 1.00 54.49 ? 304 TYR A CE1  1 
ATOM   2061 C  CE2  . TYR A 1 267 ? 27.503 25.150  -2.117 1.00 54.45 ? 304 TYR A CE2  1 
ATOM   2062 C  CZ   . TYR A 1 267 ? 28.529 24.273  -2.451 1.00 54.90 ? 304 TYR A CZ   1 
ATOM   2063 O  OH   . TYR A 1 267 ? 29.823 24.556  -2.064 1.00 55.94 ? 304 TYR A OH   1 
ATOM   2064 N  N    . ALA A 1 268 ? 23.082 22.249  -6.364 1.00 46.05 ? 305 ALA A N    1 
ATOM   2065 C  CA   . ALA A 1 268 ? 22.028 21.444  -6.962 1.00 44.90 ? 305 ALA A CA   1 
ATOM   2066 C  C    . ALA A 1 268 ? 21.497 20.470  -5.927 1.00 45.37 ? 305 ALA A C    1 
ATOM   2067 O  O    . ALA A 1 268 ? 20.294 20.167  -5.880 1.00 45.52 ? 305 ALA A O    1 
ATOM   2068 C  CB   . ALA A 1 268 ? 22.583 20.681  -8.163 1.00 44.98 ? 305 ALA A CB   1 
ATOM   2069 N  N    . GLY A 1 269 ? 22.407 19.986  -5.091 1.00 43.74 ? 306 GLY A N    1 
ATOM   2070 C  CA   . GLY A 1 269 ? 22.011 19.044  -4.075 1.00 45.13 ? 306 GLY A CA   1 
ATOM   2071 C  C    . GLY A 1 269 ? 22.035 17.652  -4.659 1.00 44.83 ? 306 GLY A C    1 
ATOM   2072 O  O    . GLY A 1 269 ? 21.882 17.483  -5.873 1.00 45.84 ? 306 GLY A O    1 
ATOM   2073 N  N    . LEU A 1 270 ? 22.217 16.660  -3.795 1.00 43.26 ? 307 LEU A N    1 
ATOM   2074 C  CA   . LEU A 1 270 ? 22.291 15.270  -4.212 1.00 41.88 ? 307 LEU A CA   1 
ATOM   2075 C  C    . LEU A 1 270 ? 20.990 14.536  -3.939 1.00 41.54 ? 307 LEU A C    1 
ATOM   2076 O  O    . LEU A 1 270 ? 20.191 14.950  -3.099 1.00 40.45 ? 307 LEU A O    1 
ATOM   2077 C  CB   . LEU A 1 270 ? 23.429 14.574  -3.475 1.00 42.28 ? 307 LEU A CB   1 
ATOM   2078 C  CG   . LEU A 1 270 ? 24.865 15.076  -3.696 1.00 42.33 ? 307 LEU A CG   1 
ATOM   2079 C  CD1  . LEU A 1 270 ? 24.967 16.577  -3.560 1.00 42.68 ? 307 LEU A CD1  1 
ATOM   2080 C  CD2  . LEU A 1 270 ? 25.767 14.399  -2.678 1.00 40.89 ? 307 LEU A CD2  1 
ATOM   2081 N  N    . THR A 1 271 ? 20.786 13.444  -4.669 1.00 41.00 ? 308 THR A N    1 
ATOM   2082 C  CA   . THR A 1 271 ? 19.595 12.629  -4.523 1.00 39.75 ? 308 THR A CA   1 
ATOM   2083 C  C    . THR A 1 271 ? 19.803 11.755  -3.294 1.00 38.79 ? 308 THR A C    1 
ATOM   2084 O  O    . THR A 1 271 ? 20.939 11.463  -2.895 1.00 37.31 ? 308 THR A O    1 
ATOM   2085 C  CB   . THR A 1 271 ? 19.405 11.691  -5.727 1.00 41.03 ? 308 THR A CB   1 
ATOM   2086 O  OG1  . THR A 1 271 ? 20.557 10.835  -5.846 1.00 41.65 ? 308 THR A OG1  1 
ATOM   2087 C  CG2  . THR A 1 271 ? 19.192 12.492  -7.005 1.00 40.34 ? 308 THR A CG2  1 
ATOM   2088 N  N    . PHE A 1 272 ? 18.712 11.313  -2.696 1.00 35.94 ? 309 PHE A N    1 
ATOM   2089 C  CA   . PHE A 1 272 ? 18.869 10.484  -1.529 1.00 35.68 ? 309 PHE A CA   1 
ATOM   2090 C  C    . PHE A 1 272 ? 19.575 9.143   -1.740 1.00 35.09 ? 309 PHE A C    1 
ATOM   2091 O  O    . PHE A 1 272 ? 20.219 8.645   -0.815 1.00 34.05 ? 309 PHE A O    1 
ATOM   2092 C  CB   . PHE A 1 272 ? 17.522 10.352  -0.827 1.00 33.58 ? 309 PHE A CB   1 
ATOM   2093 C  CG   . PHE A 1 272 ? 17.205 11.556  0.012  1.00 33.64 ? 309 PHE A CG   1 
ATOM   2094 C  CD1  . PHE A 1 272 ? 16.849 12.770  -0.582 1.00 33.95 ? 309 PHE A CD1  1 
ATOM   2095 C  CD2  . PHE A 1 272 ? 17.418 11.526  1.386  1.00 32.40 ? 309 PHE A CD2  1 
ATOM   2096 C  CE1  . PHE A 1 272 ? 16.726 13.935  0.186  1.00 33.34 ? 309 PHE A CE1  1 
ATOM   2097 C  CE2  . PHE A 1 272 ? 17.301 12.674  2.157  1.00 31.65 ? 309 PHE A CE2  1 
ATOM   2098 C  CZ   . PHE A 1 272 ? 16.955 13.883  1.558  1.00 33.45 ? 309 PHE A CZ   1 
ATOM   2099 N  N    . PRO A 1 273 ? 19.480 8.543   -2.953 1.00 35.46 ? 310 PRO A N    1 
ATOM   2100 C  CA   . PRO A 1 273 ? 20.158 7.260   -3.180 1.00 35.22 ? 310 PRO A CA   1 
ATOM   2101 C  C    . PRO A 1 273 ? 21.656 7.470   -3.126 1.00 35.25 ? 310 PRO A C    1 
ATOM   2102 O  O    . PRO A 1 273 ? 22.407 6.578   -2.738 1.00 36.50 ? 310 PRO A O    1 
ATOM   2103 C  CB   . PRO A 1 273 ? 19.680 6.844   -4.573 1.00 35.60 ? 310 PRO A CB   1 
ATOM   2104 C  CG   . PRO A 1 273 ? 18.286 7.417   -4.637 1.00 36.40 ? 310 PRO A CG   1 
ATOM   2105 C  CD   . PRO A 1 273 ? 18.520 8.816   -4.044 1.00 36.49 ? 310 PRO A CD   1 
ATOM   2106 N  N    . LYS A 1 274 ? 22.089 8.660   -3.512 1.00 36.30 ? 311 LYS A N    1 
ATOM   2107 C  CA   . LYS A 1 274 ? 23.514 8.997   -3.483 1.00 38.76 ? 311 LYS A CA   1 
ATOM   2108 C  C    . LYS A 1 274 ? 23.940 9.355   -2.063 1.00 38.47 ? 311 LYS A C    1 
ATOM   2109 O  O    . LYS A 1 274 ? 25.041 9.004   -1.624 1.00 38.27 ? 311 LYS A O    1 
ATOM   2110 C  CB   . LYS A 1 274 ? 23.787 10.184  -4.404 1.00 40.14 ? 311 LYS A CB   1 
ATOM   2111 C  CG   . LYS A 1 274 ? 23.558 9.913   -5.894 1.00 43.19 ? 311 LYS A CG   1 
ATOM   2112 C  CD   . LYS A 1 274 ? 23.931 11.167  -6.676 1.00 45.54 ? 311 LYS A CD   1 
ATOM   2113 C  CE   . LYS A 1 274 ? 23.930 10.963  -8.189 1.00 46.79 ? 311 LYS A CE   1 
ATOM   2114 N  NZ   . LYS A 1 274 ? 24.156 12.276  -8.895 1.00 46.64 ? 311 LYS A NZ   1 
ATOM   2115 N  N    . LEU A 1 275 ? 23.049 10.057  -1.358 1.00 38.29 ? 312 LEU A N    1 
ATOM   2116 C  CA   . LEU A 1 275 ? 23.296 10.490  0.013  1.00 37.83 ? 312 LEU A CA   1 
ATOM   2117 C  C    . LEU A 1 275 ? 23.321 9.333   0.971  1.00 38.20 ? 312 LEU A C    1 
ATOM   2118 O  O    . LEU A 1 275 ? 24.054 9.367   1.962  1.00 38.56 ? 312 LEU A O    1 
ATOM   2119 C  CB   . LEU A 1 275 ? 22.244 11.518  0.470  1.00 37.09 ? 312 LEU A CB   1 
ATOM   2120 C  CG   . LEU A 1 275 ? 22.588 13.006  0.240  1.00 36.19 ? 312 LEU A CG   1 
ATOM   2121 C  CD1  . LEU A 1 275 ? 21.367 13.888  0.451  1.00 35.09 ? 312 LEU A CD1  1 
ATOM   2122 C  CD2  . LEU A 1 275 ? 23.714 13.423  1.186  1.00 35.85 ? 312 LEU A CD2  1 
ATOM   2123 N  N    . PHE A 1 276 ? 22.535 8.299   0.663  1.00 38.81 ? 313 PHE A N    1 
ATOM   2124 C  CA   . PHE A 1 276 ? 22.448 7.101   1.508  1.00 37.97 ? 313 PHE A CA   1 
ATOM   2125 C  C    . PHE A 1 276 ? 22.411 5.846   0.632  1.00 39.52 ? 313 PHE A C    1 
ATOM   2126 O  O    . PHE A 1 276 ? 21.369 5.195   0.507  1.00 38.59 ? 313 PHE A O    1 
ATOM   2127 C  CB   . PHE A 1 276 ? 21.182 7.148   2.377  1.00 35.59 ? 313 PHE A CB   1 
ATOM   2128 C  CG   . PHE A 1 276 ? 21.105 8.345   3.289  1.00 33.73 ? 313 PHE A CG   1 
ATOM   2129 C  CD1  . PHE A 1 276 ? 21.904 8.431   4.424  1.00 31.28 ? 313 PHE A CD1  1 
ATOM   2130 C  CD2  . PHE A 1 276 ? 20.242 9.395   2.996  1.00 32.23 ? 313 PHE A CD2  1 
ATOM   2131 C  CE1  . PHE A 1 276 ? 21.844 9.543   5.248  1.00 32.65 ? 313 PHE A CE1  1 
ATOM   2132 C  CE2  . PHE A 1 276 ? 20.174 10.509  3.812  1.00 31.95 ? 313 PHE A CE2  1 
ATOM   2133 C  CZ   . PHE A 1 276 ? 20.976 10.586  4.939  1.00 31.41 ? 313 PHE A CZ   1 
ATOM   2134 N  N    . PRO A 1 277 ? 23.549 5.501   0.006  1.00 41.87 ? 314 PRO A N    1 
ATOM   2135 C  CA   . PRO A 1 277 ? 23.693 4.326   -0.872 1.00 43.05 ? 314 PRO A CA   1 
ATOM   2136 C  C    . PRO A 1 277 ? 23.145 3.036   -0.285 1.00 44.44 ? 314 PRO A C    1 
ATOM   2137 O  O    . PRO A 1 277 ? 22.970 2.930   0.920  1.00 45.45 ? 314 PRO A O    1 
ATOM   2138 C  CB   . PRO A 1 277 ? 25.194 4.258   -1.094 1.00 42.03 ? 314 PRO A CB   1 
ATOM   2139 C  CG   . PRO A 1 277 ? 25.545 5.749   -1.214 1.00 42.20 ? 314 PRO A CG   1 
ATOM   2140 C  CD   . PRO A 1 277 ? 24.776 6.328   -0.020 1.00 41.39 ? 314 PRO A CD   1 
ATOM   2141 N  N    . ASP A 1 278 ? 22.886 2.047   -1.138 1.00 46.93 ? 315 ASP A N    1 
ATOM   2142 C  CA   . ASP A 1 278 ? 22.356 0.762   -0.684 1.00 47.82 ? 315 ASP A CA   1 
ATOM   2143 C  C    . ASP A 1 278 ? 23.361 0.030   0.204  1.00 46.75 ? 315 ASP A C    1 
ATOM   2144 O  O    . ASP A 1 278 ? 22.985 -0.712  1.122  1.00 47.29 ? 315 ASP A O    1 
ATOM   2145 C  CB   . ASP A 1 278 ? 21.978 -0.113  -1.886 1.00 50.25 ? 315 ASP A CB   1 
ATOM   2146 C  CG   . ASP A 1 278 ? 21.157 0.647   -2.929 1.00 52.98 ? 315 ASP A CG   1 
ATOM   2147 O  OD1  . ASP A 1 278 ? 20.656 0.018   -3.900 1.00 53.09 ? 315 ASP A OD1  1 
ATOM   2148 O  OD2  . ASP A 1 278 ? 21.017 1.882   -2.782 1.00 54.38 ? 315 ASP A OD2  1 
ATOM   2149 N  N    . SER A 1 279 ? 24.641 0.254   -0.061 1.00 46.74 ? 316 SER A N    1 
ATOM   2150 C  CA   . SER A 1 279 ? 25.705 -0.385  0.714  1.00 46.75 ? 316 SER A CA   1 
ATOM   2151 C  C    . SER A 1 279 ? 25.499 -0.207  2.198  1.00 46.60 ? 316 SER A C    1 
ATOM   2152 O  O    . SER A 1 279 ? 25.865 -1.075  2.996  1.00 47.04 ? 316 SER A O    1 
ATOM   2153 C  CB   . SER A 1 279 ? 27.058 0.196   0.316  1.00 47.05 ? 316 SER A CB   1 
ATOM   2154 O  OG   . SER A 1 279 ? 26.990 1.610   0.268  1.00 48.13 ? 316 SER A OG   1 
ATOM   2155 N  N    . LEU A 1 280 ? 24.904 0.922   2.578  1.00 46.76 ? 317 LEU A N    1 
ATOM   2156 C  CA   . LEU A 1 280 ? 24.653 1.208   4.000  1.00 46.85 ? 317 LEU A CA   1 
ATOM   2157 C  C    . LEU A 1 280 ? 23.475 0.437   4.573  1.00 46.64 ? 317 LEU A C    1 
ATOM   2158 O  O    . LEU A 1 280 ? 23.276 0.393   5.779  1.00 45.75 ? 317 LEU A O    1 
ATOM   2159 C  CB   . LEU A 1 280 ? 24.383 2.695   4.190  1.00 46.24 ? 317 LEU A CB   1 
ATOM   2160 C  CG   . LEU A 1 280 ? 25.473 3.614   3.658  1.00 45.60 ? 317 LEU A CG   1 
ATOM   2161 C  CD1  . LEU A 1 280 ? 25.109 5.057   4.013  1.00 45.19 ? 317 LEU A CD1  1 
ATOM   2162 C  CD2  . LEU A 1 280 ? 26.814 3.213   4.248  1.00 43.72 ? 317 LEU A CD2  1 
ATOM   2163 N  N    . PHE A 1 281 ? 22.679 -0.146  3.692  1.00 48.05 ? 318 PHE A N    1 
ATOM   2164 C  CA   . PHE A 1 281 ? 21.515 -0.886  4.127  1.00 49.35 ? 318 PHE A CA   1 
ATOM   2165 C  C    . PHE A 1 281 ? 21.731 -2.348  3.809  1.00 51.20 ? 318 PHE A C    1 
ATOM   2166 O  O    . PHE A 1 281 ? 22.311 -2.701  2.762  1.00 52.51 ? 318 PHE A O    1 
ATOM   2167 C  CB   . PHE A 1 281 ? 20.275 -0.394  3.391  1.00 48.58 ? 318 PHE A CB   1 
ATOM   2168 C  CG   . PHE A 1 281 ? 19.907 1.038   3.695  1.00 47.71 ? 318 PHE A CG   1 
ATOM   2169 C  CD1  . PHE A 1 281 ? 19.304 1.377   4.901  1.00 47.61 ? 318 PHE A CD1  1 
ATOM   2170 C  CD2  . PHE A 1 281 ? 20.140 2.045   2.763  1.00 47.98 ? 318 PHE A CD2  1 
ATOM   2171 C  CE1  . PHE A 1 281 ? 18.935 2.697   5.176  1.00 46.59 ? 318 PHE A CE1  1 
ATOM   2172 C  CE2  . PHE A 1 281 ? 19.775 3.372   3.028  1.00 46.63 ? 318 PHE A CE2  1 
ATOM   2173 C  CZ   . PHE A 1 281 ? 19.171 3.691   4.236  1.00 46.22 ? 318 PHE A CZ   1 
ATOM   2174 N  N    . PRO A 1 282 ? 21.282 -3.221  4.717  1.00 51.68 ? 319 PRO A N    1 
ATOM   2175 C  CA   . PRO A 1 282 ? 21.376 -4.682  4.619  1.00 51.97 ? 319 PRO A CA   1 
ATOM   2176 C  C    . PRO A 1 282 ? 20.497 -5.213  3.473  1.00 51.79 ? 319 PRO A C    1 
ATOM   2177 O  O    . PRO A 1 282 ? 19.273 -5.313  3.617  1.00 52.90 ? 319 PRO A O    1 
ATOM   2178 C  CB   . PRO A 1 282 ? 20.866 -5.146  5.981  1.00 52.36 ? 319 PRO A CB   1 
ATOM   2179 C  CG   . PRO A 1 282 ? 21.230 -3.992  6.894  1.00 52.23 ? 319 PRO A CG   1 
ATOM   2180 C  CD   . PRO A 1 282 ? 20.825 -2.813  6.059  1.00 52.00 ? 319 PRO A CD   1 
ATOM   2181 N  N    . ALA A 1 283 ? 21.114 -5.563  2.349  1.00 50.54 ? 320 ALA A N    1 
ATOM   2182 C  CA   . ALA A 1 283 ? 20.373 -6.071  1.192  1.00 48.88 ? 320 ALA A CA   1 
ATOM   2183 C  C    . ALA A 1 283 ? 20.563 -7.564  0.982  1.00 47.59 ? 320 ALA A C    1 
ATOM   2184 O  O    . ALA A 1 283 ? 20.816 -8.007  -0.142 1.00 48.52 ? 320 ALA A O    1 
ATOM   2185 C  CB   . ALA A 1 283 ? 20.803 -5.320  -0.079 1.00 50.35 ? 320 ALA A CB   1 
ATOM   2186 N  N    . ASP A 1 284 ? 20.431 -8.342  2.050  1.00 45.16 ? 321 ASP A N    1 
ATOM   2187 C  CA   . ASP A 1 284 ? 20.604 -9.787  1.958  1.00 42.55 ? 321 ASP A CA   1 
ATOM   2188 C  C    . ASP A 1 284 ? 19.271 -10.547 1.863  1.00 40.43 ? 321 ASP A C    1 
ATOM   2189 O  O    . ASP A 1 284 ? 19.253 -11.776 1.853  1.00 41.74 ? 321 ASP A O    1 
ATOM   2190 C  CB   . ASP A 1 284 ? 21.403 -10.283 3.165  1.00 43.19 ? 321 ASP A CB   1 
ATOM   2191 C  CG   . ASP A 1 284 ? 20.689 -10.024 4.471  1.00 44.29 ? 321 ASP A CG   1 
ATOM   2192 O  OD1  . ASP A 1 284 ? 19.843 -9.101  4.505  1.00 44.66 ? 321 ASP A OD1  1 
ATOM   2193 O  OD2  . ASP A 1 284 ? 20.967 -10.731 5.466  1.00 44.48 ? 321 ASP A OD2  1 
ATOM   2194 N  N    . SER A 1 285 ? 18.162 -9.825  1.796  1.00 36.47 ? 322 SER A N    1 
ATOM   2195 C  CA   . SER A 1 285 ? 16.864 -10.465 1.689  1.00 33.33 ? 322 SER A CA   1 
ATOM   2196 C  C    . SER A 1 285 ? 15.852 -9.464  1.159  1.00 31.90 ? 322 SER A C    1 
ATOM   2197 O  O    . SER A 1 285 ? 16.042 -8.253  1.275  1.00 31.54 ? 322 SER A O    1 
ATOM   2198 C  CB   . SER A 1 285 ? 16.403 -10.992 3.045  1.00 32.70 ? 322 SER A CB   1 
ATOM   2199 O  OG   . SER A 1 285 ? 16.098 -9.923  3.926  1.00 33.37 ? 322 SER A OG   1 
ATOM   2200 N  N    . GLU A 1 286 ? 14.778 -9.970  0.574  1.00 29.59 ? 323 GLU A N    1 
ATOM   2201 C  CA   . GLU A 1 286 ? 13.753 -9.103  0.020  1.00 27.49 ? 323 GLU A CA   1 
ATOM   2202 C  C    . GLU A 1 286 ? 13.212 -8.159  1.093  1.00 26.16 ? 323 GLU A C    1 
ATOM   2203 O  O    . GLU A 1 286 ? 13.034 -6.963  0.859  1.00 25.81 ? 323 GLU A O    1 
ATOM   2204 C  CB   . GLU A 1 286 ? 12.642 -9.960  -0.580 1.00 28.51 ? 323 GLU A CB   1 
ATOM   2205 C  CG   . GLU A 1 286 ? 13.073 -10.737 -1.858 1.00 30.06 ? 323 GLU A CG   1 
ATOM   2206 C  CD   . GLU A 1 286 ? 13.292 -9.842  -3.093 1.00 33.19 ? 323 GLU A CD   1 
ATOM   2207 O  OE1  . GLU A 1 286 ? 12.828 -8.674  -3.083 1.00 31.94 ? 323 GLU A OE1  1 
ATOM   2208 O  OE2  . GLU A 1 286 ? 13.914 -10.304 -4.094 1.00 34.48 ? 323 GLU A OE2  1 
ATOM   2209 N  N    . HIS A 1 287 ? 12.981 -8.701  2.283  1.00 24.66 ? 324 HIS A N    1 
ATOM   2210 C  CA   . HIS A 1 287 ? 12.466 -7.924  3.401  1.00 23.94 ? 324 HIS A CA   1 
ATOM   2211 C  C    . HIS A 1 287 ? 13.355 -6.729  3.652  1.00 21.69 ? 324 HIS A C    1 
ATOM   2212 O  O    . HIS A 1 287 ? 12.884 -5.602  3.713  1.00 21.90 ? 324 HIS A O    1 
ATOM   2213 C  CB   . HIS A 1 287 ? 12.423 -8.787  4.663  1.00 27.28 ? 324 HIS A CB   1 
ATOM   2214 C  CG   . HIS A 1 287 ? 12.107 -8.021  5.910  1.00 28.13 ? 324 HIS A CG   1 
ATOM   2215 N  ND1  . HIS A 1 287 ? 10.816 -7.747  6.310  1.00 29.12 ? 324 HIS A ND1  1 
ATOM   2216 C  CD2  . HIS A 1 287 ? 12.916 -7.484  6.857  1.00 27.43 ? 324 HIS A CD2  1 
ATOM   2217 C  CE1  . HIS A 1 287 ? 10.841 -7.085  7.454  1.00 28.97 ? 324 HIS A CE1  1 
ATOM   2218 N  NE2  . HIS A 1 287 ? 12.104 -6.914  7.808  1.00 29.04 ? 324 HIS A NE2  1 
ATOM   2219 N  N    . ASN A 1 288 ? 14.653 -6.985  3.799  1.00 21.46 ? 325 ASN A N    1 
ATOM   2220 C  CA   . ASN A 1 288 ? 15.611 -5.922  4.050  1.00 21.00 ? 325 ASN A CA   1 
ATOM   2221 C  C    . ASN A 1 288 ? 15.729 -4.985  2.874  1.00 21.34 ? 325 ASN A C    1 
ATOM   2222 O  O    . ASN A 1 288 ? 16.029 -3.797  3.051  1.00 20.46 ? 325 ASN A O    1 
ATOM   2223 C  CB   . ASN A 1 288 ? 16.981 -6.492  4.409  1.00 24.56 ? 325 ASN A CB   1 
ATOM   2224 C  CG   . ASN A 1 288 ? 17.039 -6.996  5.843  1.00 27.26 ? 325 ASN A CG   1 
ATOM   2225 O  OD1  . ASN A 1 288 ? 16.075 -6.863  6.600  1.00 28.96 ? 325 ASN A OD1  1 
ATOM   2226 N  ND2  . ASN A 1 288 ? 18.172 -7.573  6.225  1.00 28.32 ? 325 ASN A ND2  1 
ATOM   2227 N  N    . LYS A 1 289 ? 15.507 -5.503  1.665  1.00 20.63 ? 326 LYS A N    1 
ATOM   2228 C  CA   . LYS A 1 289 ? 15.549 -4.641  0.489  1.00 21.99 ? 326 LYS A CA   1 
ATOM   2229 C  C    . LYS A 1 289 ? 14.329 -3.699  0.498  1.00 20.92 ? 326 LYS A C    1 
ATOM   2230 O  O    . LYS A 1 289 ? 14.434 -2.541  0.131  1.00 19.32 ? 326 LYS A O    1 
ATOM   2231 C  CB   . LYS A 1 289 ? 15.530 -5.461  -0.808 1.00 23.65 ? 326 LYS A CB   1 
ATOM   2232 C  CG   . LYS A 1 289 ? 16.779 -6.270  -1.053 1.00 27.23 ? 326 LYS A CG   1 
ATOM   2233 C  CD   . LYS A 1 289 ? 16.714 -7.027  -2.369 1.00 27.30 ? 326 LYS A CD   1 
ATOM   2234 C  CE   . LYS A 1 289 ? 17.897 -7.957  -2.494 1.00 29.73 ? 326 LYS A CE   1 
ATOM   2235 N  NZ   . LYS A 1 289 ? 17.980 -8.531  -3.864 1.00 32.22 ? 326 LYS A NZ   1 
ATOM   2236 N  N    . LEU A 1 290 ? 13.170 -4.193  0.908  1.00 20.08 ? 327 LEU A N    1 
ATOM   2237 C  CA   . LEU A 1 290 ? 12.001 -3.323  0.912  1.00 20.87 ? 327 LEU A CA   1 
ATOM   2238 C  C    . LEU A 1 290 ? 12.145 -2.297  2.034  1.00 22.24 ? 327 LEU A C    1 
ATOM   2239 O  O    . LEU A 1 290 ? 11.875 -1.111  1.838  1.00 22.21 ? 327 LEU A O    1 
ATOM   2240 C  CB   . LEU A 1 290 ? 10.716 -4.153  1.090  1.00 20.43 ? 327 LEU A CB   1 
ATOM   2241 C  CG   . LEU A 1 290 ? 9.372  -3.431  1.237  1.00 19.35 ? 327 LEU A CG   1 
ATOM   2242 C  CD1  . LEU A 1 290 ? 9.077  -2.572  0.018  1.00 17.27 ? 327 LEU A CD1  1 
ATOM   2243 C  CD2  . LEU A 1 290 ? 8.306  -4.467  1.393  1.00 19.72 ? 327 LEU A CD2  1 
ATOM   2244 N  N    . LYS A 1 291 ? 12.592 -2.739  3.209  1.00 23.69 ? 328 LYS A N    1 
ATOM   2245 C  CA   . LYS A 1 291 ? 12.739 -1.816  4.340  1.00 24.03 ? 328 LYS A CA   1 
ATOM   2246 C  C    . LYS A 1 291 ? 13.755 -0.715  4.047  1.00 23.86 ? 328 LYS A C    1 
ATOM   2247 O  O    . LYS A 1 291 ? 13.579 0.417   4.472  1.00 22.62 ? 328 LYS A O    1 
ATOM   2248 C  CB   . LYS A 1 291 ? 13.129 -2.582  5.628  1.00 23.88 ? 328 LYS A CB   1 
ATOM   2249 C  CG   . LYS A 1 291 ? 11.966 -3.349  6.284  1.00 26.19 ? 328 LYS A CG   1 
ATOM   2250 C  CD   . LYS A 1 291 ? 10.810 -2.397  6.589  1.00 29.18 ? 328 LYS A CD   1 
ATOM   2251 C  CE   . LYS A 1 291 ? 9.553  -3.084  7.121  1.00 30.40 ? 328 LYS A CE   1 
ATOM   2252 N  NZ   . LYS A 1 291 ? 8.409  -2.090  7.218  1.00 31.32 ? 328 LYS A NZ   1 
ATOM   2253 N  N    . ALA A 1 292 ? 14.805 -1.036  3.302  1.00 24.34 ? 329 ALA A N    1 
ATOM   2254 C  CA   . ALA A 1 292 ? 15.829 -0.037  2.992  1.00 25.89 ? 329 ALA A CA   1 
ATOM   2255 C  C    . ALA A 1 292 ? 15.225 1.070   2.143  1.00 27.69 ? 329 ALA A C    1 
ATOM   2256 O  O    . ALA A 1 292 ? 15.515 2.249   2.337  1.00 27.40 ? 329 ALA A O    1 
ATOM   2257 C  CB   . ALA A 1 292 ? 16.980 -0.664  2.264  1.00 24.94 ? 329 ALA A CB   1 
ATOM   2258 N  N    . SER A 1 293 ? 14.387 0.669   1.199  1.00 27.41 ? 330 SER A N    1 
ATOM   2259 C  CA   . SER A 1 293 ? 13.712 1.592   0.319  1.00 27.82 ? 330 SER A CA   1 
ATOM   2260 C  C    . SER A 1 293 ? 12.790 2.504   1.123  1.00 27.77 ? 330 SER A C    1 
ATOM   2261 O  O    . SER A 1 293 ? 12.727 3.719   0.889  1.00 28.42 ? 330 SER A O    1 
ATOM   2262 C  CB   . SER A 1 293 ? 12.900 0.804   -0.697 1.00 28.97 ? 330 SER A CB   1 
ATOM   2263 O  OG   . SER A 1 293 ? 12.176 1.674   -1.542 1.00 33.04 ? 330 SER A OG   1 
ATOM   2264 N  N    . GLN A 1 294 ? 12.067 1.915   2.069  1.00 27.08 ? 331 GLN A N    1 
ATOM   2265 C  CA   . GLN A 1 294 ? 11.152 2.678   2.914  1.00 27.22 ? 331 GLN A CA   1 
ATOM   2266 C  C    . GLN A 1 294 ? 11.879 3.629   3.852  1.00 27.00 ? 331 GLN A C    1 
ATOM   2267 O  O    . GLN A 1 294 ? 11.356 4.683   4.187  1.00 27.50 ? 331 GLN A O    1 
ATOM   2268 C  CB   . GLN A 1 294 ? 10.283 1.742   3.746  1.00 27.41 ? 331 GLN A CB   1 
ATOM   2269 C  CG   . GLN A 1 294 ? 9.218  1.051   2.942  1.00 28.86 ? 331 GLN A CG   1 
ATOM   2270 C  CD   . GLN A 1 294 ? 8.502  -0.027  3.721  1.00 28.07 ? 331 GLN A CD   1 
ATOM   2271 O  OE1  . GLN A 1 294 ? 7.643  -0.712  3.181  1.00 32.42 ? 331 GLN A OE1  1 
ATOM   2272 N  NE2  . GLN A 1 294 ? 8.854  -0.191  4.986  1.00 25.41 ? 331 GLN A NE2  1 
ATOM   2273 N  N    . ALA A 1 295 ? 13.071 3.241   4.291  1.00 25.92 ? 332 ALA A N    1 
ATOM   2274 C  CA   . ALA A 1 295 ? 13.851 4.075   5.183  1.00 25.73 ? 332 ALA A CA   1 
ATOM   2275 C  C    . ALA A 1 295 ? 14.316 5.307   4.414  1.00 26.84 ? 332 ALA A C    1 
ATOM   2276 O  O    . ALA A 1 295 ? 14.164 6.454   4.866  1.00 24.83 ? 332 ALA A O    1 
ATOM   2277 C  CB   . ALA A 1 295 ? 15.049 3.302   5.707  1.00 23.46 ? 332 ALA A CB   1 
ATOM   2278 N  N    . ARG A 1 296 ? 14.892 5.064   3.242  1.00 27.08 ? 333 ARG A N    1 
ATOM   2279 C  CA   . ARG A 1 296 ? 15.376 6.163   2.441  1.00 28.10 ? 333 ARG A CA   1 
ATOM   2280 C  C    . ARG A 1 296 ? 14.214 7.098   2.166  1.00 27.10 ? 333 ARG A C    1 
ATOM   2281 O  O    . ARG A 1 296 ? 14.364 8.324   2.216  1.00 28.15 ? 333 ARG A O    1 
ATOM   2282 C  CB   . ARG A 1 296 ? 15.996 5.667   1.129  1.00 30.69 ? 333 ARG A CB   1 
ATOM   2283 C  CG   . ARG A 1 296 ? 17.088 6.629   0.631  1.00 36.84 ? 333 ARG A CG   1 
ATOM   2284 C  CD   . ARG A 1 296 ? 17.795 6.193   -0.668 1.00 39.01 ? 333 ARG A CD   1 
ATOM   2285 N  NE   . ARG A 1 296 ? 18.325 4.848   -0.555 1.00 41.81 ? 333 ARG A NE   1 
ATOM   2286 C  CZ   . ARG A 1 296 ? 17.669 3.752   -0.916 1.00 43.60 ? 333 ARG A CZ   1 
ATOM   2287 N  NH1  . ARG A 1 296 ? 16.447 3.835   -1.440 1.00 44.24 ? 333 ARG A NH1  1 
ATOM   2288 N  NH2  . ARG A 1 296 ? 18.220 2.566   -0.708 1.00 44.36 ? 333 ARG A NH2  1 
ATOM   2289 N  N    . ASP A 1 297 ? 13.040 6.529   1.922  1.00 25.24 ? 334 ASP A N    1 
ATOM   2290 C  CA   . ASP A 1 297 ? 11.882 7.373   1.648  1.00 24.37 ? 334 ASP A CA   1 
ATOM   2291 C  C    . ASP A 1 297 ? 11.618 8.308   2.842  1.00 22.52 ? 334 ASP A C    1 
ATOM   2292 O  O    . ASP A 1 297 ? 11.434 9.511   2.665  1.00 24.56 ? 334 ASP A O    1 
ATOM   2293 C  CB   . ASP A 1 297 ? 10.641 6.519   1.348  1.00 24.43 ? 334 ASP A CB   1 
ATOM   2294 C  CG   . ASP A 1 297 ? 9.435  7.362   0.975  1.00 28.22 ? 334 ASP A CG   1 
ATOM   2295 O  OD1  . ASP A 1 297 ? 9.474  8.002   -0.095 1.00 31.44 ? 334 ASP A OD1  1 
ATOM   2296 O  OD2  . ASP A 1 297 ? 8.446  7.412   1.744  1.00 28.23 ? 334 ASP A OD2  1 
ATOM   2297 N  N    . LEU A 1 298 ? 11.618 7.767   4.054  1.00 21.07 ? 335 LEU A N    1 
ATOM   2298 C  CA   . LEU A 1 298 ? 11.373 8.589   5.226  1.00 21.27 ? 335 LEU A CA   1 
ATOM   2299 C  C    . LEU A 1 298 ? 12.468 9.671   5.388  1.00 19.90 ? 335 LEU A C    1 
ATOM   2300 O  O    . LEU A 1 298 ? 12.175 10.837  5.659  1.00 19.37 ? 335 LEU A O    1 
ATOM   2301 C  CB   . LEU A 1 298 ? 11.271 7.705   6.467  1.00 20.91 ? 335 LEU A CB   1 
ATOM   2302 C  CG   . LEU A 1 298 ? 10.862 8.423   7.772  1.00 21.77 ? 335 LEU A CG   1 
ATOM   2303 C  CD1  . LEU A 1 298 ? 9.598  9.246   7.543  1.00 20.62 ? 335 LEU A CD1  1 
ATOM   2304 C  CD2  . LEU A 1 298 ? 10.657 7.398   8.870  1.00 20.26 ? 335 LEU A CD2  1 
ATOM   2305 N  N    . LEU A 1 299 ? 13.726 9.289   5.202  1.00 19.15 ? 336 LEU A N    1 
ATOM   2306 C  CA   . LEU A 1 299 ? 14.801 10.259  5.293  1.00 18.56 ? 336 LEU A CA   1 
ATOM   2307 C  C    . LEU A 1 299 ? 14.550 11.447  4.373  1.00 19.29 ? 336 LEU A C    1 
ATOM   2308 O  O    . LEU A 1 299 ? 14.660 12.602  4.800  1.00 17.75 ? 336 LEU A O    1 
ATOM   2309 C  CB   . LEU A 1 299 ? 16.130 9.609   4.930  1.00 18.29 ? 336 LEU A CB   1 
ATOM   2310 C  CG   . LEU A 1 299 ? 16.747 8.892   6.112  1.00 18.70 ? 336 LEU A CG   1 
ATOM   2311 C  CD1  . LEU A 1 299 ? 17.758 7.847   5.643  1.00 18.14 ? 336 LEU A CD1  1 
ATOM   2312 C  CD2  . LEU A 1 299 ? 17.379 9.952   7.030  1.00 15.33 ? 336 LEU A CD2  1 
ATOM   2313 N  N    . SER A 1 300 ? 14.215 11.161  3.111  1.00 18.95 ? 337 SER A N    1 
ATOM   2314 C  CA   . SER A 1 300 ? 13.951 12.214  2.113  1.00 20.54 ? 337 SER A CA   1 
ATOM   2315 C  C    . SER A 1 300 ? 12.767 13.102  2.489  1.00 20.99 ? 337 SER A C    1 
ATOM   2316 O  O    . SER A 1 300 ? 12.624 14.203  1.970  1.00 22.17 ? 337 SER A O    1 
ATOM   2317 C  CB   . SER A 1 300 ? 13.673 11.606  0.724  1.00 20.46 ? 337 SER A CB   1 
ATOM   2318 O  OG   . SER A 1 300 ? 12.393 10.974  0.697  1.00 19.78 ? 337 SER A OG   1 
ATOM   2319 N  N    . LYS A 1 301 ? 11.900 12.613  3.360  1.00 21.96 ? 338 LYS A N    1 
ATOM   2320 C  CA   . LYS A 1 301 ? 10.753 13.408  3.784  1.00 23.01 ? 338 LYS A CA   1 
ATOM   2321 C  C    . LYS A 1 301 ? 11.069 14.197  5.046  1.00 22.95 ? 338 LYS A C    1 
ATOM   2322 O  O    . LYS A 1 301 ? 10.419 15.201  5.353  1.00 23.59 ? 338 LYS A O    1 
ATOM   2323 C  CB   . LYS A 1 301 ? 9.548  12.513  4.065  1.00 23.20 ? 338 LYS A CB   1 
ATOM   2324 C  CG   . LYS A 1 301 ? 8.632  12.323  2.876  1.00 27.13 ? 338 LYS A CG   1 
ATOM   2325 C  CD   . LYS A 1 301 ? 8.922  11.075  2.130  1.00 31.19 ? 338 LYS A CD   1 
ATOM   2326 C  CE   . LYS A 1 301 ? 7.839  10.832  1.062  1.00 33.34 ? 338 LYS A CE   1 
ATOM   2327 N  NZ   . LYS A 1 301 ? 6.530  10.536  1.693  1.00 35.15 ? 338 LYS A NZ   1 
ATOM   2328 N  N    . MET A 1 302 ? 12.055 13.729  5.795  1.00 22.08 ? 339 MET A N    1 
ATOM   2329 C  CA   . MET A 1 302 ? 12.405 14.403  7.034  1.00 22.25 ? 339 MET A CA   1 
ATOM   2330 C  C    . MET A 1 302 ? 13.498 15.426  6.863  1.00 21.39 ? 339 MET A C    1 
ATOM   2331 O  O    . MET A 1 302 ? 13.480 16.463  7.526  1.00 19.42 ? 339 MET A O    1 
ATOM   2332 C  CB   . MET A 1 302 ? 12.796 13.376  8.118  1.00 21.31 ? 339 MET A CB   1 
ATOM   2333 C  CG   . MET A 1 302 ? 11.624 12.464  8.476  1.00 22.63 ? 339 MET A CG   1 
ATOM   2334 S  SD   . MET A 1 302 ? 11.692 11.593  10.074 1.00 26.59 ? 339 MET A SD   1 
ATOM   2335 C  CE   . MET A 1 302 ? 13.213 10.812  9.878  1.00 25.57 ? 339 MET A CE   1 
ATOM   2336 N  N    . LEU A 1 303 ? 14.456 15.129  5.991  1.00 20.75 ? 340 LEU A N    1 
ATOM   2337 C  CA   . LEU A 1 303 ? 15.565 16.044  5.746  1.00 21.30 ? 340 LEU A CA   1 
ATOM   2338 C  C    . LEU A 1 303 ? 15.155 16.966  4.615  1.00 21.15 ? 340 LEU A C    1 
ATOM   2339 O  O    . LEU A 1 303 ? 15.669 16.883  3.515  1.00 19.75 ? 340 LEU A O    1 
ATOM   2340 C  CB   . LEU A 1 303 ? 16.829 15.254  5.376  1.00 20.32 ? 340 LEU A CB   1 
ATOM   2341 C  CG   . LEU A 1 303 ? 17.421 14.466  6.541  1.00 20.11 ? 340 LEU A CG   1 
ATOM   2342 C  CD1  . LEU A 1 303 ? 18.632 13.674  6.082  1.00 22.78 ? 340 LEU A CD1  1 
ATOM   2343 C  CD2  . LEU A 1 303 ? 17.841 15.444  7.640  1.00 18.32 ? 340 LEU A CD2  1 
ATOM   2344 N  N    . VAL A 1 304 ? 14.192 17.828  4.914  1.00 22.21 ? 341 VAL A N    1 
ATOM   2345 C  CA   . VAL A 1 304 ? 13.659 18.782  3.955  1.00 22.58 ? 341 VAL A CA   1 
ATOM   2346 C  C    . VAL A 1 304 ? 13.866 20.145  4.577  1.00 23.88 ? 341 VAL A C    1 
ATOM   2347 O  O    . VAL A 1 304 ? 13.323 20.433  5.631  1.00 25.08 ? 341 VAL A O    1 
ATOM   2348 C  CB   . VAL A 1 304 ? 12.158 18.493  3.694  1.00 23.99 ? 341 VAL A CB   1 
ATOM   2349 C  CG1  . VAL A 1 304 ? 11.555 19.580  2.842  1.00 23.11 ? 341 VAL A CG1  1 
ATOM   2350 C  CG2  . VAL A 1 304 ? 12.012 17.131  2.974  1.00 19.58 ? 341 VAL A CG2  1 
ATOM   2351 N  N    . ILE A 1 305 ? 14.682 20.972  3.935  1.00 24.48 ? 342 ILE A N    1 
ATOM   2352 C  CA   . ILE A 1 305 ? 14.986 22.281  4.462  1.00 24.54 ? 342 ILE A CA   1 
ATOM   2353 C  C    . ILE A 1 305 ? 13.781 23.171  4.715  1.00 26.38 ? 342 ILE A C    1 
ATOM   2354 O  O    . ILE A 1 305 ? 13.680 23.827  5.754  1.00 25.79 ? 342 ILE A O    1 
ATOM   2355 C  CB   . ILE A 1 305 ? 15.941 23.028  3.542  1.00 25.29 ? 342 ILE A CB   1 
ATOM   2356 C  CG1  . ILE A 1 305 ? 17.232 22.225  3.366  1.00 23.84 ? 342 ILE A CG1  1 
ATOM   2357 C  CG2  . ILE A 1 305 ? 16.284 24.391  4.154  1.00 26.32 ? 342 ILE A CG2  1 
ATOM   2358 C  CD1  . ILE A 1 305 ? 18.315 23.000  2.669  1.00 24.42 ? 342 ILE A CD1  1 
ATOM   2359 N  N    . ASP A 1 306 ? 12.855 23.211  3.777  1.00 27.30 ? 343 ASP A N    1 
ATOM   2360 C  CA   . ASP A 1 306 ? 11.701 24.067  3.976  1.00 28.64 ? 343 ASP A CA   1 
ATOM   2361 C  C    . ASP A 1 306 ? 10.671 23.378  4.832  1.00 27.22 ? 343 ASP A C    1 
ATOM   2362 O  O    . ASP A 1 306 ? 10.113 22.368  4.437  1.00 29.66 ? 343 ASP A O    1 
ATOM   2363 C  CB   . ASP A 1 306 ? 11.090 24.461  2.626  1.00 32.47 ? 343 ASP A CB   1 
ATOM   2364 C  CG   . ASP A 1 306 ? 9.907  25.393  2.776  1.00 35.19 ? 343 ASP A CG   1 
ATOM   2365 O  OD1  . ASP A 1 306 ? 9.739  25.962  3.870  1.00 36.18 ? 343 ASP A OD1  1 
ATOM   2366 O  OD2  . ASP A 1 306 ? 9.143  25.567  1.805  1.00 40.00 ? 343 ASP A OD2  1 
ATOM   2367 N  N    . PRO A 1 307 ? 10.413 23.910  6.028  1.00 26.14 ? 344 PRO A N    1 
ATOM   2368 C  CA   . PRO A 1 307 ? 9.434  23.342  6.957  1.00 26.88 ? 344 PRO A CA   1 
ATOM   2369 C  C    . PRO A 1 307 ? 8.012  23.211  6.386  1.00 27.39 ? 344 PRO A C    1 
ATOM   2370 O  O    . PRO A 1 307 ? 7.212  22.403  6.860  1.00 24.88 ? 344 PRO A O    1 
ATOM   2371 C  CB   . PRO A 1 307 ? 9.488  24.303  8.148  1.00 26.40 ? 344 PRO A CB   1 
ATOM   2372 C  CG   . PRO A 1 307 ? 9.888  25.616  7.501  1.00 26.26 ? 344 PRO A CG   1 
ATOM   2373 C  CD   . PRO A 1 307 ? 10.944 25.185  6.543  1.00 27.31 ? 344 PRO A CD   1 
ATOM   2374 N  N    . ALA A 1 308 ? 7.711  24.006  5.369  1.00 28.86 ? 345 ALA A N    1 
ATOM   2375 C  CA   . ALA A 1 308 ? 6.390  23.986  4.734  1.00 30.98 ? 345 ALA A CA   1 
ATOM   2376 C  C    . ALA A 1 308 ? 6.186  22.684  3.957  1.00 31.31 ? 345 ALA A C    1 
ATOM   2377 O  O    . ALA A 1 308 ? 5.052  22.247  3.768  1.00 32.92 ? 345 ALA A O    1 
ATOM   2378 C  CB   . ALA A 1 308 ? 6.245  25.200  3.786  1.00 30.24 ? 345 ALA A CB   1 
ATOM   2379 N  N    . LYS A 1 309 ? 7.285  22.069  3.522  1.00 31.96 ? 346 LYS A N    1 
ATOM   2380 C  CA   . LYS A 1 309 ? 7.241  20.816  2.766  1.00 33.06 ? 346 LYS A CA   1 
ATOM   2381 C  C    . LYS A 1 309 ? 7.805  19.576  3.498  1.00 32.13 ? 346 LYS A C    1 
ATOM   2382 O  O    . LYS A 1 309 ? 7.907  18.493  2.910  1.00 31.63 ? 346 LYS A O    1 
ATOM   2383 C  CB   . LYS A 1 309 ? 7.974  21.007  1.421  1.00 36.70 ? 346 LYS A CB   1 
ATOM   2384 C  CG   . LYS A 1 309 ? 9.446  21.455  1.543  1.00 42.59 ? 346 LYS A CG   1 
ATOM   2385 C  CD   . LYS A 1 309 ? 10.120 21.882  0.186  1.00 45.70 ? 346 LYS A CD   1 
ATOM   2386 C  CE   . LYS A 1 309 ? 11.604 22.333  0.420  1.00 47.59 ? 346 LYS A CE   1 
ATOM   2387 N  NZ   . LYS A 1 309 ? 12.367 22.811  -0.781 1.00 47.50 ? 346 LYS A NZ   1 
ATOM   2388 N  N    . ARG A 1 310 ? 8.162  19.728  4.773  1.00 29.82 ? 347 ARG A N    1 
ATOM   2389 C  CA   . ARG A 1 310 ? 8.733  18.631  5.571  1.00 27.24 ? 347 ARG A CA   1 
ATOM   2390 C  C    . ARG A 1 310 ? 7.595  17.884  6.247  1.00 27.48 ? 347 ARG A C    1 
ATOM   2391 O  O    . ARG A 1 310 ? 6.645  18.502  6.738  1.00 27.41 ? 347 ARG A O    1 
ATOM   2392 C  CB   . ARG A 1 310 ? 9.687  19.204  6.640  1.00 27.35 ? 347 ARG A CB   1 
ATOM   2393 C  CG   . ARG A 1 310 ? 10.596 18.215  7.416  1.00 25.03 ? 347 ARG A CG   1 
ATOM   2394 C  CD   . ARG A 1 310 ? 11.255 18.979  8.570  1.00 22.46 ? 347 ARG A CD   1 
ATOM   2395 N  NE   . ARG A 1 310 ? 11.900 20.203  8.081  1.00 23.98 ? 347 ARG A NE   1 
ATOM   2396 C  CZ   . ARG A 1 310 ? 12.136 21.301  8.808  1.00 22.46 ? 347 ARG A CZ   1 
ATOM   2397 N  NH1  . ARG A 1 310 ? 11.789 21.359  10.084 1.00 19.40 ? 347 ARG A NH1  1 
ATOM   2398 N  NH2  . ARG A 1 310 ? 12.705 22.353  8.246  1.00 21.62 ? 347 ARG A NH2  1 
ATOM   2399 N  N    . ILE A 1 311 ? 7.699  16.560  6.307  1.00 26.71 ? 348 ILE A N    1 
ATOM   2400 C  CA   . ILE A 1 311 ? 6.645  15.781  6.912  1.00 26.35 ? 348 ILE A CA   1 
ATOM   2401 C  C    . ILE A 1 311 ? 6.464  16.140  8.382  1.00 28.25 ? 348 ILE A C    1 
ATOM   2402 O  O    . ILE A 1 311 ? 7.413  16.551  9.055  1.00 27.92 ? 348 ILE A O    1 
ATOM   2403 C  CB   . ILE A 1 311 ? 6.899  14.243  6.711  1.00 27.40 ? 348 ILE A CB   1 
ATOM   2404 C  CG1  . ILE A 1 311 ? 5.740  13.447  7.298  1.00 26.76 ? 348 ILE A CG1  1 
ATOM   2405 C  CG2  . ILE A 1 311 ? 8.238  13.814  7.311  1.00 24.90 ? 348 ILE A CG2  1 
ATOM   2406 C  CD1  . ILE A 1 311 ? 5.692  12.006  6.802  1.00 29.15 ? 348 ILE A CD1  1 
ATOM   2407 N  N    . SER A 1 312 ? 5.228  16.000  8.865  1.00 28.15 ? 349 SER A N    1 
ATOM   2408 C  CA   . SER A 1 312 ? 4.856  16.309  10.249 1.00 27.26 ? 349 SER A CA   1 
ATOM   2409 C  C    . SER A 1 312 ? 5.041  15.085  11.133 1.00 27.37 ? 349 SER A C    1 
ATOM   2410 O  O    . SER A 1 312 ? 5.300  13.993  10.641 1.00 27.88 ? 349 SER A O    1 
ATOM   2411 C  CB   . SER A 1 312 ? 3.386  16.744  10.303 1.00 28.72 ? 349 SER A CB   1 
ATOM   2412 O  OG   . SER A 1 312 ? 2.547  15.691  9.856  1.00 26.99 ? 349 SER A OG   1 
ATOM   2413 N  N    . VAL A 1 313 ? 4.883  15.257  12.438 1.00 26.68 ? 350 VAL A N    1 
ATOM   2414 C  CA   . VAL A 1 313 ? 5.048  14.142  13.355 1.00 26.80 ? 350 VAL A CA   1 
ATOM   2415 C  C    . VAL A 1 313 ? 4.019  13.045  13.102 1.00 27.24 ? 350 VAL A C    1 
ATOM   2416 O  O    . VAL A 1 313 ? 4.368  11.865  13.010 1.00 26.10 ? 350 VAL A O    1 
ATOM   2417 C  CB   . VAL A 1 313 ? 4.936  14.617  14.836 1.00 26.07 ? 350 VAL A CB   1 
ATOM   2418 C  CG1  . VAL A 1 313 ? 4.989  13.419  15.786 1.00 25.98 ? 350 VAL A CG1  1 
ATOM   2419 C  CG2  . VAL A 1 313 ? 6.071  15.575  15.159 1.00 25.77 ? 350 VAL A CG2  1 
ATOM   2420 N  N    . ASP A 1 314 ? 2.750  13.437  12.976 1.00 28.52 ? 351 ASP A N    1 
ATOM   2421 C  CA   . ASP A 1 314 ? 1.678  12.462  12.764 1.00 29.52 ? 351 ASP A CA   1 
ATOM   2422 C  C    . ASP A 1 314 ? 1.812  11.688  11.458 1.00 28.96 ? 351 ASP A C    1 
ATOM   2423 O  O    . ASP A 1 314 ? 1.518  10.502  11.427 1.00 27.69 ? 351 ASP A O    1 
ATOM   2424 C  CB   . ASP A 1 314 ? 0.289  13.129  12.856 1.00 31.70 ? 351 ASP A CB   1 
ATOM   2425 C  CG   . ASP A 1 314 ? -0.043 13.604  14.281 1.00 32.85 ? 351 ASP A CG   1 
ATOM   2426 O  OD1  . ASP A 1 314 ? 0.379  12.929  15.243 1.00 33.46 ? 351 ASP A OD1  1 
ATOM   2427 O  OD2  . ASP A 1 314 ? -0.732 14.639  14.446 1.00 33.31 ? 351 ASP A OD2  1 
ATOM   2428 N  N    . ASP A 1 315 ? 2.264  12.345  10.391 1.00 29.19 ? 352 ASP A N    1 
ATOM   2429 C  CA   . ASP A 1 315 ? 2.437  11.662  9.130  1.00 28.71 ? 352 ASP A CA   1 
ATOM   2430 C  C    . ASP A 1 315 ? 3.647  10.734  9.175  1.00 29.64 ? 352 ASP A C    1 
ATOM   2431 O  O    . ASP A 1 315 ? 3.659  9.674   8.530  1.00 27.50 ? 352 ASP A O    1 
ATOM   2432 C  CB   . ASP A 1 315 ? 2.547  12.663  7.976  1.00 30.30 ? 352 ASP A CB   1 
ATOM   2433 C  CG   . ASP A 1 315 ? 1.183  13.258  7.581  1.00 32.30 ? 352 ASP A CG   1 
ATOM   2434 O  OD1  . ASP A 1 315 ? 0.135  12.687  7.987  1.00 33.46 ? 352 ASP A OD1  1 
ATOM   2435 O  OD2  . ASP A 1 315 ? 1.156  14.281  6.856  1.00 30.03 ? 352 ASP A OD2  1 
ATOM   2436 N  N    . ALA A 1 316 ? 4.663  11.108  9.951  1.00 30.05 ? 353 ALA A N    1 
ATOM   2437 C  CA   . ALA A 1 316 ? 5.858  10.260  10.067 1.00 29.47 ? 353 ALA A CA   1 
ATOM   2438 C  C    . ALA A 1 316 ? 5.495  8.983   10.834 1.00 29.55 ? 353 ALA A C    1 
ATOM   2439 O  O    . ALA A 1 316 ? 6.028  7.915   10.561 1.00 28.11 ? 353 ALA A O    1 
ATOM   2440 C  CB   . ALA A 1 316 ? 6.982  11.016  10.783 1.00 29.40 ? 353 ALA A CB   1 
ATOM   2441 N  N    . LEU A 1 317 ? 4.575  9.104   11.791 1.00 30.06 ? 354 LEU A N    1 
ATOM   2442 C  CA   . LEU A 1 317 ? 4.133  7.958   12.572 1.00 29.01 ? 354 LEU A CA   1 
ATOM   2443 C  C    . LEU A 1 317 ? 3.247  7.059   11.724 1.00 30.15 ? 354 LEU A C    1 
ATOM   2444 O  O    . LEU A 1 317 ? 2.913  5.923   12.112 1.00 30.82 ? 354 LEU A O    1 
ATOM   2445 C  CB   . LEU A 1 317 ? 3.345  8.418   13.797 1.00 27.34 ? 354 LEU A CB   1 
ATOM   2446 C  CG   . LEU A 1 317 ? 4.166  9.030   14.933 1.00 28.17 ? 354 LEU A CG   1 
ATOM   2447 C  CD1  . LEU A 1 317 ? 3.296  9.900   15.842 1.00 24.64 ? 354 LEU A CD1  1 
ATOM   2448 C  CD2  . LEU A 1 317 ? 4.868  7.881   15.695 1.00 25.70 ? 354 LEU A CD2  1 
ATOM   2449 N  N    . GLN A 1 318 ? 2.885  7.570   10.557 1.00 30.78 ? 355 GLN A N    1 
ATOM   2450 C  CA   . GLN A 1 318 ? 1.997  6.858   9.642  1.00 32.37 ? 355 GLN A CA   1 
ATOM   2451 C  C    . GLN A 1 318 ? 2.754  6.289   8.457  1.00 30.47 ? 355 GLN A C    1 
ATOM   2452 O  O    . GLN A 1 318 ? 2.195  5.559   7.646  1.00 30.92 ? 355 GLN A O    1 
ATOM   2453 C  CB   . GLN A 1 318 ? 0.912  7.812   9.138  1.00 35.23 ? 355 GLN A CB   1 
ATOM   2454 C  CG   . GLN A 1 318 ? -0.438 7.169   9.011  1.00 39.70 ? 355 GLN A CG   1 
ATOM   2455 C  CD   . GLN A 1 318 ? -1.267 7.334   10.253 1.00 40.21 ? 355 GLN A CD   1 
ATOM   2456 O  OE1  . GLN A 1 318 ? -1.028 6.685   11.275 1.00 41.96 ? 355 GLN A OE1  1 
ATOM   2457 N  NE2  . GLN A 1 318 ? -2.251 8.227   10.181 1.00 42.18 ? 355 GLN A NE2  1 
ATOM   2458 N  N    . HIS A 1 319 ? 4.026  6.655   8.350  1.00 29.18 ? 356 HIS A N    1 
ATOM   2459 C  CA   . HIS A 1 319 ? 4.870  6.173   7.276  1.00 26.51 ? 356 HIS A CA   1 
ATOM   2460 C  C    . HIS A 1 319 ? 5.044  4.675   7.486  1.00 26.96 ? 356 HIS A C    1 
ATOM   2461 O  O    . HIS A 1 319 ? 5.188  4.202   8.610  1.00 24.43 ? 356 HIS A O    1 
ATOM   2462 C  CB   . HIS A 1 319 ? 6.222  6.883   7.331  1.00 27.11 ? 356 HIS A CB   1 
ATOM   2463 C  CG   . HIS A 1 319 ? 7.135  6.562   6.188  1.00 24.56 ? 356 HIS A CG   1 
ATOM   2464 N  ND1  . HIS A 1 319 ? 7.740  5.337   6.040  1.00 23.58 ? 356 HIS A ND1  1 
ATOM   2465 C  CD2  . HIS A 1 319 ? 7.513  7.301   5.115  1.00 24.61 ? 356 HIS A CD2  1 
ATOM   2466 C  CE1  . HIS A 1 319 ? 8.450  5.329   4.923  1.00 21.12 ? 356 HIS A CE1  1 
ATOM   2467 N  NE2  . HIS A 1 319 ? 8.326  6.510   4.346  1.00 21.91 ? 356 HIS A NE2  1 
ATOM   2468 N  N    . PRO A 1 320 ? 5.006  3.900   6.397  1.00 27.82 ? 357 PRO A N    1 
ATOM   2469 C  CA   . PRO A 1 320 ? 5.156  2.437   6.407  1.00 27.75 ? 357 PRO A CA   1 
ATOM   2470 C  C    . PRO A 1 320 ? 6.356  1.927   7.238  1.00 27.48 ? 357 PRO A C    1 
ATOM   2471 O  O    . PRO A 1 320 ? 6.269  0.894   7.905  1.00 27.71 ? 357 PRO A O    1 
ATOM   2472 C  CB   . PRO A 1 320 ? 5.315  2.108   4.922  1.00 27.63 ? 357 PRO A CB   1 
ATOM   2473 C  CG   . PRO A 1 320 ? 4.426  3.112   4.285  1.00 28.87 ? 357 PRO A CG   1 
ATOM   2474 C  CD   . PRO A 1 320 ? 4.756  4.391   5.031  1.00 27.94 ? 357 PRO A CD   1 
ATOM   2475 N  N    . TYR A 1 321 ? 7.478  2.642   7.180  1.00 26.88 ? 358 TYR A N    1 
ATOM   2476 C  CA   . TYR A 1 321 ? 8.673  2.246   7.925  1.00 25.35 ? 358 TYR A CA   1 
ATOM   2477 C  C    . TYR A 1 321 ? 8.438  2.278   9.418  1.00 25.69 ? 358 TYR A C    1 
ATOM   2478 O  O    . TYR A 1 321 ? 9.009  1.491   10.165 1.00 26.78 ? 358 TYR A O    1 
ATOM   2479 C  CB   . TYR A 1 321 ? 9.830  3.188   7.635  1.00 24.35 ? 358 TYR A CB   1 
ATOM   2480 C  CG   . TYR A 1 321 ? 11.145 2.665   8.156  1.00 23.43 ? 358 TYR A CG   1 
ATOM   2481 C  CD1  . TYR A 1 321 ? 11.731 1.548   7.576  1.00 22.92 ? 358 TYR A CD1  1 
ATOM   2482 C  CD2  . TYR A 1 321 ? 11.827 3.303   9.208  1.00 23.09 ? 358 TYR A CD2  1 
ATOM   2483 C  CE1  . TYR A 1 321 ? 12.961 1.075   8.010  1.00 22.83 ? 358 TYR A CE1  1 
ATOM   2484 C  CE2  . TYR A 1 321 ? 13.065 2.833   9.654  1.00 19.33 ? 358 TYR A CE2  1 
ATOM   2485 C  CZ   . TYR A 1 321 ? 13.631 1.714   9.038  1.00 22.02 ? 358 TYR A CZ   1 
ATOM   2486 O  OH   . TYR A 1 321 ? 14.890 1.260   9.388  1.00 21.34 ? 358 TYR A OH   1 
ATOM   2487 N  N    . ILE A 1 322 ? 7.587  3.202   9.843  1.00 24.91 ? 359 ILE A N    1 
ATOM   2488 C  CA   . ILE A 1 322 ? 7.292  3.393   11.247 1.00 24.49 ? 359 ILE A CA   1 
ATOM   2489 C  C    . ILE A 1 322 ? 5.997  2.749   11.731 1.00 26.37 ? 359 ILE A C    1 
ATOM   2490 O  O    . ILE A 1 322 ? 5.933  2.188   12.829 1.00 24.69 ? 359 ILE A O    1 
ATOM   2491 C  CB   . ILE A 1 322 ? 7.217  4.892   11.558 1.00 22.83 ? 359 ILE A CB   1 
ATOM   2492 C  CG1  . ILE A 1 322 ? 8.515  5.565   11.127 1.00 21.02 ? 359 ILE A CG1  1 
ATOM   2493 C  CG2  . ILE A 1 322 ? 6.954  5.109   13.038 1.00 22.54 ? 359 ILE A CG2  1 
ATOM   2494 C  CD1  . ILE A 1 322 ? 9.712  5.028   11.860 1.00 20.53 ? 359 ILE A CD1  1 
ATOM   2495 N  N    . ASN A 1 323 ? 4.979  2.838   10.889 1.00 27.67 ? 360 ASN A N    1 
ATOM   2496 C  CA   . ASN A 1 323 ? 3.647  2.353   11.176 1.00 29.52 ? 360 ASN A CA   1 
ATOM   2497 C  C    . ASN A 1 323 ? 3.467  0.952   11.745 1.00 29.70 ? 360 ASN A C    1 
ATOM   2498 O  O    . ASN A 1 323 ? 2.479  0.676   12.430 1.00 29.95 ? 360 ASN A O    1 
ATOM   2499 C  CB   . ASN A 1 323 ? 2.809  2.512   9.929  1.00 33.34 ? 360 ASN A CB   1 
ATOM   2500 C  CG   . ASN A 1 323 ? 1.391  2.177   10.170 1.00 36.11 ? 360 ASN A CG   1 
ATOM   2501 O  OD1  . ASN A 1 323 ? 0.966  1.058   9.901  1.00 41.81 ? 360 ASN A OD1  1 
ATOM   2502 N  ND2  . ASN A 1 323 ? 0.636  3.128   10.713 1.00 37.88 ? 360 ASN A ND2  1 
ATOM   2503 N  N    . VAL A 1 324 ? 4.408  0.060   11.489 1.00 29.85 ? 361 VAL A N    1 
ATOM   2504 C  CA   . VAL A 1 324 ? 4.285  -1.294  12.016 1.00 30.13 ? 361 VAL A CA   1 
ATOM   2505 C  C    . VAL A 1 324 ? 4.260  -1.341  13.536 1.00 30.78 ? 361 VAL A C    1 
ATOM   2506 O  O    . VAL A 1 324 ? 3.911  -2.368  14.102 1.00 30.72 ? 361 VAL A O    1 
ATOM   2507 C  CB   . VAL A 1 324 ? 5.441  -2.216  11.533 1.00 31.22 ? 361 VAL A CB   1 
ATOM   2508 C  CG1  . VAL A 1 324 ? 5.623  -2.078  10.031 1.00 30.42 ? 361 VAL A CG1  1 
ATOM   2509 C  CG2  . VAL A 1 324 ? 6.740  -1.882  12.273 1.00 30.67 ? 361 VAL A CG2  1 
ATOM   2510 N  N    . TRP A 1 325 ? 4.634  -0.254  14.209 1.00 32.15 ? 362 TRP A N    1 
ATOM   2511 C  CA   . TRP A 1 325 ? 4.635  -0.264  15.676 1.00 31.90 ? 362 TRP A CA   1 
ATOM   2512 C  C    . TRP A 1 325 ? 3.475  0.546   16.250 1.00 33.98 ? 362 TRP A C    1 
ATOM   2513 O  O    . TRP A 1 325 ? 3.202  0.470   17.446 1.00 32.72 ? 362 TRP A O    1 
ATOM   2514 C  CB   . TRP A 1 325 ? 5.954  0.302   16.242 1.00 30.55 ? 362 TRP A CB   1 
ATOM   2515 C  CG   . TRP A 1 325 ? 7.206  -0.388  15.749 1.00 28.57 ? 362 TRP A CG   1 
ATOM   2516 C  CD1  . TRP A 1 325 ? 8.032  0.039   14.760 1.00 28.28 ? 362 TRP A CD1  1 
ATOM   2517 C  CD2  . TRP A 1 325 ? 7.743  -1.639  16.208 1.00 29.90 ? 362 TRP A CD2  1 
ATOM   2518 N  NE1  . TRP A 1 325 ? 9.049  -0.860  14.567 1.00 29.62 ? 362 TRP A NE1  1 
ATOM   2519 C  CE2  . TRP A 1 325 ? 8.897  -1.902  15.444 1.00 29.38 ? 362 TRP A CE2  1 
ATOM   2520 C  CE3  . TRP A 1 325 ? 7.359  -2.563  17.189 1.00 30.63 ? 362 TRP A CE3  1 
ATOM   2521 C  CZ2  . TRP A 1 325 ? 9.680  -3.049  15.627 1.00 29.38 ? 362 TRP A CZ2  1 
ATOM   2522 C  CZ3  . TRP A 1 325 ? 8.144  -3.715  17.369 1.00 32.83 ? 362 TRP A CZ3  1 
ATOM   2523 C  CH2  . TRP A 1 325 ? 9.288  -3.940  16.588 1.00 30.48 ? 362 TRP A CH2  1 
ATOM   2524 N  N    . TYR A 1 326 ? 2.799  1.318   15.396 1.00 36.97 ? 363 TYR A N    1 
ATOM   2525 C  CA   . TYR A 1 326 ? 1.691  2.174   15.836 1.00 39.68 ? 363 TYR A CA   1 
ATOM   2526 C  C    . TYR A 1 326 ? 0.819  1.513   16.904 1.00 42.14 ? 363 TYR A C    1 
ATOM   2527 O  O    . TYR A 1 326 ? 0.576  0.309   16.849 1.00 42.98 ? 363 TYR A O    1 
ATOM   2528 C  CB   . TYR A 1 326 ? 0.826  2.611   14.644 1.00 39.21 ? 363 TYR A CB   1 
ATOM   2529 C  CG   . TYR A 1 326 ? -0.058 3.812   14.970 1.00 39.60 ? 363 TYR A CG   1 
ATOM   2530 C  CD1  . TYR A 1 326 ? 0.367  5.117   14.703 1.00 37.67 ? 363 TYR A CD1  1 
ATOM   2531 C  CD2  . TYR A 1 326 ? -1.295 3.638   15.608 1.00 38.69 ? 363 TYR A CD2  1 
ATOM   2532 C  CE1  . TYR A 1 326 ? -0.412 6.220   15.067 1.00 37.59 ? 363 TYR A CE1  1 
ATOM   2533 C  CE2  . TYR A 1 326 ? -2.077 4.729   15.976 1.00 38.79 ? 363 TYR A CE2  1 
ATOM   2534 C  CZ   . TYR A 1 326 ? -1.625 6.017   15.705 1.00 38.69 ? 363 TYR A CZ   1 
ATOM   2535 O  OH   . TYR A 1 326 ? -2.384 7.084   16.117 1.00 39.63 ? 363 TYR A OH   1 
ATOM   2536 N  N    . ASP A 1 327 ? 0.384  2.313   17.881 1.00 44.76 ? 364 ASP A N    1 
ATOM   2537 C  CA   . ASP A 1 327 ? -0.446 1.868   19.004 1.00 47.22 ? 364 ASP A CA   1 
ATOM   2538 C  C    . ASP A 1 327 ? -1.118 3.118   19.590 1.00 48.83 ? 364 ASP A C    1 
ATOM   2539 O  O    . ASP A 1 327 ? -0.440 3.992   20.141 1.00 49.03 ? 364 ASP A O    1 
ATOM   2540 C  CB   . ASP A 1 327 ? 0.429  1.219   20.085 1.00 48.22 ? 364 ASP A CB   1 
ATOM   2541 C  CG   . ASP A 1 327 ? -0.384 0.619   21.234 1.00 49.00 ? 364 ASP A CG   1 
ATOM   2542 O  OD1  . ASP A 1 327 ? -1.562 1.010   21.422 1.00 48.88 ? 364 ASP A OD1  1 
ATOM   2543 O  OD2  . ASP A 1 327 ? 0.175  -0.242  21.954 1.00 49.87 ? 364 ASP A OD2  1 
ATOM   2544 N  N    . PRO A 1 328 ? -2.458 3.220   19.479 1.00 50.17 ? 365 PRO A N    1 
ATOM   2545 C  CA   . PRO A 1 328 ? -3.216 4.368   19.994 1.00 50.37 ? 365 PRO A CA   1 
ATOM   2546 C  C    . PRO A 1 328 ? -2.912 4.683   21.454 1.00 50.86 ? 365 PRO A C    1 
ATOM   2547 O  O    . PRO A 1 328 ? -2.878 5.851   21.857 1.00 52.00 ? 365 PRO A O    1 
ATOM   2548 C  CB   . PRO A 1 328 ? -4.668 3.946   19.776 1.00 50.66 ? 365 PRO A CB   1 
ATOM   2549 C  CG   . PRO A 1 328 ? -4.581 3.119   18.513 1.00 51.19 ? 365 PRO A CG   1 
ATOM   2550 C  CD   . PRO A 1 328 ? -3.355 2.264   18.800 1.00 50.89 ? 365 PRO A CD   1 
ATOM   2551 N  N    . ALA A 1 329 ? -2.685 3.640   22.245 1.00 50.31 ? 366 ALA A N    1 
ATOM   2552 C  CA   . ALA A 1 329 ? -2.391 3.818   23.659 1.00 49.71 ? 366 ALA A CA   1 
ATOM   2553 C  C    . ALA A 1 329 ? -1.091 4.607   23.854 1.00 49.74 ? 366 ALA A C    1 
ATOM   2554 O  O    . ALA A 1 329 ? -0.956 5.367   24.812 1.00 49.77 ? 366 ALA A O    1 
ATOM   2555 C  CB   . ALA A 1 329 ? -2.302 2.446   24.350 1.00 48.42 ? 366 ALA A CB   1 
ATOM   2556 N  N    . GLU A 1 330 ? -0.142 4.430   22.937 1.00 49.93 ? 367 GLU A N    1 
ATOM   2557 C  CA   . GLU A 1 330 ? 1.155  5.118   23.011 1.00 49.43 ? 367 GLU A CA   1 
ATOM   2558 C  C    . GLU A 1 330 ? 1.232  6.457   22.247 1.00 49.83 ? 367 GLU A C    1 
ATOM   2559 O  O    . GLU A 1 330 ? 2.056  7.316   22.585 1.00 49.36 ? 367 GLU A O    1 
ATOM   2560 C  CB   . GLU A 1 330 ? 2.258  4.172   22.504 1.00 48.29 ? 367 GLU A CB   1 
ATOM   2561 C  CG   . GLU A 1 330 ? 2.219  2.782   23.154 1.00 45.92 ? 367 GLU A CG   1 
ATOM   2562 C  CD   . GLU A 1 330 ? 3.129  1.773   22.476 1.00 44.00 ? 367 GLU A CD   1 
ATOM   2563 O  OE1  . GLU A 1 330 ? 3.198  1.785   21.227 1.00 41.69 ? 367 GLU A OE1  1 
ATOM   2564 O  OE2  . GLU A 1 330 ? 3.765  0.953   23.190 1.00 43.71 ? 367 GLU A OE2  1 
ATOM   2565 N  N    . VAL A 1 331 ? 0.381  6.632   21.231 1.00 50.44 ? 368 VAL A N    1 
ATOM   2566 C  CA   . VAL A 1 331 ? 0.373  7.853   20.414 1.00 51.82 ? 368 VAL A CA   1 
ATOM   2567 C  C    . VAL A 1 331 ? -0.495 8.987   20.971 1.00 53.55 ? 368 VAL A C    1 
ATOM   2568 O  O    . VAL A 1 331 ? -0.330 10.140  20.576 1.00 53.06 ? 368 VAL A O    1 
ATOM   2569 C  CB   . VAL A 1 331 ? -0.078 7.544   18.952 1.00 51.82 ? 368 VAL A CB   1 
ATOM   2570 C  CG1  . VAL A 1 331 ? 0.091  8.774   18.062 1.00 51.13 ? 368 VAL A CG1  1 
ATOM   2571 C  CG2  . VAL A 1 331 ? 0.720  6.373   18.399 1.00 50.82 ? 368 VAL A CG2  1 
ATOM   2572 N  N    . GLU A 1 332 ? -1.422 8.667   21.877 1.00 56.39 ? 369 GLU A N    1 
ATOM   2573 C  CA   . GLU A 1 332 ? -2.282 9.691   22.500 1.00 58.48 ? 369 GLU A CA   1 
ATOM   2574 C  C    . GLU A 1 332 ? -2.463 9.474   24.014 1.00 58.67 ? 369 GLU A C    1 
ATOM   2575 O  O    . GLU A 1 332 ? -2.840 8.384   24.437 1.00 59.41 ? 369 GLU A O    1 
ATOM   2576 C  CB   . GLU A 1 332 ? -3.639 9.712   21.801 1.00 59.49 ? 369 GLU A CB   1 
ATOM   2577 C  CG   . GLU A 1 332 ? -4.203 8.328   21.556 1.00 62.14 ? 369 GLU A CG   1 
ATOM   2578 C  CD   . GLU A 1 332 ? -4.904 8.223   20.213 1.00 63.49 ? 369 GLU A CD   1 
ATOM   2579 O  OE1  . GLU A 1 332 ? -4.207 8.305   19.167 1.00 63.64 ? 369 GLU A OE1  1 
ATOM   2580 O  OE2  . GLU A 1 332 ? -6.152 8.059   20.211 1.00 63.90 ? 369 GLU A OE2  1 
ATOM   2581 N  N    . ALA A 1 333 ? -2.178 10.504  24.820 1.00 59.21 ? 370 ALA A N    1 
ATOM   2582 C  CA   . ALA A 1 333 ? -2.300 10.413  26.283 1.00 59.32 ? 370 ALA A CA   1 
ATOM   2583 C  C    . ALA A 1 333 ? -2.488 11.760  27.029 1.00 59.74 ? 370 ALA A C    1 
ATOM   2584 O  O    . ALA A 1 333 ? -3.329 11.861  27.940 1.00 59.53 ? 370 ALA A O    1 
ATOM   2585 C  CB   . ALA A 1 333 ? -1.081 9.669   26.856 1.00 59.08 ? 370 ALA A CB   1 
ATOM   2586 N  N    . PRO A 1 334 ? -1.693 12.772  26.659 1.00 60.02 ? 371 PRO A N    1 
ATOM   2587 C  CA   . PRO A 1 334 ? -1.735 14.118  27.259 1.00 59.26 ? 371 PRO A CA   1 
ATOM   2588 C  C    . PRO A 1 334 ? -1.330 14.147  28.740 1.00 59.62 ? 371 PRO A C    1 
ATOM   2589 O  O    . PRO A 1 334 ? -0.890 13.077  29.233 1.00 60.16 ? 371 PRO A O    1 
ATOM   2590 C  CB   . PRO A 1 334 ? -3.124 14.734  27.073 1.00 59.58 ? 371 PRO A CB   1 
ATOM   2591 N  N    . GLN A 1 342 ? 0.279  28.043  34.713 1.00 60.17 ? 379 GLN A N    1 
ATOM   2592 C  CA   . GLN A 1 342 ? 1.651  27.463  34.774 1.00 60.21 ? 379 GLN A CA   1 
ATOM   2593 C  C    . GLN A 1 342 ? 2.605  28.495  34.199 1.00 60.52 ? 379 GLN A C    1 
ATOM   2594 O  O    . GLN A 1 342 ? 3.652  28.794  34.786 1.00 59.73 ? 379 GLN A O    1 
ATOM   2595 C  CB   . GLN A 1 342 ? 1.707  26.187  33.949 1.00 60.12 ? 379 GLN A CB   1 
ATOM   2596 N  N    . LEU A 1 343 ? 2.192  29.044  33.055 1.00 60.75 ? 380 LEU A N    1 
ATOM   2597 C  CA   . LEU A 1 343 ? 2.923  30.058  32.278 1.00 60.69 ? 380 LEU A CA   1 
ATOM   2598 C  C    . LEU A 1 343 ? 4.110  30.716  32.990 1.00 60.59 ? 380 LEU A C    1 
ATOM   2599 O  O    . LEU A 1 343 ? 3.950  31.310  34.058 1.00 60.81 ? 380 LEU A O    1 
ATOM   2600 C  CB   . LEU A 1 343 ? 1.941  31.147  31.812 1.00 60.11 ? 380 LEU A CB   1 
ATOM   2601 C  CG   . LEU A 1 343 ? 0.496  30.667  31.560 1.00 60.22 ? 380 LEU A CG   1 
ATOM   2602 C  CD1  . LEU A 1 343 ? -0.395 31.896  31.292 1.00 59.58 ? 380 LEU A CD1  1 
ATOM   2603 C  CD2  . LEU A 1 343 ? 0.436  29.663  30.392 1.00 59.29 ? 380 LEU A CD2  1 
ATOM   2604 N  N    . ASP A 1 344 ? 5.292  30.608  32.379 1.00 60.63 ? 381 ASP A N    1 
ATOM   2605 C  CA   . ASP A 1 344 ? 6.519  31.192  32.917 1.00 61.16 ? 381 ASP A CA   1 
ATOM   2606 C  C    . ASP A 1 344 ? 7.368  31.687  31.745 1.00 60.54 ? 381 ASP A C    1 
ATOM   2607 O  O    . ASP A 1 344 ? 7.453  31.012  30.719 1.00 60.12 ? 381 ASP A O    1 
ATOM   2608 C  CB   . ASP A 1 344 ? 7.290  30.147  33.730 1.00 62.08 ? 381 ASP A CB   1 
ATOM   2609 C  CG   . ASP A 1 344 ? 6.497  29.636  34.927 1.00 64.33 ? 381 ASP A CG   1 
ATOM   2610 O  OD1  . ASP A 1 344 ? 5.943  28.503  34.866 1.00 64.81 ? 381 ASP A OD1  1 
ATOM   2611 O  OD2  . ASP A 1 344 ? 6.421  30.377  35.940 1.00 65.02 ? 381 ASP A OD2  1 
ATOM   2612 N  N    . GLU A 1 345 ? 8.001  32.850  31.894 1.00 59.52 ? 382 GLU A N    1 
ATOM   2613 C  CA   . GLU A 1 345 ? 8.799  33.382  30.801 1.00 58.87 ? 382 GLU A CA   1 
ATOM   2614 C  C    . GLU A 1 345 ? 10.056 34.172  31.182 1.00 58.69 ? 382 GLU A C    1 
ATOM   2615 O  O    . GLU A 1 345 ? 11.174 33.646  31.099 1.00 59.18 ? 382 GLU A O    1 
ATOM   2616 C  CB   . GLU A 1 345 ? 7.916  34.228  29.913 1.00 58.89 ? 382 GLU A CB   1 
ATOM   2617 N  N    . ARG A 1 346 ? 9.855  35.430  31.587 1.00 57.32 ? 383 ARG A N    1 
ATOM   2618 C  CA   . ARG A 1 346 ? 10.918 36.377  31.961 1.00 55.35 ? 383 ARG A CA   1 
ATOM   2619 C  C    . ARG A 1 346 ? 12.163 35.847  32.656 1.00 54.41 ? 383 ARG A C    1 
ATOM   2620 O  O    . ARG A 1 346 ? 12.314 34.644  32.899 1.00 53.77 ? 383 ARG A O    1 
ATOM   2621 C  CB   . ARG A 1 346 ? 10.326 37.528  32.807 1.00 54.52 ? 383 ARG A CB   1 
ATOM   2622 N  N    . GLU A 1 347 ? 13.051 36.786  32.975 1.00 53.40 ? 384 GLU A N    1 
ATOM   2623 C  CA   . GLU A 1 347 ? 14.315 36.476  33.640 1.00 52.71 ? 384 GLU A CA   1 
ATOM   2624 C  C    . GLU A 1 347 ? 14.413 37.122  35.033 1.00 50.17 ? 384 GLU A C    1 
ATOM   2625 O  O    . GLU A 1 347 ? 13.747 38.123  35.331 1.00 49.21 ? 384 GLU A O    1 
ATOM   2626 C  CB   . GLU A 1 347 ? 15.503 36.914  32.759 1.00 54.63 ? 384 GLU A CB   1 
ATOM   2627 C  CG   . GLU A 1 347 ? 15.933 38.379  32.905 1.00 55.66 ? 384 GLU A CG   1 
ATOM   2628 C  CD   . GLU A 1 347 ? 16.653 38.894  31.651 1.00 56.98 ? 384 GLU A CD   1 
ATOM   2629 O  OE1  . GLU A 1 347 ? 17.332 38.090  30.958 1.00 56.67 ? 384 GLU A OE1  1 
ATOM   2630 O  OE2  . GLU A 1 347 ? 16.538 40.105  31.359 1.00 57.32 ? 384 GLU A OE2  1 
ATOM   2631 N  N    . HIS A 1 348 ? 15.237 36.519  35.881 1.00 46.73 ? 385 HIS A N    1 
ATOM   2632 C  CA   . HIS A 1 348 ? 15.409 36.993  37.237 1.00 44.42 ? 385 HIS A CA   1 
ATOM   2633 C  C    . HIS A 1 348 ? 16.867 37.077  37.616 1.00 42.93 ? 385 HIS A C    1 
ATOM   2634 O  O    . HIS A 1 348 ? 17.750 36.718  36.837 1.00 43.73 ? 385 HIS A O    1 
ATOM   2635 C  CB   . HIS A 1 348 ? 14.718 36.053  38.221 1.00 44.47 ? 385 HIS A CB   1 
ATOM   2636 C  CG   . HIS A 1 348 ? 13.256 35.868  37.965 1.00 45.62 ? 385 HIS A CG   1 
ATOM   2637 N  ND1  . HIS A 1 348 ? 12.769 35.133  36.904 1.00 46.45 ? 385 HIS A ND1  1 
ATOM   2638 C  CD2  . HIS A 1 348 ? 12.174 36.316  38.644 1.00 45.29 ? 385 HIS A CD2  1 
ATOM   2639 C  CE1  . HIS A 1 348 ? 11.449 35.136  36.941 1.00 46.71 ? 385 HIS A CE1  1 
ATOM   2640 N  NE2  . HIS A 1 348 ? 11.063 35.848  37.987 1.00 46.94 ? 385 HIS A NE2  1 
ATOM   2641 N  N    . THR A 1 349 ? 17.098 37.546  38.837 1.00 41.06 ? 386 THR A N    1 
ATOM   2642 C  CA   . THR A 1 349 ? 18.432 37.676  39.400 1.00 37.62 ? 386 THR A CA   1 
ATOM   2643 C  C    . THR A 1 349 ? 18.781 36.343  40.078 1.00 36.33 ? 386 THR A C    1 
ATOM   2644 O  O    . THR A 1 349 ? 17.899 35.506  40.308 1.00 34.22 ? 386 THR A O    1 
ATOM   2645 C  CB   . THR A 1 349 ? 18.456 38.777  40.468 1.00 36.74 ? 386 THR A CB   1 
ATOM   2646 O  OG1  . THR A 1 349 ? 17.781 38.310  41.640 1.00 34.33 ? 386 THR A OG1  1 
ATOM   2647 C  CG2  . THR A 1 349 ? 17.748 40.031  39.961 1.00 37.72 ? 386 THR A CG2  1 
ATOM   2648 N  N    . ILE A 1 350 ? 20.063 36.162  40.393 1.00 34.52 ? 387 ILE A N    1 
ATOM   2649 C  CA   . ILE A 1 350 ? 20.538 34.953  41.050 1.00 34.15 ? 387 ILE A CA   1 
ATOM   2650 C  C    . ILE A 1 350 ? 19.642 34.596  42.217 1.00 33.77 ? 387 ILE A C    1 
ATOM   2651 O  O    . ILE A 1 350 ? 19.149 33.471  42.325 1.00 32.67 ? 387 ILE A O    1 
ATOM   2652 C  CB   . ILE A 1 350 ? 21.954 35.134  41.637 1.00 35.04 ? 387 ILE A CB   1 
ATOM   2653 C  CG1  . ILE A 1 350 ? 22.992 35.168  40.519 1.00 35.20 ? 387 ILE A CG1  1 
ATOM   2654 C  CG2  . ILE A 1 350 ? 22.247 34.017  42.652 1.00 32.96 ? 387 ILE A CG2  1 
ATOM   2655 C  CD1  . ILE A 1 350 ? 24.388 35.406  41.029 1.00 35.40 ? 387 ILE A CD1  1 
ATOM   2656 N  N    . GLU A 1 351 ? 19.479 35.573  43.101 1.00 33.62 ? 388 GLU A N    1 
ATOM   2657 C  CA   . GLU A 1 351 ? 18.677 35.448  44.300 1.00 32.54 ? 388 GLU A CA   1 
ATOM   2658 C  C    . GLU A 1 351 ? 17.269 34.992  43.971 1.00 32.33 ? 388 GLU A C    1 
ATOM   2659 O  O    . GLU A 1 351 ? 16.754 34.053  44.571 1.00 31.22 ? 388 GLU A O    1 
ATOM   2660 C  CB   . GLU A 1 351 ? 18.641 36.801  45.020 1.00 34.81 ? 388 GLU A CB   1 
ATOM   2661 C  CG   . GLU A 1 351 ? 17.678 36.872  46.201 1.00 38.16 ? 388 GLU A CG   1 
ATOM   2662 C  CD   . GLU A 1 351 ? 17.619 38.263  46.837 1.00 40.87 ? 388 GLU A CD   1 
ATOM   2663 O  OE1  . GLU A 1 351 ? 17.430 39.264  46.095 1.00 41.90 ? 388 GLU A OE1  1 
ATOM   2664 O  OE2  . GLU A 1 351 ? 17.751 38.354  48.084 1.00 42.97 ? 388 GLU A OE2  1 
ATOM   2665 N  N    . GLU A 1 352 ? 16.633 35.667  43.023 1.00 31.34 ? 389 GLU A N    1 
ATOM   2666 C  CA   . GLU A 1 352 ? 15.276 35.297  42.651 1.00 32.13 ? 389 GLU A CA   1 
ATOM   2667 C  C    . GLU A 1 352 ? 15.201 33.854  42.139 1.00 31.31 ? 389 GLU A C    1 
ATOM   2668 O  O    . GLU A 1 352 ? 14.280 33.106  42.494 1.00 30.70 ? 389 GLU A O    1 
ATOM   2669 C  CB   . GLU A 1 352 ? 14.760 36.277  41.607 1.00 33.19 ? 389 GLU A CB   1 
ATOM   2670 C  CG   . GLU A 1 352 ? 14.625 37.696  42.147 1.00 37.16 ? 389 GLU A CG   1 
ATOM   2671 C  CD   . GLU A 1 352 ? 14.344 38.688  41.038 1.00 40.64 ? 389 GLU A CD   1 
ATOM   2672 O  OE1  . GLU A 1 352 ? 14.918 38.506  39.932 1.00 41.70 ? 389 GLU A OE1  1 
ATOM   2673 O  OE2  . GLU A 1 352 ? 13.565 39.644  41.271 1.00 42.05 ? 389 GLU A OE2  1 
ATOM   2674 N  N    . TRP A 1 353 ? 16.195 33.458  41.346 1.00 30.83 ? 390 TRP A N    1 
ATOM   2675 C  CA   . TRP A 1 353 ? 16.248 32.104  40.777 1.00 31.13 ? 390 TRP A CA   1 
ATOM   2676 C  C    . TRP A 1 353 ? 16.438 31.045  41.860 1.00 31.12 ? 390 TRP A C    1 
ATOM   2677 O  O    . TRP A 1 353 ? 15.795 29.988  41.834 1.00 29.77 ? 390 TRP A O    1 
ATOM   2678 C  CB   . TRP A 1 353 ? 17.392 31.992  39.753 1.00 28.76 ? 390 TRP A CB   1 
ATOM   2679 C  CG   . TRP A 1 353 ? 17.040 32.443  38.366 1.00 29.80 ? 390 TRP A CG   1 
ATOM   2680 C  CD1  . TRP A 1 353 ? 17.735 33.341  37.580 1.00 28.65 ? 390 TRP A CD1  1 
ATOM   2681 C  CD2  . TRP A 1 353 ? 15.940 31.990  37.568 1.00 27.26 ? 390 TRP A CD2  1 
ATOM   2682 N  NE1  . TRP A 1 353 ? 17.129 33.465  36.357 1.00 27.96 ? 390 TRP A NE1  1 
ATOM   2683 C  CE2  . TRP A 1 353 ? 16.027 32.651  36.320 1.00 28.19 ? 390 TRP A CE2  1 
ATOM   2684 C  CE3  . TRP A 1 353 ? 14.896 31.094  37.784 1.00 27.91 ? 390 TRP A CE3  1 
ATOM   2685 C  CZ2  . TRP A 1 353 ? 15.099 32.437  35.287 1.00 29.57 ? 390 TRP A CZ2  1 
ATOM   2686 C  CZ3  . TRP A 1 353 ? 13.969 30.876  36.758 1.00 29.14 ? 390 TRP A CZ3  1 
ATOM   2687 C  CH2  . TRP A 1 353 ? 14.078 31.548  35.524 1.00 29.68 ? 390 TRP A CH2  1 
ATOM   2688 N  N    . LYS A 1 354 ? 17.323 31.348  42.807 1.00 31.12 ? 391 LYS A N    1 
ATOM   2689 C  CA   . LYS A 1 354 ? 17.623 30.439  43.900 1.00 31.75 ? 391 LYS A CA   1 
ATOM   2690 C  C    . LYS A 1 354 ? 16.333 30.109  44.626 1.00 31.84 ? 391 LYS A C    1 
ATOM   2691 O  O    . LYS A 1 354 ? 16.058 28.947  44.898 1.00 32.07 ? 391 LYS A O    1 
ATOM   2692 C  CB   . LYS A 1 354 ? 18.624 31.069  44.877 1.00 31.71 ? 391 LYS A CB   1 
ATOM   2693 C  CG   . LYS A 1 354 ? 19.252 30.090  45.875 1.00 32.73 ? 391 LYS A CG   1 
ATOM   2694 C  CD   . LYS A 1 354 ? 20.173 30.824  46.857 1.00 35.11 ? 391 LYS A CD   1 
ATOM   2695 C  CE   . LYS A 1 354 ? 20.907 29.839  47.781 1.00 38.74 ? 391 LYS A CE   1 
ATOM   2696 N  NZ   . LYS A 1 354 ? 21.611 30.454  48.974 1.00 39.14 ? 391 LYS A NZ   1 
ATOM   2697 N  N    . GLU A 1 355 ? 15.529 31.124  44.923 1.00 32.32 ? 392 GLU A N    1 
ATOM   2698 C  CA   . GLU A 1 355 ? 14.281 30.876  45.623 1.00 32.78 ? 392 GLU A CA   1 
ATOM   2699 C  C    . GLU A 1 355 ? 13.296 30.141  44.728 1.00 31.10 ? 392 GLU A C    1 
ATOM   2700 O  O    . GLU A 1 355 ? 12.591 29.238  45.171 1.00 31.29 ? 392 GLU A O    1 
ATOM   2701 C  CB   . GLU A 1 355 ? 13.664 32.187  46.118 1.00 33.02 ? 392 GLU A CB   1 
ATOM   2702 C  CG   . GLU A 1 355 ? 12.355 31.970  46.882 1.00 37.62 ? 392 GLU A CG   1 
ATOM   2703 C  CD   . GLU A 1 355 ? 11.944 33.174  47.752 1.00 40.58 ? 392 GLU A CD   1 
ATOM   2704 O  OE1  . GLU A 1 355 ? 11.947 34.334  47.260 1.00 41.63 ? 392 GLU A OE1  1 
ATOM   2705 O  OE2  . GLU A 1 355 ? 11.596 32.946  48.933 1.00 42.34 ? 392 GLU A OE2  1 
ATOM   2706 N  N    . LEU A 1 356 ? 13.242 30.517  43.462 1.00 30.86 ? 393 LEU A N    1 
ATOM   2707 C  CA   . LEU A 1 356 ? 12.315 29.868  42.549 1.00 31.66 ? 393 LEU A CA   1 
ATOM   2708 C  C    . LEU A 1 356 ? 12.560 28.376  42.433 1.00 30.36 ? 393 LEU A C    1 
ATOM   2709 O  O    . LEU A 1 356 ? 11.619 27.598  42.346 1.00 30.25 ? 393 LEU A O    1 
ATOM   2710 C  CB   . LEU A 1 356 ? 12.414 30.486  41.158 1.00 33.10 ? 393 LEU A CB   1 
ATOM   2711 C  CG   . LEU A 1 356 ? 11.659 31.772  40.877 1.00 34.94 ? 393 LEU A CG   1 
ATOM   2712 C  CD1  . LEU A 1 356 ? 12.025 32.258  39.488 1.00 35.35 ? 393 LEU A CD1  1 
ATOM   2713 C  CD2  . LEU A 1 356 ? 10.157 31.531  40.974 1.00 35.62 ? 393 LEU A CD2  1 
ATOM   2714 N  N    . ILE A 1 357 ? 13.827 27.979  42.420 1.00 29.51 ? 394 ILE A N    1 
ATOM   2715 C  CA   . ILE A 1 357 ? 14.188 26.565  42.283 1.00 27.73 ? 394 ILE A CA   1 
ATOM   2716 C  C    . ILE A 1 357 ? 13.961 25.825  43.594 1.00 28.39 ? 394 ILE A C    1 
ATOM   2717 O  O    . ILE A 1 357 ? 13.411 24.722  43.617 1.00 28.27 ? 394 ILE A O    1 
ATOM   2718 C  CB   . ILE A 1 357 ? 15.664 26.449  41.804 1.00 27.14 ? 394 ILE A CB   1 
ATOM   2719 C  CG1  . ILE A 1 357 ? 15.750 27.002  40.373 1.00 24.79 ? 394 ILE A CG1  1 
ATOM   2720 C  CG2  . ILE A 1 357 ? 16.182 25.007  41.917 1.00 23.67 ? 394 ILE A CG2  1 
ATOM   2721 C  CD1  . ILE A 1 357 ? 17.141 27.186  39.868 1.00 24.16 ? 394 ILE A CD1  1 
ATOM   2722 N  N    . TYR A 1 358 ? 14.358 26.451  44.692 1.00 28.99 ? 395 TYR A N    1 
ATOM   2723 C  CA   . TYR A 1 358 ? 14.183 25.862  46.012 1.00 30.13 ? 395 TYR A CA   1 
ATOM   2724 C  C    . TYR A 1 358 ? 12.700 25.515  46.231 1.00 31.41 ? 395 TYR A C    1 
ATOM   2725 O  O    . TYR A 1 358 ? 12.362 24.413  46.658 1.00 31.94 ? 395 TYR A O    1 
ATOM   2726 C  CB   . TYR A 1 358 ? 14.643 26.861  47.083 1.00 29.83 ? 395 TYR A CB   1 
ATOM   2727 C  CG   . TYR A 1 358 ? 14.656 26.304  48.494 1.00 30.80 ? 395 TYR A CG   1 
ATOM   2728 C  CD1  . TYR A 1 358 ? 15.484 25.222  48.831 1.00 31.81 ? 395 TYR A CD1  1 
ATOM   2729 C  CD2  . TYR A 1 358 ? 13.806 26.819  49.480 1.00 29.07 ? 395 TYR A CD2  1 
ATOM   2730 C  CE1  . TYR A 1 358 ? 15.458 24.657  50.110 1.00 32.48 ? 395 TYR A CE1  1 
ATOM   2731 C  CE2  . TYR A 1 358 ? 13.772 26.264  50.766 1.00 31.28 ? 395 TYR A CE2  1 
ATOM   2732 C  CZ   . TYR A 1 358 ? 14.592 25.184  51.071 1.00 32.61 ? 395 TYR A CZ   1 
ATOM   2733 O  OH   . TYR A 1 358 ? 14.531 24.602  52.309 1.00 32.60 ? 395 TYR A OH   1 
ATOM   2734 N  N    . LYS A 1 359 ? 11.816 26.465  45.954 1.00 31.63 ? 396 LYS A N    1 
ATOM   2735 C  CA   . LYS A 1 359 ? 10.390 26.227  46.133 1.00 33.33 ? 396 LYS A CA   1 
ATOM   2736 C  C    . LYS A 1 359 ? 9.976  24.992  45.354 1.00 34.01 ? 396 LYS A C    1 
ATOM   2737 O  O    . LYS A 1 359 ? 9.356  24.088  45.885 1.00 32.14 ? 396 LYS A O    1 
ATOM   2738 C  CB   . LYS A 1 359 ? 9.591  27.448  45.675 1.00 34.92 ? 396 LYS A CB   1 
ATOM   2739 C  CG   . LYS A 1 359 ? 9.725  28.627  46.624 1.00 37.67 ? 396 LYS A CG   1 
ATOM   2740 C  CD   . LYS A 1 359 ? 8.981  29.851  46.127 1.00 40.56 ? 396 LYS A CD   1 
ATOM   2741 C  CE   . LYS A 1 359 ? 8.570  30.730  47.296 1.00 42.60 ? 396 LYS A CE   1 
ATOM   2742 N  NZ   . LYS A 1 359 ? 9.741  31.245  48.064 1.00 44.18 ? 396 LYS A NZ   1 
ATOM   2743 N  N    . GLU A 1 360 ? 10.349 24.954  44.084 1.00 36.76 ? 397 GLU A N    1 
ATOM   2744 C  CA   . GLU A 1 360 ? 10.035 23.817  43.235 1.00 37.44 ? 397 GLU A CA   1 
ATOM   2745 C  C    . GLU A 1 360 ? 10.580 22.509  43.855 1.00 38.30 ? 397 GLU A C    1 
ATOM   2746 O  O    . GLU A 1 360 ? 9.849  21.521  43.998 1.00 38.04 ? 397 GLU A O    1 
ATOM   2747 C  CB   . GLU A 1 360 ? 10.633 24.069  41.847 1.00 38.19 ? 397 GLU A CB   1 
ATOM   2748 C  CG   . GLU A 1 360 ? 9.861  23.440  40.706 1.00 39.90 ? 397 GLU A CG   1 
ATOM   2749 C  CD   . GLU A 1 360 ? 8.362  23.587  40.878 1.00 40.01 ? 397 GLU A CD   1 
ATOM   2750 O  OE1  . GLU A 1 360 ? 7.871  24.738  40.905 1.00 39.46 ? 397 GLU A OE1  1 
ATOM   2751 O  OE2  . GLU A 1 360 ? 7.689  22.541  41.004 1.00 41.96 ? 397 GLU A OE2  1 
ATOM   2752 N  N    . VAL A 1 361 ? 11.853 22.510  44.244 1.00 37.84 ? 398 VAL A N    1 
ATOM   2753 C  CA   . VAL A 1 361 ? 12.437 21.327  44.845 1.00 37.36 ? 398 VAL A CA   1 
ATOM   2754 C  C    . VAL A 1 361 ? 11.660 20.900  46.100 1.00 39.93 ? 398 VAL A C    1 
ATOM   2755 O  O    . VAL A 1 361 ? 11.405 19.717  46.306 1.00 39.78 ? 398 VAL A O    1 
ATOM   2756 C  CB   . VAL A 1 361 ? 13.893 21.571  45.246 1.00 35.77 ? 398 VAL A CB   1 
ATOM   2757 C  CG1  . VAL A 1 361 ? 14.472 20.305  45.866 1.00 33.62 ? 398 VAL A CG1  1 
ATOM   2758 C  CG2  . VAL A 1 361 ? 14.699 21.997  44.041 1.00 33.74 ? 398 VAL A CG2  1 
ATOM   2759 N  N    . MET A 1 362 ? 11.287 21.853  46.947 1.00 41.26 ? 399 MET A N    1 
ATOM   2760 C  CA   . MET A 1 362 ? 10.547 21.514  48.162 1.00 44.33 ? 399 MET A CA   1 
ATOM   2761 C  C    . MET A 1 362 ? 9.051  21.304  47.856 1.00 46.04 ? 399 MET A C    1 
ATOM   2762 O  O    . MET A 1 362 ? 8.279  20.909  48.731 1.00 45.39 ? 399 MET A O    1 
ATOM   2763 C  CB   . MET A 1 362 ? 10.730 22.621  49.206 1.00 43.73 ? 399 MET A CB   1 
ATOM   2764 C  CG   . MET A 1 362 ? 12.188 22.877  49.583 1.00 44.94 ? 399 MET A CG   1 
ATOM   2765 S  SD   . MET A 1 362 ? 13.031 21.501  50.465 1.00 45.80 ? 399 MET A SD   1 
ATOM   2766 C  CE   . MET A 1 362 ? 13.648 20.510  49.089 1.00 47.16 ? 399 MET A CE   1 
ATOM   2767 N  N    . ASN A 1 363 ? 8.674  21.534  46.599 1.00 47.41 ? 400 ASN A N    1 
ATOM   2768 C  CA   . ASN A 1 363 ? 7.295  21.403  46.137 1.00 49.88 ? 400 ASN A CA   1 
ATOM   2769 C  C    . ASN A 1 363 ? 6.359  22.358  46.855 1.00 51.26 ? 400 ASN A C    1 
ATOM   2770 O  O    . ASN A 1 363 ? 6.853  23.265  47.571 1.00 52.99 ? 400 ASN A O    1 
ATOM   2771 C  CB   . ASN A 1 363 ? 6.777  19.967  46.298 1.00 50.15 ? 400 ASN A CB   1 
ATOM   2772 C  CG   . ASN A 1 363 ? 6.785  19.196  44.987 1.00 49.52 ? 400 ASN A CG   1 
ATOM   2773 O  OD1  . ASN A 1 363 ? 6.833  19.788  43.904 1.00 49.89 ? 400 ASN A OD1  1 
ATOM   2774 N  ND2  . ASN A 1 363 ? 6.721  17.869  45.079 1.00 50.49 ? 400 ASN A ND2  1 
HETATM 2775 N  N1   . 984 B 2 .   ? 22.929 10.681  31.054 1.00 20.38 ? 501 984 A N1   1 
HETATM 2776 C  C2   . 984 B 2 .   ? 23.012 12.032  30.959 1.00 21.19 ? 501 984 A C2   1 
HETATM 2777 N  N3   . 984 B 2 .   ? 22.099 12.689  31.761 1.00 20.39 ? 501 984 A N3   1 
HETATM 2778 C  C4   . 984 B 2 .   ? 21.286 11.715  32.506 1.00 18.32 ? 501 984 A C4   1 
HETATM 2779 C  C5   . 984 B 2 .   ? 21.818 10.391  32.070 1.00 18.75 ? 501 984 A C5   1 
HETATM 2780 C  C6   . 984 B 2 .   ? 23.810 9.773   30.284 1.00 16.92 ? 501 984 A C6   1 
HETATM 2781 C  C7   . 984 B 2 .   ? 25.052 9.346   31.058 1.00 22.20 ? 501 984 A C7   1 
HETATM 2782 C  C10  . 984 B 2 .   ? 26.273 9.103   30.175 1.00 21.68 ? 501 984 A C10  1 
HETATM 2783 C  C16  . 984 B 2 .   ? 23.755 12.832  30.259 1.00 23.06 ? 501 984 A C16  1 
HETATM 2784 C  C17  . 984 B 2 .   ? 22.993 13.755  29.246 1.00 24.67 ? 501 984 A C17  1 
HETATM 2785 C  C18  . 984 B 2 .   ? 23.949 14.690  28.421 1.00 25.86 ? 501 984 A C18  1 
HETATM 2786 N  N19  . 984 B 2 .   ? 24.867 15.478  29.304 1.00 27.09 ? 501 984 A N19  1 
HETATM 2787 C  C20  . 984 B 2 .   ? 25.646 14.618  30.217 1.00 26.19 ? 501 984 A C20  1 
HETATM 2788 C  C21  . 984 B 2 .   ? 24.742 13.694  31.104 1.00 23.46 ? 501 984 A C21  1 
HETATM 2789 C  C31  . 984 B 2 .   ? 25.771 16.330  28.490 1.00 26.38 ? 501 984 A C31  1 
HETATM 2790 C  C35  . 984 B 2 .   ? 20.233 12.113  33.484 1.00 15.75 ? 501 984 A C35  1 
HETATM 2791 C  C36  . 984 B 2 .   ? 21.478 8.914   32.226 1.00 18.11 ? 501 984 A C36  1 
HETATM 2792 C  C37  . 984 B 2 .   ? 20.149 11.487  34.750 1.00 14.63 ? 501 984 A C37  1 
HETATM 2793 C  C38  . 984 B 2 .   ? 19.164 11.823  35.678 1.00 13.58 ? 501 984 A C38  1 
HETATM 2794 C  C39  . 984 B 2 .   ? 18.187 12.800  35.352 1.00 13.81 ? 501 984 A C39  1 
HETATM 2795 C  C40  . 984 B 2 .   ? 18.251 13.461  34.084 1.00 15.25 ? 501 984 A C40  1 
HETATM 2796 C  C41  . 984 B 2 .   ? 19.283 13.102  33.140 1.00 17.72 ? 501 984 A C41  1 
HETATM 2797 CL CL45 . 984 B 2 .   ? 19.205 10.973  37.165 1.00 1.00  ? 501 984 A CL45 1 
HETATM 2798 CL CL46 . 984 B 2 .   ? 16.917 13.246  36.437 1.00 4.05  ? 501 984 A CL46 1 
HETATM 2799 C  C47  . 984 B 2 .   ? 20.240 8.598   32.848 1.00 18.20 ? 501 984 A C47  1 
HETATM 2800 C  C48  . 984 B 2 .   ? 19.962 7.222   33.017 1.00 14.40 ? 501 984 A C48  1 
HETATM 2801 N  N49  . 984 B 2 .   ? 20.831 6.265   32.634 1.00 19.07 ? 501 984 A N49  1 
HETATM 2802 C  C50  . 984 B 2 .   ? 21.978 6.679   32.078 1.00 18.17 ? 501 984 A C50  1 
HETATM 2803 N  N51  . 984 B 2 .   ? 22.318 7.950   31.867 1.00 19.33 ? 501 984 A N51  1 
HETATM 2804 N  N54  . 984 B 2 .   ? 22.907 5.776   31.683 1.00 21.30 ? 501 984 A N54  1 
HETATM 2805 C  C55  . 984 B 2 .   ? 23.040 5.365   30.301 1.00 24.56 ? 501 984 A C55  1 
HETATM 2806 C  C56  . 984 B 2 .   ? 24.372 4.720   30.671 1.00 23.09 ? 501 984 A C56  1 
HETATM 2807 C  C57  . 984 B 2 .   ? 24.257 5.791   29.633 1.00 22.39 ? 501 984 A C57  1 
HETATM 2808 O  O    . HOH C 3 .   ? 17.469 7.254   52.307 1.00 24.26 ? 601 HOH A O    1 
HETATM 2809 O  O    . HOH C 3 .   ? 14.898 6.449   51.939 1.00 17.29 ? 602 HOH A O    1 
HETATM 2810 O  O    . HOH C 3 .   ? 25.796 0.230   37.681 1.00 50.26 ? 603 HOH A O    1 
HETATM 2811 O  O    . HOH C 3 .   ? 19.485 -0.350  33.451 1.00 33.78 ? 604 HOH A O    1 
HETATM 2812 O  O    . HOH C 3 .   ? 18.079 16.192  31.178 1.00 33.63 ? 605 HOH A O    1 
HETATM 2813 O  O    . HOH C 3 .   ? 16.985 19.945  34.178 1.00 43.79 ? 606 HOH A O    1 
HETATM 2814 O  O    . HOH C 3 .   ? 10.845 -3.846  23.930 1.00 35.18 ? 607 HOH A O    1 
HETATM 2815 O  O    . HOH C 3 .   ? 11.793 7.245   44.609 1.00 21.42 ? 608 HOH A O    1 
HETATM 2816 O  O    . HOH C 3 .   ? 16.506 -3.969  29.295 1.00 30.02 ? 609 HOH A O    1 
HETATM 2817 O  O    . HOH C 3 .   ? 24.773 14.347  20.624 1.00 24.00 ? 610 HOH A O    1 
HETATM 2818 O  O    . HOH C 3 .   ? 12.338 -5.610  10.502 1.00 28.98 ? 611 HOH A O    1 
HETATM 2819 O  O    . HOH C 3 .   ? 22.065 20.026  17.967 1.00 15.99 ? 612 HOH A O    1 
HETATM 2820 O  O    . HOH C 3 .   ? 12.018 8.019   33.074 1.00 34.36 ? 613 HOH A O    1 
HETATM 2821 O  O    . HOH C 3 .   ? 8.672  2.323   25.053 1.00 26.34 ? 614 HOH A O    1 
HETATM 2822 O  O    . HOH C 3 .   ? 7.587  26.872  10.243 1.00 28.05 ? 615 HOH A O    1 
HETATM 2823 O  O    . HOH C 3 .   ? 14.694 19.326  18.051 1.00 12.46 ? 616 HOH A O    1 
HETATM 2824 O  O    . HOH C 3 .   ? 32.542 26.620  1.483  1.00 35.06 ? 617 HOH A O    1 
HETATM 2825 O  O    . HOH C 3 .   ? 29.915 -2.433  41.276 1.00 40.90 ? 618 HOH A O    1 
HETATM 2826 O  O    . HOH C 3 .   ? 13.234 4.946   -1.669 1.00 26.19 ? 619 HOH A O    1 
HETATM 2827 O  O    . HOH C 3 .   ? 20.592 -5.473  15.644 1.00 34.76 ? 620 HOH A O    1 
HETATM 2828 O  O    . HOH C 3 .   ? 18.242 7.416   57.589 1.00 28.89 ? 621 HOH A O    1 
HETATM 2829 O  O    . HOH C 3 .   ? 6.114  4.115   22.459 1.00 32.85 ? 623 HOH A O    1 
HETATM 2830 O  O    . HOH C 3 .   ? 6.622  1.006   22.633 1.00 28.46 ? 624 HOH A O    1 
HETATM 2831 O  O    . HOH C 3 .   ? 12.756 7.017   36.051 1.00 21.95 ? 625 HOH A O    1 
HETATM 2832 O  O    . HOH C 3 .   ? 14.865 22.703  28.851 1.00 44.36 ? 626 HOH A O    1 
HETATM 2833 O  O    . HOH C 3 .   ? 14.491 6.520   43.956 1.00 20.17 ? 627 HOH A O    1 
HETATM 2834 O  O    . HOH C 3 .   ? 12.979 13.128  48.888 1.00 29.38 ? 628 HOH A O    1 
HETATM 2835 O  O    . HOH C 3 .   ? 13.046 14.817  50.569 1.00 36.89 ? 629 HOH A O    1 
HETATM 2836 O  O    . HOH C 3 .   ? 29.298 20.074  46.631 1.00 52.59 ? 630 HOH A O    1 
HETATM 2837 O  O    . HOH C 3 .   ? 9.848  -1.224  9.492  1.00 21.26 ? 631 HOH A O    1 
HETATM 2838 O  O    . HOH C 3 .   ? 10.100 -5.107  11.013 1.00 33.22 ? 632 HOH A O    1 
HETATM 2839 O  O    . HOH C 3 .   ? 26.209 13.145  18.565 1.00 39.53 ? 633 HOH A O    1 
HETATM 2840 O  O    . HOH C 3 .   ? 15.448 21.756  15.817 1.00 22.77 ? 634 HOH A O    1 
HETATM 2841 O  O    . HOH C 3 .   ? 23.820 16.604  11.443 1.00 21.57 ? 635 HOH A O    1 
HETATM 2842 O  O    . HOH C 3 .   ? 22.337 29.488  0.873  1.00 27.23 ? 636 HOH A O    1 
HETATM 2843 O  O    . HOH C 3 .   ? 14.396 15.098  -2.978 1.00 52.32 ? 637 HOH A O    1 
HETATM 2844 O  O    . HOH C 3 .   ? 25.218 1.447   7.234  1.00 33.67 ? 638 HOH A O    1 
HETATM 2845 O  O    . HOH C 3 .   ? 15.832 -10.716 6.240  1.00 32.76 ? 639 HOH A O    1 
HETATM 2846 O  O    . HOH C 3 .   ? 14.588 -12.937 0.607  1.00 25.05 ? 640 HOH A O    1 
HETATM 2847 O  O    . HOH C 3 .   ? 16.830 18.080  -1.256 1.00 41.12 ? 641 HOH A O    1 
HETATM 2848 O  O    . HOH C 3 .   ? 8.859  27.903  42.096 1.00 38.76 ? 642 HOH A O    1 
HETATM 2849 O  O    . HOH C 3 .   ? 17.156 -2.325  38.393 1.00 30.57 ? 643 HOH A O    1 
HETATM 2850 O  O    . HOH C 3 .   ? 22.211 -2.210  35.499 1.00 47.21 ? 644 HOH A O    1 
HETATM 2851 O  O    . HOH C 3 .   ? 14.720 17.548  49.648 1.00 23.48 ? 645 HOH A O    1 
HETATM 2852 O  O    . HOH C 3 .   ? 28.920 9.909   23.993 1.00 34.28 ? 646 HOH A O    1 
HETATM 2853 O  O    . HOH C 3 .   ? 21.820 0.508   9.236  1.00 34.00 ? 647 HOH A O    1 
HETATM 2854 O  O    . HOH C 3 .   ? 26.878 34.536  1.340  1.00 38.30 ? 648 HOH A O    1 
HETATM 2855 O  O    . HOH C 3 .   ? 29.988 32.050  4.162  1.00 45.99 ? 649 HOH A O    1 
HETATM 2856 O  O    . HOH C 3 .   ? 6.932  0.191   0.136  1.00 35.93 ? 650 HOH A O    1 
HETATM 2857 O  O    . HOH C 3 .   ? 5.454  -2.616  4.221  1.00 53.73 ? 651 HOH A O    1 
HETATM 2858 O  O    . HOH C 3 .   ? 8.178  15.817  3.153  1.00 32.42 ? 652 HOH A O    1 
HETATM 2859 O  O    . HOH C 3 .   ? 13.587 15.842  -0.037 1.00 30.47 ? 653 HOH A O    1 
HETATM 2860 O  O    . HOH C 3 .   ? 24.950 1.978   33.405 1.00 51.69 ? 654 HOH A O    1 
HETATM 2861 O  O    . HOH C 3 .   ? 17.870 17.490  34.213 1.00 27.89 ? 655 HOH A O    1 
HETATM 2862 O  O    . HOH C 3 .   ? 21.105 -5.334  48.935 1.00 42.61 ? 656 HOH A O    1 
HETATM 2863 O  O    . HOH C 3 .   ? 7.579  11.084  31.566 1.00 28.35 ? 657 HOH A O    1 
HETATM 2864 O  O    . HOH C 3 .   ? 10.873 8.836   47.695 1.00 41.18 ? 658 HOH A O    1 
HETATM 2865 O  O    . HOH C 3 .   ? 28.332 8.568   18.077 1.00 38.23 ? 659 HOH A O    1 
HETATM 2866 O  O    . HOH C 3 .   ? 7.566  26.021  26.430 1.00 34.91 ? 660 HOH A O    1 
HETATM 2867 O  O    . HOH C 3 .   ? 4.547  18.010  13.224 1.00 30.39 ? 661 HOH A O    1 
HETATM 2868 O  O    . HOH C 3 .   ? 24.879 0.132   9.330  1.00 39.94 ? 662 HOH A O    1 
HETATM 2869 O  O    . HOH C 3 .   ? 30.972 12.011  12.495 1.00 34.42 ? 663 HOH A O    1 
HETATM 2870 O  O    . HOH C 3 .   ? 26.378 29.394  5.419  1.00 43.62 ? 665 HOH A O    1 
HETATM 2871 O  O    . HOH C 3 .   ? 16.545 12.293  -3.667 1.00 38.08 ? 667 HOH A O    1 
HETATM 2872 O  O    . HOH C 3 .   ? 17.116 -5.844  9.293  1.00 31.03 ? 668 HOH A O    1 
HETATM 2873 O  O    . HOH C 3 .   ? 4.166  -2.485  1.815  1.00 31.46 ? 669 HOH A O    1 
HETATM 2874 O  O    . HOH C 3 .   ? 4.822  9.750   4.288  1.00 25.03 ? 671 HOH A O    1 
HETATM 2875 O  O    . HOH C 3 .   ? 28.332 30.813  36.823 1.00 33.04 ? 672 HOH A O    1 
HETATM 2876 O  O    . HOH C 3 .   ? 21.554 15.454  32.157 1.00 32.50 ? 673 HOH A O    1 
HETATM 2877 O  O    . HOH C 3 .   ? 10.231 -4.594  20.503 1.00 41.28 ? 674 HOH A O    1 
HETATM 2878 O  O    . HOH C 3 .   ? 15.269 14.892  51.899 1.00 47.55 ? 675 HOH A O    1 
HETATM 2879 O  O    . HOH C 3 .   ? 18.744 14.714  57.668 1.00 32.51 ? 676 HOH A O    1 
HETATM 2880 O  O    . HOH C 3 .   ? 16.277 17.925  52.941 1.00 37.59 ? 677 HOH A O    1 
HETATM 2881 O  O    . HOH C 3 .   ? 25.311 18.503  48.110 1.00 24.71 ? 679 HOH A O    1 
HETATM 2882 O  O    . HOH C 3 .   ? 27.858 22.761  45.102 1.00 35.09 ? 680 HOH A O    1 
HETATM 2883 O  O    . HOH C 3 .   ? 22.092 22.435  55.389 1.00 29.25 ? 681 HOH A O    1 
HETATM 2884 O  O    . HOH C 3 .   ? 13.944 28.655  53.871 1.00 32.50 ? 682 HOH A O    1 
HETATM 2885 O  O    . HOH C 3 .   ? 12.256 30.476  52.688 1.00 43.69 ? 683 HOH A O    1 
HETATM 2886 O  O    . HOH C 3 .   ? 14.114 34.877  -2.768 1.00 45.16 ? 684 HOH A O    1 
HETATM 2887 O  O    . HOH C 3 .   ? 12.422 34.323  43.375 1.00 45.92 ? 685 HOH A O    1 
HETATM 2888 O  O    . HOH C 3 .   ? 21.074 1.885   52.514 1.00 34.34 ? 686 HOH A O    1 
HETATM 2889 O  O    . HOH C 3 .   ? 28.257 5.218   47.576 1.00 43.86 ? 687 HOH A O    1 
HETATM 2890 O  O    . HOH C 3 .   ? 27.288 3.318   49.308 1.00 29.96 ? 688 HOH A O    1 
HETATM 2891 O  O    . HOH C 3 .   ? 31.285 2.422   43.932 1.00 34.60 ? 689 HOH A O    1 
HETATM 2892 O  O    . HOH C 3 .   ? 25.368 0.416   40.558 1.00 44.90 ? 690 HOH A O    1 
HETATM 2893 O  O    . HOH C 3 .   ? 20.827 -2.471  54.523 1.00 38.20 ? 691 HOH A O    1 
HETATM 2894 O  O    . HOH C 3 .   ? 28.634 11.893  29.793 1.00 40.02 ? 692 HOH A O    1 
HETATM 2895 O  O    . HOH C 3 .   ? 27.404 12.810  26.743 1.00 38.06 ? 693 HOH A O    1 
HETATM 2896 O  O    . HOH C 3 .   ? 25.152 11.082  27.047 1.00 22.90 ? 694 HOH A O    1 
HETATM 2897 O  O    . HOH C 3 .   ? 27.696 5.884   28.181 1.00 39.82 ? 695 HOH A O    1 
HETATM 2898 O  O    . HOH C 3 .   ? 26.733 2.451   28.553 1.00 42.38 ? 697 HOH A O    1 
HETATM 2899 O  O    . HOH C 3 .   ? 7.909  27.714  32.237 1.00 48.14 ? 698 HOH A O    1 
HETATM 2900 O  O    . HOH C 3 .   ? 19.746 21.010  33.967 1.00 32.82 ? 699 HOH A O    1 
HETATM 2901 O  O    . HOH C 3 .   ? 24.506 24.385  37.748 1.00 43.93 ? 700 HOH A O    1 
HETATM 2902 O  O    . HOH C 3 .   ? 22.351 28.009  21.652 1.00 46.22 ? 701 HOH A O    1 
HETATM 2903 O  O    . HOH C 3 .   ? 20.691 29.208  17.916 1.00 37.74 ? 702 HOH A O    1 
HETATM 2904 O  O    . HOH C 3 .   ? 8.203  2.672   41.563 1.00 42.54 ? 703 HOH A O    1 
HETATM 2905 O  O    . HOH C 3 .   ? 19.460 -6.938  46.978 1.00 48.89 ? 704 HOH A O    1 
HETATM 2906 O  O    . HOH C 3 .   ? 10.064 5.904   46.951 1.00 47.42 ? 705 HOH A O    1 
HETATM 2907 O  O    . HOH C 3 .   ? 14.339 4.044   -4.845 1.00 44.90 ? 706 HOH A O    1 
HETATM 2908 O  O    . HOH C 3 .   ? 17.361 16.084  -2.903 1.00 34.90 ? 707 HOH A O    1 
HETATM 2909 O  O    . HOH C 3 .   ? 10.590 -1.423  43.023 1.00 42.00 ? 708 HOH A O    1 
HETATM 2910 O  O    . HOH C 3 .   ? 33.032 29.791  9.942  1.00 34.52 ? 709 HOH A O    1 
HETATM 2911 O  O    . HOH C 3 .   ? 14.425 -4.915  40.522 1.00 43.39 ? 710 HOH A O    1 
HETATM 2912 O  O    . HOH C 3 .   ? 9.655  7.555   31.571 1.00 21.27 ? 712 HOH A O    1 
HETATM 2913 O  O    . HOH C 3 .   ? 9.859  3.463   27.581 1.00 35.95 ? 713 HOH A O    1 
HETATM 2914 O  O    . HOH C 3 .   ? 29.706 6.879   16.199 1.00 45.90 ? 714 HOH A O    1 
HETATM 2915 O  O    . HOH C 3 .   ? 29.798 6.935   21.760 1.00 56.61 ? 715 HOH A O    1 
HETATM 2916 O  O    . HOH C 3 .   ? 18.084 17.152  23.423 1.00 35.72 ? 717 HOH A O    1 
HETATM 2917 O  O    . HOH C 3 .   ? 10.844 -2.332  29.571 1.00 42.18 ? 718 HOH A O    1 
HETATM 2918 O  O    . HOH C 3 .   ? 18.032 -3.315  31.031 1.00 25.35 ? 719 HOH A O    1 
HETATM 2919 O  O    . HOH C 3 .   ? 24.573 33.493  32.087 1.00 44.02 ? 720 HOH A O    1 
HETATM 2920 O  O    . HOH C 3 .   ? 27.876 22.285  17.397 1.00 36.02 ? 721 HOH A O    1 
HETATM 2921 O  O    . HOH C 3 .   ? 23.497 13.863  12.205 1.00 27.49 ? 722 HOH A O    1 
HETATM 2922 O  O    . HOH C 3 .   ? 21.307 20.313  11.280 1.00 14.95 ? 723 HOH A O    1 
HETATM 2923 O  O    . HOH C 3 .   ? 9.158  24.239  11.441 1.00 24.87 ? 724 HOH A O    1 
HETATM 2924 O  O    . HOH C 3 .   ? 3.748  20.864  12.155 1.00 35.02 ? 725 HOH A O    1 
HETATM 2925 O  O    . HOH C 3 .   ? 10.114 32.660  9.851  1.00 41.93 ? 726 HOH A O    1 
HETATM 2926 O  O    . HOH C 3 .   ? 22.443 28.259  -1.852 1.00 40.40 ? 727 HOH A O    1 
HETATM 2927 O  O    . HOH C 3 .   ? 15.245 20.567  1.013  1.00 39.34 ? 728 HOH A O    1 
HETATM 2928 O  O    . HOH C 3 .   ? 15.313 17.456  0.860  1.00 29.00 ? 729 HOH A O    1 
HETATM 2929 O  O    . HOH C 3 .   ? 16.516 -1.295  -1.359 1.00 36.91 ? 730 HOH A O    1 
HETATM 2930 O  O    . HOH C 3 .   ? 22.537 1.225   11.704 1.00 46.36 ? 731 HOH A O    1 
HETATM 2931 O  O    . HOH C 3 .   ? 16.845 21.764  -1.037 1.00 43.22 ? 732 HOH A O    1 
HETATM 2932 O  O    . HOH C 3 .   ? 4.800  17.660  4.012  1.00 38.55 ? 733 HOH A O    1 
HETATM 2933 O  O    . HOH C 3 .   ? 2.696  16.757  16.361 1.00 35.49 ? 734 HOH A O    1 
HETATM 2934 O  O    . HOH C 3 .   ? 17.874 8.440   54.793 1.00 32.40 ? 736 HOH A O    1 
HETATM 2935 O  O    . HOH C 3 .   ? 19.682 -1.778  35.567 1.00 31.04 ? 738 HOH A O    1 
HETATM 2936 O  O    . HOH C 3 .   ? 14.916 1.019   37.050 1.00 44.95 ? 739 HOH A O    1 
HETATM 2937 O  O    . HOH C 3 .   ? 12.152 -4.493  19.093 1.00 32.33 ? 740 HOH A O    1 
HETATM 2938 O  O    . HOH C 3 .   ? 29.677 -0.288  18.496 1.00 32.53 ? 741 HOH A O    1 
HETATM 2939 O  O    . HOH C 3 .   ? 3.260  5.930   27.842 1.00 29.90 ? 742 HOH A O    1 
HETATM 2940 O  O    . HOH C 3 .   ? 7.948  13.344  33.546 1.00 29.14 ? 743 HOH A O    1 
HETATM 2941 O  O    . HOH C 3 .   ? 27.191 18.638  39.676 1.00 27.51 ? 745 HOH A O    1 
HETATM 2942 O  O    . HOH C 3 .   ? 16.129 0.564   34.522 1.00 49.13 ? 746 HOH A O    1 
HETATM 2943 O  O    . HOH C 3 .   ? 1.725  16.565  13.868 1.00 30.77 ? 747 HOH A O    1 
HETATM 2944 O  O    . HOH C 3 .   ? 19.584 19.852  18.262 1.00 17.79 ? 748 HOH A O    1 
HETATM 2945 O  O    . HOH C 3 .   ? 12.838 29.300  32.154 1.00 41.41 ? 749 HOH A O    1 
HETATM 2946 O  O    . HOH C 3 .   ? 27.092 25.624  -5.598 1.00 38.97 ? 750 HOH A O    1 
HETATM 2947 O  O    . HOH C 3 .   ? 9.539  18.736  43.731 1.00 42.26 ? 751 HOH A O    1 
HETATM 2948 O  O    . HOH C 3 .   ? 14.645 -6.484  11.429 1.00 29.54 ? 752 HOH A O    1 
HETATM 2949 O  O    . HOH C 3 .   ? 25.697 38.553  1.477  1.00 43.72 ? 753 HOH A O    1 
HETATM 2950 O  O    . HOH C 3 .   ? 9.399  1.973   -0.590 1.00 21.45 ? 754 HOH A O    1 
HETATM 2951 O  O    . HOH C 3 .   ? 3.074  9.073   5.693  1.00 28.56 ? 755 HOH A O    1 
HETATM 2952 O  O    . HOH C 3 .   ? 2.494  10.283  22.259 1.00 22.91 ? 756 HOH A O    1 
HETATM 2953 O  O    . HOH C 3 .   ? 12.236 17.495  48.100 1.00 40.51 ? 757 HOH A O    1 
HETATM 2954 O  O    . HOH C 3 .   ? 19.372 18.420  30.798 1.00 48.08 ? 758 HOH A O    1 
HETATM 2955 O  O    . HOH C 3 .   ? 7.153  -0.298  25.797 1.00 33.49 ? 759 HOH A O    1 
HETATM 2956 O  O    . HOH C 3 .   ? 20.072 23.798  58.786 1.00 46.75 ? 760 HOH A O    1 
HETATM 2957 O  O    . HOH C 3 .   ? 21.436 11.845  -9.742 1.00 47.15 ? 761 HOH A O    1 
HETATM 2958 O  O    . HOH C 3 .   ? 19.282 -7.198  9.760  1.00 39.54 ? 762 HOH A O    1 
HETATM 2959 O  O    . HOH C 3 .   ? 8.674  12.945  36.458 1.00 28.95 ? 763 HOH A O    1 
HETATM 2960 O  O    . HOH C 3 .   ? 10.426 12.330  -1.250 1.00 50.75 ? 764 HOH A O    1 
HETATM 2961 O  O    . HOH C 3 .   ? 23.000 -0.215  55.443 1.00 42.80 ? 765 HOH A O    1 
HETATM 2962 O  O    . HOH C 3 .   ? 10.088 5.006   36.543 1.00 44.45 ? 766 HOH A O    1 
HETATM 2963 O  O    . HOH C 3 .   ? 3.120  20.225  9.629  1.00 49.79 ? 767 HOH A O    1 
HETATM 2964 O  O    . HOH C 3 .   ? 24.500 28.339  20.319 1.00 42.56 ? 768 HOH A O    1 
HETATM 2965 O  O    . HOH C 3 .   ? -1.272 14.828  19.200 1.00 55.65 ? 770 HOH A O    1 
HETATM 2966 O  O    . HOH C 3 .   ? 4.631  -1.520  6.471  1.00 40.56 ? 771 HOH A O    1 
HETATM 2967 O  O    . HOH C 3 .   ? 1.093  23.626  9.387  1.00 37.21 ? 772 HOH A O    1 
HETATM 2968 O  O    . HOH C 3 .   ? 13.220 6.713   -5.041 1.00 39.00 ? 773 HOH A O    1 
HETATM 2969 O  O    . HOH C 3 .   ? 3.271  15.736  6.492  1.00 41.02 ? 774 HOH A O    1 
HETATM 2970 O  O    . HOH C 3 .   ? 12.491 2.204   28.980 1.00 28.00 ? 776 HOH A O    1 
HETATM 2971 O  O    . HOH C 3 .   ? 25.362 20.016  23.842 1.00 31.79 ? 777 HOH A O    1 
HETATM 2972 O  O    . HOH C 3 .   ? 28.876 15.420  6.204  1.00 41.37 ? 778 HOH A O    1 
HETATM 2973 O  O    . HOH C 3 .   ? 7.914  24.959  23.716 1.00 43.42 ? 779 HOH A O    1 
HETATM 2974 O  O    . HOH C 3 .   ? 28.981 9.405   14.602 1.00 48.29 ? 780 HOH A O    1 
HETATM 2975 O  O    . HOH C 3 .   ? 19.396 18.925  62.723 1.00 37.54 ? 781 HOH A O    1 
HETATM 2976 O  O    . HOH C 3 .   ? 22.352 26.233  23.212 1.00 40.94 ? 782 HOH A O    1 
HETATM 2977 O  O    . HOH C 3 .   ? 23.209 19.246  26.392 1.00 38.73 ? 783 HOH A O    1 
HETATM 2978 O  O    . HOH C 3 .   ? 20.645 23.507  34.922 1.00 27.47 ? 784 HOH A O    1 
HETATM 2979 O  O    . HOH C 3 .   ? 12.641 39.260  10.389 1.00 50.52 ? 785 HOH A O    1 
HETATM 2980 O  O    . HOH C 3 .   ? 23.708 -0.042  33.302 1.00 43.11 ? 786 HOH A O    1 
HETATM 2981 O  O    . HOH C 3 .   ? 21.952 30.935  -2.562 1.00 43.22 ? 787 HOH A O    1 
HETATM 2982 O  O    . HOH C 3 .   ? 11.538 30.045  50.237 1.00 43.85 ? 788 HOH A O    1 
HETATM 2983 O  O    . HOH C 3 .   ? -0.599 9.745   12.815 1.00 34.49 ? 789 HOH A O    1 
HETATM 2984 O  O    . HOH C 3 .   ? 20.710 17.589  55.750 1.00 41.51 ? 791 HOH A O    1 
HETATM 2985 O  O    . HOH C 3 .   ? 22.409 22.900  36.404 1.00 38.88 ? 797 HOH A O    1 
HETATM 2986 O  O    . HOH C 3 .   ? 17.550 21.501  27.237 1.00 42.19 ? 798 HOH A O    1 
HETATM 2987 O  O    . HOH C 3 .   ? 20.950 33.534  37.965 1.00 48.91 ? 799 HOH A O    1 
HETATM 2988 O  O    . HOH C 3 .   ? 15.616 22.020  52.667 1.00 33.83 ? 800 HOH A O    1 
HETATM 2989 O  O    . HOH C 3 .   ? 21.019 38.588  43.066 1.00 37.36 ? 801 HOH A O    1 
HETATM 2990 O  O    . HOH C 3 .   ? 14.640 -8.337  12.989 1.00 38.33 ? 802 HOH A O    1 
HETATM 2991 O  O    . HOH C 3 .   ? 22.463 -1.197  10.493 1.00 39.00 ? 803 HOH A O    1 
HETATM 2992 O  O    . HOH C 3 .   ? 27.103 -0.463  8.338  1.00 40.33 ? 804 HOH A O    1 
HETATM 2993 O  O    . HOH C 3 .   ? 24.567 -6.033  11.402 1.00 36.00 ? 805 HOH A O    1 
HETATM 2994 O  O    . HOH C 3 .   ? 21.608 -8.283  6.797  1.00 56.53 ? 806 HOH A O    1 
HETATM 2995 O  O    . HOH C 3 .   ? 18.551 -3.179  4.244  1.00 32.86 ? 807 HOH A O    1 
HETATM 2996 O  O    . HOH C 3 .   ? 15.698 29.453  18.564 1.00 54.34 ? 808 HOH A O    1 
HETATM 2997 O  O    . HOH C 3 .   ? 12.047 0.893   30.744 1.00 42.15 ? 811 HOH A O    1 
HETATM 2998 O  O    . HOH C 3 .   ? 17.875 25.782  27.396 1.00 40.60 ? 812 HOH A O    1 
HETATM 2999 O  O    . HOH C 3 .   ? 15.911 26.993  29.133 1.00 55.29 ? 813 HOH A O    1 
HETATM 3000 O  O    . HOH C 3 .   ? 26.637 16.127  22.131 1.00 55.08 ? 814 HOH A O    1 
HETATM 3001 O  O    . HOH C 3 .   ? 6.162  26.354  7.584  1.00 46.85 ? 815 HOH A O    1 
HETATM 3002 O  O    . HOH C 3 .   ? 18.866 21.617  -7.642 1.00 51.34 ? 816 HOH A O    1 
HETATM 3003 O  O    . HOH C 3 .   ? 3.704  18.639  7.421  1.00 41.87 ? 817 HOH A O    1 
HETATM 3004 O  O    . HOH C 3 .   ? 9.308  33.614  35.519 1.00 41.77 ? 819 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   38  ?   ?   ?   A . n 
A 1 2   ALA 2   39  ?   ?   ?   A . n 
A 1 3   SER 3   40  ?   ?   ?   A . n 
A 1 4   LYS 4   41  ?   ?   ?   A . n 
A 1 5   SER 5   42  ?   ?   ?   A . n 
A 1 6   LYS 6   43  ?   ?   ?   A . n 
A 1 7   VAL 7   44  ?   ?   ?   A . n 
A 1 8   ASP 8   45  45  ASP ASP A . n 
A 1 9   ASN 9   46  46  ASN ASN A . n 
A 1 10  GLN 10  47  47  GLN GLN A . n 
A 1 11  PHE 11  48  48  PHE PHE A . n 
A 1 12  TYR 12  49  49  TYR TYR A . n 
A 1 13  SER 13  50  50  SER SER A . n 
A 1 14  VAL 14  51  51  VAL VAL A . n 
A 1 15  GLU 15  52  52  GLU GLU A . n 
A 1 16  VAL 16  53  53  VAL VAL A . n 
A 1 17  GLY 17  54  54  GLY GLY A . n 
A 1 18  ASP 18  55  55  ASP ASP A . n 
A 1 19  SER 19  56  56  SER SER A . n 
A 1 20  THR 20  57  57  THR THR A . n 
A 1 21  PHE 21  58  58  PHE PHE A . n 
A 1 22  THR 22  59  59  THR THR A . n 
A 1 23  VAL 23  60  60  VAL VAL A . n 
A 1 24  LEU 24  61  61  LEU LEU A . n 
A 1 25  LYS 25  62  62  LYS LYS A . n 
A 1 26  ARG 26  63  63  ARG ARG A . n 
A 1 27  TYR 27  64  64  TYR TYR A . n 
A 1 28  GLN 28  65  65  GLN GLN A . n 
A 1 29  ASN 29  66  66  ASN ASN A . n 
A 1 30  LEU 30  67  67  LEU LEU A . n 
A 1 31  LYS 31  68  68  LYS LYS A . n 
A 1 32  PRO 32  69  69  PRO PRO A . n 
A 1 33  ILE 33  70  70  ILE ILE A . n 
A 1 34  GLY 34  71  71  GLY GLY A . n 
A 1 35  SER 35  72  72  SER SER A . n 
A 1 36  GLY 36  73  73  GLY GLY A . n 
A 1 37  ALA 37  74  74  ALA ALA A . n 
A 1 38  GLN 38  75  75  GLN GLN A . n 
A 1 39  GLY 39  76  76  GLY GLY A . n 
A 1 40  ILE 40  77  77  ILE ILE A . n 
A 1 41  VAL 41  78  78  VAL VAL A . n 
A 1 42  CYS 42  79  79  CYS CYS A . n 
A 1 43  ALA 43  80  80  ALA ALA A . n 
A 1 44  ALA 44  81  81  ALA ALA A . n 
A 1 45  TYR 45  82  82  TYR TYR A . n 
A 1 46  ASP 46  83  83  ASP ASP A . n 
A 1 47  ALA 47  84  84  ALA ALA A . n 
A 1 48  VAL 48  85  85  VAL VAL A . n 
A 1 49  LEU 49  86  86  LEU LEU A . n 
A 1 50  ASP 50  87  87  ASP ASP A . n 
A 1 51  ARG 51  88  88  ARG ARG A . n 
A 1 52  ASN 52  89  89  ASN ASN A . n 
A 1 53  VAL 53  90  90  VAL VAL A . n 
A 1 54  ALA 54  91  91  ALA ALA A . n 
A 1 55  ILE 55  92  92  ILE ILE A . n 
A 1 56  LYS 56  93  93  LYS LYS A . n 
A 1 57  LYS 57  94  94  LYS LYS A . n 
A 1 58  LEU 58  95  95  LEU LEU A . n 
A 1 59  SER 59  96  96  SER SER A . n 
A 1 60  ARG 60  97  97  ARG ARG A . n 
A 1 61  PRO 61  98  98  PRO PRO A . n 
A 1 62  PHE 62  99  99  PHE PHE A . n 
A 1 63  GLN 63  100 100 GLN GLN A . n 
A 1 64  ASN 64  101 101 ASN ASN A . n 
A 1 65  GLN 65  102 102 GLN GLN A . n 
A 1 66  THR 66  103 103 THR THR A . n 
A 1 67  HIS 67  104 104 HIS HIS A . n 
A 1 68  ALA 68  105 105 ALA ALA A . n 
A 1 69  LYS 69  106 106 LYS LYS A . n 
A 1 70  ARG 70  107 107 ARG ARG A . n 
A 1 71  ALA 71  108 108 ALA ALA A . n 
A 1 72  TYR 72  109 109 TYR TYR A . n 
A 1 73  ARG 73  110 110 ARG ARG A . n 
A 1 74  GLU 74  111 111 GLU GLU A . n 
A 1 75  LEU 75  112 112 LEU LEU A . n 
A 1 76  VAL 76  113 113 VAL VAL A . n 
A 1 77  LEU 77  114 114 LEU LEU A . n 
A 1 78  MET 78  115 115 MET MET A . n 
A 1 79  LYS 79  116 116 LYS LYS A . n 
A 1 80  CYS 80  117 117 CYS CYS A . n 
A 1 81  VAL 81  118 118 VAL VAL A . n 
A 1 82  ASN 82  119 119 ASN ASN A . n 
A 1 83  HIS 83  120 120 HIS HIS A . n 
A 1 84  LYS 84  121 121 LYS LYS A . n 
A 1 85  ASN 85  122 122 ASN ASN A . n 
A 1 86  ILE 86  123 123 ILE ILE A . n 
A 1 87  ILE 87  124 124 ILE ILE A . n 
A 1 88  SER 88  125 125 SER SER A . n 
A 1 89  LEU 89  126 126 LEU LEU A . n 
A 1 90  LEU 90  127 127 LEU LEU A . n 
A 1 91  ASN 91  128 128 ASN ASN A . n 
A 1 92  VAL 92  129 129 VAL VAL A . n 
A 1 93  PHE 93  130 130 PHE PHE A . n 
A 1 94  THR 94  131 131 THR THR A . n 
A 1 95  PRO 95  132 132 PRO PRO A . n 
A 1 96  GLN 96  133 133 GLN GLN A . n 
A 1 97  LYS 97  134 134 LYS LYS A . n 
A 1 98  THR 98  135 135 THR THR A . n 
A 1 99  LEU 99  136 136 LEU LEU A . n 
A 1 100 GLU 100 137 137 GLU GLU A . n 
A 1 101 GLU 101 138 138 GLU GLU A . n 
A 1 102 PHE 102 139 139 PHE PHE A . n 
A 1 103 GLN 103 140 140 GLN GLN A . n 
A 1 104 ASP 104 141 141 ASP ASP A . n 
A 1 105 VAL 105 142 142 VAL VAL A . n 
A 1 106 TYR 106 143 143 TYR TYR A . n 
A 1 107 LEU 107 144 144 LEU LEU A . n 
A 1 108 VAL 108 145 145 VAL VAL A . n 
A 1 109 MET 109 146 146 MET MET A . n 
A 1 110 GLU 110 147 147 GLU GLU A . n 
A 1 111 LEU 111 148 148 LEU LEU A . n 
A 1 112 MET 112 149 149 MET MET A . n 
A 1 113 ASP 113 150 150 ASP ASP A . n 
A 1 114 ALA 114 151 151 ALA ALA A . n 
A 1 115 ASN 115 152 152 ASN ASN A . n 
A 1 116 LEU 116 153 153 LEU LEU A . n 
A 1 117 CYS 117 154 154 CYS CYS A . n 
A 1 118 GLN 118 155 155 GLN GLN A . n 
A 1 119 VAL 119 156 156 VAL VAL A . n 
A 1 120 ILE 120 157 157 ILE ILE A . n 
A 1 121 GLN 121 158 158 GLN GLN A . n 
A 1 122 MET 122 159 159 MET MET A . n 
A 1 123 GLU 123 160 160 GLU GLU A . n 
A 1 124 LEU 124 161 161 LEU LEU A . n 
A 1 125 ASP 125 162 162 ASP ASP A . n 
A 1 126 HIS 126 163 163 HIS HIS A . n 
A 1 127 GLU 127 164 164 GLU GLU A . n 
A 1 128 ARG 128 165 165 ARG ARG A . n 
A 1 129 MET 129 166 166 MET MET A . n 
A 1 130 SER 130 167 167 SER SER A . n 
A 1 131 TYR 131 168 168 TYR TYR A . n 
A 1 132 LEU 132 169 169 LEU LEU A . n 
A 1 133 LEU 133 170 170 LEU LEU A . n 
A 1 134 TYR 134 171 171 TYR TYR A . n 
A 1 135 GLN 135 172 172 GLN GLN A . n 
A 1 136 MET 136 173 173 MET MET A . n 
A 1 137 LEU 137 174 174 LEU LEU A . n 
A 1 138 CYS 138 175 175 CYS CYS A . n 
A 1 139 GLY 139 176 176 GLY GLY A . n 
A 1 140 ILE 140 177 177 ILE ILE A . n 
A 1 141 LYS 141 178 178 LYS LYS A . n 
A 1 142 HIS 142 179 179 HIS HIS A . n 
A 1 143 LEU 143 180 180 LEU LEU A . n 
A 1 144 HIS 144 181 181 HIS HIS A . n 
A 1 145 SER 145 182 182 SER SER A . n 
A 1 146 ALA 146 183 183 ALA ALA A . n 
A 1 147 GLY 147 184 184 GLY GLY A . n 
A 1 148 ILE 148 185 185 ILE ILE A . n 
A 1 149 ILE 149 186 186 ILE ILE A . n 
A 1 150 HIS 150 187 187 HIS HIS A . n 
A 1 151 ARG 151 188 188 ARG ARG A . n 
A 1 152 ASP 152 189 189 ASP ASP A . n 
A 1 153 LEU 153 190 190 LEU LEU A . n 
A 1 154 LYS 154 191 191 LYS LYS A . n 
A 1 155 PRO 155 192 192 PRO PRO A . n 
A 1 156 SER 156 193 193 SER SER A . n 
A 1 157 ASN 157 194 194 ASN ASN A . n 
A 1 158 ILE 158 195 195 ILE ILE A . n 
A 1 159 VAL 159 196 196 VAL VAL A . n 
A 1 160 VAL 160 197 197 VAL VAL A . n 
A 1 161 LYS 161 198 198 LYS LYS A . n 
A 1 162 SER 162 199 199 SER SER A . n 
A 1 163 ASP 163 200 200 ASP ASP A . n 
A 1 164 CYS 164 201 201 CYS CYS A . n 
A 1 165 THR 165 202 202 THR THR A . n 
A 1 166 LEU 166 203 203 LEU LEU A . n 
A 1 167 LYS 167 204 204 LYS LYS A . n 
A 1 168 ILE 168 205 205 ILE ILE A . n 
A 1 169 LEU 169 206 206 LEU LEU A . n 
A 1 170 ASP 170 207 207 ASP ASP A . n 
A 1 171 PHE 171 208 208 PHE PHE A . n 
A 1 172 GLY 172 209 209 GLY GLY A . n 
A 1 173 LEU 173 210 210 LEU LEU A . n 
A 1 174 ALA 174 211 211 ALA ALA A . n 
A 1 175 ARG 175 212 ?   ?   ?   A . n 
A 1 176 THR 176 213 ?   ?   ?   A . n 
A 1 177 ALA 177 214 ?   ?   ?   A . n 
A 1 178 GLY 178 215 ?   ?   ?   A . n 
A 1 179 THR 179 216 ?   ?   ?   A . n 
A 1 180 SER 180 217 217 SER SER A . n 
A 1 181 PHE 181 218 218 PHE PHE A . n 
A 1 182 MET 182 219 219 MET MET A . n 
A 1 183 MET 183 220 220 MET MET A . n 
A 1 184 THR 184 221 221 THR THR A . n 
A 1 185 PRO 185 222 222 PRO PRO A . n 
A 1 186 TYR 186 223 223 TYR TYR A . n 
A 1 187 VAL 187 224 224 VAL VAL A . n 
A 1 188 VAL 188 225 225 VAL VAL A . n 
A 1 189 THR 189 226 226 THR THR A . n 
A 1 190 ARG 190 227 227 ARG ARG A . n 
A 1 191 TYR 191 228 228 TYR TYR A . n 
A 1 192 TYR 192 229 229 TYR TYR A . n 
A 1 193 ARG 193 230 230 ARG ARG A . n 
A 1 194 ALA 194 231 231 ALA ALA A . n 
A 1 195 PRO 195 232 232 PRO PRO A . n 
A 1 196 GLU 196 233 233 GLU GLU A . n 
A 1 197 VAL 197 234 234 VAL VAL A . n 
A 1 198 ILE 198 235 235 ILE ILE A . n 
A 1 199 LEU 199 236 236 LEU LEU A . n 
A 1 200 GLY 200 237 237 GLY GLY A . n 
A 1 201 MET 201 238 238 MET MET A . n 
A 1 202 GLY 202 239 239 GLY GLY A . n 
A 1 203 TYR 203 240 240 TYR TYR A . n 
A 1 204 LYS 204 241 241 LYS LYS A . n 
A 1 205 GLU 205 242 242 GLU GLU A . n 
A 1 206 ASN 206 243 243 ASN ASN A . n 
A 1 207 VAL 207 244 244 VAL VAL A . n 
A 1 208 ASP 208 245 245 ASP ASP A . n 
A 1 209 ILE 209 246 246 ILE ILE A . n 
A 1 210 TRP 210 247 247 TRP TRP A . n 
A 1 211 SER 211 248 248 SER SER A . n 
A 1 212 VAL 212 249 249 VAL VAL A . n 
A 1 213 GLY 213 250 250 GLY GLY A . n 
A 1 214 CYS 214 251 251 CYS CYS A . n 
A 1 215 ILE 215 252 252 ILE ILE A . n 
A 1 216 MET 216 253 253 MET MET A . n 
A 1 217 GLY 217 254 254 GLY GLY A . n 
A 1 218 GLU 218 255 255 GLU GLU A . n 
A 1 219 MET 219 256 256 MET MET A . n 
A 1 220 VAL 220 257 257 VAL VAL A . n 
A 1 221 ARG 221 258 258 ARG ARG A . n 
A 1 222 HIS 222 259 259 HIS HIS A . n 
A 1 223 LYS 223 260 260 LYS LYS A . n 
A 1 224 ILE 224 261 261 ILE ILE A . n 
A 1 225 LEU 225 262 262 LEU LEU A . n 
A 1 226 PHE 226 263 263 PHE PHE A . n 
A 1 227 PRO 227 264 264 PRO PRO A . n 
A 1 228 GLY 228 265 265 GLY GLY A . n 
A 1 229 ARG 229 266 266 ARG ARG A . n 
A 1 230 ASP 230 267 267 ASP ASP A . n 
A 1 231 TYR 231 268 268 TYR TYR A . n 
A 1 232 ILE 232 269 269 ILE ILE A . n 
A 1 233 ASP 233 270 270 ASP ASP A . n 
A 1 234 GLN 234 271 271 GLN GLN A . n 
A 1 235 TRP 235 272 272 TRP TRP A . n 
A 1 236 ASN 236 273 273 ASN ASN A . n 
A 1 237 LYS 237 274 274 LYS LYS A . n 
A 1 238 VAL 238 275 275 VAL VAL A . n 
A 1 239 ILE 239 276 276 ILE ILE A . n 
A 1 240 GLU 240 277 277 GLU GLU A . n 
A 1 241 GLN 241 278 278 GLN GLN A . n 
A 1 242 LEU 242 279 279 LEU LEU A . n 
A 1 243 GLY 243 280 280 GLY GLY A . n 
A 1 244 THR 244 281 281 THR THR A . n 
A 1 245 PRO 245 282 282 PRO PRO A . n 
A 1 246 CYS 246 283 283 CYS CYS A . n 
A 1 247 PRO 247 284 284 PRO PRO A . n 
A 1 248 GLU 248 285 285 GLU ALA A . n 
A 1 249 PHE 249 286 286 PHE PHE A . n 
A 1 250 MET 250 287 287 MET MET A . n 
A 1 251 LYS 251 288 288 LYS LYS A . n 
A 1 252 LYS 252 289 289 LYS LYS A . n 
A 1 253 LEU 253 290 290 LEU LEU A . n 
A 1 254 GLN 254 291 291 GLN GLN A . n 
A 1 255 PRO 255 292 292 PRO PRO A . n 
A 1 256 THR 256 293 293 THR THR A . n 
A 1 257 VAL 257 294 294 VAL VAL A . n 
A 1 258 ARG 258 295 295 ARG ARG A . n 
A 1 259 ASN 259 296 296 ASN ASN A . n 
A 1 260 TYR 260 297 297 TYR TYR A . n 
A 1 261 VAL 261 298 298 VAL VAL A . n 
A 1 262 GLU 262 299 299 GLU GLU A . n 
A 1 263 ASN 263 300 300 ASN ASN A . n 
A 1 264 ARG 264 301 301 ARG ARG A . n 
A 1 265 PRO 265 302 302 PRO PRO A . n 
A 1 266 LYS 266 303 303 LYS LYS A . n 
A 1 267 TYR 267 304 304 TYR TYR A . n 
A 1 268 ALA 268 305 305 ALA ALA A . n 
A 1 269 GLY 269 306 306 GLY GLY A . n 
A 1 270 LEU 270 307 307 LEU LEU A . n 
A 1 271 THR 271 308 308 THR THR A . n 
A 1 272 PHE 272 309 309 PHE PHE A . n 
A 1 273 PRO 273 310 310 PRO PRO A . n 
A 1 274 LYS 274 311 311 LYS LYS A . n 
A 1 275 LEU 275 312 312 LEU LEU A . n 
A 1 276 PHE 276 313 313 PHE PHE A . n 
A 1 277 PRO 277 314 314 PRO PRO A . n 
A 1 278 ASP 278 315 315 ASP ASP A . n 
A 1 279 SER 279 316 316 SER SER A . n 
A 1 280 LEU 280 317 317 LEU LEU A . n 
A 1 281 PHE 281 318 318 PHE PHE A . n 
A 1 282 PRO 282 319 319 PRO PRO A . n 
A 1 283 ALA 283 320 320 ALA ALA A . n 
A 1 284 ASP 284 321 321 ASP ASP A . n 
A 1 285 SER 285 322 322 SER SER A . n 
A 1 286 GLU 286 323 323 GLU GLU A . n 
A 1 287 HIS 287 324 324 HIS HIS A . n 
A 1 288 ASN 288 325 325 ASN ASN A . n 
A 1 289 LYS 289 326 326 LYS LYS A . n 
A 1 290 LEU 290 327 327 LEU LEU A . n 
A 1 291 LYS 291 328 328 LYS LYS A . n 
A 1 292 ALA 292 329 329 ALA ALA A . n 
A 1 293 SER 293 330 330 SER SER A . n 
A 1 294 GLN 294 331 331 GLN GLN A . n 
A 1 295 ALA 295 332 332 ALA ALA A . n 
A 1 296 ARG 296 333 333 ARG ARG A . n 
A 1 297 ASP 297 334 334 ASP ASP A . n 
A 1 298 LEU 298 335 335 LEU LEU A . n 
A 1 299 LEU 299 336 336 LEU LEU A . n 
A 1 300 SER 300 337 337 SER SER A . n 
A 1 301 LYS 301 338 338 LYS LYS A . n 
A 1 302 MET 302 339 339 MET MET A . n 
A 1 303 LEU 303 340 340 LEU LEU A . n 
A 1 304 VAL 304 341 341 VAL VAL A . n 
A 1 305 ILE 305 342 342 ILE ILE A . n 
A 1 306 ASP 306 343 343 ASP ASP A . n 
A 1 307 PRO 307 344 344 PRO PRO A . n 
A 1 308 ALA 308 345 345 ALA ALA A . n 
A 1 309 LYS 309 346 346 LYS LYS A . n 
A 1 310 ARG 310 347 347 ARG ARG A . n 
A 1 311 ILE 311 348 348 ILE ILE A . n 
A 1 312 SER 312 349 349 SER SER A . n 
A 1 313 VAL 313 350 350 VAL VAL A . n 
A 1 314 ASP 314 351 351 ASP ASP A . n 
A 1 315 ASP 315 352 352 ASP ASP A . n 
A 1 316 ALA 316 353 353 ALA ALA A . n 
A 1 317 LEU 317 354 354 LEU LEU A . n 
A 1 318 GLN 318 355 355 GLN GLN A . n 
A 1 319 HIS 319 356 356 HIS HIS A . n 
A 1 320 PRO 320 357 357 PRO PRO A . n 
A 1 321 TYR 321 358 358 TYR TYR A . n 
A 1 322 ILE 322 359 359 ILE ILE A . n 
A 1 323 ASN 323 360 360 ASN ASN A . n 
A 1 324 VAL 324 361 361 VAL VAL A . n 
A 1 325 TRP 325 362 362 TRP TRP A . n 
A 1 326 TYR 326 363 363 TYR TYR A . n 
A 1 327 ASP 327 364 364 ASP ASP A . n 
A 1 328 PRO 328 365 365 PRO PRO A . n 
A 1 329 ALA 329 366 366 ALA ALA A . n 
A 1 330 GLU 330 367 367 GLU GLU A . n 
A 1 331 VAL 331 368 368 VAL VAL A . n 
A 1 332 GLU 332 369 369 GLU GLU A . n 
A 1 333 ALA 333 370 370 ALA ALA A . n 
A 1 334 PRO 334 371 371 PRO ALA A . n 
A 1 335 PRO 335 372 ?   ?   ?   A . n 
A 1 336 PRO 336 373 ?   ?   ?   A . n 
A 1 337 GLN 337 374 ?   ?   ?   A . n 
A 1 338 ILE 338 375 ?   ?   ?   A . n 
A 1 339 TYR 339 376 ?   ?   ?   A . n 
A 1 340 ASP 340 377 ?   ?   ?   A . n 
A 1 341 LYS 341 378 ?   ?   ?   A . n 
A 1 342 GLN 342 379 379 GLN ALA A . n 
A 1 343 LEU 343 380 380 LEU LEU A . n 
A 1 344 ASP 344 381 381 ASP ASP A . n 
A 1 345 GLU 345 382 382 GLU ALA A . n 
A 1 346 ARG 346 383 383 ARG ALA A . n 
A 1 347 GLU 347 384 384 GLU GLU A . n 
A 1 348 HIS 348 385 385 HIS HIS A . n 
A 1 349 THR 349 386 386 THR THR A . n 
A 1 350 ILE 350 387 387 ILE ILE A . n 
A 1 351 GLU 351 388 388 GLU GLU A . n 
A 1 352 GLU 352 389 389 GLU GLU A . n 
A 1 353 TRP 353 390 390 TRP TRP A . n 
A 1 354 LYS 354 391 391 LYS LYS A . n 
A 1 355 GLU 355 392 392 GLU GLU A . n 
A 1 356 LEU 356 393 393 LEU LEU A . n 
A 1 357 ILE 357 394 394 ILE ILE A . n 
A 1 358 TYR 358 395 395 TYR TYR A . n 
A 1 359 LYS 359 396 396 LYS LYS A . n 
A 1 360 GLU 360 397 397 GLU GLU A . n 
A 1 361 VAL 361 398 398 VAL VAL A . n 
A 1 362 MET 362 399 399 MET MET A . n 
A 1 363 ASN 363 400 400 ASN ASN A . n 
A 1 364 SER 364 401 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 984 1   501 501 984 984 A . 
C 3 HOH 1   601 601 HOH HOH A . 
C 3 HOH 2   602 602 HOH HOH A . 
C 3 HOH 3   603 603 HOH HOH A . 
C 3 HOH 4   604 604 HOH HOH A . 
C 3 HOH 5   605 605 HOH HOH A . 
C 3 HOH 6   606 606 HOH HOH A . 
C 3 HOH 7   607 607 HOH HOH A . 
C 3 HOH 8   608 608 HOH HOH A . 
C 3 HOH 9   609 609 HOH HOH A . 
C 3 HOH 10  610 610 HOH HOH A . 
C 3 HOH 11  611 611 HOH HOH A . 
C 3 HOH 12  612 612 HOH HOH A . 
C 3 HOH 13  613 613 HOH HOH A . 
C 3 HOH 14  614 614 HOH HOH A . 
C 3 HOH 15  615 615 HOH HOH A . 
C 3 HOH 16  616 616 HOH HOH A . 
C 3 HOH 17  617 617 HOH HOH A . 
C 3 HOH 18  618 618 HOH HOH A . 
C 3 HOH 19  619 619 HOH HOH A . 
C 3 HOH 20  620 620 HOH HOH A . 
C 3 HOH 21  621 621 HOH HOH A . 
C 3 HOH 22  623 623 HOH HOH A . 
C 3 HOH 23  624 624 HOH HOH A . 
C 3 HOH 24  625 625 HOH HOH A . 
C 3 HOH 25  626 626 HOH HOH A . 
C 3 HOH 26  627 627 HOH HOH A . 
C 3 HOH 27  628 628 HOH HOH A . 
C 3 HOH 28  629 629 HOH HOH A . 
C 3 HOH 29  630 630 HOH HOH A . 
C 3 HOH 30  631 631 HOH HOH A . 
C 3 HOH 31  632 632 HOH HOH A . 
C 3 HOH 32  633 633 HOH HOH A . 
C 3 HOH 33  634 634 HOH HOH A . 
C 3 HOH 34  635 635 HOH HOH A . 
C 3 HOH 35  636 636 HOH HOH A . 
C 3 HOH 36  637 637 HOH HOH A . 
C 3 HOH 37  638 638 HOH HOH A . 
C 3 HOH 38  639 639 HOH HOH A . 
C 3 HOH 39  640 640 HOH HOH A . 
C 3 HOH 40  641 641 HOH HOH A . 
C 3 HOH 41  642 642 HOH HOH A . 
C 3 HOH 42  643 643 HOH HOH A . 
C 3 HOH 43  644 644 HOH HOH A . 
C 3 HOH 44  645 645 HOH HOH A . 
C 3 HOH 45  646 646 HOH HOH A . 
C 3 HOH 46  647 647 HOH HOH A . 
C 3 HOH 47  648 648 HOH HOH A . 
C 3 HOH 48  649 649 HOH HOH A . 
C 3 HOH 49  650 650 HOH HOH A . 
C 3 HOH 50  651 651 HOH HOH A . 
C 3 HOH 51  652 652 HOH HOH A . 
C 3 HOH 52  653 653 HOH HOH A . 
C 3 HOH 53  654 654 HOH HOH A . 
C 3 HOH 54  655 655 HOH HOH A . 
C 3 HOH 55  656 656 HOH HOH A . 
C 3 HOH 56  657 657 HOH HOH A . 
C 3 HOH 57  658 658 HOH HOH A . 
C 3 HOH 58  659 659 HOH HOH A . 
C 3 HOH 59  660 660 HOH HOH A . 
C 3 HOH 60  661 661 HOH HOH A . 
C 3 HOH 61  662 662 HOH HOH A . 
C 3 HOH 62  663 663 HOH HOH A . 
C 3 HOH 63  665 665 HOH HOH A . 
C 3 HOH 64  667 667 HOH HOH A . 
C 3 HOH 65  668 668 HOH HOH A . 
C 3 HOH 66  669 669 HOH HOH A . 
C 3 HOH 67  671 671 HOH HOH A . 
C 3 HOH 68  672 672 HOH HOH A . 
C 3 HOH 69  673 673 HOH HOH A . 
C 3 HOH 70  674 674 HOH HOH A . 
C 3 HOH 71  675 675 HOH HOH A . 
C 3 HOH 72  676 676 HOH HOH A . 
C 3 HOH 73  677 677 HOH HOH A . 
C 3 HOH 74  679 679 HOH HOH A . 
C 3 HOH 75  680 680 HOH HOH A . 
C 3 HOH 76  681 681 HOH HOH A . 
C 3 HOH 77  682 682 HOH HOH A . 
C 3 HOH 78  683 683 HOH HOH A . 
C 3 HOH 79  684 684 HOH HOH A . 
C 3 HOH 80  685 685 HOH HOH A . 
C 3 HOH 81  686 686 HOH HOH A . 
C 3 HOH 82  687 687 HOH HOH A . 
C 3 HOH 83  688 688 HOH HOH A . 
C 3 HOH 84  689 689 HOH HOH A . 
C 3 HOH 85  690 690 HOH HOH A . 
C 3 HOH 86  691 691 HOH HOH A . 
C 3 HOH 87  692 692 HOH HOH A . 
C 3 HOH 88  693 693 HOH HOH A . 
C 3 HOH 89  694 694 HOH HOH A . 
C 3 HOH 90  695 695 HOH HOH A . 
C 3 HOH 91  697 697 HOH HOH A . 
C 3 HOH 92  698 698 HOH HOH A . 
C 3 HOH 93  699 699 HOH HOH A . 
C 3 HOH 94  700 700 HOH HOH A . 
C 3 HOH 95  701 701 HOH HOH A . 
C 3 HOH 96  702 702 HOH HOH A . 
C 3 HOH 97  703 703 HOH HOH A . 
C 3 HOH 98  704 704 HOH HOH A . 
C 3 HOH 99  705 705 HOH HOH A . 
C 3 HOH 100 706 706 HOH HOH A . 
C 3 HOH 101 707 707 HOH HOH A . 
C 3 HOH 102 708 708 HOH HOH A . 
C 3 HOH 103 709 709 HOH HOH A . 
C 3 HOH 104 710 710 HOH HOH A . 
C 3 HOH 105 712 712 HOH HOH A . 
C 3 HOH 106 713 713 HOH HOH A . 
C 3 HOH 107 714 714 HOH HOH A . 
C 3 HOH 108 715 715 HOH HOH A . 
C 3 HOH 109 717 717 HOH HOH A . 
C 3 HOH 110 718 718 HOH HOH A . 
C 3 HOH 111 719 719 HOH HOH A . 
C 3 HOH 112 720 720 HOH HOH A . 
C 3 HOH 113 721 721 HOH HOH A . 
C 3 HOH 114 722 722 HOH HOH A . 
C 3 HOH 115 723 723 HOH HOH A . 
C 3 HOH 116 724 724 HOH HOH A . 
C 3 HOH 117 725 725 HOH HOH A . 
C 3 HOH 118 726 726 HOH HOH A . 
C 3 HOH 119 727 727 HOH HOH A . 
C 3 HOH 120 728 728 HOH HOH A . 
C 3 HOH 121 729 729 HOH HOH A . 
C 3 HOH 122 730 730 HOH HOH A . 
C 3 HOH 123 731 731 HOH HOH A . 
C 3 HOH 124 732 732 HOH HOH A . 
C 3 HOH 125 733 733 HOH HOH A . 
C 3 HOH 126 734 734 HOH HOH A . 
C 3 HOH 127 736 736 HOH HOH A . 
C 3 HOH 128 738 738 HOH HOH A . 
C 3 HOH 129 739 739 HOH HOH A . 
C 3 HOH 130 740 740 HOH HOH A . 
C 3 HOH 131 741 741 HOH HOH A . 
C 3 HOH 132 742 742 HOH HOH A . 
C 3 HOH 133 743 743 HOH HOH A . 
C 3 HOH 134 745 745 HOH HOH A . 
C 3 HOH 135 746 746 HOH HOH A . 
C 3 HOH 136 747 747 HOH HOH A . 
C 3 HOH 137 748 748 HOH HOH A . 
C 3 HOH 138 749 749 HOH HOH A . 
C 3 HOH 139 750 750 HOH HOH A . 
C 3 HOH 140 751 751 HOH HOH A . 
C 3 HOH 141 752 752 HOH HOH A . 
C 3 HOH 142 753 753 HOH HOH A . 
C 3 HOH 143 754 754 HOH HOH A . 
C 3 HOH 144 755 755 HOH HOH A . 
C 3 HOH 145 756 756 HOH HOH A . 
C 3 HOH 146 757 757 HOH HOH A . 
C 3 HOH 147 758 758 HOH HOH A . 
C 3 HOH 148 759 759 HOH HOH A . 
C 3 HOH 149 760 760 HOH HOH A . 
C 3 HOH 150 761 761 HOH HOH A . 
C 3 HOH 151 762 762 HOH HOH A . 
C 3 HOH 152 763 763 HOH HOH A . 
C 3 HOH 153 764 764 HOH HOH A . 
C 3 HOH 154 765 765 HOH HOH A . 
C 3 HOH 155 766 766 HOH HOH A . 
C 3 HOH 156 767 767 HOH HOH A . 
C 3 HOH 157 768 768 HOH HOH A . 
C 3 HOH 158 770 770 HOH HOH A . 
C 3 HOH 159 771 771 HOH HOH A . 
C 3 HOH 160 772 772 HOH HOH A . 
C 3 HOH 161 773 773 HOH HOH A . 
C 3 HOH 162 774 774 HOH HOH A . 
C 3 HOH 163 776 776 HOH HOH A . 
C 3 HOH 164 777 777 HOH HOH A . 
C 3 HOH 165 778 778 HOH HOH A . 
C 3 HOH 166 779 779 HOH HOH A . 
C 3 HOH 167 780 780 HOH HOH A . 
C 3 HOH 168 781 781 HOH HOH A . 
C 3 HOH 169 782 782 HOH HOH A . 
C 3 HOH 170 783 783 HOH HOH A . 
C 3 HOH 171 784 784 HOH HOH A . 
C 3 HOH 172 785 785 HOH HOH A . 
C 3 HOH 173 786 786 HOH HOH A . 
C 3 HOH 174 787 787 HOH HOH A . 
C 3 HOH 175 788 788 HOH HOH A . 
C 3 HOH 176 789 789 HOH HOH A . 
C 3 HOH 177 791 791 HOH HOH A . 
C 3 HOH 178 797 797 HOH HOH A . 
C 3 HOH 179 798 798 HOH HOH A . 
C 3 HOH 180 799 799 HOH HOH A . 
C 3 HOH 181 800 800 HOH HOH A . 
C 3 HOH 182 801 801 HOH HOH A . 
C 3 HOH 183 802 802 HOH HOH A . 
C 3 HOH 184 803 803 HOH HOH A . 
C 3 HOH 185 804 804 HOH HOH A . 
C 3 HOH 186 805 805 HOH HOH A . 
C 3 HOH 187 806 806 HOH HOH A . 
C 3 HOH 188 807 807 HOH HOH A . 
C 3 HOH 189 808 808 HOH HOH A . 
C 3 HOH 190 811 811 HOH HOH A . 
C 3 HOH 191 812 812 HOH HOH A . 
C 3 HOH 192 813 813 HOH HOH A . 
C 3 HOH 193 814 814 HOH HOH A . 
C 3 HOH 194 815 815 HOH HOH A . 
C 3 HOH 195 816 816 HOH HOH A . 
C 3 HOH 196 817 817 HOH HOH A . 
C 3 HOH 197 819 819 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-09-09 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-GEN 'data scaling'   . ? 1 
X-GEN 'data reduction' . ? 2 
CNX   refinement       . ? 3 
CNX   phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 97  ? ? 36.17   62.47   
2  1 GLN A 140 ? ? -137.75 -48.85  
3  1 ARG A 188 ? ? 73.62   -6.55   
4  1 PRO A 264 ? ? -69.28  -169.85 
5  1 PRO A 314 ? ? -48.35  161.03  
6  1 ALA A 320 ? ? -107.10 47.43   
7  1 TYR A 363 ? ? -38.50  141.08  
8  1 ASP A 364 ? ? -160.41 113.71  
9  1 ALA A 370 ? ? -156.79 -45.12  
10 1 LEU A 380 ? ? -12.44  122.51  
11 1 GLU A 382 ? ? -146.13 -78.25  
12 1 ARG A 383 ? ? -34.68  -178.75 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 285 ? CG  ? A GLU 248 CG  
2  1 Y 1 A GLU 285 ? CD  ? A GLU 248 CD  
3  1 Y 1 A GLU 285 ? OE1 ? A GLU 248 OE1 
4  1 Y 1 A GLU 285 ? OE2 ? A GLU 248 OE2 
5  1 Y 1 A PRO 371 ? CG  ? A PRO 334 CG  
6  1 Y 1 A PRO 371 ? CD  ? A PRO 334 CD  
7  1 Y 1 A GLN 379 ? CG  ? A GLN 342 CG  
8  1 Y 1 A GLN 379 ? CD  ? A GLN 342 CD  
9  1 Y 1 A GLN 379 ? OE1 ? A GLN 342 OE1 
10 1 Y 1 A GLN 379 ? NE2 ? A GLN 342 NE2 
11 1 Y 1 A GLU 382 ? CG  ? A GLU 345 CG  
12 1 Y 1 A GLU 382 ? CD  ? A GLU 345 CD  
13 1 Y 1 A GLU 382 ? OE1 ? A GLU 345 OE1 
14 1 Y 1 A GLU 382 ? OE2 ? A GLU 345 OE2 
15 1 Y 1 A ARG 383 ? CG  ? A ARG 346 CG  
16 1 Y 1 A ARG 383 ? CD  ? A ARG 346 CD  
17 1 Y 1 A ARG 383 ? NE  ? A ARG 346 NE  
18 1 Y 1 A ARG 383 ? CZ  ? A ARG 346 CZ  
19 1 Y 1 A ARG 383 ? NH1 ? A ARG 346 NH1 
20 1 Y 1 A ARG 383 ? NH2 ? A ARG 346 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 38  ? A MET 1   
2  1 Y 1 A ALA 39  ? A ALA 2   
3  1 Y 1 A SER 40  ? A SER 3   
4  1 Y 1 A LYS 41  ? A LYS 4   
5  1 Y 1 A SER 42  ? A SER 5   
6  1 Y 1 A LYS 43  ? A LYS 6   
7  1 Y 1 A VAL 44  ? A VAL 7   
8  1 Y 1 A ARG 212 ? A ARG 175 
9  1 Y 1 A THR 213 ? A THR 176 
10 1 Y 1 A ALA 214 ? A ALA 177 
11 1 Y 1 A GLY 215 ? A GLY 178 
12 1 Y 1 A THR 216 ? A THR 179 
13 1 Y 1 A PRO 372 ? A PRO 335 
14 1 Y 1 A PRO 373 ? A PRO 336 
15 1 Y 1 A GLN 374 ? A GLN 337 
16 1 Y 1 A ILE 375 ? A ILE 338 
17 1 Y 1 A TYR 376 ? A TYR 339 
18 1 Y 1 A ASP 377 ? A ASP 340 
19 1 Y 1 A LYS 378 ? A LYS 341 
20 1 Y 1 A SER 401 ? A SER 364 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CYCLOPROPYL-{4-[5-(3,4-DICHLOROPHENYL)-2-[(1-METHYL)-PIPERIDIN]-4-YL-3-PROPYL-3H-IMIDAZOL-4-YL]-PYRIMIDIN-2-YL}AMINE' 984 
3 water                                                                                                                  HOH 
#