data_1QGH
# 
_entry.id   1QGH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QGH         
RCSB  RCSB000952   
WWPDB D_1000000952 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QGH 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-27 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ilari, A.'      1 
'Stefanini, S.'  2 
'Chiancone, E.'  3 
'Tsernoglou, D.' 4 
# 
_citation.id                        primary 
_citation.title                     
'The dodecameric ferritin from Listeria innocua contains a novel intersubunit iron-binding site.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            7 
_citation.page_first                38 
_citation.page_last                 43 
_citation.year                      2000 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10625425 
_citation.pdbx_database_id_DOI      10.1038/71236 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ilari, A.'      1 
primary 'Stefanini, S.'  2 
primary 'Chiancone, E.'  3 
primary 'Tsernoglou, D.' 4 
# 
_cell.entry_id           1QGH 
_cell.length_a           87.540 
_cell.length_b           137.500 
_cell.length_c           173.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QGH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'NON-HEME IRON-CONTAINING FERRITIN' 18070.553 12  ? ? ? ? 
2 non-polymer syn 'FE (III) ION'                      55.845    12  ? ? ? ? 
3 water       nat water                               18.015    479 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKTINSVDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLE
NASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKTINSVDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLE
NASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   THR n 
1 4   ILE n 
1 5   ASN n 
1 6   SER n 
1 7   VAL n 
1 8   ASP n 
1 9   THR n 
1 10  LYS n 
1 11  GLU n 
1 12  PHE n 
1 13  LEU n 
1 14  ASN n 
1 15  HIS n 
1 16  GLN n 
1 17  VAL n 
1 18  ALA n 
1 19  ASN n 
1 20  LEU n 
1 21  ASN n 
1 22  VAL n 
1 23  PHE n 
1 24  THR n 
1 25  VAL n 
1 26  LYS n 
1 27  ILE n 
1 28  HIS n 
1 29  GLN n 
1 30  ILE n 
1 31  HIS n 
1 32  TRP n 
1 33  TYR n 
1 34  MET n 
1 35  ARG n 
1 36  GLY n 
1 37  HIS n 
1 38  ASN n 
1 39  PHE n 
1 40  PHE n 
1 41  THR n 
1 42  LEU n 
1 43  HIS n 
1 44  GLU n 
1 45  LYS n 
1 46  MET n 
1 47  ASP n 
1 48  ASP n 
1 49  LEU n 
1 50  TYR n 
1 51  SER n 
1 52  GLU n 
1 53  PHE n 
1 54  GLY n 
1 55  GLU n 
1 56  GLN n 
1 57  MET n 
1 58  ASP n 
1 59  GLU n 
1 60  VAL n 
1 61  ALA n 
1 62  GLU n 
1 63  ARG n 
1 64  LEU n 
1 65  LEU n 
1 66  ALA n 
1 67  ILE n 
1 68  GLY n 
1 69  GLY n 
1 70  SER n 
1 71  PRO n 
1 72  PHE n 
1 73  SER n 
1 74  THR n 
1 75  LEU n 
1 76  LYS n 
1 77  GLU n 
1 78  PHE n 
1 79  LEU n 
1 80  GLU n 
1 81  ASN n 
1 82  ALA n 
1 83  SER n 
1 84  VAL n 
1 85  GLU n 
1 86  GLU n 
1 87  ALA n 
1 88  PRO n 
1 89  TYR n 
1 90  THR n 
1 91  LYS n 
1 92  PRO n 
1 93  LYS n 
1 94  THR n 
1 95  MET n 
1 96  ASP n 
1 97  GLN n 
1 98  LEU n 
1 99  MET n 
1 100 GLU n 
1 101 ASP n 
1 102 LEU n 
1 103 VAL n 
1 104 GLY n 
1 105 THR n 
1 106 LEU n 
1 107 GLU n 
1 108 LEU n 
1 109 LEU n 
1 110 ARG n 
1 111 ASP n 
1 112 GLU n 
1 113 TYR n 
1 114 LYS n 
1 115 GLN n 
1 116 GLY n 
1 117 ILE n 
1 118 GLU n 
1 119 LEU n 
1 120 THR n 
1 121 ASP n 
1 122 LYS n 
1 123 GLU n 
1 124 GLY n 
1 125 ASP n 
1 126 ASP n 
1 127 VAL n 
1 128 THR n 
1 129 ASN n 
1 130 ASP n 
1 131 MET n 
1 132 LEU n 
1 133 ILE n 
1 134 ALA n 
1 135 PHE n 
1 136 LYS n 
1 137 ALA n 
1 138 SER n 
1 139 ILE n 
1 140 ASP n 
1 141 LYS n 
1 142 HIS n 
1 143 ILE n 
1 144 TRP n 
1 145 MET n 
1 146 PHE n 
1 147 LYS n 
1 148 ALA n 
1 149 PHE n 
1 150 LEU n 
1 151 GLY n 
1 152 LYS n 
1 153 ALA n 
1 154 PRO n 
1 155 LEU n 
1 156 GLU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Listeria innocua' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      1642 
_entity_src_nat.genus                      Listeria 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FRI_LISIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P80725 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1QGH A 1 ? 156 ? P80725 1 ? 156 ? 1 156 
2  1 1QGH B 1 ? 156 ? P80725 1 ? 156 ? 1 156 
3  1 1QGH C 1 ? 156 ? P80725 1 ? 156 ? 1 156 
4  1 1QGH D 1 ? 156 ? P80725 1 ? 156 ? 1 156 
5  1 1QGH E 1 ? 156 ? P80725 1 ? 156 ? 1 156 
6  1 1QGH F 1 ? 156 ? P80725 1 ? 156 ? 1 156 
7  1 1QGH G 1 ? 156 ? P80725 1 ? 156 ? 1 156 
8  1 1QGH H 1 ? 156 ? P80725 1 ? 156 ? 1 156 
9  1 1QGH I 1 ? 156 ? P80725 1 ? 156 ? 1 156 
10 1 1QGH J 1 ? 156 ? P80725 1 ? 156 ? 1 156 
11 1 1QGH K 1 ? 156 ? P80725 1 ? 156 ? 1 156 
12 1 1QGH L 1 ? 156 ? P80725 1 ? 156 ? 1 156 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QGH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   48.86 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    'PEG 1000 AT 19-25 %, MES 0.1 M AT PH 5.0-6.2, pH 5.8' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1997-12-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8373 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             0.8373 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QGH 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.35 
_reflns.number_obs                   80150 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1QGH 
_refine.ls_number_reflns_obs                     80098 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    91 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          0.2190000 
_refine.ls_R_factor_R_work                       0.2190000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1DPS 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14664 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             479 
_refine_hist.number_atoms_total               15155 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.012  ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.039  ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 14.698 ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?      ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?      ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.011  ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       0.016  ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?      ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?      ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1QGH 
_pdbx_refine.R_factor_all_no_cutoff                      0.2190000 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1  given ? 0.025340  -0.003220 -0.999670 -0.002890 -0.999990 0.003150  -0.999670 0.002810  -0.025300 30.92601 0.14676   31.67621 
2  given ? -0.565240 -0.694260 0.445540  -0.693920 0.108110  -0.711890 0.446070  -0.711560 -0.542870 16.93955 22.19773  17.90978 
3  given ? -0.459440 0.694270  0.553990  0.696980  -0.104820 0.709390  0.550580  0.712040  -0.435730 13.46489 -21.91316 14.38429 
4  given ? -0.204910 0.218490  -0.954080 0.864580  0.497340  -0.071800 0.458820  -0.839590 -0.290810 33.73081 -11.88506 13.68209 
5  given ? 0.949310  -0.216520 0.227870  0.092650  -0.499970 -0.861070 0.300370  0.838540  -0.454570 -2.64692 12.34241  18.55365 
6  given ? -0.465440 0.844520  0.264870  -0.863530 -0.498930 0.073360  0.194100  -0.194580 0.961490  18.20738 12.12980  -2.29897 
7  given ? -0.277950 -0.842290 0.461840  -0.094760 0.502480  0.859380  -0.955910 0.195100  -0.219480 12.36059 -12.03838 33.96724 
8  given ? -0.209410 0.867280  0.451630  0.216460  0.491520  -0.843530 -0.953570 -0.078890 -0.290660 11.43735 10.10695  34.98370 
9  given ? -0.464200 -0.864090 0.194570  0.843940  -0.498180 -0.198960 0.268860  0.071850  0.960500  19.50842 -9.60517  -3.50690 
10 given ? -0.280230 -0.094860 -0.955230 -0.843160 0.499990  0.197700  0.458850  0.860820  -0.220100 34.79960 9.82864   12.27548 
11 given ? 0.947890  0.096830  0.303530  -0.218490 -0.495830 0.840480  0.231890  -0.863000 -0.448830 -3.86911 -9.90294  19.56981 
# 
_struct.entry_id                  1QGH 
_struct.title                     
'THE X-RAY STRUCTURE OF THE UNUSUAL DODECAMERIC FERRITIN FROM LISTERIA INNOCUA, REVEALS A NOVEL INTERSUBUNIT IRON BINDING SITE.' 
_struct.pdbx_descriptor           'NON-HEME IRON-CONTAINING FERRITIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QGH 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'FERRITIN, METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 9   ? TYR A 33  ? THR A 9   TYR A 33  1 ? 25 
HELX_P HELX_P2  2  PHE A 39  ? ILE A 67  ? PHE A 39  ILE A 67  1 ? 29 
HELX_P HELX_P3  3  LEU A 75  ? ASN A 81  ? LEU A 75  ASN A 81  1 ? 7  
HELX_P HELX_P4  4  MET A 95  ? GLU A 123 ? MET A 95  GLU A 123 1 ? 29 
HELX_P HELX_P5  5  ASP A 126 ? PHE A 149 ? ASP A 126 PHE A 149 1 ? 24 
HELX_P HELX_P6  6  THR B 9   ? TYR B 33  ? THR B 9   TYR B 33  1 ? 25 
HELX_P HELX_P7  7  PHE B 39  ? ILE B 67  ? PHE B 39  ILE B 67  1 ? 29 
HELX_P HELX_P8  8  LEU B 75  ? ASN B 81  ? LEU B 75  ASN B 81  1 ? 7  
HELX_P HELX_P9  9  MET B 95  ? LYS B 122 ? MET B 95  LYS B 122 1 ? 28 
HELX_P HELX_P10 10 ASP B 126 ? PHE B 149 ? ASP B 126 PHE B 149 1 ? 24 
HELX_P HELX_P11 11 THR C 9   ? TYR C 33  ? THR C 9   TYR C 33  1 ? 25 
HELX_P HELX_P12 12 PHE C 39  ? ILE C 67  ? PHE C 39  ILE C 67  1 ? 29 
HELX_P HELX_P13 13 LEU C 75  ? ASN C 81  ? LEU C 75  ASN C 81  1 ? 7  
HELX_P HELX_P14 14 MET C 95  ? GLU C 123 ? MET C 95  GLU C 123 1 ? 29 
HELX_P HELX_P15 15 ASP C 126 ? PHE C 149 ? ASP C 126 PHE C 149 1 ? 24 
HELX_P HELX_P16 16 THR D 9   ? TYR D 33  ? THR D 9   TYR D 33  1 ? 25 
HELX_P HELX_P17 17 PHE D 39  ? ALA D 66  ? PHE D 39  ALA D 66  1 ? 28 
HELX_P HELX_P18 18 LEU D 75  ? ASN D 81  ? LEU D 75  ASN D 81  1 ? 7  
HELX_P HELX_P19 19 MET D 95  ? LYS D 122 ? MET D 95  LYS D 122 1 ? 28 
HELX_P HELX_P20 20 ASP D 126 ? PHE D 149 ? ASP D 126 PHE D 149 1 ? 24 
HELX_P HELX_P21 21 THR E 9   ? TYR E 33  ? THR E 9   TYR E 33  1 ? 25 
HELX_P HELX_P22 22 PHE E 39  ? ILE E 67  ? PHE E 39  ILE E 67  1 ? 29 
HELX_P HELX_P23 23 LEU E 75  ? ASN E 81  ? LEU E 75  ASN E 81  1 ? 7  
HELX_P HELX_P24 24 MET E 95  ? LYS E 122 ? MET E 95  LYS E 122 1 ? 28 
HELX_P HELX_P25 25 ASP E 126 ? LEU E 150 ? ASP E 126 LEU E 150 1 ? 25 
HELX_P HELX_P26 26 THR F 9   ? TYR F 33  ? THR F 9   TYR F 33  1 ? 25 
HELX_P HELX_P27 27 PHE F 39  ? ILE F 67  ? PHE F 39  ILE F 67  1 ? 29 
HELX_P HELX_P28 28 LEU F 75  ? ASN F 81  ? LEU F 75  ASN F 81  1 ? 7  
HELX_P HELX_P29 29 MET F 95  ? LYS F 122 ? MET F 95  LYS F 122 1 ? 28 
HELX_P HELX_P30 30 ASP F 126 ? PHE F 149 ? ASP F 126 PHE F 149 1 ? 24 
HELX_P HELX_P31 31 THR G 9   ? TYR G 33  ? THR G 9   TYR G 33  1 ? 25 
HELX_P HELX_P32 32 PHE G 39  ? ILE G 67  ? PHE G 39  ILE G 67  1 ? 29 
HELX_P HELX_P33 33 LEU G 75  ? ASN G 81  ? LEU G 75  ASN G 81  1 ? 7  
HELX_P HELX_P34 34 MET G 95  ? LYS G 122 ? MET G 95  LYS G 122 1 ? 28 
HELX_P HELX_P35 35 ASP G 126 ? PHE G 149 ? ASP G 126 PHE G 149 1 ? 24 
HELX_P HELX_P36 36 THR H 9   ? TYR H 33  ? THR H 9   TYR H 33  1 ? 25 
HELX_P HELX_P37 37 PHE H 39  ? ALA H 66  ? PHE H 39  ALA H 66  1 ? 28 
HELX_P HELX_P38 38 LEU H 75  ? ASN H 81  ? LEU H 75  ASN H 81  1 ? 7  
HELX_P HELX_P39 39 MET H 95  ? LYS H 122 ? MET H 95  LYS H 122 1 ? 28 
HELX_P HELX_P40 40 ASP H 126 ? PHE H 149 ? ASP H 126 PHE H 149 1 ? 24 
HELX_P HELX_P41 41 THR J 9   ? TYR J 33  ? THR J 9   TYR J 33  1 ? 25 
HELX_P HELX_P42 42 PHE J 39  ? ILE J 67  ? PHE J 39  ILE J 67  1 ? 29 
HELX_P HELX_P43 43 LEU J 75  ? ASN J 81  ? LEU J 75  ASN J 81  1 ? 7  
HELX_P HELX_P44 44 MET J 95  ? GLU J 123 ? MET J 95  GLU J 123 1 ? 29 
HELX_P HELX_P45 45 ASP J 126 ? PHE J 149 ? ASP J 126 PHE J 149 1 ? 24 
HELX_P HELX_P46 46 THR K 9   ? TYR K 33  ? THR K 9   TYR K 33  1 ? 25 
HELX_P HELX_P47 47 PHE K 39  ? ILE K 67  ? PHE K 39  ILE K 67  1 ? 29 
HELX_P HELX_P48 48 LEU K 75  ? ASN K 81  ? LEU K 75  ASN K 81  1 ? 7  
HELX_P HELX_P49 49 MET K 95  ? GLU K 123 ? MET K 95  GLU K 123 1 ? 29 
HELX_P HELX_P50 50 ASP K 126 ? PHE K 149 ? ASP K 126 PHE K 149 1 ? 24 
HELX_P HELX_P51 51 THR L 9   ? TYR L 33  ? THR L 9   TYR L 33  1 ? 25 
HELX_P HELX_P52 52 PHE L 39  ? ILE L 67  ? PHE L 39  ILE L 67  1 ? 29 
HELX_P HELX_P53 53 LEU L 75  ? ASN L 81  ? LEU L 75  ASN L 81  1 ? 7  
HELX_P HELX_P54 54 MET L 95  ? LYS L 122 ? MET L 95  LYS L 122 1 ? 28 
HELX_P HELX_P55 55 ASP L 126 ? LEU L 150 ? ASP L 126 LEU L 150 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? O FE  .  FE  ? ? ? 1_555 A  ASP 58 OD2 ? ? C FE  157 A ASP 58  1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc2  metalc ? ? V FE  .  FE  ? ? ? 1_555 B  ASP 58 OD2 ? ? J FE  157 B ASP 58  1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc3  metalc ? ? P FE  .  FE  ? ? ? 1_555 C  ASP 58 OD2 ? ? D FE  157 C ASP 58  1_555 ? ? ? ? ? ? ? 1.781 ? 
metalc4  metalc ? ? X FE  .  FE  ? ? ? 1_555 D  ASP 58 OD2 ? ? L FE  157 D ASP 58  1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc5  metalc ? ? N FE  .  FE  ? ? ? 1_555 E  ASP 58 OD2 ? ? B FE  157 E ASP 58  1_555 ? ? ? ? ? ? ? 1.788 ? 
metalc6  metalc ? ? W FE  .  FE  ? ? ? 1_555 F  ASP 58 OD2 ? ? K FE  157 F ASP 58  1_555 ? ? ? ? ? ? ? 1.769 ? 
metalc7  metalc ? ? M FE  .  FE  ? ? ? 1_555 G  ASP 58 OD2 ? ? A FE  157 G ASP 58  1_555 ? ? ? ? ? ? ? 1.793 ? 
metalc8  metalc ? ? R FE  .  FE  ? ? ? 1_555 H  ASP 58 OD2 ? ? F FE  157 H ASP 58  1_555 ? ? ? ? ? ? ? 1.831 ? 
metalc9  metalc ? ? Q FE  .  FE  ? ? ? 1_555 I  ASP 58 OD2 ? ? E FE  157 I ASP 58  1_555 ? ? ? ? ? ? ? 1.886 ? 
metalc10 metalc ? ? S FE  .  FE  ? ? ? 1_555 J  ASP 58 OD2 ? ? G FE  157 J ASP 58  1_555 ? ? ? ? ? ? ? 1.715 ? 
metalc11 metalc ? ? U FE  .  FE  ? ? ? 1_555 K  ASP 58 OD2 ? ? I FE  157 K ASP 58  1_555 ? ? ? ? ? ? ? 1.734 ? 
metalc12 metalc ? ? T FE  .  FE  ? ? ? 1_555 L  ASP 58 OD2 ? ? H FE  157 L ASP 58  1_555 ? ? ? ? ? ? ? 1.752 ? 
metalc13 metalc ? ? O FE  .  FE  ? ? ? 1_555 A  GLU 62 OE2 ? ? C FE  157 A GLU 62  1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc14 metalc ? ? V FE  .  FE  ? ? ? 1_555 B  GLU 62 OE2 ? ? J FE  157 B GLU 62  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc15 metalc ? ? P FE  .  FE  ? ? ? 1_555 C  GLU 62 OE2 ? ? D FE  157 C GLU 62  1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc16 metalc ? ? X FE  .  FE  ? ? ? 1_555 D  GLU 62 OE2 ? ? L FE  157 D GLU 62  1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc17 metalc ? ? N FE  .  FE  ? ? ? 1_555 E  GLU 62 OE2 ? ? B FE  157 E GLU 62  1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc18 metalc ? ? W FE  .  FE  ? ? ? 1_555 F  GLU 62 OE2 ? ? K FE  157 F GLU 62  1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc19 metalc ? ? M FE  .  FE  ? ? ? 1_555 G  GLU 62 OE2 ? ? A FE  157 G GLU 62  1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc20 metalc ? ? R FE  .  FE  ? ? ? 1_555 H  GLU 62 OE2 ? ? F FE  157 H GLU 62  1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc21 metalc ? ? Q FE  .  FE  ? ? ? 1_555 I  GLU 62 OE2 ? ? E FE  157 I GLU 62  1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc22 metalc ? ? S FE  .  FE  ? ? ? 1_555 J  GLU 62 OE2 ? ? G FE  157 J GLU 62  1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc23 metalc ? ? U FE  .  FE  ? ? ? 1_555 K  GLU 62 OE2 ? ? I FE  157 K GLU 62  1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc24 metalc ? ? T FE  .  FE  ? ? ? 1_555 L  GLU 62 OE2 ? ? H FE  157 L GLU 62  1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc25 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 P  FE  .  FE  ? ? A HIS 31  D FE  157 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc26 metalc ? ? B HIS 31 NE2 ? ? ? 1_555 X  FE  .  FE  ? ? B HIS 31  L FE  157 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc27 metalc ? ? C HIS 31 NE2 ? ? ? 1_555 O  FE  .  FE  ? ? C HIS 31  C FE  157 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc28 metalc ? ? D HIS 31 NE2 ? ? ? 1_555 V  FE  .  FE  ? ? D HIS 31  J FE  157 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc29 metalc ? ? E HIS 31 NE2 ? ? ? 1_555 M  FE  .  FE  ? ? E HIS 31  A FE  157 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc30 metalc ? ? F HIS 31 NE2 ? ? ? 1_555 R  FE  .  FE  ? ? F HIS 31  F FE  157 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc31 metalc ? ? G HIS 31 NE2 ? ? ? 1_555 N  FE  .  FE  ? ? G HIS 31  B FE  157 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc32 metalc ? ? H HIS 31 NE2 ? ? ? 1_555 W  FE  .  FE  ? ? H HIS 31  K FE  157 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc33 metalc ? ? I HIS 31 NE2 ? ? ? 1_555 U  FE  .  FE  ? ? I HIS 31  I FE  157 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc34 metalc ? ? J HIS 31 NE2 ? ? ? 1_555 T  FE  .  FE  ? ? J HIS 31  H FE  157 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc35 metalc ? ? K HIS 31 NE2 ? ? ? 1_555 Q  FE  .  FE  ? ? K HIS 31  E FE  157 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc36 metalc ? ? L HIS 31 NE2 ? ? ? 1_555 S  FE  .  FE  ? ? L HIS 31  G FE  157 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc37 metalc ? ? S FE  .  FE  ? ? ? 1_555 HA HOH .  O   ? ? G FE  157 J HOH 161 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc38 metalc ? ? T FE  .  FE  ? ? ? 1_555 JA HOH .  O   ? ? H FE  157 L HOH 158 1_555 ? ? ? ? ? ? ? 2.511 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ASA Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASB Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASC Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASD Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASE Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASF Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASG Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASH Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASI Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASJ Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASK Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
ASL Author   ? ? ? ? 5 'IRON-BINDING SITE'                 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE A 157' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FE B 157' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE C 157' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE D 157' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FE E 157' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FE F 157' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE G 157' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE H 157' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FE I 157' 
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FE J 157' 
BC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FE K 157' 
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FE L 157' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   ASA 5 GLU A  62 ? GLU A 62  . ? 1_555 ? 
2   ASA 5 ASP A  58 ? ASP A 58  . ? 1_555 ? 
3   ASA 5 HIS A  31 ? HIS A 31  . ? 1_555 ? 
4   ASA 5 ASP A  47 ? ASP A 47  . ? 1_555 ? 
5   ASA 5 HIS A  43 ? HIS A 43  . ? 1_555 ? 
6   ASB 5 GLU B  62 ? GLU B 62  . ? 1_555 ? 
7   ASB 5 ASP B  58 ? ASP B 58  . ? 1_555 ? 
8   ASB 5 HIS B  31 ? HIS B 31  . ? 1_555 ? 
9   ASB 5 ASP B  47 ? ASP B 47  . ? 1_555 ? 
10  ASB 5 HIS B  43 ? HIS B 43  . ? 1_555 ? 
11  ASC 5 GLU C  62 ? GLU C 62  . ? 1_555 ? 
12  ASC 5 ASP C  58 ? ASP C 58  . ? 1_555 ? 
13  ASC 5 HIS C  31 ? HIS C 31  . ? 1_555 ? 
14  ASC 5 ASP C  47 ? ASP C 47  . ? 1_555 ? 
15  ASC 5 HIS C  43 ? HIS C 43  . ? 1_555 ? 
16  ASD 5 GLU D  62 ? GLU D 62  . ? 1_555 ? 
17  ASD 5 ASP D  58 ? ASP D 58  . ? 1_555 ? 
18  ASD 5 HIS D  31 ? HIS D 31  . ? 1_555 ? 
19  ASD 5 ASP D  47 ? ASP D 47  . ? 1_555 ? 
20  ASD 5 HIS D  43 ? HIS D 43  . ? 1_555 ? 
21  ASE 5 GLU E  62 ? GLU E 62  . ? 1_555 ? 
22  ASE 5 ASP E  58 ? ASP E 58  . ? 1_555 ? 
23  ASE 5 HIS E  31 ? HIS E 31  . ? 1_555 ? 
24  ASE 5 ASP E  47 ? ASP E 47  . ? 1_555 ? 
25  ASE 5 HIS E  43 ? HIS E 43  . ? 1_555 ? 
26  ASF 5 GLU F  62 ? GLU F 62  . ? 1_555 ? 
27  ASF 5 ASP F  58 ? ASP F 58  . ? 1_555 ? 
28  ASF 5 HIS F  31 ? HIS F 31  . ? 1_555 ? 
29  ASF 5 ASP F  47 ? ASP F 47  . ? 1_555 ? 
30  ASF 5 HIS F  43 ? HIS F 43  . ? 1_555 ? 
31  ASG 5 GLU G  62 ? GLU G 62  . ? 1_555 ? 
32  ASG 5 ASP G  58 ? ASP G 58  . ? 1_555 ? 
33  ASG 5 HIS G  31 ? HIS G 31  . ? 1_555 ? 
34  ASG 5 ASP G  47 ? ASP G 47  . ? 1_555 ? 
35  ASG 5 HIS G  43 ? HIS G 43  . ? 1_555 ? 
36  ASH 5 GLU H  62 ? GLU H 62  . ? 1_555 ? 
37  ASH 5 ASP H  58 ? ASP H 58  . ? 1_555 ? 
38  ASH 5 HIS H  31 ? HIS H 31  . ? 1_555 ? 
39  ASH 5 ASP H  47 ? ASP H 47  . ? 1_555 ? 
40  ASH 5 HIS H  43 ? HIS H 43  . ? 1_555 ? 
41  ASI 5 GLU I  62 ? GLU I 62  . ? 1_555 ? 
42  ASI 5 ASP I  58 ? ASP I 58  . ? 1_555 ? 
43  ASI 5 HIS I  31 ? HIS I 31  . ? 1_555 ? 
44  ASI 5 ASP I  47 ? ASP I 47  . ? 1_555 ? 
45  ASI 5 HIS I  43 ? HIS I 43  . ? 1_555 ? 
46  ASJ 5 GLU J  62 ? GLU J 62  . ? 1_555 ? 
47  ASJ 5 ASP J  58 ? ASP J 58  . ? 1_555 ? 
48  ASJ 5 HIS J  31 ? HIS J 31  . ? 1_555 ? 
49  ASJ 5 ASP J  47 ? ASP J 47  . ? 1_555 ? 
50  ASJ 5 HIS J  43 ? HIS J 43  . ? 1_555 ? 
51  ASK 5 GLU K  62 ? GLU K 62  . ? 1_555 ? 
52  ASK 5 ASP K  58 ? ASP K 58  . ? 1_555 ? 
53  ASK 5 HIS K  31 ? HIS K 31  . ? 1_555 ? 
54  ASK 5 ASP K  47 ? ASP K 47  . ? 1_555 ? 
55  ASK 5 HIS K  43 ? HIS K 43  . ? 1_555 ? 
56  ASL 5 GLU L  62 ? GLU L 62  . ? 1_555 ? 
57  ASL 5 ASP L  58 ? ASP L 58  . ? 1_555 ? 
58  ASL 5 HIS L  31 ? HIS L 31  . ? 1_555 ? 
59  ASL 5 ASP L  47 ? ASP L 47  . ? 1_555 ? 
60  ASL 5 HIS L  43 ? HIS L 43  . ? 1_555 ? 
61  AC1 4 HIS E  31 ? HIS E 31  . ? 1_555 ? 
62  AC1 4 HOH CA .  ? HOH E 197 . ? 1_555 ? 
63  AC1 4 ASP G  58 ? ASP G 58  . ? 1_555 ? 
64  AC1 4 GLU G  62 ? GLU G 62  . ? 1_555 ? 
65  AC2 3 ASP E  58 ? ASP E 58  . ? 1_555 ? 
66  AC2 3 GLU E  62 ? GLU E 62  . ? 1_555 ? 
67  AC2 3 HIS G  31 ? HIS G 31  . ? 1_555 ? 
68  AC3 4 ASP A  58 ? ASP A 58  . ? 1_555 ? 
69  AC3 4 GLU A  62 ? GLU A 62  . ? 1_555 ? 
70  AC3 4 HIS C  31 ? HIS C 31  . ? 1_555 ? 
71  AC3 4 ASP C  47 ? ASP C 47  . ? 1_555 ? 
72  AC4 4 HIS A  31 ? HIS A 31  . ? 1_555 ? 
73  AC4 4 ASP A  47 ? ASP A 47  . ? 1_555 ? 
74  AC4 4 ASP C  58 ? ASP C 58  . ? 1_555 ? 
75  AC4 4 GLU C  62 ? GLU C 62  . ? 1_555 ? 
76  AC5 3 ASP I  58 ? ASP I 58  . ? 1_555 ? 
77  AC5 3 GLU I  62 ? GLU I 62  . ? 1_555 ? 
78  AC5 3 HIS K  31 ? HIS K 31  . ? 1_555 ? 
79  AC6 3 HIS F  31 ? HIS F 31  . ? 1_555 ? 
80  AC6 3 ASP H  58 ? ASP H 58  . ? 1_555 ? 
81  AC6 3 GLU H  62 ? GLU H 62  . ? 1_555 ? 
82  AC7 5 ASP J  58 ? ASP J 58  . ? 1_555 ? 
83  AC7 5 GLU J  62 ? GLU J 62  . ? 1_555 ? 
84  AC7 5 HOH HA .  ? HOH J 161 . ? 1_555 ? 
85  AC7 5 HIS L  31 ? HIS L 31  . ? 1_555 ? 
86  AC7 5 ASP L  47 ? ASP L 47  . ? 1_555 ? 
87  AC8 4 HIS J  31 ? HIS J 31  . ? 1_555 ? 
88  AC8 4 ASP L  58 ? ASP L 58  . ? 1_555 ? 
89  AC8 4 GLU L  62 ? GLU L 62  . ? 1_555 ? 
90  AC8 4 HOH JA .  ? HOH L 158 . ? 1_555 ? 
91  AC9 3 HIS I  31 ? HIS I 31  . ? 1_555 ? 
92  AC9 3 ASP K  58 ? ASP K 58  . ? 1_555 ? 
93  AC9 3 GLU K  62 ? GLU K 62  . ? 1_555 ? 
94  BC1 3 ASP B  58 ? ASP B 58  . ? 1_555 ? 
95  BC1 3 GLU B  62 ? GLU B 62  . ? 1_555 ? 
96  BC1 3 HIS D  31 ? HIS D 31  . ? 1_555 ? 
97  BC2 3 ASP F  58 ? ASP F 58  . ? 1_555 ? 
98  BC2 3 GLU F  62 ? GLU F 62  . ? 1_555 ? 
99  BC2 3 HIS H  31 ? HIS H 31  . ? 1_555 ? 
100 BC3 3 HIS B  31 ? HIS B 31  . ? 1_555 ? 
101 BC3 3 ASP D  58 ? ASP D 58  . ? 1_555 ? 
102 BC3 3 GLU D  62 ? GLU D 62  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QGH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QGH 
_atom_sites.fract_transf_matrix[1][1]   0.011423 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007273 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005768 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A  1 7   ? 13.469  -40.700 40.268  1.00 76.00  ? 7   VAL A N   1 
ATOM   2     C  CA  . VAL A  1 7   ? 13.780  -39.475 40.944  1.00 73.79  ? 7   VAL A CA  1 
ATOM   3     C  C   . VAL A  1 7   ? 12.510  -38.520 41.068  1.00 67.59  ? 7   VAL A C   1 
ATOM   4     O  O   . VAL A  1 7   ? 11.439  -38.800 40.514  1.00 77.45  ? 7   VAL A O   1 
ATOM   5     C  CB  . VAL A  1 7   ? 14.858  -38.701 40.090  1.00 76.50  ? 7   VAL A CB  1 
ATOM   6     C  CG1 . VAL A  1 7   ? 15.901  -37.988 40.953  1.00 74.55  ? 7   VAL A CG1 1 
ATOM   7     C  CG2 . VAL A  1 7   ? 15.646  -39.617 39.152  1.00 78.36  ? 7   VAL A CG2 1 
ATOM   8     N  N   . ASP A  1 8   ? 12.643  -37.373 41.822  1.00 37.56  ? 8   ASP A N   1 
ATOM   9     C  CA  . ASP A  1 8   ? 11.545  -36.318 41.987  1.00 28.83  ? 8   ASP A CA  1 
ATOM   10    C  C   . ASP A  1 8   ? 11.901  -35.060 41.135  1.00 15.18  ? 8   ASP A C   1 
ATOM   11    O  O   . ASP A  1 8   ? 12.997  -34.971 40.567  1.00 11.25  ? 8   ASP A O   1 
ATOM   12    C  CB  . ASP A  1 8   ? 11.346  -35.920 43.472  1.00 26.34  ? 8   ASP A CB  1 
ATOM   13    C  CG  . ASP A  1 8   ? 12.407  -34.954 44.016  1.00 34.75  ? 8   ASP A CG  1 
ATOM   14    O  OD1 . ASP A  1 8   ? 13.456  -34.689 43.317  1.00 44.17  ? 8   ASP A OD1 1 
ATOM   15    O  OD2 . ASP A  1 8   ? 12.259  -34.415 45.183  1.00 46.43  ? 8   ASP A OD2 1 
ATOM   16    N  N   . THR A  1 9   ? 10.972  -34.093 41.058  1.00 9.04   ? 9   THR A N   1 
ATOM   17    C  CA  . THR A  1 9   ? 11.133  -32.880 40.190  1.00 10.28  ? 9   THR A CA  1 
ATOM   18    C  C   . THR A  1 9   ? 12.437  -32.141 40.459  1.00 11.19  ? 9   THR A C   1 
ATOM   19    O  O   . THR A  1 9   ? 13.217  -31.844 39.538  1.00 9.48   ? 9   THR A O   1 
ATOM   20    C  CB  . THR A  1 9   ? 9.940   -31.937 40.321  1.00 17.22  ? 9   THR A CB  1 
ATOM   21    O  OG1 . THR A  1 9   ? 8.750   -32.617 39.933  1.00 14.75  ? 9   THR A OG1 1 
ATOM   22    C  CG2 . THR A  1 9   ? 10.061  -30.704 39.416  1.00 16.60  ? 9   THR A CG2 1 
ATOM   23    N  N   . LYS A  1 10  ? 12.688  -31.906 41.734  1.00 2.11   ? 10  LYS A N   1 
ATOM   24    C  CA  . LYS A  1 10  ? 13.908  -31.216 42.117  1.00 4.69   ? 10  LYS A CA  1 
ATOM   25    C  C   . LYS A  1 10  ? 15.161  -31.925 41.621  1.00 13.26  ? 10  LYS A C   1 
ATOM   26    O  O   . LYS A  1 10  ? 16.010  -31.336 40.936  1.00 20.12  ? 10  LYS A O   1 
ATOM   27    C  CB  . LYS A  1 10  ? 13.944  -30.988 43.605  1.00 4.03   ? 10  LYS A CB  1 
ATOM   28    C  CG  . LYS A  1 10  ? 12.797  -30.151 44.142  1.00 5.10   ? 10  LYS A CG  1 
ATOM   29    C  CD  . LYS A  1 10  ? 13.132  -29.687 45.545  1.00 11.06  ? 10  LYS A CD  1 
ATOM   30    C  CE  . LYS A  1 10  ? 11.957  -29.135 46.294  1.00 56.40  ? 10  LYS A CE  1 
ATOM   31    N  NZ  . LYS A  1 10  ? 12.166  -28.908 47.712  1.00 93.83  ? 10  LYS A NZ  1 
ATOM   32    N  N   . GLU A  1 11  ? 15.241  -33.221 41.912  1.00 9.51   ? 11  GLU A N   1 
ATOM   33    C  CA  . GLU A  1 11  ? 16.392  -33.971 41.388  1.00 13.09  ? 11  GLU A CA  1 
ATOM   34    C  C   . GLU A  1 11  ? 16.419  -34.038 39.889  1.00 10.54  ? 11  GLU A C   1 
ATOM   35    O  O   . GLU A  1 11  ? 17.486  -34.055 39.304  1.00 9.50   ? 11  GLU A O   1 
ATOM   36    C  CB  . GLU A  1 11  ? 16.354  -35.431 41.912  1.00 18.61  ? 11  GLU A CB  1 
ATOM   37    C  CG  . GLU A  1 11  ? 16.931  -35.682 43.283  1.00 72.61  ? 11  GLU A CG  1 
ATOM   38    C  CD  . GLU A  1 11  ? 16.376  -34.885 44.376  0.00 100.00 ? 11  GLU A CD  1 
ATOM   39    O  OE1 . GLU A  1 11  ? 16.458  -33.640 44.363  0.00 100.00 ? 11  GLU A OE1 1 
ATOM   40    O  OE2 . GLU A  1 11  ? 15.796  -35.497 45.342  0.00 100.00 ? 11  GLU A OE2 1 
ATOM   41    N  N   . PHE A  1 12  ? 15.280  -34.110 39.244  1.00 3.26   ? 12  PHE A N   1 
ATOM   42    C  CA  . PHE A  1 12  ? 15.321  -34.194 37.800  1.00 2.82   ? 12  PHE A CA  1 
ATOM   43    C  C   . PHE A  1 12  ? 15.844  -32.866 37.291  1.00 8.02   ? 12  PHE A C   1 
ATOM   44    O  O   . PHE A  1 12  ? 16.706  -32.806 36.415  1.00 7.08   ? 12  PHE A O   1 
ATOM   45    C  CB  . PHE A  1 12  ? 13.923  -34.396 37.239  1.00 5.12   ? 12  PHE A CB  1 
ATOM   46    C  CG  . PHE A  1 12  ? 13.899  -34.244 35.757  1.00 10.73  ? 12  PHE A CG  1 
ATOM   47    C  CD1 . PHE A  1 12  ? 14.245  -35.302 34.942  1.00 11.19  ? 12  PHE A CD1 1 
ATOM   48    C  CD2 . PHE A  1 12  ? 13.613  -33.039 35.167  1.00 16.78  ? 12  PHE A CD2 1 
ATOM   49    C  CE1 . PHE A  1 12  ? 14.241  -35.181 33.569  1.00 12.14  ? 12  PHE A CE1 1 
ATOM   50    C  CE2 . PHE A  1 12  ? 13.632  -32.929 33.804  1.00 13.20  ? 12  PHE A CE2 1 
ATOM   51    C  CZ  . PHE A  1 12  ? 13.950  -33.985 32.991  1.00 12.56  ? 12  PHE A CZ  1 
ATOM   52    N  N   . LEU A  1 13  ? 15.294  -31.781 37.812  1.00 2.67   ? 13  LEU A N   1 
ATOM   53    C  CA  . LEU A  1 13  ? 15.757  -30.491 37.333  1.00 4.04   ? 13  LEU A CA  1 
ATOM   54    C  C   . LEU A  1 13  ? 17.267  -30.276 37.537  1.00 6.96   ? 13  LEU A C   1 
ATOM   55    O  O   . LEU A  1 13  ? 18.004  -29.891 36.623  1.00 11.16  ? 13  LEU A O   1 
ATOM   56    C  CB  . LEU A  1 13  ? 14.949  -29.386 37.998  1.00 2.28   ? 13  LEU A CB  1 
ATOM   57    C  CG  . LEU A  1 13  ? 13.862  -28.664 37.211  1.00 7.04   ? 13  LEU A CG  1 
ATOM   58    C  CD1 . LEU A  1 13  ? 13.319  -29.429 36.037  1.00 1.38   ? 13  LEU A CD1 1 
ATOM   59    C  CD2 . LEU A  1 13  ? 12.843  -28.254 38.234  1.00 1.00   ? 13  LEU A CD2 1 
ATOM   60    N  N   . ASN A  1 14  ? 17.751  -30.579 38.737  1.00 4.16   ? 14  ASN A N   1 
ATOM   61    C  CA  . ASN A  1 14  ? 19.168  -30.368 38.984  1.00 5.85   ? 14  ASN A CA  1 
ATOM   62    C  C   . ASN A  1 14  ? 19.999  -31.250 38.068  1.00 9.54   ? 14  ASN A C   1 
ATOM   63    O  O   . ASN A  1 14  ? 21.033  -30.872 37.542  1.00 12.06  ? 14  ASN A O   1 
ATOM   64    C  CB  . ASN A  1 14  ? 19.440  -30.660 40.451  1.00 3.68   ? 14  ASN A CB  1 
ATOM   65    C  CG  . ASN A  1 14  ? 20.367  -29.644 41.088  1.00 21.50  ? 14  ASN A CG  1 
ATOM   66    O  OD1 . ASN A  1 14  ? 20.853  -28.706 40.473  1.00 13.68  ? 14  ASN A OD1 1 
ATOM   67    N  ND2 . ASN A  1 14  ? 20.607  -29.843 42.368  1.00 12.96  ? 14  ASN A ND2 1 
ATOM   68    N  N   . HIS A  1 15  ? 19.517  -32.437 37.769  1.00 5.98   ? 15  HIS A N   1 
ATOM   69    C  CA  . HIS A  1 15  ? 20.293  -33.278 36.889  1.00 7.01   ? 15  HIS A CA  1 
ATOM   70    C  C   . HIS A  1 15  ? 20.402  -32.585 35.549  1.00 8.12   ? 15  HIS A C   1 
ATOM   71    O  O   . HIS A  1 15  ? 21.426  -32.717 34.886  1.00 8.63   ? 15  HIS A O   1 
ATOM   72    C  CB  . HIS A  1 15  ? 19.620  -34.648 36.767  1.00 10.64  ? 15  HIS A CB  1 
ATOM   73    C  CG  . HIS A  1 15  ? 20.370  -35.607 35.900  1.00 18.09  ? 15  HIS A CG  1 
ATOM   74    N  ND1 . HIS A  1 15  ? 19.944  -35.963 34.639  1.00 24.54  ? 15  HIS A ND1 1 
ATOM   75    C  CD2 . HIS A  1 15  ? 21.551  -36.239 36.080  1.00 18.32  ? 15  HIS A CD2 1 
ATOM   76    C  CE1 . HIS A  1 15  ? 20.815  -36.791 34.091  1.00 22.79  ? 15  HIS A CE1 1 
ATOM   77    N  NE2 . HIS A  1 15  ? 21.816  -36.951 34.934  1.00 21.13  ? 15  HIS A NE2 1 
ATOM   78    N  N   . GLN A  1 16  ? 19.359  -31.858 35.156  1.00 2.97   ? 16  GLN A N   1 
ATOM   79    C  CA  . GLN A  1 16  ? 19.436  -31.169 33.882  1.00 2.82   ? 16  GLN A CA  1 
ATOM   80    C  C   . GLN A  1 16  ? 20.342  -29.958 33.942  1.00 7.83   ? 16  GLN A C   1 
ATOM   81    O  O   . GLN A  1 16  ? 21.000  -29.610 32.973  1.00 8.27   ? 16  GLN A O   1 
ATOM   82    C  CB  . GLN A  1 16  ? 18.074  -30.833 33.289  1.00 2.09   ? 16  GLN A CB  1 
ATOM   83    C  CG  . GLN A  1 16  ? 17.250  -32.082 33.069  1.00 8.08   ? 16  GLN A CG  1 
ATOM   84    C  CD  . GLN A  1 16  ? 17.969  -33.148 32.223  1.00 18.91  ? 16  GLN A CD  1 
ATOM   85    O  OE1 . GLN A  1 16  ? 18.783  -32.841 31.346  1.00 6.39   ? 16  GLN A OE1 1 
ATOM   86    N  NE2 . GLN A  1 16  ? 17.628  -34.422 32.467  1.00 12.92  ? 16  GLN A NE2 1 
ATOM   87    N  N   . VAL A  1 17  ? 20.463  -29.348 35.104  1.00 1.94   ? 17  VAL A N   1 
ATOM   88    C  CA  . VAL A  1 17  ? 21.406  -28.235 35.209  1.00 2.73   ? 17  VAL A CA  1 
ATOM   89    C  C   . VAL A  1 17  ? 22.813  -28.768 34.898  1.00 5.93   ? 17  VAL A C   1 
ATOM   90    O  O   . VAL A  1 17  ? 23.572  -28.200 34.088  1.00 8.32   ? 17  VAL A O   1 
ATOM   91    C  CB  . VAL A  1 17  ? 21.408  -27.610 36.609  1.00 1.83   ? 17  VAL A CB  1 
ATOM   92    C  CG1 . VAL A  1 17  ? 22.573  -26.626 36.731  1.00 1.03   ? 17  VAL A CG1 1 
ATOM   93    C  CG2 . VAL A  1 17  ? 20.055  -26.958 36.880  1.00 1.09   ? 17  VAL A CG2 1 
ATOM   94    N  N   . ALA A  1 18  ? 23.123  -29.916 35.481  1.00 4.10   ? 18  ALA A N   1 
ATOM   95    C  CA  . ALA A  1 18  ? 24.381  -30.591 35.183  1.00 4.13   ? 18  ALA A CA  1 
ATOM   96    C  C   . ALA A  1 18  ? 24.498  -30.935 33.685  1.00 6.12   ? 18  ALA A C   1 
ATOM   97    O  O   . ALA A  1 18  ? 25.491  -30.554 33.052  1.00 9.68   ? 18  ALA A O   1 
ATOM   98    C  CB  . ALA A  1 18  ? 24.543  -31.822 36.059  1.00 2.74   ? 18  ALA A CB  1 
ATOM   99    N  N   . ASN A  1 19  ? 23.538  -31.650 33.091  1.00 1.88   ? 19  ASN A N   1 
ATOM   100   C  CA  . ASN A  1 19  ? 23.652  -31.964 31.675  1.00 1.83   ? 19  ASN A CA  1 
ATOM   101   C  C   . ASN A  1 19  ? 23.836  -30.737 30.791  1.00 9.15   ? 19  ASN A C   1 
ATOM   102   O  O   . ASN A  1 19  ? 24.600  -30.715 29.836  1.00 9.59   ? 19  ASN A O   1 
ATOM   103   C  CB  . ASN A  1 19  ? 22.366  -32.621 31.211  1.00 4.81   ? 19  ASN A CB  1 
ATOM   104   C  CG  . ASN A  1 19  ? 22.309  -34.070 31.595  1.00 14.85  ? 19  ASN A CG  1 
ATOM   105   O  OD1 . ASN A  1 19  ? 23.335  -34.685 31.911  1.00 11.06  ? 19  ASN A OD1 1 
ATOM   106   N  ND2 . ASN A  1 19  ? 21.133  -34.658 31.473  1.00 3.18   ? 19  ASN A ND2 1 
ATOM   107   N  N   . LEU A  1 20  ? 23.012  -29.734 31.032  1.00 10.29  ? 20  LEU A N   1 
ATOM   108   C  CA  . LEU A  1 20  ? 22.997  -28.528 30.229  1.00 7.18   ? 20  LEU A CA  1 
ATOM   109   C  C   . LEU A  1 20  ? 24.367  -27.869 30.293  1.00 7.91   ? 20  LEU A C   1 
ATOM   110   O  O   . LEU A  1 20  ? 24.864  -27.459 29.246  1.00 8.23   ? 20  LEU A O   1 
ATOM   111   C  CB  . LEU A  1 20  ? 21.840  -27.631 30.633  1.00 4.24   ? 20  LEU A CB  1 
ATOM   112   C  CG  . LEU A  1 20  ? 20.555  -27.619 29.805  1.00 3.24   ? 20  LEU A CG  1 
ATOM   113   C  CD1 . LEU A  1 20  ? 20.464  -28.628 28.716  1.00 1.45   ? 20  LEU A CD1 1 
ATOM   114   C  CD2 . LEU A  1 20  ? 19.314  -27.492 30.615  1.00 1.00   ? 20  LEU A CD2 1 
ATOM   115   N  N   . ASN A  1 21  ? 25.017  -27.816 31.450  1.00 1.26   ? 21  ASN A N   1 
ATOM   116   C  CA  . ASN A  1 21  ? 26.381  -27.278 31.494  1.00 1.27   ? 21  ASN A CA  1 
ATOM   117   C  C   . ASN A  1 21  ? 27.442  -28.075 30.751  1.00 9.27   ? 21  ASN A C   1 
ATOM   118   O  O   . ASN A  1 21  ? 28.393  -27.514 30.212  1.00 13.70  ? 21  ASN A O   1 
ATOM   119   C  CB  . ASN A  1 21  ? 26.837  -27.082 32.932  1.00 6.04   ? 21  ASN A CB  1 
ATOM   120   C  CG  . ASN A  1 21  ? 26.318  -25.799 33.481  1.00 20.52  ? 21  ASN A CG  1 
ATOM   121   O  OD1 . ASN A  1 21  ? 26.943  -24.770 33.273  1.00 16.46  ? 21  ASN A OD1 1 
ATOM   122   N  ND2 . ASN A  1 21  ? 25.085  -25.803 33.979  1.00 11.82  ? 21  ASN A ND2 1 
ATOM   123   N  N   . VAL A  1 22  ? 27.222  -29.380 30.639  1.00 9.00   ? 22  VAL A N   1 
ATOM   124   C  CA  . VAL A  1 22  ? 28.154  -30.195 29.894  1.00 6.51   ? 22  VAL A CA  1 
ATOM   125   C  C   . VAL A  1 22  ? 27.890  -29.982 28.418  1.00 5.69   ? 22  VAL A C   1 
ATOM   126   O  O   . VAL A  1 22  ? 28.849  -29.903 27.638  1.00 5.25   ? 22  VAL A O   1 
ATOM   127   C  CB  . VAL A  1 22  ? 28.073  -31.688 30.226  1.00 5.68   ? 22  VAL A CB  1 
ATOM   128   C  CG1 . VAL A  1 22  ? 29.062  -32.478 29.352  1.00 6.95   ? 22  VAL A CG1 1 
ATOM   129   C  CG2 . VAL A  1 22  ? 28.413  -31.904 31.673  1.00 2.39   ? 22  VAL A CG2 1 
ATOM   130   N  N   . PHE A  1 23  ? 26.613  -29.950 28.054  1.00 1.00   ? 23  PHE A N   1 
ATOM   131   C  CA  . PHE A  1 23  ? 26.249  -29.860 26.654  1.00 1.17   ? 23  PHE A CA  1 
ATOM   132   C  C   . PHE A  1 23  ? 26.799  -28.573 26.053  1.00 9.05   ? 23  PHE A C   1 
ATOM   133   O  O   . PHE A  1 23  ? 27.329  -28.487 24.951  1.00 6.75   ? 23  PHE A O   1 
ATOM   134   C  CB  . PHE A  1 23  ? 24.717  -29.889 26.532  1.00 1.91   ? 23  PHE A CB  1 
ATOM   135   C  CG  . PHE A  1 23  ? 24.212  -29.872 25.112  1.00 4.85   ? 23  PHE A CG  1 
ATOM   136   C  CD1 . PHE A  1 23  ? 24.892  -30.519 24.106  1.00 10.64  ? 23  PHE A CD1 1 
ATOM   137   C  CD2 . PHE A  1 23  ? 22.993  -29.314 24.788  1.00 5.11   ? 23  PHE A CD2 1 
ATOM   138   C  CE1 . PHE A  1 23  ? 24.404  -30.543 22.805  1.00 8.05   ? 23  PHE A CE1 1 
ATOM   139   C  CE2 . PHE A  1 23  ? 22.513  -29.296 23.487  1.00 2.54   ? 23  PHE A CE2 1 
ATOM   140   C  CZ  . PHE A  1 23  ? 23.197  -29.920 22.477  1.00 1.00   ? 23  PHE A CZ  1 
ATOM   141   N  N   . THR A  1 24  ? 26.687  -27.536 26.863  1.00 3.04   ? 24  THR A N   1 
ATOM   142   C  CA  . THR A  1 24  ? 27.054  -26.185 26.452  1.00 2.75   ? 24  THR A CA  1 
ATOM   143   C  C   . THR A  1 24  ? 28.525  -26.096 26.099  1.00 9.86   ? 24  THR A C   1 
ATOM   144   O  O   . THR A  1 24  ? 28.878  -25.556 25.062  1.00 5.49   ? 24  THR A O   1 
ATOM   145   C  CB  . THR A  1 24  ? 26.540  -25.225 27.515  1.00 6.24   ? 24  THR A CB  1 
ATOM   146   O  OG1 . THR A  1 24  ? 26.043  -24.036 26.916  1.00 37.04  ? 24  THR A OG1 1 
ATOM   147   C  CG2 . THR A  1 24  ? 27.567  -24.918 28.549  1.00 1.50   ? 24  THR A CG2 1 
ATOM   148   N  N   . VAL A  1 25  ? 29.355  -26.719 26.931  1.00 5.82   ? 25  VAL A N   1 
ATOM   149   C  CA  . VAL A  1 25  ? 30.793  -26.765 26.677  1.00 1.97   ? 25  VAL A CA  1 
ATOM   150   C  C   . VAL A  1 25  ? 31.038  -27.611 25.420  1.00 6.89   ? 25  VAL A C   1 
ATOM   151   O  O   . VAL A  1 25  ? 31.847  -27.302 24.552  1.00 4.72   ? 25  VAL A O   1 
ATOM   152   C  CB  . VAL A  1 25  ? 31.527  -27.301 27.922  1.00 7.11   ? 25  VAL A CB  1 
ATOM   153   C  CG1 . VAL A  1 25  ? 33.015  -27.568 27.630  1.00 5.33   ? 25  VAL A CG1 1 
ATOM   154   C  CG2 . VAL A  1 25  ? 31.330  -26.307 29.077  1.00 1.21   ? 25  VAL A CG2 1 
ATOM   155   N  N   . LYS A  1 26  ? 30.262  -28.673 25.264  1.00 1.77   ? 26  LYS A N   1 
ATOM   156   C  CA  . LYS A  1 26  ? 30.410  -29.525 24.084  1.00 2.84   ? 26  LYS A CA  1 
ATOM   157   C  C   . LYS A  1 26  ? 30.097  -28.698 22.826  1.00 6.52   ? 26  LYS A C   1 
ATOM   158   O  O   . LYS A  1 26  ? 30.722  -28.855 21.778  1.00 8.24   ? 26  LYS A O   1 
ATOM   159   C  CB  . LYS A  1 26  ? 29.502  -30.758 24.229  1.00 3.47   ? 26  LYS A CB  1 
ATOM   160   C  CG  . LYS A  1 26  ? 29.614  -31.678 23.038  1.00 15.03  ? 26  LYS A CG  1 
ATOM   161   C  CD  . LYS A  1 26  ? 28.539  -32.737 23.075  1.00 29.98  ? 26  LYS A CD  1 
ATOM   162   C  CE  . LYS A  1 26  ? 28.771  -33.749 24.191  1.00 12.87  ? 26  LYS A CE  1 
ATOM   163   N  NZ  . LYS A  1 26  ? 29.853  -34.721 23.885  1.00 36.46  ? 26  LYS A NZ  1 
ATOM   164   N  N   . ILE A  1 27  ? 29.111  -27.819 22.907  1.00 2.71   ? 27  ILE A N   1 
ATOM   165   C  CA  . ILE A  1 27  ? 28.764  -27.017 21.747  1.00 1.55   ? 27  ILE A CA  1 
ATOM   166   C  C   . ILE A  1 27  ? 29.972  -26.140 21.418  1.00 6.09   ? 27  ILE A C   1 
ATOM   167   O  O   . ILE A  1 27  ? 30.393  -26.053 20.247  1.00 7.90   ? 27  ILE A O   1 
ATOM   168   C  CB  . ILE A  1 27  ? 27.483  -26.193 22.011  1.00 2.62   ? 27  ILE A CB  1 
ATOM   169   C  CG1 . ILE A  1 27  ? 26.279  -27.147 22.101  1.00 1.00   ? 27  ILE A CG1 1 
ATOM   170   C  CG2 . ILE A  1 27  ? 27.190  -25.200 20.853  1.00 1.00   ? 27  ILE A CG2 1 
ATOM   171   C  CD1 . ILE A  1 27  ? 25.041  -26.435 22.689  1.00 1.41   ? 27  ILE A CD1 1 
ATOM   172   N  N   . HIS A  1 28  ? 30.568  -25.521 22.443  1.00 2.22   ? 28  HIS A N   1 
ATOM   173   C  CA  . HIS A  1 28  ? 31.768  -24.729 22.168  1.00 2.06   ? 28  HIS A CA  1 
ATOM   174   C  C   . HIS A  1 28  ? 32.867  -25.564 21.513  1.00 8.25   ? 28  HIS A C   1 
ATOM   175   O  O   . HIS A  1 28  ? 33.542  -25.140 20.582  1.00 7.67   ? 28  HIS A O   1 
ATOM   176   C  CB  . HIS A  1 28  ? 32.318  -24.153 23.452  1.00 5.12   ? 28  HIS A CB  1 
ATOM   177   C  CG  . HIS A  1 28  ? 31.798  -22.792 23.742  1.00 10.30  ? 28  HIS A CG  1 
ATOM   178   N  ND1 . HIS A  1 28  ? 31.339  -21.947 22.766  1.00 16.35  ? 28  HIS A ND1 1 
ATOM   179   C  CD2 . HIS A  1 28  ? 31.804  -22.085 24.892  1.00 11.42  ? 28  HIS A CD2 1 
ATOM   180   C  CE1 . HIS A  1 28  ? 30.978  -20.796 23.295  1.00 16.62  ? 28  HIS A CE1 1 
ATOM   181   N  NE2 . HIS A  1 28  ? 31.270  -20.844 24.594  1.00 15.58  ? 28  HIS A NE2 1 
ATOM   182   N  N   . GLN A  1 29  ? 33.040  -26.796 21.975  1.00 4.51   ? 29  GLN A N   1 
ATOM   183   C  CA  . GLN A  1 29  ? 34.080  -27.644 21.413  1.00 5.34   ? 29  GLN A CA  1 
ATOM   184   C  C   . GLN A  1 29  ? 33.929  -27.790 19.909  1.00 8.27   ? 29  GLN A C   1 
ATOM   185   O  O   . GLN A  1 29  ? 34.872  -27.631 19.145  1.00 6.07   ? 29  GLN A O   1 
ATOM   186   C  CB  . GLN A  1 29  ? 34.098  -29.014 22.061  1.00 7.47   ? 29  GLN A CB  1 
ATOM   187   C  CG  . GLN A  1 29  ? 34.904  -30.054 21.298  1.00 10.76  ? 29  GLN A CG  1 
ATOM   188   C  CD  . GLN A  1 29  ? 34.995  -31.364 22.092  1.00 16.23  ? 29  GLN A CD  1 
ATOM   189   O  OE1 . GLN A  1 29  ? 35.675  -31.421 23.149  1.00 12.25  ? 29  GLN A OE1 1 
ATOM   190   N  NE2 . GLN A  1 29  ? 34.326  -32.405 21.583  1.00 10.02  ? 29  GLN A NE2 1 
ATOM   191   N  N   . ILE A  1 30  ? 32.710  -28.102 19.495  1.00 2.90   ? 30  ILE A N   1 
ATOM   192   C  CA  . ILE A  1 30  ? 32.480  -28.351 18.078  1.00 2.15   ? 30  ILE A CA  1 
ATOM   193   C  C   . ILE A  1 30  ? 32.703  -27.070 17.332  1.00 6.18   ? 30  ILE A C   1 
ATOM   194   O  O   . ILE A  1 30  ? 33.180  -26.982 16.193  1.00 6.11   ? 30  ILE A O   1 
ATOM   195   C  CB  . ILE A  1 30  ? 30.990  -28.764 17.907  1.00 6.36   ? 30  ILE A CB  1 
ATOM   196   C  CG1 . ILE A  1 30  ? 30.713  -30.116 18.586  1.00 9.52   ? 30  ILE A CG1 1 
ATOM   197   C  CG2 . ILE A  1 30  ? 30.556  -28.774 16.426  1.00 1.09   ? 30  ILE A CG2 1 
ATOM   198   C  CD1 . ILE A  1 30  ? 29.255  -30.479 18.687  1.00 12.84  ? 30  ILE A CD1 1 
ATOM   199   N  N   . HIS A  1 31  ? 32.286  -26.025 18.018  1.00 2.51   ? 31  HIS A N   1 
ATOM   200   C  CA  . HIS A  1 31  ? 32.315  -24.732 17.420  1.00 2.73   ? 31  HIS A CA  1 
ATOM   201   C  C   . HIS A  1 31  ? 33.701  -24.217 17.170  1.00 11.64  ? 31  HIS A C   1 
ATOM   202   O  O   . HIS A  1 31  ? 33.990  -23.510 16.146  1.00 4.43   ? 31  HIS A O   1 
ATOM   203   C  CB  . HIS A  1 31  ? 31.635  -23.836 18.407  1.00 2.51   ? 31  HIS A CB  1 
ATOM   204   C  CG  . HIS A  1 31  ? 31.840  -22.378 18.172  1.00 9.57   ? 31  HIS A CG  1 
ATOM   205   N  ND1 . HIS A  1 31  ? 31.126  -21.711 17.208  1.00 14.47  ? 31  HIS A ND1 1 
ATOM   206   C  CD2 . HIS A  1 31  ? 32.441  -21.421 18.950  1.00 10.63  ? 31  HIS A CD2 1 
ATOM   207   C  CE1 . HIS A  1 31  ? 31.354  -20.418 17.305  1.00 11.58  ? 31  HIS A CE1 1 
ATOM   208   N  NE2 . HIS A  1 31  ? 32.178  -20.210 18.336  1.00 10.47  ? 31  HIS A NE2 1 
ATOM   209   N  N   . TRP A  1 32  ? 34.615  -24.676 18.026  1.00 5.64   ? 32  TRP A N   1 
ATOM   210   C  CA  . TRP A  1 32  ? 35.986  -24.204 17.911  1.00 3.69   ? 32  TRP A CA  1 
ATOM   211   C  C   . TRP A  1 32  ? 36.763  -25.133 16.966  1.00 10.95  ? 32  TRP A C   1 
ATOM   212   O  O   . TRP A  1 32  ? 37.562  -24.735 16.153  1.00 7.11   ? 32  TRP A O   1 
ATOM   213   C  CB  . TRP A  1 32  ? 36.604  -24.306 19.314  1.00 2.53   ? 32  TRP A CB  1 
ATOM   214   C  CG  . TRP A  1 32  ? 36.209  -23.225 20.279  1.00 1.00   ? 32  TRP A CG  1 
ATOM   215   C  CD1 . TRP A  1 32  ? 35.720  -21.976 19.971  1.00 2.50   ? 32  TRP A CD1 1 
ATOM   216   C  CD2 . TRP A  1 32  ? 36.136  -23.315 21.707  1.00 1.88   ? 32  TRP A CD2 1 
ATOM   217   N  NE1 . TRP A  1 32  ? 35.448  -21.265 21.094  1.00 1.47   ? 32  TRP A NE1 1 
ATOM   218   C  CE2 . TRP A  1 32  ? 35.706  -22.070 22.194  1.00 3.14   ? 32  TRP A CE2 1 
ATOM   219   C  CE3 . TRP A  1 32  ? 36.470  -24.314 22.628  1.00 3.92   ? 32  TRP A CE3 1 
ATOM   220   C  CZ2 . TRP A  1 32  ? 35.527  -21.805 23.551  1.00 1.45   ? 32  TRP A CZ2 1 
ATOM   221   C  CZ3 . TRP A  1 32  ? 36.296  -24.019 24.003  1.00 5.89   ? 32  TRP A CZ3 1 
ATOM   222   C  CH2 . TRP A  1 32  ? 35.820  -22.792 24.445  1.00 6.40   ? 32  TRP A CH2 1 
ATOM   223   N  N   . TYR A  1 33  ? 36.552  -26.412 17.117  1.00 4.06   ? 33  TYR A N   1 
ATOM   224   C  CA  . TYR A  1 33  ? 37.332  -27.347 16.357  1.00 3.35   ? 33  TYR A CA  1 
ATOM   225   C  C   . TYR A  1 33  ? 36.846  -27.670 14.965  1.00 11.95  ? 33  TYR A C   1 
ATOM   226   O  O   . TYR A  1 33  ? 37.567  -28.307 14.194  1.00 12.13  ? 33  TYR A O   1 
ATOM   227   C  CB  . TYR A  1 33  ? 37.554  -28.636 17.175  1.00 1.99   ? 33  TYR A CB  1 
ATOM   228   C  CG  . TYR A  1 33  ? 38.494  -28.420 18.348  1.00 4.52   ? 33  TYR A CG  1 
ATOM   229   C  CD1 . TYR A  1 33  ? 39.877  -28.343 18.135  1.00 12.24  ? 33  TYR A CD1 1 
ATOM   230   C  CD2 . TYR A  1 33  ? 38.056  -28.277 19.650  1.00 1.00   ? 33  TYR A CD2 1 
ATOM   231   C  CE1 . TYR A  1 33  ? 40.769  -28.154 19.170  1.00 11.50  ? 33  TYR A CE1 1 
ATOM   232   C  CE2 . TYR A  1 33  ? 38.930  -28.149 20.690  1.00 5.72   ? 33  TYR A CE2 1 
ATOM   233   C  CZ  . TYR A  1 33  ? 40.288  -28.056 20.433  1.00 16.03  ? 33  TYR A CZ  1 
ATOM   234   O  OH  . TYR A  1 33  ? 41.192  -27.899 21.452  1.00 12.70  ? 33  TYR A OH  1 
ATOM   235   N  N   . MET A  1 34  ? 35.616  -27.312 14.624  1.00 7.04   ? 34  MET A N   1 
ATOM   236   C  CA  . MET A  1 34  ? 35.128  -27.720 13.311  1.00 4.22   ? 34  MET A CA  1 
ATOM   237   C  C   . MET A  1 34  ? 35.960  -27.230 12.113  1.00 4.52   ? 34  MET A C   1 
ATOM   238   O  O   . MET A  1 34  ? 36.565  -26.163 12.150  1.00 5.93   ? 34  MET A O   1 
ATOM   239   C  CB  . MET A  1 34  ? 33.646  -27.346 13.121  1.00 6.33   ? 34  MET A CB  1 
ATOM   240   C  CG  . MET A  1 34  ? 33.523  -25.892 13.248  1.00 12.68  ? 34  MET A CG  1 
ATOM   241   S  SD  . MET A  1 34  ? 31.920  -25.364 12.680  1.00 21.00  ? 34  MET A SD  1 
ATOM   242   C  CE  . MET A  1 34  ? 30.889  -26.273 13.791  1.00 16.01  ? 34  MET A CE  1 
ATOM   243   N  N   . ARG A  1 35  ? 35.999  -28.041 11.059  1.00 9.14   ? 35  ARG A N   1 
ATOM   244   C  CA  . ARG A  1 35  ? 36.692  -27.711 9.824   1.00 10.68  ? 35  ARG A CA  1 
ATOM   245   C  C   . ARG A  1 35  ? 35.928  -28.396 8.690   1.00 12.96  ? 35  ARG A C   1 
ATOM   246   O  O   . ARG A  1 35  ? 35.297  -29.423 8.934   1.00 17.66  ? 35  ARG A O   1 
ATOM   247   C  CB  . ARG A  1 35  ? 38.102  -28.277 9.804   1.00 9.07   ? 35  ARG A CB  1 
ATOM   248   C  CG  . ARG A  1 35  ? 39.041  -27.594 10.736  1.00 15.31  ? 35  ARG A CG  1 
ATOM   249   C  CD  . ARG A  1 35  ? 40.409  -28.145 10.432  1.00 4.99   ? 35  ARG A CD  1 
ATOM   250   N  NE  . ARG A  1 35  ? 41.353  -27.665 11.416  1.00 21.10  ? 35  ARG A NE  1 
ATOM   251   C  CZ  . ARG A  1 35  ? 42.562  -28.173 11.553  1.00 35.40  ? 35  ARG A CZ  1 
ATOM   252   N  NH1 . ARG A  1 35  ? 42.966  -29.137 10.744  1.00 43.02  ? 35  ARG A NH1 1 
ATOM   253   N  NH2 . ARG A  1 35  ? 43.340  -27.727 12.515  1.00 30.62  ? 35  ARG A NH2 1 
ATOM   254   N  N   . GLY A  1 36  ? 35.964  -27.841 7.477   1.00 8.34   ? 36  GLY A N   1 
ATOM   255   C  CA  . GLY A  1 36  ? 35.223  -28.376 6.340   1.00 6.98   ? 36  GLY A CA  1 
ATOM   256   C  C   . GLY A  1 36  ? 34.424  -27.286 5.648   1.00 13.19  ? 36  GLY A C   1 
ATOM   257   O  O   . GLY A  1 36  ? 34.182  -26.195 6.168   1.00 11.94  ? 36  GLY A O   1 
ATOM   258   N  N   . HIS A  1 37  ? 33.976  -27.589 4.441   1.00 9.59   ? 37  HIS A N   1 
ATOM   259   C  CA  . HIS A  1 37  ? 33.186  -26.606 3.715   1.00 14.42  ? 37  HIS A CA  1 
ATOM   260   C  C   . HIS A  1 37  ? 31.961  -25.970 4.424   1.00 17.87  ? 37  HIS A C   1 
ATOM   261   O  O   . HIS A  1 37  ? 31.496  -24.867 4.070   1.00 15.62  ? 37  HIS A O   1 
ATOM   262   C  CB  . HIS A  1 37  ? 32.800  -27.230 2.379   1.00 19.82  ? 37  HIS A CB  1 
ATOM   263   C  CG  . HIS A  1 37  ? 33.975  -27.450 1.491   1.00 31.70  ? 37  HIS A CG  1 
ATOM   264   N  ND1 . HIS A  1 37  ? 34.087  -26.866 0.253   1.00 39.95  ? 37  HIS A ND1 1 
ATOM   265   C  CD2 . HIS A  1 37  ? 35.132  -28.111 1.709   1.00 48.38  ? 37  HIS A CD2 1 
ATOM   266   C  CE1 . HIS A  1 37  ? 35.242  -27.208 -0.282  1.00 45.89  ? 37  HIS A CE1 1 
ATOM   267   N  NE2 . HIS A  1 37  ? 35.899  -27.964 0.581   1.00 49.07  ? 37  HIS A NE2 1 
ATOM   268   N  N   . ASN A  1 38  ? 31.419  -26.647 5.427   1.00 12.72  ? 38  ASN A N   1 
ATOM   269   C  CA  . ASN A  1 38  ? 30.271  -26.093 6.134   1.00 13.95  ? 38  ASN A CA  1 
ATOM   270   C  C   . ASN A  1 38  ? 30.625  -25.231 7.320   1.00 16.96  ? 38  ASN A C   1 
ATOM   271   O  O   . ASN A  1 38  ? 29.735  -24.824 8.057   1.00 14.75  ? 38  ASN A O   1 
ATOM   272   C  CB  . ASN A  1 38  ? 29.381  -27.220 6.624   1.00 14.99  ? 38  ASN A CB  1 
ATOM   273   C  CG  . ASN A  1 38  ? 29.056  -28.150 5.501   1.00 33.57  ? 38  ASN A CG  1 
ATOM   274   O  OD1 . ASN A  1 38  ? 29.552  -29.288 5.446   1.00 36.89  ? 38  ASN A OD1 1 
ATOM   275   N  ND2 . ASN A  1 38  ? 28.330  -27.618 4.520   1.00 15.68  ? 38  ASN A ND2 1 
ATOM   276   N  N   . PHE A  1 39  ? 31.912  -24.989 7.499   1.00 6.22   ? 39  PHE A N   1 
ATOM   277   C  CA  . PHE A  1 39  ? 32.393  -24.223 8.637   1.00 3.83   ? 39  PHE A CA  1 
ATOM   278   C  C   . PHE A  1 39  ? 31.606  -22.967 8.904   1.00 6.60   ? 39  PHE A C   1 
ATOM   279   O  O   . PHE A  1 39  ? 31.154  -22.736 10.018  1.00 5.77   ? 39  PHE A O   1 
ATOM   280   C  CB  . PHE A  1 39  ? 33.888  -23.853 8.533   1.00 1.00   ? 39  PHE A CB  1 
ATOM   281   C  CG  . PHE A  1 39  ? 34.395  -22.986 9.640   1.00 2.12   ? 39  PHE A CG  1 
ATOM   282   C  CD1 . PHE A  1 39  ? 34.832  -23.576 10.810  1.00 1.00   ? 39  PHE A CD1 1 
ATOM   283   C  CD2 . PHE A  1 39  ? 34.376  -21.611 9.499   1.00 4.01   ? 39  PHE A CD2 1 
ATOM   284   C  CE1 . PHE A  1 39  ? 35.254  -22.798 11.852  1.00 1.00   ? 39  PHE A CE1 1 
ATOM   285   C  CE2 . PHE A  1 39  ? 34.815  -20.796 10.522  1.00 4.61   ? 39  PHE A CE2 1 
ATOM   286   C  CZ  . PHE A  1 39  ? 35.259  -21.401 11.720  1.00 2.53   ? 39  PHE A CZ  1 
ATOM   287   N  N   . PHE A  1 40  ? 31.485  -22.125 7.888   1.00 1.45   ? 40  PHE A N   1 
ATOM   288   C  CA  . PHE A  1 40  ? 30.844  -20.871 8.220   1.00 7.83   ? 40  PHE A CA  1 
ATOM   289   C  C   . PHE A  1 40  ? 29.448  -20.966 8.820   1.00 17.09  ? 40  PHE A C   1 
ATOM   290   O  O   . PHE A  1 40  ? 29.093  -20.480 9.898   1.00 12.78  ? 40  PHE A O   1 
ATOM   291   C  CB  . PHE A  1 40  ? 30.932  -19.938 7.029   1.00 5.50   ? 40  PHE A CB  1 
ATOM   292   C  CG  . PHE A  1 40  ? 32.317  -19.447 6.746   1.00 4.39   ? 40  PHE A CG  1 
ATOM   293   C  CD1 . PHE A  1 40  ? 32.895  -18.464 7.539   1.00 1.00   ? 40  PHE A CD1 1 
ATOM   294   C  CD2 . PHE A  1 40  ? 33.036  -20.017 5.700   1.00 5.75   ? 40  PHE A CD2 1 
ATOM   295   C  CE1 . PHE A  1 40  ? 34.174  -18.050 7.252   1.00 4.98   ? 40  PHE A CE1 1 
ATOM   296   C  CE2 . PHE A  1 40  ? 34.340  -19.622 5.406   1.00 7.83   ? 40  PHE A CE2 1 
ATOM   297   C  CZ  . PHE A  1 40  ? 34.909  -18.635 6.194   1.00 2.71   ? 40  PHE A CZ  1 
ATOM   298   N  N   . THR A  1 41  ? 28.671  -21.714 8.069   1.00 13.17  ? 41  THR A N   1 
ATOM   299   C  CA  . THR A  1 41  ? 27.315  -21.931 8.493   1.00 12.70  ? 41  THR A CA  1 
ATOM   300   C  C   . THR A  1 41  ? 27.235  -22.667 9.846   1.00 11.77  ? 41  THR A C   1 
ATOM   301   O  O   . THR A  1 41  ? 26.611  -22.155 10.777  1.00 12.58  ? 41  THR A O   1 
ATOM   302   C  CB  . THR A  1 41  ? 26.534  -22.473 7.294   1.00 34.98  ? 41  THR A CB  1 
ATOM   303   O  OG1 . THR A  1 41  ? 25.300  -23.021 7.754   1.00 54.10  ? 41  THR A OG1 1 
ATOM   304   C  CG2 . THR A  1 41  ? 27.333  -23.515 6.516   1.00 68.35  ? 41  THR A CG2 1 
ATOM   305   N  N   . LEU A  1 42  ? 27.893  -23.810 10.022  1.00 7.32   ? 42  LEU A N   1 
ATOM   306   C  CA  . LEU A  1 42  ? 27.798  -24.494 11.292  1.00 4.41   ? 42  LEU A CA  1 
ATOM   307   C  C   . LEU A  1 42  ? 28.436  -23.730 12.432  1.00 10.07  ? 42  LEU A C   1 
ATOM   308   O  O   . LEU A  1 42  ? 27.984  -23.829 13.574  1.00 10.91  ? 42  LEU A O   1 
ATOM   309   C  CB  . LEU A  1 42  ? 28.388  -25.892 11.156  1.00 6.49   ? 42  LEU A CB  1 
ATOM   310   C  CG  . LEU A  1 42  ? 27.388  -27.022 10.898  1.00 11.54  ? 42  LEU A CG  1 
ATOM   311   C  CD1 . LEU A  1 42  ? 26.008  -26.495 10.490  1.00 9.01   ? 42  LEU A CD1 1 
ATOM   312   C  CD2 . LEU A  1 42  ? 27.951  -27.912 9.795   1.00 21.37  ? 42  LEU A CD2 1 
ATOM   313   N  N   . HIS A  1 43  ? 29.464  -22.947 12.114  1.00 4.00   ? 43  HIS A N   1 
ATOM   314   C  CA  . HIS A  1 43  ? 30.178  -22.171 13.133  1.00 3.35   ? 43  HIS A CA  1 
ATOM   315   C  C   . HIS A  1 43  ? 29.133  -21.249 13.766  1.00 8.17   ? 43  HIS A C   1 
ATOM   316   O  O   . HIS A  1 43  ? 28.959  -21.143 14.990  1.00 7.15   ? 43  HIS A O   1 
ATOM   317   C  CB  . HIS A  1 43  ? 31.388  -21.363 12.522  1.00 1.74   ? 43  HIS A CB  1 
ATOM   318   C  CG  . HIS A  1 43  ? 32.181  -20.591 13.537  1.00 8.89   ? 43  HIS A CG  1 
ATOM   319   N  ND1 . HIS A  1 43  ? 32.972  -21.196 14.499  1.00 10.03  ? 43  HIS A ND1 1 
ATOM   320   C  CD2 . HIS A  1 43  ? 32.276  -19.258 13.775  1.00 9.61   ? 43  HIS A CD2 1 
ATOM   321   C  CE1 . HIS A  1 43  ? 33.477  -20.275 15.300  1.00 10.81  ? 43  HIS A CE1 1 
ATOM   322   N  NE2 . HIS A  1 43  ? 33.085  -19.088 14.859  1.00 10.30  ? 43  HIS A NE2 1 
ATOM   323   N  N   . GLU A  1 44  ? 28.366  -20.611 12.893  1.00 5.95   ? 44  GLU A N   1 
ATOM   324   C  CA  . GLU A  1 44  ? 27.314  -19.725 13.382  1.00 6.61   ? 44  GLU A CA  1 
ATOM   325   C  C   . GLU A  1 44  ? 26.163  -20.463 14.062  1.00 8.30   ? 44  GLU A C   1 
ATOM   326   O  O   . GLU A  1 44  ? 25.749  -20.079 15.163  1.00 9.57   ? 44  GLU A O   1 
ATOM   327   C  CB  . GLU A  1 44  ? 26.829  -18.774 12.286  1.00 8.48   ? 44  GLU A CB  1 
ATOM   328   C  CG  . GLU A  1 44  ? 28.001  -18.008 11.660  1.00 78.64  ? 44  GLU A CG  1 
ATOM   329   C  CD  . GLU A  1 44  ? 27.683  -17.409 10.315  0.00 100.00 ? 44  GLU A CD  1 
ATOM   330   O  OE1 . GLU A  1 44  ? 26.505  -17.455 9.921   1.00 99.83  ? 44  GLU A OE1 1 
ATOM   331   O  OE2 . GLU A  1 44  ? 28.629  -16.942 9.651   0.00 100.00 ? 44  GLU A OE2 1 
ATOM   332   N  N   . LYS A  1 45  ? 25.717  -21.564 13.468  1.00 2.78   ? 45  LYS A N   1 
ATOM   333   C  CA  . LYS A  1 45  ? 24.686  -22.345 14.123  1.00 2.90   ? 45  LYS A CA  1 
ATOM   334   C  C   . LYS A  1 45  ? 25.060  -22.757 15.556  1.00 2.97   ? 45  LYS A C   1 
ATOM   335   O  O   . LYS A  1 45  ? 24.248  -22.636 16.475  1.00 4.67   ? 45  LYS A O   1 
ATOM   336   C  CB  . LYS A  1 45  ? 24.426  -23.608 13.325  1.00 6.62   ? 45  LYS A CB  1 
ATOM   337   C  CG  . LYS A  1 45  ? 23.066  -24.132 13.622  1.00 28.25  ? 45  LYS A CG  1 
ATOM   338   C  CD  . LYS A  1 45  ? 22.059  -23.239 12.927  1.00 53.14  ? 45  LYS A CD  1 
ATOM   339   C  CE  . LYS A  1 45  ? 20.652  -23.285 13.560  1.00 91.41  ? 45  LYS A CE  1 
ATOM   340   N  NZ  . LYS A  1 45  ? 19.913  -24.592 13.608  1.00 78.30  ? 45  LYS A NZ  1 
ATOM   341   N  N   . MET A  1 46  ? 26.297  -23.172 15.792  1.00 1.00   ? 46  MET A N   1 
ATOM   342   C  CA  . MET A  1 46  ? 26.660  -23.502 17.153  1.00 1.00   ? 46  MET A CA  1 
ATOM   343   C  C   . MET A  1 46  ? 26.542  -22.333 18.077  1.00 6.62   ? 46  MET A C   1 
ATOM   344   O  O   . MET A  1 46  ? 26.152  -22.501 19.215  1.00 13.55  ? 46  MET A O   1 
ATOM   345   C  CB  . MET A  1 46  ? 28.067  -24.061 17.223  1.00 1.20   ? 46  MET A CB  1 
ATOM   346   C  CG  . MET A  1 46  ? 28.261  -25.285 16.342  1.00 2.21   ? 46  MET A CG  1 
ATOM   347   S  SD  . MET A  1 46  ? 27.106  -26.622 16.798  1.00 8.53   ? 46  MET A SD  1 
ATOM   348   C  CE  . MET A  1 46  ? 25.840  -26.526 15.621  1.00 3.29   ? 46  MET A CE  1 
ATOM   349   N  N   . ASP A  1 47  ? 26.845  -21.119 17.633  1.00 3.88   ? 47  ASP A N   1 
ATOM   350   C  CA  . ASP A  1 47  ? 26.706  -19.953 18.500  1.00 9.13   ? 47  ASP A CA  1 
ATOM   351   C  C   . ASP A  1 47  ? 25.258  -19.821 18.962  1.00 7.79   ? 47  ASP A C   1 
ATOM   352   O  O   . ASP A  1 47  ? 24.898  -19.506 20.118  1.00 8.84   ? 47  ASP A O   1 
ATOM   353   C  CB  . ASP A  1 47  ? 27.173  -18.632 17.859  1.00 15.67  ? 47  ASP A CB  1 
ATOM   354   C  CG  . ASP A  1 47  ? 28.603  -18.212 18.204  1.00 77.71  ? 47  ASP A CG  1 
ATOM   355   O  OD1 . ASP A  1 47  ? 29.217  -18.923 19.125  1.00 89.74  ? 47  ASP A OD1 1 
ATOM   356   O  OD2 . ASP A  1 47  ? 29.152  -17.317 17.651  1.00 98.93  ? 47  ASP A OD2 1 
ATOM   357   N  N   . ASP A  1 48  ? 24.359  -20.104 18.027  1.00 3.90   ? 48  ASP A N   1 
ATOM   358   C  CA  . ASP A  1 48  ? 22.957  -20.032 18.328  1.00 8.65   ? 48  ASP A CA  1 
ATOM   359   C  C   . ASP A  1 48  ? 22.526  -21.112 19.328  1.00 10.83  ? 48  ASP A C   1 
ATOM   360   O  O   . ASP A  1 48  ? 21.786  -20.806 20.291  1.00 8.46   ? 48  ASP A O   1 
ATOM   361   C  CB  . ASP A  1 48  ? 22.148  -20.134 17.007  1.00 14.18  ? 48  ASP A CB  1 
ATOM   362   C  CG  . ASP A  1 48  ? 22.378  -18.909 16.059  1.00 51.64  ? 48  ASP A CG  1 
ATOM   363   O  OD1 . ASP A  1 48  ? 22.800  -17.853 16.523  1.00 54.35  ? 48  ASP A OD1 1 
ATOM   364   O  OD2 . ASP A  1 48  ? 22.137  -19.030 14.860  1.00 81.46  ? 48  ASP A OD2 1 
ATOM   365   N  N   . LEU A  1 49  ? 23.040  -22.341 19.130  1.00 4.28   ? 49  LEU A N   1 
ATOM   366   C  CA  . LEU A  1 49  ? 22.744  -23.419 20.046  1.00 4.16   ? 49  LEU A CA  1 
ATOM   367   C  C   . LEU A  1 49  ? 23.276  -23.113 21.424  1.00 2.45   ? 49  LEU A C   1 
ATOM   368   O  O   . LEU A  1 49  ? 22.625  -23.381 22.450  1.00 6.40   ? 49  LEU A O   1 
ATOM   369   C  CB  . LEU A  1 49  ? 23.394  -24.715 19.592  1.00 2.74   ? 49  LEU A CB  1 
ATOM   370   C  CG  . LEU A  1 49  ? 22.418  -25.725 19.028  1.00 7.80   ? 49  LEU A CG  1 
ATOM   371   C  CD1 . LEU A  1 49  ? 21.572  -25.071 18.043  1.00 1.79   ? 49  LEU A CD1 1 
ATOM   372   C  CD2 . LEU A  1 49  ? 23.262  -26.782 18.375  1.00 8.26   ? 49  LEU A CD2 1 
ATOM   373   N  N   . TYR A  1 50  ? 24.471  -22.552 21.462  1.00 1.00   ? 50  TYR A N   1 
ATOM   374   C  CA  . TYR A  1 50  ? 25.088  -22.253 22.724  1.00 1.90   ? 50  TYR A CA  1 
ATOM   375   C  C   . TYR A  1 50  ? 24.220  -21.299 23.538  1.00 7.53   ? 50  TYR A C   1 
ATOM   376   O  O   . TYR A  1 50  ? 24.016  -21.452 24.733  1.00 8.98   ? 50  TYR A O   1 
ATOM   377   C  CB  . TYR A  1 50  ? 26.481  -21.625 22.505  1.00 3.99   ? 50  TYR A CB  1 
ATOM   378   C  CG  . TYR A  1 50  ? 27.253  -21.405 23.790  1.00 11.08  ? 50  TYR A CG  1 
ATOM   379   C  CD1 . TYR A  1 50  ? 28.094  -22.391 24.308  1.00 16.89  ? 50  TYR A CD1 1 
ATOM   380   C  CD2 . TYR A  1 50  ? 27.140  -20.197 24.500  1.00 13.25  ? 50  TYR A CD2 1 
ATOM   381   C  CE1 . TYR A  1 50  ? 28.818  -22.178 25.496  1.00 21.36  ? 50  TYR A CE1 1 
ATOM   382   C  CE2 . TYR A  1 50  ? 27.837  -19.988 25.703  1.00 27.95  ? 50  TYR A CE2 1 
ATOM   383   C  CZ  . TYR A  1 50  ? 28.687  -20.977 26.202  1.00 37.82  ? 50  TYR A CZ  1 
ATOM   384   O  OH  . TYR A  1 50  ? 29.381  -20.729 27.388  1.00 32.02  ? 50  TYR A OH  1 
ATOM   385   N  N   . SER A  1 51  ? 23.719  -20.260 22.890  1.00 4.09   ? 51  SER A N   1 
ATOM   386   C  CA  . SER A  1 51  ? 22.897  -19.286 23.592  1.00 6.70   ? 51  SER A CA  1 
ATOM   387   C  C   . SER A  1 51  ? 21.560  -19.902 23.976  1.00 5.36   ? 51  SER A C   1 
ATOM   388   O  O   . SER A  1 51  ? 21.068  -19.748 25.090  1.00 5.39   ? 51  SER A O   1 
ATOM   389   C  CB  . SER A  1 51  ? 22.671  -18.045 22.757  1.00 5.71   ? 51  SER A CB  1 
ATOM   390   O  OG  . SER A  1 51  ? 23.894  -17.422 22.450  1.00 55.83  ? 51  SER A OG  1 
ATOM   391   N  N   . GLU A  1 52  ? 20.965  -20.650 23.070  1.00 1.00   ? 52  GLU A N   1 
ATOM   392   C  CA  . GLU A  1 52  ? 19.713  -21.238 23.473  1.00 1.26   ? 52  GLU A CA  1 
ATOM   393   C  C   . GLU A  1 52  ? 19.826  -22.195 24.635  1.00 5.42   ? 52  GLU A C   1 
ATOM   394   O  O   . GLU A  1 52  ? 19.022  -22.167 25.579  1.00 3.54   ? 52  GLU A O   1 
ATOM   395   C  CB  . GLU A  1 52  ? 19.214  -22.049 22.287  1.00 1.80   ? 52  GLU A CB  1 
ATOM   396   C  CG  . GLU A  1 52  ? 18.026  -22.881 22.742  1.00 17.84  ? 52  GLU A CG  1 
ATOM   397   C  CD  . GLU A  1 52  ? 17.273  -23.488 21.594  1.00 55.24  ? 52  GLU A CD  1 
ATOM   398   O  OE1 . GLU A  1 52  ? 17.822  -23.533 20.473  1.00 21.25  ? 52  GLU A OE1 1 
ATOM   399   O  OE2 . GLU A  1 52  ? 16.099  -23.833 21.815  1.00 27.72  ? 52  GLU A OE2 1 
ATOM   400   N  N   . PHE A  1 53  ? 20.813  -23.084 24.562  1.00 3.13   ? 53  PHE A N   1 
ATOM   401   C  CA  . PHE A  1 53  ? 20.979  -24.052 25.632  1.00 3.03   ? 53  PHE A CA  1 
ATOM   402   C  C   . PHE A  1 53  ? 21.388  -23.433 26.950  1.00 4.60   ? 53  PHE A C   1 
ATOM   403   O  O   . PHE A  1 53  ? 20.986  -23.863 28.021  1.00 5.23   ? 53  PHE A O   1 
ATOM   404   C  CB  . PHE A  1 53  ? 21.622  -25.373 25.219  1.00 1.00   ? 53  PHE A CB  1 
ATOM   405   C  CG  . PHE A  1 53  ? 20.755  -26.169 24.280  1.00 1.84   ? 53  PHE A CG  1 
ATOM   406   C  CD1 . PHE A  1 53  ? 20.764  -25.912 22.932  1.00 2.37   ? 53  PHE A CD1 1 
ATOM   407   C  CD2 . PHE A  1 53  ? 19.802  -27.045 24.774  1.00 1.90   ? 53  PHE A CD2 1 
ATOM   408   C  CE1 . PHE A  1 53  ? 19.907  -26.561 22.090  1.00 3.31   ? 53  PHE A CE1 1 
ATOM   409   C  CE2 . PHE A  1 53  ? 18.939  -27.717 23.939  1.00 6.59   ? 53  PHE A CE2 1 
ATOM   410   C  CZ  . PHE A  1 53  ? 18.977  -27.456 22.590  1.00 6.58   ? 53  PHE A CZ  1 
ATOM   411   N  N   . GLY A  1 54  ? 22.104  -22.333 26.835  1.00 1.00   ? 54  GLY A N   1 
ATOM   412   C  CA  . GLY A  1 54  ? 22.503  -21.621 28.029  1.00 1.00   ? 54  GLY A CA  1 
ATOM   413   C  C   . GLY A  1 54  ? 21.266  -20.995 28.661  1.00 5.76   ? 54  GLY A C   1 
ATOM   414   O  O   . GLY A  1 54  ? 21.126  -20.883 29.882  1.00 5.87   ? 54  GLY A O   1 
ATOM   415   N  N   . GLU A  1 55  ? 20.326  -20.558 27.845  1.00 3.78   ? 55  GLU A N   1 
ATOM   416   C  CA  . GLU A  1 55  ? 19.146  -19.983 28.459  1.00 7.13   ? 55  GLU A CA  1 
ATOM   417   C  C   . GLU A  1 55  ? 18.290  -21.112 29.073  1.00 9.03   ? 55  GLU A C   1 
ATOM   418   O  O   . GLU A  1 55  ? 17.740  -20.886 30.147  1.00 12.67  ? 55  GLU A O   1 
ATOM   419   C  CB  . GLU A  1 55  ? 18.320  -19.202 27.426  1.00 12.64  ? 55  GLU A CB  1 
ATOM   420   C  CG  . GLU A  1 55  ? 18.758  -17.810 27.003  1.00 68.00  ? 55  GLU A CG  1 
ATOM   421   C  CD  . GLU A  1 55  ? 17.794  -17.156 26.042  0.00 100.00 ? 55  GLU A CD  1 
ATOM   422   O  OE1 . GLU A  1 55  ? 16.762  -17.758 25.705  0.00 100.00 ? 55  GLU A OE1 1 
ATOM   423   O  OE2 . GLU A  1 55  ? 18.072  -16.022 25.617  0.00 100.00 ? 55  GLU A OE2 1 
ATOM   424   N  N   . GLN A  1 56  ? 18.145  -22.290 28.449  1.00 4.91   ? 56  GLN A N   1 
ATOM   425   C  CA  . GLN A  1 56  ? 17.365  -23.385 29.056  1.00 4.66   ? 56  GLN A CA  1 
ATOM   426   C  C   . GLN A  1 56  ? 17.928  -23.654 30.456  1.00 4.36   ? 56  GLN A C   1 
ATOM   427   O  O   . GLN A  1 56  ? 17.240  -23.827 31.454  1.00 3.04   ? 56  GLN A O   1 
ATOM   428   C  CB  . GLN A  1 56  ? 17.503  -24.700 28.292  1.00 4.24   ? 56  GLN A CB  1 
ATOM   429   C  CG  . GLN A  1 56  ? 16.598  -24.789 27.102  1.00 17.12  ? 56  GLN A CG  1 
ATOM   430   C  CD  . GLN A  1 56  ? 16.438  -26.170 26.493  1.00 27.45  ? 56  GLN A CD  1 
ATOM   431   O  OE1 . GLN A  1 56  ? 16.778  -27.184 27.102  1.00 12.30  ? 56  GLN A OE1 1 
ATOM   432   N  NE2 . GLN A  1 56  ? 15.882  -26.196 25.281  1.00 12.28  ? 56  GLN A NE2 1 
ATOM   433   N  N   . MET A  1 57  ? 19.251  -23.649 30.493  1.00 1.00   ? 57  MET A N   1 
ATOM   434   C  CA  . MET A  1 57  ? 19.997  -23.951 31.687  1.00 1.00   ? 57  MET A CA  1 
ATOM   435   C  C   . MET A  1 57  ? 19.681  -22.935 32.753  1.00 3.74   ? 57  MET A C   1 
ATOM   436   O  O   . MET A  1 57  ? 19.284  -23.306 33.841  1.00 11.70  ? 57  MET A O   1 
ATOM   437   C  CB  . MET A  1 57  ? 21.480  -24.036 31.367  1.00 3.40   ? 57  MET A CB  1 
ATOM   438   C  CG  . MET A  1 57  ? 22.346  -24.693 32.437  1.00 8.82   ? 57  MET A CG  1 
ATOM   439   S  SD  . MET A  1 57  ? 22.801  -23.456 33.692  1.00 16.23  ? 57  MET A SD  1 
ATOM   440   C  CE  . MET A  1 57  ? 24.083  -22.577 32.777  1.00 7.47   ? 57  MET A CE  1 
ATOM   441   N  N   . ASP A  1 58  ? 19.782  -21.651 32.468  1.00 1.30   ? 58  ASP A N   1 
ATOM   442   C  CA  . ASP A  1 58  ? 19.416  -20.691 33.513  1.00 3.12   ? 58  ASP A CA  1 
ATOM   443   C  C   . ASP A  1 58  ? 17.964  -20.836 34.012  1.00 3.89   ? 58  ASP A C   1 
ATOM   444   O  O   . ASP A  1 58  ? 17.677  -20.644 35.206  1.00 2.11   ? 58  ASP A O   1 
ATOM   445   C  CB  . ASP A  1 58  ? 19.702  -19.237 33.103  1.00 5.43   ? 58  ASP A CB  1 
ATOM   446   C  CG  . ASP A  1 58  ? 19.758  -18.274 34.300  1.00 16.07  ? 58  ASP A CG  1 
ATOM   447   O  OD1 . ASP A  1 58  ? 20.601  -18.467 35.212  1.00 23.84  ? 58  ASP A OD1 1 
ATOM   448   O  OD2 . ASP A  1 58  ? 19.089  -17.224 34.240  1.00 18.84  ? 58  ASP A OD2 1 
ATOM   449   N  N   . GLU A  1 59  ? 17.073  -21.195 33.075  1.00 5.09   ? 59  GLU A N   1 
ATOM   450   C  CA  . GLU A  1 59  ? 15.621  -21.308 33.338  1.00 5.58   ? 59  GLU A CA  1 
ATOM   451   C  C   . GLU A  1 59  ? 15.333  -22.555 34.150  1.00 4.73   ? 59  GLU A C   1 
ATOM   452   O  O   . GLU A  1 59  ? 14.525  -22.538 35.068  1.00 3.97   ? 59  GLU A O   1 
ATOM   453   C  CB  . GLU A  1 59  ? 14.743  -21.362 32.072  1.00 8.47   ? 59  GLU A CB  1 
ATOM   454   C  CG  . GLU A  1 59  ? 14.567  -20.099 31.238  1.00 47.83  ? 59  GLU A CG  1 
ATOM   455   C  CD  . GLU A  1 59  ? 13.616  -20.255 30.070  0.00 100.00 ? 59  GLU A CD  1 
ATOM   456   O  OE1 . GLU A  1 59  ? 12.587  -20.932 30.220  1.00 99.99  ? 59  GLU A OE1 1 
ATOM   457   O  OE2 . GLU A  1 59  ? 13.848  -19.647 29.005  0.00 100.00 ? 59  GLU A OE2 1 
ATOM   458   N  N   . VAL A  1 60  ? 16.021  -23.628 33.798  1.00 2.18   ? 60  VAL A N   1 
ATOM   459   C  CA  . VAL A  1 60  ? 15.824  -24.812 34.605  1.00 1.98   ? 60  VAL A CA  1 
ATOM   460   C  C   . VAL A  1 60  ? 16.288  -24.492 36.014  1.00 3.41   ? 60  VAL A C   1 
ATOM   461   O  O   . VAL A  1 60  ? 15.561  -24.724 36.972  1.00 7.19   ? 60  VAL A O   1 
ATOM   462   C  CB  . VAL A  1 60  ? 16.695  -25.908 34.019  1.00 4.92   ? 60  VAL A CB  1 
ATOM   463   C  CG1 . VAL A  1 60  ? 16.822  -27.047 35.007  1.00 3.11   ? 60  VAL A CG1 1 
ATOM   464   C  CG2 . VAL A  1 60  ? 16.052  -26.368 32.703  1.00 2.02   ? 60  VAL A CG2 1 
ATOM   465   N  N   . ALA A  1 61  ? 17.490  -23.949 36.187  1.00 1.42   ? 61  ALA A N   1 
ATOM   466   C  CA  . ALA A  1 61  ? 18.022  -23.654 37.511  1.00 1.00   ? 61  ALA A CA  1 
ATOM   467   C  C   . ALA A  1 61  ? 17.091  -22.700 38.238  1.00 8.33   ? 61  ALA A C   1 
ATOM   468   O  O   . ALA A  1 61  ? 16.822  -22.871 39.422  1.00 7.51   ? 61  ALA A O   1 
ATOM   469   C  CB  . ALA A  1 61  ? 19.406  -23.035 37.401  1.00 1.00   ? 61  ALA A CB  1 
ATOM   470   N  N   . GLU A  1 62  ? 16.615  -21.648 37.580  1.00 4.34   ? 62  GLU A N   1 
ATOM   471   C  CA  . GLU A  1 62  ? 15.704  -20.729 38.275  1.00 2.09   ? 62  GLU A CA  1 
ATOM   472   C  C   . GLU A  1 62  ? 14.355  -21.312 38.639  1.00 7.45   ? 62  GLU A C   1 
ATOM   473   O  O   . GLU A  1 62  ? 13.781  -20.973 39.669  1.00 7.22   ? 62  GLU A O   1 
ATOM   474   C  CB  . GLU A  1 62  ? 15.684  -19.369 37.604  1.00 2.41   ? 62  GLU A CB  1 
ATOM   475   C  CG  . GLU A  1 62  ? 17.104  -18.715 37.535  1.00 10.01  ? 62  GLU A CG  1 
ATOM   476   C  CD  . GLU A  1 62  ? 17.184  -17.314 36.855  1.00 11.69  ? 62  GLU A CD  1 
ATOM   477   O  OE1 . GLU A  1 62  ? 16.175  -16.809 36.292  1.00 43.01  ? 62  GLU A OE1 1 
ATOM   478   O  OE2 . GLU A  1 62  ? 18.307  -16.737 36.864  1.00 22.82  ? 62  GLU A OE2 1 
ATOM   479   N  N   . ARG A  1 63  ? 13.875  -22.257 37.846  1.00 2.54   ? 63  ARG A N   1 
ATOM   480   C  CA  . ARG A  1 63  ? 12.630  -22.937 38.156  1.00 2.61   ? 63  ARG A CA  1 
ATOM   481   C  C   . ARG A  1 63  ? 12.909  -23.778 39.369  1.00 7.53   ? 63  ARG A C   1 
ATOM   482   O  O   . ARG A  1 63  ? 12.133  -23.771 40.313  1.00 6.65   ? 63  ARG A O   1 
ATOM   483   C  CB  . ARG A  1 63  ? 12.222  -23.856 37.002  1.00 1.37   ? 63  ARG A CB  1 
ATOM   484   C  CG  . ARG A  1 63  ? 10.970  -24.673 37.288  1.00 1.00   ? 63  ARG A CG  1 
ATOM   485   C  CD  . ARG A  1 63  ? 9.772   -23.763 37.706  1.00 2.26   ? 63  ARG A CD  1 
ATOM   486   N  NE  . ARG A  1 63  ? 8.605   -24.538 38.134  1.00 5.96   ? 63  ARG A NE  1 
ATOM   487   C  CZ  . ARG A  1 63  ? 7.567   -24.050 38.800  1.00 7.34   ? 63  ARG A CZ  1 
ATOM   488   N  NH1 . ARG A  1 63  ? 7.531   -22.773 39.150  1.00 2.44   ? 63  ARG A NH1 1 
ATOM   489   N  NH2 . ARG A  1 63  ? 6.599   -24.876 39.167  1.00 2.23   ? 63  ARG A NH2 1 
ATOM   490   N  N   . LEU A  1 64  ? 14.044  -24.454 39.414  1.00 1.00   ? 64  LEU A N   1 
ATOM   491   C  CA  . LEU A  1 64  ? 14.359  -25.249 40.595  1.00 2.72   ? 64  LEU A CA  1 
ATOM   492   C  C   . LEU A  1 64  ? 14.327  -24.402 41.867  1.00 11.85  ? 64  LEU A C   1 
ATOM   493   O  O   . LEU A  1 64  ? 13.731  -24.714 42.909  1.00 11.15  ? 64  LEU A O   1 
ATOM   494   C  CB  . LEU A  1 64  ? 15.768  -25.802 40.454  1.00 1.67   ? 64  LEU A CB  1 
ATOM   495   C  CG  . LEU A  1 64  ? 16.299  -26.655 41.616  1.00 9.64   ? 64  LEU A CG  1 
ATOM   496   C  CD1 . LEU A  1 64  ? 15.335  -27.793 41.961  1.00 5.19   ? 64  LEU A CD1 1 
ATOM   497   C  CD2 . LEU A  1 64  ? 17.555  -27.336 41.160  1.00 2.65   ? 64  LEU A CD2 1 
ATOM   498   N  N   . LEU A  1 65  ? 15.024  -23.290 41.752  1.00 3.91   ? 65  LEU A N   1 
ATOM   499   C  CA  . LEU A  1 65  ? 15.193  -22.366 42.862  1.00 3.77   ? 65  LEU A CA  1 
ATOM   500   C  C   . LEU A  1 65  ? 13.798  -21.970 43.257  1.00 9.24   ? 65  LEU A C   1 
ATOM   501   O  O   . LEU A  1 65  ? 13.455  -21.986 44.434  1.00 5.53   ? 65  LEU A O   1 
ATOM   502   C  CB  . LEU A  1 65  ? 15.920  -21.153 42.311  1.00 3.63   ? 65  LEU A CB  1 
ATOM   503   C  CG  . LEU A  1 65  ? 17.058  -20.361 42.942  1.00 9.82   ? 65  LEU A CG  1 
ATOM   504   C  CD1 . LEU A  1 65  ? 17.912  -21.359 43.667  1.00 1.38   ? 65  LEU A CD1 1 
ATOM   505   C  CD2 . LEU A  1 65  ? 17.826  -19.929 41.724  1.00 1.26   ? 65  LEU A CD2 1 
ATOM   506   N  N   . ALA A  1 66  ? 12.958  -21.716 42.266  1.00 6.30   ? 66  ALA A N   1 
ATOM   507   C  CA  . ALA A  1 66  ? 11.594  -21.314 42.597  1.00 5.55   ? 66  ALA A CA  1 
ATOM   508   C  C   . ALA A  1 66  ? 10.716  -22.331 43.317  1.00 11.55  ? 66  ALA A C   1 
ATOM   509   O  O   . ALA A  1 66  ? 9.768   -21.954 44.006  1.00 5.54   ? 66  ALA A O   1 
ATOM   510   C  CB  . ALA A  1 66  ? 10.891  -20.844 41.340  1.00 6.01   ? 66  ALA A CB  1 
ATOM   511   N  N   . ILE A  1 67  ? 10.980  -23.609 43.078  1.00 9.67   ? 67  ILE A N   1 
ATOM   512   C  CA  . ILE A  1 67  ? 10.188  -24.627 43.736  1.00 6.83   ? 67  ILE A CA  1 
ATOM   513   C  C   . ILE A  1 67  ? 10.857  -25.009 45.033  1.00 17.16  ? 67  ILE A C   1 
ATOM   514   O  O   . ILE A  1 67  ? 10.568  -26.057 45.595  1.00 14.60  ? 67  ILE A O   1 
ATOM   515   C  CB  . ILE A  1 67  ? 9.919   -25.867 42.893  1.00 7.14   ? 67  ILE A CB  1 
ATOM   516   C  CG1 . ILE A  1 67  ? 11.200  -26.576 42.471  1.00 5.60   ? 67  ILE A CG1 1 
ATOM   517   C  CG2 . ILE A  1 67  ? 8.997   -25.517 41.756  1.00 3.39   ? 67  ILE A CG2 1 
ATOM   518   C  CD1 . ILE A  1 67  ? 10.971  -27.759 41.553  1.00 28.45  ? 67  ILE A CD1 1 
ATOM   519   N  N   . GLY A  1 68  ? 11.789  -24.172 45.472  1.00 7.14   ? 68  GLY A N   1 
ATOM   520   C  CA  . GLY A  1 68  ? 12.501  -24.439 46.714  1.00 1.09   ? 68  GLY A CA  1 
ATOM   521   C  C   . GLY A  1 68  ? 13.745  -25.311 46.622  1.00 12.54  ? 68  GLY A C   1 
ATOM   522   O  O   . GLY A  1 68  ? 14.262  -25.741 47.667  1.00 20.08  ? 68  GLY A O   1 
ATOM   523   N  N   . GLY A  1 69  ? 14.242  -25.544 45.410  1.00 8.20   ? 69  GLY A N   1 
ATOM   524   C  CA  . GLY A  1 69  ? 15.463  -26.343 45.225  1.00 1.63   ? 69  GLY A CA  1 
ATOM   525   C  C   . GLY A  1 69  ? 16.795  -25.557 45.307  1.00 6.63   ? 69  GLY A C   1 
ATOM   526   O  O   . GLY A  1 69  ? 16.816  -24.339 45.560  1.00 7.15   ? 69  GLY A O   1 
ATOM   527   N  N   . SER A  1 70  ? 17.920  -26.241 45.066  1.00 4.94   ? 70  SER A N   1 
ATOM   528   C  CA  . SER A  1 70  ? 19.231  -25.599 45.150  1.00 8.03   ? 70  SER A CA  1 
ATOM   529   C  C   . SER A  1 70  ? 20.084  -26.182 44.049  1.00 16.32  ? 70  SER A C   1 
ATOM   530   O  O   . SER A  1 70  ? 20.549  -27.303 44.141  1.00 21.12  ? 70  SER A O   1 
ATOM   531   C  CB  . SER A  1 70  ? 19.875  -26.029 46.465  1.00 12.17  ? 70  SER A CB  1 
ATOM   532   O  OG  . SER A  1 70  ? 19.140  -25.489 47.546  1.00 34.05  ? 70  SER A OG  1 
ATOM   533   N  N   . PRO A  1 71  ? 20.291  -25.409 42.998  1.00 12.75  ? 71  PRO A N   1 
ATOM   534   C  CA  . PRO A  1 71  ? 20.949  -25.940 41.826  1.00 10.46  ? 71  PRO A CA  1 
ATOM   535   C  C   . PRO A  1 71  ? 22.379  -26.209 42.067  1.00 9.08   ? 71  PRO A C   1 
ATOM   536   O  O   . PRO A  1 71  ? 22.957  -25.435 42.792  1.00 5.24   ? 71  PRO A O   1 
ATOM   537   C  CB  . PRO A  1 71  ? 20.884  -24.780 40.858  1.00 9.87   ? 71  PRO A CB  1 
ATOM   538   C  CG  . PRO A  1 71  ? 20.726  -23.577 41.692  1.00 13.78  ? 71  PRO A CG  1 
ATOM   539   C  CD  . PRO A  1 71  ? 19.952  -23.983 42.862  1.00 6.46   ? 71  PRO A CD  1 
ATOM   540   N  N   . PHE A  1 72  ? 22.923  -27.219 41.400  1.00 7.05   ? 72  PHE A N   1 
ATOM   541   C  CA  . PHE A  1 72  ? 24.368  -27.483 41.416  1.00 5.35   ? 72  PHE A CA  1 
ATOM   542   C  C   . PHE A  1 72  ? 25.016  -26.230 40.829  1.00 13.72  ? 72  PHE A C   1 
ATOM   543   O  O   . PHE A  1 72  ? 24.469  -25.604 39.914  1.00 10.77  ? 72  PHE A O   1 
ATOM   544   C  CB  . PHE A  1 72  ? 24.759  -28.589 40.434  1.00 5.13   ? 72  PHE A CB  1 
ATOM   545   C  CG  . PHE A  1 72  ? 24.209  -29.923 40.809  1.00 8.32   ? 72  PHE A CG  1 
ATOM   546   C  CD1 . PHE A  1 72  ? 24.324  -30.371 42.111  1.00 14.41  ? 72  PHE A CD1 1 
ATOM   547   C  CD2 . PHE A  1 72  ? 23.488  -30.674 39.900  1.00 9.73   ? 72  PHE A CD2 1 
ATOM   548   C  CE1 . PHE A  1 72  ? 23.796  -31.615 42.484  1.00 18.87  ? 72  PHE A CE1 1 
ATOM   549   C  CE2 . PHE A  1 72  ? 22.945  -31.885 40.249  1.00 11.87  ? 72  PHE A CE2 1 
ATOM   550   C  CZ  . PHE A  1 72  ? 23.089  -32.361 41.554  1.00 14.13  ? 72  PHE A CZ  1 
ATOM   551   N  N   . SER A  1 73  ? 26.202  -25.887 41.293  1.00 5.01   ? 73  SER A N   1 
ATOM   552   C  CA  . SER A  1 73  ? 26.760  -24.680 40.729  1.00 3.05   ? 73  SER A CA  1 
ATOM   553   C  C   . SER A  1 73  ? 28.266  -24.597 40.741  1.00 6.84   ? 73  SER A C   1 
ATOM   554   O  O   . SER A  1 73  ? 28.845  -23.601 41.160  1.00 5.57   ? 73  SER A O   1 
ATOM   555   C  CB  . SER A  1 73  ? 26.174  -23.509 41.495  1.00 6.05   ? 73  SER A CB  1 
ATOM   556   O  OG  . SER A  1 73  ? 26.512  -23.588 42.857  1.00 12.72  ? 73  SER A OG  1 
ATOM   557   N  N   . THR A  1 74  ? 28.890  -25.666 40.272  1.00 3.34   ? 74  THR A N   1 
ATOM   558   C  CA  . THR A  1 74  ? 30.334  -25.775 40.185  1.00 3.46   ? 74  THR A CA  1 
ATOM   559   C  C   . THR A  1 74  ? 30.531  -26.887 39.154  1.00 6.85   ? 74  THR A C   1 
ATOM   560   O  O   . THR A  1 74  ? 29.740  -27.845 39.103  1.00 10.37  ? 74  THR A O   1 
ATOM   561   C  CB  . THR A  1 74  ? 30.954  -26.296 41.498  1.00 10.92  ? 74  THR A CB  1 
ATOM   562   O  OG1 . THR A  1 74  ? 30.478  -27.618 41.825  1.00 12.73  ? 74  THR A OG1 1 
ATOM   563   C  CG2 . THR A  1 74  ? 30.735  -25.310 42.639  1.00 5.39   ? 74  THR A CG2 1 
ATOM   564   N  N   . LEU A  1 75  ? 31.609  -26.783 38.375  1.00 4.91   ? 75  LEU A N   1 
ATOM   565   C  CA  . LEU A  1 75  ? 31.935  -27.787 37.353  1.00 7.01   ? 75  LEU A CA  1 
ATOM   566   C  C   . LEU A  1 75  ? 32.000  -29.165 37.978  1.00 10.80  ? 75  LEU A C   1 
ATOM   567   O  O   . LEU A  1 75  ? 31.619  -30.169 37.392  1.00 14.60  ? 75  LEU A O   1 
ATOM   568   C  CB  . LEU A  1 75  ? 33.275  -27.494 36.652  1.00 7.99   ? 75  LEU A CB  1 
ATOM   569   C  CG  . LEU A  1 75  ? 33.327  -26.283 35.714  1.00 14.05  ? 75  LEU A CG  1 
ATOM   570   C  CD1 . LEU A  1 75  ? 33.057  -25.064 36.569  1.00 16.87  ? 75  LEU A CD1 1 
ATOM   571   C  CD2 . LEU A  1 75  ? 34.670  -26.143 35.034  1.00 8.64   ? 75  LEU A CD2 1 
ATOM   572   N  N   . LYS A  1 76  ? 32.537  -29.199 39.179  1.00 10.59  ? 76  LYS A N   1 
ATOM   573   C  CA  . LYS A  1 76  ? 32.703  -30.467 39.835  1.00 10.78  ? 76  LYS A CA  1 
ATOM   574   C  C   . LYS A  1 76  ? 31.342  -31.099 40.025  1.00 11.35  ? 76  LYS A C   1 
ATOM   575   O  O   . LYS A  1 76  ? 31.134  -32.245 39.617  1.00 11.30  ? 76  LYS A O   1 
ATOM   576   C  CB  . LYS A  1 76  ? 33.406  -30.272 41.164  1.00 14.73  ? 76  LYS A CB  1 
ATOM   577   C  CG  . LYS A  1 76  ? 33.580  -31.561 41.972  1.00 50.19  ? 76  LYS A CG  1 
ATOM   578   C  CD  . LYS A  1 76  ? 34.543  -31.352 43.149  1.00 99.44  ? 76  LYS A CD  1 
ATOM   579   C  CE  . LYS A  1 76  ? 34.697  -32.592 44.021  1.00 99.98  ? 76  LYS A CE  1 
ATOM   580   N  NZ  . LYS A  1 76  ? 33.439  -32.867 44.749  0.00 100.00 ? 76  LYS A NZ  1 
ATOM   581   N  N   . GLU A  1 77  ? 30.388  -30.348 40.561  1.00 7.49   ? 77  GLU A N   1 
ATOM   582   C  CA  . GLU A  1 77  ? 29.071  -30.940 40.687  1.00 7.11   ? 77  GLU A CA  1 
ATOM   583   C  C   . GLU A  1 77  ? 28.509  -31.294 39.314  1.00 10.30  ? 77  GLU A C   1 
ATOM   584   O  O   . GLU A  1 77  ? 27.897  -32.341 39.137  1.00 10.09  ? 77  GLU A O   1 
ATOM   585   C  CB  . GLU A  1 77  ? 28.136  -29.974 41.388  1.00 8.77   ? 77  GLU A CB  1 
ATOM   586   C  CG  . GLU A  1 77  ? 28.402  -29.762 42.875  1.00 11.96  ? 77  GLU A CG  1 
ATOM   587   C  CD  . GLU A  1 77  ? 27.712  -28.522 43.439  1.00 34.80  ? 77  GLU A CD  1 
ATOM   588   O  OE1 . GLU A  1 77  ? 27.962  -27.378 43.001  1.00 27.87  ? 77  GLU A OE1 1 
ATOM   589   O  OE2 . GLU A  1 77  ? 26.849  -28.717 44.314  1.00 30.62  ? 77  GLU A OE2 1 
ATOM   590   N  N   . PHE A  1 78  ? 28.697  -30.450 38.310  1.00 7.69   ? 78  PHE A N   1 
ATOM   591   C  CA  . PHE A  1 78  ? 28.126  -30.813 37.022  1.00 6.71   ? 78  PHE A CA  1 
ATOM   592   C  C   . PHE A  1 78  ? 28.756  -32.104 36.592  1.00 11.69  ? 78  PHE A C   1 
ATOM   593   O  O   . PHE A  1 78  ? 28.077  -33.039 36.215  1.00 12.58  ? 78  PHE A O   1 
ATOM   594   C  CB  . PHE A  1 78  ? 28.334  -29.765 35.936  1.00 6.14   ? 78  PHE A CB  1 
ATOM   595   C  CG  . PHE A  1 78  ? 27.828  -28.402 36.315  1.00 5.10   ? 78  PHE A CG  1 
ATOM   596   C  CD1 . PHE A  1 78  ? 26.718  -28.247 37.138  1.00 4.07   ? 78  PHE A CD1 1 
ATOM   597   C  CD2 . PHE A  1 78  ? 28.482  -27.245 35.893  1.00 4.81   ? 78  PHE A CD2 1 
ATOM   598   C  CE1 . PHE A  1 78  ? 26.219  -26.972 37.492  1.00 6.99   ? 78  PHE A CE1 1 
ATOM   599   C  CE2 . PHE A  1 78  ? 28.019  -25.966 36.256  1.00 2.19   ? 78  PHE A CE2 1 
ATOM   600   C  CZ  . PHE A  1 78  ? 26.896  -25.833 37.084  1.00 4.55   ? 78  PHE A CZ  1 
ATOM   601   N  N   . LEU A  1 79  ? 30.071  -32.186 36.695  1.00 8.12   ? 79  LEU A N   1 
ATOM   602   C  CA  . LEU A  1 79  ? 30.774  -33.400 36.267  1.00 14.05  ? 79  LEU A CA  1 
ATOM   603   C  C   . LEU A  1 79  ? 30.275  -34.641 36.978  1.00 22.02  ? 79  LEU A C   1 
ATOM   604   O  O   . LEU A  1 79  ? 30.058  -35.708 36.379  1.00 18.46  ? 79  LEU A O   1 
ATOM   605   C  CB  . LEU A  1 79  ? 32.268  -33.258 36.520  1.00 15.59  ? 79  LEU A CB  1 
ATOM   606   C  CG  . LEU A  1 79  ? 32.852  -32.713 35.222  1.00 25.01  ? 79  LEU A CG  1 
ATOM   607   C  CD1 . LEU A  1 79  ? 34.355  -32.587 35.330  1.00 19.48  ? 79  LEU A CD1 1 
ATOM   608   C  CD2 . LEU A  1 79  ? 32.472  -33.646 34.076  1.00 27.23  ? 79  LEU A CD2 1 
ATOM   609   N  N   . GLU A  1 80  ? 30.075  -34.467 38.282  1.00 16.13  ? 80  GLU A N   1 
ATOM   610   C  CA  . GLU A  1 80  ? 29.568  -35.584 39.055  1.00 17.50  ? 80  GLU A CA  1 
ATOM   611   C  C   . GLU A  1 80  ? 28.133  -35.975 38.732  1.00 25.86  ? 80  GLU A C   1 
ATOM   612   O  O   . GLU A  1 80  ? 27.740  -37.118 38.981  1.00 38.34  ? 80  GLU A O   1 
ATOM   613   C  CB  . GLU A  1 80  ? 29.628  -35.269 40.552  1.00 18.09  ? 80  GLU A CB  1 
ATOM   614   C  CG  . GLU A  1 80  ? 31.048  -34.997 40.980  1.00 63.40  ? 80  GLU A CG  1 
ATOM   615   C  CD  . GLU A  1 80  ? 31.166  -34.638 42.426  0.00 100.00 ? 80  GLU A CD  1 
ATOM   616   O  OE1 . GLU A  1 80  ? 30.169  -34.194 43.020  1.00 99.73  ? 80  GLU A OE1 1 
ATOM   617   O  OE2 . GLU A  1 80  ? 32.284  -34.744 42.951  0.00 100.00 ? 80  GLU A OE2 1 
ATOM   618   N  N   . ASN A  1 81  ? 27.299  -35.068 38.240  1.00 12.43  ? 81  ASN A N   1 
ATOM   619   C  CA  . ASN A  1 81  ? 25.913  -35.483 38.041  1.00 11.11  ? 81  ASN A CA  1 
ATOM   620   C  C   . ASN A  1 81  ? 25.410  -35.661 36.626  1.00 13.65  ? 81  ASN A C   1 
ATOM   621   O  O   . ASN A  1 81  ? 24.332  -36.190 36.413  1.00 18.73  ? 81  ASN A O   1 
ATOM   622   C  CB  . ASN A  1 81  ? 24.978  -34.547 38.813  1.00 15.10  ? 81  ASN A CB  1 
ATOM   623   C  CG  . ASN A  1 81  ? 25.262  -34.528 40.304  1.00 14.17  ? 81  ASN A CG  1 
ATOM   624   O  OD1 . ASN A  1 81  ? 26.167  -33.843 40.770  1.00 21.58  ? 81  ASN A OD1 1 
ATOM   625   N  ND2 . ASN A  1 81  ? 24.469  -35.268 41.068  1.00 14.70  ? 81  ASN A ND2 1 
ATOM   626   N  N   . ALA A  1 82  ? 26.136  -35.148 35.647  1.00 13.33  ? 82  ALA A N   1 
ATOM   627   C  CA  . ALA A  1 82  ? 25.633  -35.212 34.297  1.00 12.84  ? 82  ALA A CA  1 
ATOM   628   C  C   . ALA A  1 82  ? 25.515  -36.591 33.741  1.00 16.58  ? 82  ALA A C   1 
ATOM   629   O  O   . ALA A  1 82  ? 26.359  -37.427 33.978  1.00 20.60  ? 82  ALA A O   1 
ATOM   630   C  CB  . ALA A  1 82  ? 26.564  -34.427 33.423  1.00 12.64  ? 82  ALA A CB  1 
ATOM   631   N  N   . SER A  1 83  ? 24.522  -36.802 32.902  1.00 6.01   ? 83  SER A N   1 
ATOM   632   C  CA  . SER A  1 83  ? 24.427  -38.066 32.190  1.00 4.58   ? 83  SER A CA  1 
ATOM   633   C  C   . SER A  1 83  ? 25.006  -37.824 30.786  1.00 14.71  ? 83  SER A C   1 
ATOM   634   O  O   . SER A  1 83  ? 25.329  -38.770 30.051  1.00 17.07  ? 83  SER A O   1 
ATOM   635   C  CB  . SER A  1 83  ? 22.984  -38.583 32.190  1.00 4.40   ? 83  SER A CB  1 
ATOM   636   O  OG  . SER A  1 83  ? 22.076  -37.578 31.782  1.00 25.86  ? 83  SER A OG  1 
ATOM   637   N  N   . VAL A  1 84  ? 25.133  -36.550 30.410  1.00 12.39  ? 84  VAL A N   1 
ATOM   638   C  CA  . VAL A  1 84  ? 25.705  -36.177 29.113  1.00 9.17   ? 84  VAL A CA  1 
ATOM   639   C  C   . VAL A  1 84  ? 27.209  -36.469 29.154  1.00 13.12  ? 84  VAL A C   1 
ATOM   640   O  O   . VAL A  1 84  ? 27.888  -36.198 30.154  1.00 12.56  ? 84  VAL A O   1 
ATOM   641   C  CB  . VAL A  1 84  ? 25.486  -34.682 28.813  1.00 5.88   ? 84  VAL A CB  1 
ATOM   642   C  CG1 . VAL A  1 84  ? 26.265  -34.254 27.591  1.00 6.14   ? 84  VAL A CG1 1 
ATOM   643   C  CG2 . VAL A  1 84  ? 24.037  -34.445 28.528  1.00 4.12   ? 84  VAL A CG2 1 
ATOM   644   N  N   . GLU A  1 85  ? 27.744  -37.078 28.104  1.00 20.35  ? 85  GLU A N   1 
ATOM   645   C  CA  . GLU A  1 85  ? 29.153  -37.446 28.093  1.00 21.96  ? 85  GLU A CA  1 
ATOM   646   C  C   . GLU A  1 85  ? 30.003  -36.419 27.361  1.00 18.27  ? 85  GLU A C   1 
ATOM   647   O  O   . GLU A  1 85  ? 29.588  -35.873 26.331  1.00 22.42  ? 85  GLU A O   1 
ATOM   648   C  CB  . GLU A  1 85  ? 29.318  -38.770 27.356  1.00 26.86  ? 85  GLU A CB  1 
ATOM   649   C  CG  . GLU A  1 85  ? 28.886  -40.000 28.147  1.00 73.35  ? 85  GLU A CG  1 
ATOM   650   C  CD  . GLU A  1 85  ? 29.585  -40.123 29.479  0.00 100.00 ? 85  GLU A CD  1 
ATOM   651   O  OE1 . GLU A  1 85  ? 30.573  -39.412 29.687  0.00 100.00 ? 85  GLU A OE1 1 
ATOM   652   O  OE2 . GLU A  1 85  ? 29.131  -40.905 30.340  1.00 99.97  ? 85  GLU A OE2 1 
ATOM   653   N  N   . GLU A  1 86  ? 31.227  -36.219 27.848  1.00 13.02  ? 86  GLU A N   1 
ATOM   654   C  CA  . GLU A  1 86  ? 32.156  -35.289 27.196  1.00 16.14  ? 86  GLU A CA  1 
ATOM   655   C  C   . GLU A  1 86  ? 33.512  -35.949 27.017  1.00 19.31  ? 86  GLU A C   1 
ATOM   656   O  O   . GLU A  1 86  ? 33.901  -36.842 27.766  1.00 20.59  ? 86  GLU A O   1 
ATOM   657   C  CB  . GLU A  1 86  ? 32.395  -33.989 27.957  1.00 16.93  ? 86  GLU A CB  1 
ATOM   658   C  CG  . GLU A  1 86  ? 33.022  -34.212 29.309  1.00 39.32  ? 86  GLU A CG  1 
ATOM   659   C  CD  . GLU A  1 86  ? 33.574  -32.969 29.977  1.00 49.17  ? 86  GLU A CD  1 
ATOM   660   O  OE1 . GLU A  1 86  ? 33.221  -31.827 29.622  1.00 28.22  ? 86  GLU A OE1 1 
ATOM   661   O  OE2 . GLU A  1 86  ? 34.352  -33.113 30.940  1.00 25.44  ? 86  GLU A OE2 1 
ATOM   662   N  N   . ALA A  1 87  ? 34.250  -35.482 26.018  1.00 17.22  ? 87  ALA A N   1 
ATOM   663   C  CA  . ALA A  1 87  ? 35.575  -36.027 25.765  1.00 17.26  ? 87  ALA A CA  1 
ATOM   664   C  C   . ALA A  1 87  ? 36.426  -34.983 25.063  1.00 20.06  ? 87  ALA A C   1 
ATOM   665   O  O   . ALA A  1 87  ? 36.008  -34.350 24.100  1.00 25.74  ? 87  ALA A O   1 
ATOM   666   C  CB  . ALA A  1 87  ? 35.501  -37.262 24.906  1.00 17.70  ? 87  ALA A CB  1 
ATOM   667   N  N   . PRO A  1 88  ? 37.652  -34.858 25.559  1.00 17.62  ? 88  PRO A N   1 
ATOM   668   C  CA  . PRO A  1 88  ? 38.653  -33.932 25.024  1.00 19.68  ? 88  PRO A CA  1 
ATOM   669   C  C   . PRO A  1 88  ? 38.856  -34.215 23.543  1.00 18.56  ? 88  PRO A C   1 
ATOM   670   O  O   . PRO A  1 88  ? 38.697  -35.331 23.044  1.00 16.15  ? 88  PRO A O   1 
ATOM   671   C  CB  . PRO A  1 88  ? 39.906  -34.300 25.823  1.00 23.42  ? 88  PRO A CB  1 
ATOM   672   C  CG  . PRO A  1 88  ? 39.706  -35.734 26.210  1.00 27.19  ? 88  PRO A CG  1 
ATOM   673   C  CD  . PRO A  1 88  ? 38.234  -35.842 26.482  1.00 18.85  ? 88  PRO A CD  1 
ATOM   674   N  N   . TYR A  1 89  ? 39.124  -33.130 22.832  1.00 15.15  ? 89  TYR A N   1 
ATOM   675   C  CA  . TYR A  1 89  ? 39.304  -33.239 21.411  1.00 14.20  ? 89  TYR A CA  1 
ATOM   676   C  C   . TYR A  1 89  ? 40.780  -33.498 21.148  1.00 30.63  ? 89  TYR A C   1 
ATOM   677   O  O   . TYR A  1 89  ? 41.654  -32.652 21.335  1.00 35.47  ? 89  TYR A O   1 
ATOM   678   C  CB  . TYR A  1 89  ? 38.843  -31.947 20.766  1.00 8.69   ? 89  TYR A CB  1 
ATOM   679   C  CG  . TYR A  1 89  ? 38.818  -32.064 19.280  1.00 9.97   ? 89  TYR A CG  1 
ATOM   680   C  CD1 . TYR A  1 89  ? 39.925  -31.758 18.529  1.00 13.81  ? 89  TYR A CD1 1 
ATOM   681   C  CD2 . TYR A  1 89  ? 37.664  -32.443 18.610  1.00 8.97   ? 89  TYR A CD2 1 
ATOM   682   C  CE1 . TYR A  1 89  ? 39.863  -31.818 17.137  1.00 19.26  ? 89  TYR A CE1 1 
ATOM   683   C  CE2 . TYR A  1 89  ? 37.583  -32.471 17.225  1.00 9.50   ? 89  TYR A CE2 1 
ATOM   684   C  CZ  . TYR A  1 89  ? 38.686  -32.170 16.475  1.00 20.65  ? 89  TYR A CZ  1 
ATOM   685   O  OH  . TYR A  1 89  ? 38.606  -32.216 15.104  1.00 31.18  ? 89  TYR A OH  1 
ATOM   686   N  N   . THR A  1 90  ? 41.068  -34.719 20.736  1.00 35.79  ? 90  THR A N   1 
ATOM   687   C  CA  . THR A  1 90  ? 42.436  -35.124 20.475  1.00 38.52  ? 90  THR A CA  1 
ATOM   688   C  C   . THR A  1 90  ? 42.623  -35.365 18.984  1.00 47.51  ? 90  THR A C   1 
ATOM   689   O  O   . THR A  1 90  ? 43.224  -34.586 18.239  1.00 48.31  ? 90  THR A O   1 
ATOM   690   C  CB  . THR A  1 90  ? 42.665  -36.426 21.258  1.00 51.21  ? 90  THR A CB  1 
ATOM   691   O  OG1 . THR A  1 90  ? 41.554  -37.313 21.052  1.00 56.68  ? 90  THR A OG1 1 
ATOM   692   C  CG2 . THR A  1 90  ? 42.717  -36.108 22.751  1.00 52.07  ? 90  THR A CG2 1 
ATOM   693   N  N   . LYS A  1 91  ? 42.057  -36.486 18.568  1.00 38.89  ? 91  LYS A N   1 
ATOM   694   C  CA  . LYS A  1 91  ? 42.154  -36.862 17.185  1.00 34.95  ? 91  LYS A CA  1 
ATOM   695   C  C   . LYS A  1 91  ? 41.219  -35.791 16.682  1.00 28.93  ? 91  LYS A C   1 
ATOM   696   O  O   . LYS A  1 91  ? 40.353  -35.275 17.396  1.00 53.80  ? 91  LYS A O   1 
ATOM   697   C  CB  . LYS A  1 91  ? 41.476  -38.225 16.998  1.00 36.43  ? 91  LYS A CB  1 
ATOM   698   C  CG  . LYS A  1 91  ? 41.949  -39.036 15.806  1.00 82.68  ? 91  LYS A CG  1 
ATOM   699   C  CD  . LYS A  1 91  ? 41.067  -40.269 15.662  0.00 100.00 ? 91  LYS A CD  1 
ATOM   700   C  CE  . LYS A  1 91  ? 41.115  -41.155 16.886  1.00 95.01  ? 91  LYS A CE  1 
ATOM   701   N  NZ  . LYS A  1 91  ? 40.206  -42.357 16.808  1.00 37.99  ? 91  LYS A NZ  1 
ATOM   702   N  N   . PRO A  1 92  ? 41.503  -35.459 15.436  1.00 30.66  ? 92  PRO A N   1 
ATOM   703   C  CA  . PRO A  1 92  ? 40.744  -34.544 14.616  1.00 27.02  ? 92  PRO A CA  1 
ATOM   704   C  C   . PRO A  1 92  ? 39.509  -35.392 14.328  1.00 50.54  ? 92  PRO A C   1 
ATOM   705   O  O   . PRO A  1 92  ? 39.499  -36.621 14.417  1.00 54.29  ? 92  PRO A O   1 
ATOM   706   C  CB  . PRO A  1 92  ? 41.548  -34.426 13.330  1.00 28.67  ? 92  PRO A CB  1 
ATOM   707   C  CG  . PRO A  1 92  ? 42.776  -35.266 13.516  1.00 28.75  ? 92  PRO A CG  1 
ATOM   708   C  CD  . PRO A  1 92  ? 42.865  -35.694 14.940  1.00 23.82  ? 92  PRO A CD  1 
ATOM   709   N  N   . LYS A  1 93  ? 38.468  -34.685 13.923  1.00 28.96  ? 93  LYS A N   1 
ATOM   710   C  CA  . LYS A  1 93  ? 37.198  -35.351 13.730  1.00 15.16  ? 93  LYS A CA  1 
ATOM   711   C  C   . LYS A  1 93  ? 36.531  -34.636 12.583  1.00 18.95  ? 93  LYS A C   1 
ATOM   712   O  O   . LYS A  1 93  ? 36.781  -33.452 12.359  1.00 45.35  ? 93  LYS A O   1 
ATOM   713   C  CB  . LYS A  1 93  ? 36.387  -35.242 15.036  1.00 19.82  ? 93  LYS A CB  1 
ATOM   714   C  CG  . LYS A  1 93  ? 36.552  -36.426 15.981  1.00 9.61   ? 93  LYS A CG  1 
ATOM   715   C  CD  . LYS A  1 93  ? 37.565  -36.337 17.110  1.00 73.76  ? 93  LYS A CD  1 
ATOM   716   C  CE  . LYS A  1 93  ? 36.855  -35.983 18.411  1.00 80.26  ? 93  LYS A CE  1 
ATOM   717   N  NZ  . LYS A  1 93  ? 37.770  -36.077 19.578  1.00 76.97  ? 93  LYS A NZ  1 
ATOM   718   N  N   . THR A  1 94  ? 35.720  -35.363 11.842  1.00 21.98  ? 94  THR A N   1 
ATOM   719   C  CA  . THR A  1 94  ? 34.946  -34.778 10.744  1.00 25.45  ? 94  THR A CA  1 
ATOM   720   C  C   . THR A  1 94  ? 33.698  -33.922 11.091  1.00 15.28  ? 94  THR A C   1 
ATOM   721   O  O   . THR A  1 94  ? 33.145  -34.108 12.174  1.00 12.57  ? 94  THR A O   1 
ATOM   722   C  CB  . THR A  1 94  ? 34.554  -35.947 9.832   1.00 12.47  ? 94  THR A CB  1 
ATOM   723   O  OG1 . THR A  1 94  ? 35.601  -36.188 8.889   1.00 31.58  ? 94  THR A OG1 1 
ATOM   724   C  CG2 . THR A  1 94  ? 33.124  -35.817 9.270   1.00 38.19  ? 94  THR A CG2 1 
ATOM   725   N  N   . MET A  1 95  ? 33.214  -33.068 10.180  1.00 15.71  ? 95  MET A N   1 
ATOM   726   C  CA  . MET A  1 95  ? 32.030  -32.269 10.457  1.00 21.15  ? 95  MET A CA  1 
ATOM   727   C  C   . MET A  1 95  ? 30.858  -33.193 10.812  1.00 22.65  ? 95  MET A C   1 
ATOM   728   O  O   . MET A  1 95  ? 30.196  -33.022 11.848  1.00 23.36  ? 95  MET A O   1 
ATOM   729   C  CB  . MET A  1 95  ? 31.662  -31.312 9.330   1.00 25.29  ? 95  MET A CB  1 
ATOM   730   C  CG  . MET A  1 95  ? 30.672  -30.222 9.737   1.00 30.94  ? 95  MET A CG  1 
ATOM   731   S  SD  . MET A  1 95  ? 31.442  -28.948 10.766  1.00 33.35  ? 95  MET A SD  1 
ATOM   732   C  CE  . MET A  1 95  ? 31.957  -27.740 9.443   1.00 25.99  ? 95  MET A CE  1 
ATOM   733   N  N   . ASP A  1 96  ? 30.644  -34.226 10.007  1.00 21.25  ? 96  ASP A N   1 
ATOM   734   C  CA  . ASP A  1 96  ? 29.589  -35.191 10.308  1.00 24.60  ? 96  ASP A CA  1 
ATOM   735   C  C   . ASP A  1 96  ? 29.792  -35.872 11.646  1.00 14.96  ? 96  ASP A C   1 
ATOM   736   O  O   . ASP A  1 96  ? 28.838  -36.063 12.412  1.00 18.04  ? 96  ASP A O   1 
ATOM   737   C  CB  . ASP A  1 96  ? 29.496  -36.227 9.193   1.00 29.05  ? 96  ASP A CB  1 
ATOM   738   C  CG  . ASP A  1 96  ? 28.876  -35.649 7.950   1.00 56.91  ? 96  ASP A CG  1 
ATOM   739   O  OD1 . ASP A  1 96  ? 28.675  -34.413 7.925   1.00 66.16  ? 96  ASP A OD1 1 
ATOM   740   O  OD2 . ASP A  1 96  ? 28.538  -36.436 7.045   1.00 59.15  ? 96  ASP A OD2 1 
ATOM   741   N  N   . GLN A  1 97  ? 31.043  -36.183 11.956  1.00 8.21   ? 97  GLN A N   1 
ATOM   742   C  CA  . GLN A  1 97  ? 31.206  -36.854 13.229  1.00 14.93  ? 97  GLN A CA  1 
ATOM   743   C  C   . GLN A  1 97  ? 30.798  -35.954 14.373  1.00 19.76  ? 97  GLN A C   1 
ATOM   744   O  O   . GLN A  1 97  ? 30.284  -36.402 15.398  1.00 14.65  ? 97  GLN A O   1 
ATOM   745   C  CB  . GLN A  1 97  ? 32.662  -37.239 13.435  1.00 22.70  ? 97  GLN A CB  1 
ATOM   746   C  CG  . GLN A  1 97  ? 33.265  -38.144 12.381  1.00 41.97  ? 97  GLN A CG  1 
ATOM   747   C  CD  . GLN A  1 97  ? 34.734  -38.445 12.680  1.00 61.48  ? 97  GLN A CD  1 
ATOM   748   O  OE1 . GLN A  1 97  ? 35.591  -38.384 11.792  1.00 73.63  ? 97  GLN A OE1 1 
ATOM   749   N  NE2 . GLN A  1 97  ? 35.030  -38.785 13.937  1.00 91.42  ? 97  GLN A NE2 1 
ATOM   750   N  N   . LEU A  1 98  ? 31.112  -34.677 14.196  1.00 13.45  ? 98  LEU A N   1 
ATOM   751   C  CA  . LEU A  1 98  ? 30.790  -33.672 15.209  1.00 13.67  ? 98  LEU A CA  1 
ATOM   752   C  C   . LEU A  1 98  ? 29.251  -33.521 15.323  1.00 11.36  ? 98  LEU A C   1 
ATOM   753   O  O   . LEU A  1 98  ? 28.655  -33.559 16.417  1.00 7.84   ? 98  LEU A O   1 
ATOM   754   C  CB  . LEU A  1 98  ? 31.471  -32.362 14.812  1.00 11.36  ? 98  LEU A CB  1 
ATOM   755   C  CG  . LEU A  1 98  ? 32.990  -32.406 14.939  1.00 10.74  ? 98  LEU A CG  1 
ATOM   756   C  CD1 . LEU A  1 98  ? 33.643  -31.100 14.526  1.00 8.93   ? 98  LEU A CD1 1 
ATOM   757   C  CD2 . LEU A  1 98  ? 33.340  -32.792 16.374  1.00 1.22   ? 98  LEU A CD2 1 
ATOM   758   N  N   . MET A  1 99  ? 28.626  -33.428 14.148  1.00 4.21   ? 99  MET A N   1 
ATOM   759   C  CA  . MET A  1 99  ? 27.181  -33.308 14.123  1.00 3.22   ? 99  MET A CA  1 
ATOM   760   C  C   . MET A  1 99  ? 26.519  -34.494 14.795  1.00 10.16  ? 99  MET A C   1 
ATOM   761   O  O   . MET A  1 99  ? 25.614  -34.349 15.620  1.00 12.59  ? 99  MET A O   1 
ATOM   762   C  CB  . MET A  1 99  ? 26.678  -33.065 12.709  1.00 4.13   ? 99  MET A CB  1 
ATOM   763   C  CG  . MET A  1 99  ? 27.066  -31.676 12.193  1.00 11.85  ? 99  MET A CG  1 
ATOM   764   S  SD  . MET A  1 99  ? 26.737  -30.217 13.250  1.00 14.50  ? 99  MET A SD  1 
ATOM   765   C  CE  . MET A  1 99  ? 28.101  -30.090 14.277  1.00 11.39  ? 99  MET A CE  1 
ATOM   766   N  N   . GLU A  1 100 ? 27.044  -35.672 14.490  1.00 10.72  ? 100 GLU A N   1 
ATOM   767   C  CA  . GLU A  1 100 ? 26.538  -36.883 15.103  1.00 12.07  ? 100 GLU A CA  1 
ATOM   768   C  C   . GLU A  1 100 ? 26.654  -36.865 16.610  1.00 11.67  ? 100 GLU A C   1 
ATOM   769   O  O   . GLU A  1 100 ? 25.773  -37.338 17.317  1.00 13.60  ? 100 GLU A O   1 
ATOM   770   C  CB  . GLU A  1 100 ? 27.242  -38.107 14.519  1.00 14.36  ? 100 GLU A CB  1 
ATOM   771   C  CG  . GLU A  1 100 ? 26.696  -38.432 13.131  1.00 37.19  ? 100 GLU A CG  1 
ATOM   772   C  CD  . GLU A  1 100 ? 27.537  -39.319 12.240  0.00 100.00 ? 100 GLU A CD  1 
ATOM   773   O  OE1 . GLU A  1 100 ? 28.716  -39.528 12.550  1.00 98.11  ? 100 GLU A OE1 1 
ATOM   774   O  OE2 . GLU A  1 100 ? 27.027  -39.749 11.182  0.00 100.00 ? 100 GLU A OE2 1 
ATOM   775   N  N   . ASP A  1 101 ? 27.718  -36.259 17.115  1.00 12.15  ? 101 ASP A N   1 
ATOM   776   C  CA  . ASP A  1 101 ? 27.865  -36.193 18.554  1.00 17.81  ? 101 ASP A CA  1 
ATOM   777   C  C   . ASP A  1 101 ? 26.773  -35.257 19.066  1.00 16.29  ? 101 ASP A C   1 
ATOM   778   O  O   . ASP A  1 101 ? 26.080  -35.542 20.061  1.00 13.24  ? 101 ASP A O   1 
ATOM   779   C  CB  . ASP A  1 101 ? 29.271  -35.663 18.867  1.00 26.02  ? 101 ASP A CB  1 
ATOM   780   C  CG  . ASP A  1 101 ? 29.576  -35.631 20.370  1.00 70.29  ? 101 ASP A CG  1 
ATOM   781   O  OD1 . ASP A  1 101 ? 28.788  -36.156 21.191  1.00 74.42  ? 101 ASP A OD1 1 
ATOM   782   O  OD2 . ASP A  1 101 ? 30.623  -35.048 20.732  1.00 79.71  ? 101 ASP A OD2 1 
ATOM   783   N  N   . LEU A  1 102 ? 26.634  -34.139 18.360  1.00 8.54   ? 102 LEU A N   1 
ATOM   784   C  CA  . LEU A  1 102 ? 25.666  -33.128 18.765  1.00 6.50   ? 102 LEU A CA  1 
ATOM   785   C  C   . LEU A  1 102 ? 24.273  -33.768 18.799  1.00 9.08   ? 102 LEU A C   1 
ATOM   786   O  O   . LEU A  1 102 ? 23.558  -33.731 19.804  1.00 9.78   ? 102 LEU A O   1 
ATOM   787   C  CB  . LEU A  1 102 ? 25.675  -32.077 17.666  1.00 5.68   ? 102 LEU A CB  1 
ATOM   788   C  CG  . LEU A  1 102 ? 25.210  -30.685 18.024  1.00 13.24  ? 102 LEU A CG  1 
ATOM   789   C  CD1 . LEU A  1 102 ? 24.441  -30.084 16.852  1.00 7.87   ? 102 LEU A CD1 1 
ATOM   790   C  CD2 . LEU A  1 102 ? 24.534  -30.698 19.377  1.00 24.30  ? 102 LEU A CD2 1 
ATOM   791   N  N   . VAL A  1 103 ? 23.961  -34.417 17.677  1.00 1.00   ? 103 VAL A N   1 
ATOM   792   C  CA  . VAL A  1 103 ? 22.665  -35.031 17.589  1.00 3.65   ? 103 VAL A CA  1 
ATOM   793   C  C   . VAL A  1 103 ? 22.420  -36.055 18.674  1.00 13.09  ? 103 VAL A C   1 
ATOM   794   O  O   . VAL A  1 103 ? 21.346  -36.163 19.245  1.00 8.25   ? 103 VAL A O   1 
ATOM   795   C  CB  . VAL A  1 103 ? 22.493  -35.658 16.252  1.00 13.06  ? 103 VAL A CB  1 
ATOM   796   C  CG1 . VAL A  1 103 ? 21.358  -36.649 16.364  1.00 13.80  ? 103 VAL A CG1 1 
ATOM   797   C  CG2 . VAL A  1 103 ? 22.149  -34.537 15.267  1.00 13.85  ? 103 VAL A CG2 1 
ATOM   798   N  N   . GLY A  1 104 ? 23.462  -36.807 18.970  1.00 6.37   ? 104 GLY A N   1 
ATOM   799   C  CA  . GLY A  1 104 ? 23.225  -37.833 19.974  1.00 5.19   ? 104 GLY A CA  1 
ATOM   800   C  C   . GLY A  1 104 ? 22.914  -37.194 21.301  1.00 8.33   ? 104 GLY A C   1 
ATOM   801   O  O   . GLY A  1 104 ? 22.042  -37.625 22.016  1.00 11.80  ? 104 GLY A O   1 
ATOM   802   N  N   . THR A  1 105 ? 23.634  -36.133 21.600  1.00 5.14   ? 105 THR A N   1 
ATOM   803   C  CA  . THR A  1 105 ? 23.350  -35.479 22.857  1.00 5.31   ? 105 THR A CA  1 
ATOM   804   C  C   . THR A  1 105 ? 21.946  -34.916 22.856  1.00 4.72   ? 105 THR A C   1 
ATOM   805   O  O   . THR A  1 105 ? 21.254  -34.952 23.879  1.00 7.26   ? 105 THR A O   1 
ATOM   806   C  CB  . THR A  1 105 ? 24.412  -34.426 23.143  1.00 12.77  ? 105 THR A CB  1 
ATOM   807   O  OG1 . THR A  1 105 ? 25.683  -35.092 23.181  1.00 16.59  ? 105 THR A OG1 1 
ATOM   808   C  CG2 . THR A  1 105 ? 24.110  -33.753 24.488  1.00 7.62   ? 105 THR A CG2 1 
ATOM   809   N  N   . LEU A  1 106 ? 21.530  -34.416 21.694  1.00 2.83   ? 106 LEU A N   1 
ATOM   810   C  CA  . LEU A  1 106 ? 20.177  -33.894 21.614  1.00 3.54   ? 106 LEU A CA  1 
ATOM   811   C  C   . LEU A  1 106 ? 19.169  -35.006 21.927  1.00 11.04  ? 106 LEU A C   1 
ATOM   812   O  O   . LEU A  1 106 ? 18.235  -34.861 22.738  1.00 9.77   ? 106 LEU A O   1 
ATOM   813   C  CB  . LEU A  1 106 ? 19.917  -33.273 20.252  1.00 2.06   ? 106 LEU A CB  1 
ATOM   814   C  CG  . LEU A  1 106 ? 20.573  -31.896 20.046  1.00 6.18   ? 106 LEU A CG  1 
ATOM   815   C  CD1 . LEU A  1 106 ? 20.486  -31.504 18.549  1.00 1.06   ? 106 LEU A CD1 1 
ATOM   816   C  CD2 . LEU A  1 106 ? 20.045  -30.804 20.945  1.00 1.25   ? 106 LEU A CD2 1 
ATOM   817   N  N   . GLU A  1 107 ? 19.384  -36.157 21.311  1.00 3.68   ? 107 GLU A N   1 
ATOM   818   C  CA  . GLU A  1 107 ? 18.479  -37.267 21.569  1.00 5.63   ? 107 GLU A CA  1 
ATOM   819   C  C   . GLU A  1 107 ? 18.512  -37.650 23.025  1.00 10.50  ? 107 GLU A C   1 
ATOM   820   O  O   . GLU A  1 107 ? 17.468  -37.911 23.607  1.00 9.18   ? 107 GLU A O   1 
ATOM   821   C  CB  . GLU A  1 107 ? 18.836  -38.452 20.662  1.00 5.99   ? 107 GLU A CB  1 
ATOM   822   C  CG  . GLU A  1 107 ? 18.481  -38.200 19.196  1.00 16.28  ? 107 GLU A CG  1 
ATOM   823   C  CD  . GLU A  1 107 ? 19.070  -39.188 18.188  1.00 28.01  ? 107 GLU A CD  1 
ATOM   824   O  OE1 . GLU A  1 107 ? 20.132  -39.755 18.485  1.00 39.76  ? 107 GLU A OE1 1 
ATOM   825   O  OE2 . GLU A  1 107 ? 18.517  -39.403 17.089  1.00 29.82  ? 107 GLU A OE2 1 
ATOM   826   N  N   . LEU A  1 108 ? 19.663  -37.581 23.677  1.00 5.68   ? 108 LEU A N   1 
ATOM   827   C  CA  . LEU A  1 108 ? 19.629  -37.929 25.089  1.00 6.07   ? 108 LEU A CA  1 
ATOM   828   C  C   . LEU A  1 108 ? 18.775  -36.953 25.869  1.00 10.38  ? 108 LEU A C   1 
ATOM   829   O  O   . LEU A  1 108 ? 18.006  -37.353 26.727  1.00 11.70  ? 108 LEU A O   1 
ATOM   830   C  CB  . LEU A  1 108 ? 21.052  -37.888 25.645  1.00 9.69   ? 108 LEU A CB  1 
ATOM   831   C  CG  . LEU A  1 108 ? 21.254  -38.099 27.144  1.00 18.25  ? 108 LEU A CG  1 
ATOM   832   C  CD1 . LEU A  1 108 ? 22.698  -38.484 27.425  1.00 15.21  ? 108 LEU A CD1 1 
ATOM   833   C  CD2 . LEU A  1 108 ? 20.845  -36.914 28.006  1.00 24.33  ? 108 LEU A CD2 1 
ATOM   834   N  N   . LEU A  1 109 ? 18.925  -35.665 25.584  1.00 5.90   ? 109 LEU A N   1 
ATOM   835   C  CA  . LEU A  1 109 ? 18.186  -34.641 26.294  1.00 5.27   ? 109 LEU A CA  1 
ATOM   836   C  C   . LEU A  1 109 ? 16.712  -34.800 26.092  1.00 6.10   ? 109 LEU A C   1 
ATOM   837   O  O   . LEU A  1 109 ? 15.938  -34.777 27.028  1.00 11.01  ? 109 LEU A O   1 
ATOM   838   C  CB  . LEU A  1 109 ? 18.636  -33.250 25.899  1.00 5.53   ? 109 LEU A CB  1 
ATOM   839   C  CG  . LEU A  1 109 ? 20.030  -32.959 26.437  1.00 10.50  ? 109 LEU A CG  1 
ATOM   840   C  CD1 . LEU A  1 109 ? 20.579  -31.685 25.869  1.00 11.50  ? 109 LEU A CD1 1 
ATOM   841   C  CD2 . LEU A  1 109 ? 19.899  -32.804 27.928  1.00 8.03   ? 109 LEU A CD2 1 
ATOM   842   N  N   . ARG A  1 110 ? 16.368  -35.072 24.844  1.00 2.80   ? 110 ARG A N   1 
ATOM   843   C  CA  . ARG A  1 110 ? 14.975  -35.306 24.462  1.00 4.45   ? 110 ARG A CA  1 
ATOM   844   C  C   . ARG A  1 110 ? 14.375  -36.397 25.330  1.00 10.70  ? 110 ARG A C   1 
ATOM   845   O  O   . ARG A  1 110 ? 13.348  -36.241 25.978  1.00 7.85   ? 110 ARG A O   1 
ATOM   846   C  CB  . ARG A  1 110 ? 14.875  -35.747 22.996  1.00 1.66   ? 110 ARG A CB  1 
ATOM   847   C  CG  . ARG A  1 110 ? 13.444  -35.897 22.477  1.00 5.97   ? 110 ARG A CG  1 
ATOM   848   C  CD  . ARG A  1 110 ? 13.389  -36.671 21.169  1.00 5.63   ? 110 ARG A CD  1 
ATOM   849   N  NE  . ARG A  1 110 ? 14.161  -37.913 21.284  1.00 9.07   ? 110 ARG A NE  1 
ATOM   850   C  CZ  . ARG A  1 110 ? 14.657  -38.594 20.265  1.00 17.62  ? 110 ARG A CZ  1 
ATOM   851   N  NH1 . ARG A  1 110 ? 14.447  -38.192 19.021  1.00 7.11   ? 110 ARG A NH1 1 
ATOM   852   N  NH2 . ARG A  1 110 ? 15.367  -39.681 20.511  1.00 14.62  ? 110 ARG A NH2 1 
ATOM   853   N  N   . ASP A  1 111 ? 15.088  -37.504 25.347  1.00 7.03   ? 111 ASP A N   1 
ATOM   854   C  CA  . ASP A  1 111 ? 14.630  -38.668 26.072  1.00 10.85  ? 111 ASP A CA  1 
ATOM   855   C  C   . ASP A  1 111 ? 14.543  -38.413 27.538  1.00 8.98   ? 111 ASP A C   1 
ATOM   856   O  O   . ASP A  1 111 ? 13.543  -38.775 28.172  1.00 10.60  ? 111 ASP A O   1 
ATOM   857   C  CB  . ASP A  1 111 ? 15.453  -39.889 25.688  1.00 19.06  ? 111 ASP A CB  1 
ATOM   858   C  CG  . ASP A  1 111 ? 15.332  -40.208 24.190  1.00 33.57  ? 111 ASP A CG  1 
ATOM   859   O  OD1 . ASP A  1 111 ? 14.345  -39.833 23.508  1.00 24.30  ? 111 ASP A OD1 1 
ATOM   860   O  OD2 . ASP A  1 111 ? 16.270  -40.813 23.637  1.00 59.24  ? 111 ASP A OD2 1 
ATOM   861   N  N   . GLU A  1 112 ? 15.537  -37.704 28.055  1.00 2.45   ? 112 GLU A N   1 
ATOM   862   C  CA  . GLU A  1 112 ? 15.436  -37.409 29.482  1.00 3.49   ? 112 GLU A CA  1 
ATOM   863   C  C   . GLU A  1 112 ? 14.315  -36.449 29.811  1.00 11.64  ? 112 GLU A C   1 
ATOM   864   O  O   . GLU A  1 112 ? 13.634  -36.569 30.842  1.00 11.76  ? 112 GLU A O   1 
ATOM   865   C  CB  . GLU A  1 112 ? 16.736  -36.878 30.045  1.00 5.27   ? 112 GLU A CB  1 
ATOM   866   C  CG  . GLU A  1 112 ? 17.816  -37.938 29.812  1.00 23.28  ? 112 GLU A CG  1 
ATOM   867   C  CD  . GLU A  1 112 ? 18.988  -37.780 30.755  1.00 36.15  ? 112 GLU A CD  1 
ATOM   868   O  OE1 . GLU A  1 112 ? 18.958  -36.837 31.582  1.00 17.94  ? 112 GLU A OE1 1 
ATOM   869   O  OE2 . GLU A  1 112 ? 19.905  -38.627 30.705  1.00 23.20  ? 112 GLU A OE2 1 
ATOM   870   N  N   . TYR A  1 113 ? 14.133  -35.485 28.919  1.00 7.06   ? 113 TYR A N   1 
ATOM   871   C  CA  . TYR A  1 113 ? 13.064  -34.528 29.128  1.00 6.03   ? 113 TYR A CA  1 
ATOM   872   C  C   . TYR A  1 113 ? 11.740  -35.229 29.158  1.00 8.78   ? 113 TYR A C   1 
ATOM   873   O  O   . TYR A  1 113 ? 10.903  -34.955 29.990  1.00 6.50   ? 113 TYR A O   1 
ATOM   874   C  CB  . TYR A  1 113 ? 13.069  -33.453 28.060  1.00 3.87   ? 113 TYR A CB  1 
ATOM   875   C  CG  . TYR A  1 113 ? 14.068  -32.377 28.349  1.00 9.84   ? 113 TYR A CG  1 
ATOM   876   C  CD1 . TYR A  1 113 ? 15.191  -32.628 29.152  1.00 12.50  ? 113 TYR A CD1 1 
ATOM   877   C  CD2 . TYR A  1 113 ? 13.917  -31.131 27.770  1.00 14.88  ? 113 TYR A CD2 1 
ATOM   878   C  CE1 . TYR A  1 113 ? 16.129  -31.645 29.372  1.00 17.71  ? 113 TYR A CE1 1 
ATOM   879   C  CE2 . TYR A  1 113 ? 14.856  -30.136 27.977  1.00 21.31  ? 113 TYR A CE2 1 
ATOM   880   C  CZ  . TYR A  1 113 ? 15.958  -30.415 28.754  1.00 18.48  ? 113 TYR A CZ  1 
ATOM   881   O  OH  . TYR A  1 113 ? 16.796  -29.351 28.935  1.00 18.84  ? 113 TYR A OH  1 
ATOM   882   N  N   . LYS A  1 114 ? 11.568  -36.178 28.257  1.00 10.49  ? 114 LYS A N   1 
ATOM   883   C  CA  . LYS A  1 114 ? 10.338  -36.955 28.211  1.00 11.03  ? 114 LYS A CA  1 
ATOM   884   C  C   . LYS A  1 114 ? 10.050  -37.573 29.578  1.00 13.07  ? 114 LYS A C   1 
ATOM   885   O  O   . LYS A  1 114 ? 8.927   -37.448 30.082  1.00 13.02  ? 114 LYS A O   1 
ATOM   886   C  CB  . LYS A  1 114 ? 10.472  -38.011 27.116  1.00 12.75  ? 114 LYS A CB  1 
ATOM   887   C  CG  . LYS A  1 114 ? 9.224   -38.827 26.963  1.00 47.46  ? 114 LYS A CG  1 
ATOM   888   C  CD  . LYS A  1 114 ? 8.014   -37.949 27.211  1.00 65.74  ? 114 LYS A CD  1 
ATOM   889   C  CE  . LYS A  1 114 ? 6.719   -38.737 27.040  1.00 72.38  ? 114 LYS A CE  1 
ATOM   890   N  NZ  . LYS A  1 114 ? 5.510   -37.912 27.331  1.00 81.38  ? 114 LYS A NZ  1 
ATOM   891   N  N   . GLN A  1 115 ? 11.073  -38.119 30.242  1.00 9.48   ? 115 GLN A N   1 
ATOM   892   C  CA  . GLN A  1 115 ? 10.905  -38.681 31.582  1.00 10.77  ? 115 GLN A CA  1 
ATOM   893   C  C   . GLN A  1 115 ? 10.437  -37.600 32.543  1.00 10.20  ? 115 GLN A C   1 
ATOM   894   O  O   . GLN A  1 115 ? 9.565   -37.843 33.373  1.00 12.75  ? 115 GLN A O   1 
ATOM   895   C  CB  . GLN A  1 115 ? 12.197  -39.229 32.204  1.00 12.73  ? 115 GLN A CB  1 
ATOM   896   C  CG  . GLN A  1 115 ? 13.186  -39.982 31.343  1.00 65.15  ? 115 GLN A CG  1 
ATOM   897   C  CD  . GLN A  1 115 ? 12.562  -41.022 30.465  0.00 100.00 ? 115 GLN A CD  1 
ATOM   898   O  OE1 . GLN A  1 115 ? 11.469  -41.509 30.753  0.00 100.00 ? 115 GLN A OE1 1 
ATOM   899   N  NE2 . GLN A  1 115 ? 13.220  -41.348 29.364  0.00 100.00 ? 115 GLN A NE2 1 
ATOM   900   N  N   . GLY A  1 116 ? 11.111  -36.456 32.501  1.00 6.33   ? 116 GLY A N   1 
ATOM   901   C  CA  . GLY A  1 116 ? 10.821  -35.368 33.430  1.00 2.58   ? 116 GLY A CA  1 
ATOM   902   C  C   . GLY A  1 116 ? 9.407   -34.949 33.149  1.00 2.45   ? 116 GLY A C   1 
ATOM   903   O  O   . GLY A  1 116 ? 8.686   -34.524 34.028  1.00 7.52   ? 116 GLY A O   1 
ATOM   904   N  N   . ILE A  1 117 ? 8.992   -35.133 31.900  1.00 1.00   ? 117 ILE A N   1 
ATOM   905   C  CA  . ILE A  1 117 ? 7.646   -34.687 31.557  1.00 10.99  ? 117 ILE A CA  1 
ATOM   906   C  C   . ILE A  1 117 ? 6.625   -35.574 32.256  1.00 12.72  ? 117 ILE A C   1 
ATOM   907   O  O   . ILE A  1 117 ? 5.701   -35.020 32.852  1.00 17.91  ? 117 ILE A O   1 
ATOM   908   C  CB  . ILE A  1 117 ? 7.354   -34.464 30.058  1.00 7.80   ? 117 ILE A CB  1 
ATOM   909   C  CG1 . ILE A  1 117 ? 8.119   -33.251 29.487  1.00 7.17   ? 117 ILE A CG1 1 
ATOM   910   C  CG2 . ILE A  1 117 ? 5.870   -34.221 29.919  1.00 1.00   ? 117 ILE A CG2 1 
ATOM   911   C  CD1 . ILE A  1 117 ? 8.238   -33.165 27.974  1.00 1.00   ? 117 ILE A CD1 1 
ATOM   912   N  N   . GLU A  1 118 ? 6.835   -36.895 32.255  1.00 1.00   ? 118 GLU A N   1 
ATOM   913   C  CA  . GLU A  1 118 ? 5.941   -37.869 32.900  1.00 1.00   ? 118 GLU A CA  1 
ATOM   914   C  C   . GLU A  1 118 ? 5.960   -37.632 34.406  1.00 13.72  ? 118 GLU A C   1 
ATOM   915   O  O   . GLU A  1 118 ? 4.910   -37.475 35.040  1.00 22.41  ? 118 GLU A O   1 
ATOM   916   C  CB  . GLU A  1 118 ? 6.313   -39.287 32.461  1.00 1.00   ? 118 GLU A CB  1 
ATOM   917   C  CG  . GLU A  1 118 ? 5.973   -39.394 30.952  1.00 44.77  ? 118 GLU A CG  1 
ATOM   918   C  CD  . GLU A  1 118 ? 6.484   -40.618 30.193  0.00 100.00 ? 118 GLU A CD  1 
ATOM   919   O  OE1 . GLU A  1 118 ? 7.707   -40.995 30.294  1.00 37.10  ? 118 GLU A OE1 1 
ATOM   920   O  OE2 . GLU A  1 118 ? 5.670   -41.266 29.421  0.00 100.00 ? 118 GLU A OE2 1 
ATOM   921   N  N   . LEU A  1 119 ? 7.154   -37.593 34.910  1.00 1.00   ? 119 LEU A N   1 
ATOM   922   C  CA  . LEU A  1 119 ? 7.444   -37.326 36.320  1.00 1.00   ? 119 LEU A CA  1 
ATOM   923   C  C   . LEU A  1 119 ? 6.624   -36.134 36.822  1.00 1.54   ? 119 LEU A C   1 
ATOM   924   O  O   . LEU A  1 119 ? 5.951   -36.215 37.849  1.00 12.81  ? 119 LEU A O   1 
ATOM   925   C  CB  . LEU A  1 119 ? 8.942   -36.965 36.381  1.00 21.89  ? 119 LEU A CB  1 
ATOM   926   C  CG  . LEU A  1 119 ? 9.410   -36.307 37.677  1.00 27.21  ? 119 LEU A CG  1 
ATOM   927   C  CD1 . LEU A  1 119 ? 10.430  -37.177 38.417  1.00 33.77  ? 119 LEU A CD1 1 
ATOM   928   C  CD2 . LEU A  1 119 ? 10.106  -34.954 37.460  1.00 39.27  ? 119 LEU A CD2 1 
ATOM   929   N  N   . THR A  1 120 ? 6.757   -35.000 36.150  1.00 7.53   ? 120 THR A N   1 
ATOM   930   C  CA  . THR A  1 120 ? 6.095   -33.780 36.593  1.00 10.12  ? 120 THR A CA  1 
ATOM   931   C  C   . THR A  1 120 ? 4.577   -33.715 36.419  1.00 14.55  ? 120 THR A C   1 
ATOM   932   O  O   . THR A  1 120 ? 3.830   -32.993 37.124  1.00 4.75   ? 120 THR A O   1 
ATOM   933   C  CB  . THR A  1 120 ? 6.744   -32.573 35.950  1.00 22.15  ? 120 THR A CB  1 
ATOM   934   O  OG1 . THR A  1 120 ? 7.005   -32.869 34.581  1.00 21.39  ? 120 THR A OG1 1 
ATOM   935   C  CG2 . THR A  1 120 ? 7.991   -32.162 36.742  1.00 12.28  ? 120 THR A CG2 1 
ATOM   936   N  N   . ASP A  1 121 ? 4.150   -34.434 35.408  1.00 7.05   ? 121 ASP A N   1 
ATOM   937   C  CA  . ASP A  1 121 ? 2.724   -34.642 35.157  1.00 5.70   ? 121 ASP A CA  1 
ATOM   938   C  C   . ASP A  1 121 ? 2.210   -35.440 36.381  1.00 3.78   ? 121 ASP A C   1 
ATOM   939   O  O   . ASP A  1 121 ? 1.384   -34.924 37.139  1.00 7.50   ? 121 ASP A O   1 
ATOM   940   C  CB  . ASP A  1 121 ? 2.566   -35.510 33.912  1.00 5.90   ? 121 ASP A CB  1 
ATOM   941   C  CG  . ASP A  1 121 ? 1.157   -35.513 33.389  1.00 56.68  ? 121 ASP A CG  1 
ATOM   942   O  OD1 . ASP A  1 121 ? 0.572   -34.419 33.301  1.00 55.99  ? 121 ASP A OD1 1 
ATOM   943   O  OD2 . ASP A  1 121 ? 0.617   -36.625 33.204  1.00 78.41  ? 121 ASP A OD2 1 
ATOM   944   N  N   . LYS A  1 122 ? 2.765   -36.638 36.611  1.00 1.00   ? 122 LYS A N   1 
ATOM   945   C  CA  . LYS A  1 122 ? 2.416   -37.455 37.763  1.00 1.15   ? 122 LYS A CA  1 
ATOM   946   C  C   . LYS A  1 122 ? 2.522   -36.687 39.068  1.00 2.86   ? 122 LYS A C   1 
ATOM   947   O  O   . LYS A  1 122 ? 1.628   -36.813 39.898  1.00 17.63  ? 122 LYS A O   1 
ATOM   948   C  CB  . LYS A  1 122 ? 3.330   -38.663 37.951  1.00 6.07   ? 122 LYS A CB  1 
ATOM   949   C  CG  . LYS A  1 122 ? 3.145   -39.820 36.961  1.00 22.39  ? 122 LYS A CG  1 
ATOM   950   C  CD  . LYS A  1 122 ? 4.167   -40.923 37.251  1.00 10.39  ? 122 LYS A CD  1 
ATOM   951   C  CE  . LYS A  1 122 ? 4.324   -41.869 36.055  1.00 30.60  ? 122 LYS A CE  1 
ATOM   952   N  NZ  . LYS A  1 122 ? 3.093   -42.631 35.723  0.00 100.00 ? 122 LYS A NZ  1 
ATOM   953   N  N   . GLU A  1 123 ? 3.581   -35.916 39.269  1.00 1.00   ? 123 GLU A N   1 
ATOM   954   C  CA  . GLU A  1 123 ? 3.682   -35.159 40.513  1.00 12.07  ? 123 GLU A CA  1 
ATOM   955   C  C   . GLU A  1 123 ? 2.824   -33.914 40.578  1.00 8.29   ? 123 GLU A C   1 
ATOM   956   O  O   . GLU A  1 123 ? 2.814   -33.259 41.616  1.00 10.61  ? 123 GLU A O   1 
ATOM   957   C  CB  . GLU A  1 123 ? 5.072   -34.611 40.770  1.00 5.09   ? 123 GLU A CB  1 
ATOM   958   C  CG  . GLU A  1 123 ? 6.195   -35.628 40.803  1.00 67.55  ? 123 GLU A CG  1 
ATOM   959   C  CD  . GLU A  1 123 ? 7.327   -35.255 41.748  1.00 52.14  ? 123 GLU A CD  1 
ATOM   960   O  OE1 . GLU A  1 123 ? 7.447   -34.124 42.266  1.00 31.37  ? 123 GLU A OE1 1 
ATOM   961   O  OE2 . GLU A  1 123 ? 8.117   -36.181 41.994  1.00 37.91  ? 123 GLU A OE2 1 
ATOM   962   N  N   . GLY A  1 124 ? 2.218   -33.507 39.465  1.00 20.51  ? 124 GLY A N   1 
ATOM   963   C  CA  . GLY A  1 124 ? 1.371   -32.311 39.448  1.00 24.66  ? 124 GLY A CA  1 
ATOM   964   C  C   . GLY A  1 124 ? 2.014   -30.915 39.389  1.00 27.55  ? 124 GLY A C   1 
ATOM   965   O  O   . GLY A  1 124 ? 1.421   -29.891 39.763  1.00 19.55  ? 124 GLY A O   1 
ATOM   966   N  N   . ASP A  1 125 ? 3.258   -30.850 38.977  1.00 23.30  ? 125 ASP A N   1 
ATOM   967   C  CA  . ASP A  1 125 ? 3.896   -29.547 38.892  1.00 12.79  ? 125 ASP A CA  1 
ATOM   968   C  C   . ASP A  1 125 ? 3.692   -29.101 37.454  1.00 11.25  ? 125 ASP A C   1 
ATOM   969   O  O   . ASP A  1 125 ? 4.557   -29.359 36.599  1.00 12.74  ? 125 ASP A O   1 
ATOM   970   C  CB  . ASP A  1 125 ? 5.399   -29.692 39.109  1.00 3.27   ? 125 ASP A CB  1 
ATOM   971   C  CG  . ASP A  1 125 ? 6.113   -28.386 39.004  1.00 22.37  ? 125 ASP A CG  1 
ATOM   972   O  OD1 . ASP A  1 125 ? 5.524   -27.411 38.478  1.00 21.44  ? 125 ASP A OD1 1 
ATOM   973   O  OD2 . ASP A  1 125 ? 7.242   -28.411 39.530  1.00 13.73  ? 125 ASP A OD2 1 
ATOM   974   N  N   . ASP A  1 126 ? 2.549   -28.470 37.216  1.00 7.65   ? 126 ASP A N   1 
ATOM   975   C  CA  . ASP A  1 126 ? 2.136   -28.035 35.894  1.00 9.57   ? 126 ASP A CA  1 
ATOM   976   C  C   . ASP A  1 126 ? 3.117   -27.055 35.281  1.00 6.14   ? 126 ASP A C   1 
ATOM   977   O  O   . ASP A  1 126 ? 3.447   -27.159 34.113  1.00 8.54   ? 126 ASP A O   1 
ATOM   978   C  CB  . ASP A  1 126 ? 0.799   -27.317 36.024  1.00 17.65  ? 126 ASP A CB  1 
ATOM   979   C  CG  . ASP A  1 126 ? -0.179  -28.085 36.877  1.00 39.59  ? 126 ASP A CG  1 
ATOM   980   O  OD1 . ASP A  1 126 ? -0.615  -29.135 36.384  1.00 40.09  ? 126 ASP A OD1 1 
ATOM   981   O  OD2 . ASP A  1 126 ? -0.365  -27.714 38.052  1.00 51.36  ? 126 ASP A OD2 1 
ATOM   982   N  N   . VAL A  1 127 ? 3.609   -26.115 36.069  1.00 1.01   ? 127 VAL A N   1 
ATOM   983   C  CA  . VAL A  1 127 ? 4.562   -25.189 35.511  1.00 2.16   ? 127 VAL A CA  1 
ATOM   984   C  C   . VAL A  1 127 ? 5.833   -25.885 35.010  1.00 8.24   ? 127 VAL A C   1 
ATOM   985   O  O   . VAL A  1 127 ? 6.201   -25.687 33.841  1.00 11.43  ? 127 VAL A O   1 
ATOM   986   C  CB  . VAL A  1 127 ? 4.854   -24.086 36.524  1.00 4.46   ? 127 VAL A CB  1 
ATOM   987   C  CG1 . VAL A  1 127 ? 6.148   -23.362 36.131  1.00 2.54   ? 127 VAL A CG1 1 
ATOM   988   C  CG2 . VAL A  1 127 ? 3.673   -23.153 36.601  1.00 1.00   ? 127 VAL A CG2 1 
ATOM   989   N  N   . THR A  1 128 ? 6.494   -26.708 35.822  1.00 2.08   ? 128 THR A N   1 
ATOM   990   C  CA  . THR A  1 128 ? 7.713   -27.344 35.307  1.00 1.00   ? 128 THR A CA  1 
ATOM   991   C  C   . THR A  1 128 ? 7.408   -28.227 34.110  1.00 6.04   ? 128 THR A C   1 
ATOM   992   O  O   . THR A  1 128 ? 8.204   -28.298 33.175  1.00 6.69   ? 128 THR A O   1 
ATOM   993   C  CB  . THR A  1 128 ? 8.360   -28.182 36.388  1.00 1.48   ? 128 THR A CB  1 
ATOM   994   O  OG1 . THR A  1 128 ? 8.565   -27.328 37.504  1.00 6.52   ? 128 THR A OG1 1 
ATOM   995   C  CG2 . THR A  1 128 ? 9.669   -28.766 35.956  1.00 1.00   ? 128 THR A CG2 1 
ATOM   996   N  N   . ASN A  1 129 ? 6.238   -28.865 34.131  1.00 1.77   ? 129 ASN A N   1 
ATOM   997   C  CA  . ASN A  1 129 ? 5.809   -29.727 33.039  1.00 1.00   ? 129 ASN A CA  1 
ATOM   998   C  C   . ASN A  1 129 ? 5.785   -28.959 31.722  1.00 2.84   ? 129 ASN A C   1 
ATOM   999   O  O   . ASN A  1 129 ? 6.235   -29.436 30.664  1.00 3.18   ? 129 ASN A O   1 
ATOM   1000  C  CB  . ASN A  1 129 ? 4.385   -30.192 33.347  1.00 3.06   ? 129 ASN A CB  1 
ATOM   1001  C  CG  . ASN A  1 129 ? 3.810   -31.137 32.304  1.00 8.12   ? 129 ASN A CG  1 
ATOM   1002  O  OD1 . ASN A  1 129 ? 2.860   -30.786 31.614  1.00 27.08  ? 129 ASN A OD1 1 
ATOM   1003  N  ND2 . ASN A  1 129 ? 4.330   -32.349 32.234  1.00 3.00   ? 129 ASN A ND2 1 
ATOM   1004  N  N   . ASP A  1 130 ? 5.177   -27.777 31.799  1.00 1.00   ? 130 ASP A N   1 
ATOM   1005  C  CA  . ASP A  1 130 ? 5.116   -26.963 30.584  1.00 5.81   ? 130 ASP A CA  1 
ATOM   1006  C  C   . ASP A  1 130 ? 6.516   -26.528 30.113  1.00 7.59   ? 130 ASP A C   1 
ATOM   1007  O  O   . ASP A  1 130 ? 6.763   -26.461 28.906  1.00 10.35  ? 130 ASP A O   1 
ATOM   1008  C  CB  . ASP A  1 130 ? 4.148   -25.770 30.664  1.00 10.66  ? 130 ASP A CB  1 
ATOM   1009  C  CG  . ASP A  1 130 ? 2.799   -26.010 29.960  1.00 57.56  ? 130 ASP A CG  1 
ATOM   1010  O  OD1 . ASP A  1 130 ? 2.365   -27.152 29.710  1.00 57.47  ? 130 ASP A OD1 1 
ATOM   1011  O  OD2 . ASP A  1 130 ? 2.145   -25.008 29.611  1.00 94.39  ? 130 ASP A OD2 1 
ATOM   1012  N  N   . MET A  1 131 ? 7.410   -26.199 31.043  1.00 2.88   ? 131 MET A N   1 
ATOM   1013  C  CA  . MET A  1 131 ? 8.726   -25.743 30.648  1.00 6.02   ? 131 MET A CA  1 
ATOM   1014  C  C   . MET A  1 131 ? 9.410   -26.826 29.831  1.00 4.07   ? 131 MET A C   1 
ATOM   1015  O  O   . MET A  1 131 ? 9.971   -26.605 28.758  1.00 3.22   ? 131 MET A O   1 
ATOM   1016  C  CB  . MET A  1 131 ? 9.628   -25.728 31.865  1.00 12.74  ? 131 MET A CB  1 
ATOM   1017  C  CG  . MET A  1 131 ? 9.887   -24.453 32.637  1.00 18.14  ? 131 MET A CG  1 
ATOM   1018  S  SD  . MET A  1 131 ? 11.622  -24.543 33.223  1.00 15.86  ? 131 MET A SD  1 
ATOM   1019  C  CE  . MET A  1 131 ? 11.859  -26.279 33.672  1.00 13.50  ? 131 MET A CE  1 
ATOM   1020  N  N   . LEU A  1 132 ? 9.444   -27.997 30.437  1.00 2.74   ? 132 LEU A N   1 
ATOM   1021  C  CA  . LEU A  1 132 ? 10.098  -29.091 29.769  1.00 4.19   ? 132 LEU A CA  1 
ATOM   1022  C  C   . LEU A  1 132 ? 9.481   -29.349 28.406  1.00 7.29   ? 132 LEU A C   1 
ATOM   1023  O  O   . LEU A  1 132 ? 10.187  -29.665 27.457  1.00 7.51   ? 132 LEU A O   1 
ATOM   1024  C  CB  . LEU A  1 132 ? 9.916   -30.298 30.664  1.00 5.32   ? 132 LEU A CB  1 
ATOM   1025  C  CG  . LEU A  1 132 ? 11.001  -30.644 31.677  1.00 10.52  ? 132 LEU A CG  1 
ATOM   1026  C  CD1 . LEU A  1 132 ? 11.989  -29.498 31.838  1.00 7.13   ? 132 LEU A CD1 1 
ATOM   1027  C  CD2 . LEU A  1 132 ? 10.457  -31.045 33.051  1.00 5.55   ? 132 LEU A CD2 1 
ATOM   1028  N  N   . ILE A  1 133 ? 8.167   -29.214 28.289  1.00 2.35   ? 133 ILE A N   1 
ATOM   1029  C  CA  . ILE A  1 133 ? 7.532   -29.504 27.010  1.00 3.20   ? 133 ILE A CA  1 
ATOM   1030  C  C   . ILE A  1 133 ? 7.988   -28.527 25.954  1.00 8.41   ? 133 ILE A C   1 
ATOM   1031  O  O   . ILE A  1 133 ? 8.260   -28.875 24.813  1.00 7.42   ? 133 ILE A O   1 
ATOM   1032  C  CB  . ILE A  1 133 ? 6.022   -29.527 27.089  1.00 5.87   ? 133 ILE A CB  1 
ATOM   1033  C  CG1 . ILE A  1 133 ? 5.621   -30.620 28.078  1.00 8.49   ? 133 ILE A CG1 1 
ATOM   1034  C  CG2 . ILE A  1 133 ? 5.461   -29.723 25.715  1.00 2.03   ? 133 ILE A CG2 1 
ATOM   1035  C  CD1 . ILE A  1 133 ? 4.123   -30.770 28.293  1.00 1.46   ? 133 ILE A CD1 1 
ATOM   1036  N  N   . ALA A  1 134 ? 8.112   -27.276 26.370  1.00 4.17   ? 134 ALA A N   1 
ATOM   1037  C  CA  . ALA A  1 134 ? 8.588   -26.267 25.413  1.00 4.01   ? 134 ALA A CA  1 
ATOM   1038  C  C   . ALA A  1 134 ? 10.025  -26.512 24.962  1.00 6.01   ? 134 ALA A C   1 
ATOM   1039  O  O   . ALA A  1 134 ? 10.317  -26.391 23.768  1.00 8.89   ? 134 ALA A O   1 
ATOM   1040  C  CB  . ALA A  1 134 ? 8.438   -24.892 25.993  1.00 1.54   ? 134 ALA A CB  1 
ATOM   1041  N  N   . PHE A  1 135 ? 10.875  -26.913 25.916  1.00 1.58   ? 135 PHE A N   1 
ATOM   1042  C  CA  . PHE A  1 135 ? 12.265  -27.247 25.596  1.00 2.20   ? 135 PHE A CA  1 
ATOM   1043  C  C   . PHE A  1 135 ? 12.253  -28.451 24.680  1.00 4.77   ? 135 PHE A C   1 
ATOM   1044  O  O   . PHE A  1 135 ? 13.005  -28.518 23.716  1.00 7.56   ? 135 PHE A O   1 
ATOM   1045  C  CB  . PHE A  1 135 ? 13.079  -27.614 26.832  1.00 8.73   ? 135 PHE A CB  1 
ATOM   1046  C  CG  . PHE A  1 135 ? 13.262  -26.492 27.801  1.00 18.05  ? 135 PHE A CG  1 
ATOM   1047  C  CD1 . PHE A  1 135 ? 12.909  -25.193 27.498  1.00 22.10  ? 135 PHE A CD1 1 
ATOM   1048  C  CD2 . PHE A  1 135 ? 13.786  -26.742 29.053  1.00 22.55  ? 135 PHE A CD2 1 
ATOM   1049  C  CE1 . PHE A  1 135 ? 13.132  -24.180 28.422  1.00 21.54  ? 135 PHE A CE1 1 
ATOM   1050  C  CE2 . PHE A  1 135 ? 14.025  -25.736 29.968  1.00 18.35  ? 135 PHE A CE2 1 
ATOM   1051  C  CZ  . PHE A  1 135 ? 13.684  -24.440 29.658  1.00 12.54  ? 135 PHE A CZ  1 
ATOM   1052  N  N   . LYS A  1 136 ? 11.395  -29.421 24.955  1.00 3.14   ? 136 LYS A N   1 
ATOM   1053  C  CA  . LYS A  1 136 ? 11.405  -30.569 24.073  1.00 4.00   ? 136 LYS A CA  1 
ATOM   1054  C  C   . LYS A  1 136 ? 11.035  -30.199 22.654  1.00 3.05   ? 136 LYS A C   1 
ATOM   1055  O  O   . LYS A  1 136 ? 11.567  -30.679 21.646  1.00 2.89   ? 136 LYS A O   1 
ATOM   1056  C  CB  . LYS A  1 136 ? 10.453  -31.630 24.609  1.00 1.81   ? 136 LYS A CB  1 
ATOM   1057  C  CG  . LYS A  1 136 ? 10.759  -32.930 23.896  1.00 9.46   ? 136 LYS A CG  1 
ATOM   1058  C  CD  . LYS A  1 136 ? 10.110  -34.197 24.447  1.00 5.94   ? 136 LYS A CD  1 
ATOM   1059  C  CE  . LYS A  1 136 ? 8.875   -34.583 23.647  1.00 42.35  ? 136 LYS A CE  1 
ATOM   1060  N  NZ  . LYS A  1 136 ? 9.157   -35.126 22.305  1.00 15.55  ? 136 LYS A NZ  1 
ATOM   1061  N  N   . ALA A  1 137 ? 10.063  -29.313 22.561  1.00 1.36   ? 137 ALA A N   1 
ATOM   1062  C  CA  . ALA A  1 137 ? 9.564   -28.939 21.257  1.00 2.65   ? 137 ALA A CA  1 
ATOM   1063  C  C   . ALA A  1 137 ? 10.718  -28.501 20.417  1.00 6.30   ? 137 ALA A C   1 
ATOM   1064  O  O   . ALA A  1 137 ? 10.853  -28.953 19.307  1.00 7.46   ? 137 ALA A O   1 
ATOM   1065  C  CB  . ALA A  1 137 ? 8.560   -27.786 21.413  1.00 1.00   ? 137 ALA A CB  1 
ATOM   1066  N  N   . SER A  1 138 ? 11.579  -27.678 20.987  1.00 1.00   ? 138 SER A N   1 
ATOM   1067  C  CA  . SER A  1 138 ? 12.743  -27.151 20.286  1.00 1.00   ? 138 SER A CA  1 
ATOM   1068  C  C   . SER A  1 138 ? 13.811  -28.194 19.938  1.00 5.61   ? 138 SER A C   1 
ATOM   1069  O  O   . SER A  1 138 ? 14.358  -28.263 18.835  1.00 2.62   ? 138 SER A O   1 
ATOM   1070  C  CB  . SER A  1 138 ? 13.360  -25.996 21.102  1.00 1.36   ? 138 SER A CB  1 
ATOM   1071  O  OG  . SER A  1 138 ? 14.606  -25.675 20.537  1.00 36.30  ? 138 SER A OG  1 
ATOM   1072  N  N   . ILE A  1 139 ? 14.056  -29.071 20.901  1.00 1.88   ? 139 ILE A N   1 
ATOM   1073  C  CA  . ILE A  1 139 ? 15.056  -30.098 20.683  1.00 2.30   ? 139 ILE A CA  1 
ATOM   1074  C  C   . ILE A  1 139 ? 14.647  -30.974 19.522  1.00 5.32   ? 139 ILE A C   1 
ATOM   1075  O  O   . ILE A  1 139 ? 15.484  -31.338 18.688  1.00 4.82   ? 139 ILE A O   1 
ATOM   1076  C  CB  . ILE A  1 139 ? 15.191  -30.930 21.937  1.00 5.21   ? 139 ILE A CB  1 
ATOM   1077  C  CG1 . ILE A  1 139 ? 15.882  -30.106 23.012  1.00 4.09   ? 139 ILE A CG1 1 
ATOM   1078  C  CG2 . ILE A  1 139 ? 15.903  -32.247 21.640  1.00 3.14   ? 139 ILE A CG2 1 
ATOM   1079  C  CD1 . ILE A  1 139 ? 15.712  -30.729 24.392  1.00 6.55   ? 139 ILE A CD1 1 
ATOM   1080  N  N   . ASP A  1 140 ? 13.351  -31.270 19.459  1.00 2.20   ? 140 ASP A N   1 
ATOM   1081  C  CA  . ASP A  1 140 ? 12.826  -32.119 18.395  1.00 3.15   ? 140 ASP A CA  1 
ATOM   1082  C  C   . ASP A  1 140 ? 13.077  -31.486 17.034  1.00 6.33   ? 140 ASP A C   1 
ATOM   1083  O  O   . ASP A  1 140 ? 13.413  -32.164 16.043  1.00 7.31   ? 140 ASP A O   1 
ATOM   1084  C  CB  . ASP A  1 140 ? 11.326  -32.346 18.594  1.00 9.57   ? 140 ASP A CB  1 
ATOM   1085  C  CG  . ASP A  1 140 ? 11.004  -33.344 19.698  1.00 20.54  ? 140 ASP A CG  1 
ATOM   1086  O  OD1 . ASP A  1 140 ? 11.862  -34.170 20.048  1.00 11.48  ? 140 ASP A OD1 1 
ATOM   1087  O  OD2 . ASP A  1 140 ? 9.881   -33.330 20.237  1.00 14.66  ? 140 ASP A OD2 1 
ATOM   1088  N  N   . LYS A  1 141 ? 12.867  -30.175 16.980  1.00 5.87   ? 141 LYS A N   1 
ATOM   1089  C  CA  . LYS A  1 141 ? 13.055  -29.453 15.723  1.00 3.20   ? 141 LYS A CA  1 
ATOM   1090  C  C   . LYS A  1 141 ? 14.543  -29.480 15.375  1.00 4.17   ? 141 LYS A C   1 
ATOM   1091  O  O   . LYS A  1 141 ? 14.915  -29.777 14.233  1.00 7.81   ? 141 LYS A O   1 
ATOM   1092  C  CB  . LYS A  1 141 ? 12.569  -28.021 15.877  1.00 5.60   ? 141 LYS A CB  1 
ATOM   1093  C  CG  . LYS A  1 141 ? 12.613  -27.177 14.598  1.00 45.93  ? 141 LYS A CG  1 
ATOM   1094  C  CD  . LYS A  1 141 ? 12.371  -25.735 14.971  1.00 83.98  ? 141 LYS A CD  1 
ATOM   1095  C  CE  . LYS A  1 141 ? 12.571  -24.752 13.842  0.00 100.00 ? 141 LYS A CE  1 
ATOM   1096  N  NZ  . LYS A  1 141 ? 11.510  -24.814 12.804  0.00 100.00 ? 141 LYS A NZ  1 
ATOM   1097  N  N   . HIS A  1 142 ? 15.413  -29.245 16.354  1.00 2.96   ? 142 HIS A N   1 
ATOM   1098  C  CA  . HIS A  1 142 ? 16.834  -29.314 16.054  1.00 3.03   ? 142 HIS A CA  1 
ATOM   1099  C  C   . HIS A  1 142 ? 17.192  -30.724 15.597  1.00 6.69   ? 142 HIS A C   1 
ATOM   1100  O  O   . HIS A  1 142 ? 17.947  -30.940 14.637  1.00 6.38   ? 142 HIS A O   1 
ATOM   1101  C  CB  . HIS A  1 142 ? 17.640  -29.097 17.301  1.00 3.92   ? 142 HIS A CB  1 
ATOM   1102  C  CG  . HIS A  1 142 ? 17.601  -27.687 17.762  1.00 5.56   ? 142 HIS A CG  1 
ATOM   1103  N  ND1 . HIS A  1 142 ? 17.888  -26.640 16.910  1.00 8.35   ? 142 HIS A ND1 1 
ATOM   1104  C  CD2 . HIS A  1 142 ? 17.363  -27.146 18.980  1.00 6.68   ? 142 HIS A CD2 1 
ATOM   1105  C  CE1 . HIS A  1 142 ? 17.814  -25.505 17.579  1.00 5.99   ? 142 HIS A CE1 1 
ATOM   1106  N  NE2 . HIS A  1 142 ? 17.462  -25.785 18.824  1.00 6.73   ? 142 HIS A NE2 1 
ATOM   1107  N  N   . ILE A  1 143 ? 16.679  -31.712 16.312  1.00 1.78   ? 143 ILE A N   1 
ATOM   1108  C  CA  . ILE A  1 143 ? 16.982  -33.051 15.854  1.00 4.12   ? 143 ILE A CA  1 
ATOM   1109  C  C   . ILE A  1 143 ? 16.593  -33.251 14.376  1.00 9.16   ? 143 ILE A C   1 
ATOM   1110  O  O   . ILE A  1 143 ? 17.371  -33.765 13.566  1.00 4.13   ? 143 ILE A O   1 
ATOM   1111  C  CB  . ILE A  1 143 ? 16.328  -34.071 16.773  1.00 9.29   ? 143 ILE A CB  1 
ATOM   1112  C  CG1 . ILE A  1 143 ? 16.996  -34.049 18.152  1.00 2.90   ? 143 ILE A CG1 1 
ATOM   1113  C  CG2 . ILE A  1 143 ? 16.385  -35.453 16.124  1.00 8.29   ? 143 ILE A CG2 1 
ATOM   1114  C  CD1 . ILE A  1 143 ? 16.299  -34.982 19.139  1.00 1.54   ? 143 ILE A CD1 1 
ATOM   1115  N  N   . TRP A  1 144 ? 15.426  -32.775 13.960  1.00 4.15   ? 144 TRP A N   1 
ATOM   1116  C  CA  . TRP A  1 144 ? 15.055  -32.917 12.543  1.00 1.47   ? 144 TRP A CA  1 
ATOM   1117  C  C   . TRP A  1 144 ? 16.083  -32.251 11.640  1.00 7.34   ? 144 TRP A C   1 
ATOM   1118  O  O   . TRP A  1 144 ? 16.628  -32.848 10.740  1.00 9.66   ? 144 TRP A O   1 
ATOM   1119  C  CB  . TRP A  1 144 ? 13.638  -32.395 12.294  1.00 1.47   ? 144 TRP A CB  1 
ATOM   1120  C  CG  . TRP A  1 144 ? 13.369  -31.914 10.924  1.00 5.51   ? 144 TRP A CG  1 
ATOM   1121  C  CD1 . TRP A  1 144 ? 13.537  -32.618 9.781   1.00 10.46  ? 144 TRP A CD1 1 
ATOM   1122  C  CD2 . TRP A  1 144 ? 12.963  -30.603 10.524  1.00 4.30   ? 144 TRP A CD2 1 
ATOM   1123  N  NE1 . TRP A  1 144 ? 13.279  -31.831 8.680   1.00 8.06   ? 144 TRP A NE1 1 
ATOM   1124  C  CE2 . TRP A  1 144 ? 12.913  -30.590 9.122   1.00 7.40   ? 144 TRP A CE2 1 
ATOM   1125  C  CE3 . TRP A  1 144 ? 12.594  -29.459 11.224  1.00 4.77   ? 144 TRP A CE3 1 
ATOM   1126  C  CZ2 . TRP A  1 144 ? 12.518  -29.476 8.393   1.00 6.83   ? 144 TRP A CZ2 1 
ATOM   1127  C  CZ3 . TRP A  1 144 ? 12.265  -28.336 10.501  1.00 6.03   ? 144 TRP A CZ3 1 
ATOM   1128  C  CH2 . TRP A  1 144 ? 12.257  -28.341 9.107   1.00 6.62   ? 144 TRP A CH2 1 
ATOM   1129  N  N   . MET A  1 145 ? 16.431  -31.012 11.947  1.00 5.21   ? 145 MET A N   1 
ATOM   1130  C  CA  . MET A  1 145 ? 17.376  -30.263 11.138  1.00 3.34   ? 145 MET A CA  1 
ATOM   1131  C  C   . MET A  1 145 ? 18.786  -30.828 11.068  1.00 9.20   ? 145 MET A C   1 
ATOM   1132  O  O   . MET A  1 145 ? 19.405  -30.889 10.003  1.00 6.14   ? 145 MET A O   1 
ATOM   1133  C  CB  . MET A  1 145 ? 17.346  -28.788 11.516  1.00 3.01   ? 145 MET A CB  1 
ATOM   1134  C  CG  . MET A  1 145 ? 15.997  -28.119 11.366  1.00 7.29   ? 145 MET A CG  1 
ATOM   1135  S  SD  . MET A  1 145 ? 16.112  -26.334 11.591  1.00 11.60  ? 145 MET A SD  1 
ATOM   1136  C  CE  . MET A  1 145 ? 16.409  -26.335 13.333  1.00 21.16  ? 145 MET A CE  1 
ATOM   1137  N  N   . PHE A  1 146 ? 19.312  -31.253 12.202  1.00 4.48   ? 146 PHE A N   1 
ATOM   1138  C  CA  . PHE A  1 146 ? 20.657  -31.782 12.127  1.00 6.20   ? 146 PHE A CA  1 
ATOM   1139  C  C   . PHE A  1 146 ? 20.676  -33.107 11.406  1.00 9.90   ? 146 PHE A C   1 
ATOM   1140  O  O   . PHE A  1 146 ? 21.572  -33.370 10.609  1.00 8.42   ? 146 PHE A O   1 
ATOM   1141  C  CB  . PHE A  1 146 ? 21.394  -31.768 13.444  1.00 6.62   ? 146 PHE A CB  1 
ATOM   1142  C  CG  . PHE A  1 146 ? 21.834  -30.390 13.820  1.00 9.37   ? 146 PHE A CG  1 
ATOM   1143  C  CD1 . PHE A  1 146 ? 22.966  -29.840 13.254  1.00 8.97   ? 146 PHE A CD1 1 
ATOM   1144  C  CD2 . PHE A  1 146 ? 21.072  -29.603 14.687  1.00 9.76   ? 146 PHE A CD2 1 
ATOM   1145  C  CE1 . PHE A  1 146 ? 23.382  -28.557 13.610  1.00 8.25   ? 146 PHE A CE1 1 
ATOM   1146  C  CE2 . PHE A  1 146 ? 21.476  -28.304 15.019  1.00 12.28  ? 146 PHE A CE2 1 
ATOM   1147  C  CZ  . PHE A  1 146 ? 22.631  -27.782 14.470  1.00 9.84   ? 146 PHE A CZ  1 
ATOM   1148  N  N   . LYS A  1 147 ? 19.656  -33.934 11.606  1.00 3.85   ? 147 LYS A N   1 
ATOM   1149  C  CA  . LYS A  1 147 ? 19.557  -35.189 10.855  1.00 2.80   ? 147 LYS A CA  1 
ATOM   1150  C  C   . LYS A  1 147 ? 19.425  -34.924 9.369   1.00 9.47   ? 147 LYS A C   1 
ATOM   1151  O  O   . LYS A  1 147 ? 20.071  -35.605 8.572   1.00 9.30   ? 147 LYS A O   1 
ATOM   1152  C  CB  . LYS A  1 147 ? 18.441  -36.097 11.378  1.00 5.70   ? 147 LYS A CB  1 
ATOM   1153  C  CG  . LYS A  1 147 ? 18.820  -36.709 12.720  1.00 7.63   ? 147 LYS A CG  1 
ATOM   1154  C  CD  . LYS A  1 147 ? 18.484  -38.195 12.816  1.00 26.66  ? 147 LYS A CD  1 
ATOM   1155  C  CE  . LYS A  1 147 ? 19.308  -38.838 13.930  1.00 14.26  ? 147 LYS A CE  1 
ATOM   1156  N  NZ  . LYS A  1 147 ? 19.211  -40.317 13.997  1.00 60.82  ? 147 LYS A NZ  1 
ATOM   1157  N  N   . ALA A  1 148 ? 18.641  -33.918 8.989   1.00 5.23   ? 148 ALA A N   1 
ATOM   1158  C  CA  . ALA A  1 148 ? 18.501  -33.606 7.559   1.00 4.40   ? 148 ALA A CA  1 
ATOM   1159  C  C   . ALA A  1 148 ? 19.859  -33.205 6.972   1.00 8.04   ? 148 ALA A C   1 
ATOM   1160  O  O   . ALA A  1 148 ? 20.232  -33.674 5.902   1.00 5.88   ? 148 ALA A O   1 
ATOM   1161  C  CB  . ALA A  1 148 ? 17.496  -32.527 7.313   1.00 2.60   ? 148 ALA A CB  1 
ATOM   1162  N  N   . PHE A  1 149 ? 20.623  -32.384 7.692   1.00 6.44   ? 149 PHE A N   1 
ATOM   1163  C  CA  . PHE A  1 149 ? 21.980  -31.974 7.323   1.00 3.36   ? 149 PHE A CA  1 
ATOM   1164  C  C   . PHE A  1 149 ? 22.812  -33.257 7.100   1.00 14.60  ? 149 PHE A C   1 
ATOM   1165  O  O   . PHE A  1 149 ? 23.543  -33.397 6.133   1.00 13.12  ? 149 PHE A O   1 
ATOM   1166  C  CB  . PHE A  1 149 ? 22.598  -31.149 8.479   1.00 4.24   ? 149 PHE A CB  1 
ATOM   1167  C  CG  . PHE A  1 149 ? 24.074  -30.900 8.321   1.00 8.20   ? 149 PHE A CG  1 
ATOM   1168  C  CD1 . PHE A  1 149 ? 24.531  -29.910 7.486   1.00 6.45   ? 149 PHE A CD1 1 
ATOM   1169  C  CD2 . PHE A  1 149 ? 25.018  -31.731 8.925   1.00 8.05   ? 149 PHE A CD2 1 
ATOM   1170  C  CE1 . PHE A  1 149 ? 25.889  -29.734 7.271   1.00 4.71   ? 149 PHE A CE1 1 
ATOM   1171  C  CE2 . PHE A  1 149 ? 26.377  -31.585 8.703   1.00 5.93   ? 149 PHE A CE2 1 
ATOM   1172  C  CZ  . PHE A  1 149 ? 26.810  -30.580 7.858   1.00 5.51   ? 149 PHE A CZ  1 
ATOM   1173  N  N   . LEU A  1 150 ? 22.699  -34.236 7.991   1.00 10.83  ? 150 LEU A N   1 
ATOM   1174  C  CA  . LEU A  1 150 ? 23.419  -35.485 7.875   1.00 7.58   ? 150 LEU A CA  1 
ATOM   1175  C  C   . LEU A  1 150 ? 22.841  -36.429 6.854   1.00 21.14  ? 150 LEU A C   1 
ATOM   1176  O  O   . LEU A  1 150 ? 23.318  -37.544 6.714   1.00 18.97  ? 150 LEU A O   1 
ATOM   1177  C  CB  . LEU A  1 150 ? 23.366  -36.148 9.240   1.00 4.58   ? 150 LEU A CB  1 
ATOM   1178  C  CG  . LEU A  1 150 ? 24.230  -35.460 10.305  1.00 8.48   ? 150 LEU A CG  1 
ATOM   1179  C  CD1 . LEU A  1 150 ? 23.984  -36.104 11.653  1.00 9.22   ? 150 LEU A CD1 1 
ATOM   1180  C  CD2 . LEU A  1 150 ? 25.683  -35.696 9.913   1.00 6.94   ? 150 LEU A CD2 1 
ATOM   1181  N  N   . GLY A  1 151 ? 21.802  -36.020 6.146   1.00 14.01  ? 151 GLY A N   1 
ATOM   1182  C  CA  . GLY A  1 151 ? 21.175  -36.871 5.127   1.00 9.88   ? 151 GLY A CA  1 
ATOM   1183  C  C   . GLY A  1 151 ? 20.193  -37.925 5.678   1.00 17.58  ? 151 GLY A C   1 
ATOM   1184  O  O   . GLY A  1 151 ? 19.774  -38.836 4.953   1.00 23.91  ? 151 GLY A O   1 
ATOM   1185  N  N   . LYS A  1 152 ? 19.833  -37.813 6.959   1.00 16.01  ? 152 LYS A N   1 
ATOM   1186  C  CA  . LYS A  1 152 ? 18.970  -38.793 7.598   1.00 9.78   ? 152 LYS A CA  1 
ATOM   1187  C  C   . LYS A  1 152 ? 17.557  -38.272 7.867   1.00 17.34  ? 152 LYS A C   1 
ATOM   1188  O  O   . LYS A  1 152 ? 17.280  -37.069 7.800   1.00 15.41  ? 152 LYS A O   1 
ATOM   1189  C  CB  . LYS A  1 152 ? 19.650  -39.314 8.893   1.00 14.35  ? 152 LYS A CB  1 
ATOM   1190  C  CG  . LYS A  1 152 ? 21.017  -39.987 8.698   1.00 62.80  ? 152 LYS A CG  1 
ATOM   1191  C  CD  . LYS A  1 152 ? 20.840  -41.146 7.738   0.00 100.00 ? 152 LYS A CD  1 
ATOM   1192  C  CE  . LYS A  1 152 ? 22.126  -41.820 7.304   0.00 100.00 ? 152 LYS A CE  1 
ATOM   1193  N  NZ  . LYS A  1 152 ? 21.862  -42.843 6.263   0.00 100.00 ? 152 LYS A NZ  1 
ATOM   1194  N  N   . ALA A  1 153 ? 16.656  -39.199 8.180   1.00 15.81  ? 153 ALA A N   1 
ATOM   1195  C  CA  . ALA A  1 153 ? 15.303  -38.868 8.592   1.00 10.11  ? 153 ALA A CA  1 
ATOM   1196  C  C   . ALA A  1 153 ? 15.424  -38.613 10.092  1.00 14.50  ? 153 ALA A C   1 
ATOM   1197  O  O   . ALA A  1 153 ? 16.334  -39.152 10.750  1.00 11.17  ? 153 ALA A O   1 
ATOM   1198  C  CB  . ALA A  1 153 ? 14.393  -40.062 8.379   1.00 7.96   ? 153 ALA A CB  1 
ATOM   1199  N  N   . PRO A  1 154 ? 14.557  -37.822 10.682  1.00 15.07  ? 154 PRO A N   1 
ATOM   1200  C  CA  . PRO A  1 154 ? 14.668  -37.460 12.088  1.00 10.30  ? 154 PRO A CA  1 
ATOM   1201  C  C   . PRO A  1 154 ? 14.733  -38.599 13.067  1.00 13.75  ? 154 PRO A C   1 
ATOM   1202  O  O   . PRO A  1 154 ? 15.628  -38.597 13.965  1.00 18.03  ? 154 PRO A O   1 
ATOM   1203  C  CB  . PRO A  1 154 ? 13.488  -36.565 12.326  1.00 10.69  ? 154 PRO A CB  1 
ATOM   1204  C  CG  . PRO A  1 154 ? 12.728  -36.437 11.010  1.00 12.39  ? 154 PRO A CG  1 
ATOM   1205  C  CD  . PRO A  1 154 ? 13.427  -37.246 9.958   1.00 10.10  ? 154 PRO A CD  1 
ATOM   1206  N  N   . LEU A  1 155 ? 13.849  -39.552 12.969  1.00 19.46  ? 155 LEU A N   1 
ATOM   1207  C  CA  . LEU A  1 155 ? 13.844  -40.640 13.954  1.00 19.41  ? 155 LEU A CA  1 
ATOM   1208  C  C   . LEU A  1 155 ? 14.618  -41.840 13.441  1.00 44.33  ? 155 LEU A C   1 
ATOM   1209  O  O   . LEU A  1 155 ? 14.770  -42.853 14.137  1.00 36.29  ? 155 LEU A O   1 
ATOM   1210  C  CB  . LEU A  1 155 ? 12.416  -41.014 14.279  1.00 18.60  ? 155 LEU A CB  1 
ATOM   1211  C  CG  . LEU A  1 155 ? 11.630  -39.799 14.755  1.00 27.44  ? 155 LEU A CG  1 
ATOM   1212  C  CD1 . LEU A  1 155 ? 10.214  -40.139 15.202  1.00 23.33  ? 155 LEU A CD1 1 
ATOM   1213  C  CD2 . LEU A  1 155 ? 12.292  -39.095 15.943  1.00 18.87  ? 155 LEU A CD2 1 
ATOM   1214  N  N   . GLU A  1 156 ? 15.099  -41.701 12.235  1.00 37.75  ? 156 GLU A N   1 
ATOM   1215  C  CA  . GLU A  1 156 ? 15.871  -42.760 11.616  1.00 49.84  ? 156 GLU A CA  1 
ATOM   1216  C  C   . GLU A  1 156 ? 17.322  -42.784 12.206  1.00 61.48  ? 156 GLU A C   1 
ATOM   1217  O  O   . GLU A  1 156 ? 17.850  -41.747 12.540  1.00 62.39  ? 156 GLU A O   1 
ATOM   1218  C  CB  . GLU A  1 156 ? 15.980  -42.560 10.105  1.00 58.55  ? 156 GLU A CB  1 
ATOM   1219  C  CG  . GLU A  1 156 ? 16.882  -43.609 9.446   1.00 92.86  ? 156 GLU A CG  1 
ATOM   1220  C  CD  . GLU A  1 156 ? 17.298  -43.246 8.020   0.00 100.00 ? 156 GLU A CD  1 
ATOM   1221  O  OE1 . GLU A  1 156 ? 16.892  -42.143 7.492   0.00 100.00 ? 156 GLU A OE1 1 
ATOM   1222  O  OE2 . GLU A  1 156 ? 18.050  -44.048 7.346   0.00 100.00 ? 156 GLU A OE2 1 
ATOM   1223  N  N   . VAL B  1 7   ? -8.882  40.352  17.821  1.00 75.40  ? 7   VAL B N   1 
ATOM   1224  C  CA  . VAL B  1 7   ? -10.166 39.675  17.267  1.00 74.29  ? 7   VAL B CA  1 
ATOM   1225  C  C   . VAL B  1 7   ? -10.630 38.600  18.240  1.00 68.51  ? 7   VAL B C   1 
ATOM   1226  O  O   . VAL B  1 7   ? -11.098 38.896  19.347  1.00 77.64  ? 7   VAL B O   1 
ATOM   1227  C  CB  . VAL B  1 7   ? -10.023 39.143  15.780  1.00 76.99  ? 7   VAL B CB  1 
ATOM   1228  C  CG1 . VAL B  1 7   ? -11.276 38.420  15.281  1.00 74.53  ? 7   VAL B CG1 1 
ATOM   1229  C  CG2 . VAL B  1 7   ? -9.757  40.258  14.768  1.00 78.83  ? 7   VAL B CG2 1 
ATOM   1230  N  N   . ASP B  1 8   ? -10.524 37.373  17.828  1.00 38.70  ? 8   ASP B N   1 
ATOM   1231  C  CA  . ASP B  1 8   ? -10.882 36.253  18.695  1.00 28.37  ? 8   ASP B CA  1 
ATOM   1232  C  C   . ASP B  1 8   ? -10.023 35.073  18.281  1.00 15.42  ? 8   ASP B C   1 
ATOM   1233  O  O   . ASP B  1 8   ? -9.515  35.018  17.153  1.00 12.32  ? 8   ASP B O   1 
ATOM   1234  C  CB  . ASP B  1 8   ? -12.402 36.016  18.647  1.00 26.30  ? 8   ASP B CB  1 
ATOM   1235  C  CG  . ASP B  1 8   ? -12.866 35.005  17.600  1.00 34.16  ? 8   ASP B CG  1 
ATOM   1236  O  OD1 . ASP B  1 8   ? -12.099 34.696  16.617  1.00 44.63  ? 8   ASP B OD1 1 
ATOM   1237  O  OD2 . ASP B  1 8   ? -14.038 34.469  17.705  1.00 45.61  ? 8   ASP B OD2 1 
ATOM   1238  N  N   . THR B  1 9   ? -9.867  34.172  19.211  1.00 8.53   ? 9   THR B N   1 
ATOM   1239  C  CA  . THR B  1 9   ? -9.001  33.014  19.031  1.00 10.55  ? 9   THR B CA  1 
ATOM   1240  C  C   . THR B  1 9   ? -9.281  32.289  17.718  1.00 10.89  ? 9   THR B C   1 
ATOM   1241  O  O   . THR B  1 9   ? -8.363  31.968  16.956  1.00 8.86   ? 9   THR B O   1 
ATOM   1242  C  CB  . THR B  1 9   ? -9.157  32.051  20.205  1.00 17.97  ? 9   THR B CB  1 
ATOM   1243  O  OG1 . THR B  1 9   ? -8.892  32.735  21.424  1.00 14.89  ? 9   THR B OG1 1 
ATOM   1244  C  CG2 . THR B  1 9   ? -8.190  30.866  20.133  1.00 16.12  ? 9   THR B CG2 1 
ATOM   1245  N  N   . LYS B  1 10  ? -10.535 32.033  17.447  1.00 1.78   ? 10  LYS B N   1 
ATOM   1246  C  CA  . LYS B  1 10  ? -10.889 31.316  16.224  1.00 4.21   ? 10  LYS B CA  1 
ATOM   1247  C  C   . LYS B  1 10  ? -10.343 32.060  15.015  1.00 13.74  ? 10  LYS B C   1 
ATOM   1248  O  O   . LYS B  1 10  ? -9.693  31.483  14.139  1.00 20.35  ? 10  LYS B O   1 
ATOM   1249  C  CB  . LYS B  1 10  ? -12.390 31.168  16.110  1.00 3.13   ? 10  LYS B CB  1 
ATOM   1250  C  CG  . LYS B  1 10  ? -12.958 30.246  17.182  1.00 5.72   ? 10  LYS B CG  1 
ATOM   1251  C  CD  . LYS B  1 10  ? -14.303 29.653  16.789  1.00 10.26  ? 10  LYS B CD  1 
ATOM   1252  C  CE  . LYS B  1 10  ? -15.132 29.224  17.995  1.00 56.00  ? 10  LYS B CE  1 
ATOM   1253  N  NZ  . LYS B  1 10  ? -16.549 29.021  17.669  1.00 93.81  ? 10  LYS B NZ  1 
ATOM   1254  N  N   . GLU B  1 11  ? -10.609 33.341  14.973  1.00 10.67  ? 11  GLU B N   1 
ATOM   1255  C  CA  . GLU B  1 11  ? -10.133 34.148  13.861  1.00 13.13  ? 11  GLU B CA  1 
ATOM   1256  C  C   . GLU B  1 11  ? -8.626  34.119  13.824  1.00 10.67  ? 11  GLU B C   1 
ATOM   1257  O  O   . GLU B  1 11  ? -8.035  34.091  12.743  1.00 11.19  ? 11  GLU B O   1 
ATOM   1258  C  CB  . GLU B  1 11  ? -10.607 35.595  13.993  1.00 18.91  ? 11  GLU B CB  1 
ATOM   1259  C  CG  . GLU B  1 11  ? -11.882 35.871  13.196  1.00 72.50  ? 11  GLU B CG  1 
ATOM   1260  C  CD  . GLU B  1 11  ? -13.058 35.019  13.664  0.00 100.00 ? 11  GLU B CD  1 
ATOM   1261  O  OE1 . GLU B  1 11  ? -13.017 33.737  13.533  0.00 100.00 ? 11  GLU B OE1 1 
ATOM   1262  O  OE2 . GLU B  1 11  ? -14.086 35.583  14.193  0.00 100.00 ? 11  GLU B OE2 1 
ATOM   1263  N  N   . PHE B  1 12  ? -8.033  34.221  15.004  1.00 3.36   ? 12  PHE B N   1 
ATOM   1264  C  CA  . PHE B  1 12  ? -6.577  34.235  15.004  1.00 3.32   ? 12  PHE B CA  1 
ATOM   1265  C  C   . PHE B  1 12  ? -6.056  32.918  14.463  1.00 7.43   ? 12  PHE B C   1 
ATOM   1266  O  O   . PHE B  1 12  ? -5.178  32.865  13.602  1.00 8.36   ? 12  PHE B O   1 
ATOM   1267  C  CB  . PHE B  1 12  ? -6.017  34.447  16.407  1.00 6.79   ? 12  PHE B CB  1 
ATOM   1268  C  CG  . PHE B  1 12  ? -4.517  34.318  16.458  1.00 11.21  ? 12  PHE B CG  1 
ATOM   1269  C  CD1 . PHE B  1 12  ? -3.705  35.399  16.135  1.00 10.91  ? 12  PHE B CD1 1 
ATOM   1270  C  CD2 . PHE B  1 12  ? -3.935  33.093  16.769  1.00 16.56  ? 12  PHE B CD2 1 
ATOM   1271  C  CE1 . PHE B  1 12  ? -2.307  35.267  16.155  1.00 13.77  ? 12  PHE B CE1 1 
ATOM   1272  C  CE2 . PHE B  1 12  ? -2.560  32.952  16.792  1.00 13.66  ? 12  PHE B CE2 1 
ATOM   1273  C  CZ  . PHE B  1 12  ? -1.734  34.032  16.482  1.00 13.95  ? 12  PHE B CZ  1 
ATOM   1274  N  N   . LEU B  1 13  ? -6.609  31.839  14.985  1.00 2.20   ? 13  LEU B N   1 
ATOM   1275  C  CA  . LEU B  1 13  ? -6.072  30.574  14.547  1.00 3.89   ? 13  LEU B CA  1 
ATOM   1276  C  C   . LEU B  1 13  ? -6.222  30.378  13.053  1.00 6.91   ? 13  LEU B C   1 
ATOM   1277  O  O   . LEU B  1 13  ? -5.264  30.030  12.364  1.00 11.61  ? 13  LEU B O   1 
ATOM   1278  C  CB  . LEU B  1 13  ? -6.794  29.478  15.317  1.00 3.15   ? 13  LEU B CB  1 
ATOM   1279  C  CG  . LEU B  1 13  ? -6.042  28.847  16.475  1.00 7.62   ? 13  LEU B CG  1 
ATOM   1280  C  CD1 . LEU B  1 13  ? -4.931  29.664  17.076  1.00 1.64   ? 13  LEU B CD1 1 
ATOM   1281  C  CD2 . LEU B  1 13  ? -7.072  28.418  17.484  1.00 1.00   ? 13  LEU B CD2 1 
ATOM   1282  N  N   . ASN B  1 14  ? -7.400  30.685  12.536  1.00 4.26   ? 14  ASN B N   1 
ATOM   1283  C  CA  . ASN B  1 14  ? -7.599  30.457  11.118  1.00 5.73   ? 14  ASN B CA  1 
ATOM   1284  C  C   . ASN B  1 14  ? -6.645  31.309  10.300  1.00 9.94   ? 14  ASN B C   1 
ATOM   1285  O  O   . ASN B  1 14  ? -6.082  30.889  9.285   1.00 13.57  ? 14  ASN B O   1 
ATOM   1286  C  CB  . ASN B  1 14  ? -9.037  30.747  10.733  1.00 3.52   ? 14  ASN B CB  1 
ATOM   1287  C  CG  . ASN B  1 14  ? -9.567  29.728  9.756   1.00 21.90  ? 14  ASN B CG  1 
ATOM   1288  O  OD1 . ASN B  1 14  ? -8.880  28.791  9.327   1.00 14.41  ? 14  ASN B OD1 1 
ATOM   1289  N  ND2 . ASN B  1 14  ? -10.843 29.880  9.430   1.00 13.43  ? 14  ASN B ND2 1 
ATOM   1290  N  N   . HIS B  1 15  ? -6.405  32.515  10.788  1.00 6.04   ? 15  HIS B N   1 
ATOM   1291  C  CA  . HIS B  1 15  ? -5.469  33.344  10.053  1.00 7.56   ? 15  HIS B CA  1 
ATOM   1292  C  C   . HIS B  1 15  ? -4.114  32.611  9.983   1.00 8.36   ? 15  HIS B C   1 
ATOM   1293  O  O   . HIS B  1 15  ? -3.403  32.699  8.982   1.00 9.72   ? 15  HIS B O   1 
ATOM   1294  C  CB  . HIS B  1 15  ? -5.361  34.729  10.774  1.00 10.13  ? 15  HIS B CB  1 
ATOM   1295  C  CG  . HIS B  1 15  ? -4.456  35.701  10.083  1.00 18.69  ? 15  HIS B CG  1 
ATOM   1296  N  ND1 . HIS B  1 15  ? -3.225  36.074  10.587  1.00 24.20  ? 15  HIS B ND1 1 
ATOM   1297  C  CD2 . HIS B  1 15  ? -4.574  36.298  8.867   1.00 19.49  ? 15  HIS B CD2 1 
ATOM   1298  C  CE1 . HIS B  1 15  ? -2.626  36.862  9.710   1.00 23.29  ? 15  HIS B CE1 1 
ATOM   1299  N  NE2 . HIS B  1 15  ? -3.406  36.991  8.648   1.00 22.00  ? 15  HIS B NE2 1 
ATOM   1300  N  N   . GLN B  1 16  ? -3.712  31.902  11.034  1.00 3.24   ? 16  GLN B N   1 
ATOM   1301  C  CA  . GLN B  1 16  ? -2.402  31.259  11.003  1.00 3.14   ? 16  GLN B CA  1 
ATOM   1302  C  C   . GLN B  1 16  ? -2.450  30.065  10.067  1.00 7.41   ? 16  GLN B C   1 
ATOM   1303  O  O   . GLN B  1 16  ? -1.478  29.772  9.387   1.00 8.55   ? 16  GLN B O   1 
ATOM   1304  C  CB  . GLN B  1 16  ? -1.901  30.919  12.407  1.00 1.52   ? 16  GLN B CB  1 
ATOM   1305  C  CG  . GLN B  1 16  ? -1.791  32.171  13.259  1.00 7.60   ? 16  GLN B CG  1 
ATOM   1306  C  CD  . GLN B  1 16  ? -0.966  33.260  12.604  1.00 19.07  ? 16  GLN B CD  1 
ATOM   1307  O  OE1 . GLN B  1 16  ? -0.042  32.968  11.842  1.00 7.52   ? 16  GLN B OE1 1 
ATOM   1308  N  NE2 . GLN B  1 16  ? -1.262  34.513  12.937  1.00 13.31  ? 16  GLN B NE2 1 
ATOM   1309  N  N   . VAL B  1 17  ? -3.611  29.433  9.965   1.00 2.43   ? 17  VAL B N   1 
ATOM   1310  C  CA  . VAL B  1 17  ? -3.729  28.318  9.032   1.00 1.66   ? 17  VAL B CA  1 
ATOM   1311  C  C   . VAL B  1 17  ? -3.346  28.824  7.644   1.00 6.41   ? 17  VAL B C   1 
ATOM   1312  O  O   . VAL B  1 17  ? -2.504  28.251  6.943   1.00 8.73   ? 17  VAL B O   1 
ATOM   1313  C  CB  . VAL B  1 17  ? -5.141  27.699  9.010   1.00 2.74   ? 17  VAL B CB  1 
ATOM   1314  C  CG1 . VAL B  1 17  ? -5.197  26.664  7.904   1.00 1.88   ? 17  VAL B CG1 1 
ATOM   1315  C  CG2 . VAL B  1 17  ? -5.429  27.012  10.337  1.00 1.26   ? 17  VAL B CG2 1 
ATOM   1316  N  N   . ALA B  1 18  ? -3.898  29.979  7.296   1.00 5.61   ? 18  ALA B N   1 
ATOM   1317  C  CA  . ALA B  1 18  ? -3.575  30.622  6.027   1.00 3.60   ? 18  ALA B CA  1 
ATOM   1318  C  C   . ALA B  1 18  ? -2.081  30.984  5.978   1.00 5.38   ? 18  ALA B C   1 
ATOM   1319  O  O   . ALA B  1 18  ? -1.425  30.732  4.964   1.00 10.40  ? 18  ALA B O   1 
ATOM   1320  C  CB  . ALA B  1 18  ? -4.471  31.874  5.800   1.00 2.76   ? 18  ALA B CB  1 
ATOM   1321  N  N   . ASN B  1 19  ? -1.516  31.602  7.011   1.00 2.22   ? 19  ASN B N   1 
ATOM   1322  C  CA  . ASN B  1 19  ? -0.117  31.983  6.946   1.00 2.50   ? 19  ASN B CA  1 
ATOM   1323  C  C   . ASN B  1 19  ? 0.817   30.803  6.786   1.00 8.74   ? 19  ASN B C   1 
ATOM   1324  O  O   . ASN B  1 19  ? 1.783   30.830  6.028   1.00 9.51   ? 19  ASN B O   1 
ATOM   1325  C  CB  . ASN B  1 19  ? 0.281   32.674  8.235   1.00 4.82   ? 19  ASN B CB  1 
ATOM   1326  C  CG  . ASN B  1 19  ? -0.124  34.120  8.272   1.00 15.15  ? 19  ASN B CG  1 
ATOM   1327  O  OD1 . ASN B  1 19  ? -0.394  34.732  7.245   1.00 10.36  ? 19  ASN B OD1 1 
ATOM   1328  N  ND2 . ASN B  1 19  ? -0.013  34.724  9.442   1.00 4.98   ? 19  ASN B ND2 1 
ATOM   1329  N  N   . LEU B  1 20  ? 0.551   29.802  7.608   1.00 10.35  ? 20  LEU B N   1 
ATOM   1330  C  CA  . LEU B  1 20  ? 1.364   28.586  7.648   1.00 7.59   ? 20  LEU B CA  1 
ATOM   1331  C  C   . LEU B  1 20  ? 1.389   27.931  6.240   1.00 8.08   ? 20  LEU B C   1 
ATOM   1332  O  O   . LEU B  1 20  ? 2.454   27.538  5.728   1.00 7.62   ? 20  LEU B O   1 
ATOM   1333  C  CB  . LEU B  1 20  ? 0.841   27.682  8.776   1.00 5.18   ? 20  LEU B CB  1 
ATOM   1334  C  CG  . LEU B  1 20  ? 1.618   27.705  10.093  1.00 3.82   ? 20  LEU B CG  1 
ATOM   1335  C  CD1 . LEU B  1 20  ? 2.693   28.764  10.154  1.00 1.00   ? 20  LEU B CD1 1 
ATOM   1336  C  CD2 . LEU B  1 20  ? 0.819   27.604  11.405  1.00 1.00   ? 20  LEU B CD2 1 
ATOM   1337  N  N   . ASN B  1 21  ? 0.242   27.837  5.569   1.00 1.00   ? 21  ASN B N   1 
ATOM   1338  C  CA  . ASN B  1 21  ? 0.283   27.282  4.231   1.00 1.34   ? 21  ASN B CA  1 
ATOM   1339  C  C   . ASN B  1 21  ? 1.110   28.124  3.239   1.00 9.79   ? 21  ASN B C   1 
ATOM   1340  O  O   . ASN B  1 21  ? 1.731   27.642  2.292   1.00 14.32  ? 21  ASN B O   1 
ATOM   1341  C  CB  . ASN B  1 21  ? -1.166  27.129  3.783   1.00 6.42   ? 21  ASN B CB  1 
ATOM   1342  C  CG  . ASN B  1 21  ? -1.768  25.846  4.280   1.00 20.96  ? 21  ASN B CG  1 
ATOM   1343  O  OD1 . ASN B  1 21  ? -1.507  24.804  3.679   1.00 16.94  ? 21  ASN B OD1 1 
ATOM   1344  N  ND2 . ASN B  1 21  ? -2.409  25.874  5.450   1.00 11.40  ? 21  ASN B ND2 1 
ATOM   1345  N  N   . VAL B  1 22  ? 1.155   29.435  3.438   1.00 9.13   ? 22  VAL B N   1 
ATOM   1346  C  CA  . VAL B  1 22  ? 1.930   30.243  2.493   1.00 5.82   ? 22  VAL B CA  1 
ATOM   1347  C  C   . VAL B  1 22  ? 3.396   30.057  2.799   1.00 5.88   ? 22  VAL B C   1 
ATOM   1348  O  O   . VAL B  1 22  ? 4.222   29.947  1.911   1.00 6.23   ? 22  VAL B O   1 
ATOM   1349  C  CB  . VAL B  1 22  ? 1.590   31.763  2.576   1.00 5.50   ? 22  VAL B CB  1 
ATOM   1350  C  CG1 . VAL B  1 22  ? 2.501   32.564  1.679   1.00 7.22   ? 22  VAL B CG1 1 
ATOM   1351  C  CG2 . VAL B  1 22  ? 0.144   31.989  2.188   1.00 2.45   ? 22  VAL B CG2 1 
ATOM   1352  N  N   . PHE B  1 23  ? 3.722   30.063  4.089   1.00 2.16   ? 23  PHE B N   1 
ATOM   1353  C  CA  . PHE B  1 23  ? 5.122   29.889  4.511   1.00 1.86   ? 23  PHE B CA  1 
ATOM   1354  C  C   . PHE B  1 23  ? 5.707   28.542  4.065   1.00 9.19   ? 23  PHE B C   1 
ATOM   1355  O  O   . PHE B  1 23  ? 6.837   28.394  3.590   1.00 8.34   ? 23  PHE B O   1 
ATOM   1356  C  CB  . PHE B  1 23  ? 5.134   29.907  6.045   1.00 1.83   ? 23  PHE B CB  1 
ATOM   1357  C  CG  . PHE B  1 23  ? 6.515   29.926  6.602   1.00 6.19   ? 23  PHE B CG  1 
ATOM   1358  C  CD1 . PHE B  1 23  ? 7.529   30.579  5.924   1.00 10.56  ? 23  PHE B CD1 1 
ATOM   1359  C  CD2 . PHE B  1 23  ? 6.780   29.371  7.850   1.00 6.04   ? 23  PHE B CD2 1 
ATOM   1360  C  CE1 . PHE B  1 23  ? 8.800   30.628  6.479   1.00 7.12   ? 23  PHE B CE1 1 
ATOM   1361  C  CE2 . PHE B  1 23  ? 8.076   29.386  8.388   1.00 3.99   ? 23  PHE B CE2 1 
ATOM   1362  C  CZ  . PHE B  1 23  ? 9.083   30.033  7.709   1.00 1.64   ? 23  PHE B CZ  1 
ATOM   1363  N  N   . THR B  1 24  ? 4.857   27.535  4.166   1.00 3.15   ? 24  THR B N   1 
ATOM   1364  C  CA  . THR B  1 24  ? 5.271   26.202  3.781   1.00 2.09   ? 24  THR B CA  1 
ATOM   1365  C  C   . THR B  1 24  ? 5.663   26.159  2.303   1.00 11.00  ? 24  THR B C   1 
ATOM   1366  O  O   . THR B  1 24  ? 6.742   25.666  1.964   1.00 6.42   ? 24  THR B O   1 
ATOM   1367  C  CB  . THR B  1 24  ? 4.169   25.249  4.237   1.00 6.19   ? 24  THR B CB  1 
ATOM   1368  O  OG1 . THR B  1 24  ? 4.724   24.043  4.758   1.00 37.28  ? 24  THR B OG1 1 
ATOM   1369  C  CG2 . THR B  1 24  ? 3.239   24.941  3.133   1.00 2.45   ? 24  THR B CG2 1 
ATOM   1370  N  N   . VAL B  1 25  ? 4.857   26.754  1.423   1.00 6.31   ? 25  VAL B N   1 
ATOM   1371  C  CA  . VAL B  1 25  ? 5.170   26.783  0.003   1.00 2.10   ? 25  VAL B CA  1 
ATOM   1372  C  C   . VAL B  1 25  ? 6.400   27.634  -0.232  1.00 7.35   ? 25  VAL B C   1 
ATOM   1373  O  O   . VAL B  1 25  ? 7.241   27.306  -1.064  1.00 4.76   ? 25  VAL B O   1 
ATOM   1374  C  CB  . VAL B  1 25  ? 4.000   27.370  -0.767  1.00 8.23   ? 25  VAL B CB  1 
ATOM   1375  C  CG1 . VAL B  1 25  ? 4.350   27.568  -2.252  1.00 6.78   ? 25  VAL B CG1 1 
ATOM   1376  C  CG2 . VAL B  1 25  ? 2.812   26.423  -0.645  1.00 1.83   ? 25  VAL B CG2 1 
ATOM   1377  N  N   . LYS B  1 26  ? 6.604   28.661  0.583   1.00 1.28   ? 26  LYS B N   1 
ATOM   1378  C  CA  . LYS B  1 26  ? 7.789   29.470  0.424   1.00 2.37   ? 26  LYS B CA  1 
ATOM   1379  C  C   . LYS B  1 26  ? 9.061   28.708  0.770   1.00 6.66   ? 26  LYS B C   1 
ATOM   1380  O  O   . LYS B  1 26  ? 10.155  28.936  0.248   1.00 8.62   ? 26  LYS B O   1 
ATOM   1381  C  CB  . LYS B  1 26  ? 7.681   30.674  1.352   1.00 2.81   ? 26  LYS B CB  1 
ATOM   1382  C  CG  . LYS B  1 26  ? 8.868   31.603  1.286   1.00 15.83  ? 26  LYS B CG  1 
ATOM   1383  C  CD  . LYS B  1 26  ? 8.726   32.712  2.335   1.00 30.37  ? 26  LYS B CD  1 
ATOM   1384  C  CE  . LYS B  1 26  ? 7.614   33.717  2.067   1.00 12.96  ? 26  LYS B CE  1 
ATOM   1385  N  NZ  . LYS B  1 26  ? 7.901   34.659  0.953   1.00 37.15  ? 26  LYS B NZ  1 
ATOM   1386  N  N   . ILE B  1 27  ? 8.900   27.819  1.744   1.00 4.21   ? 27  ILE B N   1 
ATOM   1387  C  CA  . ILE B  1 27  ? 10.059  27.041  2.183   1.00 1.37   ? 27  ILE B CA  1 
ATOM   1388  C  C   . ILE B  1 27  ? 10.428  26.136  0.998   1.00 5.71   ? 27  ILE B C   1 
ATOM   1389  O  O   . ILE B  1 27  ? 11.632  26.060  0.647   1.00 7.96   ? 27  ILE B O   1 
ATOM   1390  C  CB  . ILE B  1 27  ? 9.730   26.273  3.463   1.00 2.46   ? 27  ILE B CB  1 
ATOM   1391  C  CG1 . ILE B  1 27  ? 9.610   27.214  4.655   1.00 1.11   ? 27  ILE B CG1 1 
ATOM   1392  C  CG2 . ILE B  1 27  ? 10.841  25.309  3.811   1.00 1.72   ? 27  ILE B CG2 1 
ATOM   1393  C  CD1 . ILE B  1 27  ? 8.924   26.530  5.822   1.00 2.14   ? 27  ILE B CD1 1 
ATOM   1394  N  N   . HIS B  1 28  ? 9.431   25.511  0.354   1.00 1.76   ? 28  HIS B N   1 
ATOM   1395  C  CA  . HIS B  1 28  ? 9.747   24.719  -0.822  1.00 1.25   ? 28  HIS B CA  1 
ATOM   1396  C  C   . HIS B  1 28  ? 10.405  25.527  -1.911  1.00 9.12   ? 28  HIS B C   1 
ATOM   1397  O  O   . HIS B  1 28  ? 11.323  25.089  -2.581  1.00 9.04   ? 28  HIS B O   1 
ATOM   1398  C  CB  . HIS B  1 28  ? 8.521   24.128  -1.456  1.00 5.39   ? 28  HIS B CB  1 
ATOM   1399  C  CG  . HIS B  1 28  ? 8.200   22.758  -0.946  1.00 11.42  ? 28  HIS B CG  1 
ATOM   1400  N  ND1 . HIS B  1 28  ? 9.162   21.880  -0.488  1.00 16.81  ? 28  HIS B ND1 1 
ATOM   1401  C  CD2 . HIS B  1 28  ? 7.033   22.062  -0.948  1.00 11.75  ? 28  HIS B CD2 1 
ATOM   1402  C  CE1 . HIS B  1 28  ? 8.587   20.741  -0.136  1.00 16.55  ? 28  HIS B CE1 1 
ATOM   1403  N  NE2 . HIS B  1 28  ? 7.299   20.825  -0.416  1.00 14.70  ? 28  HIS B NE2 1 
ATOM   1404  N  N   . GLN B  1 29  ? 9.971   26.765  -2.079  1.00 5.79   ? 29  GLN B N   1 
ATOM   1405  C  CA  . GLN B  1 29  ? 10.566  27.582  -3.120  1.00 4.67   ? 29  GLN B CA  1 
ATOM   1406  C  C   . GLN B  1 29  ? 12.025  27.720  -2.851  1.00 6.99   ? 29  GLN B C   1 
ATOM   1407  O  O   . GLN B  1 29  ? 12.842  27.575  -3.773  1.00 7.52   ? 29  GLN B O   1 
ATOM   1408  C  CB  . GLN B  1 29  ? 9.933   28.975  -3.151  1.00 8.19   ? 29  GLN B CB  1 
ATOM   1409  C  CG  . GLN B  1 29  ? 10.731  30.042  -3.898  1.00 11.87  ? 29  GLN B CG  1 
ATOM   1410  C  CD  . GLN B  1 29  ? 9.977   31.356  -4.068  1.00 16.88  ? 29  GLN B CD  1 
ATOM   1411  O  OE1 . GLN B  1 29  ? 8.937   31.383  -4.719  1.00 14.04  ? 29  GLN B OE1 1 
ATOM   1412  N  NE2 . GLN B  1 29  ? 10.498  32.441  -3.493  1.00 9.68   ? 29  GLN B NE2 1 
ATOM   1413  N  N   . ILE B  1 30  ? 12.355  28.100  -1.629  1.00 2.17   ? 30  ILE B N   1 
ATOM   1414  C  CA  . ILE B  1 30  ? 13.787  28.334  -1.339  1.00 2.57   ? 30  ILE B CA  1 
ATOM   1415  C  C   . ILE B  1 30  ? 14.653  27.084  -1.537  1.00 8.27   ? 30  ILE B C   1 
ATOM   1416  O  O   . ILE B  1 30  ? 15.810  27.079  -2.059  1.00 7.08   ? 30  ILE B O   1 
ATOM   1417  C  CB  . ILE B  1 30  ? 13.901  28.743  0.170   1.00 5.83   ? 30  ILE B CB  1 
ATOM   1418  C  CG1 . ILE B  1 30  ? 13.134  30.056  0.358   1.00 9.54   ? 30  ILE B CG1 1 
ATOM   1419  C  CG2 . ILE B  1 30  ? 15.366  28.756  0.604   1.00 1.73   ? 30  ILE B CG2 1 
ATOM   1420  C  CD1 . ILE B  1 30  ? 13.183  30.528  1.810   1.00 13.98  ? 30  ILE B CD1 1 
ATOM   1421  N  N   . HIS B  1 31  ? 14.011  25.974  -1.138  1.00 3.66   ? 31  HIS B N   1 
ATOM   1422  C  CA  . HIS B  1 31  ? 14.593  24.665  -1.149  1.00 2.23   ? 31  HIS B CA  1 
ATOM   1423  C  C   . HIS B  1 31  ? 14.911  24.219  -2.551  1.00 11.16  ? 31  HIS B C   1 
ATOM   1424  O  O   . HIS B  1 31  ? 15.945  23.577  -2.791  1.00 5.19   ? 31  HIS B O   1 
ATOM   1425  C  CB  . HIS B  1 31  ? 13.498  23.808  -0.541  1.00 2.70   ? 31  HIS B CB  1 
ATOM   1426  C  CG  . HIS B  1 31  ? 13.741  22.339  -0.688  1.00 9.78   ? 31  HIS B CG  1 
ATOM   1427  N  ND1 . HIS B  1 31  ? 14.680  21.681  0.091   1.00 15.37  ? 31  HIS B ND1 1 
ATOM   1428  C  CD2 . HIS B  1 31  ? 13.025  21.383  -1.345  1.00 10.59  ? 31  HIS B CD2 1 
ATOM   1429  C  CE1 . HIS B  1 31  ? 14.587  20.379  -0.169  1.00 12.91  ? 31  HIS B CE1 1 
ATOM   1430  N  NE2 . HIS B  1 31  ? 13.624  20.176  -1.040  1.00 11.24  ? 31  HIS B NE2 1 
ATOM   1431  N  N   . TRP B  1 32  ? 13.992  24.524  -3.470  1.00 5.89   ? 32  TRP B N   1 
ATOM   1432  C  CA  . TRP B  1 32  ? 14.113  24.149  -4.868  1.00 2.97   ? 32  TRP B CA  1 
ATOM   1433  C  C   . TRP B  1 32  ? 15.054  25.079  -5.635  1.00 12.26  ? 32  TRP B C   1 
ATOM   1434  O  O   . TRP B  1 32  ? 15.847  24.619  -6.477  1.00 8.20   ? 32  TRP B O   1 
ATOM   1435  C  CB  . TRP B  1 32  ? 12.742  24.258  -5.518  1.00 1.30   ? 32  TRP B CB  1 
ATOM   1436  C  CG  . TRP B  1 32  ? 11.820  23.215  -5.126  1.00 1.21   ? 32  TRP B CG  1 
ATOM   1437  C  CD1 . TRP B  1 32  ? 12.148  21.979  -4.613  1.00 3.25   ? 32  TRP B CD1 1 
ATOM   1438  C  CD2 . TRP B  1 32  ? 10.393  23.281  -5.115  1.00 2.26   ? 32  TRP B CD2 1 
ATOM   1439  N  NE1 . TRP B  1 32  ? 11.022  21.235  -4.413  1.00 2.44   ? 32  TRP B NE1 1 
ATOM   1440  C  CE2 . TRP B  1 32  ? 9.908   22.036  -4.675  1.00 3.12   ? 32  TRP B CE2 1 
ATOM   1441  C  CE3 . TRP B  1 32  ? 9.478   24.279  -5.517  1.00 4.61   ? 32  TRP B CE3 1 
ATOM   1442  C  CZ2 . TRP B  1 32  ? 8.555   21.722  -4.626  1.00 1.44   ? 32  TRP B CZ2 1 
ATOM   1443  C  CZ3 . TRP B  1 32  ? 8.119   23.982  -5.354  1.00 6.53   ? 32  TRP B CZ3 1 
ATOM   1444  C  CH2 . TRP B  1 32  ? 7.653   22.711  -4.953  1.00 6.66   ? 32  TRP B CH2 1 
ATOM   1445  N  N   . TYR B  1 33  ? 14.960  26.376  -5.340  1.00 3.05   ? 33  TYR B N   1 
ATOM   1446  C  CA  . TYR B  1 33  ? 15.754  27.353  -6.066  1.00 3.63   ? 33  TYR B CA  1 
ATOM   1447  C  C   . TYR B  1 33  ? 17.131  27.719  -5.556  1.00 12.15  ? 33  TYR B C   1 
ATOM   1448  O  O   . TYR B  1 33  ? 17.928  28.308  -6.292  1.00 12.87  ? 33  TYR B O   1 
ATOM   1449  C  CB  . TYR B  1 33  ? 14.972  28.630  -6.351  1.00 3.84   ? 33  TYR B CB  1 
ATOM   1450  C  CG  . TYR B  1 33  ? 13.856  28.431  -7.345  1.00 5.08   ? 33  TYR B CG  1 
ATOM   1451  C  CD1 . TYR B  1 33  ? 14.135  28.333  -8.727  1.00 12.63  ? 33  TYR B CD1 1 
ATOM   1452  C  CD2 . TYR B  1 33  ? 12.528  28.336  -6.939  1.00 1.26   ? 33  TYR B CD2 1 
ATOM   1453  C  CE1 . TYR B  1 33  ? 13.105  28.118  -9.692  1.00 11.61  ? 33  TYR B CE1 1 
ATOM   1454  C  CE2 . TYR B  1 33  ? 11.493  28.126  -7.896  1.00 5.49   ? 33  TYR B CE2 1 
ATOM   1455  C  CZ  . TYR B  1 33  ? 11.786  28.020  -9.267  1.00 16.47  ? 33  TYR B CZ  1 
ATOM   1456  O  OH  . TYR B  1 33  ? 10.783  27.772  -10.194 1.00 13.30  ? 33  TYR B OH  1 
ATOM   1457  N  N   . MET B  1 34  ? 17.427  27.403  -4.307  1.00 7.32   ? 34  MET B N   1 
ATOM   1458  C  CA  . MET B  1 34  ? 18.740  27.791  -3.818  1.00 3.83   ? 34  MET B CA  1 
ATOM   1459  C  C   . MET B  1 34  ? 19.918  27.239  -4.608  1.00 4.64   ? 34  MET B C   1 
ATOM   1460  O  O   . MET B  1 34  ? 19.883  26.142  -5.176  1.00 5.69   ? 34  MET B O   1 
ATOM   1461  C  CB  . MET B  1 34  ? 18.955  27.378  -2.347  1.00 7.16   ? 34  MET B CB  1 
ATOM   1462  C  CG  . MET B  1 34  ? 18.859  25.833  -2.166  1.00 13.36  ? 34  MET B CG  1 
ATOM   1463  S  SD  . MET B  1 34  ? 19.121  25.140  -0.489  1.00 20.36  ? 34  MET B SD  1 
ATOM   1464  C  CE  . MET B  1 34  ? 18.147  26.257  0.500   1.00 16.63  ? 34  MET B CE  1 
ATOM   1465  N  N   . ARG B  1 35  ? 21.004  28.009  -4.576  1.00 9.95   ? 35  ARG B N   1 
ATOM   1466  C  CA  . ARG B  1 35  ? 22.267  27.639  -5.206  1.00 9.93   ? 35  ARG B CA  1 
ATOM   1467  C  C   . ARG B  1 35  ? 23.339  28.323  -4.390  1.00 12.29  ? 35  ARG B C   1 
ATOM   1468  O  O   . ARG B  1 35  ? 23.070  29.321  -3.716  1.00 17.14  ? 35  ARG B O   1 
ATOM   1469  C  CB  . ARG B  1 35  ? 22.382  28.193  -6.614  1.00 8.27   ? 35  ARG B CB  1 
ATOM   1470  C  CG  . ARG B  1 35  ? 21.380  27.664  -7.563  1.00 15.06  ? 35  ARG B CG  1 
ATOM   1471  C  CD  . ARG B  1 35  ? 21.708  28.269  -8.896  1.00 5.21   ? 35  ARG B CD  1 
ATOM   1472  N  NE  . ARG B  1 35  ? 20.792  27.742  -9.894  1.00 22.09  ? 35  ARG B NE  1 
ATOM   1473  C  CZ  . ARG B  1 35  ? 20.777  28.176  -11.149 1.00 35.62  ? 35  ARG B CZ  1 
ATOM   1474  N  NH1 . ARG B  1 35  ? 21.635  29.114  -11.534 1.00 42.27  ? 35  ARG B NH1 1 
ATOM   1475  N  NH2 . ARG B  1 35  ? 19.889  27.673  -11.990 1.00 31.13  ? 35  ARG B NH2 1 
ATOM   1476  N  N   . GLY B  1 36  ? 24.534  27.747  -4.445  1.00 8.08   ? 36  GLY B N   1 
ATOM   1477  C  CA  . GLY B  1 36  ? 25.681  28.236  -3.680  1.00 7.86   ? 36  GLY B CA  1 
ATOM   1478  C  C   . GLY B  1 36  ? 26.362  27.145  -2.829  1.00 13.43  ? 36  GLY B C   1 
ATOM   1479  O  O   . GLY B  1 36  ? 25.867  26.024  -2.617  1.00 11.86  ? 36  GLY B O   1 
ATOM   1480  N  N   . HIS B  1 37  ? 27.518  27.497  -2.288  1.00 10.30  ? 37  HIS B N   1 
ATOM   1481  C  CA  . HIS B  1 37  ? 28.247  26.545  -1.468  1.00 14.17  ? 37  HIS B CA  1 
ATOM   1482  C  C   . HIS B  1 37  ? 27.487  25.900  -0.323  1.00 16.89  ? 37  HIS B C   1 
ATOM   1483  O  O   . HIS B  1 37  ? 27.846  24.816  0.103   1.00 15.54  ? 37  HIS B O   1 
ATOM   1484  C  CB  . HIS B  1 37  ? 29.528  27.200  -1.011  1.00 18.48  ? 37  HIS B CB  1 
ATOM   1485  C  CG  . HIS B  1 37  ? 30.461  27.410  -2.150  1.00 31.71  ? 37  HIS B CG  1 
ATOM   1486  N  ND1 . HIS B  1 37  ? 31.724  26.868  -2.189  1.00 40.36  ? 37  HIS B ND1 1 
ATOM   1487  C  CD2 . HIS B  1 37  ? 30.249  27.953  -3.369  1.00 48.69  ? 37  HIS B CD2 1 
ATOM   1488  C  CE1 . HIS B  1 37  ? 32.284  27.132  -3.353  1.00 45.94  ? 37  HIS B CE1 1 
ATOM   1489  N  NE2 . HIS B  1 37  ? 31.403  27.796  -4.092  1.00 49.66  ? 37  HIS B NE2 1 
ATOM   1490  N  N   . ASN B  1 38  ? 26.434  26.549  0.162   1.00 13.62  ? 38  ASN B N   1 
ATOM   1491  C  CA  . ASN B  1 38  ? 25.637  26.056  1.284   1.00 14.06  ? 38  ASN B CA  1 
ATOM   1492  C  C   . ASN B  1 38  ? 24.464  25.215  0.873   1.00 16.71  ? 38  ASN B C   1 
ATOM   1493  O  O   . ASN B  1 38  ? 23.616  24.860  1.677   1.00 14.63  ? 38  ASN B O   1 
ATOM   1494  C  CB  . ASN B  1 38  ? 25.150  27.221  2.140   1.00 15.04  ? 38  ASN B CB  1 
ATOM   1495  C  CG  . ASN B  1 38  ? 26.300  28.099  2.560   1.00 33.60  ? 38  ASN B CG  1 
ATOM   1496  O  OD1 . ASN B  1 38  ? 26.492  29.171  2.002   1.00 36.83  ? 38  ASN B OD1 1 
ATOM   1497  N  ND2 . ASN B  1 38  ? 27.159  27.555  3.417   1.00 15.58  ? 38  ASN B ND2 1 
ATOM   1498  N  N   . PHE B  1 39  ? 24.424  24.898  -0.409  1.00 7.26   ? 39  PHE B N   1 
ATOM   1499  C  CA  . PHE B  1 39  ? 23.296  24.178  -0.957  1.00 2.87   ? 39  PHE B CA  1 
ATOM   1500  C  C   . PHE B  1 39  ? 22.934  22.924  -0.205  1.00 7.68   ? 39  PHE B C   1 
ATOM   1501  O  O   . PHE B  1 39  ? 21.758  22.729  0.159   1.00 7.60   ? 39  PHE B O   1 
ATOM   1502  C  CB  . PHE B  1 39  ? 23.528  23.814  -2.408  1.00 1.00   ? 39  PHE B CB  1 
ATOM   1503  C  CG  . PHE B  1 39  ? 22.447  22.941  -2.951  1.00 2.99   ? 39  PHE B CG  1 
ATOM   1504  C  CD1 . PHE B  1 39  ? 21.288  23.525  -3.443  1.00 1.56   ? 39  PHE B CD1 1 
ATOM   1505  C  CD2 . PHE B  1 39  ? 22.561  21.563  -2.888  1.00 5.43   ? 39  PHE B CD2 1 
ATOM   1506  C  CE1 . PHE B  1 39  ? 20.229  22.719  -3.875  1.00 1.00   ? 39  PHE B CE1 1 
ATOM   1507  C  CE2 . PHE B  1 39  ? 21.550  20.744  -3.364  1.00 4.38   ? 39  PHE B CE2 1 
ATOM   1508  C  CZ  . PHE B  1 39  ? 20.381  21.323  -3.842  1.00 2.41   ? 39  PHE B CZ  1 
ATOM   1509  N  N   . PHE B  1 40  ? 23.941  22.076  0.011   1.00 3.02   ? 40  PHE B N   1 
ATOM   1510  C  CA  . PHE B  1 40  ? 23.616  20.812  0.657   1.00 6.68   ? 40  PHE B CA  1 
ATOM   1511  C  C   . PHE B  1 40  ? 22.975  20.976  2.036   1.00 17.44  ? 40  PHE B C   1 
ATOM   1512  O  O   . PHE B  1 40  ? 21.833  20.549  2.263   1.00 14.06  ? 40  PHE B O   1 
ATOM   1513  C  CB  . PHE B  1 40  ? 24.801  19.871  0.641   1.00 4.57   ? 40  PHE B CB  1 
ATOM   1514  C  CG  . PHE B  1 40  ? 25.158  19.438  -0.750  1.00 4.28   ? 40  PHE B CG  1 
ATOM   1515  C  CD1 . PHE B  1 40  ? 24.342  18.556  -1.443  1.00 1.49   ? 40  PHE B CD1 1 
ATOM   1516  C  CD2 . PHE B  1 40  ? 26.244  19.979  -1.395  1.00 5.54   ? 40  PHE B CD2 1 
ATOM   1517  C  CE1 . PHE B  1 40  ? 24.658  18.125  -2.716  1.00 4.68   ? 40  PHE B CE1 1 
ATOM   1518  C  CE2 . PHE B  1 40  ? 26.575  19.567  -2.688  1.00 7.43   ? 40  PHE B CE2 1 
ATOM   1519  C  CZ  . PHE B  1 40  ? 25.776  18.654  -3.354  1.00 2.29   ? 40  PHE B CZ  1 
ATOM   1520  N  N   . THR B  1 41  ? 23.696  21.712  2.884   1.00 13.98  ? 41  THR B N   1 
ATOM   1521  C  CA  . THR B  1 41  ? 23.189  21.983  4.225   1.00 12.73  ? 41  THR B CA  1 
ATOM   1522  C  C   . THR B  1 41  ? 21.836  22.692  4.297   1.00 11.62  ? 41  THR B C   1 
ATOM   1523  O  O   . THR B  1 41  ? 20.877  22.191  4.881   1.00 12.24  ? 41  THR B O   1 
ATOM   1524  C  CB  . THR B  1 41  ? 24.329  22.504  5.095   1.00 34.84  ? 41  THR B CB  1 
ATOM   1525  O  OG1 . THR B  1 41  ? 23.819  23.101  6.286   1.00 53.68  ? 41  THR B OG1 1 
ATOM   1526  C  CG2 . THR B  1 41  ? 25.171  23.504  4.312   1.00 68.46  ? 41  THR B CG2 1 
ATOM   1527  N  N   . LEU B  1 42  ? 21.694  23.830  3.645   1.00 8.29   ? 42  LEU B N   1 
ATOM   1528  C  CA  . LEU B  1 42  ? 20.402  24.494  3.674   1.00 5.05   ? 42  LEU B CA  1 
ATOM   1529  C  C   . LEU B  1 42  ? 19.325  23.726  2.920   1.00 10.79  ? 42  LEU B C   1 
ATOM   1530  O  O   . LEU B  1 42  ? 18.140  23.774  3.288   1.00 10.95  ? 42  LEU B O   1 
ATOM   1531  C  CB  . LEU B  1 42  ? 20.596  25.903  3.135   1.00 6.95   ? 42  LEU B CB  1 
ATOM   1532  C  CG  . LEU B  1 42  ? 20.803  27.046  4.146   1.00 11.63  ? 42  LEU B CG  1 
ATOM   1533  C  CD1 . LEU B  1 42  ? 21.230  26.535  5.482   1.00 9.66   ? 42  LEU B CD1 1 
ATOM   1534  C  CD2 . LEU B  1 42  ? 21.982  27.862  3.654   1.00 21.22  ? 42  LEU B CD2 1 
ATOM   1535  N  N   . HIS B  1 43  ? 19.713  22.963  1.908   1.00 2.53   ? 43  HIS B N   1 
ATOM   1536  C  CA  . HIS B  1 43  ? 18.686  22.247  1.160   1.00 2.44   ? 43  HIS B CA  1 
ATOM   1537  C  C   . HIS B  1 43  ? 18.000  21.321  2.144   1.00 8.29   ? 43  HIS B C   1 
ATOM   1538  O  O   . HIS B  1 43  ? 16.774  21.242  2.207   1.00 9.13   ? 43  HIS B O   1 
ATOM   1539  C  CB  . HIS B  1 43  ? 19.346  21.437  0.034   1.00 2.40   ? 43  HIS B CB  1 
ATOM   1540  C  CG  . HIS B  1 43  ? 18.378  20.649  -0.779  1.00 7.99   ? 43  HIS B CG  1 
ATOM   1541  N  ND1 . HIS B  1 43  ? 17.416  21.247  -1.559  1.00 10.38  ? 43  HIS B ND1 1 
ATOM   1542  C  CD2 . HIS B  1 43  ? 18.197  19.308  -0.919  1.00 9.46   ? 43  HIS B CD2 1 
ATOM   1543  C  CE1 . HIS B  1 43  ? 16.723  20.306  -2.196  1.00 10.94  ? 43  HIS B CE1 1 
ATOM   1544  N  NE2 . HIS B  1 43  ? 17.147  19.123  -1.773  1.00 11.93  ? 43  HIS B NE2 1 
ATOM   1545  N  N   . GLU B  1 44  ? 18.796  20.634  2.953   1.00 6.52   ? 44  GLU B N   1 
ATOM   1546  C  CA  . GLU B  1 44  ? 18.209  19.720  3.947   1.00 7.09   ? 44  GLU B CA  1 
ATOM   1547  C  C   . GLU B  1 44  ? 17.486  20.462  5.083   1.00 8.61   ? 44  GLU B C   1 
ATOM   1548  O  O   . GLU B  1 44  ? 16.383  20.086  5.482   1.00 11.01  ? 44  GLU B O   1 
ATOM   1549  C  CB  . GLU B  1 44  ? 19.305  18.761  4.472   1.00 9.70   ? 44  GLU B CB  1 
ATOM   1550  C  CG  . GLU B  1 44  ? 20.038  17.966  3.360   1.00 78.57  ? 44  GLU B CG  1 
ATOM   1551  C  CD  . GLU B  1 44  ? 21.363  17.370  3.761   0.00 100.00 ? 44  GLU B CD  1 
ATOM   1552  O  OE1 . GLU B  1 44  ? 21.726  17.412  4.942   0.00 100.00 ? 44  GLU B OE1 1 
ATOM   1553  O  OE2 . GLU B  1 44  ? 22.051  16.878  2.843   0.00 100.00 ? 44  GLU B OE2 1 
ATOM   1554  N  N   . LYS B  1 45  ? 18.067  21.556  5.562   1.00 2.69   ? 45  LYS B N   1 
ATOM   1555  C  CA  . LYS B  1 45  ? 17.449  22.346  6.622   1.00 3.19   ? 45  LYS B CA  1 
ATOM   1556  C  C   . LYS B  1 45  ? 16.026  22.768  6.234   1.00 4.71   ? 45  LYS B C   1 
ATOM   1557  O  O   . LYS B  1 45  ? 15.083  22.722  7.029   1.00 6.06   ? 45  LYS B O   1 
ATOM   1558  C  CB  . LYS B  1 45  ? 18.308  23.585  6.881   1.00 7.24   ? 45  LYS B CB  1 
ATOM   1559  C  CG  . LYS B  1 45  ? 18.050  24.151  8.259   1.00 28.30  ? 45  LYS B CG  1 
ATOM   1560  C  CD  . LYS B  1 45  ? 18.616  23.206  9.313   1.00 52.73  ? 45  LYS B CD  1 
ATOM   1561  C  CE  . LYS B  1 45  ? 17.885  23.289  10.656  1.00 91.62  ? 45  LYS B CE  1 
ATOM   1562  N  NZ  . LYS B  1 45  ? 17.815  24.586  11.414  1.00 78.51  ? 45  LYS B NZ  1 
ATOM   1563  N  N   . MET B  1 46  ? 15.846  23.115  4.966   1.00 1.29   ? 46  MET B N   1 
ATOM   1564  C  CA  . MET B  1 46  ? 14.499  23.518  4.593   1.00 1.00   ? 46  MET B CA  1 
ATOM   1565  C  C   . MET B  1 46  ? 13.596  22.328  4.664   1.00 6.55   ? 46  MET B C   1 
ATOM   1566  O  O   . MET B  1 46  ? 12.427  22.457  4.949   1.00 13.26  ? 46  MET B O   1 
ATOM   1567  C  CB  . MET B  1 46  ? 14.496  24.081  3.182   1.00 1.61   ? 46  MET B CB  1 
ATOM   1568  C  CG  . MET B  1 46  ? 15.388  25.296  2.963   1.00 2.47   ? 46  MET B CG  1 
ATOM   1569  S  SD  . MET B  1 46  ? 14.947  26.725  4.018   1.00 9.42   ? 46  MET B SD  1 
ATOM   1570  C  CE  . MET B  1 46  ? 16.065  26.555  5.397   1.00 3.79   ? 46  MET B CE  1 
ATOM   1571  N  N   . ASP B  1 47  ? 14.093  21.135  4.393   1.00 4.66   ? 47  ASP B N   1 
ATOM   1572  C  CA  . ASP B  1 47  ? 13.165  20.000  4.437   1.00 7.87   ? 47  ASP B CA  1 
ATOM   1573  C  C   . ASP B  1 47  ? 12.681  19.885  5.871   1.00 7.40   ? 47  ASP B C   1 
ATOM   1574  O  O   . ASP B  1 47  ? 11.527  19.532  6.157   1.00 9.38   ? 47  ASP B O   1 
ATOM   1575  C  CB  . ASP B  1 47  ? 13.796  18.685  3.924   1.00 16.20  ? 47  ASP B CB  1 
ATOM   1576  C  CG  . ASP B  1 47  ? 13.536  18.420  2.420   1.00 77.72  ? 47  ASP B CG  1 
ATOM   1577  O  OD1 . ASP B  1 47  ? 12.553  18.933  1.859   1.00 90.00  ? 47  ASP B OD1 1 
ATOM   1578  O  OD2 . ASP B  1 47  ? 14.326  17.624  1.820   1.00 99.03  ? 47  ASP B OD2 1 
ATOM   1579  N  N   . ASP B  1 48  ? 13.569  20.277  6.776   1.00 3.64   ? 48  ASP B N   1 
ATOM   1580  C  CA  . ASP B  1 48  ? 13.208  20.157  8.201   1.00 9.70   ? 48  ASP B CA  1 
ATOM   1581  C  C   . ASP B  1 48  ? 12.140  21.154  8.642   1.00 11.47  ? 48  ASP B C   1 
ATOM   1582  O  O   . ASP B  1 48  ? 11.179  20.829  9.332   1.00 7.44   ? 48  ASP B O   1 
ATOM   1583  C  CB  . ASP B  1 48  ? 14.465  20.140  9.077   1.00 13.79  ? 48  ASP B CB  1 
ATOM   1584  C  CG  . ASP B  1 48  ? 15.396  18.942  8.787   1.00 51.89  ? 48  ASP B CG  1 
ATOM   1585  O  OD1 . ASP B  1 48  ? 14.939  17.863  8.329   1.00 54.18  ? 48  ASP B OD1 1 
ATOM   1586  O  OD2 . ASP B  1 48  ? 16.608  19.064  9.073   1.00 81.62  ? 48  ASP B OD2 1 
ATOM   1587  N  N   . LEU B  1 49  ? 12.350  22.373  8.154   1.00 5.45   ? 49  LEU B N   1 
ATOM   1588  C  CA  . LEU B  1 49  ? 11.447  23.480  8.395   1.00 4.21   ? 49  LEU B CA  1 
ATOM   1589  C  C   . LEU B  1 49  ? 10.129  23.145  7.772   1.00 2.92   ? 49  LEU B C   1 
ATOM   1590  O  O   . LEU B  1 49  ? 9.095   23.384  8.391   1.00 7.05   ? 49  LEU B O   1 
ATOM   1591  C  CB  . LEU B  1 49  ? 11.967  24.715  7.678   1.00 3.44   ? 49  LEU B CB  1 
ATOM   1592  C  CG  . LEU B  1 49  ? 12.430  25.737  8.696   1.00 7.24   ? 49  LEU B CG  1 
ATOM   1593  C  CD1 . LEU B  1 49  ? 13.385  25.069  9.672   1.00 2.11   ? 49  LEU B CD1 1 
ATOM   1594  C  CD2 . LEU B  1 49  ? 13.138  26.781  7.865   1.00 8.03   ? 49  LEU B CD2 1 
ATOM   1595  N  N   . TYR B  1 50  ? 10.131  22.647  6.537   1.00 1.21   ? 50  TYR B N   1 
ATOM   1596  C  CA  . TYR B  1 50  ? 8.888   22.291  5.850   1.00 2.24   ? 50  TYR B CA  1 
ATOM   1597  C  C   . TYR B  1 50  ? 8.058   21.320  6.697   1.00 7.54   ? 50  TYR B C   1 
ATOM   1598  O  O   . TYR B  1 50  ? 6.851   21.431  6.879   1.00 8.78   ? 50  TYR B O   1 
ATOM   1599  C  CB  . TYR B  1 50  ? 9.198   21.626  4.499   1.00 3.71   ? 50  TYR B CB  1 
ATOM   1600  C  CG  . TYR B  1 50  ? 7.964   21.375  3.668   1.00 11.31  ? 50  TYR B CG  1 
ATOM   1601  C  CD1 . TYR B  1 50  ? 7.190   20.220  3.843   1.00 12.17  ? 50  TYR B CD1 1 
ATOM   1602  C  CD2 . TYR B  1 50  ? 7.506   22.348  2.758   1.00 17.81  ? 50  TYR B CD2 1 
ATOM   1603  C  CE1 . TYR B  1 50  ? 6.012   20.034  3.116   1.00 27.90  ? 50  TYR B CE1 1 
ATOM   1604  C  CE2 . TYR B  1 50  ? 6.330   22.159  2.011   1.00 22.00  ? 50  TYR B CE2 1 
ATOM   1605  C  CZ  . TYR B  1 50  ? 5.588   20.994  2.205   1.00 38.42  ? 50  TYR B CZ  1 
ATOM   1606  O  OH  . TYR B  1 50  ? 4.438   20.772  1.465   1.00 32.89  ? 50  TYR B OH  1 
ATOM   1607  N  N   . SER B  1 51  ? 8.708   20.301  7.214   1.00 4.48   ? 51  SER B N   1 
ATOM   1608  C  CA  . SER B  1 51  ? 7.981   19.343  8.039   1.00 7.37   ? 51  SER B CA  1 
ATOM   1609  C  C   . SER B  1 51  ? 7.484   19.964  9.336   1.00 6.02   ? 51  SER B C   1 
ATOM   1610  O  O   . SER B  1 51  ? 6.365   19.741  9.788   1.00 4.76   ? 51  SER B O   1 
ATOM   1611  C  CB  . SER B  1 51  ? 8.855   18.128  8.333   1.00 6.38   ? 51  SER B CB  1 
ATOM   1612  O  OG  . SER B  1 51  ? 9.160   17.504  7.094   1.00 56.21  ? 51  SER B OG  1 
ATOM   1613  N  N   . GLU B  1 52  ? 8.367   20.740  9.942   1.00 1.72   ? 52  GLU B N   1 
ATOM   1614  C  CA  . GLU B  1 52  ? 7.963   21.335  11.199  1.00 1.00   ? 52  GLU B CA  1 
ATOM   1615  C  C   . GLU B  1 52  ? 6.730   22.237  11.072  1.00 6.68   ? 52  GLU B C   1 
ATOM   1616  O  O   . GLU B  1 52  ? 5.735   22.154  11.813  1.00 4.54   ? 52  GLU B O   1 
ATOM   1617  C  CB  . GLU B  1 52  ? 9.126   22.151  11.723  1.00 1.38   ? 52  GLU B CB  1 
ATOM   1618  C  CG  . GLU B  1 52  ? 8.637   22.885  12.924  1.00 17.80  ? 52  GLU B CG  1 
ATOM   1619  C  CD  . GLU B  1 52  ? 9.786   23.469  13.715  1.00 55.26  ? 52  GLU B CD  1 
ATOM   1620  O  OE1 . GLU B  1 52  ? 10.930  23.440  13.191  1.00 20.69  ? 52  GLU B OE1 1 
ATOM   1621  O  OE2 . GLU B  1 52  ? 9.563   23.883  14.879  1.00 28.16  ? 52  GLU B OE2 1 
ATOM   1622  N  N   . PHE B  1 53  ? 6.835   23.137  10.102  1.00 4.01   ? 53  PHE B N   1 
ATOM   1623  C  CA  . PHE B  1 53  ? 5.777   24.106  9.897   1.00 1.30   ? 53  PHE B CA  1 
ATOM   1624  C  C   . PHE B  1 53  ? 4.489   23.453  9.439   1.00 4.36   ? 53  PHE B C   1 
ATOM   1625  O  O   . PHE B  1 53  ? 3.386   23.823  9.845   1.00 6.36   ? 53  PHE B O   1 
ATOM   1626  C  CB  . PHE B  1 53  ? 6.230   25.422  9.256   1.00 1.00   ? 53  PHE B CB  1 
ATOM   1627  C  CG  . PHE B  1 53  ? 7.097   26.251  10.178  1.00 2.35   ? 53  PHE B CG  1 
ATOM   1628  C  CD1 . PHE B  1 53  ? 8.459   25.977  10.286  1.00 3.60   ? 53  PHE B CD1 1 
ATOM   1629  C  CD2 . PHE B  1 53  ? 6.530   27.196  11.024  1.00 1.00   ? 53  PHE B CD2 1 
ATOM   1630  C  CE1 . PHE B  1 53  ? 9.324   26.673  11.115  1.00 1.72   ? 53  PHE B CE1 1 
ATOM   1631  C  CE2 . PHE B  1 53  ? 7.369   27.853  11.933  1.00 7.15   ? 53  PHE B CE2 1 
ATOM   1632  C  CZ  . PHE B  1 53  ? 8.775   27.600  11.954  1.00 6.40   ? 53  PHE B CZ  1 
ATOM   1633  N  N   . GLY B  1 54  ? 4.658   22.389  8.680   1.00 1.00   ? 54  GLY B N   1 
ATOM   1634  C  CA  . GLY B  1 54  ? 3.496   21.632  8.203   1.00 1.00   ? 54  GLY B CA  1 
ATOM   1635  C  C   . GLY B  1 54  ? 2.794   21.000  9.405   1.00 6.35   ? 54  GLY B C   1 
ATOM   1636  O  O   . GLY B  1 54  ? 1.557   20.943  9.462   1.00 6.65   ? 54  GLY B O   1 
ATOM   1637  N  N   . GLU B  1 55  ? 3.571   20.583  10.403  1.00 2.42   ? 55  GLU B N   1 
ATOM   1638  C  CA  . GLU B  1 55  ? 2.918   20.066  11.603  1.00 7.85   ? 55  GLU B CA  1 
ATOM   1639  C  C   . GLU B  1 55  ? 2.313   21.205  12.423  1.00 8.93   ? 55  GLU B C   1 
ATOM   1640  O  O   . GLU B  1 55  ? 1.235   20.989  12.963  1.00 12.46  ? 55  GLU B O   1 
ATOM   1641  C  CB  . GLU B  1 55  ? 3.886   19.280  12.518  1.00 13.32  ? 55  GLU B CB  1 
ATOM   1642  C  CG  . GLU B  1 55  ? 4.375   17.906  12.064  1.00 68.03  ? 55  GLU B CG  1 
ATOM   1643  C  CD  . GLU B  1 55  ? 5.256   17.221  13.078  0.00 100.00 ? 55  GLU B CD  1 
ATOM   1644  O  OE1 . GLU B  1 55  ? 5.534   17.791  14.145  0.00 100.00 ? 55  GLU B OE1 1 
ATOM   1645  O  OE2 . GLU B  1 55  ? 5.699   16.093  12.802  0.00 100.00 ? 55  GLU B OE2 1 
ATOM   1646  N  N   . GLN B  1 56  ? 2.961   22.372  12.549  1.00 4.78   ? 56  GLN B N   1 
ATOM   1647  C  CA  . GLN B  1 56  ? 2.324   23.472  13.289  1.00 4.01   ? 56  GLN B CA  1 
ATOM   1648  C  C   . GLN B  1 56  ? 0.984   23.778  12.675  1.00 4.60   ? 56  GLN B C   1 
ATOM   1649  O  O   . GLN B  1 56  ? -0.030  23.948  13.340  1.00 3.50   ? 56  GLN B O   1 
ATOM   1650  C  CB  . GLN B  1 56  ? 3.105   24.778  13.143  1.00 6.30   ? 56  GLN B CB  1 
ATOM   1651  C  CG  . GLN B  1 56  ? 4.240   24.814  14.126  1.00 16.98  ? 56  GLN B CG  1 
ATOM   1652  C  CD  . GLN B  1 56  ? 4.759   26.181  14.365  1.00 27.41  ? 56  GLN B CD  1 
ATOM   1653  O  OE1 . GLN B  1 56  ? 4.122   27.144  14.008  1.00 12.71  ? 56  GLN B OE1 1 
ATOM   1654  N  NE2 . GLN B  1 56  ? 5.942   26.274  14.926  1.00 11.87  ? 56  GLN B NE2 1 
ATOM   1655  N  N   . MET B  1 57  ? 1.009   23.811  11.357  1.00 1.32   ? 57  MET B N   1 
ATOM   1656  C  CA  . MET B  1 57  ? -0.186  24.066  10.599  1.00 1.00   ? 57  MET B CA  1 
ATOM   1657  C  C   . MET B  1 57  ? -1.279  23.065  10.941  1.00 4.28   ? 57  MET B C   1 
ATOM   1658  O  O   . MET B  1 57  ? -2.381  23.484  11.264  1.00 11.42  ? 57  MET B O   1 
ATOM   1659  C  CB  . MET B  1 57  ? 0.165   24.064  9.105   1.00 4.67   ? 57  MET B CB  1 
ATOM   1660  C  CG  . MET B  1 57  ? -0.877  24.684  8.179   1.00 9.08   ? 57  MET B CG  1 
ATOM   1661  S  SD  . MET B  1 57  ? -2.157  23.498  7.740   1.00 17.30  ? 57  MET B SD  1 
ATOM   1662  C  CE  . MET B  1 57  ? -1.141  22.670  6.536   1.00 7.50   ? 57  MET B CE  1 
ATOM   1663  N  N   . ASP B  1 58  ? -1.023  21.762  10.880  1.00 2.40   ? 58  ASP B N   1 
ATOM   1664  C  CA  . ASP B  1 58  ? -2.111  20.795  11.130  1.00 2.40   ? 58  ASP B CA  1 
ATOM   1665  C  C   . ASP B  1 58  ? -2.600  20.945  12.563  1.00 3.50   ? 58  ASP B C   1 
ATOM   1666  O  O   . ASP B  1 58  ? -3.783  20.776  12.860  1.00 3.17   ? 58  ASP B O   1 
ATOM   1667  C  CB  . ASP B  1 58  ? -1.686  19.345  10.829  1.00 5.13   ? 58  ASP B CB  1 
ATOM   1668  C  CG  . ASP B  1 58  ? -2.855  18.368  10.725  1.00 15.72  ? 58  ASP B CG  1 
ATOM   1669  O  OD1 . ASP B  1 58  ? -3.772  18.591  9.895   1.00 24.21  ? 58  ASP B OD1 1 
ATOM   1670  O  OD2 . ASP B  1 58  ? -2.824  17.289  11.367  1.00 18.77  ? 58  ASP B OD2 1 
ATOM   1671  N  N   . GLU B  1 59  ? -1.689  21.264  13.475  1.00 3.31   ? 59  GLU B N   1 
ATOM   1672  C  CA  . GLU B  1 59  ? -2.100  21.350  14.885  1.00 5.09   ? 59  GLU B CA  1 
ATOM   1673  C  C   . GLU B  1 59  ? -3.013  22.546  15.131  1.00 4.75   ? 59  GLU B C   1 
ATOM   1674  O  O   . GLU B  1 59  ? -3.976  22.515  15.898  1.00 3.05   ? 59  GLU B O   1 
ATOM   1675  C  CB  . GLU B  1 59  ? -0.883  21.423  15.821  1.00 9.22   ? 59  GLU B CB  1 
ATOM   1676  C  CG  . GLU B  1 59  ? -0.027  20.154  15.993  1.00 47.81  ? 59  GLU B CG  1 
ATOM   1677  C  CD  . GLU B  1 59  ? 1.097   20.268  17.035  1.00 99.88  ? 59  GLU B CD  1 
ATOM   1678  O  OE1 . GLU B  1 59  ? 0.898   20.959  18.058  1.00 99.89  ? 59  GLU B OE1 1 
ATOM   1679  O  OE2 . GLU B  1 59  ? 2.152   19.615  16.863  1.00 99.91  ? 59  GLU B OE2 1 
ATOM   1680  N  N   . VAL B  1 60  ? -2.635  23.662  14.514  1.00 3.34   ? 60  VAL B N   1 
ATOM   1681  C  CA  . VAL B  1 60  ? -3.391  24.898  14.654  1.00 1.31   ? 60  VAL B CA  1 
ATOM   1682  C  C   . VAL B  1 60  ? -4.779  24.571  14.126  1.00 3.13   ? 60  VAL B C   1 
ATOM   1683  O  O   . VAL B  1 60  ? -5.799  24.740  14.794  1.00 5.21   ? 60  VAL B O   1 
ATOM   1684  C  CB  . VAL B  1 60  ? -2.676  25.965  13.793  1.00 5.24   ? 60  VAL B CB  1 
ATOM   1685  C  CG1 . VAL B  1 60  ? -3.643  27.124  13.569  1.00 3.50   ? 60  VAL B CG1 1 
ATOM   1686  C  CG2 . VAL B  1 60  ? -1.415  26.476  14.477  1.00 1.26   ? 60  VAL B CG2 1 
ATOM   1687  N  N   . ALA B  1 61  ? -4.807  23.984  12.947  1.00 1.26   ? 61  ALA B N   1 
ATOM   1688  C  CA  . ALA B  1 61  ? -6.120  23.679  12.369  1.00 1.78   ? 61  ALA B CA  1 
ATOM   1689  C  C   . ALA B  1 61  ? -6.898  22.738  13.246  1.00 8.04   ? 61  ALA B C   1 
ATOM   1690  O  O   . ALA B  1 61  ? -8.089  22.891  13.397  1.00 9.34   ? 61  ALA B O   1 
ATOM   1691  C  CB  . ALA B  1 61  ? -6.031  23.071  10.974  1.00 1.14   ? 61  ALA B CB  1 
ATOM   1692  N  N   . GLU B  1 62  ? -6.239  21.735  13.801  1.00 3.55   ? 62  GLU B N   1 
ATOM   1693  C  CA  . GLU B  1 62  ? -7.011  20.807  14.615  1.00 2.73   ? 62  GLU B CA  1 
ATOM   1694  C  C   . GLU B  1 62  ? -7.474  21.433  15.926  1.00 7.34   ? 62  GLU B C   1 
ATOM   1695  O  O   . GLU B  1 62  ? -8.514  21.059  16.474  1.00 6.35   ? 62  GLU B O   1 
ATOM   1696  C  CB  . GLU B  1 62  ? -6.283  19.468  14.743  1.00 2.68   ? 62  GLU B CB  1 
ATOM   1697  C  CG  . GLU B  1 62  ? -6.272  18.766  13.358  1.00 10.34  ? 62  GLU B CG  1 
ATOM   1698  C  CD  . GLU B  1 62  ? -5.498  17.435  13.272  1.00 11.45  ? 62  GLU B CD  1 
ATOM   1699  O  OE1 . GLU B  1 62  ? -4.857  17.036  14.282  1.00 42.38  ? 62  GLU B OE1 1 
ATOM   1700  O  OE2 . GLU B  1 62  ? -5.490  16.865  12.139  1.00 22.91  ? 62  GLU B OE2 1 
ATOM   1701  N  N   . ARG B  1 63  ? -6.689  22.403  16.398  1.00 3.75   ? 63  ARG B N   1 
ATOM   1702  C  CA  . ARG B  1 63  ? -7.001  23.102  17.637  1.00 3.17   ? 63  ARG B CA  1 
ATOM   1703  C  C   . ARG B  1 63  ? -8.269  23.924  17.375  1.00 8.94   ? 63  ARG B C   1 
ATOM   1704  O  O   . ARG B  1 63  ? -9.246  23.926  18.139  1.00 6.33   ? 63  ARG B O   1 
ATOM   1705  C  CB  . ARG B  1 63  ? -5.858  23.990  18.107  1.00 1.00   ? 63  ARG B CB  1 
ATOM   1706  C  CG  . ARG B  1 63  ? -6.160  24.740  19.405  1.00 1.38   ? 63  ARG B CG  1 
ATOM   1707  C  CD  . ARG B  1 63  ? -6.751  23.870  20.512  1.00 2.60   ? 63  ARG B CD  1 
ATOM   1708  N  NE  . ARG B  1 63  ? -7.247  24.671  21.642  1.00 6.24   ? 63  ARG B NE  1 
ATOM   1709  C  CZ  . ARG B  1 63  ? -7.960  24.203  22.675  1.00 8.22   ? 63  ARG B CZ  1 
ATOM   1710  N  NH1 . ARG B  1 63  ? -8.290  22.915  22.765  1.00 1.00   ? 63  ARG B NH1 1 
ATOM   1711  N  NH2 . ARG B  1 63  ? -8.333  25.033  23.650  1.00 1.60   ? 63  ARG B NH2 1 
ATOM   1712  N  N   . LEU B  1 64  ? -8.253  24.556  16.210  1.00 2.31   ? 64  LEU B N   1 
ATOM   1713  C  CA  . LEU B  1 64  ? -9.412  25.358  15.837  1.00 2.90   ? 64  LEU B CA  1 
ATOM   1714  C  C   . LEU B  1 64  ? -10.671 24.502  15.820  1.00 12.07  ? 64  LEU B C   1 
ATOM   1715  O  O   . LEU B  1 64  ? -11.740 24.807  16.375  1.00 11.17  ? 64  LEU B O   1 
ATOM   1716  C  CB  . LEU B  1 64  ? -9.132  25.894  14.437  1.00 1.26   ? 64  LEU B CB  1 
ATOM   1717  C  CG  . LEU B  1 64  ? -10.218 26.769  13.830  1.00 8.87   ? 64  LEU B CG  1 
ATOM   1718  C  CD1 . LEU B  1 64  ? -10.594 27.941  14.748  1.00 5.67   ? 64  LEU B CD1 1 
ATOM   1719  C  CD2 . LEU B  1 64  ? -9.721  27.317  12.518  1.00 3.18   ? 64  LEU B CD2 1 
ATOM   1720  N  N   . LEU B  1 65  ? -10.496 23.395  15.127  1.00 4.85   ? 65  LEU B N   1 
ATOM   1721  C  CA  . LEU B  1 65  ? -11.605 22.509  14.946  1.00 3.48   ? 65  LEU B CA  1 
ATOM   1722  C  C   . LEU B  1 65  ? -12.055 22.109  16.339  1.00 9.21   ? 65  LEU B C   1 
ATOM   1723  O  O   . LEU B  1 65  ? -13.255 22.076  16.644  1.00 6.54   ? 65  LEU B O   1 
ATOM   1724  C  CB  . LEU B  1 65  ? -10.902 21.366  14.263  1.00 3.28   ? 65  LEU B CB  1 
ATOM   1725  C  CG  . LEU B  1 65  ? -11.477 20.629  13.069  1.00 10.28  ? 65  LEU B CG  1 
ATOM   1726  C  CD1 . LEU B  1 65  ? -12.211 21.605  12.212  1.00 2.03   ? 65  LEU B CD1 1 
ATOM   1727  C  CD2 . LEU B  1 65  ? -10.278 20.128  12.309  1.00 1.22   ? 65  LEU B CD2 1 
ATOM   1728  N  N   . ALA B  1 66  ? -11.079 21.817  17.188  1.00 6.54   ? 66  ALA B N   1 
ATOM   1729  C  CA  . ALA B  1 66  ? -11.432 21.417  18.542  1.00 5.35   ? 66  ALA B CA  1 
ATOM   1730  C  C   . ALA B  1 66  ? -12.123 22.469  19.418  1.00 11.59  ? 66  ALA B C   1 
ATOM   1731  O  O   . ALA B  1 66  ? -12.811 22.155  20.389  1.00 5.30   ? 66  ALA B O   1 
ATOM   1732  C  CB  . ALA B  1 66  ? -10.191 20.887  19.214  1.00 4.69   ? 66  ALA B CB  1 
ATOM   1733  N  N   . ILE B  1 67  ? -11.923 23.747  19.113  1.00 10.15  ? 67  ILE B N   1 
ATOM   1734  C  CA  . ILE B  1 67  ? -12.642 24.782  19.864  1.00 7.96   ? 67  ILE B CA  1 
ATOM   1735  C  C   . ILE B  1 67  ? -13.923 25.181  19.143  1.00 16.88  ? 67  ILE B C   1 
ATOM   1736  O  O   . ILE B  1 67  ? -14.556 26.191  19.452  1.00 15.71  ? 67  ILE B O   1 
ATOM   1737  C  CB  . ILE B  1 67  ? -11.838 26.056  20.178  1.00 7.46   ? 67  ILE B CB  1 
ATOM   1738  C  CG1 . ILE B  1 67  ? -11.351 26.708  18.897  1.00 5.99   ? 67  ILE B CG1 1 
ATOM   1739  C  CG2 . ILE B  1 67  ? -10.694 25.781  21.135  1.00 4.72   ? 67  ILE B CG2 1 
ATOM   1740  C  CD1 . ILE B  1 67  ? -10.524 27.926  19.165  1.00 29.03  ? 67  ILE B CD1 1 
ATOM   1741  N  N   . GLY B  1 68  ? -14.314 24.353  18.187  1.00 7.26   ? 68  GLY B N   1 
ATOM   1742  C  CA  . GLY B  1 68  ? -15.568 24.609  17.503  1.00 1.96   ? 68  GLY B CA  1 
ATOM   1743  C  C   . GLY B  1 68  ? -15.451 25.468  16.256  1.00 13.22  ? 68  GLY B C   1 
ATOM   1744  O  O   . GLY B  1 68  ? -16.511 25.888  15.740  1.00 20.43  ? 68  GLY B O   1 
ATOM   1745  N  N   . GLY B  1 69  ? -14.222 25.694  15.776  1.00 8.18   ? 69  GLY B N   1 
ATOM   1746  C  CA  . GLY B  1 69  ? -13.984 26.493  14.563  1.00 1.38   ? 69  GLY B CA  1 
ATOM   1747  C  C   . GLY B  1 69  ? -14.046 25.673  13.284  1.00 6.33   ? 69  GLY B C   1 
ATOM   1748  O  O   . GLY B  1 69  ? -14.289 24.460  13.291  1.00 7.09   ? 69  GLY B O   1 
ATOM   1749  N  N   . SER B  1 70  ? -13.716 26.336  12.185  1.00 6.19   ? 70  SER B N   1 
ATOM   1750  C  CA  . SER B  1 70  ? -13.703 25.720  10.849  1.00 8.19   ? 70  SER B CA  1 
ATOM   1751  C  C   . SER B  1 70  ? -12.545 26.290  10.050  1.00 16.89  ? 70  SER B C   1 
ATOM   1752  O  O   . SER B  1 70  ? -12.609 27.419  9.581   1.00 21.81  ? 70  SER B O   1 
ATOM   1753  C  CB  . SER B  1 70  ? -15.008 26.037  10.103  1.00 12.61  ? 70  SER B CB  1 
ATOM   1754  O  OG  . SER B  1 70  ? -16.124 25.445  10.755  1.00 34.15  ? 70  SER B OG  1 
ATOM   1755  N  N   . PRO B  1 71  ? -11.476 25.525  9.911   1.00 13.53  ? 71  PRO B N   1 
ATOM   1756  C  CA  . PRO B  1 71  ? -10.300 26.026  9.207   1.00 10.79  ? 71  PRO B CA  1 
ATOM   1757  C  C   . PRO B  1 71  ? -10.499 26.304  7.723   1.00 9.22   ? 71  PRO B C   1 
ATOM   1758  O  O   . PRO B  1 71  ? -11.225 25.567  7.053   1.00 5.55   ? 71  PRO B O   1 
ATOM   1759  C  CB  . PRO B  1 71  ? -9.332  24.852  9.311   1.00 9.99   ? 71  PRO B CB  1 
ATOM   1760  C  CG  . PRO B  1 71  ? -10.218 23.680  9.376   1.00 14.00  ? 71  PRO B CG  1 
ATOM   1761  C  CD  . PRO B  1 71  ? -11.390 24.090  10.208  1.00 6.66   ? 71  PRO B CD  1 
ATOM   1762  N  N   . PHE B  1 72  ? -9.793  27.317  7.228   1.00 7.49   ? 72  PHE B N   1 
ATOM   1763  C  CA  . PHE B  1 72  ? -9.802  27.559  5.783   1.00 4.06   ? 72  PHE B CA  1 
ATOM   1764  C  C   . PHE B  1 72  ? -9.211  26.302  5.193   1.00 14.37  ? 72  PHE B C   1 
ATOM   1765  O  O   . PHE B  1 72  ? -8.306  25.681  5.761   1.00 11.69  ? 72  PHE B O   1 
ATOM   1766  C  CB  . PHE B  1 72  ? -8.804  28.631  5.408   1.00 5.31   ? 72  PHE B CB  1 
ATOM   1767  C  CG  . PHE B  1 72  ? -9.183  29.968  5.946   1.00 9.28   ? 72  PHE B CG  1 
ATOM   1768  C  CD1 . PHE B  1 72  ? -10.470 30.442  5.756   1.00 14.15  ? 72  PHE B CD1 1 
ATOM   1769  C  CD2 . PHE B  1 72  ? -8.288  30.718  6.696   1.00 10.46  ? 72  PHE B CD2 1 
ATOM   1770  C  CE1 . PHE B  1 72  ? -10.857 31.671  6.258   1.00 18.56  ? 72  PHE B CE1 1 
ATOM   1771  C  CE2 . PHE B  1 72  ? -8.650  31.963  7.229   1.00 12.55  ? 72  PHE B CE2 1 
ATOM   1772  C  CZ  . PHE B  1 72  ? -9.954  32.440  7.011   1.00 14.21  ? 72  PHE B CZ  1 
ATOM   1773  N  N   . SER B  1 73  ? -9.640  25.965  3.991   1.00 6.35   ? 73  SER B N   1 
ATOM   1774  C  CA  . SER B  1 73  ? -9.075  24.755  3.435   1.00 3.00   ? 73  SER B CA  1 
ATOM   1775  C  C   . SER B  1 73  ? -8.972  24.673  1.923   1.00 9.06   ? 73  SER B C   1 
ATOM   1776  O  O   . SER B  1 73  ? -9.266  23.628  1.326   1.00 5.98   ? 73  SER B O   1 
ATOM   1777  C  CB  . SER B  1 73  ? -9.840  23.547  3.962   1.00 7.20   ? 73  SER B CB  1 
ATOM   1778  O  OG  . SER B  1 73  ? -11.207 23.635  3.600   1.00 13.21  ? 73  SER B OG  1 
ATOM   1779  N  N   . THR B  1 74  ? -8.489  25.771  1.350   1.00 4.41   ? 74  THR B N   1 
ATOM   1780  C  CA  . THR B  1 74  ? -8.309  25.854  -0.107  1.00 3.86   ? 74  THR B CA  1 
ATOM   1781  C  C   . THR B  1 74  ? -7.258  26.930  -0.288  1.00 7.22   ? 74  THR B C   1 
ATOM   1782  O  O   . THR B  1 74  ? -7.150  27.808  0.574   1.00 9.84   ? 74  THR B O   1 
ATOM   1783  C  CB  . THR B  1 74  ? -9.570  26.422  -0.765  1.00 10.85  ? 74  THR B CB  1 
ATOM   1784  O  OG1 . THR B  1 74  ? -9.875  27.705  -0.175  1.00 13.19  ? 74  THR B OG1 1 
ATOM   1785  C  CG2 . THR B  1 74  ? -10.745 25.419  -0.675  1.00 5.86   ? 74  THR B CG2 1 
ATOM   1786  N  N   . LEU B  1 75  ? -6.486  26.815  -1.363  1.00 3.36   ? 75  LEU B N   1 
ATOM   1787  C  CA  . LEU B  1 75  ? -5.416  27.778  -1.582  1.00 6.23   ? 75  LEU B CA  1 
ATOM   1788  C  C   . LEU B  1 75  ? -6.036  29.163  -1.697  1.00 12.35  ? 75  LEU B C   1 
ATOM   1789  O  O   . LEU B  1 75  ? -5.469  30.173  -1.294  1.00 16.00  ? 75  LEU B O   1 
ATOM   1790  C  CB  . LEU B  1 75  ? -4.697  27.501  -2.909  1.00 8.17   ? 75  LEU B CB  1 
ATOM   1791  C  CG  . LEU B  1 75  ? -3.787  26.262  -2.902  1.00 14.59  ? 75  LEU B CG  1 
ATOM   1792  C  CD1 . LEU B  1 75  ? -4.616  25.039  -2.600  1.00 17.26  ? 75  LEU B CD1 1 
ATOM   1793  C  CD2 . LEU B  1 75  ? -3.125  26.165  -4.269  1.00 9.50   ? 75  LEU B CD2 1 
ATOM   1794  N  N   . LYS B  1 76  ? -7.224  29.154  -2.279  1.00 11.99  ? 76  LYS B N   1 
ATOM   1795  C  CA  . LYS B  1 76  ? -7.898  30.416  -2.493  1.00 10.92  ? 76  LYS B CA  1 
ATOM   1796  C  C   . LYS B  1 76  ? -8.083  31.132  -1.154  1.00 10.78  ? 76  LYS B C   1 
ATOM   1797  O  O   . LYS B  1 76  ? -7.641  32.265  -0.986  1.00 11.99  ? 76  LYS B O   1 
ATOM   1798  C  CB  . LYS B  1 76  ? -9.201  30.230  -3.277  1.00 14.92  ? 76  LYS B CB  1 
ATOM   1799  C  CG  . LYS B  1 76  ? -9.942  31.547  -3.483  1.00 50.63  ? 76  LYS B CG  1 
ATOM   1800  C  CD  . LYS B  1 76  ? -11.082 31.398  -4.459  1.00 99.46  ? 76  LYS B CD  1 
ATOM   1801  C  CE  . LYS B  1 76  ? -11.917 32.643  -4.616  0.00 100.00 ? 76  LYS B CE  1 
ATOM   1802  N  NZ  . LYS B  1 76  ? -12.744 32.903  -3.419  0.00 100.00 ? 76  LYS B NZ  1 
ATOM   1803  N  N   . GLU B  1 77  ? -8.686  30.433  -0.195  1.00 8.53   ? 77  GLU B N   1 
ATOM   1804  C  CA  . GLU B  1 77  ? -8.875  31.007  1.135   1.00 6.62   ? 77  GLU B CA  1 
ATOM   1805  C  C   . GLU B  1 77  ? -7.539  31.384  1.776   1.00 10.85  ? 77  GLU B C   1 
ATOM   1806  O  O   . GLU B  1 77  ? -7.432  32.406  2.463   1.00 11.48  ? 77  GLU B O   1 
ATOM   1807  C  CB  . GLU B  1 77  ? -9.570  29.983  2.026   1.00 8.30   ? 77  GLU B CB  1 
ATOM   1808  C  CG  . GLU B  1 77  ? -10.993 29.683  1.621   1.00 11.48  ? 77  GLU B CG  1 
ATOM   1809  C  CD  . GLU B  1 77  ? -11.587 28.523  2.422   1.00 35.28  ? 77  GLU B CD  1 
ATOM   1810  O  OE1 . GLU B  1 77  ? -11.119 27.378  2.203   1.00 29.58  ? 77  GLU B OE1 1 
ATOM   1811  O  OE2 . GLU B  1 77  ? -12.484 28.716  3.286   1.00 31.46  ? 77  GLU B OE2 1 
ATOM   1812  N  N   . PHE B  1 78  ? -6.513  30.563  1.563   1.00 8.16   ? 78  PHE B N   1 
ATOM   1813  C  CA  . PHE B  1 78  ? -5.242  30.853  2.211   1.00 7.02   ? 78  PHE B CA  1 
ATOM   1814  C  C   . PHE B  1 78  ? -4.781  32.157  1.644   1.00 12.36  ? 78  PHE B C   1 
ATOM   1815  O  O   . PHE B  1 78  ? -4.469  33.062  2.398   1.00 13.56  ? 78  PHE B O   1 
ATOM   1816  C  CB  . PHE B  1 78  ? -4.166  29.779  1.990   1.00 6.93   ? 78  PHE B CB  1 
ATOM   1817  C  CG  . PHE B  1 78  ? -4.558  28.424  2.516   1.00 4.38   ? 78  PHE B CG  1 
ATOM   1818  C  CD1 . PHE B  1 78  ? -5.431  28.295  3.571   1.00 3.93   ? 78  PHE B CD1 1 
ATOM   1819  C  CD2 . PHE B  1 78  ? -4.141  27.268  1.883   1.00 4.47   ? 78  PHE B CD2 1 
ATOM   1820  C  CE1 . PHE B  1 78  ? -5.831  27.031  4.030   1.00 7.26   ? 78  PHE B CE1 1 
ATOM   1821  C  CE2 . PHE B  1 78  ? -4.540  25.995  2.322   1.00 2.80   ? 78  PHE B CE2 1 
ATOM   1822  C  CZ  . PHE B  1 78  ? -5.382  25.872  3.399   1.00 4.43   ? 78  PHE B CZ  1 
ATOM   1823  N  N   . LEU B  1 79  ? -4.745  32.230  0.330   1.00 7.79   ? 79  LEU B N   1 
ATOM   1824  C  CA  . LEU B  1 79  ? -4.311  33.454  -0.332  1.00 13.76  ? 79  LEU B CA  1 
ATOM   1825  C  C   . LEU B  1 79  ? -5.072  34.707  0.112   1.00 22.02  ? 79  LEU B C   1 
ATOM   1826  O  O   . LEU B  1 79  ? -4.533  35.803  0.371   1.00 17.66  ? 79  LEU B O   1 
ATOM   1827  C  CB  . LEU B  1 79  ? -4.477  33.294  -1.837  1.00 16.13  ? 79  LEU B CB  1 
ATOM   1828  C  CG  . LEU B  1 79  ? -3.175  32.685  -2.349  1.00 24.85  ? 79  LEU B CG  1 
ATOM   1829  C  CD1 . LEU B  1 79  ? -3.244  32.569  -3.876  1.00 19.92  ? 79  LEU B CD1 1 
ATOM   1830  C  CD2 . LEU B  1 79  ? -2.095  33.659  -1.913  1.00 27.40  ? 79  LEU B CD2 1 
ATOM   1831  N  N   . GLU B  1 80  ? -6.377  34.512  0.231   1.00 15.43  ? 80  GLU B N   1 
ATOM   1832  C  CA  . GLU B  1 80  ? -7.185  35.618  0.691   1.00 17.55  ? 80  GLU B CA  1 
ATOM   1833  C  C   . GLU B  1 80  ? -6.906  36.039  2.118   1.00 26.05  ? 80  GLU B C   1 
ATOM   1834  O  O   . GLU B  1 80  ? -7.087  37.204  2.464   1.00 38.66  ? 80  GLU B O   1 
ATOM   1835  C  CB  . GLU B  1 80  ? -8.663  35.251  0.548   1.00 17.93  ? 80  GLU B CB  1 
ATOM   1836  C  CG  . GLU B  1 80  ? -9.032  34.987  -0.893  1.00 63.13  ? 80  GLU B CG  1 
ATOM   1837  C  CD  . GLU B  1 80  ? -10.485 34.682  -1.082  0.00 100.00 ? 80  GLU B CD  1 
ATOM   1838  O  OE1 . GLU B  1 80  ? -11.142 34.326  -0.088  0.00 100.00 ? 80  GLU B OE1 1 
ATOM   1839  O  OE2 . GLU B  1 80  ? -10.941 34.769  -2.233  0.00 100.00 ? 80  GLU B OE2 1 
ATOM   1840  N  N   . ASN B  1 81  ? -6.522  35.117  2.991   1.00 13.00  ? 81  ASN B N   1 
ATOM   1841  C  CA  . ASN B  1 81  ? -6.344  35.545  4.370   1.00 10.56  ? 81  ASN B CA  1 
ATOM   1842  C  C   . ASN B  1 81  ? -4.946  35.683  4.924   1.00 14.68  ? 81  ASN B C   1 
ATOM   1843  O  O   . ASN B  1 81  ? -4.743  36.241  6.016   1.00 18.49  ? 81  ASN B O   1 
ATOM   1844  C  CB  . ASN B  1 81  ? -7.194  34.666  5.279   1.00 14.17  ? 81  ASN B CB  1 
ATOM   1845  C  CG  . ASN B  1 81  ? -8.664  34.644  4.849   1.00 14.83  ? 81  ASN B CG  1 
ATOM   1846  O  OD1 . ASN B  1 81  ? -9.066  33.942  3.904   1.00 21.71  ? 81  ASN B OD1 1 
ATOM   1847  N  ND2 . ASN B  1 81  ? -9.481  35.384  5.588   1.00 15.48  ? 81  ASN B ND2 1 
ATOM   1848  N  N   . ALA B  1 82  ? -3.966  35.157  4.205   1.00 13.17  ? 82  ALA B N   1 
ATOM   1849  C  CA  . ALA B  1 82  ? -2.650  35.249  4.805   1.00 12.62  ? 82  ALA B CA  1 
ATOM   1850  C  C   . ALA B  1 82  ? -2.067  36.651  4.924   1.00 17.33  ? 82  ALA B C   1 
ATOM   1851  O  O   . ALA B  1 82  ? -2.295  37.462  4.024   1.00 20.46  ? 82  ALA B O   1 
ATOM   1852  C  CB  . ALA B  1 82  ? -1.742  34.371  3.962   1.00 12.63  ? 82  ALA B CB  1 
ATOM   1853  N  N   . SER B  1 83  ? -1.238  36.909  5.936   1.00 8.29   ? 83  SER B N   1 
ATOM   1854  C  CA  . SER B  1 83  ? -0.519  38.172  6.041   1.00 4.04   ? 83  SER B CA  1 
ATOM   1855  C  C   . SER B  1 83  ? 0.896   37.894  5.522   1.00 14.41  ? 83  SER B C   1 
ATOM   1856  O  O   . SER B  1 83  ? 1.658   38.803  5.206   1.00 17.65  ? 83  SER B O   1 
ATOM   1857  C  CB  . SER B  1 83  ? -0.519  38.675  7.483   1.00 3.94   ? 83  SER B CB  1 
ATOM   1858  O  OG  . SER B  1 83  ? -0.189  37.671  8.427   1.00 26.55  ? 83  SER B OG  1 
ATOM   1859  N  N   . VAL B  1 84  ? 1.273   36.613  5.457   1.00 14.26  ? 84  VAL B N   1 
ATOM   1860  C  CA  . VAL B  1 84  ? 2.601   36.221  4.946   1.00 9.99   ? 84  VAL B CA  1 
ATOM   1861  C  C   . VAL B  1 84  ? 2.619   36.532  3.446   1.00 12.76  ? 84  VAL B C   1 
ATOM   1862  O  O   . VAL B  1 84  ? 1.694   36.192  2.708   1.00 11.58  ? 84  VAL B O   1 
ATOM   1863  C  CB  . VAL B  1 84  ? 2.868   34.716  5.158   1.00 6.05   ? 84  VAL B CB  1 
ATOM   1864  C  CG1 . VAL B  1 84  ? 4.130   34.299  4.420   1.00 5.41   ? 84  VAL B CG1 1 
ATOM   1865  C  CG2 . VAL B  1 84  ? 3.036   34.426  6.633   1.00 5.82   ? 84  VAL B CG2 1 
ATOM   1866  N  N   . GLU B  1 85  ? 3.659   37.214  2.983   1.00 20.49  ? 85  GLU B N   1 
ATOM   1867  C  CA  . GLU B  1 85  ? 3.680   37.530  1.548   1.00 22.11  ? 85  GLU B CA  1 
ATOM   1868  C  C   . GLU B  1 85  ? 4.397   36.460  0.712   1.00 19.16  ? 85  GLU B C   1 
ATOM   1869  O  O   . GLU B  1 85  ? 5.424   35.916  1.154   1.00 23.98  ? 85  GLU B O   1 
ATOM   1870  C  CB  . GLU B  1 85  ? 4.456   38.827  1.317   1.00 27.39  ? 85  GLU B CB  1 
ATOM   1871  C  CG  . GLU B  1 85  ? 3.691   40.060  1.740   1.00 73.13  ? 85  GLU B CG  1 
ATOM   1872  C  CD  . GLU B  1 85  ? 2.400   40.154  0.993   0.00 100.00 ? 85  GLU B CD  1 
ATOM   1873  O  OE1 . GLU B  1 85  ? 2.218   39.412  0.010   0.00 100.00 ? 85  GLU B OE1 1 
ATOM   1874  O  OE2 . GLU B  1 85  ? 1.523   40.933  1.411   0.00 100.00 ? 85  GLU B OE2 1 
ATOM   1875  N  N   . GLU B  1 86  ? 4.010   36.269  -0.542  1.00 13.73  ? 86  GLU B N   1 
ATOM   1876  C  CA  . GLU B  1 86  ? 4.757   35.326  -1.376  1.00 16.69  ? 86  GLU B CA  1 
ATOM   1877  C  C   . GLU B  1 86  ? 5.051   35.957  -2.732  1.00 19.23  ? 86  GLU B C   1 
ATOM   1878  O  O   . GLU B  1 86  ? 4.339   36.857  -3.188  1.00 20.38  ? 86  GLU B O   1 
ATOM   1879  C  CB  . GLU B  1 86  ? 4.002   34.010  -1.606  1.00 17.51  ? 86  GLU B CB  1 
ATOM   1880  C  CG  . GLU B  1 86  ? 2.648   34.207  -2.291  1.00 39.50  ? 86  GLU B CG  1 
ATOM   1881  C  CD  . GLU B  1 86  ? 2.042   32.963  -2.926  1.00 49.48  ? 86  GLU B CD  1 
ATOM   1882  O  OE1 . GLU B  1 86  ? 2.319   31.819  -2.531  1.00 29.14  ? 86  GLU B OE1 1 
ATOM   1883  O  OE2 . GLU B  1 86  ? 1.229   33.118  -3.850  1.00 26.22  ? 86  GLU B OE2 1 
ATOM   1884  N  N   . ALA B  1 87  ? 6.046   35.424  -3.439  1.00 17.27  ? 87  ALA B N   1 
ATOM   1885  C  CA  . ALA B  1 87  ? 6.348   35.947  -4.760  1.00 17.61  ? 87  ALA B CA  1 
ATOM   1886  C  C   . ALA B  1 87  ? 7.062   34.915  -5.601  1.00 20.75  ? 87  ALA B C   1 
ATOM   1887  O  O   . ALA B  1 87  ? 8.094   34.353  -5.227  1.00 25.95  ? 87  ALA B O   1 
ATOM   1888  C  CB  . ALA B  1 87  ? 7.198   37.190  -4.676  1.00 17.26  ? 87  ALA B CB  1 
ATOM   1889  N  N   . PRO B  1 88  ? 6.560   34.776  -6.824  1.00 18.55  ? 88  PRO B N   1 
ATOM   1890  C  CA  . PRO B  1 88  ? 7.186   33.883  -7.806  1.00 21.29  ? 88  PRO B CA  1 
ATOM   1891  C  C   . PRO B  1 88  ? 8.693   34.176  -7.921  1.00 18.90  ? 88  PRO B C   1 
ATOM   1892  O  O   . PRO B  1 88  ? 9.193   35.292  -7.712  1.00 15.77  ? 88  PRO B O   1 
ATOM   1893  C  CB  . PRO B  1 88  ? 6.478   34.236  -9.127  1.00 23.58  ? 88  PRO B CB  1 
ATOM   1894  C  CG  . PRO B  1 88  ? 6.100   35.705  -8.934  1.00 27.45  ? 88  PRO B CG  1 
ATOM   1895  C  CD  . PRO B  1 88  ? 5.694   35.784  -7.464  1.00 19.81  ? 88  PRO B CD  1 
ATOM   1896  N  N   . TYR B  1 89  ? 9.400   33.095  -8.200  1.00 15.86  ? 89  TYR B N   1 
ATOM   1897  C  CA  . TYR B  1 89  ? 10.839  33.226  -8.307  1.00 14.80  ? 89  TYR B CA  1 
ATOM   1898  C  C   . TYR B  1 89  ? 11.152  33.484  -9.772  1.00 30.57  ? 89  TYR B C   1 
ATOM   1899  O  O   . TYR B  1 89  ? 10.983  32.612  -10.633 1.00 35.83  ? 89  TYR B O   1 
ATOM   1900  C  CB  . TYR B  1 89  ? 11.460  31.936  -7.798  1.00 8.66   ? 89  TYR B CB  1 
ATOM   1901  C  CG  . TYR B  1 89  ? 12.968  32.015  -7.706  1.00 10.22  ? 89  TYR B CG  1 
ATOM   1902  C  CD1 . TYR B  1 89  ? 13.565  32.477  -6.535  1.00 8.06   ? 89  TYR B CD1 1 
ATOM   1903  C  CD2 . TYR B  1 89  ? 13.740  31.627  -8.798  1.00 14.11  ? 89  TYR B CD2 1 
ATOM   1904  C  CE1 . TYR B  1 89  ? 14.955  32.552  -6.454  1.00 9.55   ? 89  TYR B CE1 1 
ATOM   1905  C  CE2 . TYR B  1 89  ? 15.132  31.702  -8.719  1.00 18.95  ? 89  TYR B CE2 1 
ATOM   1906  C  CZ  . TYR B  1 89  ? 15.741  32.165  -7.547  1.00 20.23  ? 89  TYR B CZ  1 
ATOM   1907  O  OH  . TYR B  1 89  ? 17.095  32.237  -7.471  1.00 30.93  ? 89  TYR B OH  1 
ATOM   1908  N  N   . THR B  1 90  ? 11.584  34.690  -10.034 1.00 35.81  ? 90  THR B N   1 
ATOM   1909  C  CA  . THR B  1 90  ? 11.879  35.115  -11.395 1.00 38.75  ? 90  THR B CA  1 
ATOM   1910  C  C   . THR B  1 90  ? 13.386  35.281  -11.565 1.00 47.80  ? 90  THR B C   1 
ATOM   1911  O  O   . THR B  1 90  ? 14.044  34.522  -12.285 1.00 48.82  ? 90  THR B O   1 
ATOM   1912  C  CB  . THR B  1 90  ? 11.109  36.401  -11.674 1.00 51.16  ? 90  THR B CB  1 
ATOM   1913  O  OG1 . THR B  1 90  ? 11.279  37.311  -10.597 1.00 56.50  ? 90  THR B OG1 1 
ATOM   1914  C  CG2 . THR B  1 90  ? 9.602   36.152  -11.826 1.00 51.75  ? 90  THR B CG2 1 
ATOM   1915  N  N   . LYS B  1 91  ? 13.927  36.267  -10.899 1.00 43.97  ? 91  LYS B N   1 
ATOM   1916  C  CA  . LYS B  1 91  ? 15.361  36.515  -10.969 1.00 28.17  ? 91  LYS B CA  1 
ATOM   1917  C  C   . LYS B  1 91  ? 16.093  35.592  -10.023 1.00 52.85  ? 91  LYS B C   1 
ATOM   1918  O  O   . LYS B  1 91  ? 15.565  35.174  -8.991  1.00 72.98  ? 91  LYS B O   1 
ATOM   1919  C  CB  . LYS B  1 91  ? 15.687  37.944  -10.535 1.00 67.60  ? 91  LYS B CB  1 
ATOM   1920  C  CG  . LYS B  1 91  ? 17.189  38.190  -10.327 0.00 100.00 ? 91  LYS B CG  1 
ATOM   1921  C  CD  . LYS B  1 91  ? 17.569  39.660  -10.528 0.00 100.00 ? 91  LYS B CD  1 
ATOM   1922  C  CE  . LYS B  1 91  ? 17.048  40.224  -11.852 0.00 100.00 ? 91  LYS B CE  1 
ATOM   1923  N  NZ  . LYS B  1 91  ? 17.757  41.440  -12.290 0.00 100.00 ? 91  LYS B NZ  1 
ATOM   1924  N  N   . PRO B  1 92  ? 17.278  35.133  -10.343 0.00 76.82  ? 92  PRO B N   1 
ATOM   1925  C  CA  . PRO B  1 92  ? 18.082  34.467  -9.350  0.00 38.88  ? 92  PRO B CA  1 
ATOM   1926  C  C   . PRO B  1 92  ? 18.427  35.444  -8.218  0.00 67.91  ? 92  PRO B C   1 
ATOM   1927  O  O   . PRO B  1 92  ? 18.758  36.641  -8.493  0.00 50.69  ? 92  PRO B O   1 
ATOM   1928  C  CB  . PRO B  1 92  ? 19.280  34.006  -10.138 0.00 44.00  ? 92  PRO B CB  1 
ATOM   1929  C  CG  . PRO B  1 92  ? 19.077  34.436  -11.584 0.00 90.10  ? 92  PRO B CG  1 
ATOM   1930  C  CD  . PRO B  1 92  ? 17.815  35.221  -11.688 0.00 83.45  ? 92  PRO B CD  1 
ATOM   1931  N  N   . LYS B  1 93  ? 18.327  34.920  -6.999  1.00 47.15  ? 93  LYS B N   1 
ATOM   1932  C  CA  . LYS B  1 93  ? 18.640  35.645  -5.742  1.00 39.32  ? 93  LYS B CA  1 
ATOM   1933  C  C   . LYS B  1 93  ? 19.721  34.878  -4.988  1.00 39.66  ? 93  LYS B C   1 
ATOM   1934  O  O   . LYS B  1 93  ? 19.894  33.683  -5.217  1.00 53.39  ? 93  LYS B O   1 
ATOM   1935  C  CB  . LYS B  1 93  ? 17.420  35.685  -4.816  1.00 7.26   ? 93  LYS B CB  1 
ATOM   1936  C  CG  . LYS B  1 93  ? 16.175  36.298  -5.448  1.00 89.56  ? 93  LYS B CG  1 
ATOM   1937  C  CD  . LYS B  1 93  ? 14.956  36.232  -4.524  0.00 100.00 ? 93  LYS B CD  1 
ATOM   1938  C  CE  . LYS B  1 93  ? 15.000  37.269  -3.400  0.00 100.00 ? 93  LYS B CE  1 
ATOM   1939  N  NZ  . LYS B  1 93  ? 14.482  38.581  -3.817  0.00 100.00 ? 93  LYS B NZ  1 
ATOM   1940  N  N   . THR B  1 94  ? 20.418  35.522  -4.058  1.00 49.24  ? 94  THR B N   1 
ATOM   1941  C  CA  . THR B  1 94  ? 21.421  34.828  -3.253  1.00 41.61  ? 94  THR B CA  1 
ATOM   1942  C  C   . THR B  1 94  ? 20.793  33.995  -2.143  1.00 32.46  ? 94  THR B C   1 
ATOM   1943  O  O   . THR B  1 94  ? 19.650  34.200  -1.738  1.00 31.67  ? 94  THR B O   1 
ATOM   1944  C  CB  . THR B  1 94  ? 22.301  35.859  -2.526  1.00 36.38  ? 94  THR B CB  1 
ATOM   1945  O  OG1 . THR B  1 94  ? 22.969  36.630  -3.490  1.00 88.93  ? 94  THR B OG1 1 
ATOM   1946  C  CG2 . THR B  1 94  ? 23.283  35.191  -1.580  1.00 34.81  ? 94  THR B CG2 1 
ATOM   1947  N  N   . MET B  1 95  ? 21.597  33.077  -1.623  1.00 16.26  ? 95  MET B N   1 
ATOM   1948  C  CA  . MET B  1 95  ? 21.251  32.236  -0.483  1.00 20.63  ? 95  MET B CA  1 
ATOM   1949  C  C   . MET B  1 95  ? 20.866  33.217  0.630   1.00 22.72  ? 95  MET B C   1 
ATOM   1950  O  O   . MET B  1 95  ? 19.767  33.181  1.188   1.00 22.64  ? 95  MET B O   1 
ATOM   1951  C  CB  . MET B  1 95  ? 22.471  31.421  -0.021  1.00 25.62  ? 95  MET B CB  1 
ATOM   1952  C  CG  . MET B  1 95  ? 22.135  30.308  0.953   1.00 30.87  ? 95  MET B CG  1 
ATOM   1953  S  SD  . MET B  1 95  ? 21.072  28.957  0.344   1.00 33.38  ? 95  MET B SD  1 
ATOM   1954  C  CE  . MET B  1 95  ? 22.157  27.916  -0.646  1.00 26.02  ? 95  MET B CE  1 
ATOM   1955  N  N   . ASP B  1 96  ? 21.764  34.168  0.873   1.00 21.82  ? 96  ASP B N   1 
ATOM   1956  C  CA  . ASP B  1 96  ? 21.485  35.185  1.873   1.00 24.50  ? 96  ASP B CA  1 
ATOM   1957  C  C   . ASP B  1 96  ? 20.161  35.883  1.581   1.00 15.30  ? 96  ASP B C   1 
ATOM   1958  O  O   . ASP B  1 96  ? 19.336  36.135  2.460   1.00 19.55  ? 96  ASP B O   1 
ATOM   1959  C  CB  . ASP B  1 96  ? 22.640  36.183  1.941   1.00 29.81  ? 96  ASP B CB  1 
ATOM   1960  C  CG  . ASP B  1 96  ? 23.854  35.613  2.651   1.00 56.68  ? 96  ASP B CG  1 
ATOM   1961  O  OD1 . ASP B  1 96  ? 23.829  34.380  2.839   1.00 65.72  ? 96  ASP B OD1 1 
ATOM   1962  O  OD2 . ASP B  1 96  ? 24.743  36.382  3.098   1.00 58.97  ? 96  ASP B OD2 1 
ATOM   1963  N  N   . GLN B  1 97  ? 19.904  36.152  0.310   1.00 8.66   ? 97  GLN B N   1 
ATOM   1964  C  CA  . GLN B  1 97  ? 18.652  36.825  0.050   1.00 15.01  ? 97  GLN B CA  1 
ATOM   1965  C  C   . GLN B  1 97  ? 17.520  35.894  0.455   1.00 20.30  ? 97  GLN B C   1 
ATOM   1966  O  O   . GLN B  1 97  ? 16.518  36.353  0.989   1.00 16.43  ? 97  GLN B O   1 
ATOM   1967  C  CB  . GLN B  1 97  ? 18.544  37.134  -1.435  1.00 22.27  ? 97  GLN B CB  1 
ATOM   1968  C  CG  . GLN B  1 97  ? 19.590  38.071  -1.980  1.00 41.89  ? 97  GLN B CG  1 
ATOM   1969  C  CD  . GLN B  1 97  ? 19.301  38.411  -3.429  1.00 61.35  ? 97  GLN B CD  1 
ATOM   1970  O  OE1 . GLN B  1 97  ? 20.193  38.357  -4.269  1.00 74.02  ? 97  GLN B OE1 1 
ATOM   1971  N  NE2 . GLN B  1 97  ? 18.065  38.773  -3.733  1.00 91.27  ? 97  GLN B NE2 1 
ATOM   1972  N  N   . LEU B  1 98  ? 17.684  34.612  0.162   1.00 13.36  ? 98  LEU B N   1 
ATOM   1973  C  CA  . LEU B  1 98  ? 16.672  33.614  0.476   1.00 12.69  ? 98  LEU B CA  1 
ATOM   1974  C  C   . LEU B  1 98  ? 16.473  33.475  1.992   1.00 11.15  ? 98  LEU B C   1 
ATOM   1975  O  O   . LEU B  1 98  ? 15.368  33.537  2.553   1.00 8.73   ? 98  LEU B O   1 
ATOM   1976  C  CB  . LEU B  1 98  ? 17.066  32.292  -0.186  1.00 11.47  ? 98  LEU B CB  1 
ATOM   1977  C  CG  . LEU B  1 98  ? 16.987  32.373  -1.718  1.00 11.41  ? 98  LEU B CG  1 
ATOM   1978  C  CD1 . LEU B  1 98  ? 17.477  31.137  -2.469  1.00 9.25   ? 98  LEU B CD1 1 
ATOM   1979  C  CD2 . LEU B  1 98  ? 15.577  32.666  -2.187  1.00 1.88   ? 98  LEU B CD2 1 
ATOM   1980  N  N   . MET B  1 99  ? 17.598  33.349  2.676   1.00 4.91   ? 99  MET B N   1 
ATOM   1981  C  CA  . MET B  1 99  ? 17.515  33.212  4.115   1.00 1.70   ? 99  MET B CA  1 
ATOM   1982  C  C   . MET B  1 99  ? 16.865  34.436  4.678   1.00 10.10  ? 99  MET B C   1 
ATOM   1983  O  O   . MET B  1 99  ? 15.997  34.311  5.533   1.00 12.75  ? 99  MET B O   1 
ATOM   1984  C  CB  . MET B  1 99  ? 18.881  33.000  4.742   1.00 4.24   ? 99  MET B CB  1 
ATOM   1985  C  CG  . MET B  1 99  ? 19.511  31.698  4.252   1.00 11.67  ? 99  MET B CG  1 
ATOM   1986  S  SD  . MET B  1 99  ? 18.452  30.320  4.618   1.00 16.91  ? 99  MET B SD  1 
ATOM   1987  C  CE  . MET B  1 99  ? 17.495  30.142  3.221   1.00 11.93  ? 99  MET B CE  1 
ATOM   1988  N  N   . GLU B  1 100 ? 17.235  35.615  4.187   1.00 11.22  ? 100 GLU B N   1 
ATOM   1989  C  CA  . GLU B  1 100 ? 16.628  36.848  4.696   1.00 11.39  ? 100 GLU B CA  1 
ATOM   1990  C  C   . GLU B  1 100 ? 15.113  36.873  4.508   1.00 12.03  ? 100 GLU B C   1 
ATOM   1991  O  O   . GLU B  1 100 ? 14.399  37.351  5.383   1.00 13.25  ? 100 GLU B O   1 
ATOM   1992  C  CB  . GLU B  1 100 ? 17.272  38.088  4.053   1.00 15.45  ? 100 GLU B CB  1 
ATOM   1993  C  CG  . GLU B  1 100 ? 18.623  38.452  4.672   1.00 36.99  ? 100 GLU B CG  1 
ATOM   1994  C  CD  . GLU B  1 100 ? 19.496  39.342  3.826   0.00 100.00 ? 100 GLU B CD  1 
ATOM   1995  O  OE1 . GLU B  1 100 ? 19.231  39.546  2.628   1.00 97.89  ? 100 GLU B OE1 1 
ATOM   1996  O  OE2 . GLU B  1 100 ? 20.521  39.804  4.357   0.00 100.00 ? 100 GLU B OE2 1 
ATOM   1997  N  N   . ASP B  1 101 ? 14.631  36.298  3.413   1.00 11.98  ? 101 ASP B N   1 
ATOM   1998  C  CA  . ASP B  1 101 ? 13.199  36.219  3.195   1.00 17.89  ? 101 ASP B CA  1 
ATOM   1999  C  C   . ASP B  1 101 ? 12.663  35.235  4.237   1.00 16.70  ? 101 ASP B C   1 
ATOM   2000  O  O   . ASP B  1 101 ? 11.671  35.525  4.923   1.00 14.48  ? 101 ASP B O   1 
ATOM   2001  C  CB  . ASP B  1 101 ? 12.938  35.713  1.772   1.00 26.00  ? 101 ASP B CB  1 
ATOM   2002  C  CG  . ASP B  1 101 ? 11.450  35.667  1.406   1.00 70.57  ? 101 ASP B CG  1 
ATOM   2003  O  OD1 . ASP B  1 101 ? 10.599  36.222  2.155   1.00 74.67  ? 101 ASP B OD1 1 
ATOM   2004  O  OD2 . ASP B  1 101 ? 11.109  35.084  0.364   1.00 79.89  ? 101 ASP B OD2 1 
ATOM   2005  N  N   . LEU B  1 102 ? 13.344  34.109  4.407   1.00 8.14   ? 102 LEU B N   1 
ATOM   2006  C  CA  . LEU B  1 102 ? 12.883  33.156  5.409   1.00 6.05   ? 102 LEU B CA  1 
ATOM   2007  C  C   . LEU B  1 102 ? 12.784  33.831  6.810   1.00 8.82   ? 102 LEU B C   1 
ATOM   2008  O  O   . LEU B  1 102 ? 11.794  33.777  7.556   1.00 8.44   ? 102 LEU B O   1 
ATOM   2009  C  CB  . LEU B  1 102 ? 13.997  32.104  5.464   1.00 6.14   ? 102 LEU B CB  1 
ATOM   2010  C  CG  . LEU B  1 102 ? 13.602  30.695  5.875   1.00 13.49  ? 102 LEU B CG  1 
ATOM   2011  C  CD1 . LEU B  1 102 ? 14.698  30.100  6.728   1.00 8.90   ? 102 LEU B CD1 1 
ATOM   2012  C  CD2 . LEU B  1 102 ? 12.260  30.745  6.569   1.00 24.37  ? 102 LEU B CD2 1 
ATOM   2013  N  N   . VAL B  1 103 ? 13.860  34.484  7.214   1.00 1.94   ? 103 VAL B N   1 
ATOM   2014  C  CA  . VAL B  1 103 ? 13.879  35.057  8.535   1.00 3.29   ? 103 VAL B CA  1 
ATOM   2015  C  C   . VAL B  1 103 ? 12.804  36.103  8.740   1.00 13.17  ? 103 VAL B C   1 
ATOM   2016  O  O   . VAL B  1 103 ? 12.216  36.231  9.821   1.00 7.34   ? 103 VAL B O   1 
ATOM   2017  C  CB  . VAL B  1 103 ? 15.230  35.687  8.756   1.00 13.04  ? 103 VAL B CB  1 
ATOM   2018  C  CG1 . VAL B  1 103 ? 15.146  36.643  9.917   1.00 13.61  ? 103 VAL B CG1 1 
ATOM   2019  C  CG2 . VAL B  1 103 ? 16.231  34.602  9.040   1.00 14.54  ? 103 VAL B CG2 1 
ATOM   2020  N  N   . GLY B  1 104 ? 12.571  36.860  7.673   1.00 6.78   ? 104 GLY B N   1 
ATOM   2021  C  CA  . GLY B  1 104 ? 11.552  37.906  7.760   1.00 3.60   ? 104 GLY B CA  1 
ATOM   2022  C  C   . GLY B  1 104 ? 10.227  37.243  8.026   1.00 8.53   ? 104 GLY B C   1 
ATOM   2023  O  O   . GLY B  1 104 ? 9.447   37.666  8.870   1.00 12.24  ? 104 GLY B O   1 
ATOM   2024  N  N   . THR B  1 105 ? 9.954   36.167  7.311   1.00 6.25   ? 105 THR B N   1 
ATOM   2025  C  CA  . THR B  1 105 ? 8.692   35.492  7.568   1.00 4.62   ? 105 THR B CA  1 
ATOM   2026  C  C   . THR B  1 105 ? 8.634   34.949  8.982   1.00 5.81   ? 105 THR B C   1 
ATOM   2027  O  O   . THR B  1 105 ? 7.601   35.067  9.636   1.00 8.74   ? 105 THR B O   1 
ATOM   2028  C  CB  . THR B  1 105 ? 8.423   34.402  6.549   1.00 11.83  ? 105 THR B CB  1 
ATOM   2029  O  OG1 . THR B  1 105 ? 8.384   35.031  5.265   1.00 16.97  ? 105 THR B OG1 1 
ATOM   2030  C  CG2 . THR B  1 105 ? 7.064   33.757  6.774   1.00 8.21   ? 105 THR B CG2 1 
ATOM   2031  N  N   . LEU B  1 106 ? 9.755   34.404  9.455   1.00 3.88   ? 106 LEU B N   1 
ATOM   2032  C  CA  . LEU B  1 106 ? 9.818   33.892  10.806  1.00 3.00   ? 106 LEU B CA  1 
ATOM   2033  C  C   . LEU B  1 106 ? 9.458   35.041  11.742  1.00 10.94  ? 106 LEU B C   1 
ATOM   2034  O  O   . LEU B  1 106 ? 8.592   34.941  12.622  1.00 9.09   ? 106 LEU B O   1 
ATOM   2035  C  CB  . LEU B  1 106 ? 11.250  33.418  11.049  1.00 1.62   ? 106 LEU B CB  1 
ATOM   2036  C  CG  . LEU B  1 106 ? 11.489  32.016  10.457  1.00 5.98   ? 106 LEU B CG  1 
ATOM   2037  C  CD1 . LEU B  1 106 ? 12.953  31.637  10.684  1.00 1.00   ? 106 LEU B CD1 1 
ATOM   2038  C  CD2 . LEU B  1 106 ? 10.536  30.913  10.978  1.00 2.34   ? 106 LEU B CD2 1 
ATOM   2039  N  N   . GLU B  1 107 ? 10.129  36.155  11.518  1.00 5.46   ? 107 GLU B N   1 
ATOM   2040  C  CA  . GLU B  1 107 ? 9.830   37.303  12.377  1.00 5.74   ? 107 GLU B CA  1 
ATOM   2041  C  C   . GLU B  1 107 ? 8.350   37.675  12.362  1.00 12.19  ? 107 GLU B C   1 
ATOM   2042  O  O   . GLU B  1 107 ? 7.694   37.819  13.406  1.00 9.60   ? 107 GLU B O   1 
ATOM   2043  C  CB  . GLU B  1 107 ? 10.726  38.514  12.111  1.00 5.66   ? 107 GLU B CB  1 
ATOM   2044  C  CG  . GLU B  1 107 ? 12.185  38.194  12.447  1.00 16.11  ? 107 GLU B CG  1 
ATOM   2045  C  CD  . GLU B  1 107 ? 13.188  39.229  11.949  1.00 27.75  ? 107 GLU B CD  1 
ATOM   2046  O  OE1 . GLU B  1 107 ? 12.954  39.793  10.847  1.00 39.63  ? 107 GLU B OE1 1 
ATOM   2047  O  OE2 . GLU B  1 107 ? 14.210  39.424  12.661  1.00 29.59  ? 107 GLU B OE2 1 
ATOM   2048  N  N   . LEU B  1 108 ? 7.784   37.638  11.158  1.00 6.65   ? 108 LEU B N   1 
ATOM   2049  C  CA  . LEU B  1 108 ? 6.352   37.928  11.133  1.00 6.90   ? 108 LEU B CA  1 
ATOM   2050  C  C   . LEU B  1 108 ? 5.469   36.991  11.984  1.00 10.76  ? 108 LEU B C   1 
ATOM   2051  O  O   . LEU B  1 108 ? 4.552   37.392  12.720  1.00 12.52  ? 108 LEU B O   1 
ATOM   2052  C  CB  . LEU B  1 108 ? 5.893   37.974  9.671   1.00 9.99   ? 108 LEU B CB  1 
ATOM   2053  C  CG  . LEU B  1 108 ? 4.387   38.117  9.380   1.00 18.88  ? 108 LEU B CG  1 
ATOM   2054  C  CD1 . LEU B  1 108 ? 4.155   38.498  7.913   1.00 15.77  ? 108 LEU B CD1 1 
ATOM   2055  C  CD2 . LEU B  1 108 ? 3.524   36.904  9.738   1.00 24.72  ? 108 LEU B CD2 1 
ATOM   2056  N  N   . LEU B  1 109 ? 5.735   35.692  11.856  1.00 7.07   ? 109 LEU B N   1 
ATOM   2057  C  CA  . LEU B  1 109 ? 4.963   34.699  12.596  1.00 6.11   ? 109 LEU B CA  1 
ATOM   2058  C  C   . LEU B  1 109 ? 5.243   34.927  14.075  1.00 6.95   ? 109 LEU B C   1 
ATOM   2059  O  O   . LEU B  1 109 ? 4.297   34.946  14.864  1.00 11.68  ? 109 LEU B O   1 
ATOM   2060  C  CB  . LEU B  1 109 ? 5.429   33.296  12.190  1.00 5.02   ? 109 LEU B CB  1 
ATOM   2061  C  CG  . LEU B  1 109 ? 4.999   33.075  10.734  1.00 10.91  ? 109 LEU B CG  1 
ATOM   2062  C  CD1 . LEU B  1 109 ? 5.659   31.805  10.180  1.00 12.48  ? 109 LEU B CD1 1 
ATOM   2063  C  CD2 . LEU B  1 109 ? 3.470   32.915  10.770  1.00 7.18   ? 109 LEU B CD2 1 
ATOM   2064  N  N   . ARG B  1 110 ? 6.504   35.153  14.432  1.00 2.31   ? 110 ARG B N   1 
ATOM   2065  C  CA  . ARG B  1 110 ? 6.817   35.362  15.832  1.00 4.79   ? 110 ARG B CA  1 
ATOM   2066  C  C   . ARG B  1 110 ? 5.911   36.460  16.395  1.00 11.42  ? 110 ARG B C   1 
ATOM   2067  O  O   . ARG B  1 110 ? 5.195   36.312  17.398  1.00 9.10   ? 110 ARG B O   1 
ATOM   2068  C  CB  . ARG B  1 110 ? 8.244   35.905  15.935  1.00 1.51   ? 110 ARG B CB  1 
ATOM   2069  C  CG  . ARG B  1 110 ? 8.588   36.147  17.390  1.00 6.98   ? 110 ARG B CG  1 
ATOM   2070  C  CD  . ARG B  1 110 ? 9.967   36.762  17.518  1.00 5.80   ? 110 ARG B CD  1 
ATOM   2071  N  NE  . ARG B  1 110 ? 9.947   37.975  16.714  1.00 10.46  ? 110 ARG B NE  1 
ATOM   2072  C  CZ  . ARG B  1 110 ? 11.019  38.674  16.342  1.00 18.63  ? 110 ARG B CZ  1 
ATOM   2073  N  NH1 . ARG B  1 110 ? 12.219  38.280  16.737  1.00 8.03   ? 110 ARG B NH1 1 
ATOM   2074  N  NH2 . ARG B  1 110 ? 10.875  39.755  15.575  1.00 14.61  ? 110 ARG B NH2 1 
ATOM   2075  N  N   . ASP B  1 111 ? 5.960   37.598  15.715  1.00 7.90   ? 111 ASP B N   1 
ATOM   2076  C  CA  . ASP B  1 111 ? 5.192   38.748  16.178  1.00 11.46  ? 111 ASP B CA  1 
ATOM   2077  C  C   . ASP B  1 111 ? 3.683   38.484  16.211  1.00 9.86   ? 111 ASP B C   1 
ATOM   2078  O  O   . ASP B  1 111 ? 3.027   38.840  17.198  1.00 9.24   ? 111 ASP B O   1 
ATOM   2079  C  CB  . ASP B  1 111 ? 5.583   39.987  15.380  1.00 19.67  ? 111 ASP B CB  1 
ATOM   2080  C  CG  . ASP B  1 111 ? 7.070   40.313  15.518  1.00 34.31  ? 111 ASP B CG  1 
ATOM   2081  O  OD1 . ASP B  1 111 ? 7.659   40.000  16.589  1.00 25.34  ? 111 ASP B OD1 1 
ATOM   2082  O  OD2 . ASP B  1 111 ? 7.655   40.876  14.557  1.00 59.56  ? 111 ASP B OD2 1 
ATOM   2083  N  N   . GLU B  1 112 ? 3.168   37.804  15.182  1.00 3.72   ? 112 GLU B N   1 
ATOM   2084  C  CA  . GLU B  1 112 ? 1.741   37.514  15.210  1.00 2.94   ? 112 GLU B CA  1 
ATOM   2085  C  C   . GLU B  1 112 ? 1.406   36.523  16.320  1.00 12.96  ? 112 GLU B C   1 
ATOM   2086  O  O   . GLU B  1 112 ? 0.353   36.638  16.994  1.00 14.24  ? 112 GLU B O   1 
ATOM   2087  C  CB  . GLU B  1 112 ? 1.230   37.008  13.875  1.00 5.83   ? 112 GLU B CB  1 
ATOM   2088  C  CG  . GLU B  1 112 ? 1.507   38.039  12.784  1.00 23.79  ? 112 GLU B CG  1 
ATOM   2089  C  CD  . GLU B  1 112 ? 0.644   37.837  11.548  1.00 35.97  ? 112 GLU B CD  1 
ATOM   2090  O  OE1 . GLU B  1 112 ? -0.149  36.873  11.542  1.00 18.00  ? 112 GLU B OE1 1 
ATOM   2091  O  OE2 . GLU B  1 112 ? 0.727   38.660  10.596  1.00 23.23  ? 112 GLU B OE2 1 
ATOM   2092  N  N   . TYR B  1 113 ? 2.297   35.559  16.538  1.00 7.82   ? 113 TYR B N   1 
ATOM   2093  C  CA  . TYR B  1 113 ? 1.991   34.602  17.587  1.00 5.11   ? 113 TYR B CA  1 
ATOM   2094  C  C   . TYR B  1 113 ? 1.920   35.340  18.908  1.00 8.85   ? 113 TYR B C   1 
ATOM   2095  O  O   . TYR B  1 113 ? 1.023   35.104  19.708  1.00 8.11   ? 113 TYR B O   1 
ATOM   2096  C  CB  . TYR B  1 113 ? 3.044   33.519  17.666  1.00 3.63   ? 113 TYR B CB  1 
ATOM   2097  C  CG  . TYR B  1 113 ? 2.797   32.438  16.659  1.00 9.26   ? 113 TYR B CG  1 
ATOM   2098  C  CD1 . TYR B  1 113 ? 2.138   32.706  15.453  1.00 12.32  ? 113 TYR B CD1 1 
ATOM   2099  C  CD2 . TYR B  1 113 ? 3.371   31.187  16.827  1.00 15.49  ? 113 TYR B CD2 1 
ATOM   2100  C  CE1 . TYR B  1 113 ? 1.968   31.723  14.493  1.00 17.81  ? 113 TYR B CE1 1 
ATOM   2101  C  CE2 . TYR B  1 113 ? 3.209   30.192  15.876  1.00 21.36  ? 113 TYR B CE2 1 
ATOM   2102  C  CZ  . TYR B  1 113 ? 2.526   30.470  14.711  1.00 17.45  ? 113 TYR B CZ  1 
ATOM   2103  O  OH  . TYR B  1 113 ? 2.387   29.445  13.813  1.00 18.15  ? 113 TYR B OH  1 
ATOM   2104  N  N   . LYS B  1 114 ? 2.823   36.297  19.083  1.00 9.18   ? 114 LYS B N   1 
ATOM   2105  C  CA  . LYS B  1 114 ? 2.845   37.070  20.309  1.00 10.22  ? 114 LYS B CA  1 
ATOM   2106  C  C   . LYS B  1 114 ? 1.485   37.705  20.538  1.00 13.12  ? 114 LYS B C   1 
ATOM   2107  O  O   . LYS B  1 114 ? 0.926   37.598  21.637  1.00 13.45  ? 114 LYS B O   1 
ATOM   2108  C  CB  . LYS B  1 114 ? 3.952   38.115  20.274  1.00 14.32  ? 114 LYS B CB  1 
ATOM   2109  C  CG  . LYS B  1 114 ? 4.086   38.915  21.544  1.00 47.40  ? 114 LYS B CG  1 
ATOM   2110  C  CD  . LYS B  1 114 ? 3.746   38.054  22.742  1.00 65.79  ? 114 LYS B CD  1 
ATOM   2111  C  CE  . LYS B  1 114 ? 3.829   38.846  24.043  1.00 72.38  ? 114 LYS B CE  1 
ATOM   2112  N  NZ  . LYS B  1 114 ? 3.438   38.049  25.229  1.00 80.91  ? 114 LYS B NZ  1 
ATOM   2113  N  N   . GLN B  1 115 ? 0.884   38.193  19.454  1.00 7.76   ? 115 GLN B N   1 
ATOM   2114  C  CA  . GLN B  1 115 ? -0.473  38.715  19.574  1.00 10.82  ? 115 GLN B CA  1 
ATOM   2115  C  C   . GLN B  1 115 ? -1.445  37.620  20.035  1.00 11.51  ? 115 GLN B C   1 
ATOM   2116  O  O   . GLN B  1 115 ? -2.296  37.826  20.915  1.00 13.44  ? 115 GLN B O   1 
ATOM   2117  C  CB  . GLN B  1 115 ? -1.058  39.261  18.255  1.00 13.35  ? 115 GLN B CB  1 
ATOM   2118  C  CG  . GLN B  1 115 ? -0.177  40.121  17.325  1.00 65.65  ? 115 GLN B CG  1 
ATOM   2119  C  CD  . GLN B  1 115 ? 0.658   41.159  18.008  0.00 100.00 ? 115 GLN B CD  1 
ATOM   2120  O  OE1 . GLN B  1 115 ? 0.344   41.619  19.100  0.00 100.00 ? 115 GLN B OE1 1 
ATOM   2121  N  NE2 . GLN B  1 115 ? 1.777   41.504  17.390  0.00 100.00 ? 115 GLN B NE2 1 
ATOM   2122  N  N   . GLY B  1 116 ? -1.352  36.493  19.346  1.00 6.61   ? 116 GLY B N   1 
ATOM   2123  C  CA  . GLY B  1 116 ? -2.275  35.395  19.612  1.00 2.91   ? 116 GLY B CA  1 
ATOM   2124  C  C   . GLY B  1 116 ? -2.087  35.047  21.070  1.00 5.23   ? 116 GLY B C   1 
ATOM   2125  O  O   . GLY B  1 116 ? -3.023  34.765  21.844  1.00 9.74   ? 116 GLY B O   1 
ATOM   2126  N  N   . ILE B  1 117 ? -0.825  35.119  21.441  1.00 3.32   ? 117 ILE B N   1 
ATOM   2127  C  CA  . ILE B  1 117 ? -0.540  34.756  22.807  1.00 16.79  ? 117 ILE B CA  1 
ATOM   2128  C  C   . ILE B  1 117 ? -1.300  35.678  23.745  1.00 12.65  ? 117 ILE B C   1 
ATOM   2129  O  O   . ILE B  1 117 ? -1.901  35.242  24.711  1.00 18.91  ? 117 ILE B O   1 
ATOM   2130  C  CB  . ILE B  1 117 ? 0.974   34.725  23.058  1.00 10.31  ? 117 ILE B CB  1 
ATOM   2131  C  CG1 . ILE B  1 117 ? 1.556   33.375  22.629  1.00 14.92  ? 117 ILE B CG1 1 
ATOM   2132  C  CG2 . ILE B  1 117 ? 1.337   35.001  24.493  1.00 29.06  ? 117 ILE B CG2 1 
ATOM   2133  C  CD1 . ILE B  1 117 ? 3.038   33.214  22.880  1.00 33.03  ? 117 ILE B CD1 1 
ATOM   2134  N  N   . GLU B  1 118 ? -1.353  36.948  23.395  1.00 15.93  ? 118 GLU B N   1 
ATOM   2135  C  CA  . GLU B  1 118 ? -2.000  37.866  24.314  1.00 1.00   ? 118 GLU B CA  1 
ATOM   2136  C  C   . GLU B  1 118 ? -3.509  37.747  24.392  1.00 6.33   ? 118 GLU B C   1 
ATOM   2137  O  O   . GLU B  1 118 ? -4.159  37.737  25.436  1.00 16.45  ? 118 GLU B O   1 
ATOM   2138  C  CB  . GLU B  1 118 ? -1.428  39.284  24.102  1.00 13.55  ? 118 GLU B CB  1 
ATOM   2139  C  CG  . GLU B  1 118 ? 0.045   39.389  24.490  1.00 50.48  ? 118 GLU B CG  1 
ATOM   2140  C  CD  . GLU B  1 118 ? 0.810   40.596  23.962  0.00 100.00 ? 118 GLU B CD  1 
ATOM   2141  O  OE1 . GLU B  1 118 ? 0.467   41.745  24.388  0.00 100.00 ? 118 GLU B OE1 1 
ATOM   2142  O  OE2 . GLU B  1 118 ? 1.702   40.425  23.159  1.00 93.12  ? 118 GLU B OE2 1 
ATOM   2143  N  N   . LEU B  1 119 ? -4.021  37.536  23.195  1.00 1.09   ? 119 LEU B N   1 
ATOM   2144  C  CA  . LEU B  1 119 ? -5.427  37.426  22.903  1.00 8.70   ? 119 LEU B CA  1 
ATOM   2145  C  C   . LEU B  1 119 ? -5.992  36.203  23.600  1.00 28.83  ? 119 LEU B C   1 
ATOM   2146  O  O   . LEU B  1 119 ? -7.000  36.212  24.311  1.00 15.98  ? 119 LEU B O   1 
ATOM   2147  C  CB  . LEU B  1 119 ? -5.413  37.193  21.395  1.00 18.60  ? 119 LEU B CB  1 
ATOM   2148  C  CG  . LEU B  1 119 ? -6.723  36.649  20.851  1.00 43.55  ? 119 LEU B CG  1 
ATOM   2149  C  CD1 . LEU B  1 119 ? -7.818  37.715  20.928  1.00 51.57  ? 119 LEU B CD1 1 
ATOM   2150  C  CD2 . LEU B  1 119 ? -6.398  36.277  19.429  1.00 41.86  ? 119 LEU B CD2 1 
ATOM   2151  N  N   . THR B  1 120 ? -5.287  35.108  23.364  1.00 12.92  ? 120 THR B N   1 
ATOM   2152  C  CA  . THR B  1 120 ? -5.700  33.792  23.824  1.00 6.83   ? 120 THR B CA  1 
ATOM   2153  C  C   . THR B  1 120 ? -5.743  33.844  25.351  1.00 6.16   ? 120 THR B C   1 
ATOM   2154  O  O   . THR B  1 120 ? -6.541  33.191  26.037  1.00 13.78  ? 120 THR B O   1 
ATOM   2155  C  CB  . THR B  1 120 ? -4.655  32.895  23.151  1.00 1.00   ? 120 THR B CB  1 
ATOM   2156  O  OG1 . THR B  1 120 ? -5.053  31.512  23.114  1.00 39.67  ? 120 THR B OG1 1 
ATOM   2157  C  CG2 . THR B  1 120 ? -3.346  33.135  23.842  1.00 1.00   ? 120 THR B CG2 1 
ATOM   2158  N  N   . ASP B  1 121 ? -4.880  34.690  25.880  1.00 4.68   ? 121 ASP B N   1 
ATOM   2159  C  CA  . ASP B  1 121 ? -4.842  34.795  27.327  1.00 28.06  ? 121 ASP B CA  1 
ATOM   2160  C  C   . ASP B  1 121 ? -5.929  35.668  27.874  1.00 3.56   ? 121 ASP B C   1 
ATOM   2161  O  O   . ASP B  1 121 ? -6.382  35.344  28.969  1.00 13.47  ? 121 ASP B O   1 
ATOM   2162  C  CB  . ASP B  1 121 ? -3.567  35.350  27.933  1.00 5.02   ? 121 ASP B CB  1 
ATOM   2163  C  CG  . ASP B  1 121 ? -3.524  35.120  29.415  0.00 100.00 ? 121 ASP B CG  1 
ATOM   2164  O  OD1 . ASP B  1 121 ? -4.382  35.601  30.114  0.00 100.00 ? 121 ASP B OD1 1 
ATOM   2165  O  OD2 . ASP B  1 121 ? -2.663  34.290  29.904  0.00 100.00 ? 121 ASP B OD2 1 
ATOM   2166  N  N   . LYS B  1 122 ? -6.226  36.790  27.214  1.00 3.34   ? 122 LYS B N   1 
ATOM   2167  C  CA  . LYS B  1 122 ? -7.259  37.639  27.767  1.00 18.10  ? 122 LYS B CA  1 
ATOM   2168  C  C   . LYS B  1 122 ? -8.500  36.764  27.853  1.00 19.30  ? 122 LYS B C   1 
ATOM   2169  O  O   . LYS B  1 122 ? -9.166  36.718  28.887  1.00 20.30  ? 122 LYS B O   1 
ATOM   2170  C  CB  . LYS B  1 122 ? -7.623  38.863  26.901  1.00 6.90   ? 122 LYS B CB  1 
ATOM   2171  C  CG  . LYS B  1 122 ? -6.639  40.030  26.900  1.00 31.27  ? 122 LYS B CG  1 
ATOM   2172  C  CD  . LYS B  1 122 ? -7.144  41.171  26.058  0.00 100.00 ? 122 LYS B CD  1 
ATOM   2173  C  CE  . LYS B  1 122 ? -6.168  41.659  24.998  0.00 100.00 ? 122 LYS B CE  1 
ATOM   2174  N  NZ  . LYS B  1 122 ? -6.254  41.005  23.657  1.00 20.94  ? 122 LYS B NZ  1 
ATOM   2175  N  N   . GLU B  1 123 ? -8.803  36.026  26.797  1.00 2.43   ? 123 GLU B N   1 
ATOM   2176  C  CA  . GLU B  1 123 ? -9.978  35.189  26.811  1.00 18.59  ? 123 GLU B CA  1 
ATOM   2177  C  C   . GLU B  1 123 ? -9.813  33.955  27.671  1.00 10.08  ? 123 GLU B C   1 
ATOM   2178  O  O   . GLU B  1 123 ? -10.774 33.214  27.915  1.00 9.16   ? 123 GLU B O   1 
ATOM   2179  C  CB  . GLU B  1 123 ? -10.279 34.800  25.369  1.00 1.00   ? 123 GLU B CB  1 
ATOM   2180  C  CG  . GLU B  1 123 ? -9.910  35.992  24.488  1.00 46.91  ? 123 GLU B CG  1 
ATOM   2181  C  CD  . GLU B  1 123 ? -10.497 35.969  23.119  0.00 100.00 ? 123 GLU B CD  1 
ATOM   2182  O  OE1 . GLU B  1 123 ? -11.387 35.181  22.848  0.00 100.00 ? 123 GLU B OE1 1 
ATOM   2183  O  OE2 . GLU B  1 123 ? -10.027 36.820  22.300  0.00 100.00 ? 123 GLU B OE2 1 
ATOM   2184  N  N   . GLY B  1 124 ? -8.592  33.701  28.131  1.00 2.11   ? 124 GLY B N   1 
ATOM   2185  C  CA  . GLY B  1 124 ? -8.372  32.529  28.987  1.00 14.96  ? 124 GLY B CA  1 
ATOM   2186  C  C   . GLY B  1 124 ? -8.468  31.129  28.333  1.00 20.08  ? 124 GLY B C   1 
ATOM   2187  O  O   . GLY B  1 124 ? -8.985  30.159  29.011  1.00 22.52  ? 124 GLY B O   1 
ATOM   2188  N  N   . ASP B  1 125 ? -8.127  31.020  27.061  1.00 24.24  ? 125 ASP B N   1 
ATOM   2189  C  CA  . ASP B  1 125 ? -8.095  29.724  26.388  1.00 12.85  ? 125 ASP B CA  1 
ATOM   2190  C  C   . ASP B  1 125 ? -6.680  29.270  26.681  1.00 10.97  ? 125 ASP B C   1 
ATOM   2191  O  O   . ASP B  1 125 ? -5.757  29.581  25.946  1.00 11.16  ? 125 ASP B O   1 
ATOM   2192  C  CB  . ASP B  1 125 ? -8.251  29.853  24.885  1.00 2.53   ? 125 ASP B CB  1 
ATOM   2193  C  CG  . ASP B  1 125 ? -8.127  28.510  24.179  1.00 22.26  ? 125 ASP B CG  1 
ATOM   2194  O  OD1 . ASP B  1 125 ? -7.651  27.523  24.801  1.00 20.57  ? 125 ASP B OD1 1 
ATOM   2195  O  OD2 . ASP B  1 125 ? -8.470  28.473  22.977  1.00 14.45  ? 125 ASP B OD2 1 
ATOM   2196  N  N   . ASP B  1 126 ? -6.495  28.573  27.786  1.00 7.70   ? 126 ASP B N   1 
ATOM   2197  C  CA  . ASP B  1 126 ? -5.189  28.152  28.246  1.00 9.05   ? 126 ASP B CA  1 
ATOM   2198  C  C   . ASP B  1 126 ? -4.520  27.204  27.311  1.00 7.90   ? 126 ASP B C   1 
ATOM   2199  O  O   . ASP B  1 126 ? -3.351  27.325  27.055  1.00 9.32   ? 126 ASP B O   1 
ATOM   2200  C  CB  . ASP B  1 126 ? -5.375  27.411  29.557  1.00 17.03  ? 126 ASP B CB  1 
ATOM   2201  C  CG  . ASP B  1 126 ? -6.206  28.217  30.536  1.00 39.82  ? 126 ASP B CG  1 
ATOM   2202  O  OD1 . ASP B  1 126 ? -5.654  29.215  31.065  1.00 40.12  ? 126 ASP B OD1 1 
ATOM   2203  O  OD2 . ASP B  1 126 ? -7.407  27.876  30.631  1.00 51.85  ? 126 ASP B OD2 1 
ATOM   2204  N  N   . VAL B  1 127 ? -5.289  26.293  26.742  1.00 2.77   ? 127 VAL B N   1 
ATOM   2205  C  CA  . VAL B  1 127 ? -4.683  25.354  25.826  1.00 2.21   ? 127 VAL B CA  1 
ATOM   2206  C  C   . VAL B  1 127 ? -4.108  26.055  24.603  1.00 8.19   ? 127 VAL B C   1 
ATOM   2207  O  O   . VAL B  1 127 ? -2.935  25.922  24.309  1.00 10.85  ? 127 VAL B O   1 
ATOM   2208  C  CB  . VAL B  1 127 ? -5.627  24.194  25.500  1.00 3.79   ? 127 VAL B CB  1 
ATOM   2209  C  CG1 . VAL B  1 127 ? -5.096  23.427  24.281  1.00 1.70   ? 127 VAL B CG1 1 
ATOM   2210  C  CG2 . VAL B  1 127 ? -5.764  23.294  26.736  1.00 1.00   ? 127 VAL B CG2 1 
ATOM   2211  N  N   . THR B  1 128 ? -4.897  26.865  23.918  1.00 3.42   ? 128 THR B N   1 
ATOM   2212  C  CA  . THR B  1 128 ? -4.380  27.517  22.729  1.00 1.00   ? 128 THR B CA  1 
ATOM   2213  C  C   . THR B  1 128 ? -3.177  28.379  23.083  1.00 7.39   ? 128 THR B C   1 
ATOM   2214  O  O   . THR B  1 128 ? -2.173  28.417  22.371  1.00 7.87   ? 128 THR B O   1 
ATOM   2215  C  CB  . THR B  1 128 ? -5.449  28.331  22.063  1.00 1.00   ? 128 THR B CB  1 
ATOM   2216  O  OG1 . THR B  1 128 ? -6.557  27.470  21.801  1.00 4.88   ? 128 THR B OG1 1 
ATOM   2217  C  CG2 . THR B  1 128 ? -4.905  28.825  20.738  1.00 1.00   ? 128 THR B CG2 1 
ATOM   2218  N  N   . ASN B  1 129 ? -3.273  29.017  24.241  1.00 2.90   ? 129 ASN B N   1 
ATOM   2219  C  CA  . ASN B  1 129 ? -2.197  29.877  24.699  1.00 1.00   ? 129 ASN B CA  1 
ATOM   2220  C  C   . ASN B  1 129 ? -0.902  29.072  24.792  1.00 2.93   ? 129 ASN B C   1 
ATOM   2221  O  O   . ASN B  1 129 ? 0.126   29.503  24.307  1.00 3.90   ? 129 ASN B O   1 
ATOM   2222  C  CB  . ASN B  1 129 ? -2.567  30.387  26.095  1.00 1.86   ? 129 ASN B CB  1 
ATOM   2223  C  CG  . ASN B  1 129 ? -1.463  31.244  26.735  1.00 8.77   ? 129 ASN B CG  1 
ATOM   2224  O  OD1 . ASN B  1 129 ? -0.880  30.841  27.740  1.00 27.57  ? 129 ASN B OD1 1 
ATOM   2225  N  ND2 . ASN B  1 129 ? -1.284  32.470  26.245  1.00 4.25   ? 129 ASN B ND2 1 
ATOM   2226  N  N   . ASP B  1 130 ? -0.921  27.904  25.433  1.00 1.46   ? 130 ASP B N   1 
ATOM   2227  C  CA  . ASP B  1 130 ? 0.303   27.134  25.535  1.00 5.27   ? 130 ASP B CA  1 
ATOM   2228  C  C   . ASP B  1 130 ? 0.766   26.692  24.150  1.00 7.95   ? 130 ASP B C   1 
ATOM   2229  O  O   . ASP B  1 130 ? 1.974   26.657  23.948  1.00 10.67  ? 130 ASP B O   1 
ATOM   2230  C  CB  . ASP B  1 130 ? 0.148   25.911  26.451  1.00 9.53   ? 130 ASP B CB  1 
ATOM   2231  C  CG  . ASP B  1 130 ? 0.745   26.130  27.837  1.00 57.20  ? 130 ASP B CG  1 
ATOM   2232  O  OD1 . ASP B  1 130 ? 0.972   27.278  28.276  1.00 57.43  ? 130 ASP B OD1 1 
ATOM   2233  O  OD2 . ASP B  1 130 ? 1.053   25.106  28.478  1.00 94.38  ? 130 ASP B OD2 1 
ATOM   2234  N  N   . MET B  1 131 ? -0.134  26.345  23.231  1.00 2.40   ? 131 MET B N   1 
ATOM   2235  C  CA  . MET B  1 131 ? 0.331   25.882  21.938  1.00 6.51   ? 131 MET B CA  1 
ATOM   2236  C  C   . MET B  1 131 ? 1.214   26.946  21.295  1.00 5.90   ? 131 MET B C   1 
ATOM   2237  O  O   . MET B  1 131 ? 2.306   26.684  20.755  1.00 5.06   ? 131 MET B O   1 
ATOM   2238  C  CB  . MET B  1 131 ? -0.800  25.792  20.920  1.00 12.22  ? 131 MET B CB  1 
ATOM   2239  C  CG  . MET B  1 131 ? -1.593  24.544  20.788  1.00 17.41  ? 131 MET B CG  1 
ATOM   2240  S  SD  . MET B  1 131 ? -1.957  24.613  19.024  1.00 16.19  ? 131 MET B SD  1 
ATOM   2241  C  CE  . MET B  1 131 ? -2.563  26.250  18.670  1.00 14.57  ? 131 MET B CE  1 
ATOM   2242  N  N   . LEU B  1 132 ? 0.639   28.135  21.259  1.00 2.22   ? 132 LEU B N   1 
ATOM   2243  C  CA  . LEU B  1 132 ? 1.296   29.257  20.626  1.00 4.67   ? 132 LEU B CA  1 
ATOM   2244  C  C   . LEU B  1 132 ? 2.655   29.534  21.251  1.00 6.79   ? 132 LEU B C   1 
ATOM   2245  O  O   . LEU B  1 132 ? 3.661   29.782  20.594  1.00 7.06   ? 132 LEU B O   1 
ATOM   2246  C  CB  . LEU B  1 132 ? 0.368   30.462  20.778  1.00 5.02   ? 132 LEU B CB  1 
ATOM   2247  C  CG  . LEU B  1 132 ? -0.585  30.773  19.625  1.00 9.88   ? 132 LEU B CG  1 
ATOM   2248  C  CD1 . LEU B  1 132 ? -0.714  29.717  18.541  1.00 7.41   ? 132 LEU B CD1 1 
ATOM   2249  C  CD2 . LEU B  1 132 ? -1.970  31.197  20.151  1.00 6.72   ? 132 LEU B CD2 1 
ATOM   2250  N  N   . ILE B  1 133 ? 2.692   29.443  22.563  1.00 2.82   ? 133 ILE B N   1 
ATOM   2251  C  CA  . ILE B  1 133 ? 3.941   29.649  23.243  1.00 2.68   ? 133 ILE B CA  1 
ATOM   2252  C  C   . ILE B  1 133 ? 5.007   28.646  22.790  1.00 8.63   ? 133 ILE B C   1 
ATOM   2253  O  O   . ILE B  1 133 ? 6.161   28.969  22.436  1.00 6.34   ? 133 ILE B O   1 
ATOM   2254  C  CB  . ILE B  1 133 ? 3.726   29.619  24.751  1.00 6.55   ? 133 ILE B CB  1 
ATOM   2255  C  CG1 . ILE B  1 133 ? 2.821   30.790  25.090  1.00 7.87   ? 133 ILE B CG1 1 
ATOM   2256  C  CG2 . ILE B  1 133 ? 5.053   29.738  25.493  1.00 2.21   ? 133 ILE B CG2 1 
ATOM   2257  C  CD1 . ILE B  1 133 ? 2.610   30.934  26.548  1.00 1.53   ? 133 ILE B CD1 1 
ATOM   2258  N  N   . ALA B  1 134 ? 4.595   27.386  22.734  1.00 5.20   ? 134 ALA B N   1 
ATOM   2259  C  CA  . ALA B  1 134 ? 5.554   26.374  22.274  1.00 3.34   ? 134 ALA B CA  1 
ATOM   2260  C  C   . ALA B  1 134 ? 6.007   26.642  20.830  1.00 6.29   ? 134 ALA B C   1 
ATOM   2261  O  O   . ALA B  1 134 ? 7.198   26.522  20.519  1.00 10.52  ? 134 ALA B O   1 
ATOM   2262  C  CB  . ALA B  1 134 ? 4.943   24.992  22.423  1.00 1.00   ? 134 ALA B CB  1 
ATOM   2263  N  N   . PHE B  1 135 ? 5.093   27.005  19.939  1.00 1.00   ? 135 PHE B N   1 
ATOM   2264  C  CA  . PHE B  1 135 ? 5.554   27.295  18.585  1.00 2.58   ? 135 PHE B CA  1 
ATOM   2265  C  C   . PHE B  1 135 ? 6.513   28.489  18.615  1.00 4.34   ? 135 PHE B C   1 
ATOM   2266  O  O   . PHE B  1 135 ? 7.511   28.555  17.891  1.00 7.16   ? 135 PHE B O   1 
ATOM   2267  C  CB  . PHE B  1 135 ? 4.404   27.661  17.644  1.00 9.89   ? 135 PHE B CB  1 
ATOM   2268  C  CG  . PHE B  1 135 ? 3.395   26.581  17.444  1.00 18.65  ? 135 PHE B CG  1 
ATOM   2269  C  CD1 . PHE B  1 135 ? 3.674   25.283  17.809  1.00 22.14  ? 135 PHE B CD1 1 
ATOM   2270  C  CD2 . PHE B  1 135 ? 2.149   26.875  16.911  1.00 21.90  ? 135 PHE B CD2 1 
ATOM   2271  C  CE1 . PHE B  1 135 ? 2.735   24.273  17.590  1.00 21.51  ? 135 PHE B CE1 1 
ATOM   2272  C  CE2 . PHE B  1 135 ? 1.215   25.891  16.678  1.00 18.62  ? 135 PHE B CE2 1 
ATOM   2273  C  CZ  . PHE B  1 135 ? 1.502   24.582  17.018  1.00 13.55  ? 135 PHE B CZ  1 
ATOM   2274  N  N   . LYS B  1 136 ? 6.172   29.464  19.445  1.00 4.02   ? 136 LYS B N   1 
ATOM   2275  C  CA  . LYS B  1 136 ? 7.016   30.649  19.467  1.00 3.49   ? 136 LYS B CA  1 
ATOM   2276  C  C   . LYS B  1 136 ? 8.448   30.318  19.861  1.00 2.95   ? 136 LYS B C   1 
ATOM   2277  O  O   . LYS B  1 136 ? 9.427   30.779  19.262  1.00 3.00   ? 136 LYS B O   1 
ATOM   2278  C  CB  . LYS B  1 136 ? 6.417   31.771  20.326  1.00 2.86   ? 136 LYS B CB  1 
ATOM   2279  C  CG  . LYS B  1 136 ? 7.185   33.063  20.086  1.00 9.55   ? 136 LYS B CG  1 
ATOM   2280  C  CD  . LYS B  1 136 ? 6.624   34.298  20.767  1.00 6.15   ? 136 LYS B CD  1 
ATOM   2281  C  CE  . LYS B  1 136 ? 7.351   34.688  22.035  1.00 42.53  ? 136 LYS B CE  1 
ATOM   2282  N  NZ  . LYS B  1 136 ? 8.669   35.311  21.792  1.00 15.70  ? 136 LYS B NZ  1 
ATOM   2283  N  N   . ALA B  1 137 ? 8.547   29.473  20.879  1.00 2.21   ? 137 ALA B N   1 
ATOM   2284  C  CA  . ALA B  1 137 ? 9.846   29.030  21.395  1.00 1.58   ? 137 ALA B CA  1 
ATOM   2285  C  C   . ALA B  1 137 ? 10.702  28.560  20.237  1.00 6.33   ? 137 ALA B C   1 
ATOM   2286  O  O   . ALA B  1 137 ? 11.836  28.968  20.060  1.00 7.52   ? 137 ALA B O   1 
ATOM   2287  C  CB  . ALA B  1 137 ? 9.648   27.856  22.373  1.00 1.46   ? 137 ALA B CB  1 
ATOM   2288  N  N   . SER B  1 138 ? 10.160  27.676  19.427  1.00 2.06   ? 138 SER B N   1 
ATOM   2289  C  CA  . SER B  1 138 ? 10.915  27.167  18.302  1.00 1.00   ? 138 SER B CA  1 
ATOM   2290  C  C   . SER B  1 138 ? 11.244  28.251  17.284  1.00 5.45   ? 138 SER B C   1 
ATOM   2291  O  O   . SER B  1 138 ? 12.357  28.314  16.774  1.00 3.12   ? 138 SER B O   1 
ATOM   2292  C  CB  . SER B  1 138 ? 10.009  26.134  17.637  1.00 1.00   ? 138 SER B CB  1 
ATOM   2293  O  OG  . SER B  1 138 ? 10.521  25.768  16.373  1.00 37.15  ? 138 SER B OG  1 
ATOM   2294  N  N   . ILE B  1 139 ? 10.260  29.082  16.958  1.00 2.39   ? 139 ILE B N   1 
ATOM   2295  C  CA  . ILE B  1 139 ? 10.516  30.142  15.982  1.00 3.35   ? 139 ILE B CA  1 
ATOM   2296  C  C   . ILE B  1 139 ? 11.683  31.025  16.404  1.00 5.80   ? 139 ILE B C   1 
ATOM   2297  O  O   . ILE B  1 139 ? 12.526  31.441  15.606  1.00 4.47   ? 139 ILE B O   1 
ATOM   2298  C  CB  . ILE B  1 139 ? 9.246   31.026  15.824  1.00 5.22   ? 139 ILE B CB  1 
ATOM   2299  C  CG1 . ILE B  1 139 ? 8.201   30.224  15.050  1.00 5.08   ? 139 ILE B CG1 1 
ATOM   2300  C  CG2 . ILE B  1 139 ? 9.514   32.340  15.069  1.00 2.51   ? 139 ILE B CG2 1 
ATOM   2301  C  CD1 . ILE B  1 139 ? 6.858   30.813  15.249  1.00 5.69   ? 139 ILE B CD1 1 
ATOM   2302  N  N   . ASP B  1 140 ? 11.698  31.322  17.700  1.00 3.39   ? 140 ASP B N   1 
ATOM   2303  C  CA  . ASP B  1 140 ? 12.737  32.183  18.258  1.00 3.53   ? 140 ASP B CA  1 
ATOM   2304  C  C   . ASP B  1 140 ? 14.076  31.543  18.041  1.00 7.27   ? 140 ASP B C   1 
ATOM   2305  O  O   . ASP B  1 140 ? 15.025  32.228  17.699  1.00 9.56   ? 140 ASP B O   1 
ATOM   2306  C  CB  . ASP B  1 140 ? 12.517  32.398  19.761  1.00 9.70   ? 140 ASP B CB  1 
ATOM   2307  C  CG  . ASP B  1 140 ? 11.445  33.435  20.063  1.00 21.10  ? 140 ASP B CG  1 
ATOM   2308  O  OD1 . ASP B  1 140 ? 11.189  34.236  19.136  1.00 11.43  ? 140 ASP B OD1 1 
ATOM   2309  O  OD2 . ASP B  1 140 ? 10.933  33.487  21.215  1.00 15.69  ? 140 ASP B OD2 1 
ATOM   2310  N  N   . LYS B  1 141 ? 14.150  30.230  18.224  1.00 4.40   ? 141 LYS B N   1 
ATOM   2311  C  CA  . LYS B  1 141 ? 15.414  29.525  18.110  1.00 3.60   ? 141 LYS B CA  1 
ATOM   2312  C  C   . LYS B  1 141 ? 15.831  29.558  16.675  1.00 4.78   ? 141 LYS B C   1 
ATOM   2313  O  O   . LYS B  1 141 ? 17.000  29.878  16.409  1.00 8.26   ? 141 LYS B O   1 
ATOM   2314  C  CB  . LYS B  1 141 ? 15.297  28.078  18.564  1.00 4.77   ? 141 LYS B CB  1 
ATOM   2315  C  CG  . LYS B  1 141 ? 16.571  27.275  18.642  1.00 45.94  ? 141 LYS B CG  1 
ATOM   2316  C  CD  . LYS B  1 141 ? 16.165  25.836  18.914  1.00 84.25  ? 141 LYS B CD  1 
ATOM   2317  C  CE  . LYS B  1 141 ? 17.287  24.831  18.752  0.00 100.00 ? 141 LYS B CE  1 
ATOM   2318  N  NZ  . LYS B  1 141 ? 18.293  24.882  19.840  0.00 100.00 ? 141 LYS B NZ  1 
ATOM   2319  N  N   . HIS B  1 142 ? 14.869  29.286  15.792  1.00 3.18   ? 142 HIS B N   1 
ATOM   2320  C  CA  . HIS B  1 142 ? 15.227  29.340  14.373  1.00 2.64   ? 142 HIS B CA  1 
ATOM   2321  C  C   . HIS B  1 142 ? 15.716  30.728  14.040  1.00 5.31   ? 142 HIS B C   1 
ATOM   2322  O  O   . HIS B  1 142 ? 16.747  30.882  13.391  1.00 6.13   ? 142 HIS B O   1 
ATOM   2323  C  CB  . HIS B  1 142 ? 14.025  29.128  13.496  1.00 3.26   ? 142 HIS B CB  1 
ATOM   2324  C  CG  . HIS B  1 142 ? 13.589  27.709  13.507  1.00 6.43   ? 142 HIS B CG  1 
ATOM   2325  N  ND1 . HIS B  1 142 ? 14.448  26.675  13.218  1.00 9.08   ? 142 HIS B ND1 1 
ATOM   2326  C  CD2 . HIS B  1 142 ? 12.370  27.152  13.687  1.00 7.79   ? 142 HIS B CD2 1 
ATOM   2327  C  CE1 . HIS B  1 142 ? 13.783  25.538  13.258  1.00 6.21   ? 142 HIS B CE1 1 
ATOM   2328  N  NE2 . HIS B  1 142 ? 12.520  25.795  13.540  1.00 5.98   ? 142 HIS B NE2 1 
ATOM   2329  N  N   . ILE B  1 143 ? 15.006  31.742  14.525  1.00 2.13   ? 143 ILE B N   1 
ATOM   2330  C  CA  . ILE B  1 143 ? 15.431  33.100  14.260  1.00 4.82   ? 143 ILE B CA  1 
ATOM   2331  C  C   . ILE B  1 143 ? 16.863  33.355  14.709  1.00 8.81   ? 143 ILE B C   1 
ATOM   2332  O  O   . ILE B  1 143 ? 17.632  33.956  13.976  1.00 5.07   ? 143 ILE B O   1 
ATOM   2333  C  CB  . ILE B  1 143 ? 14.489  34.123  14.863  1.00 8.94   ? 143 ILE B CB  1 
ATOM   2334  C  CG1 . ILE B  1 143 ? 13.152  34.134  14.124  1.00 2.70   ? 143 ILE B CG1 1 
ATOM   2335  C  CG2 . ILE B  1 143 ? 15.134  35.488  14.815  1.00 9.01   ? 143 ILE B CG2 1 
ATOM   2336  C  CD1 . ILE B  1 143 ? 12.133  35.062  14.784  1.00 1.33   ? 143 ILE B CD1 1 
ATOM   2337  N  N   . TRP B  1 144 ? 17.252  32.860  15.872  1.00 2.79   ? 144 TRP B N   1 
ATOM   2338  C  CA  . TRP B  1 144 ? 18.622  33.023  16.327  1.00 2.02   ? 144 TRP B CA  1 
ATOM   2339  C  C   . TRP B  1 144 ? 19.562  32.292  15.383  1.00 8.11   ? 144 TRP B C   1 
ATOM   2340  O  O   . TRP B  1 144 ? 20.527  32.867  14.884  1.00 10.84  ? 144 TRP B O   1 
ATOM   2341  C  CB  . TRP B  1 144 ? 18.793  32.454  17.747  1.00 2.51   ? 144 TRP B CB  1 
ATOM   2342  C  CG  . TRP B  1 144 ? 20.192  31.949  18.066  1.00 5.65   ? 144 TRP B CG  1 
ATOM   2343  C  CD1 . TRP B  1 144 ? 21.333  32.664  18.023  1.00 9.97   ? 144 TRP B CD1 1 
ATOM   2344  C  CD2 . TRP B  1 144 ? 20.579  30.609  18.459  1.00 5.16   ? 144 TRP B CD2 1 
ATOM   2345  N  NE1 . TRP B  1 144 ? 22.389  31.881  18.365  1.00 8.74   ? 144 TRP B NE1 1 
ATOM   2346  C  CE2 . TRP B  1 144 ? 21.965  30.609  18.626  1.00 7.16   ? 144 TRP B CE2 1 
ATOM   2347  C  CE3 . TRP B  1 144 ? 19.880  29.434  18.740  1.00 5.13   ? 144 TRP B CE3 1 
ATOM   2348  C  CZ2 . TRP B  1 144 ? 22.662  29.483  18.999  1.00 7.20   ? 144 TRP B CZ2 1 
ATOM   2349  C  CZ3 . TRP B  1 144 ? 20.586  28.311  19.089  1.00 6.19   ? 144 TRP B CZ3 1 
ATOM   2350  C  CH2 . TRP B  1 144 ? 21.955  28.333  19.191  1.00 6.62   ? 144 TRP B CH2 1 
ATOM   2351  N  N   . MET B  1 145 ? 19.277  31.040  15.063  1.00 4.30   ? 145 MET B N   1 
ATOM   2352  C  CA  . MET B  1 145 ? 20.138  30.319  14.113  1.00 3.24   ? 145 MET B CA  1 
ATOM   2353  C  C   . MET B  1 145 ? 20.271  30.868  12.658  1.00 9.47   ? 145 MET B C   1 
ATOM   2354  O  O   . MET B  1 145 ? 21.351  30.886  12.087  1.00 8.08   ? 145 MET B O   1 
ATOM   2355  C  CB  . MET B  1 145 ? 19.783  28.828  14.120  1.00 3.11   ? 145 MET B CB  1 
ATOM   2356  C  CG  . MET B  1 145 ? 19.958  28.160  15.481  1.00 8.18   ? 145 MET B CG  1 
ATOM   2357  S  SD  . MET B  1 145 ? 19.652  26.380  15.366  1.00 12.91  ? 145 MET B SD  1 
ATOM   2358  C  CE  . MET B  1 145 ? 17.965  26.364  14.799  1.00 19.76  ? 145 MET B CE  1 
ATOM   2359  N  N   . PHE B  1 146 ? 19.189  31.262  11.997  1.00 5.02   ? 146 PHE B N   1 
ATOM   2360  C  CA  . PHE B  1 146 ? 19.330  31.777  10.640  1.00 6.21   ? 146 PHE B CA  1 
ATOM   2361  C  C   . PHE B  1 146 ? 20.017  33.131  10.714  1.00 10.37  ? 146 PHE B C   1 
ATOM   2362  O  O   . PHE B  1 146 ? 20.775  33.508  9.799   1.00 10.89  ? 146 PHE B O   1 
ATOM   2363  C  CB  . PHE B  1 146 ? 18.005  31.810  9.886   1.00 7.66   ? 146 PHE B CB  1 
ATOM   2364  C  CG  . PHE B  1 146 ? 17.593  30.466  9.411   1.00 8.76   ? 146 PHE B CG  1 
ATOM   2365  C  CD1 . PHE B  1 146 ? 18.274  29.874  8.364   1.00 9.54   ? 146 PHE B CD1 1 
ATOM   2366  C  CD2 . PHE B  1 146 ? 16.666  29.715  10.115  1.00 9.44   ? 146 PHE B CD2 1 
ATOM   2367  C  CE1 . PHE B  1 146 ? 17.949  28.589  7.932   1.00 9.47   ? 146 PHE B CE1 1 
ATOM   2368  C  CE2 . PHE B  1 146 ? 16.360  28.408  9.714   1.00 12.35  ? 146 PHE B CE2 1 
ATOM   2369  C  CZ  . PHE B  1 146 ? 16.992  27.856  8.595   1.00 10.19  ? 146 PHE B CZ  1 
ATOM   2370  N  N   . LYS B  1 147 ? 19.840  33.848  11.820  1.00 2.23   ? 147 LYS B N   1 
ATOM   2371  C  CA  . LYS B  1 147 ? 20.542  35.118  11.924  1.00 3.04   ? 147 LYS B CA  1 
ATOM   2372  C  C   . LYS B  1 147 ? 22.042  34.859  12.075  1.00 10.19  ? 147 LYS B C   1 
ATOM   2373  O  O   . LYS B  1 147 ? 22.863  35.542  11.457  1.00 12.46  ? 147 LYS B O   1 
ATOM   2374  C  CB  . LYS B  1 147 ? 19.956  36.094  12.969  1.00 5.53   ? 147 LYS B CB  1 
ATOM   2375  C  CG  . LYS B  1 147 ? 18.693  36.758  12.499  1.00 7.14   ? 147 LYS B CG  1 
ATOM   2376  C  CD  . LYS B  1 147 ? 18.607  38.241  12.833  1.00 26.82  ? 147 LYS B CD  1 
ATOM   2377  C  CE  . LYS B  1 147 ? 17.620  38.925  11.865  1.00 13.62  ? 147 LYS B CE  1 
ATOM   2378  N  NZ  . LYS B  1 147 ? 17.487  40.409  12.035  1.00 60.69  ? 147 LYS B NZ  1 
ATOM   2379  N  N   . ALA B  1 148 ? 22.414  33.895  12.900  0.00 4.60   ? 148 ALA B N   1 
ATOM   2380  C  CA  . ALA B  1 148 ? 23.836  33.644  13.062  0.00 4.33   ? 148 ALA B CA  1 
ATOM   2381  C  C   . ALA B  1 148 ? 24.467  33.286  11.720  0.00 7.81   ? 148 ALA B C   1 
ATOM   2382  O  O   . ALA B  1 148 ? 25.573  33.690  11.380  0.00 6.65   ? 148 ALA B O   1 
ATOM   2383  C  CB  . ALA B  1 148 ? 24.041  32.536  14.064  0.00 3.60   ? 148 ALA B CB  1 
ATOM   2384  N  N   . PHE B  1 149 ? 23.734  32.520  10.939  1.00 6.11   ? 149 PHE B N   1 
ATOM   2385  C  CA  . PHE B  1 149 ? 24.099  32.048  9.607   1.00 4.52   ? 149 PHE B CA  1 
ATOM   2386  C  C   . PHE B  1 149 ? 24.357  33.259  8.730   1.00 14.96  ? 149 PHE B C   1 
ATOM   2387  O  O   . PHE B  1 149 ? 25.318  33.314  7.970   1.00 13.84  ? 149 PHE B O   1 
ATOM   2388  C  CB  . PHE B  1 149 ? 22.980  31.224  8.958   1.00 5.26   ? 149 PHE B CB  1 
ATOM   2389  C  CG  . PHE B  1 149 ? 23.210  30.931  7.485   1.00 8.66   ? 149 PHE B CG  1 
ATOM   2390  C  CD1 . PHE B  1 149 ? 24.068  29.888  7.091   1.00 6.52   ? 149 PHE B CD1 1 
ATOM   2391  C  CD2 . PHE B  1 149 ? 22.569  31.697  6.517   1.00 6.89   ? 149 PHE B CD2 1 
ATOM   2392  C  CE1 . PHE B  1 149 ? 24.319  29.660  5.710   1.00 4.85   ? 149 PHE B CE1 1 
ATOM   2393  C  CE2 . PHE B  1 149 ? 22.818  31.495  5.153   1.00 6.31   ? 149 PHE B CE2 1 
ATOM   2394  C  CZ  . PHE B  1 149 ? 23.696  30.485  4.743   1.00 5.51   ? 149 PHE B CZ  1 
ATOM   2395  N  N   . LEU B  1 150 ? 23.487  34.255  8.830   1.00 11.38  ? 150 LEU B N   1 
ATOM   2396  C  CA  . LEU B  1 150 ? 23.637  35.521  8.111   1.00 8.20   ? 150 LEU B CA  1 
ATOM   2397  C  C   . LEU B  1 150 ? 24.661  36.456  8.747   1.00 21.90  ? 150 LEU B C   1 
ATOM   2398  O  O   . LEU B  1 150 ? 24.811  37.584  8.291   1.00 19.54  ? 150 LEU B O   1 
ATOM   2399  C  CB  . LEU B  1 150 ? 22.297  36.239  8.091   1.00 4.44   ? 150 LEU B CB  1 
ATOM   2400  C  CG  . LEU B  1 150 ? 21.250  35.536  7.215   1.00 8.00   ? 150 LEU B CG  1 
ATOM   2401  C  CD1 . LEU B  1 150 ? 19.842  36.069  7.357   1.00 8.73   ? 150 LEU B CD1 1 
ATOM   2402  C  CD2 . LEU B  1 150 ? 21.667  35.704  5.758   1.00 6.93   ? 150 LEU B CD2 1 
ATOM   2403  N  N   . GLY B  1 151 ? 25.331  35.996  9.805   1.00 15.34  ? 151 GLY B N   1 
ATOM   2404  C  CA  . GLY B  1 151 ? 26.305  36.822  10.530  1.00 10.16  ? 151 GLY B CA  1 
ATOM   2405  C  C   . GLY B  1 151 ? 25.707  37.932  11.430  1.00 17.70  ? 151 GLY B C   1 
ATOM   2406  O  O   . GLY B  1 151 ? 26.376  38.882  11.837  1.00 24.83  ? 151 GLY B O   1 
ATOM   2407  N  N   . LYS B  1 152 ? 24.417  37.846  11.743  1.00 16.43  ? 152 LYS B N   1 
ATOM   2408  C  CA  . LYS B  1 152 ? 23.793  38.896  12.543  1.00 9.75   ? 152 LYS B CA  1 
ATOM   2409  C  C   . LYS B  1 152 ? 23.435  38.364  13.913  1.00 16.59  ? 152 LYS B C   1 
ATOM   2410  O  O   . LYS B  1 152 ? 23.444  37.178  14.151  1.00 15.58  ? 152 LYS B O   1 
ATOM   2411  C  CB  . LYS B  1 152 ? 22.525  39.386  11.827  1.00 15.02  ? 152 LYS B CB  1 
ATOM   2412  C  CG  . LYS B  1 152 ? 22.770  40.019  10.449  1.00 62.94  ? 152 LYS B CG  1 
ATOM   2413  C  CD  . LYS B  1 152 ? 23.741  41.164  10.628  0.00 100.00 ? 152 LYS B CD  1 
ATOM   2414  C  CE  . LYS B  1 152 ? 24.214  41.817  9.356   0.00 100.00 ? 152 LYS B CE  1 
ATOM   2415  N  NZ  . LYS B  1 152 ? 25.239  42.824  9.687   1.00 99.97  ? 152 LYS B NZ  1 
ATOM   2416  N  N   . ALA B  1 153 ? 23.090  39.264  14.810  1.00 15.09  ? 153 ALA B N   1 
ATOM   2417  C  CA  . ALA B  1 153 ? 22.631  38.887  16.134  1.00 9.84   ? 153 ALA B CA  1 
ATOM   2418  C  C   . ALA B  1 153 ? 21.133  38.620  15.958  1.00 15.32  ? 153 ALA B C   1 
ATOM   2419  O  O   . ALA B  1 153 ? 20.511  39.132  15.008  1.00 13.38  ? 153 ALA B O   1 
ATOM   2420  C  CB  . ALA B  1 153 ? 22.806  40.046  17.130  1.00 8.45   ? 153 ALA B CB  1 
ATOM   2421  N  N   . PRO B  1 154 ? 20.495  37.847  16.822  1.00 15.96  ? 154 PRO B N   1 
ATOM   2422  C  CA  . PRO B  1 154 ? 19.091  37.489  16.659  1.00 10.22  ? 154 PRO B CA  1 
ATOM   2423  C  C   . PRO B  1 154 ? 18.117  38.653  16.561  1.00 13.66  ? 154 PRO B C   1 
ATOM   2424  O  O   . PRO B  1 154 ? 17.252  38.663  15.643  1.00 19.09  ? 154 PRO B O   1 
ATOM   2425  C  CB  . PRO B  1 154 ? 18.790  36.623  17.848  1.00 10.70  ? 154 PRO B CB  1 
ATOM   2426  C  CG  . PRO B  1 154 ? 20.068  36.472  18.647  1.00 11.90  ? 154 PRO B CG  1 
ATOM   2427  C  CD  . PRO B  1 154 ? 21.146  37.284  18.001  1.00 11.05  ? 154 PRO B CD  1 
ATOM   2428  N  N   . LEU B  1 155 ? 18.171  39.621  17.445  1.00 18.87  ? 155 LEU B N   1 
ATOM   2429  C  CA  . LEU B  1 155 ? 17.164  40.715  17.402  1.00 19.57  ? 155 LEU B CA  1 
ATOM   2430  C  C   . LEU B  1 155 ? 17.677  41.879  16.568  1.00 44.17  ? 155 LEU B C   1 
ATOM   2431  O  O   . LEU B  1 155 ? 17.127  42.985  16.596  1.00 36.10  ? 155 LEU B O   1 
ATOM   2432  C  CB  . LEU B  1 155 ? 16.837  41.103  18.816  1.00 18.95  ? 155 LEU B CB  1 
ATOM   2433  C  CG  . LEU B  1 155 ? 16.375  39.875  19.582  1.00 28.18  ? 155 LEU B CG  1 
ATOM   2434  C  CD1 . LEU B  1 155 ? 15.884  40.196  20.981  1.00 23.52  ? 155 LEU B CD1 1 
ATOM   2435  C  CD2 . LEU B  1 155 ? 15.229  39.147  18.869  1.00 19.17  ? 155 LEU B CD2 1 
ATOM   2436  N  N   . GLU B  1 156 ? 18.682  41.520  15.866  1.00 20.13  ? 156 GLU B N   1 
ATOM   2437  C  CA  . GLU B  1 156 ? 19.461  42.353  14.980  1.00 25.98  ? 156 GLU B CA  1 
ATOM   2438  C  C   . GLU B  1 156 ? 20.188  43.484  15.655  1.00 33.10  ? 156 GLU B C   1 
ATOM   2439  O  O   . GLU B  1 156 ? 20.902  43.253  16.688  0.00 100.00 ? 156 GLU B O   1 
ATOM   2440  C  CB  . GLU B  1 156 ? 18.763  42.873  13.751  1.00 29.47  ? 156 GLU B CB  1 
ATOM   2441  C  CG  . GLU B  1 156 ? 19.801  43.154  12.622  1.00 34.43  ? 156 GLU B CG  1 
ATOM   2442  C  CD  . GLU B  1 156 ? 21.248  42.651  12.921  0.00 100.00 ? 156 GLU B CD  1 
ATOM   2443  O  OE1 . GLU B  1 156 ? 21.443  41.542  13.555  1.00 30.05  ? 156 GLU B OE1 1 
ATOM   2444  O  OE2 . GLU B  1 156 ? 22.282  43.333  12.524  1.00 45.57  ? 156 GLU B OE2 1 
ATOM   2445  N  N   . VAL C  1 7   ? 56.063  -19.302 30.933  1.00 75.87  ? 7   VAL C N   1 
ATOM   2446  C  CA  . VAL C  1 7   ? 55.606  -20.368 30.000  1.00 74.19  ? 7   VAL C CA  1 
ATOM   2447  C  C   . VAL C  1 7   ? 55.542  -19.838 28.559  1.00 67.59  ? 7   VAL C C   1 
ATOM   2448  O  O   . VAL C  1 7   ? 56.525  -19.357 28.030  1.00 76.65  ? 7   VAL C O   1 
ATOM   2449  C  CB  . VAL C  1 7   ? 54.236  -20.905 30.408  1.00 76.99  ? 7   VAL C CB  1 
ATOM   2450  C  CG1 . VAL C  1 7   ? 54.072  -22.311 29.813  1.00 74.43  ? 7   VAL C CG1 1 
ATOM   2451  C  CG2 . VAL C  1 7   ? 54.014  -20.825 31.933  1.00 78.44  ? 7   VAL C CG2 1 
ATOM   2452  N  N   . ASP C  1 8   ? 54.387  -19.963 27.914  1.00 38.01  ? 8   ASP C N   1 
ATOM   2453  C  CA  . ASP C  1 8   ? 54.233  -19.442 26.559  1.00 28.88  ? 8   ASP C CA  1 
ATOM   2454  C  C   . ASP C  1 8   ? 52.821  -18.932 26.327  1.00 15.88  ? 8   ASP C C   1 
ATOM   2455  O  O   . ASP C  1 8   ? 51.936  -19.220 27.118  1.00 13.00  ? 8   ASP C O   1 
ATOM   2456  C  CB  . ASP C  1 8   ? 54.764  -20.327 25.421  1.00 26.47  ? 8   ASP C CB  1 
ATOM   2457  C  CG  . ASP C  1 8   ? 53.792  -21.407 24.983  1.00 34.07  ? 8   ASP C CG  1 
ATOM   2458  O  OD1 . ASP C  1 8   ? 52.758  -21.605 25.665  1.00 44.88  ? 8   ASP C OD1 1 
ATOM   2459  O  OD2 . ASP C  1 8   ? 54.089  -22.075 23.958  1.00 46.14  ? 8   ASP C OD2 1 
ATOM   2460  N  N   . THR C  1 9   ? 52.629  -18.179 25.257  1.00 8.02   ? 9   THR C N   1 
ATOM   2461  C  CA  . THR C  1 9   ? 51.321  -17.587 25.021  1.00 10.66  ? 9   THR C CA  1 
ATOM   2462  C  C   . THR C  1 9   ? 50.182  -18.588 24.950  1.00 11.13  ? 9   THR C C   1 
ATOM   2463  O  O   . THR C  1 9   ? 49.167  -18.478 25.629  1.00 8.22   ? 9   THR C O   1 
ATOM   2464  C  CB  . THR C  1 9   ? 51.366  -16.703 23.772  1.00 18.37  ? 9   THR C CB  1 
ATOM   2465  O  OG1 . THR C  1 9   ? 52.363  -15.698 24.005  1.00 15.21  ? 9   THR C OG1 1 
ATOM   2466  C  CG2 . THR C  1 9   ? 49.987  -16.085 23.544  1.00 16.15  ? 9   THR C CG2 1 
ATOM   2467  N  N   . LYS C  1 10  ? 50.446  -19.618 24.169  1.00 2.21   ? 10  LYS C N   1 
ATOM   2468  C  CA  . LYS C  1 10  ? 49.455  -20.667 24.027  1.00 5.16   ? 10  LYS C CA  1 
ATOM   2469  C  C   . LYS C  1 10  ? 49.093  -21.243 25.378  1.00 13.26  ? 10  LYS C C   1 
ATOM   2470  O  O   . LYS C  1 10  ? 47.920  -21.360 25.719  1.00 19.79  ? 10  LYS C O   1 
ATOM   2471  C  CB  . LYS C  1 10  ? 49.917  -21.761 23.072  1.00 3.97   ? 10  LYS C CB  1 
ATOM   2472  C  CG  . LYS C  1 10  ? 50.206  -21.263 21.662  1.00 4.83   ? 10  LYS C CG  1 
ATOM   2473  C  CD  . LYS C  1 10  ? 50.347  -22.488 20.773  1.00 10.38  ? 10  LYS C CD  1 
ATOM   2474  C  CE  . LYS C  1 10  ? 51.022  -22.138 19.457  1.00 55.93  ? 10  LYS C CE  1 
ATOM   2475  N  NZ  . LYS C  1 10  ? 51.380  -23.372 18.697  1.00 93.82  ? 10  LYS C NZ  1 
ATOM   2476  N  N   . GLU C  1 11  ? 50.097  -21.589 26.167  1.00 9.77   ? 11  GLU C N   1 
ATOM   2477  C  CA  . GLU C  1 11  ? 49.746  -22.142 27.458  1.00 13.09  ? 11  GLU C CA  1 
ATOM   2478  C  C   . GLU C  1 11  ? 49.001  -21.131 28.283  1.00 9.87   ? 11  GLU C C   1 
ATOM   2479  O  O   . GLU C  1 11  ? 48.125  -21.501 29.040  1.00 8.68   ? 11  GLU C O   1 
ATOM   2480  C  CB  . GLU C  1 11  ? 50.969  -22.613 28.229  1.00 18.91  ? 11  GLU C CB  1 
ATOM   2481  C  CG  . GLU C  1 11  ? 51.427  -24.049 27.989  1.00 72.49  ? 11  GLU C CG  1 
ATOM   2482  C  CD  . GLU C  1 11  ? 51.669  -24.389 26.541  0.00 100.00 ? 11  GLU C CD  1 
ATOM   2483  O  OE1 . GLU C  1 11  ? 50.713  -24.335 25.744  0.00 100.00 ? 11  GLU C OE1 1 
ATOM   2484  O  OE2 . GLU C  1 11  ? 52.823  -24.729 26.215  0.00 100.00 ? 11  GLU C OE2 1 
ATOM   2485  N  N   . PHE C  1 12  ? 49.379  -19.869 28.159  1.00 3.67   ? 12  PHE C N   1 
ATOM   2486  C  CA  . PHE C  1 12  ? 48.759  -18.842 28.973  1.00 2.70   ? 12  PHE C CA  1 
ATOM   2487  C  C   . PHE C  1 12  ? 47.302  -18.775 28.595  1.00 6.51   ? 12  PHE C C   1 
ATOM   2488  O  O   . PHE C  1 12  ? 46.405  -18.834 29.428  1.00 7.18   ? 12  PHE C O   1 
ATOM   2489  C  CB  . PHE C  1 12  ? 49.426  -17.475 28.774  1.00 6.50   ? 12  PHE C CB  1 
ATOM   2490  C  CG  . PHE C  1 12  ? 48.711  -16.382 29.499  1.00 11.23  ? 12  PHE C CG  1 
ATOM   2491  C  CD1 . PHE C  1 12  ? 48.870  -16.173 30.865  1.00 11.31  ? 12  PHE C CD1 1 
ATOM   2492  C  CD2 . PHE C  1 12  ? 47.722  -15.673 28.840  1.00 16.89  ? 12  PHE C CD2 1 
ATOM   2493  C  CE1 . PHE C  1 12  ? 48.124  -15.205 31.560  1.00 11.62  ? 12  PHE C CE1 1 
ATOM   2494  C  CE2 . PHE C  1 12  ? 46.983  -14.701 29.516  1.00 13.63  ? 12  PHE C CE2 1 
ATOM   2495  C  CZ  . PHE C  1 12  ? 47.182  -14.479 30.877  1.00 12.90  ? 12  PHE C CZ  1 
ATOM   2496  N  N   . LEU C  1 13  ? 47.099  -18.628 27.299  1.00 2.25   ? 13  LEU C N   1 
ATOM   2497  C  CA  . LEU C  1 13  ? 45.738  -18.479 26.854  1.00 3.42   ? 13  LEU C CA  1 
ATOM   2498  C  C   . LEU C  1 13  ? 44.898  -19.650 27.279  1.00 7.25   ? 13  LEU C C   1 
ATOM   2499  O  O   . LEU C  1 13  ? 43.831  -19.479 27.857  1.00 12.45  ? 13  LEU C O   1 
ATOM   2500  C  CB  . LEU C  1 13  ? 45.694  -18.283 25.364  1.00 2.15   ? 13  LEU C CB  1 
ATOM   2501  C  CG  . LEU C  1 13  ? 45.548  -16.900 24.774  1.00 6.60   ? 13  LEU C CG  1 
ATOM   2502  C  CD1 . LEU C  1 13  ? 45.973  -15.787 25.655  1.00 1.17   ? 13  LEU C CD1 1 
ATOM   2503  C  CD2 . LEU C  1 13  ? 46.273  -16.825 23.467  1.00 2.41   ? 13  LEU C CD2 1 
ATOM   2504  N  N   . ASN C  1 14  ? 45.384  -20.858 27.078  1.00 3.24   ? 14  ASN C N   1 
ATOM   2505  C  CA  . ASN C  1 14  ? 44.527  -21.962 27.437  1.00 5.69   ? 14  ASN C CA  1 
ATOM   2506  C  C   . ASN C  1 14  ? 44.234  -21.995 28.935  1.00 10.35  ? 14  ASN C C   1 
ATOM   2507  O  O   . ASN C  1 14  ? 43.207  -22.475 29.394  1.00 11.78  ? 14  ASN C O   1 
ATOM   2508  C  CB  . ASN C  1 14  ? 45.206  -23.263 27.027  1.00 4.19   ? 14  ASN C CB  1 
ATOM   2509  C  CG  . ASN C  1 14  ? 44.233  -24.283 26.452  1.00 21.20  ? 14  ASN C CG  1 
ATOM   2510  O  OD1 . ASN C  1 14  ? 43.026  -24.097 26.313  1.00 13.51  ? 14  ASN C OD1 1 
ATOM   2511  N  ND2 . ASN C  1 14  ? 44.833  -25.379 26.020  1.00 12.83  ? 14  ASN C ND2 1 
ATOM   2512  N  N   . HIS C  1 15  ? 45.158  -21.461 29.711  1.00 5.40   ? 15  HIS C N   1 
ATOM   2513  C  CA  . HIS C  1 15  ? 44.958  -21.519 31.134  1.00 5.77   ? 15  HIS C CA  1 
ATOM   2514  C  C   . HIS C  1 15  ? 43.791  -20.597 31.371  1.00 8.12   ? 15  HIS C C   1 
ATOM   2515  O  O   . HIS C  1 15  ? 42.972  -20.885 32.234  1.00 8.90   ? 15  HIS C O   1 
ATOM   2516  C  CB  . HIS C  1 15  ? 46.216  -21.064 31.855  1.00 9.89   ? 15  HIS C CB  1 
ATOM   2517  C  CG  . HIS C  1 15  ? 46.083  -21.043 33.345  1.00 17.70  ? 15  HIS C CG  1 
ATOM   2518  N  ND1 . HIS C  1 15  ? 46.138  -19.882 34.079  1.00 23.68  ? 15  HIS C ND1 1 
ATOM   2519  C  CD2 . HIS C  1 15  ? 45.881  -22.035 34.232  1.00 18.69  ? 15  HIS C CD2 1 
ATOM   2520  C  CE1 . HIS C  1 15  ? 45.960  -20.146 35.356  1.00 22.41  ? 15  HIS C CE1 1 
ATOM   2521  N  NE2 . HIS C  1 15  ? 45.785  -21.447 35.470  1.00 21.93  ? 15  HIS C NE2 1 
ATOM   2522  N  N   . GLN C  1 16  ? 43.720  -19.508 30.616  1.00 2.78   ? 16  GLN C N   1 
ATOM   2523  C  CA  . GLN C  1 16  ? 42.600  -18.600 30.825  1.00 2.41   ? 16  GLN C CA  1 
ATOM   2524  C  C   . GLN C  1 16  ? 41.266  -19.188 30.371  1.00 7.86   ? 16  GLN C C   1 
ATOM   2525  O  O   . GLN C  1 16  ? 40.226  -18.943 30.979  1.00 9.43   ? 16  GLN C O   1 
ATOM   2526  C  CB  . GLN C  1 16  ? 42.849  -17.199 30.282  1.00 1.34   ? 16  GLN C CB  1 
ATOM   2527  C  CG  . GLN C  1 16  ? 44.119  -16.626 30.873  1.00 6.89   ? 16  GLN C CG  1 
ATOM   2528  C  CD  . GLN C  1 16  ? 44.083  -16.615 32.394  1.00 18.60  ? 16  GLN C CD  1 
ATOM   2529  O  OE1 . GLN C  1 16  ? 43.022  -16.594 33.006  1.00 7.80   ? 16  GLN C OE1 1 
ATOM   2530  N  NE2 . GLN C  1 16  ? 45.241  -16.615 33.033  1.00 12.64  ? 16  GLN C NE2 1 
ATOM   2531  N  N   . VAL C  1 17  ? 41.287  -20.024 29.336  1.00 1.00   ? 17  VAL C N   1 
ATOM   2532  C  CA  . VAL C  1 17  ? 40.048  -20.679 28.916  1.00 1.98   ? 17  VAL C CA  1 
ATOM   2533  C  C   . VAL C  1 17  ? 39.527  -21.473 30.121  1.00 6.48   ? 17  VAL C C   1 
ATOM   2534  O  O   . VAL C  1 17  ? 38.352  -21.391 30.473  1.00 9.63   ? 17  VAL C O   1 
ATOM   2535  C  CB  . VAL C  1 17  ? 40.252  -21.598 27.726  1.00 2.76   ? 17  VAL C CB  1 
ATOM   2536  C  CG1 . VAL C  1 17  ? 39.013  -22.399 27.474  1.00 1.03   ? 17  VAL C CG1 1 
ATOM   2537  C  CG2 . VAL C  1 17  ? 40.592  -20.803 26.479  1.00 1.00   ? 17  VAL C CG2 1 
ATOM   2538  N  N   . ALA C  1 18  ? 40.414  -22.176 30.810  1.00 3.86   ? 18  ALA C N   1 
ATOM   2539  C  CA  . ALA C  1 18  ? 39.994  -22.921 31.993  1.00 4.17   ? 18  ALA C CA  1 
ATOM   2540  C  C   . ALA C  1 18  ? 39.478  -21.961 33.060  1.00 5.93   ? 18  ALA C C   1 
ATOM   2541  O  O   . ALA C  1 18  ? 38.389  -22.179 33.586  1.00 9.23   ? 18  ALA C O   1 
ATOM   2542  C  CB  . ALA C  1 18  ? 41.156  -23.775 32.522  1.00 3.17   ? 18  ALA C CB  1 
ATOM   2543  N  N   . ASN C  1 19  ? 40.254  -20.934 33.389  1.00 1.00   ? 19  ASN C N   1 
ATOM   2544  C  CA  . ASN C  1 19  ? 39.830  -19.997 34.410  1.00 2.43   ? 19  ASN C CA  1 
ATOM   2545  C  C   . ASN C  1 19  ? 38.504  -19.341 34.122  1.00 8.78   ? 19  ASN C C   1 
ATOM   2546  O  O   . ASN C  1 19  ? 37.666  -19.176 35.020  1.00 9.29   ? 19  ASN C O   1 
ATOM   2547  C  CB  . ASN C  1 19  ? 40.819  -18.846 34.490  1.00 4.98   ? 19  ASN C CB  1 
ATOM   2548  C  CG  . ASN C  1 19  ? 42.008  -19.157 35.379  1.00 15.33  ? 19  ASN C CG  1 
ATOM   2549  O  OD1 . ASN C  1 19  ? 42.073  -20.170 36.086  1.00 9.73   ? 19  ASN C OD1 1 
ATOM   2550  N  ND2 . ASN C  1 19  ? 42.950  -18.232 35.392  1.00 3.29   ? 19  ASN C ND2 1 
ATOM   2551  N  N   . LEU C  1 20  ? 38.361  -18.918 32.875  1.00 9.52   ? 20  LEU C N   1 
ATOM   2552  C  CA  . LEU C  1 20  ? 37.157  -18.233 32.429  1.00 7.51   ? 20  LEU C CA  1 
ATOM   2553  C  C   . LEU C  1 20  ? 35.890  -19.122 32.591  1.00 9.02   ? 20  LEU C C   1 
ATOM   2554  O  O   . LEU C  1 20  ? 34.839  -18.714 33.123  1.00 6.64   ? 20  LEU C O   1 
ATOM   2555  C  CB  . LEU C  1 20  ? 37.406  -17.639 31.053  1.00 4.31   ? 20  LEU C CB  1 
ATOM   2556  C  CG  . LEU C  1 20  ? 37.697  -16.150 30.987  1.00 3.17   ? 20  LEU C CG  1 
ATOM   2557  C  CD1 . LEU C  1 20  ? 37.968  -15.404 32.236  1.00 1.88   ? 20  LEU C CD1 1 
ATOM   2558  C  CD2 . LEU C  1 20  ? 38.670  -15.823 29.906  1.00 1.00   ? 20  LEU C CD2 1 
ATOM   2559  N  N   . ASN C  1 21  ? 36.050  -20.382 32.224  1.00 1.00   ? 21  ASN C N   1 
ATOM   2560  C  CA  . ASN C  1 21  ? 34.947  -21.290 32.441  1.00 1.21   ? 21  ASN C CA  1 
ATOM   2561  C  C   . ASN C  1 21  ? 34.534  -21.513 33.899  1.00 9.71   ? 21  ASN C C   1 
ATOM   2562  O  O   . ASN C  1 21  ? 33.351  -21.699 34.167  1.00 13.45  ? 21  ASN C O   1 
ATOM   2563  C  CB  . ASN C  1 21  ? 35.190  -22.612 31.729  1.00 6.85   ? 21  ASN C CB  1 
ATOM   2564  C  CG  . ASN C  1 21  ? 34.817  -22.529 30.292  1.00 20.80  ? 21  ASN C CG  1 
ATOM   2565  O  OD1 . ASN C  1 21  ? 33.657  -22.596 29.947  1.00 15.73  ? 21  ASN C OD1 1 
ATOM   2566  N  ND2 . ASN C  1 21  ? 35.769  -22.127 29.485  1.00 11.75  ? 21  ASN C ND2 1 
ATOM   2567  N  N   . VAL C  1 22  ? 35.471  -21.493 34.842  1.00 9.44   ? 22  VAL C N   1 
ATOM   2568  C  CA  . VAL C  1 22  ? 35.147  -21.711 36.248  1.00 4.87   ? 22  VAL C CA  1 
ATOM   2569  C  C   . VAL C  1 22  ? 34.532  -20.420 36.732  1.00 5.20   ? 22  VAL C C   1 
ATOM   2570  O  O   . VAL C  1 22  ? 33.594  -20.490 37.503  1.00 3.71   ? 22  VAL C O   1 
ATOM   2571  C  CB  . VAL C  1 22  ? 36.411  -22.004 37.123  1.00 5.48   ? 22  VAL C CB  1 
ATOM   2572  C  CG1 . VAL C  1 22  ? 36.052  -22.180 38.572  1.00 6.31   ? 22  VAL C CG1 1 
ATOM   2573  C  CG2 . VAL C  1 22  ? 37.158  -23.234 36.633  1.00 2.37   ? 22  VAL C CG2 1 
ATOM   2574  N  N   . PHE C  1 23  ? 35.030  -19.276 36.278  1.00 1.51   ? 23  PHE C N   1 
ATOM   2575  C  CA  . PHE C  1 23  ? 34.497  -17.990 36.773  1.00 1.60   ? 23  PHE C CA  1 
ATOM   2576  C  C   . PHE C  1 23  ? 33.061  -17.771 36.368  1.00 9.33   ? 23  PHE C C   1 
ATOM   2577  O  O   . PHE C  1 23  ? 32.240  -17.264 37.146  1.00 8.14   ? 23  PHE C O   1 
ATOM   2578  C  CB  . PHE C  1 23  ? 35.355  -16.843 36.243  1.00 1.79   ? 23  PHE C CB  1 
ATOM   2579  C  CG  . PHE C  1 23  ? 34.990  -15.471 36.767  1.00 4.83   ? 23  PHE C CG  1 
ATOM   2580  C  CD1 . PHE C  1 23  ? 34.501  -15.325 38.064  1.00 10.05  ? 23  PHE C CD1 1 
ATOM   2581  C  CD2 . PHE C  1 23  ? 35.158  -14.365 35.935  1.00 5.94   ? 23  PHE C CD2 1 
ATOM   2582  C  CE1 . PHE C  1 23  ? 34.190  -14.051 38.542  1.00 6.68   ? 23  PHE C CE1 1 
ATOM   2583  C  CE2 . PHE C  1 23  ? 34.852  -13.089 36.414  1.00 3.26   ? 23  PHE C CE2 1 
ATOM   2584  C  CZ  . PHE C  1 23  ? 34.369  -12.931 37.719  1.00 1.00   ? 23  PHE C CZ  1 
ATOM   2585  N  N   . THR C  1 24  ? 32.789  -18.158 35.169  1.00 3.31   ? 24  THR C N   1 
ATOM   2586  C  CA  . THR C  1 24  ? 31.478  -17.977 34.600  1.00 1.47   ? 24  THR C CA  1 
ATOM   2587  C  C   . THR C  1 24  ? 30.448  -18.773 35.426  1.00 9.39   ? 24  THR C C   1 
ATOM   2588  O  O   . THR C  1 24  ? 29.345  -18.295 35.718  1.00 4.85   ? 24  THR C O   1 
ATOM   2589  C  CB  . THR C  1 24  ? 31.566  -18.342 33.124  1.00 6.33   ? 24  THR C CB  1 
ATOM   2590  O  OG1 . THR C  1 24  ? 30.779  -17.443 32.362  1.00 36.84  ? 24  THR C OG1 1 
ATOM   2591  C  CG2 . THR C  1 24  ? 31.115  -19.759 32.813  1.00 1.13   ? 24  THR C CG2 1 
ATOM   2592  N  N   . VAL C  1 25  ? 30.807  -19.978 35.827  1.00 4.69   ? 25  VAL C N   1 
ATOM   2593  C  CA  . VAL C  1 25  ? 29.893  -20.806 36.631  1.00 2.30   ? 25  VAL C CA  1 
ATOM   2594  C  C   . VAL C  1 25  ? 29.749  -20.190 38.031  1.00 7.72   ? 25  VAL C C   1 
ATOM   2595  O  O   . VAL C  1 25  ? 28.678  -20.231 38.648  1.00 4.45   ? 25  VAL C O   1 
ATOM   2596  C  CB  . VAL C  1 25  ? 30.400  -22.243 36.695  1.00 6.20   ? 25  VAL C CB  1 
ATOM   2597  C  CG1 . VAL C  1 25  ? 29.616  -23.112 37.681  1.00 4.85   ? 25  VAL C CG1 1 
ATOM   2598  C  CG2 . VAL C  1 25  ? 30.295  -22.953 35.341  1.00 1.00   ? 25  VAL C CG2 1 
ATOM   2599  N  N   . LYS C  1 26  ? 30.832  -19.611 38.513  1.00 1.00   ? 26  LYS C N   1 
ATOM   2600  C  CA  . LYS C  1 26  ? 30.830  -18.955 39.826  1.00 1.00   ? 26  LYS C CA  1 
ATOM   2601  C  C   . LYS C  1 26  ? 29.888  -17.773 39.788  1.00 6.36   ? 26  LYS C C   1 
ATOM   2602  O  O   . LYS C  1 26  ? 29.155  -17.522 40.760  1.00 9.23   ? 26  LYS C O   1 
ATOM   2603  C  CB  . LYS C  1 26  ? 32.228  -18.483 40.180  1.00 2.81   ? 26  LYS C CB  1 
ATOM   2604  C  CG  . LYS C  1 26  ? 32.290  -17.865 41.568  1.00 14.63  ? 26  LYS C CG  1 
ATOM   2605  C  CD  . LYS C  1 26  ? 33.639  -17.225 41.860  1.00 30.31  ? 26  LYS C CD  1 
ATOM   2606  C  CE  . LYS C  1 26  ? 34.739  -18.254 42.118  1.00 13.45  ? 26  LYS C CE  1 
ATOM   2607  N  NZ  . LYS C  1 26  ? 34.566  -18.966 43.391  1.00 36.49  ? 26  LYS C NZ  1 
ATOM   2608  N  N   . ILE C  1 27  ? 29.904  -17.048 38.666  1.00 2.73   ? 27  ILE C N   1 
ATOM   2609  C  CA  . ILE C  1 27  ? 28.973  -15.925 38.506  1.00 1.45   ? 27  ILE C CA  1 
ATOM   2610  C  C   . ILE C  1 27  ? 27.513  -16.452 38.605  1.00 5.16   ? 27  ILE C C   1 
ATOM   2611  O  O   . ILE C  1 27  ? 26.672  -15.901 39.335  1.00 6.24   ? 27  ILE C O   1 
ATOM   2612  C  CB  . ILE C  1 27  ? 29.245  -15.173 37.177  1.00 1.90   ? 27  ILE C CB  1 
ATOM   2613  C  CG1 . ILE C  1 27  ? 30.583  -14.454 37.269  1.00 1.51   ? 27  ILE C CG1 1 
ATOM   2614  C  CG2 . ILE C  1 27  ? 28.227  -14.088 36.922  1.00 1.00   ? 27  ILE C CG2 1 
ATOM   2615  C  CD1 . ILE C  1 27  ? 31.138  -14.056 35.887  1.00 1.99   ? 27  ILE C CD1 1 
ATOM   2616  N  N   . HIS C  1 28  ? 27.201  -17.561 37.930  1.00 2.59   ? 28  HIS C N   1 
ATOM   2617  C  CA  . HIS C  1 28  ? 25.851  -18.099 38.018  1.00 1.73   ? 28  HIS C CA  1 
ATOM   2618  C  C   . HIS C  1 28  ? 25.500  -18.492 39.459  1.00 8.89   ? 28  HIS C C   1 
ATOM   2619  O  O   . HIS C  1 28  ? 24.386  -18.297 39.926  1.00 8.30   ? 28  HIS C O   1 
ATOM   2620  C  CB  . HIS C  1 28  ? 25.679  -19.349 37.150  1.00 5.89   ? 28  HIS C CB  1 
ATOM   2621  C  CG  . HIS C  1 28  ? 25.219  -19.082 35.772  1.00 10.65  ? 28  HIS C CG  1 
ATOM   2622  N  ND1 . HIS C  1 28  ? 24.401  -18.014 35.465  1.00 17.70  ? 28  HIS C ND1 1 
ATOM   2623  C  CD2 . HIS C  1 28  ? 25.302  -19.829 34.648  1.00 10.72  ? 28  HIS C CD2 1 
ATOM   2624  C  CE1 . HIS C  1 28  ? 24.053  -18.064 34.193  1.00 16.30  ? 28  HIS C CE1 1 
ATOM   2625  N  NE2 . HIS C  1 28  ? 24.602  -19.162 33.675  1.00 14.52  ? 28  HIS C NE2 1 
ATOM   2626  N  N   . GLN C  1 29  ? 26.463  -19.058 40.182  1.00 4.51   ? 29  GLN C N   1 
ATOM   2627  C  CA  . GLN C  1 29  ? 26.176  -19.453 41.546  1.00 4.82   ? 29  GLN C CA  1 
ATOM   2628  C  C   . GLN C  1 29  ? 25.712  -18.257 42.368  1.00 7.72   ? 29  GLN C C   1 
ATOM   2629  O  O   . GLN C  1 29  ? 24.725  -18.337 43.097  1.00 5.70   ? 29  GLN C O   1 
ATOM   2630  C  CB  . GLN C  1 29  ? 27.414  -20.064 42.176  1.00 7.29   ? 29  GLN C CB  1 
ATOM   2631  C  CG  . GLN C  1 29  ? 27.407  -20.149 43.658  1.00 10.98  ? 29  GLN C CG  1 
ATOM   2632  C  CD  . GLN C  1 29  ? 28.625  -20.884 44.217  1.00 16.53  ? 29  GLN C CD  1 
ATOM   2633  O  OE1 . GLN C  1 29  ? 28.788  -22.087 44.006  1.00 13.17  ? 29  GLN C OE1 1 
ATOM   2634  N  NE2 . GLN C  1 29  ? 29.471  -20.143 44.953  1.00 9.28   ? 29  GLN C NE2 1 
ATOM   2635  N  N   . ILE C  1 30  ? 26.444  -17.153 42.259  1.00 2.70   ? 30  ILE C N   1 
ATOM   2636  C  CA  . ILE C  1 30  ? 26.146  -15.950 43.037  1.00 2.37   ? 30  ILE C CA  1 
ATOM   2637  C  C   . ILE C  1 30  ? 24.780  -15.420 42.647  1.00 7.11   ? 30  ILE C C   1 
ATOM   2638  O  O   . ILE C  1 30  ? 23.938  -14.978 43.425  1.00 7.12   ? 30  ILE C O   1 
ATOM   2639  C  CB  . ILE C  1 30  ? 27.189  -14.814 42.746  1.00 4.96   ? 30  ILE C CB  1 
ATOM   2640  C  CG1 . ILE C  1 30  ? 28.558  -15.246 43.261  1.00 9.70   ? 30  ILE C CG1 1 
ATOM   2641  C  CG2 . ILE C  1 30  ? 26.906  -13.518 43.396  1.00 1.00   ? 30  ILE C CG2 1 
ATOM   2642  C  CD1 . ILE C  1 30  ? 29.592  -14.289 42.940  1.00 13.85  ? 30  ILE C CD1 1 
ATOM   2643  N  N   . HIS C  1 31  ? 24.576  -15.470 41.354  1.00 2.75   ? 31  HIS C N   1 
ATOM   2644  C  CA  . HIS C  1 31  ? 23.383  -14.980 40.716  1.00 4.20   ? 31  HIS C CA  1 
ATOM   2645  C  C   . HIS C  1 31  ? 22.135  -15.741 41.151  1.00 11.84  ? 31  HIS C C   1 
ATOM   2646  O  O   . HIS C  1 31  ? 21.043  -15.166 41.266  1.00 5.24   ? 31  HIS C O   1 
ATOM   2647  C  CB  . HIS C  1 31  ? 23.611  -15.182 39.196  1.00 3.10   ? 31  HIS C CB  1 
ATOM   2648  C  CG  . HIS C  1 31  ? 22.417  -15.002 38.271  1.00 8.63   ? 31  HIS C CG  1 
ATOM   2649  N  ND1 . HIS C  1 31  ? 21.858  -13.756 38.021  1.00 14.75  ? 31  HIS C ND1 1 
ATOM   2650  C  CD2 . HIS C  1 31  ? 21.716  -15.899 37.534  1.00 10.77  ? 31  HIS C CD2 1 
ATOM   2651  C  CE1 . HIS C  1 31  ? 20.865  -13.922 37.165  1.00 11.68  ? 31  HIS C CE1 1 
ATOM   2652  N  NE2 . HIS C  1 31  ? 20.768  -15.195 36.865  1.00 9.54   ? 31  HIS C NE2 1 
ATOM   2653  N  N   . TRP C  1 32  ? 22.321  -17.018 41.375  1.00 5.67   ? 32  TRP C N   1 
ATOM   2654  C  CA  . TRP C  1 32  ? 21.222  -17.910 41.748  1.00 2.66   ? 32  TRP C CA  1 
ATOM   2655  C  C   . TRP C  1 32  ? 20.959  -17.905 43.243  1.00 11.42  ? 32  TRP C C   1 
ATOM   2656  O  O   . TRP C  1 32  ? 19.806  -17.981 43.689  1.00 6.58   ? 32  TRP C O   1 
ATOM   2657  C  CB  . TRP C  1 32  ? 21.557  -19.355 41.383  1.00 1.50   ? 32  TRP C CB  1 
ATOM   2658  C  CG  . TRP C  1 32  ? 21.488  -19.613 39.887  1.00 1.19   ? 32  TRP C CG  1 
ATOM   2659  C  CD1 . TRP C  1 32  ? 20.762  -18.937 38.994  1.00 2.51   ? 32  TRP C CD1 1 
ATOM   2660  C  CD2 . TRP C  1 32  ? 22.202  -20.628 39.204  1.00 2.92   ? 32  TRP C CD2 1 
ATOM   2661  N  NE1 . TRP C  1 32  ? 21.020  -19.523 37.719  1.00 2.70   ? 32  TRP C NE1 1 
ATOM   2662  C  CE2 . TRP C  1 32  ? 21.868  -20.511 37.863  1.00 3.39   ? 32  TRP C CE2 1 
ATOM   2663  C  CE3 . TRP C  1 32  ? 23.100  -21.627 39.599  1.00 3.13   ? 32  TRP C CE3 1 
ATOM   2664  C  CZ2 . TRP C  1 32  ? 22.389  -21.343 36.868  1.00 2.29   ? 32  TRP C CZ2 1 
ATOM   2665  C  CZ3 . TRP C  1 32  ? 23.620  -22.464 38.590  1.00 5.25   ? 32  TRP C CZ3 1 
ATOM   2666  C  CH2 . TRP C  1 32  ? 23.280  -22.327 37.288  1.00 6.08   ? 32  TRP C CH2 1 
ATOM   2667  N  N   . TYR C  1 33  ? 22.024  -17.805 44.002  1.00 3.21   ? 33  TYR C N   1 
ATOM   2668  C  CA  . TYR C  1 33  ? 21.909  -17.955 45.446  1.00 2.46   ? 33  TYR C CA  1 
ATOM   2669  C  C   . TYR C  1 33  ? 21.815  -16.684 46.221  1.00 12.55  ? 33  TYR C C   1 
ATOM   2670  O  O   . TYR C  1 33  ? 21.470  -16.720 47.433  1.00 12.36  ? 33  TYR C O   1 
ATOM   2671  C  CB  . TYR C  1 33  ? 23.076  -18.779 45.995  1.00 2.32   ? 33  TYR C CB  1 
ATOM   2672  C  CG  . TYR C  1 33  ? 22.912  -20.283 45.714  1.00 4.97   ? 33  TYR C CG  1 
ATOM   2673  C  CD1 . TYR C  1 33  ? 21.998  -21.056 46.453  1.00 12.11  ? 33  TYR C CD1 1 
ATOM   2674  C  CD2 . TYR C  1 33  ? 23.672  -20.893 44.709  1.00 1.69   ? 33  TYR C CD2 1 
ATOM   2675  C  CE1 . TYR C  1 33  ? 21.845  -22.423 46.180  1.00 11.16  ? 33  TYR C CE1 1 
ATOM   2676  C  CE2 . TYR C  1 33  ? 23.520  -22.259 44.438  1.00 5.71   ? 33  TYR C CE2 1 
ATOM   2677  C  CZ  . TYR C  1 33  ? 22.605  -23.024 45.171  1.00 16.13  ? 33  TYR C CZ  1 
ATOM   2678  O  OH  . TYR C  1 33  ? 22.457  -24.350 44.900  1.00 12.76  ? 33  TYR C OH  1 
ATOM   2679  N  N   . MET C  1 34  ? 22.144  -15.546 45.603  1.00 7.75   ? 34  MET C N   1 
ATOM   2680  C  CA  . MET C  1 34  ? 22.085  -14.296 46.365  1.00 4.82   ? 34  MET C CA  1 
ATOM   2681  C  C   . MET C  1 34  ? 20.720  -13.980 46.992  1.00 3.95   ? 34  MET C C   1 
ATOM   2682  O  O   . MET C  1 34  ? 19.652  -14.258 46.437  1.00 5.21   ? 34  MET C O   1 
ATOM   2683  C  CB  . MET C  1 34  ? 22.517  -13.119 45.506  1.00 6.20   ? 34  MET C CB  1 
ATOM   2684  C  CG  . MET C  1 34  ? 21.641  -12.963 44.352  1.00 12.66  ? 34  MET C CG  1 
ATOM   2685  S  SD  . MET C  1 34  ? 21.957  -11.441 43.458  1.00 20.97  ? 34  MET C SD  1 
ATOM   2686  C  CE  . MET C  1 34  ? 23.652  -11.589 43.086  1.00 15.67  ? 34  MET C CE  1 
ATOM   2687  N  N   . ARG C  1 35  ? 20.751  -13.302 48.124  1.00 8.86   ? 35  ARG C N   1 
ATOM   2688  C  CA  . ARG C  1 35  ? 19.558  -12.893 48.836  1.00 10.49  ? 35  ARG C CA  1 
ATOM   2689  C  C   . ARG C  1 35  ? 19.935  -11.605 49.539  1.00 12.01  ? 35  ARG C C   1 
ATOM   2690  O  O   . ARG C  1 35  ? 21.106  -11.367 49.806  1.00 16.78  ? 35  ARG C O   1 
ATOM   2691  C  CB  . ARG C  1 35  ? 19.150  -13.873 49.928  1.00 8.28   ? 35  ARG C CB  1 
ATOM   2692  C  CG  . ARG C  1 35  ? 18.694  -15.181 49.396  1.00 14.57  ? 35  ARG C CG  1 
ATOM   2693  C  CD  . ARG C  1 35  ? 18.189  -15.955 50.595  1.00 4.09   ? 35  ARG C CD  1 
ATOM   2694  N  NE  . ARG C  1 35  ? 17.797  -17.273 50.111  1.00 21.43  ? 35  ARG C NE  1 
ATOM   2695  C  CZ  . ARG C  1 35  ? 17.449  -18.247 50.931  1.00 35.16  ? 35  ARG C CZ  1 
ATOM   2696  N  NH1 . ARG C  1 35  ? 17.438  -17.991 52.239  1.00 42.03  ? 35  ARG C NH1 1 
ATOM   2697  N  NH2 . ARG C  1 35  ? 17.116  -19.422 50.429  1.00 30.18  ? 35  ARG C NH2 1 
ATOM   2698  N  N   . GLY C  1 36  ? 18.929  -10.784 49.824  1.00 7.57   ? 36  GLY C N   1 
ATOM   2699  C  CA  . GLY C  1 36  ? 19.129  -9.479  50.450  1.00 8.31   ? 36  GLY C CA  1 
ATOM   2700  C  C   . GLY C  1 36  ? 18.537  -8.312  49.657  1.00 13.95  ? 36  GLY C C   1 
ATOM   2701  O  O   . GLY C  1 36  ? 18.175  -8.454  48.498  1.00 11.17  ? 36  GLY C O   1 
ATOM   2702  N  N   . HIS C  1 37  ? 18.518  -7.141  50.275  1.00 9.84   ? 37  HIS C N   1 
ATOM   2703  C  CA  . HIS C  1 37  ? 17.948  -5.962  49.660  1.00 13.88  ? 37  HIS C CA  1 
ATOM   2704  C  C   . HIS C  1 37  ? 18.540  -5.570  48.331  1.00 17.65  ? 37  HIS C C   1 
ATOM   2705  O  O   . HIS C  1 37  ? 17.902  -4.849  47.586  1.00 15.64  ? 37  HIS C O   1 
ATOM   2706  C  CB  . HIS C  1 37  ? 18.007  -4.809  50.625  1.00 18.18  ? 37  HIS C CB  1 
ATOM   2707  C  CG  . HIS C  1 37  ? 17.096  -5.001  51.790  1.00 31.34  ? 37  HIS C CG  1 
ATOM   2708  N  ND1 . HIS C  1 37  ? 16.112  -4.097  52.120  1.00 40.39  ? 37  HIS C ND1 1 
ATOM   2709  C  CD2 . HIS C  1 37  ? 16.946  -6.047  52.632  1.00 48.49  ? 37  HIS C CD2 1 
ATOM   2710  C  CE1 . HIS C  1 37  ? 15.427  -4.554  53.149  1.00 45.73  ? 37  HIS C CE1 1 
ATOM   2711  N  NE2 . HIS C  1 37  ? 15.901  -5.742  53.467  1.00 49.62  ? 37  HIS C NE2 1 
ATOM   2712  N  N   . ASN C  1 38  ? 19.748  -6.026  48.006  1.00 12.92  ? 38  ASN C N   1 
ATOM   2713  C  CA  . ASN C  1 38  ? 20.372  -5.662  46.724  1.00 14.40  ? 38  ASN C CA  1 
ATOM   2714  C  C   . ASN C  1 38  ? 20.126  -6.733  45.668  1.00 17.88  ? 38  ASN C C   1 
ATOM   2715  O  O   . ASN C  1 38  ? 20.807  -6.729  44.647  1.00 15.23  ? 38  ASN C O   1 
ATOM   2716  C  CB  . ASN C  1 38  ? 21.892  -5.434  46.871  1.00 14.12  ? 38  ASN C CB  1 
ATOM   2717  C  CG  . ASN C  1 38  ? 22.222  -4.463  47.991  1.00 33.22  ? 38  ASN C CG  1 
ATOM   2718  O  OD1 . ASN C  1 38  ? 22.716  -4.844  49.061  1.00 36.75  ? 38  ASN C OD1 1 
ATOM   2719  N  ND2 . ASN C  1 38  ? 21.889  -3.204  47.767  1.00 15.22  ? 38  ASN C ND2 1 
ATOM   2720  N  N   . PHE C  1 39  ? 19.199  -7.653  45.943  1.00 7.49   ? 39  PHE C N   1 
ATOM   2721  C  CA  . PHE C  1 39  ? 18.967  -8.765  45.040  1.00 3.27   ? 39  PHE C CA  1 
ATOM   2722  C  C   . PHE C  1 39  ? 18.667  -8.333  43.612  1.00 6.74   ? 39  PHE C C   1 
ATOM   2723  O  O   . PHE C  1 39  ? 19.234  -8.812  42.621  1.00 5.50   ? 39  PHE C O   1 
ATOM   2724  C  CB  . PHE C  1 39  ? 17.857  -9.680  45.563  1.00 1.00   ? 39  PHE C CB  1 
ATOM   2725  C  CG  . PHE C  1 39  ? 17.464  -10.741 44.579  1.00 2.73   ? 39  PHE C CG  1 
ATOM   2726  C  CD1 . PHE C  1 39  ? 16.540  -10.483 43.573  1.00 4.20   ? 39  PHE C CD1 1 
ATOM   2727  C  CD2 . PHE C  1 39  ? 18.151  -11.931 44.538  1.00 1.00   ? 39  PHE C CD2 1 
ATOM   2728  C  CE1 . PHE C  1 39  ? 16.261  -11.428 42.620  1.00 3.74   ? 39  PHE C CE1 1 
ATOM   2729  C  CE2 . PHE C  1 39  ? 17.853  -12.896 43.597  1.00 1.00   ? 39  PHE C CE2 1 
ATOM   2730  C  CZ  . PHE C  1 39  ? 16.923  -12.634 42.636  1.00 1.61   ? 39  PHE C CZ  1 
ATOM   2731  N  N   . PHE C  1 40  ? 17.728  -7.407  43.505  1.00 1.98   ? 40  PHE C N   1 
ATOM   2732  C  CA  . PHE C  1 40  ? 17.348  -7.033  42.157  1.00 7.84   ? 40  PHE C CA  1 
ATOM   2733  C  C   . PHE C  1 40  ? 18.458  -6.563  41.262  1.00 17.33  ? 40  PHE C C   1 
ATOM   2734  O  O   . PHE C  1 40  ? 18.728  -7.127  40.195  1.00 12.76  ? 40  PHE C O   1 
ATOM   2735  C  CB  . PHE C  1 40  ? 16.129  -6.134  42.116  1.00 4.14   ? 40  PHE C CB  1 
ATOM   2736  C  CG  . PHE C  1 40  ? 14.895  -6.846  42.555  1.00 3.08   ? 40  PHE C CG  1 
ATOM   2737  C  CD1 . PHE C  1 40  ? 14.323  -7.842  41.745  1.00 1.04   ? 40  PHE C CD1 1 
ATOM   2738  C  CD2 . PHE C  1 40  ? 14.380  -6.595  43.822  1.00 4.88   ? 40  PHE C CD2 1 
ATOM   2739  C  CE1 . PHE C  1 40  ? 13.193  -8.512  42.188  1.00 4.67   ? 40  PHE C CE1 1 
ATOM   2740  C  CE2 . PHE C  1 40  ? 13.244  -7.252  44.277  1.00 7.42   ? 40  PHE C CE2 1 
ATOM   2741  C  CZ  . PHE C  1 40  ? 12.662  -8.210  43.462  1.00 2.04   ? 40  PHE C CZ  1 
ATOM   2742  N  N   . THR C  1 41  ? 19.143  -5.577  41.820  1.00 14.31  ? 41  THR C N   1 
ATOM   2743  C  CA  . THR C  1 41  ? 20.302  -4.988  41.163  1.00 12.77  ? 41  THR C CA  1 
ATOM   2744  C  C   . THR C  1 41  ? 21.487  -5.945  40.884  1.00 10.56  ? 41  THR C C   1 
ATOM   2745  O  O   . THR C  1 41  ? 21.993  -6.058  39.770  1.00 11.89  ? 41  THR C O   1 
ATOM   2746  C  CB  . THR C  1 41  ? 20.595  -3.608  41.819  1.00 35.32  ? 41  THR C CB  1 
ATOM   2747  O  OG1 . THR C  1 41  ? 21.900  -3.157  41.456  1.00 54.26  ? 41  THR C OG1 1 
ATOM   2748  C  CG2 . THR C  1 41  ? 20.446  -3.653  43.340  1.00 68.35  ? 41  THR C CG2 1 
ATOM   2749  N  N   . LEU C  1 42  ? 21.921  -6.680  41.895  1.00 7.26   ? 42  LEU C N   1 
ATOM   2750  C  CA  . LEU C  1 42  ? 23.042  -7.578  41.717  1.00 5.26   ? 42  LEU C CA  1 
ATOM   2751  C  C   . LEU C  1 42  ? 22.691  -8.772  40.874  1.00 9.34   ? 42  LEU C C   1 
ATOM   2752  O  O   . LEU C  1 42  ? 23.496  -9.256  40.110  1.00 8.75   ? 42  LEU C O   1 
ATOM   2753  C  CB  . LEU C  1 42  ? 23.643  -7.935  43.064  1.00 6.12   ? 42  LEU C CB  1 
ATOM   2754  C  CG  . LEU C  1 42  ? 24.836  -7.097  43.522  1.00 10.67  ? 42  LEU C CG  1 
ATOM   2755  C  CD1 . LEU C  1 42  ? 25.047  -5.809  42.799  1.00 8.33   ? 42  LEU C CD1 1 
ATOM   2756  C  CD2 . LEU C  1 42  ? 24.710  -6.724  44.960  1.00 21.73  ? 42  LEU C CD2 1 
ATOM   2757  N  N   . HIS C  1 43  ? 21.458  -9.223  40.991  1.00 3.81   ? 43  HIS C N   1 
ATOM   2758  C  CA  . HIS C  1 43  ? 21.023  -10.358 40.209  1.00 2.04   ? 43  HIS C CA  1 
ATOM   2759  C  C   . HIS C  1 43  ? 21.219  -9.988  38.747  1.00 7.46   ? 43  HIS C C   1 
ATOM   2760  O  O   . HIS C  1 43  ? 21.712  -10.781 37.958  1.00 6.47   ? 43  HIS C O   1 
ATOM   2761  C  CB  . HIS C  1 43  ? 19.526  -10.591 40.484  1.00 1.71   ? 43  HIS C CB  1 
ATOM   2762  C  CG  . HIS C  1 43  ? 18.966  -11.765 39.735  1.00 8.20   ? 43  HIS C CG  1 
ATOM   2763  N  ND1 . HIS C  1 43  ? 19.385  -13.056 39.995  1.00 10.63  ? 43  HIS C ND1 1 
ATOM   2764  C  CD2 . HIS C  1 43  ? 18.056  -11.854 38.727  1.00 9.75   ? 43  HIS C CD2 1 
ATOM   2765  C  CE1 . HIS C  1 43  ? 18.696  -13.894 39.199  1.00 10.99  ? 43  HIS C CE1 1 
ATOM   2766  N  NE2 . HIS C  1 43  ? 17.945  -13.190 38.410  1.00 10.61  ? 43  HIS C NE2 1 
ATOM   2767  N  N   . GLU C  1 44  ? 20.838  -8.770  38.381  1.00 4.98   ? 44  GLU C N   1 
ATOM   2768  C  CA  . GLU C  1 44  ? 20.994  -8.335  37.003  1.00 6.83   ? 44  GLU C CA  1 
ATOM   2769  C  C   . GLU C  1 44  ? 22.434  -8.059  36.623  1.00 8.39   ? 44  GLU C C   1 
ATOM   2770  O  O   . GLU C  1 44  ? 22.887  -8.420  35.529  1.00 8.15   ? 44  GLU C O   1 
ATOM   2771  C  CB  . GLU C  1 44  ? 20.103  -7.125  36.669  1.00 8.82   ? 44  GLU C CB  1 
ATOM   2772  C  CG  . GLU C  1 44  ? 18.599  -7.378  36.936  1.00 78.80  ? 44  GLU C CG  1 
ATOM   2773  C  CD  . GLU C  1 44  ? 17.737  -6.131  37.068  0.00 100.00 ? 44  GLU C CD  1 
ATOM   2774  O  OE1 . GLU C  1 44  ? 18.225  -5.029  36.776  0.00 100.00 ? 44  GLU C OE1 1 
ATOM   2775  O  OE2 . GLU C  1 44  ? 16.592  -6.238  37.515  0.00 100.00 ? 44  GLU C OE2 1 
ATOM   2776  N  N   . LYS C  1 45  ? 23.168  -7.462  37.552  1.00 3.91   ? 45  LYS C N   1 
ATOM   2777  C  CA  . LYS C  1 45  ? 24.583  -7.222  37.317  1.00 2.36   ? 45  LYS C CA  1 
ATOM   2778  C  C   . LYS C  1 45  ? 25.322  -8.537  37.012  1.00 3.52   ? 45  LYS C C   1 
ATOM   2779  O  O   . LYS C  1 45  ? 26.208  -8.611  36.157  1.00 5.34   ? 45  LYS C O   1 
ATOM   2780  C  CB  . LYS C  1 45  ? 25.189  -6.550  38.531  1.00 5.79   ? 45  LYS C CB  1 
ATOM   2781  C  CG  . LYS C  1 45  ? 26.472  -5.866  38.094  1.00 28.58  ? 45  LYS C CG  1 
ATOM   2782  C  CD  . LYS C  1 45  ? 26.148  -4.593  37.325  1.00 53.23  ? 45  LYS C CD  1 
ATOM   2783  C  CE  . LYS C  1 45  ? 27.259  -4.122  36.373  1.00 91.31  ? 45  LYS C CE  1 
ATOM   2784  N  NZ  . LYS C  1 45  ? 28.581  -3.772  36.980  1.00 78.21  ? 45  LYS C NZ  1 
ATOM   2785  N  N   . MET C  1 46  ? 24.971  -9.634  37.668  1.00 1.00   ? 46  MET C N   1 
ATOM   2786  C  CA  . MET C  1 46  ? 25.654  -10.876 37.376  1.00 1.00   ? 46  MET C CA  1 
ATOM   2787  C  C   . MET C  1 46  ? 25.341  -11.375 35.986  1.00 7.39   ? 46  MET C C   1 
ATOM   2788  O  O   . MET C  1 46  ? 26.172  -12.001 35.321  1.00 12.65  ? 46  MET C O   1 
ATOM   2789  C  CB  . MET C  1 46  ? 25.248  -11.936 38.415  1.00 1.00   ? 46  MET C CB  1 
ATOM   2790  C  CG  . MET C  1 46  ? 25.675  -11.604 39.842  1.00 2.26   ? 46  MET C CG  1 
ATOM   2791  S  SD  . MET C  1 46  ? 27.404  -11.222 39.974  1.00 8.51   ? 46  MET C SD  1 
ATOM   2792  C  CE  . MET C  1 46  ? 27.613  -9.458  40.004  1.00 3.35   ? 46  MET C CE  1 
ATOM   2793  N  N   . ASP C  1 47  ? 24.149  -11.121 35.527  1.00 4.41   ? 47  ASP C N   1 
ATOM   2794  C  CA  . ASP C  1 47  ? 23.819  -11.560 34.187  1.00 8.40   ? 47  ASP C CA  1 
ATOM   2795  C  C   . ASP C  1 47  ? 24.752  -10.866 33.209  1.00 8.06   ? 47  ASP C C   1 
ATOM   2796  O  O   . ASP C  1 47  ? 25.235  -11.469 32.250  1.00 9.45   ? 47  ASP C O   1 
ATOM   2797  C  CB  . ASP C  1 47  ? 22.375  -11.272 33.855  1.00 15.81  ? 47  ASP C CB  1 
ATOM   2798  C  CG  . ASP C  1 47  ? 21.548  -12.541 33.919  1.00 77.65  ? 47  ASP C CG  1 
ATOM   2799  O  OD1 . ASP C  1 47  ? 22.138  -13.679 34.057  1.00 89.87  ? 47  ASP C OD1 1 
ATOM   2800  O  OD2 . ASP C  1 47  ? 20.273  -12.474 33.857  1.00 99.09  ? 47  ASP C OD2 1 
ATOM   2801  N  N   . ASP C  1 48  ? 25.009  -9.605  33.483  1.00 3.41   ? 48  ASP C N   1 
ATOM   2802  C  CA  . ASP C  1 48  ? 25.873  -8.800  32.615  1.00 9.05   ? 48  ASP C CA  1 
ATOM   2803  C  C   . ASP C  1 48  ? 27.309  -9.334  32.649  1.00 10.24  ? 48  ASP C C   1 
ATOM   2804  O  O   . ASP C  1 48  ? 27.965  -9.462  31.609  1.00 8.35   ? 48  ASP C O   1 
ATOM   2805  C  CB  . ASP C  1 48  ? 25.821  -7.337  33.033  1.00 13.67  ? 48  ASP C CB  1 
ATOM   2806  C  CG  . ASP C  1 48  ? 24.454  -6.709  32.751  1.00 51.55  ? 48  ASP C CG  1 
ATOM   2807  O  OD1 . ASP C  1 48  ? 23.651  -7.262  31.904  1.00 53.94  ? 48  ASP C OD1 1 
ATOM   2808  O  OD2 . ASP C  1 48  ? 24.101  -5.634  33.366  1.00 81.33  ? 48  ASP C OD2 1 
ATOM   2809  N  N   . LEU C  1 49  ? 27.775  -9.642  33.843  1.00 4.60   ? 49  LEU C N   1 
ATOM   2810  C  CA  . LEU C  1 49  ? 29.127  -10.188 34.025  1.00 3.51   ? 49  LEU C CA  1 
ATOM   2811  C  C   . LEU C  1 49  ? 29.249  -11.518 33.290  1.00 1.26   ? 49  LEU C C   1 
ATOM   2812  O  O   . LEU C  1 49  ? 30.235  -11.780 32.595  1.00 5.61   ? 49  LEU C O   1 
ATOM   2813  C  CB  . LEU C  1 49  ? 29.412  -10.446 35.497  1.00 3.44   ? 49  LEU C CB  1 
ATOM   2814  C  CG  . LEU C  1 49  ? 30.472  -9.519  36.078  1.00 6.69   ? 49  LEU C CG  1 
ATOM   2815  C  CD1 . LEU C  1 49  ? 30.205  -8.048  35.764  1.00 1.96   ? 49  LEU C CD1 1 
ATOM   2816  C  CD2 . LEU C  1 49  ? 30.551  -9.621  37.598  1.00 7.65   ? 49  LEU C CD2 1 
ATOM   2817  N  N   . TYR C  1 50  ? 28.230  -12.335 33.465  1.00 1.00   ? 50  TYR C N   1 
ATOM   2818  C  CA  . TYR C  1 50  ? 28.195  -13.665 32.855  1.00 1.74   ? 50  TYR C CA  1 
ATOM   2819  C  C   . TYR C  1 50  ? 28.385  -13.583 31.349  1.00 7.71   ? 50  TYR C C   1 
ATOM   2820  O  O   . TYR C  1 50  ? 29.144  -14.351 30.735  1.00 8.53   ? 50  TYR C O   1 
ATOM   2821  C  CB  . TYR C  1 50  ? 26.858  -14.354 33.115  1.00 4.05   ? 50  TYR C CB  1 
ATOM   2822  C  CG  . TYR C  1 50  ? 26.847  -15.806 32.629  1.00 9.61   ? 50  TYR C CG  1 
ATOM   2823  C  CD1 . TYR C  1 50  ? 26.461  -16.106 31.317  1.00 11.85  ? 50  TYR C CD1 1 
ATOM   2824  C  CD2 . TYR C  1 50  ? 27.225  -16.835 33.497  1.00 17.26  ? 50  TYR C CD2 1 
ATOM   2825  C  CE1 . TYR C  1 50  ? 26.452  -17.437 30.878  1.00 28.01  ? 50  TYR C CE1 1 
ATOM   2826  C  CE2 . TYR C  1 50  ? 27.213  -18.165 33.060  1.00 21.41  ? 50  TYR C CE2 1 
ATOM   2827  C  CZ  . TYR C  1 50  ? 26.827  -18.467 31.751  1.00 37.76  ? 50  TYR C CZ  1 
ATOM   2828  O  OH  . TYR C  1 50  ? 26.818  -19.760 31.327  1.00 33.07  ? 50  TYR C OH  1 
ATOM   2829  N  N   . SER C  1 51  ? 27.686  -12.635 30.732  1.00 4.03   ? 51  SER C N   1 
ATOM   2830  C  CA  . SER C  1 51  ? 27.773  -12.502 29.285  1.00 5.94   ? 51  SER C CA  1 
ATOM   2831  C  C   . SER C  1 51  ? 29.146  -11.977 28.911  1.00 6.17   ? 51  SER C C   1 
ATOM   2832  O  O   . SER C  1 51  ? 29.761  -12.441 27.957  1.00 5.84   ? 51  SER C O   1 
ATOM   2833  C  CB  . SER C  1 51  ? 26.666  -11.561 28.793  1.00 5.66   ? 51  SER C CB  1 
ATOM   2834  O  OG  . SER C  1 51  ? 25.370  -12.127 29.027  1.00 56.32  ? 51  SER C OG  1 
ATOM   2835  N  N   . GLU C  1 52  ? 29.624  -11.013 29.692  1.00 1.69   ? 52  GLU C N   1 
ATOM   2836  C  CA  . GLU C  1 52  ? 30.892  -10.406 29.355  1.00 1.51   ? 52  GLU C CA  1 
ATOM   2837  C  C   . GLU C  1 52  ? 32.049  -11.393 29.426  1.00 6.27   ? 52  GLU C C   1 
ATOM   2838  O  O   . GLU C  1 52  ? 32.818  -11.552 28.495  1.00 2.90   ? 52  GLU C O   1 
ATOM   2839  C  CB  . GLU C  1 52  ? 31.149  -9.245  30.294  1.00 2.01   ? 52  GLU C CB  1 
ATOM   2840  C  CG  . GLU C  1 52  ? 32.593  -8.869  30.134  1.00 18.03  ? 52  GLU C CG  1 
ATOM   2841  C  CD  . GLU C  1 52  ? 32.908  -7.580  30.825  1.00 55.12  ? 52  GLU C CD  1 
ATOM   2842  O  OE1 . GLU C  1 52  ? 32.146  -7.165  31.701  1.00 20.73  ? 52  GLU C OE1 1 
ATOM   2843  O  OE2 . GLU C  1 52  ? 33.898  -6.937  30.467  1.00 28.05  ? 52  GLU C OE2 1 
ATOM   2844  N  N   . PHE C  1 53  ? 32.129  -12.069 30.556  1.00 2.21   ? 53  PHE C N   1 
ATOM   2845  C  CA  . PHE C  1 53  ? 33.204  -12.997 30.696  1.00 1.32   ? 53  PHE C CA  1 
ATOM   2846  C  C   . PHE C  1 53  ? 33.106  -14.167 29.771  1.00 4.51   ? 53  PHE C C   1 
ATOM   2847  O  O   . PHE C  1 53  ? 34.153  -14.664 29.316  1.00 5.66   ? 53  PHE C O   1 
ATOM   2848  C  CB  . PHE C  1 53  ? 33.466  -13.323 32.142  1.00 1.00   ? 53  PHE C CB  1 
ATOM   2849  C  CG  . PHE C  1 53  ? 34.085  -12.155 32.837  1.00 2.56   ? 53  PHE C CG  1 
ATOM   2850  C  CD1 . PHE C  1 53  ? 33.275  -11.159 33.383  1.00 3.21   ? 53  PHE C CD1 1 
ATOM   2851  C  CD2 . PHE C  1 53  ? 35.460  -11.967 32.815  1.00 1.62   ? 53  PHE C CD2 1 
ATOM   2852  C  CE1 . PHE C  1 53  ? 33.846  -10.041 33.995  1.00 2.16   ? 53  PHE C CE1 1 
ATOM   2853  C  CE2 . PHE C  1 53  ? 36.034  -10.840 33.405  1.00 6.72   ? 53  PHE C CE2 1 
ATOM   2854  C  CZ  . PHE C  1 53  ? 35.244  -9.879  34.001  1.00 6.52   ? 53  PHE C CZ  1 
ATOM   2855  N  N   . GLY C  1 54  ? 31.877  -14.542 29.424  1.00 2.77   ? 54  GLY C N   1 
ATOM   2856  C  CA  . GLY C  1 54  ? 31.651  -15.628 28.478  1.00 1.00   ? 54  GLY C CA  1 
ATOM   2857  C  C   . GLY C  1 54  ? 32.145  -15.166 27.097  1.00 5.32   ? 54  GLY C C   1 
ATOM   2858  O  O   . GLY C  1 54  ? 32.655  -15.936 26.311  1.00 6.47   ? 54  GLY C O   1 
ATOM   2859  N  N   . GLU C  1 55  ? 32.046  -13.880 26.778  1.00 2.83   ? 55  GLU C N   1 
ATOM   2860  C  CA  . GLU C  1 55  ? 32.611  -13.450 25.510  1.00 7.22   ? 55  GLU C CA  1 
ATOM   2861  C  C   . GLU C  1 55  ? 34.140  -13.396 25.586  1.00 8.87   ? 55  GLU C C   1 
ATOM   2862  O  O   . GLU C  1 55  ? 34.782  -13.741 24.587  1.00 13.12  ? 55  GLU C O   1 
ATOM   2863  C  CB  . GLU C  1 55  ? 32.117  -12.054 25.119  1.00 13.03  ? 55  GLU C CB  1 
ATOM   2864  C  CG  . GLU C  1 55  ? 30.716  -11.966 24.571  1.00 68.17  ? 55  GLU C CG  1 
ATOM   2865  C  CD  . GLU C  1 55  ? 30.338  -10.555 24.165  0.00 100.00 ? 55  GLU C CD  1 
ATOM   2866  O  OE1 . GLU C  1 55  ? 31.174  -9.640  24.288  0.00 100.00 ? 55  GLU C OE1 1 
ATOM   2867  O  OE2 . GLU C  1 55  ? 29.182  -10.353 23.738  0.00 100.00 ? 55  GLU C OE2 1 
ATOM   2868  N  N   . GLN C  1 56  ? 34.741  -13.031 26.725  1.00 4.46   ? 56  GLN C N   1 
ATOM   2869  C  CA  . GLN C  1 56  ? 36.199  -12.951 26.830  1.00 4.46   ? 56  GLN C CA  1 
ATOM   2870  C  C   . GLN C  1 56  ? 36.675  -14.362 26.569  1.00 4.00   ? 56  GLN C C   1 
ATOM   2871  O  O   . GLN C  1 56  ? 37.614  -14.575 25.823  1.00 2.33   ? 56  GLN C O   1 
ATOM   2872  C  CB  . GLN C  1 56  ? 36.670  -12.590 28.230  1.00 4.58   ? 56  GLN C CB  1 
ATOM   2873  C  CG  . GLN C  1 56  ? 36.734  -11.123 28.457  1.00 16.61  ? 56  GLN C CG  1 
ATOM   2874  C  CD  . GLN C  1 56  ? 37.456  -10.711 29.723  1.00 27.17  ? 56  GLN C CD  1 
ATOM   2875  O  OE1 . GLN C  1 56  ? 38.227  -11.474 30.307  1.00 12.14  ? 56  GLN C OE1 1 
ATOM   2876  N  NE2 . GLN C  1 56  ? 37.189  -9.482  30.163  1.00 11.05  ? 56  GLN C NE2 1 
ATOM   2877  N  N   . MET C  1 57  ? 35.956  -15.302 27.165  1.00 1.00   ? 57  MET C N   1 
ATOM   2878  C  CA  . MET C  1 57  ? 36.282  -16.707 27.032  1.00 1.05   ? 57  MET C CA  1 
ATOM   2879  C  C   . MET C  1 57  ? 36.302  -17.157 25.584  1.00 2.94   ? 57  MET C C   1 
ATOM   2880  O  O   . MET C  1 57  ? 37.297  -17.724 25.118  1.00 10.16  ? 57  MET C O   1 
ATOM   2881  C  CB  . MET C  1 57  ? 35.339  -17.532 27.902  1.00 3.75   ? 57  MET C CB  1 
ATOM   2882  C  CG  . MET C  1 57  ? 35.786  -18.945 28.235  1.00 8.35   ? 57  MET C CG  1 
ATOM   2883  S  SD  . MET C  1 57  ? 35.259  -20.088 26.992  1.00 15.82  ? 57  MET C SD  1 
ATOM   2884  C  CE  . MET C  1 57  ? 33.542  -20.208 27.233  1.00 7.65   ? 57  MET C CE  1 
ATOM   2885  N  N   . ASP C  1 58  ? 35.241  -16.893 24.838  1.00 1.02   ? 58  ASP C N   1 
ATOM   2886  C  CA  . ASP C  1 58  ? 35.236  -17.351 23.449  1.00 3.02   ? 58  ASP C CA  1 
ATOM   2887  C  C   . ASP C  1 58  ? 36.341  -16.689 22.628  1.00 3.05   ? 58  ASP C C   1 
ATOM   2888  O  O   . ASP C  1 58  ? 36.949  -17.269 21.729  1.00 1.00   ? 58  ASP C O   1 
ATOM   2889  C  CB  . ASP C  1 58  ? 33.879  -17.145 22.777  1.00 5.56   ? 58  ASP C CB  1 
ATOM   2890  C  CG  . ASP C  1 58  ? 33.705  -17.978 21.479  1.00 15.28  ? 58  ASP C CG  1 
ATOM   2891  O  OD1 . ASP C  1 58  ? 33.914  -19.220 21.497  1.00 22.68  ? 58  ASP C OD1 1 
ATOM   2892  O  OD2 . ASP C  1 58  ? 33.275  -17.401 20.444  1.00 18.75  ? 58  ASP C OD2 1 
ATOM   2893  N  N   . GLU C  1 59  ? 36.596  -15.433 22.963  1.00 3.81   ? 59  GLU C N   1 
ATOM   2894  C  CA  . GLU C  1 59  ? 37.660  -14.669 22.286  1.00 5.29   ? 59  GLU C CA  1 
ATOM   2895  C  C   . GLU C  1 59  ? 39.037  -15.237 22.537  1.00 3.86   ? 59  GLU C C   1 
ATOM   2896  O  O   . GLU C  1 59  ? 39.864  -15.357 21.655  1.00 3.06   ? 59  GLU C O   1 
ATOM   2897  C  CB  . GLU C  1 59  ? 37.680  -13.179 22.685  1.00 9.14   ? 59  GLU C CB  1 
ATOM   2898  C  CG  . GLU C  1 59  ? 36.526  -12.368 22.118  1.00 48.28  ? 59  GLU C CG  1 
ATOM   2899  C  CD  . GLU C  1 59  ? 36.640  -10.873 22.333  0.00 100.00 ? 59  GLU C CD  1 
ATOM   2900  O  OE1 . GLU C  1 59  ? 37.763  -10.342 22.275  0.00 100.00 ? 59  GLU C OE1 1 
ATOM   2901  O  OE2 . GLU C  1 59  ? 35.597  -10.214 22.525  0.00 100.00 ? 59  GLU C OE2 1 
ATOM   2902  N  N   . VAL C  1 60  ? 39.279  -15.550 23.793  1.00 2.05   ? 60  VAL C N   1 
ATOM   2903  C  CA  . VAL C  1 60  ? 40.579  -16.062 24.186  1.00 1.54   ? 60  VAL C CA  1 
ATOM   2904  C  C   . VAL C  1 60  ? 40.742  -17.366 23.432  1.00 3.36   ? 60  VAL C C   1 
ATOM   2905  O  O   . VAL C  1 60  ? 41.737  -17.564 22.754  1.00 4.99   ? 60  VAL C O   1 
ATOM   2906  C  CB  . VAL C  1 60  ? 40.587  -16.272 25.740  1.00 5.39   ? 60  VAL C CB  1 
ATOM   2907  C  CG1 . VAL C  1 60  ? 41.679  -17.234 26.174  1.00 2.97   ? 60  VAL C CG1 1 
ATOM   2908  C  CG2 . VAL C  1 60  ? 40.761  -14.947 26.463  1.00 1.38   ? 60  VAL C CG2 1 
ATOM   2909  N  N   . ALA C  1 61  ? 39.730  -18.221 23.509  1.00 1.15   ? 61  ALA C N   1 
ATOM   2910  C  CA  . ALA C  1 61  ? 39.839  -19.515 22.852  1.00 1.00   ? 61  ALA C CA  1 
ATOM   2911  C  C   . ALA C  1 61  ? 40.030  -19.349 21.345  1.00 8.16   ? 61  ALA C C   1 
ATOM   2912  O  O   . ALA C  1 61  ? 40.787  -20.080 20.706  1.00 6.60   ? 61  ALA C O   1 
ATOM   2913  C  CB  . ALA C  1 61  ? 38.621  -20.355 23.169  1.00 1.00   ? 61  ALA C CB  1 
ATOM   2914  N  N   . GLU C  1 62  ? 39.338  -18.383 20.751  1.00 2.76   ? 62  GLU C N   1 
ATOM   2915  C  CA  . GLU C  1 62  ? 39.461  -18.221 19.322  1.00 2.28   ? 62  GLU C CA  1 
ATOM   2916  C  C   . GLU C  1 62  ? 40.790  -17.597 18.936  1.00 8.27   ? 62  GLU C C   1 
ATOM   2917  O  O   . GLU C  1 62  ? 41.317  -17.903 17.876  1.00 6.54   ? 62  GLU C O   1 
ATOM   2918  C  CB  . GLU C  1 62  ? 38.225  -17.592 18.679  1.00 2.45   ? 62  GLU C CB  1 
ATOM   2919  C  CG  . GLU C  1 62  ? 36.993  -18.500 18.785  1.00 10.33  ? 62  GLU C CG  1 
ATOM   2920  C  CD  . GLU C  1 62  ? 35.691  -17.930 18.256  1.00 10.76  ? 62  GLU C CD  1 
ATOM   2921  O  OE1 . GLU C  1 62  ? 35.672  -16.721 17.923  1.00 42.84  ? 62  GLU C OE1 1 
ATOM   2922  O  OE2 . GLU C  1 62  ? 34.703  -18.695 18.255  1.00 22.85  ? 62  GLU C OE2 1 
ATOM   2923  N  N   . ARG C  1 63  ? 41.322  -16.744 19.807  1.00 2.73   ? 63  ARG C N   1 
ATOM   2924  C  CA  . ARG C  1 63  ? 42.657  -16.189 19.574  1.00 2.84   ? 63  ARG C CA  1 
ATOM   2925  C  C   . ARG C  1 63  ? 43.701  -17.343 19.654  1.00 8.16   ? 63  ARG C C   1 
ATOM   2926  O  O   . ARG C  1 63  ? 44.616  -17.466 18.829  1.00 7.10   ? 63  ARG C O   1 
ATOM   2927  C  CB  . ARG C  1 63  ? 42.967  -15.092 20.585  1.00 1.16   ? 63  ARG C CB  1 
ATOM   2928  C  CG  . ARG C  1 63  ? 44.412  -14.585 20.513  1.00 1.00   ? 63  ARG C CG  1 
ATOM   2929  C  CD  . ARG C  1 63  ? 44.718  -14.112 19.100  1.00 2.05   ? 63  ARG C CD  1 
ATOM   2930  N  NE  . ARG C  1 63  ? 46.108  -13.717 18.909  1.00 5.99   ? 63  ARG C NE  1 
ATOM   2931  C  CZ  . ARG C  1 63  ? 46.651  -13.446 17.733  1.00 7.06   ? 63  ARG C CZ  1 
ATOM   2932  N  NH1 . ARG C  1 63  ? 45.954  -13.534 16.617  1.00 3.29   ? 63  ARG C NH1 1 
ATOM   2933  N  NH2 . ARG C  1 63  ? 47.920  -13.107 17.665  1.00 1.24   ? 63  ARG C NH2 1 
ATOM   2934  N  N   . LEU C  1 64  ? 43.537  -18.254 20.605  1.00 1.00   ? 64  LEU C N   1 
ATOM   2935  C  CA  . LEU C  1 64  ? 44.436  -19.390 20.711  1.00 2.63   ? 64  LEU C CA  1 
ATOM   2936  C  C   . LEU C  1 64  ? 44.393  -20.213 19.434  1.00 11.37  ? 64  LEU C C   1 
ATOM   2937  O  O   . LEU C  1 64  ? 45.383  -20.630 18.846  1.00 11.48  ? 64  LEU C O   1 
ATOM   2938  C  CB  . LEU C  1 64  ? 43.969  -20.267 21.880  1.00 1.00   ? 64  LEU C CB  1 
ATOM   2939  C  CG  . LEU C  1 64  ? 44.703  -21.583 22.170  1.00 9.11   ? 64  LEU C CG  1 
ATOM   2940  C  CD1 . LEU C  1 64  ? 46.217  -21.379 22.363  1.00 6.21   ? 64  LEU C CD1 1 
ATOM   2941  C  CD2 . LEU C  1 64  ? 44.134  -22.290 23.378  1.00 3.34   ? 64  LEU C CD2 1 
ATOM   2942  N  N   . LEU C  1 65  ? 43.193  -20.502 18.997  1.00 4.79   ? 65  LEU C N   1 
ATOM   2943  C  CA  . LEU C  1 65  ? 42.993  -21.311 17.800  1.00 2.88   ? 65  LEU C CA  1 
ATOM   2944  C  C   . LEU C  1 65  ? 43.700  -20.613 16.635  1.00 8.12   ? 65  LEU C C   1 
ATOM   2945  O  O   . LEU C  1 65  ? 44.416  -21.200 15.829  1.00 4.95   ? 65  LEU C O   1 
ATOM   2946  C  CB  . LEU C  1 65  ? 41.499  -21.272 17.630  1.00 2.88   ? 65  LEU C CB  1 
ATOM   2947  C  CG  . LEU C  1 65  ? 40.604  -22.431 17.294  1.00 10.00  ? 65  LEU C CG  1 
ATOM   2948  C  CD1 . LEU C  1 65  ? 41.134  -23.652 17.971  1.00 1.00   ? 65  LEU C CD1 1 
ATOM   2949  C  CD2 . LEU C  1 65  ? 39.360  -22.060 18.023  1.00 1.51   ? 65  LEU C CD2 1 
ATOM   2950  N  N   . ALA C  1 66  ? 43.575  -19.296 16.603  1.00 5.72   ? 66  ALA C N   1 
ATOM   2951  C  CA  . ALA C  1 66  ? 44.208  -18.548 15.540  1.00 6.32   ? 66  ALA C CA  1 
ATOM   2952  C  C   . ALA C  1 66  ? 45.736  -18.534 15.531  1.00 12.35  ? 66  ALA C C   1 
ATOM   2953  O  O   . ALA C  1 66  ? 46.394  -18.298 14.504  1.00 4.55   ? 66  ALA C O   1 
ATOM   2954  C  CB  . ALA C  1 66  ? 43.715  -17.139 15.600  1.00 5.11   ? 66  ALA C CB  1 
ATOM   2955  N  N   . ILE C  1 67  ? 46.344  -18.722 16.694  1.00 11.16  ? 67  ILE C N   1 
ATOM   2956  C  CA  . ILE C  1 67  ? 47.810  -18.736 16.745  1.00 7.25   ? 67  ILE C CA  1 
ATOM   2957  C  C   . ILE C  1 67  ? 48.269  -20.168 16.658  1.00 17.00  ? 67  ILE C C   1 
ATOM   2958  O  O   . ILE C  1 67  ? 49.401  -20.480 16.988  1.00 15.28  ? 67  ILE C O   1 
ATOM   2959  C  CB  . ILE C  1 67  ? 48.431  -18.064 17.987  1.00 7.02   ? 67  ILE C CB  1 
ATOM   2960  C  CG1 . ILE C  1 67  ? 47.979  -18.713 19.289  1.00 5.77   ? 67  ILE C CG1 1 
ATOM   2961  C  CG2 . ILE C  1 67  ? 48.200  -16.522 17.976  1.00 4.17   ? 67  ILE C CG2 1 
ATOM   2962  C  CD1 . ILE C  1 67  ? 48.518  -17.999 20.507  1.00 28.39  ? 67  ILE C CD1 1 
ATOM   2963  N  N   . GLY C  1 68  ? 47.351  -21.025 16.241  1.00 6.23   ? 68  GLY C N   1 
ATOM   2964  C  CA  . GLY C  1 68  ? 47.662  -22.424 16.092  1.00 1.26   ? 68  GLY C CA  1 
ATOM   2965  C  C   . GLY C  1 68  ? 47.518  -23.279 17.330  1.00 12.09  ? 68  GLY C C   1 
ATOM   2966  O  O   . GLY C  1 68  ? 48.004  -24.414 17.329  1.00 18.81  ? 68  GLY C O   1 
ATOM   2967  N  N   . GLY C  1 69  ? 46.842  -22.784 18.365  1.00 7.32   ? 69  GLY C N   1 
ATOM   2968  C  CA  . GLY C  1 69  ? 46.660  -23.602 19.570  1.00 1.52   ? 69  GLY C CA  1 
ATOM   2969  C  C   . GLY C  1 69  ? 45.385  -24.475 19.587  1.00 6.82   ? 69  GLY C C   1 
ATOM   2970  O  O   . GLY C  1 69  ? 44.616  -24.500 18.615  1.00 6.12   ? 69  GLY C O   1 
ATOM   2971  N  N   . SER C  1 70  ? 45.141  -25.178 20.690  1.00 5.24   ? 70  SER C N   1 
ATOM   2972  C  CA  . SER C  1 70  ? 43.950  -26.014 20.791  1.00 7.39   ? 70  SER C CA  1 
ATOM   2973  C  C   . SER C  1 70  ? 43.428  -25.824 22.199  1.00 16.73  ? 70  SER C C   1 
ATOM   2974  O  O   . SER C  1 70  ? 44.030  -26.254 23.172  1.00 20.61  ? 70  SER C O   1 
ATOM   2975  C  CB  . SER C  1 70  ? 44.320  -27.484 20.617  1.00 11.43  ? 70  SER C CB  1 
ATOM   2976  O  OG  . SER C  1 70  ? 44.845  -27.686 19.323  1.00 33.87  ? 70  SER C OG  1 
ATOM   2977  N  N   . PRO C  1 71  ? 42.295  -25.145 22.312  1.00 13.58  ? 71  PRO C N   1 
ATOM   2978  C  CA  . PRO C  1 71  ? 41.734  -24.843 23.637  1.00 10.57  ? 71  PRO C CA  1 
ATOM   2979  C  C   . PRO C  1 71  ? 41.239  -26.067 24.378  1.00 9.15   ? 71  PRO C C   1 
ATOM   2980  O  O   . PRO C  1 71  ? 40.723  -26.996 23.747  1.00 4.78   ? 71  PRO C O   1 
ATOM   2981  C  CB  . PRO C  1 71  ? 40.503  -24.012 23.297  1.00 9.81   ? 71  PRO C CB  1 
ATOM   2982  C  CG  . PRO C  1 71  ? 40.158  -24.413 21.899  1.00 14.75  ? 71  PRO C CG  1 
ATOM   2983  C  CD  . PRO C  1 71  ? 41.459  -24.677 21.198  1.00 6.27   ? 71  PRO C CD  1 
ATOM   2984  N  N   . PHE C  1 72  ? 41.314  -26.049 25.703  1.00 7.56   ? 72  PHE C N   1 
ATOM   2985  C  CA  . PHE C  1 72  ? 40.714  -27.148 26.443  1.00 3.15   ? 72  PHE C CA  1 
ATOM   2986  C  C   . PHE C  1 72  ? 39.210  -27.004 26.166  1.00 13.76  ? 72  PHE C C   1 
ATOM   2987  O  O   . PHE C  1 72  ? 38.653  -25.907 25.954  1.00 10.35  ? 72  PHE C O   1 
ATOM   2988  C  CB  . PHE C  1 72  ? 40.824  -26.835 27.920  1.00 5.92   ? 72  PHE C CB  1 
ATOM   2989  C  CG  . PHE C  1 72  ? 42.235  -26.774 28.416  1.00 9.41   ? 72  PHE C CG  1 
ATOM   2990  C  CD1 . PHE C  1 72  ? 43.081  -27.850 28.170  1.00 14.57  ? 72  PHE C CD1 1 
ATOM   2991  C  CD2 . PHE C  1 72  ? 42.724  -25.666 29.108  1.00 10.79  ? 72  PHE C CD2 1 
ATOM   2992  C  CE1 . PHE C  1 72  ? 44.378  -27.855 28.618  1.00 17.17  ? 72  PHE C CE1 1 
ATOM   2993  C  CE2 . PHE C  1 72  ? 44.038  -25.650 29.565  1.00 11.65  ? 72  PHE C CE2 1 
ATOM   2994  C  CZ  . PHE C  1 72  ? 44.858  -26.745 29.313  1.00 13.56  ? 72  PHE C CZ  1 
ATOM   2995  N  N   . SER C  1 73  ? 38.458  -28.091 26.254  1.00 6.07   ? 73  SER C N   1 
ATOM   2996  C  CA  . SER C  1 73  ? 37.068  -27.926 25.891  1.00 2.51   ? 73  SER C CA  1 
ATOM   2997  C  C   . SER C  1 73  ? 36.153  -28.954 26.554  1.00 6.89   ? 73  SER C C   1 
ATOM   2998  O  O   . SER C  1 73  ? 35.261  -29.512 25.910  1.00 5.51   ? 73  SER C O   1 
ATOM   2999  C  CB  . SER C  1 73  ? 36.976  -27.975 24.351  1.00 6.12   ? 73  SER C CB  1 
ATOM   3000  O  OG  . SER C  1 73  ? 37.502  -29.178 23.800  1.00 12.77  ? 73  SER C OG  1 
ATOM   3001  N  N   . THR C  1 74  ? 36.443  -29.238 27.819  1.00 3.57   ? 74  THR C N   1 
ATOM   3002  C  CA  . THR C  1 74  ? 35.649  -30.163 28.626  1.00 4.47   ? 74  THR C CA  1 
ATOM   3003  C  C   . THR C  1 74  ? 35.763  -29.653 30.074  1.00 7.10   ? 74  THR C C   1 
ATOM   3004  O  O   . THR C  1 74  ? 36.807  -29.078 30.437  1.00 11.11  ? 74  THR C O   1 
ATOM   3005  C  CB  . THR C  1 74  ? 36.187  -31.598 28.629  1.00 10.25  ? 74  THR C CB  1 
ATOM   3006  O  OG1 . THR C  1 74  ? 37.542  -31.567 29.099  1.00 12.73  ? 74  THR C OG1 1 
ATOM   3007  C  CG2 . THR C  1 74  ? 36.116  -32.219 27.270  1.00 5.36   ? 74  THR C CG2 1 
ATOM   3008  N  N   . LEU C  1 75  ? 34.703  -29.859 30.856  1.00 4.05   ? 75  LEU C N   1 
ATOM   3009  C  CA  . LEU C  1 75  ? 34.719  -29.414 32.244  1.00 7.38   ? 75  LEU C CA  1 
ATOM   3010  C  C   . LEU C  1 75  ? 35.910  -30.042 32.948  1.00 11.13  ? 75  LEU C C   1 
ATOM   3011  O  O   . LEU C  1 75  ? 36.514  -29.463 33.853  1.00 14.84  ? 75  LEU C O   1 
ATOM   3012  C  CB  . LEU C  1 75  ? 33.448  -29.800 33.006  1.00 6.90   ? 75  LEU C CB  1 
ATOM   3013  C  CG  . LEU C  1 75  ? 32.215  -28.964 32.699  1.00 13.79  ? 75  LEU C CG  1 
ATOM   3014  C  CD1 . LEU C  1 75  ? 31.871  -29.199 31.272  1.00 17.11  ? 75  LEU C CD1 1 
ATOM   3015  C  CD2 . LEU C  1 75  ? 31.070  -29.476 33.527  1.00 9.73   ? 75  LEU C CD2 1 
ATOM   3016  N  N   . LYS C  1 76  ? 36.215  -31.264 32.546  1.00 10.81  ? 76  LYS C N   1 
ATOM   3017  C  CA  . LYS C  1 76  ? 37.293  -31.998 33.176  1.00 11.76  ? 76  LYS C CA  1 
ATOM   3018  C  C   . LYS C  1 76  ? 38.591  -31.217 32.945  1.00 10.51  ? 76  LYS C C   1 
ATOM   3019  O  O   . LYS C  1 76  ? 39.310  -30.852 33.896  1.00 10.33  ? 76  LYS C O   1 
ATOM   3020  C  CB  . LYS C  1 76  ? 37.363  -33.438 32.678  1.00 14.69  ? 76  LYS C CB  1 
ATOM   3021  C  CG  . LYS C  1 76  ? 38.531  -34.214 33.278  1.00 49.88  ? 76  LYS C CG  1 
ATOM   3022  C  CD  . LYS C  1 76  ? 38.381  -35.694 32.977  1.00 99.06  ? 76  LYS C CD  1 
ATOM   3023  C  CE  . LYS C  1 76  ? 39.549  -36.502 33.478  1.00 99.91  ? 76  LYS C CE  1 
ATOM   3024  N  NZ  . LYS C  1 76  ? 40.782  -36.222 32.692  0.00 100.00 ? 76  LYS C NZ  1 
ATOM   3025  N  N   . GLU C  1 77  ? 38.819  -30.855 31.692  1.00 7.27   ? 77  GLU C N   1 
ATOM   3026  C  CA  . GLU C  1 77  ? 40.019  -30.092 31.426  1.00 5.93   ? 77  GLU C CA  1 
ATOM   3027  C  C   . GLU C  1 77  ? 40.015  -28.781 32.161  1.00 10.49  ? 77  GLU C C   1 
ATOM   3028  O  O   . GLU C  1 77  ? 41.054  -28.374 32.675  1.00 10.43  ? 77  GLU C O   1 
ATOM   3029  C  CB  . GLU C  1 77  ? 40.167  -29.818 29.940  1.00 8.57   ? 77  GLU C CB  1 
ATOM   3030  C  CG  . GLU C  1 77  ? 40.548  -31.039 29.142  1.00 11.90  ? 77  GLU C CG  1 
ATOM   3031  C  CD  . GLU C  1 77  ? 40.385  -30.891 27.626  1.00 35.38  ? 77  GLU C CD  1 
ATOM   3032  O  OE1 . GLU C  1 77  ? 39.250  -30.628 27.158  1.00 27.50  ? 77  GLU C OE1 1 
ATOM   3033  O  OE2 . GLU C  1 77  ? 41.407  -31.034 26.912  1.00 31.68  ? 77  GLU C OE2 1 
ATOM   3034  N  N   . PHE C  1 78  ? 38.878  -28.096 32.162  1.00 8.43   ? 78  PHE C N   1 
ATOM   3035  C  CA  . PHE C  1 78  ? 38.844  -26.827 32.858  1.00 7.65   ? 78  PHE C CA  1 
ATOM   3036  C  C   . PHE C  1 78  ? 39.220  -26.997 34.330  1.00 12.64  ? 78  PHE C C   1 
ATOM   3037  O  O   . PHE C  1 78  ? 40.046  -26.279 34.881  1.00 12.67  ? 78  PHE C O   1 
ATOM   3038  C  CB  . PHE C  1 78  ? 37.464  -26.168 32.783  1.00 6.29   ? 78  PHE C CB  1 
ATOM   3039  C  CG  . PHE C  1 78  ? 37.000  -25.903 31.387  1.00 4.68   ? 78  PHE C CG  1 
ATOM   3040  C  CD1 . PHE C  1 78  ? 37.920  -25.715 30.360  1.00 4.79   ? 78  PHE C CD1 1 
ATOM   3041  C  CD2 . PHE C  1 78  ? 35.644  -25.898 31.099  1.00 4.72   ? 78  PHE C CD2 1 
ATOM   3042  C  CE1 . PHE C  1 78  ? 37.495  -25.542 29.041  1.00 6.02   ? 78  PHE C CE1 1 
ATOM   3043  C  CE2 . PHE C  1 78  ? 35.202  -25.722 29.785  1.00 3.01   ? 78  PHE C CE2 1 
ATOM   3044  C  CZ  . PHE C  1 78  ? 36.125  -25.535 28.741  1.00 3.80   ? 78  PHE C CZ  1 
ATOM   3045  N  N   . LEU C  1 79  ? 38.576  -27.940 35.003  1.00 8.62   ? 79  LEU C N   1 
ATOM   3046  C  CA  . LEU C  1 79  ? 38.848  -28.175 36.409  1.00 14.37  ? 79  LEU C CA  1 
ATOM   3047  C  C   . LEU C  1 79  ? 40.291  -28.528 36.650  1.00 21.05  ? 79  LEU C C   1 
ATOM   3048  O  O   . LEU C  1 79  ? 40.902  -28.096 37.614  1.00 16.59  ? 79  LEU C O   1 
ATOM   3049  C  CB  . LEU C  1 79  ? 37.975  -29.321 36.873  1.00 16.25  ? 79  LEU C CB  1 
ATOM   3050  C  CG  . LEU C  1 79  ? 36.637  -28.801 37.383  1.00 25.17  ? 79  LEU C CG  1 
ATOM   3051  C  CD1 . LEU C  1 79  ? 35.794  -29.942 37.937  1.00 19.76  ? 79  LEU C CD1 1 
ATOM   3052  C  CD2 . LEU C  1 79  ? 37.034  -27.898 38.520  1.00 27.08  ? 79  LEU C CD2 1 
ATOM   3053  N  N   . GLU C  1 80  ? 40.847  -29.313 35.749  1.00 15.66  ? 80  GLU C N   1 
ATOM   3054  C  CA  . GLU C  1 80  ? 42.236  -29.679 35.918  1.00 17.73  ? 80  GLU C CA  1 
ATOM   3055  C  C   . GLU C  1 80  ? 43.185  -28.531 35.728  1.00 25.54  ? 80  GLU C C   1 
ATOM   3056  O  O   . GLU C  1 80  ? 44.296  -28.571 36.250  1.00 38.22  ? 80  GLU C O   1 
ATOM   3057  C  CB  . GLU C  1 80  ? 42.637  -30.787 34.938  1.00 18.72  ? 80  GLU C CB  1 
ATOM   3058  C  CG  . GLU C  1 80  ? 41.856  -32.057 35.159  1.00 63.02  ? 80  GLU C CG  1 
ATOM   3059  C  CD  . GLU C  1 80  ? 42.187  -33.158 34.204  0.00 100.00 ? 80  GLU C CD  1 
ATOM   3060  O  OE1 . GLU C  1 80  ? 42.757  -32.902 33.123  1.00 99.96  ? 80  GLU C OE1 1 
ATOM   3061  O  OE2 . GLU C  1 80  ? 41.884  -34.308 34.520  0.00 100.00 ? 80  GLU C OE2 1 
ATOM   3062  N  N   . ASN C  1 81  ? 42.824  -27.530 34.934  1.00 12.84  ? 81  ASN C N   1 
ATOM   3063  C  CA  . ASN C  1 81  ? 43.814  -26.492 34.726  1.00 10.51  ? 81  ASN C CA  1 
ATOM   3064  C  C   . ASN C  1 81  ? 43.571  -25.166 35.374  1.00 14.38  ? 81  ASN C C   1 
ATOM   3065  O  O   . ASN C  1 81  ? 44.462  -24.336 35.368  1.00 19.28  ? 81  ASN C O   1 
ATOM   3066  C  CB  . ASN C  1 81  ? 44.120  -26.318 33.247  1.00 13.67  ? 81  ASN C CB  1 
ATOM   3067  C  CG  . ASN C  1 81  ? 44.606  -27.585 32.615  1.00 14.66  ? 81  ASN C CG  1 
ATOM   3068  O  OD1 . ASN C  1 81  ? 43.804  -28.465 32.315  1.00 21.22  ? 81  ASN C OD1 1 
ATOM   3069  N  ND2 . ASN C  1 81  ? 45.897  -27.669 32.350  1.00 15.16  ? 81  ASN C ND2 1 
ATOM   3070  N  N   . ALA C  1 82  ? 42.370  -24.933 35.884  1.00 12.77  ? 82  ALA C N   1 
ATOM   3071  C  CA  . ALA C  1 82  ? 42.030  -23.624 36.446  1.00 13.06  ? 82  ALA C CA  1 
ATOM   3072  C  C   . ALA C  1 82  ? 42.788  -23.198 37.673  1.00 16.36  ? 82  ALA C C   1 
ATOM   3073  O  O   . ALA C  1 82  ? 42.957  -24.012 38.554  1.00 19.19  ? 82  ALA C O   1 
ATOM   3074  C  CB  . ALA C  1 82  ? 40.501  -23.494 36.704  1.00 12.32  ? 82  ALA C CB  1 
ATOM   3075  N  N   . SER C  1 83  ? 43.153  -21.922 37.740  1.00 8.01   ? 83  SER C N   1 
ATOM   3076  C  CA  . SER C  1 83  ? 43.762  -21.366 38.941  1.00 5.20   ? 83  SER C CA  1 
ATOM   3077  C  C   . SER C  1 83  ? 42.660  -20.779 39.805  1.00 14.08  ? 83  SER C C   1 
ATOM   3078  O  O   . SER C  1 83  ? 42.793  -20.657 41.018  1.00 17.22  ? 83  SER C O   1 
ATOM   3079  C  CB  . SER C  1 83  ? 44.912  -20.380 38.661  1.00 3.57   ? 83  SER C CB  1 
ATOM   3080  O  OG  . SER C  1 83  ? 44.518  -19.385 37.753  1.00 25.86  ? 83  SER C OG  1 
ATOM   3081  N  N   . VAL C  1 84  ? 41.539  -20.459 39.171  1.00 14.31  ? 84  VAL C N   1 
ATOM   3082  C  CA  . VAL C  1 84  ? 40.353  -19.928 39.842  1.00 9.76   ? 84  VAL C CA  1 
ATOM   3083  C  C   . VAL C  1 84  ? 39.730  -21.026 40.698  1.00 12.44  ? 84  VAL C C   1 
ATOM   3084  O  O   . VAL C  1 84  ? 39.565  -22.148 40.282  1.00 12.47  ? 84  VAL C O   1 
ATOM   3085  C  CB  . VAL C  1 84  ? 39.315  -19.398 38.818  1.00 6.76   ? 84  VAL C CB  1 
ATOM   3086  C  CG1 . VAL C  1 84  ? 38.020  -19.077 39.509  1.00 5.26   ? 84  VAL C CG1 1 
ATOM   3087  C  CG2 . VAL C  1 84  ? 39.822  -18.147 38.106  1.00 3.60   ? 84  VAL C CG2 1 
ATOM   3088  N  N   . GLU C  1 85  ? 39.413  -20.720 41.938  1.00 19.77  ? 85  GLU C N   1 
ATOM   3089  C  CA  . GLU C  1 85  ? 38.828  -21.745 42.799  1.00 21.74  ? 85  GLU C CA  1 
ATOM   3090  C  C   . GLU C  1 85  ? 37.312  -21.737 42.859  1.00 18.44  ? 85  GLU C C   1 
ATOM   3091  O  O   . GLU C  1 85  ? 36.700  -20.677 42.932  1.00 22.37  ? 85  GLU C O   1 
ATOM   3092  C  CB  . GLU C  1 85  ? 39.293  -21.510 44.237  1.00 27.81  ? 85  GLU C CB  1 
ATOM   3093  C  CG  . GLU C  1 85  ? 40.750  -21.825 44.514  1.00 73.32  ? 85  GLU C CG  1 
ATOM   3094  C  CD  . GLU C  1 85  ? 41.042  -23.253 44.199  0.00 100.00 ? 85  GLU C CD  1 
ATOM   3095  O  OE1 . GLU C  1 85  ? 40.079  -24.025 44.030  0.00 100.00 ? 85  GLU C OE1 1 
ATOM   3096  O  OE2 . GLU C  1 85  ? 42.233  -23.620 44.115  0.00 100.00 ? 85  GLU C OE2 1 
ATOM   3097  N  N   . GLU C  1 86  ? 36.715  -22.907 43.011  1.00 13.04  ? 86  GLU C N   1 
ATOM   3098  C  CA  . GLU C  1 86  ? 35.267  -22.919 43.109  1.00 17.27  ? 86  GLU C CA  1 
ATOM   3099  C  C   . GLU C  1 86  ? 34.855  -23.767 44.291  1.00 19.23  ? 86  GLU C C   1 
ATOM   3100  O  O   . GLU C  1 86  ? 35.550  -24.683 44.679  1.00 19.62  ? 86  GLU C O   1 
ATOM   3101  C  CB  . GLU C  1 86  ? 34.620  -23.525 41.871  1.00 17.22  ? 86  GLU C CB  1 
ATOM   3102  C  CG  . GLU C  1 86  ? 35.052  -24.943 41.627  1.00 39.29  ? 86  GLU C CG  1 
ATOM   3103  C  CD  . GLU C  1 86  ? 34.191  -25.665 40.634  1.00 49.34  ? 86  GLU C CD  1 
ATOM   3104  O  OE1 . GLU C  1 86  ? 33.476  -25.022 39.824  1.00 29.58  ? 86  GLU C OE1 1 
ATOM   3105  O  OE2 . GLU C  1 86  ? 34.299  -26.913 40.630  1.00 24.35  ? 86  GLU C OE2 1 
ATOM   3106  N  N   . ALA C  1 87  ? 33.682  -23.485 44.842  1.00 16.86  ? 87  ALA C N   1 
ATOM   3107  C  CA  . ALA C  1 87  ? 33.140  -24.269 45.950  1.00 17.23  ? 87  ALA C CA  1 
ATOM   3108  C  C   . ALA C  1 87  ? 31.629  -24.334 45.968  1.00 20.18  ? 87  ALA C C   1 
ATOM   3109  O  O   . ALA C  1 87  ? 30.963  -23.299 45.912  1.00 26.03  ? 87  ALA C O   1 
ATOM   3110  C  CB  . ALA C  1 87  ? 33.592  -23.724 47.285  1.00 18.05  ? 87  ALA C CB  1 
ATOM   3111  N  N   . PRO C  1 88  ? 31.107  -25.540 46.150  1.00 16.85  ? 88  PRO C N   1 
ATOM   3112  C  CA  . PRO C  1 88  ? 29.667  -25.760 46.242  1.00 20.77  ? 88  PRO C CA  1 
ATOM   3113  C  C   . PRO C  1 88  ? 29.073  -24.826 47.301  1.00 18.60  ? 88  PRO C C   1 
ATOM   3114  O  O   . PRO C  1 88  ? 29.755  -24.448 48.256  1.00 16.40  ? 88  PRO C O   1 
ATOM   3115  C  CB  . PRO C  1 88  ? 29.555  -27.216 46.701  1.00 23.70  ? 88  PRO C CB  1 
ATOM   3116  C  CG  . PRO C  1 88  ? 30.813  -27.440 47.453  1.00 27.74  ? 88  PRO C CG  1 
ATOM   3117  C  CD  . PRO C  1 88  ? 31.870  -26.656 46.715  1.00 18.93  ? 88  PRO C CD  1 
ATOM   3118  N  N   . TYR C  1 89  ? 27.845  -24.381 47.050  1.00 15.47  ? 89  TYR C N   1 
ATOM   3119  C  CA  . TYR C  1 89  ? 27.180  -23.471 47.964  1.00 14.74  ? 89  TYR C CA  1 
ATOM   3120  C  C   . TYR C  1 89  ? 26.399  -24.331 48.936  1.00 30.24  ? 89  TYR C C   1 
ATOM   3121  O  O   . TYR C  1 89  ? 25.402  -24.966 48.569  1.00 35.43  ? 89  TYR C O   1 
ATOM   3122  C  CB  . TYR C  1 89  ? 26.227  -22.594 47.189  1.00 8.76   ? 89  TYR C CB  1 
ATOM   3123  C  CG  . TYR C  1 89  ? 25.622  -21.487 48.022  1.00 9.81   ? 89  TYR C CG  1 
ATOM   3124  C  CD1 . TYR C  1 89  ? 26.267  -20.255 48.104  1.00 8.81   ? 89  TYR C CD1 1 
ATOM   3125  C  CD2 . TYR C  1 89  ? 24.426  -21.717 48.696  1.00 13.33  ? 89  TYR C CD2 1 
ATOM   3126  C  CE1 . TYR C  1 89  ? 25.699  -19.230 48.857  1.00 9.68   ? 89  TYR C CE1 1 
ATOM   3127  C  CE2 . TYR C  1 89  ? 23.853  -20.690 49.447  1.00 18.32  ? 89  TYR C CE2 1 
ATOM   3128  C  CZ  . TYR C  1 89  ? 24.489  -19.445 49.524  1.00 20.33  ? 89  TYR C CZ  1 
ATOM   3129  O  OH  . TYR C  1 89  ? 23.925  -18.444 50.247  1.00 29.93  ? 89  TYR C OH  1 
ATOM   3130  N  N   . THR C  1 90  ? 26.885  -24.345 50.140  1.00 35.48  ? 90  THR C N   1 
ATOM   3131  C  CA  . THR C  1 90  ? 26.300  -25.146 51.203  1.00 38.54  ? 90  THR C CA  1 
ATOM   3132  C  C   . THR C  1 90  ? 25.712  -24.223 52.255  1.00 47.36  ? 90  THR C C   1 
ATOM   3133  O  O   . THR C  1 90  ? 24.491  -24.189 52.468  1.00 48.59  ? 90  THR C O   1 
ATOM   3134  C  CB  . THR C  1 90  ? 27.406  -26.009 51.801  1.00 50.93  ? 90  THR C CB  1 
ATOM   3135  O  OG1 . THR C  1 90  ? 28.530  -25.198 52.126  1.00 56.34  ? 90  THR C OG1 1 
ATOM   3136  C  CG2 . THR C  1 90  ? 27.893  -27.089 50.832  1.00 51.89  ? 90  THR C CG2 1 
ATOM   3137  N  N   . LYS C  1 91  ? 26.626  -23.518 52.853  1.00 45.79  ? 91  LYS C N   1 
ATOM   3138  C  CA  . LYS C  1 91  ? 26.349  -22.550 53.898  1.00 48.18  ? 91  LYS C CA  1 
ATOM   3139  C  C   . LYS C  1 91  ? 25.896  -21.253 53.226  1.00 75.49  ? 91  LYS C C   1 
ATOM   3140  O  O   . LYS C  1 91  ? 26.612  -20.711 52.363  1.00 81.32  ? 91  LYS C O   1 
ATOM   3141  C  CB  . LYS C  1 91  ? 27.640  -22.402 54.701  1.00 53.46  ? 91  LYS C CB  1 
ATOM   3142  C  CG  . LYS C  1 91  ? 27.537  -21.534 55.946  0.00 100.00 ? 91  LYS C CG  1 
ATOM   3143  C  CD  . LYS C  1 91  ? 28.551  -21.926 57.032  0.00 100.00 ? 91  LYS C CD  1 
ATOM   3144  C  CE  . LYS C  1 91  ? 29.689  -22.824 56.519  0.00 100.00 ? 91  LYS C CE  1 
ATOM   3145  N  NZ  . LYS C  1 91  ? 30.456  -23.469 57.604  0.00 100.00 ? 91  LYS C NZ  1 
ATOM   3146  N  N   . PRO C  1 92  ? 24.741  -20.720 53.625  1.00 57.95  ? 92  PRO C N   1 
ATOM   3147  C  CA  . PRO C  1 92  ? 24.164  -19.533 53.003  1.00 42.02  ? 92  PRO C CA  1 
ATOM   3148  C  C   . PRO C  1 92  ? 25.094  -18.353 53.335  1.00 34.80  ? 92  PRO C C   1 
ATOM   3149  O  O   . PRO C  1 92  ? 25.546  -18.160 54.476  1.00 11.67  ? 92  PRO C O   1 
ATOM   3150  C  CB  . PRO C  1 92  ? 22.888  -19.316 53.778  1.00 59.30  ? 92  PRO C CB  1 
ATOM   3151  C  CG  . PRO C  1 92  ? 22.829  -20.362 54.881  1.00 83.94  ? 92  PRO C CG  1 
ATOM   3152  C  CD  . PRO C  1 92  ? 24.002  -21.268 54.756  1.00 81.33  ? 92  PRO C CD  1 
ATOM   3153  N  N   . LYS C  1 93  ? 25.457  -17.627 52.277  1.00 14.17  ? 93  LYS C N   1 
ATOM   3154  C  CA  . LYS C  1 93  ? 26.410  -16.536 52.365  1.00 8.38   ? 93  LYS C CA  1 
ATOM   3155  C  C   . LYS C  1 93  ? 25.728  -15.162 52.301  1.00 9.84   ? 93  LYS C C   1 
ATOM   3156  O  O   . LYS C  1 93  ? 24.614  -15.033 51.824  1.00 30.92  ? 93  LYS C O   1 
ATOM   3157  C  CB  . LYS C  1 93  ? 27.438  -16.836 51.250  1.00 17.45  ? 93  LYS C CB  1 
ATOM   3158  C  CG  . LYS C  1 93  ? 28.523  -17.882 51.591  1.00 22.90  ? 93  LYS C CG  1 
ATOM   3159  C  CD  . LYS C  1 93  ? 29.150  -18.588 50.405  0.00 100.00 ? 93  LYS C CD  1 
ATOM   3160  C  CE  . LYS C  1 93  ? 29.840  -17.679 49.411  0.00 100.00 ? 93  LYS C CE  1 
ATOM   3161  N  NZ  . LYS C  1 93  ? 30.144  -18.231 48.040  1.00 79.35  ? 93  LYS C NZ  1 
ATOM   3162  N  N   . THR C  1 94  ? 26.400  -14.128 52.851  1.00 3.30   ? 94  THR C N   1 
ATOM   3163  C  CA  . THR C  1 94  ? 25.940  -12.725 52.826  1.00 5.64   ? 94  THR C CA  1 
ATOM   3164  C  C   . THR C  1 94  ? 26.160  -12.257 51.374  1.00 6.22   ? 94  THR C C   1 
ATOM   3165  O  O   . THR C  1 94  ? 26.891  -12.925 50.622  1.00 20.37  ? 94  THR C O   1 
ATOM   3166  C  CB  . THR C  1 94  ? 26.872  -11.720 53.606  1.00 10.05  ? 94  THR C CB  1 
ATOM   3167  O  OG1 . THR C  1 94  ? 27.415  -12.227 54.793  1.00 89.61  ? 94  THR C OG1 1 
ATOM   3168  C  CG2 . THR C  1 94  ? 26.153  -10.366 53.801  1.00 21.28  ? 94  THR C CG2 1 
ATOM   3169  N  N   . MET C  1 95  ? 25.565  -11.104 51.022  1.00 16.54  ? 95  MET C N   1 
ATOM   3170  C  CA  . MET C  1 95  ? 25.673  -10.488 49.697  1.00 21.05  ? 95  MET C CA  1 
ATOM   3171  C  C   . MET C  1 95  ? 27.126  -10.018 49.597  1.00 22.06  ? 95  MET C C   1 
ATOM   3172  O  O   . MET C  1 95  ? 27.860  -10.267 48.626  1.00 22.18  ? 95  MET C O   1 
ATOM   3173  C  CB  . MET C  1 95  ? 24.684  -9.320  49.538  1.00 24.55  ? 95  MET C CB  1 
ATOM   3174  C  CG  . MET C  1 95  ? 24.589  -8.736  48.119  1.00 30.61  ? 95  MET C CG  1 
ATOM   3175  S  SD  . MET C  1 95  ? 24.123  -9.844  46.745  1.00 31.85  ? 95  MET C SD  1 
ATOM   3176  C  CE  . MET C  1 95  ? 22.209  -9.654  46.748  1.00 26.50  ? 95  MET C CE  1 
ATOM   3177  N  N   . ASP C  1 96  ? 27.559  -9.428  50.696  1.00 20.66  ? 96  ASP C N   1 
ATOM   3178  C  CA  . ASP C  1 96  ? 28.924  -8.986  50.781  1.00 24.50  ? 96  ASP C CA  1 
ATOM   3179  C  C   . ASP C  1 96  ? 29.901  -10.125 50.655  1.00 15.31  ? 96  ASP C C   1 
ATOM   3180  O  O   . ASP C  1 96  ? 30.876  -10.012 49.895  1.00 18.28  ? 96  ASP C O   1 
ATOM   3181  C  CB  . ASP C  1 96  ? 29.124  -8.221  52.078  1.00 29.07  ? 96  ASP C CB  1 
ATOM   3182  C  CG  . ASP C  1 96  ? 28.553  -6.827  51.978  1.00 56.67  ? 96  ASP C CG  1 
ATOM   3183  O  OD1 . ASP C  1 96  ? 27.883  -6.567  50.966  1.00 65.70  ? 96  ASP C OD1 1 
ATOM   3184  O  OD2 . ASP C  1 96  ? 28.906  -5.969  52.806  1.00 59.27  ? 96  ASP C OD2 1 
ATOM   3185  N  N   . GLN C  1 97  ? 29.594  -11.243 51.301  1.00 8.65   ? 97  GLN C N   1 
ATOM   3186  C  CA  . GLN C  1 97  ? 30.494  -12.395 51.143  1.00 15.14  ? 97  GLN C CA  1 
ATOM   3187  C  C   . GLN C  1 97  ? 30.602  -12.831 49.668  1.00 20.30  ? 97  GLN C C   1 
ATOM   3188  O  O   . GLN C  1 97  ? 31.674  -13.194 49.169  1.00 15.93  ? 97  GLN C O   1 
ATOM   3189  C  CB  . GLN C  1 97  ? 29.993  -13.565 51.987  1.00 22.40  ? 97  GLN C CB  1 
ATOM   3190  C  CG  . GLN C  1 97  ? 29.825  -13.280 53.487  1.00 41.50  ? 97  GLN C CG  1 
ATOM   3191  C  CD  . GLN C  1 97  ? 29.407  -14.526 54.235  1.00 61.24  ? 97  GLN C CD  1 
ATOM   3192  O  OE1 . GLN C  1 97  ? 28.527  -14.478 55.085  1.00 73.49  ? 97  GLN C OE1 1 
ATOM   3193  N  NE2 . GLN C  1 97  ? 30.021  -15.656 53.899  1.00 91.64  ? 97  GLN C NE2 1 
ATOM   3194  N  N   . LEU C  1 98  ? 29.467  -12.804 48.971  1.00 13.08  ? 98  LEU C N   1 
ATOM   3195  C  CA  . LEU C  1 98  ? 29.425  -13.237 47.587  1.00 13.02  ? 98  LEU C CA  1 
ATOM   3196  C  C   . LEU C  1 98  ? 30.210  -12.259 46.743  1.00 11.07  ? 98  LEU C C   1 
ATOM   3197  O  O   . LEU C  1 98  ? 31.047  -12.666 45.957  1.00 7.48   ? 98  LEU C O   1 
ATOM   3198  C  CB  . LEU C  1 98  ? 27.985  -13.335 47.142  1.00 10.75  ? 98  LEU C CB  1 
ATOM   3199  C  CG  . LEU C  1 98  ? 27.288  -14.471 47.895  1.00 10.81  ? 98  LEU C CG  1 
ATOM   3200  C  CD1 . LEU C  1 98  ? 25.825  -14.634 47.529  1.00 9.73   ? 98  LEU C CD1 1 
ATOM   3201  C  CD2 . LEU C  1 98  ? 27.993  -15.753 47.542  1.00 1.36   ? 98  LEU C CD2 1 
ATOM   3202  N  N   . MET C  1 99  ? 29.985  -10.975 46.975  1.00 4.67   ? 99  MET C N   1 
ATOM   3203  C  CA  . MET C  1 99  ? 30.712  -9.990  46.194  1.00 1.89   ? 99  MET C CA  1 
ATOM   3204  C  C   . MET C  1 99  ? 32.198  -10.107 46.492  1.00 10.53  ? 99  MET C C   1 
ATOM   3205  O  O   . MET C  1 99  ? 33.031  -9.940  45.589  1.00 12.04  ? 99  MET C O   1 
ATOM   3206  C  CB  . MET C  1 99  ? 30.223  -8.593  46.543  1.00 4.18   ? 99  MET C CB  1 
ATOM   3207  C  CG  . MET C  1 99  ? 28.798  -8.364  46.050  1.00 11.48  ? 99  MET C CG  1 
ATOM   3208  S  SD  . MET C  1 99  ? 28.528  -8.717  44.267  1.00 15.75  ? 99  MET C SD  1 
ATOM   3209  C  CE  . MET C  1 99  ? 28.100  -10.415 44.280  1.00 11.10  ? 99  MET C CE  1 
ATOM   3210  N  N   . GLU C  1 100 ? 32.548  -10.413 47.742  1.00 11.96  ? 100 GLU C N   1 
ATOM   3211  C  CA  . GLU C  1 100 ? 33.969  -10.544 48.091  1.00 12.15  ? 100 GLU C CA  1 
ATOM   3212  C  C   . GLU C  1 100 ? 34.616  -11.699 47.348  1.00 11.85  ? 100 GLU C C   1 
ATOM   3213  O  O   . GLU C  1 100 ? 35.758  -11.607 46.899  1.00 13.29  ? 100 GLU C O   1 
ATOM   3214  C  CB  . GLU C  1 100 ? 34.215  -10.636 49.593  1.00 14.68  ? 100 GLU C CB  1 
ATOM   3215  C  CG  . GLU C  1 100 ? 34.112  -9.270  50.272  1.00 36.67  ? 100 GLU C CG  1 
ATOM   3216  C  CD  . GLU C  1 100 ? 33.860  -9.330  51.769  1.00 99.90  ? 100 GLU C CD  1 
ATOM   3217  O  OE1 . GLU C  1 100 ? 33.504  -10.399 52.310  1.00 97.90  ? 100 GLU C OE1 1 
ATOM   3218  O  OE2 . GLU C  1 100 ? 34.005  -8.267  52.404  0.00 100.00 ? 100 GLU C OE2 1 
ATOM   3219  N  N   . ASP C  1 101 ? 33.844  -12.755 47.133  1.00 11.42  ? 101 ASP C N   1 
ATOM   3220  C  CA  . ASP C  1 101 ? 34.350  -13.877 46.357  1.00 18.03  ? 101 ASP C CA  1 
ATOM   3221  C  C   . ASP C  1 101 ? 34.514  -13.427 44.901  1.00 16.12  ? 101 ASP C C   1 
ATOM   3222  O  O   . ASP C  1 101 ? 35.516  -13.681 44.246  1.00 13.03  ? 101 ASP C O   1 
ATOM   3223  C  CB  . ASP C  1 101 ? 33.350  -15.025 46.496  1.00 26.38  ? 101 ASP C CB  1 
ATOM   3224  C  CG  . ASP C  1 101 ? 33.815  -16.317 45.833  1.00 70.81  ? 101 ASP C CG  1 
ATOM   3225  O  OD1 . ASP C  1 101 ? 35.010  -16.389 45.462  1.00 75.02  ? 101 ASP C OD1 1 
ATOM   3226  O  OD2 . ASP C  1 101 ? 32.978  -17.238 45.674  1.00 79.81  ? 101 ASP C OD2 1 
ATOM   3227  N  N   . LEU C  1 102 ? 33.560  -12.662 44.397  1.00 9.14   ? 102 LEU C N   1 
ATOM   3228  C  CA  . LEU C  1 102 ? 33.618  -12.174 43.035  1.00 6.04   ? 102 LEU C CA  1 
ATOM   3229  C  C   . LEU C  1 102 ? 34.883  -11.330 42.860  1.00 7.55   ? 102 LEU C C   1 
ATOM   3230  O  O   . LEU C  1 102 ? 35.729  -11.534 41.980  1.00 9.39   ? 102 LEU C O   1 
ATOM   3231  C  CB  . LEU C  1 102 ? 32.401  -11.254 42.845  1.00 5.86   ? 102 LEU C CB  1 
ATOM   3232  C  CG  . LEU C  1 102 ? 31.829  -11.079 41.443  1.00 13.83  ? 102 LEU C CG  1 
ATOM   3233  C  CD1 . LEU C  1 102 ? 31.384  -9.659  41.220  1.00 7.83   ? 102 LEU C CD1 1 
ATOM   3234  C  CD2 . LEU C  1 102 ? 32.793  -11.619 40.379  1.00 24.82  ? 102 LEU C CD2 1 
ATOM   3235  N  N   . VAL C  1 103 ? 35.001  -10.340 43.719  1.00 1.00   ? 103 VAL C N   1 
ATOM   3236  C  CA  . VAL C  1 103 ? 36.115  -9.451  43.592  1.00 3.17   ? 103 VAL C CA  1 
ATOM   3237  C  C   . VAL C  1 103 ? 37.438  -10.179 43.734  1.00 12.16  ? 103 VAL C C   1 
ATOM   3238  O  O   . VAL C  1 103 ? 38.401  -9.886  43.019  1.00 6.85   ? 103 VAL C O   1 
ATOM   3239  C  CB  . VAL C  1 103 ? 35.998  -8.448  44.693  1.00 12.99  ? 103 VAL C CB  1 
ATOM   3240  C  CG1 . VAL C  1 103 ? 37.309  -7.751  44.833  1.00 14.58  ? 103 VAL C CG1 1 
ATOM   3241  C  CG2 . VAL C  1 103 ? 34.992  -7.408  44.289  1.00 14.51  ? 103 VAL C CG2 1 
ATOM   3242  N  N   . GLY C  1 104 ? 37.503  -11.143 44.639  1.00 5.88   ? 104 GLY C N   1 
ATOM   3243  C  CA  . GLY C  1 104 ? 38.757  -11.867 44.786  1.00 4.24   ? 104 GLY C CA  1 
ATOM   3244  C  C   . GLY C  1 104 ? 39.132  -12.524 43.454  1.00 9.06   ? 104 GLY C C   1 
ATOM   3245  O  O   . GLY C  1 104 ? 40.285  -12.450 43.026  1.00 12.46  ? 104 GLY C O   1 
ATOM   3246  N  N   . THR C  1 105 ? 38.160  -13.116 42.772  1.00 4.95   ? 105 THR C N   1 
ATOM   3247  C  CA  . THR C  1 105 ? 38.415  -13.775 41.500  1.00 4.03   ? 105 THR C CA  1 
ATOM   3248  C  C   . THR C  1 105 ? 38.777  -12.792 40.418  1.00 4.85   ? 105 THR C C   1 
ATOM   3249  O  O   . THR C  1 105 ? 39.617  -13.094 39.582  1.00 7.19   ? 105 THR C O   1 
ATOM   3250  C  CB  . THR C  1 105 ? 37.210  -14.571 41.060  1.00 12.18  ? 105 THR C CB  1 
ATOM   3251  O  OG1 . THR C  1 105 ? 36.990  -15.586 42.041  1.00 16.13  ? 105 THR C OG1 1 
ATOM   3252  C  CG2 . THR C  1 105 ? 37.471  -15.243 39.708  1.00 8.14   ? 105 THR C CG2 1 
ATOM   3253  N  N   . LEU C  1 106 ? 38.120  -11.641 40.466  1.00 2.59   ? 106 LEU C N   1 
ATOM   3254  C  CA  . LEU C  1 106 ? 38.455  -10.578 39.536  1.00 2.89   ? 106 LEU C CA  1 
ATOM   3255  C  C   . LEU C  1 106 ? 39.958  -10.250 39.759  1.00 11.24  ? 106 LEU C C   1 
ATOM   3256  O  O   . LEU C  1 106 ? 40.757  -10.191 38.813  1.00 10.01  ? 106 LEU C O   1 
ATOM   3257  C  CB  . LEU C  1 106 ? 37.567  -9.343  39.748  1.00 2.04   ? 106 LEU C CB  1 
ATOM   3258  C  CG  . LEU C  1 106 ? 36.109  -9.490  39.281  1.00 5.28   ? 106 LEU C CG  1 
ATOM   3259  C  CD1 . LEU C  1 106 ? 35.318  -8.239  39.638  1.00 1.00   ? 106 LEU C CD1 1 
ATOM   3260  C  CD2 . LEU C  1 106 ? 36.122  -9.603  37.775  1.00 1.22   ? 106 LEU C CD2 1 
ATOM   3261  N  N   . GLU C  1 107 ? 40.334  -10.001 41.006  1.00 5.31   ? 107 GLU C N   1 
ATOM   3262  C  CA  . GLU C  1 107 ? 41.722  -9.727  41.339  1.00 6.40   ? 107 GLU C CA  1 
ATOM   3263  C  C   . GLU C  1 107 ? 42.665  -10.795 40.821  1.00 11.01  ? 107 GLU C C   1 
ATOM   3264  O  O   . GLU C  1 107 ? 43.666  -10.486 40.179  1.00 8.25   ? 107 GLU C O   1 
ATOM   3265  C  CB  . GLU C  1 107 ? 41.881  -9.484  42.834  1.00 4.23   ? 107 GLU C CB  1 
ATOM   3266  C  CG  . GLU C  1 107 ? 41.344  -8.110  43.153  1.00 15.42  ? 107 GLU C CG  1 
ATOM   3267  C  CD  . GLU C  1 107 ? 41.268  -7.865  44.655  1.00 28.00  ? 107 GLU C CD  1 
ATOM   3268  O  OE1 . GLU C  1 107 ? 41.161  -8.885  45.376  1.00 39.76  ? 107 GLU C OE1 1 
ATOM   3269  O  OE2 . GLU C  1 107 ? 41.289  -6.680  45.070  1.00 30.13  ? 107 GLU C OE2 1 
ATOM   3270  N  N   . LEU C  1 108 ? 42.288  -12.054 40.974  1.00 5.81   ? 108 LEU C N   1 
ATOM   3271  C  CA  . LEU C  1 108 ? 43.138  -13.082 40.420  1.00 6.28   ? 108 LEU C CA  1 
ATOM   3272  C  C   . LEU C  1 108 ? 43.311  -12.988 38.901  1.00 9.82   ? 108 LEU C C   1 
ATOM   3273  O  O   . LEU C  1 108 ? 44.415  -13.163 38.376  1.00 11.75  ? 108 LEU C O   1 
ATOM   3274  C  CB  . LEU C  1 108 ? 42.574  -14.444 40.786  1.00 9.67   ? 108 LEU C CB  1 
ATOM   3275  C  CG  . LEU C  1 108 ? 43.279  -15.693 40.255  1.00 17.93  ? 108 LEU C CG  1 
ATOM   3276  C  CD1 . LEU C  1 108 ? 42.880  -16.907 41.033  1.00 14.40  ? 108 LEU C CD1 1 
ATOM   3277  C  CD2 . LEU C  1 108 ? 43.033  -15.956 38.784  1.00 24.80  ? 108 LEU C CD2 1 
ATOM   3278  N  N   . LEU C  1 109 ? 42.220  -12.773 38.174  1.00 5.01   ? 109 LEU C N   1 
ATOM   3279  C  CA  . LEU C  1 109 ? 42.287  -12.641 36.719  1.00 5.71   ? 109 LEU C CA  1 
ATOM   3280  C  C   . LEU C  1 109 ? 43.116  -11.435 36.329  1.00 6.23   ? 109 LEU C C   1 
ATOM   3281  O  O   . LEU C  1 109 ? 43.956  -11.480 35.429  1.00 10.17  ? 109 LEU C O   1 
ATOM   3282  C  CB  . LEU C  1 109 ? 40.906  -12.556 36.104  1.00 5.21   ? 109 LEU C CB  1 
ATOM   3283  C  CG  . LEU C  1 109 ? 40.179  -13.882 36.322  1.00 9.73   ? 109 LEU C CG  1 
ATOM   3284  C  CD1 . LEU C  1 109 ? 38.726  -13.703 36.033  1.00 11.86  ? 109 LEU C CD1 1 
ATOM   3285  C  CD2 . LEU C  1 109 ? 40.740  -14.930 35.358  1.00 6.54   ? 109 LEU C CD2 1 
ATOM   3286  N  N   . ARG C  1 110 ? 42.936  -10.354 37.071  1.00 2.60   ? 110 ARG C N   1 
ATOM   3287  C  CA  . ARG C  1 110 ? 43.699  -9.140  36.783  1.00 5.22   ? 110 ARG C CA  1 
ATOM   3288  C  C   . ARG C  1 110 ? 45.172  -9.460  36.822  1.00 11.07  ? 110 ARG C C   1 
ATOM   3289  O  O   . ARG C  1 110 ? 45.950  -9.223  35.899  1.00 8.55   ? 110 ARG C O   1 
ATOM   3290  C  CB  . ARG C  1 110 ? 43.480  -8.059  37.857  1.00 1.95   ? 110 ARG C CB  1 
ATOM   3291  C  CG  . ARG C  1 110 ? 44.279  -6.792  37.573  1.00 5.40   ? 110 ARG C CG  1 
ATOM   3292  C  CD  . ARG C  1 110 ? 44.146  -5.840  38.723  1.00 4.66   ? 110 ARG C CD  1 
ATOM   3293  N  NE  . ARG C  1 110 ? 44.497  -6.538  39.946  1.00 9.57   ? 110 ARG C NE  1 
ATOM   3294  C  CZ  . ARG C  1 110 ? 44.186  -6.139  41.174  1.00 18.25  ? 110 ARG C CZ  1 
ATOM   3295  N  NH1 . ARG C  1 110 ? 43.514  -5.019  41.439  1.00 5.94   ? 110 ARG C NH1 1 
ATOM   3296  N  NH2 . ARG C  1 110 ? 44.590  -6.886  42.204  1.00 14.94  ? 110 ARG C NH2 1 
ATOM   3297  N  N   . ASP C  1 111 ? 45.545  -10.024 37.945  1.00 6.69   ? 111 ASP C N   1 
ATOM   3298  C  CA  . ASP C  1 111 ? 46.932  -10.324 38.135  1.00 10.56  ? 111 ASP C CA  1 
ATOM   3299  C  C   . ASP C  1 111 ? 47.430  -11.331 37.122  1.00 9.48   ? 111 ASP C C   1 
ATOM   3300  O  O   . ASP C  1 111 ? 48.469  -11.117 36.525  1.00 10.58  ? 111 ASP C O   1 
ATOM   3301  C  CB  . ASP C  1 111 ? 47.214  -10.705 39.588  1.00 20.46  ? 111 ASP C CB  1 
ATOM   3302  C  CG  . ASP C  1 111 ? 46.831  -9.599  40.576  1.00 33.74  ? 111 ASP C CG  1 
ATOM   3303  O  OD1 . ASP C  1 111 ? 46.891  -8.405  40.240  1.00 24.01  ? 111 ASP C OD1 1 
ATOM   3304  O  OD2 . ASP C  1 111 ? 46.451  -9.932  41.717  1.00 59.20  ? 111 ASP C OD2 1 
ATOM   3305  N  N   . GLU C  1 112 ? 46.687  -12.375 36.810  1.00 3.85   ? 112 GLU C N   1 
ATOM   3306  C  CA  . GLU C  1 112 ? 47.227  -13.264 35.797  1.00 2.89   ? 112 GLU C CA  1 
ATOM   3307  C  C   . GLU C  1 112 ? 47.317  -12.613 34.430  1.00 11.29  ? 112 GLU C C   1 
ATOM   3308  O  O   . GLU C  1 112 ? 48.239  -12.873 33.676  1.00 12.67  ? 112 GLU C O   1 
ATOM   3309  C  CB  . GLU C  1 112 ? 46.489  -14.606 35.736  1.00 4.69   ? 112 GLU C CB  1 
ATOM   3310  C  CG  . GLU C  1 112 ? 46.418  -15.263 37.100  1.00 23.70  ? 112 GLU C CG  1 
ATOM   3311  C  CD  . GLU C  1 112 ? 46.047  -16.724 37.068  1.00 35.43  ? 112 GLU C CD  1 
ATOM   3312  O  OE1 . GLU C  1 112 ? 45.759  -17.209 35.959  1.00 17.91  ? 112 GLU C OE1 1 
ATOM   3313  O  OE2 . GLU C  1 112 ? 46.035  -17.352 38.156  1.00 22.41  ? 112 GLU C OE2 1 
ATOM   3314  N  N   . TYR C  1 113 ? 46.367  -11.763 34.094  1.00 5.36   ? 113 TYR C N   1 
ATOM   3315  C  CA  . TYR C  1 113 ? 46.402  -11.136 32.786  1.00 5.33   ? 113 TYR C CA  1 
ATOM   3316  C  C   . TYR C  1 113 ? 47.640  -10.287 32.679  1.00 8.96   ? 113 TYR C C   1 
ATOM   3317  O  O   . TYR C  1 113 ? 48.284  -10.231 31.644  1.00 6.65   ? 113 TYR C O   1 
ATOM   3318  C  CB  . TYR C  1 113 ? 45.168  -10.252 32.590  1.00 4.42   ? 113 TYR C CB  1 
ATOM   3319  C  CG  . TYR C  1 113 ? 43.980  -11.033 32.116  1.00 10.01  ? 113 TYR C CG  1 
ATOM   3320  C  CD1 . TYR C  1 113 ? 43.830  -12.369 32.462  1.00 13.13  ? 113 TYR C CD1 1 
ATOM   3321  C  CD2 . TYR C  1 113 ? 42.981  -10.419 31.394  1.00 15.06  ? 113 TYR C CD2 1 
ATOM   3322  C  CE1 . TYR C  1 113 ? 42.728  -13.082 32.069  1.00 18.25  ? 113 TYR C CE1 1 
ATOM   3323  C  CE2 . TYR C  1 113 ? 41.872  -11.128 31.002  1.00 20.89  ? 113 TYR C CE2 1 
ATOM   3324  C  CZ  . TYR C  1 113 ? 41.748  -12.439 31.356  1.00 18.08  ? 113 TYR C CZ  1 
ATOM   3325  O  OH  . TYR C  1 113 ? 40.624  -13.098 30.957  1.00 17.94  ? 113 TYR C OH  1 
ATOM   3326  N  N   . LYS C  1 114 ? 47.984  -9.650  33.787  1.00 10.50  ? 114 LYS C N   1 
ATOM   3327  C  CA  . LYS C  1 114 ? 49.170  -8.820  33.848  1.00 10.96  ? 114 LYS C CA  1 
ATOM   3328  C  C   . LYS C  1 114 ? 50.389  -9.648  33.436  1.00 12.60  ? 114 LYS C C   1 
ATOM   3329  O  O   . LYS C  1 114 ? 51.183  -9.225  32.590  1.00 13.67  ? 114 LYS C O   1 
ATOM   3330  C  CB  . LYS C  1 114 ? 49.286  -8.205  35.241  1.00 12.20  ? 114 LYS C CB  1 
ATOM   3331  C  CG  . LYS C  1 114 ? 50.471  -7.268  35.346  1.00 47.74  ? 114 LYS C CG  1 
ATOM   3332  C  CD  . LYS C  1 114 ? 50.717  -6.570  34.013  1.00 66.13  ? 114 LYS C CD  1 
ATOM   3333  C  CE  . LYS C  1 114 ? 51.943  -5.664  34.057  1.00 72.44  ? 114 LYS C CE  1 
ATOM   3334  N  NZ  . LYS C  1 114 ? 52.184  -4.988  32.752  1.00 81.07  ? 114 LYS C NZ  1 
ATOM   3335  N  N   . GLN C  1 115 ? 50.477  -10.890 33.922  1.00 8.38   ? 115 GLN C N   1 
ATOM   3336  C  CA  . GLN C  1 115 ? 51.575  -11.782 33.537  1.00 10.51  ? 115 GLN C CA  1 
ATOM   3337  C  C   . GLN C  1 115 ? 51.508  -12.087 32.046  1.00 10.32  ? 115 GLN C C   1 
ATOM   3338  O  O   . GLN C  1 115 ? 52.549  -12.187 31.394  1.00 12.97  ? 115 GLN C O   1 
ATOM   3339  C  CB  . GLN C  1 115 ? 51.520  -13.156 34.218  1.00 13.35  ? 115 GLN C CB  1 
ATOM   3340  C  CG  . GLN C  1 115 ? 51.108  -13.280 35.693  1.00 65.43  ? 115 GLN C CG  1 
ATOM   3341  C  CD  . GLN C  1 115 ? 51.792  -12.318 36.623  0.00 100.00 ? 115 GLN C CD  1 
ATOM   3342  O  OE1 . GLN C  1 115 ? 52.850  -11.790 36.301  0.00 100.00 ? 115 GLN C OE1 1 
ATOM   3343  N  NE2 . GLN C  1 115 ? 51.176  -12.045 37.763  1.00 99.98  ? 115 GLN C NE2 1 
ATOM   3344  N  N   . GLY C  1 116 ? 50.311  -12.372 31.536  1.00 6.84   ? 116 GLY C N   1 
ATOM   3345  C  CA  . GLY C  1 116 ? 50.139  -12.720 30.136  1.00 2.14   ? 116 GLY C CA  1 
ATOM   3346  C  C   . GLY C  1 116 ? 50.544  -11.469 29.350  1.00 3.04   ? 116 GLY C C   1 
ATOM   3347  O  O   . GLY C  1 116 ? 51.124  -11.562 28.271  1.00 7.82   ? 116 GLY C O   1 
ATOM   3348  N  N   . ILE C  1 117 ? 50.271  -10.259 29.839  1.00 1.00   ? 117 ILE C N   1 
ATOM   3349  C  CA  . ILE C  1 117 ? 50.632  -9.067  29.074  1.00 5.74   ? 117 ILE C CA  1 
ATOM   3350  C  C   . ILE C  1 117 ? 52.127  -8.956  28.970  1.00 6.01   ? 117 ILE C C   1 
ATOM   3351  O  O   . ILE C  1 117 ? 52.720  -8.715  27.916  1.00 11.27  ? 117 ILE C O   1 
ATOM   3352  C  CB  . ILE C  1 117 ? 50.014  -7.763  29.616  1.00 3.13   ? 117 ILE C CB  1 
ATOM   3353  C  CG1 . ILE C  1 117 ? 48.493  -7.903  29.464  1.00 11.33  ? 117 ILE C CG1 1 
ATOM   3354  C  CG2 . ILE C  1 117 ? 50.563  -6.498  28.881  1.00 1.00   ? 117 ILE C CG2 1 
ATOM   3355  C  CD1 . ILE C  1 117 ? 47.644  -6.840  30.121  1.00 1.00   ? 117 ILE C CD1 1 
ATOM   3356  N  N   . GLU C  1 118 ? 52.767  -9.260  30.080  1.00 12.18  ? 118 GLU C N   1 
ATOM   3357  C  CA  . GLU C  1 118 ? 54.204  -9.253  30.045  1.00 7.25   ? 118 GLU C CA  1 
ATOM   3358  C  C   . GLU C  1 118 ? 54.722  -10.300 29.076  1.00 7.74   ? 118 GLU C C   1 
ATOM   3359  O  O   . GLU C  1 118 ? 55.375  -9.985  28.077  1.00 15.12  ? 118 GLU C O   1 
ATOM   3360  C  CB  . GLU C  1 118 ? 54.730  -9.539  31.445  1.00 1.00   ? 118 GLU C CB  1 
ATOM   3361  C  CG  . GLU C  1 118 ? 54.684  -8.266  32.296  1.00 51.13  ? 118 GLU C CG  1 
ATOM   3362  C  CD  . GLU C  1 118 ? 56.025  -7.942  32.865  0.00 100.00 ? 118 GLU C CD  1 
ATOM   3363  O  OE1 . GLU C  1 118 ? 56.592  -8.776  33.550  0.00 100.00 ? 118 GLU C OE1 1 
ATOM   3364  O  OE2 . GLU C  1 118 ? 56.575  -6.871  32.524  0.00 100.00 ? 118 GLU C OE2 1 
ATOM   3365  N  N   . LEU C  1 119 ? 54.386  -11.550 29.358  1.00 5.52   ? 119 LEU C N   1 
ATOM   3366  C  CA  . LEU C  1 119 ? 54.823  -12.627 28.515  1.00 1.00   ? 119 LEU C CA  1 
ATOM   3367  C  C   . LEU C  1 119 ? 54.576  -12.456 27.023  1.00 1.00   ? 119 LEU C C   1 
ATOM   3368  O  O   . LEU C  1 119 ? 55.402  -12.764 26.148  1.00 3.70   ? 119 LEU C O   1 
ATOM   3369  C  CB  . LEU C  1 119 ? 54.027  -13.838 28.954  1.00 2.16   ? 119 LEU C CB  1 
ATOM   3370  C  CG  . LEU C  1 119 ? 54.076  -14.900 27.864  1.00 34.34  ? 119 LEU C CG  1 
ATOM   3371  C  CD1 . LEU C  1 119 ? 55.469  -15.488 27.802  1.00 57.15  ? 119 LEU C CD1 1 
ATOM   3372  C  CD2 . LEU C  1 119 ? 53.112  -16.014 28.047  1.00 19.17  ? 119 LEU C CD2 1 
ATOM   3373  N  N   . THR C  1 120 ? 53.390  -11.941 26.725  1.00 1.00   ? 120 THR C N   1 
ATOM   3374  C  CA  . THR C  1 120 ? 52.957  -11.790 25.326  1.00 1.00   ? 120 THR C CA  1 
ATOM   3375  C  C   . THR C  1 120 ? 53.830  -10.739 24.655  1.00 4.47   ? 120 THR C C   1 
ATOM   3376  O  O   . THR C  1 120 ? 54.205  -10.872 23.477  1.00 6.50   ? 120 THR C O   1 
ATOM   3377  C  CB  . THR C  1 120 ? 51.482  -11.406 25.300  1.00 1.00   ? 120 THR C CB  1 
ATOM   3378  O  OG1 . THR C  1 120 ? 50.974  -11.539 23.981  1.00 37.82  ? 120 THR C OG1 1 
ATOM   3379  C  CG2 . THR C  1 120 ? 51.234  -9.962  25.739  1.00 7.19   ? 120 THR C CG2 1 
ATOM   3380  N  N   . ASP C  1 121 ? 54.108  -9.762  25.468  1.00 3.00   ? 121 ASP C N   1 
ATOM   3381  C  CA  . ASP C  1 121 ? 54.941  -8.615  25.144  1.00 20.55  ? 121 ASP C CA  1 
ATOM   3382  C  C   . ASP C  1 121 ? 56.340  -9.072  24.754  1.00 24.74  ? 121 ASP C C   1 
ATOM   3383  O  O   . ASP C  1 121 ? 56.857  -8.739  23.672  1.00 21.66  ? 121 ASP C O   1 
ATOM   3384  C  CB  . ASP C  1 121 ? 55.059  -7.777  26.403  1.00 1.00   ? 121 ASP C CB  1 
ATOM   3385  C  CG  . ASP C  1 121 ? 54.939  -6.300  26.137  1.00 8.90   ? 121 ASP C CG  1 
ATOM   3386  O  OD1 . ASP C  1 121 ? 55.428  -5.824  25.054  1.00 1.10   ? 121 ASP C OD1 1 
ATOM   3387  O  OD2 . ASP C  1 121 ? 54.351  -5.542  26.999  0.00 100.00 ? 121 ASP C OD2 1 
ATOM   3388  N  N   . LYS C  1 122 ? 56.912  -9.814  25.672  1.00 20.09  ? 122 LYS C N   1 
ATOM   3389  C  CA  . LYS C  1 122 ? 58.243  -10.360 25.503  1.00 19.04  ? 122 LYS C CA  1 
ATOM   3390  C  C   . LYS C  1 122 ? 58.237  -11.208 24.244  1.00 16.42  ? 122 LYS C C   1 
ATOM   3391  O  O   . LYS C  1 122 ? 59.130  -11.099 23.407  1.00 4.63   ? 122 LYS C O   1 
ATOM   3392  C  CB  . LYS C  1 122 ? 58.640  -11.138 26.759  1.00 24.40  ? 122 LYS C CB  1 
ATOM   3393  C  CG  . LYS C  1 122 ? 58.272  -10.358 28.019  1.00 93.71  ? 122 LYS C CG  1 
ATOM   3394  C  CD  . LYS C  1 122 ? 59.310  -10.418 29.139  0.00 100.00 ? 122 LYS C CD  1 
ATOM   3395  C  CE  . LYS C  1 122 ? 58.714  -9.907  30.451  0.00 100.00 ? 122 LYS C CE  1 
ATOM   3396  N  NZ  . LYS C  1 122 ? 57.331  -10.368 30.651  0.00 100.00 ? 122 LYS C NZ  1 
ATOM   3397  N  N   . GLU C  1 123 ? 57.201  -12.008 24.100  1.00 27.15  ? 123 GLU C N   1 
ATOM   3398  C  CA  . GLU C  1 123 ? 57.093  -12.911 22.947  1.00 18.72  ? 123 GLU C CA  1 
ATOM   3399  C  C   . GLU C  1 123 ? 56.881  -12.160 21.621  1.00 23.39  ? 123 GLU C C   1 
ATOM   3400  O  O   . GLU C  1 123 ? 57.133  -12.696 20.554  1.00 6.48   ? 123 GLU C O   1 
ATOM   3401  C  CB  . GLU C  1 123 ? 55.966  -13.921 23.164  1.00 12.80  ? 123 GLU C CB  1 
ATOM   3402  C  CG  . GLU C  1 123 ? 56.256  -14.866 24.337  1.00 47.79  ? 123 GLU C CG  1 
ATOM   3403  C  CD  . GLU C  1 123 ? 55.981  -16.340 24.030  1.00 86.08  ? 123 GLU C CD  1 
ATOM   3404  O  OE1 . GLU C  1 123 ? 55.286  -16.663 22.996  1.00 49.94  ? 123 GLU C OE1 1 
ATOM   3405  O  OE2 . GLU C  1 123 ? 56.438  -17.257 24.816  1.00 69.21  ? 123 GLU C OE2 1 
ATOM   3406  N  N   . GLY C  1 124 ? 56.455  -10.914 21.669  1.00 27.90  ? 124 GLY C N   1 
ATOM   3407  C  CA  . GLY C  1 124 ? 56.154  -10.214 20.419  1.00 25.83  ? 124 GLY C CA  1 
ATOM   3408  C  C   . GLY C  1 124 ? 54.805  -10.547 19.739  1.00 22.18  ? 124 GLY C C   1 
ATOM   3409  O  O   . GLY C  1 124 ? 54.602  -10.344 18.522  1.00 24.60  ? 124 GLY C O   1 
ATOM   3410  N  N   . ASP C  1 125 ? 53.837  -11.083 20.474  1.00 22.70  ? 125 ASP C N   1 
ATOM   3411  C  CA  . ASP C  1 125 ? 52.545  -11.365 19.886  1.00 11.70  ? 125 ASP C CA  1 
ATOM   3412  C  C   . ASP C  1 125 ? 51.706  -10.154 20.225  1.00 10.57  ? 125 ASP C C   1 
ATOM   3413  O  O   . ASP C  1 125 ? 50.982  -10.112 21.216  1.00 12.63  ? 125 ASP C O   1 
ATOM   3414  C  CB  . ASP C  1 125 ? 51.946  -12.592 20.548  1.00 2.67   ? 125 ASP C CB  1 
ATOM   3415  C  CG  . ASP C  1 125 ? 50.560  -12.901 19.983  1.00 22.38  ? 125 ASP C CG  1 
ATOM   3416  O  OD1 . ASP C  1 125 ? 50.007  -12.069 19.218  1.00 20.14  ? 125 ASP C OD1 1 
ATOM   3417  O  OD2 . ASP C  1 125 ? 50.083  -14.020 20.272  1.00 14.18  ? 125 ASP C OD2 1 
ATOM   3418  N  N   . ASP C  1 126 ? 51.785  -9.156  19.371  1.00 7.05   ? 126 ASP C N   1 
ATOM   3419  C  CA  . ASP C  1 126 ? 51.103  -7.895  19.618  1.00 9.77   ? 126 ASP C CA  1 
ATOM   3420  C  C   . ASP C  1 126 ? 49.604  -8.026  19.753  1.00 6.42   ? 126 ASP C C   1 
ATOM   3421  O  O   . ASP C  1 126 ? 48.993  -7.393  20.605  1.00 7.41   ? 126 ASP C O   1 
ATOM   3422  C  CB  . ASP C  1 126 ? 51.392  -6.978  18.430  1.00 17.47  ? 126 ASP C CB  1 
ATOM   3423  C  CG  . ASP C  1 126 ? 52.854  -6.931  18.093  1.00 39.29  ? 126 ASP C CG  1 
ATOM   3424  O  OD1 . ASP C  1 126 ? 53.614  -6.284  18.859  1.00 41.00  ? 126 ASP C OD1 1 
ATOM   3425  O  OD2 . ASP C  1 126 ? 53.204  -7.638  17.121  1.00 50.82  ? 126 ASP C OD2 1 
ATOM   3426  N  N   . VAL C  1 127 ? 49.030  -8.847  18.883  1.00 3.61   ? 127 VAL C N   1 
ATOM   3427  C  CA  . VAL C  1 127 ? 47.593  -9.043  18.911  1.00 2.51   ? 127 VAL C CA  1 
ATOM   3428  C  C   . VAL C  1 127 ? 47.144  -9.577  20.285  1.00 8.75   ? 127 VAL C C   1 
ATOM   3429  O  O   . VAL C  1 127 ? 46.315  -8.959  20.955  1.00 11.16  ? 127 VAL C O   1 
ATOM   3430  C  CB  . VAL C  1 127 ? 47.123  -9.883  17.689  1.00 4.01   ? 127 VAL C CB  1 
ATOM   3431  C  CG1 . VAL C  1 127 ? 45.715  -10.401 17.945  1.00 1.40   ? 127 VAL C CG1 1 
ATOM   3432  C  CG2 . VAL C  1 127 ? 47.134  -9.069  16.389  1.00 1.00   ? 127 VAL C CG2 1 
ATOM   3433  N  N   . THR C  1 128 ? 47.723  -10.687 20.740  1.00 3.10   ? 128 THR C N   1 
ATOM   3434  C  CA  . THR C  1 128 ? 47.287  -11.230 22.017  1.00 1.00   ? 128 THR C CA  1 
ATOM   3435  C  C   . THR C  1 128 ? 47.500  -10.219 23.102  1.00 6.59   ? 128 THR C C   1 
ATOM   3436  O  O   . THR C  1 128 ? 46.622  -10.010 23.904  1.00 6.96   ? 128 THR C O   1 
ATOM   3437  C  CB  . THR C  1 128 ? 47.956  -12.543 22.306  1.00 1.00   ? 128 THR C CB  1 
ATOM   3438  O  OG1 . THR C  1 128 ? 47.672  -13.360 21.177  1.00 5.66   ? 128 THR C OG1 1 
ATOM   3439  C  CG2 . THR C  1 128 ? 47.357  -13.207 23.529  1.00 1.17   ? 128 THR C CG2 1 
ATOM   3440  N  N   . ASN C  1 129 ? 48.607  -9.503  23.032  1.00 1.80   ? 129 ASN C N   1 
ATOM   3441  C  CA  . ASN C  1 129 ? 48.940  -8.477  24.008  1.00 1.00   ? 129 ASN C CA  1 
ATOM   3442  C  C   . ASN C  1 129 ? 47.792  -7.456  24.144  1.00 3.19   ? 129 ASN C C   1 
ATOM   3443  O  O   . ASN C  1 129 ? 47.299  -7.145  25.247  1.00 2.47   ? 129 ASN C O   1 
ATOM   3444  C  CB  . ASN C  1 129 ? 50.246  -7.820  23.551  1.00 2.05   ? 129 ASN C CB  1 
ATOM   3445  C  CG  . ASN C  1 129 ? 50.708  -6.713  24.496  1.00 8.16   ? 129 ASN C CG  1 
ATOM   3446  O  OD1 . ASN C  1 129 ? 50.630  -5.521  24.188  1.00 27.60  ? 129 ASN C OD1 1 
ATOM   3447  N  ND2 . ASN C  1 129 ? 51.210  -7.134  25.663  1.00 2.62   ? 129 ASN C ND2 1 
ATOM   3448  N  N   . ASP C  1 130 ? 47.368  -6.932  22.995  1.00 1.74   ? 130 ASP C N   1 
ATOM   3449  C  CA  . ASP C  1 130 ? 46.253  -5.979  23.011  1.00 5.54   ? 130 ASP C CA  1 
ATOM   3450  C  C   . ASP C  1 130 ? 44.950  -6.548  23.541  1.00 7.78   ? 130 ASP C C   1 
ATOM   3451  O  O   . ASP C  1 130 ? 44.189  -5.850  24.203  1.00 9.47   ? 130 ASP C O   1 
ATOM   3452  C  CB  . ASP C  1 130 ? 46.019  -5.272  21.682  1.00 9.13   ? 130 ASP C CB  1 
ATOM   3453  C  CG  . ASP C  1 130 ? 46.643  -3.895  21.639  1.00 57.74  ? 130 ASP C CG  1 
ATOM   3454  O  OD1 . ASP C  1 130 ? 47.551  -3.568  22.445  1.00 57.46  ? 130 ASP C OD1 1 
ATOM   3455  O  OD2 . ASP C  1 130 ? 46.167  -3.115  20.790  1.00 94.59  ? 130 ASP C OD2 1 
ATOM   3456  N  N   . MET C  1 131 ? 44.689  -7.826  23.272  1.00 2.97   ? 131 MET C N   1 
ATOM   3457  C  CA  . MET C  1 131 ? 43.442  -8.379  23.770  1.00 7.00   ? 131 MET C CA  1 
ATOM   3458  C  C   . MET C  1 131 ? 43.424  -8.351  25.282  1.00 4.78   ? 131 MET C C   1 
ATOM   3459  O  O   . MET C  1 131 ? 42.456  -7.981  25.941  1.00 4.28   ? 131 MET C O   1 
ATOM   3460  C  CB  . MET C  1 131 ? 43.385  -9.876  23.562  1.00 12.35  ? 131 MET C CB  1 
ATOM   3461  C  CG  . MET C  1 131 ? 42.812  -10.464 22.309  1.00 17.94  ? 131 MET C CG  1 
ATOM   3462  S  SD  . MET C  1 131 ? 42.114  -12.090 22.818  1.00 14.91  ? 131 MET C SD  1 
ATOM   3463  C  CE  . MET C  1 131 ? 43.286  -12.889 23.926  1.00 13.78  ? 131 MET C CE  1 
ATOM   3464  N  N   . LEU C  1 132 ? 44.496  -8.892  25.836  1.00 2.12   ? 132 LEU C N   1 
ATOM   3465  C  CA  . LEU C  1 132 ? 44.607  -8.998  27.274  1.00 4.29   ? 132 LEU C CA  1 
ATOM   3466  C  C   . LEU C  1 132 ? 44.517  -7.621  27.881  1.00 7.17   ? 132 LEU C C   1 
ATOM   3467  O  O   . LEU C  1 132 ? 43.823  -7.462  28.864  1.00 7.44   ? 132 LEU C O   1 
ATOM   3468  C  CB  . LEU C  1 132 ? 45.941  -9.645  27.633  1.00 5.21   ? 132 LEU C CB  1 
ATOM   3469  C  CG  . LEU C  1 132 ? 45.986  -11.166 27.756  1.00 9.69   ? 132 LEU C CG  1 
ATOM   3470  C  CD1 . LEU C  1 132 ? 44.730  -11.905 27.320  1.00 6.53   ? 132 LEU C CD1 1 
ATOM   3471  C  CD2 . LEU C  1 132 ? 47.223  -11.746 27.055  1.00 5.38   ? 132 LEU C CD2 1 
ATOM   3472  N  N   . ILE C  1 133 ? 45.175  -6.635  27.277  1.00 3.93   ? 133 ILE C N   1 
ATOM   3473  C  CA  . ILE C  1 133 ? 45.071  -5.303  27.850  1.00 2.28   ? 133 ILE C CA  1 
ATOM   3474  C  C   . ILE C  1 133 ? 43.632  -4.811  27.925  1.00 7.48   ? 133 ILE C C   1 
ATOM   3475  O  O   . ILE C  1 133 ? 43.156  -4.294  28.941  1.00 5.37   ? 133 ILE C O   1 
ATOM   3476  C  CB  . ILE C  1 133 ? 45.989  -4.340  27.116  1.00 5.62   ? 133 ILE C CB  1 
ATOM   3477  C  CG1 . ILE C  1 133 ? 47.424  -4.810  27.313  1.00 7.31   ? 133 ILE C CG1 1 
ATOM   3478  C  CG2 . ILE C  1 133 ? 45.831  -2.901  27.628  1.00 2.18   ? 133 ILE C CG2 1 
ATOM   3479  C  CD1 . ILE C  1 133 ? 48.414  -3.850  26.657  1.00 1.76   ? 133 ILE C CD1 1 
ATOM   3480  N  N   . ALA C  1 134 ? 42.921  -5.008  26.832  1.00 4.74   ? 134 ALA C N   1 
ATOM   3481  C  CA  . ALA C  1 134 ? 41.536  -4.572  26.829  1.00 2.99   ? 134 ALA C CA  1 
ATOM   3482  C  C   . ALA C  1 134 ? 40.705  -5.333  27.860  1.00 6.01   ? 134 ALA C C   1 
ATOM   3483  O  O   . ALA C  1 134 ? 39.881  -4.739  28.529  1.00 8.41   ? 134 ALA C O   1 
ATOM   3484  C  CB  . ALA C  1 134 ? 40.931  -4.679  25.444  1.00 1.00   ? 134 ALA C CB  1 
ATOM   3485  N  N   . PHE C  1 135 ? 40.940  -6.620  28.068  1.00 1.96   ? 135 PHE C N   1 
ATOM   3486  C  CA  . PHE C  1 135 ? 40.155  -7.306  29.083  1.00 2.72   ? 135 PHE C CA  1 
ATOM   3487  C  C   . PHE C  1 135 ? 40.528  -6.765  30.466  1.00 4.86   ? 135 PHE C C   1 
ATOM   3488  O  O   . PHE C  1 135 ? 39.698  -6.700  31.372  1.00 6.47   ? 135 PHE C O   1 
ATOM   3489  C  CB  . PHE C  1 135 ? 40.431  -8.798  29.111  1.00 7.95   ? 135 PHE C CB  1 
ATOM   3490  C  CG  . PHE C  1 135 ? 40.049  -9.522  27.877  1.00 17.93  ? 135 PHE C CG  1 
ATOM   3491  C  CD1 . PHE C  1 135 ? 39.228  -8.953  26.932  1.00 23.40  ? 135 PHE C CD1 1 
ATOM   3492  C  CD2 . PHE C  1 135 ? 40.562  -10.772 27.629  1.00 22.48  ? 135 PHE C CD2 1 
ATOM   3493  C  CE1 . PHE C  1 135 ? 38.871  -9.641  25.779  1.00 21.19  ? 135 PHE C CE1 1 
ATOM   3494  C  CE2 . PHE C  1 135 ? 40.184  -11.484 26.491  1.00 18.98  ? 135 PHE C CE2 1 
ATOM   3495  C  CZ  . PHE C  1 135 ? 39.325  -10.921 25.559  1.00 12.72  ? 135 PHE C CZ  1 
ATOM   3496  N  N   . LYS C  1 136 ? 41.795  -6.434  30.642  1.00 3.84   ? 136 LYS C N   1 
ATOM   3497  C  CA  . LYS C  1 136 ? 42.227  -5.954  31.940  1.00 4.30   ? 136 LYS C CA  1 
ATOM   3498  C  C   . LYS C  1 136 ? 41.618  -4.596  32.237  1.00 2.11   ? 136 LYS C C   1 
ATOM   3499  O  O   . LYS C  1 136 ? 41.188  -4.318  33.347  1.00 2.52   ? 136 LYS C O   1 
ATOM   3500  C  CB  . LYS C  1 136 ? 43.738  -5.866  32.034  1.00 2.85   ? 136 LYS C CB  1 
ATOM   3501  C  CG  . LYS C  1 136 ? 44.191  -5.640  33.478  1.00 9.31   ? 136 LYS C CG  1 
ATOM   3502  C  CD  . LYS C  1 136 ? 45.720  -5.694  33.715  1.00 5.86   ? 136 LYS C CD  1 
ATOM   3503  C  CE  . LYS C  1 136 ? 46.328  -4.313  33.935  1.00 42.55  ? 136 LYS C CE  1 
ATOM   3504  N  NZ  . LYS C  1 136 ? 45.997  -3.686  35.240  1.00 15.05  ? 136 LYS C NZ  1 
ATOM   3505  N  N   . ALA C  1 137 ? 41.530  -3.759  31.221  1.00 1.00   ? 137 ALA C N   1 
ATOM   3506  C  CA  . ALA C  1 137 ? 40.908  -2.464  31.431  1.00 1.87   ? 137 ALA C CA  1 
ATOM   3507  C  C   . ALA C  1 137 ? 39.533  -2.650  32.059  1.00 7.73   ? 137 ALA C C   1 
ATOM   3508  O  O   . ALA C  1 137 ? 39.184  -1.989  33.033  1.00 8.10   ? 137 ALA C O   1 
ATOM   3509  C  CB  . ALA C  1 137 ? 40.718  -1.751  30.103  1.00 1.00   ? 137 ALA C CB  1 
ATOM   3510  N  N   . SER C  1 138 ? 38.760  -3.590  31.536  1.00 1.00   ? 138 SER C N   1 
ATOM   3511  C  CA  . SER C  1 138 ? 37.436  -3.864  32.046  1.00 1.00   ? 138 SER C CA  1 
ATOM   3512  C  C   . SER C  1 138 ? 37.430  -4.453  33.449  1.00 5.64   ? 138 SER C C   1 
ATOM   3513  O  O   . SER C  1 138 ? 36.671  -4.046  34.319  1.00 3.92   ? 138 SER C O   1 
ATOM   3514  C  CB  . SER C  1 138 ? 36.746  -4.806  31.071  1.00 1.00   ? 138 SER C CB  1 
ATOM   3515  O  OG  . SER C  1 138 ? 35.547  -5.290  31.634  1.00 36.77  ? 138 SER C OG  1 
ATOM   3516  N  N   . ILE C  1 139 ? 38.313  -5.411  33.663  1.00 1.11   ? 139 ILE C N   1 
ATOM   3517  C  CA  . ILE C  1 139 ? 38.394  -6.013  34.989  1.00 3.68   ? 139 ILE C CA  1 
ATOM   3518  C  C   . ILE C  1 139 ? 38.669  -4.941  36.022  1.00 6.02   ? 139 ILE C C   1 
ATOM   3519  O  O   . ILE C  1 139 ? 38.038  -4.933  37.072  1.00 3.00   ? 139 ILE C O   1 
ATOM   3520  C  CB  . ILE C  1 139 ? 39.483  -7.081  35.008  1.00 5.26   ? 139 ILE C CB  1 
ATOM   3521  C  CG1 . ILE C  1 139 ? 39.000  -8.250  34.177  1.00 4.47   ? 139 ILE C CG1 1 
ATOM   3522  C  CG2 . ILE C  1 139 ? 39.769  -7.514  36.429  1.00 2.06   ? 139 ILE C CG2 1 
ATOM   3523  C  CD1 . ILE C  1 139 ? 40.061  -9.174  33.783  1.00 6.00   ? 139 ILE C CD1 1 
ATOM   3524  N  N   . ASP C  1 140 ? 39.591  -4.051  35.679  1.00 2.12   ? 140 ASP C N   1 
ATOM   3525  C  CA  . ASP C  1 140 ? 39.958  -3.031  36.621  1.00 2.63   ? 140 ASP C CA  1 
ATOM   3526  C  C   . ASP C  1 140 ? 38.786  -2.156  36.979  1.00 7.24   ? 140 ASP C C   1 
ATOM   3527  O  O   . ASP C  1 140 ? 38.679  -1.731  38.127  1.00 9.32   ? 140 ASP C O   1 
ATOM   3528  C  CB  . ASP C  1 140 ? 41.054  -2.135  36.077  1.00 9.86   ? 140 ASP C CB  1 
ATOM   3529  C  CG  . ASP C  1 140 ? 42.446  -2.781  36.086  1.00 20.89  ? 140 ASP C CG  1 
ATOM   3530  O  OD1 . ASP C  1 140 ? 42.659  -3.734  36.852  1.00 11.25  ? 140 ASP C OD1 1 
ATOM   3531  O  OD2 . ASP C  1 140 ? 43.340  -2.296  35.355  1.00 14.97  ? 140 ASP C OD2 1 
ATOM   3532  N  N   . LYS C  1 141 ? 37.937  -1.837  36.018  1.00 5.39   ? 141 LYS C N   1 
ATOM   3533  C  CA  . LYS C  1 141 ? 36.779  -0.991  36.264  1.00 2.43   ? 141 LYS C CA  1 
ATOM   3534  C  C   . LYS C  1 141 ? 35.807  -1.742  37.138  1.00 3.54   ? 141 LYS C C   1 
ATOM   3535  O  O   . LYS C  1 141 ? 35.367  -1.222  38.162  1.00 7.53   ? 141 LYS C O   1 
ATOM   3536  C  CB  . LYS C  1 141 ? 36.131  -0.643  34.943  1.00 4.20   ? 141 LYS C CB  1 
ATOM   3537  C  CG  . LYS C  1 141 ? 34.946  0.305   35.019  1.00 46.31  ? 141 LYS C CG  1 
ATOM   3538  C  CD  . LYS C  1 141 ? 34.262  0.322   33.653  1.00 84.29  ? 141 LYS C CD  1 
ATOM   3539  C  CE  . LYS C  1 141 ? 32.973  1.098   33.647  0.00 100.00 ? 141 LYS C CE  1 
ATOM   3540  N  NZ  . LYS C  1 141 ? 33.144  2.574   33.750  0.00 100.00 ? 141 LYS C NZ  1 
ATOM   3541  N  N   . HIS C  1 142 ? 35.580  -3.017  36.833  1.00 2.68   ? 142 HIS C N   1 
ATOM   3542  C  CA  . HIS C  1 142 ? 34.722  -3.789  37.719  1.00 1.94   ? 142 HIS C CA  1 
ATOM   3543  C  C   . HIS C  1 142 ? 35.243  -3.784  39.132  1.00 5.12   ? 142 HIS C C   1 
ATOM   3544  O  O   . HIS C  1 142 ? 34.497  -3.615  40.096  1.00 5.72   ? 142 HIS C O   1 
ATOM   3545  C  CB  . HIS C  1 142 ? 34.677  -5.251  37.288  1.00 3.83   ? 142 HIS C CB  1 
ATOM   3546  C  CG  . HIS C  1 142 ? 33.898  -5.457  36.032  1.00 6.66   ? 142 HIS C CG  1 
ATOM   3547  N  ND1 . HIS C  1 142 ? 32.648  -4.911  35.851  1.00 8.78   ? 142 HIS C ND1 1 
ATOM   3548  C  CD2 . HIS C  1 142 ? 34.192  -6.133  34.898  1.00 6.46   ? 142 HIS C CD2 1 
ATOM   3549  C  CE1 . HIS C  1 142 ? 32.186  -5.267  34.668  1.00 6.11   ? 142 HIS C CE1 1 
ATOM   3550  N  NE2 . HIS C  1 142 ? 33.100  -6.015  34.077  1.00 7.05   ? 142 HIS C NE2 1 
ATOM   3551  N  N   . ILE C  1 143 ? 36.534  -4.021  39.252  1.00 2.15   ? 143 ILE C N   1 
ATOM   3552  C  CA  . ILE C  1 143 ? 37.106  -4.072  40.589  1.00 4.47   ? 143 ILE C CA  1 
ATOM   3553  C  C   . ILE C  1 143 ? 36.849  -2.761  41.300  1.00 8.47   ? 143 ILE C C   1 
ATOM   3554  O  O   . ILE C  1 143 ? 36.496  -2.744  42.485  1.00 4.02   ? 143 ILE C O   1 
ATOM   3555  C  CB  . ILE C  1 143 ? 38.611  -4.443  40.577  1.00 9.41   ? 143 ILE C CB  1 
ATOM   3556  C  CG1 . ILE C  1 143 ? 38.851  -5.888  40.148  1.00 2.42   ? 143 ILE C CG1 1 
ATOM   3557  C  CG2 . ILE C  1 143 ? 39.300  -4.162  41.908  1.00 7.67   ? 143 ILE C CG2 1 
ATOM   3558  C  CD1 . ILE C  1 143 ? 40.331  -6.090  39.947  1.00 1.09   ? 143 ILE C CD1 1 
ATOM   3559  N  N   . TRP C  1 144 ? 36.970  -1.645  40.600  1.00 2.31   ? 144 TRP C N   1 
ATOM   3560  C  CA  . TRP C  1 144 ? 36.663  -0.408  41.313  1.00 1.00   ? 144 TRP C CA  1 
ATOM   3561  C  C   . TRP C  1 144 ? 35.200  -0.393  41.760  1.00 7.71   ? 144 TRP C C   1 
ATOM   3562  O  O   . TRP C  1 144 ? 34.858  -0.060  42.893  1.00 9.47   ? 144 TRP C O   1 
ATOM   3563  C  CB  . TRP C  1 144 ? 36.951  0.797   40.415  1.00 1.66   ? 144 TRP C CB  1 
ATOM   3564  C  CG  . TRP C  1 144 ? 36.106  2.004   40.709  1.00 5.91   ? 144 TRP C CG  1 
ATOM   3565  C  CD1 . TRP C  1 144 ? 35.986  2.657   41.902  1.00 10.49  ? 144 TRP C CD1 1 
ATOM   3566  C  CD2 . TRP C  1 144 ? 35.275  2.717   39.795  1.00 5.08   ? 144 TRP C CD2 1 
ATOM   3567  N  NE1 . TRP C  1 144 ? 35.140  3.724   41.788  1.00 7.43   ? 144 TRP C NE1 1 
ATOM   3568  C  CE2 . TRP C  1 144 ? 34.661  3.755   40.506  1.00 8.16   ? 144 TRP C CE2 1 
ATOM   3569  C  CE3 . TRP C  1 144 ? 34.949  2.543   38.454  1.00 5.13   ? 144 TRP C CE3 1 
ATOM   3570  C  CZ2 . TRP C  1 144 ? 33.737  4.601   39.943  1.00 5.93   ? 144 TRP C CZ2 1 
ATOM   3571  C  CZ3 . TRP C  1 144 ? 34.092  3.406   37.896  1.00 5.96   ? 144 TRP C CZ3 1 
ATOM   3572  C  CH2 . TRP C  1 144 ? 33.476  4.416   38.632  1.00 6.32   ? 144 TRP C CH2 1 
ATOM   3573  N  N   . MET C  1 145 ? 34.318  -0.824  40.868  1.00 5.30   ? 145 MET C N   1 
ATOM   3574  C  CA  . MET C  1 145 ? 32.908  -0.794  41.200  1.00 2.92   ? 145 MET C CA  1 
ATOM   3575  C  C   . MET C  1 145 ? 32.454  -1.714  42.326  1.00 10.28  ? 145 MET C C   1 
ATOM   3576  O  O   . MET C  1 145 ? 31.681  -1.312  43.207  1.00 7.21   ? 145 MET C O   1 
ATOM   3577  C  CB  . MET C  1 145 ? 32.038  -0.907  39.942  1.00 3.22   ? 145 MET C CB  1 
ATOM   3578  C  CG  . MET C  1 145 ? 32.262  0.233   38.941  1.00 9.00   ? 145 MET C CG  1 
ATOM   3579  S  SD  . MET C  1 145 ? 31.128  0.133   37.550  1.00 10.44  ? 145 MET C SD  1 
ATOM   3580  C  CE  . MET C  1 145 ? 31.685  -1.394  36.802  1.00 19.62  ? 145 MET C CE  1 
ATOM   3581  N  N   . PHE C  1 146 ? 32.912  -2.956  42.294  1.00 4.10   ? 146 PHE C N   1 
ATOM   3582  C  CA  . PHE C  1 146 ? 32.485  -3.882  43.331  1.00 5.54   ? 146 PHE C CA  1 
ATOM   3583  C  C   . PHE C  1 146 ? 33.056  -3.528  44.691  1.00 9.42   ? 146 PHE C C   1 
ATOM   3584  O  O   . PHE C  1 146 ? 32.451  -3.774  45.719  1.00 7.50   ? 146 PHE C O   1 
ATOM   3585  C  CB  . PHE C  1 146 ? 32.652  -5.348  42.935  1.00 6.52   ? 146 PHE C CB  1 
ATOM   3586  C  CG  . PHE C  1 146 ? 31.629  -5.819  41.937  1.00 8.61   ? 146 PHE C CG  1 
ATOM   3587  C  CD1 . PHE C  1 146 ? 30.359  -6.203  42.354  1.00 9.77   ? 146 PHE C CD1 1 
ATOM   3588  C  CD2 . PHE C  1 146 ? 31.902  -5.826  40.577  1.00 9.05   ? 146 PHE C CD2 1 
ATOM   3589  C  CE1 . PHE C  1 146 ? 29.362  -6.595  41.457  1.00 9.01   ? 146 PHE C CE1 1 
ATOM   3590  C  CE2 . PHE C  1 146 ? 30.929  -6.239  39.672  1.00 12.70  ? 146 PHE C CE2 1 
ATOM   3591  C  CZ  . PHE C  1 146 ? 29.641  -6.618  40.102  1.00 10.15  ? 146 PHE C CZ  1 
ATOM   3592  N  N   . LYS C  1 147 ? 34.235  -2.932  44.691  1.00 3.10   ? 147 LYS C N   1 
ATOM   3593  C  CA  . LYS C  1 147 ? 34.848  -2.501  45.930  1.00 2.28   ? 147 LYS C CA  1 
ATOM   3594  C  C   . LYS C  1 147 ? 34.039  -1.334  46.428  1.00 8.80   ? 147 LYS C C   1 
ATOM   3595  O  O   . LYS C  1 147 ? 33.714  -1.301  47.599  1.00 9.41   ? 147 LYS C O   1 
ATOM   3596  C  CB  . LYS C  1 147 ? 36.340  -2.166  45.826  1.00 4.98   ? 147 LYS C CB  1 
ATOM   3597  C  CG  . LYS C  1 147 ? 37.120  -3.472  45.816  1.00 7.52   ? 147 LYS C CG  1 
ATOM   3598  C  CD  . LYS C  1 147 ? 38.390  -3.445  46.655  1.00 26.57  ? 147 LYS C CD  1 
ATOM   3599  C  CE  . LYS C  1 147 ? 38.844  -4.865  46.965  1.00 13.29  ? 147 LYS C CE  1 
ATOM   3600  N  NZ  . LYS C  1 147 ? 40.062  -4.903  47.847  1.00 60.15  ? 147 LYS C NZ  1 
ATOM   3601  N  N   . ALA C  1 148 ? 33.673  -0.403  45.559  1.00 3.86   ? 148 ALA C N   1 
ATOM   3602  C  CA  . ALA C  1 148 ? 32.906  0.723   46.065  1.00 4.15   ? 148 ALA C CA  1 
ATOM   3603  C  C   . ALA C  1 148 ? 31.609  0.251   46.703  1.00 7.05   ? 148 ALA C C   1 
ATOM   3604  O  O   . ALA C  1 148 ? 31.163  0.788   47.696  1.00 5.40   ? 148 ALA C O   1 
ATOM   3605  C  CB  . ALA C  1 148 ? 32.630  1.718   44.941  1.00 3.92   ? 148 ALA C CB  1 
ATOM   3606  N  N   . PHE C  1 149 ? 31.025  -0.774  46.103  1.00 6.06   ? 149 PHE C N   1 
ATOM   3607  C  CA  . PHE C  1 149 ? 29.790  -1.381  46.579  1.00 3.21   ? 149 PHE C CA  1 
ATOM   3608  C  C   . PHE C  1 149 ? 30.051  -1.909  47.991  1.00 14.68  ? 149 PHE C C   1 
ATOM   3609  O  O   . PHE C  1 149 ? 29.269  -1.718  48.918  1.00 12.97  ? 149 PHE C O   1 
ATOM   3610  C  CB  . PHE C  1 149 ? 29.363  -2.537  45.675  1.00 4.05   ? 149 PHE C CB  1 
ATOM   3611  C  CG  . PHE C  1 149 ? 28.248  -3.378  46.255  1.00 7.61   ? 149 PHE C CG  1 
ATOM   3612  C  CD1 . PHE C  1 149 ? 26.910  -2.993  46.168  1.00 6.89   ? 149 PHE C CD1 1 
ATOM   3613  C  CD2 . PHE C  1 149 ? 28.541  -4.553  46.937  1.00 7.57   ? 149 PHE C CD2 1 
ATOM   3614  C  CE1 . PHE C  1 149 ? 25.934  -3.815  46.678  1.00 5.21   ? 149 PHE C CE1 1 
ATOM   3615  C  CE2 . PHE C  1 149 ? 27.553  -5.352  47.478  1.00 7.09   ? 149 PHE C CE2 1 
ATOM   3616  C  CZ  . PHE C  1 149 ? 26.237  -4.995  47.323  1.00 4.93   ? 149 PHE C CZ  1 
ATOM   3617  N  N   . LEU C  1 150 ? 31.156  -2.627  48.142  1.00 12.18  ? 150 LEU C N   1 
ATOM   3618  C  CA  . LEU C  1 150 ? 31.594  -3.122  49.443  1.00 8.44   ? 150 LEU C CA  1 
ATOM   3619  C  C   . LEU C  1 150 ? 32.073  -2.014  50.404  1.00 21.33  ? 150 LEU C C   1 
ATOM   3620  O  O   . LEU C  1 150 ? 32.462  -2.270  51.520  1.00 19.52  ? 150 LEU C O   1 
ATOM   3621  C  CB  . LEU C  1 150 ? 32.710  -4.133  49.200  1.00 2.62   ? 150 LEU C CB  1 
ATOM   3622  C  CG  . LEU C  1 150 ? 32.186  -5.375  48.493  1.00 8.19   ? 150 LEU C CG  1 
ATOM   3623  C  CD1 . LEU C  1 150 ? 33.357  -6.225  48.098  1.00 8.81   ? 150 LEU C CD1 1 
ATOM   3624  C  CD2 . LEU C  1 150 ? 31.364  -6.182  49.481  1.00 6.83   ? 150 LEU C CD2 1 
ATOM   3625  N  N   . GLY C  1 151 ? 32.077  -0.750  50.003  1.00 14.15  ? 151 GLY C N   1 
ATOM   3626  C  CA  . GLY C  1 151 ? 32.544  0.307   50.895  1.00 9.99   ? 151 GLY C CA  1 
ATOM   3627  C  C   . GLY C  1 151 ? 34.059  0.528   50.916  1.00 17.28  ? 151 GLY C C   1 
ATOM   3628  O  O   . GLY C  1 151 ? 34.562  1.301   51.729  1.00 23.85  ? 151 GLY C O   1 
ATOM   3629  N  N   . LYS C  1 152 ? 34.781  -0.168  50.043  1.00 15.76  ? 152 LYS C N   1 
ATOM   3630  C  CA  . LYS C  1 152 ? 36.236  -0.098  49.998  1.00 9.28   ? 152 LYS C CA  1 
ATOM   3631  C  C   . LYS C  1 152 ? 36.816  0.690   48.820  1.00 16.46  ? 152 LYS C C   1 
ATOM   3632  O  O   . LYS C  1 152 ? 36.149  0.948   47.833  1.00 14.94  ? 152 LYS C O   1 
ATOM   3633  C  CB  . LYS C  1 152 ? 36.773  -1.532  49.986  1.00 14.12  ? 152 LYS C CB  1 
ATOM   3634  C  CG  . LYS C  1 152 ? 36.390  -2.407  51.157  1.00 62.67  ? 152 LYS C CG  1 
ATOM   3635  C  CD  . LYS C  1 152 ? 36.860  -1.684  52.407  0.00 100.00 ? 152 LYS C CD  1 
ATOM   3636  C  CE  . LYS C  1 152 ? 36.386  -2.306  53.702  0.00 100.00 ? 152 LYS C CE  1 
ATOM   3637  N  NZ  . LYS C  1 152 ? 36.753  -1.486  54.871  0.00 100.00 ? 152 LYS C NZ  1 
ATOM   3638  N  N   . ALA C  1 153 ? 38.094  1.035   48.911  1.00 16.19  ? 153 ALA C N   1 
ATOM   3639  C  CA  . ALA C  1 153 ? 38.819  1.682   47.818  1.00 10.47  ? 153 ALA C CA  1 
ATOM   3640  C  C   . ALA C  1 153 ? 39.258  0.492   46.951  1.00 14.99  ? 153 ALA C C   1 
ATOM   3641  O  O   . ALA C  1 153 ? 39.336  -0.656  47.409  1.00 10.87  ? 153 ALA C O   1 
ATOM   3642  C  CB  . ALA C  1 153 ? 40.012  2.470   48.351  1.00 7.27   ? 153 ALA C CB  1 
ATOM   3643  N  N   . PRO C  1 154 ? 39.515  0.780   45.677  1.00 14.25  ? 154 PRO C N   1 
ATOM   3644  C  CA  . PRO C  1 154 ? 39.792  -0.265  44.709  1.00 9.52   ? 154 PRO C CA  1 
ATOM   3645  C  C   . PRO C  1 154 ? 40.955  -1.166  45.010  1.00 14.15  ? 154 PRO C C   1 
ATOM   3646  O  O   . PRO C  1 154 ? 40.897  -2.389  44.826  1.00 17.54  ? 154 PRO C O   1 
ATOM   3647  C  CB  . PRO C  1 154 ? 40.065  0.490   43.423  1.00 10.72  ? 154 PRO C CB  1 
ATOM   3648  C  CG  . PRO C  1 154 ? 39.466  1.823   43.628  1.00 12.55  ? 154 PRO C CG  1 
ATOM   3649  C  CD  . PRO C  1 154 ? 39.578  2.122   45.081  1.00 10.47  ? 154 PRO C CD  1 
ATOM   3650  N  N   . LEU C  1 155 ? 42.060  -0.510  45.350  1.00 19.10  ? 155 LEU C N   1 
ATOM   3651  C  CA  . LEU C  1 155 ? 43.279  -1.258  45.640  1.00 19.65  ? 155 LEU C CA  1 
ATOM   3652  C  C   . LEU C  1 155 ? 43.349  -1.630  47.123  1.00 43.89  ? 155 LEU C C   1 
ATOM   3653  O  O   . LEU C  1 155 ? 44.340  -2.191  47.585  1.00 35.81  ? 155 LEU C O   1 
ATOM   3654  C  CB  . LEU C  1 155 ? 44.492  -0.533  45.048  1.00 19.06  ? 155 LEU C CB  1 
ATOM   3655  C  CG  . LEU C  1 155 ? 44.250  -0.258  43.558  1.00 27.41  ? 155 LEU C CG  1 
ATOM   3656  C  CD1 . LEU C  1 155 ? 45.410  0.465   42.925  1.00 22.97  ? 155 LEU C CD1 1 
ATOM   3657  C  CD2 . LEU C  1 155 ? 43.925  -1.528  42.795  1.00 18.59  ? 155 LEU C CD2 1 
ATOM   3658  N  N   . GLU C  1 156 ? 42.261  -1.328  47.832  1.00 35.60  ? 156 GLU C N   1 
ATOM   3659  C  CA  . GLU C  1 156 ? 42.093  -1.589  49.254  1.00 40.26  ? 156 GLU C CA  1 
ATOM   3660  C  C   . GLU C  1 156 ? 42.042  -3.094  49.450  0.00 100.00 ? 156 GLU C C   1 
ATOM   3661  O  O   . GLU C  1 156 ? 41.249  -3.601  50.278  0.00 100.00 ? 156 GLU C O   1 
ATOM   3662  C  CB  . GLU C  1 156 ? 40.772  -0.989  49.733  1.00 31.33  ? 156 GLU C CB  1 
ATOM   3663  C  CG  . GLU C  1 156 ? 40.797  -0.241  51.081  1.00 78.17  ? 156 GLU C CG  1 
ATOM   3664  C  CD  . GLU C  1 156 ? 41.368  1.146   51.002  0.00 100.00 ? 156 GLU C CD  1 
ATOM   3665  O  OE1 . GLU C  1 156 ? 42.432  1.312   50.430  0.00 100.00 ? 156 GLU C OE1 1 
ATOM   3666  O  OE2 . GLU C  1 156 ? 40.699  2.100   51.494  0.00 100.00 ? 156 GLU C OE2 1 
ATOM   3667  N  N   . VAL D  1 7   ? 1.856   19.117  -25.462 1.00 75.60  ? 7   VAL D N   1 
ATOM   3668  C  CA  . VAL D  1 7   ? 2.745   20.135  -24.917 1.00 73.91  ? 7   VAL D CA  1 
ATOM   3669  C  C   . VAL D  1 7   ? 4.152   19.551  -24.810 1.00 67.73  ? 7   VAL D C   1 
ATOM   3670  O  O   . VAL D  1 7   ? 4.584   18.790  -25.664 1.00 76.75  ? 7   VAL D O   1 
ATOM   3671  C  CB  . VAL D  1 7   ? 2.309   20.455  -23.481 1.00 76.88  ? 7   VAL D CB  1 
ATOM   3672  C  CG1 . VAL D  1 7   ? 2.777   21.823  -23.029 1.00 74.70  ? 7   VAL D CG1 1 
ATOM   3673  C  CG2 . VAL D  1 7   ? 0.811   20.240  -23.312 1.00 78.50  ? 7   VAL D CG2 1 
ATOM   3674  N  N   . ASP D  1 8   ? 4.867   19.881  -23.744 1.00 37.83  ? 8   ASP D N   1 
ATOM   3675  C  CA  . ASP D  1 8   ? 6.201   19.340  -23.534 1.00 29.09  ? 8   ASP D CA  1 
ATOM   3676  C  C   . ASP D  1 8   ? 6.366   18.834  -22.103 1.00 15.73  ? 8   ASP D C   1 
ATOM   3677  O  O   . ASP D  1 8   ? 5.576   19.130  -21.215 1.00 12.24  ? 8   ASP D O   1 
ATOM   3678  C  CB  . ASP D  1 8   ? 7.365   20.217  -24.034 1.00 25.73  ? 8   ASP D CB  1 
ATOM   3679  C  CG  . ASP D  1 8   ? 7.792   21.262  -23.033 1.00 34.50  ? 8   ASP D CG  1 
ATOM   3680  O  OD1 . ASP D  1 8   ? 7.128   21.455  -21.982 1.00 44.51  ? 8   ASP D OD1 1 
ATOM   3681  O  OD2 . ASP D  1 8   ? 8.846   21.885  -23.264 1.00 46.66  ? 8   ASP D OD2 1 
ATOM   3682  N  N   . THR D  1 9   ? 7.375   18.014  -21.893 1.00 8.88   ? 9   THR D N   1 
ATOM   3683  C  CA  . THR D  1 9   ? 7.600   17.472  -20.572 1.00 10.80  ? 9   THR D CA  1 
ATOM   3684  C  C   . THR D  1 9   ? 7.729   18.555  -19.527 1.00 11.35  ? 9   THR D C   1 
ATOM   3685  O  O   . THR D  1 9   ? 7.035   18.487  -18.514 1.00 10.00  ? 9   THR D O   1 
ATOM   3686  C  CB  . THR D  1 9   ? 8.852   16.618  -20.587 1.00 19.04  ? 9   THR D CB  1 
ATOM   3687  O  OG1 . THR D  1 9   ? 8.622   15.588  -21.568 1.00 15.85  ? 9   THR D OG1 1 
ATOM   3688  C  CG2 . THR D  1 9   ? 9.037   16.007  -19.211 1.00 16.76  ? 9   THR D CG2 1 
ATOM   3689  N  N   . LYS D  1 10  ? 8.536   19.576  -19.767 1.00 2.20   ? 10  LYS D N   1 
ATOM   3690  C  CA  . LYS D  1 10  ? 8.567   20.566  -18.692 1.00 5.55   ? 10  LYS D CA  1 
ATOM   3691  C  C   . LYS D  1 10  ? 7.208   21.171  -18.392 1.00 13.56  ? 10  LYS D C   1 
ATOM   3692  O  O   . LYS D  1 10  ? 6.802   21.318  -17.245 1.00 20.97  ? 10  LYS D O   1 
ATOM   3693  C  CB  . LYS D  1 10  ? 9.535   21.699  -19.007 1.00 3.79   ? 10  LYS D CB  1 
ATOM   3694  C  CG  . LYS D  1 10  ? 10.923  21.196  -19.328 1.00 5.33   ? 10  LYS D CG  1 
ATOM   3695  C  CD  . LYS D  1 10  ? 11.841  22.413  -19.411 1.00 11.39  ? 10  LYS D CD  1 
ATOM   3696  C  CE  . LYS D  1 10  ? 13.160  22.091  -20.095 1.00 56.34  ? 10  LYS D CE  1 
ATOM   3697  N  NZ  . LYS D  1 10  ? 13.993  23.285  -20.407 1.00 93.66  ? 10  LYS D NZ  1 
ATOM   3698  N  N   . GLU D  1 11  ? 6.458   21.473  -19.436 1.00 9.58   ? 11  GLU D N   1 
ATOM   3699  C  CA  . GLU D  1 11  ? 5.172   22.030  -19.102 1.00 13.86  ? 11  GLU D CA  1 
ATOM   3700  C  C   . GLU D  1 11  ? 4.317   21.025  -18.355 1.00 10.97  ? 11  GLU D C   1 
ATOM   3701  O  O   . GLU D  1 11  ? 3.501   21.397  -17.505 1.00 10.02  ? 11  GLU D O   1 
ATOM   3702  C  CB  . GLU D  1 11  ? 4.408   22.500  -20.348 1.00 19.51  ? 11  GLU D CB  1 
ATOM   3703  C  CG  . GLU D  1 11  ? 4.668   23.937  -20.824 1.00 73.02  ? 11  GLU D CG  1 
ATOM   3704  C  CD  . GLU D  1 11  ? 6.137   24.290  -21.006 0.00 100.00 ? 11  GLU D CD  1 
ATOM   3705  O  OE1 . GLU D  1 11  ? 6.897   24.247  -20.021 0.00 100.00 ? 11  GLU D OE1 1 
ATOM   3706  O  OE2 . GLU D  1 11  ? 6.511   24.642  -22.138 0.00 100.00 ? 11  GLU D OE2 1 
ATOM   3707  N  N   . PHE D  1 12  ? 4.404   19.766  -18.773 1.00 4.30   ? 12  PHE D N   1 
ATOM   3708  C  CA  . PHE D  1 12  ? 3.544   18.760  -18.170 1.00 2.55   ? 12  PHE D CA  1 
ATOM   3709  C  C   . PHE D  1 12  ? 3.872   18.632  -16.674 1.00 8.46   ? 12  PHE D C   1 
ATOM   3710  O  O   . PHE D  1 12  ? 2.975   18.634  -15.799 1.00 7.34   ? 12  PHE D O   1 
ATOM   3711  C  CB  . PHE D  1 12  ? 3.740   17.404  -18.841 1.00 5.90   ? 12  PHE D CB  1 
ATOM   3712  C  CG  . PHE D  1 12  ? 3.039   16.300  -18.086 1.00 11.60  ? 12  PHE D CG  1 
ATOM   3713  C  CD1 . PHE D  1 12  ? 1.701   16.025  -18.303 1.00 11.52  ? 12  PHE D CD1 1 
ATOM   3714  C  CD2 . PHE D  1 12  ? 3.677   15.614  -17.068 1.00 17.63  ? 12  PHE D CD2 1 
ATOM   3715  C  CE1 . PHE D  1 12  ? 1.009   15.055  -17.567 1.00 12.61  ? 12  PHE D CE1 1 
ATOM   3716  C  CE2 . PHE D  1 12  ? 2.999   14.635  -16.354 1.00 13.83  ? 12  PHE D CE2 1 
ATOM   3717  C  CZ  . PHE D  1 12  ? 1.658   14.354  -16.601 1.00 13.22  ? 12  PHE D CZ  1 
ATOM   3718  N  N   . LEU D  1 13  ? 5.180   18.506  -16.434 1.00 3.25   ? 13  LEU D N   1 
ATOM   3719  C  CA  . LEU D  1 13  ? 5.596   18.395  -15.049 1.00 3.33   ? 13  LEU D CA  1 
ATOM   3720  C  C   . LEU D  1 13  ? 5.062   19.564  -14.215 1.00 7.81   ? 13  LEU D C   1 
ATOM   3721  O  O   . LEU D  1 13  ? 4.386   19.380  -13.190 1.00 11.90  ? 13  LEU D O   1 
ATOM   3722  C  CB  . LEU D  1 13  ? 7.118   18.317  -15.060 1.00 2.71   ? 13  LEU D CB  1 
ATOM   3723  C  CG  . LEU D  1 13  ? 7.649   16.899  -14.902 1.00 7.78   ? 13  LEU D CG  1 
ATOM   3724  C  CD1 . LEU D  1 13  ? 6.715   15.786  -15.242 1.00 1.02   ? 13  LEU D CD1 1 
ATOM   3725  C  CD2 . LEU D  1 13  ? 9.029   16.782  -15.543 1.00 1.00   ? 13  LEU D CD2 1 
ATOM   3726  N  N   . ASN D  1 14  ? 5.307   20.777  -14.685 1.00 3.58   ? 14  ASN D N   1 
ATOM   3727  C  CA  . ASN D  1 14  ? 4.948   21.918  -13.870 1.00 6.29   ? 14  ASN D CA  1 
ATOM   3728  C  C   . ASN D  1 14  ? 3.451   21.911  -13.632 1.00 10.74  ? 14  ASN D C   1 
ATOM   3729  O  O   . ASN D  1 14  ? 2.918   22.293  -12.578 1.00 12.15  ? 14  ASN D O   1 
ATOM   3730  C  CB  . ASN D  1 14  ? 5.421   23.215  -14.547 1.00 4.33   ? 14  ASN D CB  1 
ATOM   3731  C  CG  . ASN D  1 14  ? 5.913   24.241  -13.528 1.00 21.48  ? 14  ASN D CG  1 
ATOM   3732  O  OD1 . ASN D  1 14  ? 5.931   23.953  -12.336 1.00 13.89  ? 14  ASN D OD1 1 
ATOM   3733  N  ND2 . ASN D  1 14  ? 6.335   25.419  -13.985 1.00 12.80  ? 14  ASN D ND2 1 
ATOM   3734  N  N   . HIS D  1 15  ? 2.750   21.416  -14.631 1.00 6.09   ? 15  HIS D N   1 
ATOM   3735  C  CA  . HIS D  1 15  ? 1.308   21.443  -14.435 1.00 6.93   ? 15  HIS D CA  1 
ATOM   3736  C  C   . HIS D  1 15  ? 0.980   20.499  -13.278 1.00 8.07   ? 15  HIS D C   1 
ATOM   3737  O  O   . HIS D  1 15  ? -0.017  20.698  -12.593 1.00 10.48  ? 15  HIS D O   1 
ATOM   3738  C  CB  . HIS D  1 15  ? 0.566   21.024  -15.730 1.00 9.81   ? 15  HIS D CB  1 
ATOM   3739  C  CG  . HIS D  1 15  ? -0.923  20.981  -15.593 1.00 18.20  ? 15  HIS D CG  1 
ATOM   3740  N  ND1 . HIS D  1 15  ? -1.656  19.811  -15.631 1.00 25.29  ? 15  HIS D ND1 1 
ATOM   3741  C  CD2 . HIS D  1 15  ? -1.829  21.969  -15.403 1.00 19.15  ? 15  HIS D CD2 1 
ATOM   3742  C  CE1 . HIS D  1 15  ? -2.945  20.074  -15.473 1.00 22.77  ? 15  HIS D CE1 1 
ATOM   3743  N  NE2 . HIS D  1 15  ? -3.075  21.382  -15.321 1.00 22.13  ? 15  HIS D NE2 1 
ATOM   3744  N  N   . GLN D  1 16  ? 1.769   19.440  -13.113 1.00 3.99   ? 16  GLN D N   1 
ATOM   3745  C  CA  . GLN D  1 16  ? 1.523   18.473  -12.037 1.00 3.98   ? 16  GLN D CA  1 
ATOM   3746  C  C   . GLN D  1 16  ? 1.911   19.056  -10.700 1.00 7.80   ? 16  GLN D C   1 
ATOM   3747  O  O   . GLN D  1 16  ? 1.256   18.824  -9.705  1.00 8.19   ? 16  GLN D O   1 
ATOM   3748  C  CB  . GLN D  1 16  ? 2.139   17.086  -12.257 1.00 1.44   ? 16  GLN D CB  1 
ATOM   3749  C  CG  . GLN D  1 16  ? 1.584   16.499  -13.548 1.00 8.84   ? 16  GLN D CG  1 
ATOM   3750  C  CD  . GLN D  1 16  ? 0.059   16.505  -13.579 1.00 18.65  ? 16  GLN D CD  1 
ATOM   3751  O  OE1 . GLN D  1 16  ? -0.580  16.387  -12.529 1.00 6.50   ? 16  GLN D OE1 1 
ATOM   3752  N  NE2 . GLN D  1 16  ? -0.518  16.592  -14.780 1.00 12.57  ? 16  GLN D NE2 1 
ATOM   3753  N  N   . VAL D  1 17  ? 2.923   19.914  -10.726 1.00 2.32   ? 17  VAL D N   1 
ATOM   3754  C  CA  . VAL D  1 17  ? 3.290   20.587  -9.485  1.00 2.46   ? 17  VAL D CA  1 
ATOM   3755  C  C   . VAL D  1 17  ? 2.074   21.366  -8.947  1.00 6.64   ? 17  VAL D C   1 
ATOM   3756  O  O   . VAL D  1 17  ? 1.686   21.303  -7.767  1.00 9.66   ? 17  VAL D O   1 
ATOM   3757  C  CB  . VAL D  1 17  ? 4.490   21.538  -9.645  1.00 1.78   ? 17  VAL D CB  1 
ATOM   3758  C  CG1 . VAL D  1 17  ? 4.683   22.312  -8.337  1.00 1.46   ? 17  VAL D CG1 1 
ATOM   3759  C  CG2 . VAL D  1 17  ? 5.731   20.747  -10.042 1.00 1.00   ? 17  VAL D CG2 1 
ATOM   3760  N  N   . ALA D  1 18  ? 1.424   22.074  -9.860  1.00 5.76   ? 18  ALA D N   1 
ATOM   3761  C  CA  . ALA D  1 18  ? 0.278   22.860  -9.440  1.00 4.08   ? 18  ALA D CA  1 
ATOM   3762  C  C   . ALA D  1 18  ? -0.784  21.875  -8.976  1.00 4.56   ? 18  ALA D C   1 
ATOM   3763  O  O   . ALA D  1 18  ? -1.368  22.042  -7.898  1.00 8.81   ? 18  ALA D O   1 
ATOM   3764  C  CB  . ALA D  1 18  ? -0.199  23.670  -10.643 1.00 2.46   ? 18  ALA D CB  1 
ATOM   3765  N  N   . ASN D  1 19  ? -1.070  20.854  -9.777  1.00 2.09   ? 19  ASN D N   1 
ATOM   3766  C  CA  . ASN D  1 19  ? -2.138  19.943  -9.375  1.00 2.64   ? 19  ASN D CA  1 
ATOM   3767  C  C   . ASN D  1 19  ? -1.922  19.295  -8.012  1.00 9.88   ? 19  ASN D C   1 
ATOM   3768  O  O   . ASN D  1 19  ? -2.861  19.105  -7.219  1.00 10.56  ? 19  ASN D O   1 
ATOM   3769  C  CB  . ASN D  1 19  ? -2.327  18.783  -10.365 1.00 4.52   ? 19  ASN D CB  1 
ATOM   3770  C  CG  . ASN D  1 19  ? -3.083  19.174  -11.639 1.00 15.72  ? 19  ASN D CG  1 
ATOM   3771  O  OD1 . ASN D  1 19  ? -3.818  20.171  -11.669 1.00 10.44  ? 19  ASN D OD1 1 
ATOM   3772  N  ND2 . ASN D  1 19  ? -2.980  18.327  -12.665 1.00 4.76   ? 19  ASN D ND2 1 
ATOM   3773  N  N   . LEU D  1 20  ? -0.690  18.841  -7.817  1.00 10.48  ? 20  LEU D N   1 
ATOM   3774  C  CA  . LEU D  1 20  ? -0.302  18.116  -6.620  1.00 7.39   ? 20  LEU D CA  1 
ATOM   3775  C  C   . LEU D  1 20  ? -0.474  19.015  -5.420  1.00 8.29   ? 20  LEU D C   1 
ATOM   3776  O  O   . LEU D  1 20  ? -1.041  18.609  -4.417  1.00 7.21   ? 20  LEU D O   1 
ATOM   3777  C  CB  . LEU D  1 20  ? 1.116   17.618  -6.822  1.00 4.53   ? 20  LEU D CB  1 
ATOM   3778  C  CG  . LEU D  1 20  ? 1.226   16.132  -7.185  1.00 4.21   ? 20  LEU D CG  1 
ATOM   3779  C  CD1 . LEU D  1 20  ? -0.023  15.331  -7.385  1.00 2.36   ? 20  LEU D CD1 1 
ATOM   3780  C  CD2 . LEU D  1 20  ? 2.289   15.756  -8.213  1.00 1.16   ? 20  LEU D CD2 1 
ATOM   3781  N  N   . ASN D  1 21  ? -0.117  20.285  -5.558  1.00 1.00   ? 21  ASN D N   1 
ATOM   3782  C  CA  . ASN D  1 21  ? -0.353  21.188  -4.442  1.00 1.16   ? 21  ASN D CA  1 
ATOM   3783  C  C   . ASN D  1 21  ? -1.831  21.418  -4.101  1.00 9.32   ? 21  ASN D C   1 
ATOM   3784  O  O   . ASN D  1 21  ? -2.162  21.672  -2.939  1.00 13.94  ? 21  ASN D O   1 
ATOM   3785  C  CB  . ASN D  1 21  ? 0.353   22.516  -4.676  1.00 6.53   ? 21  ASN D CB  1 
ATOM   3786  C  CG  . ASN D  1 21  ? 1.777   22.463  -4.235  1.00 21.08  ? 21  ASN D CG  1 
ATOM   3787  O  OD1 . ASN D  1 21  ? 2.067   22.623  -3.044  1.00 16.50  ? 21  ASN D OD1 1 
ATOM   3788  N  ND2 . ASN D  1 21  ? 2.649   22.063  -5.157  1.00 12.06  ? 21  ASN D ND2 1 
ATOM   3789  N  N   . VAL D  1 22  ? -2.725  21.351  -5.089  1.00 9.63   ? 22  VAL D N   1 
ATOM   3790  C  CA  . VAL D  1 22  ? -4.142  21.570  -4.835  1.00 5.70   ? 22  VAL D CA  1 
ATOM   3791  C  C   . VAL D  1 22  ? -4.697  20.319  -4.201  1.00 5.37   ? 22  VAL D C   1 
ATOM   3792  O  O   . VAL D  1 22  ? -5.515  20.339  -3.286  1.00 5.53   ? 22  VAL D O   1 
ATOM   3793  C  CB  . VAL D  1 22  ? -4.926  21.898  -6.114  1.00 5.68   ? 22  VAL D CB  1 
ATOM   3794  C  CG1 . VAL D  1 22  ? -6.419  22.052  -5.832  1.00 7.10   ? 22  VAL D CG1 1 
ATOM   3795  C  CG2 . VAL D  1 22  ? -4.437  23.238  -6.626  1.00 3.07   ? 22  VAL D CG2 1 
ATOM   3796  N  N   . PHE D  1 23  ? -4.199  19.197  -4.677  1.00 1.17   ? 23  PHE D N   1 
ATOM   3797  C  CA  . PHE D  1 23  ? -4.694  17.908  -4.193  1.00 1.42   ? 23  PHE D CA  1 
ATOM   3798  C  C   . PHE D  1 23  ? -4.370  17.743  -2.737  1.00 8.47   ? 23  PHE D C   1 
ATOM   3799  O  O   . PHE D  1 23  ? -5.155  17.300  -1.915  1.00 9.34   ? 23  PHE D O   1 
ATOM   3800  C  CB  . PHE D  1 23  ? -4.053  16.780  -4.982  1.00 2.15   ? 23  PHE D CB  1 
ATOM   3801  C  CG  . PHE D  1 23  ? -4.594  15.429  -4.635  1.00 4.94   ? 23  PHE D CG  1 
ATOM   3802  C  CD1 . PHE D  1 23  ? -5.912  15.264  -4.275  1.00 10.46  ? 23  PHE D CD1 1 
ATOM   3803  C  CD2 . PHE D  1 23  ? -3.808  14.297  -4.787  1.00 5.45   ? 23  PHE D CD2 1 
ATOM   3804  C  CE1 . PHE D  1 23  ? -6.422  13.990  -4.002  1.00 7.24   ? 23  PHE D CE1 1 
ATOM   3805  C  CE2 . PHE D  1 23  ? -4.313  13.045  -4.468  1.00 3.16   ? 23  PHE D CE2 1 
ATOM   3806  C  CZ  . PHE D  1 23  ? -5.621  12.877  -4.086  1.00 1.02   ? 23  PHE D CZ  1 
ATOM   3807  N  N   . THR D  1 24  ? -3.166  18.168  -2.415  1.00 2.22   ? 24  THR D N   1 
ATOM   3808  C  CA  . THR D  1 24  ? -2.677  18.037  -1.058  1.00 1.79   ? 24  THR D CA  1 
ATOM   3809  C  C   . THR D  1 24  ? -3.542  18.784  -0.048  1.00 10.05  ? 24  THR D C   1 
ATOM   3810  O  O   . THR D  1 24  ? -3.959  18.250  0.990   1.00 4.42   ? 24  THR D O   1 
ATOM   3811  C  CB  . THR D  1 24  ? -1.179  18.356  -1.109  1.00 6.45   ? 24  THR D CB  1 
ATOM   3812  O  OG1 . THR D  1 24  ? -0.452  17.421  -0.314  1.00 37.53  ? 24  THR D OG1 1 
ATOM   3813  C  CG2 . THR D  1 24  ? -0.828  19.783  -0.808  1.00 1.81   ? 24  THR D CG2 1 
ATOM   3814  N  N   . VAL D  1 25  ? -3.924  19.997  -0.440  1.00 6.17   ? 25  VAL D N   1 
ATOM   3815  C  CA  . VAL D  1 25  ? -4.779  20.807  0.417   1.00 2.30   ? 25  VAL D CA  1 
ATOM   3816  C  C   . VAL D  1 25  ? -6.163  20.171  0.486   1.00 7.11   ? 25  VAL D C   1 
ATOM   3817  O  O   . VAL D  1 25  ? -6.863  20.144  1.497   1.00 4.76   ? 25  VAL D O   1 
ATOM   3818  C  CB  . VAL D  1 25  ? -4.809  22.242  -0.122  1.00 6.96   ? 25  VAL D CB  1 
ATOM   3819  C  CG1 . VAL D  1 25  ? -5.766  23.105  0.701   1.00 5.76   ? 25  VAL D CG1 1 
ATOM   3820  C  CG2 . VAL D  1 25  ? -3.396  22.786  -0.044  1.00 1.63   ? 25  VAL D CG2 1 
ATOM   3821  N  N   . LYS D  1 26  ? -6.561  19.563  -0.605  1.00 1.00   ? 26  LYS D N   1 
ATOM   3822  C  CA  . LYS D  1 26  ? -7.874  18.994  -0.498  1.00 1.81   ? 26  LYS D CA  1 
ATOM   3823  C  C   . LYS D  1 26  ? -7.867  17.829  0.464   1.00 6.27   ? 26  LYS D C   1 
ATOM   3824  O  O   . LYS D  1 26  ? -8.876  17.582  1.153   1.00 8.55   ? 26  LYS D O   1 
ATOM   3825  C  CB  . LYS D  1 26  ? -8.266  18.512  -1.885  1.00 3.92   ? 26  LYS D CB  1 
ATOM   3826  C  CG  . LYS D  1 26  ? -9.602  17.785  -1.971  1.00 14.21  ? 26  LYS D CG  1 
ATOM   3827  C  CD  . LYS D  1 26  ? -9.820  17.200  -3.382  1.00 29.93  ? 26  LYS D CD  1 
ATOM   3828  C  CE  . LYS D  1 26  ? -10.046 18.246  -4.473  1.00 14.21  ? 26  LYS D CE  1 
ATOM   3829  N  NZ  . LYS D  1 26  ? -11.383 18.922  -4.380  1.00 36.10  ? 26  LYS D NZ  1 
ATOM   3830  N  N   . ILE D  1 27  ? -6.764  17.085  0.477   1.00 2.78   ? 27  ILE D N   1 
ATOM   3831  C  CA  . ILE D  1 27  ? -6.634  15.921  1.356   1.00 1.53   ? 27  ILE D CA  1 
ATOM   3832  C  C   . ILE D  1 27  ? -6.765  16.444  2.776   1.00 4.08   ? 27  ILE D C   1 
ATOM   3833  O  O   . ILE D  1 27  ? -7.524  15.945  3.598   1.00 7.52   ? 27  ILE D O   1 
ATOM   3834  C  CB  . ILE D  1 27  ? -5.272  15.222  1.140   1.00 3.20   ? 27  ILE D CB  1 
ATOM   3835  C  CG1 . ILE D  1 27  ? -5.252  14.559  -0.263  1.00 2.50   ? 27  ILE D CG1 1 
ATOM   3836  C  CG2 . ILE D  1 27  ? -5.063  14.139  2.216   1.00 1.61   ? 27  ILE D CG2 1 
ATOM   3837  C  CD1 . ILE D  1 27  ? -3.897  14.002  -0.760  1.00 2.17   ? 27  ILE D CD1 1 
ATOM   3838  N  N   . HIS D  1 28  ? -6.095  17.540  3.073   1.00 1.15   ? 28  HIS D N   1 
ATOM   3839  C  CA  . HIS D  1 28  ? -6.260  18.087  4.406   1.00 1.95   ? 28  HIS D CA  1 
ATOM   3840  C  C   . HIS D  1 28  ? -7.687  18.494  4.690   1.00 8.89   ? 28  HIS D C   1 
ATOM   3841  O  O   . HIS D  1 28  ? -8.168  18.362  5.826   1.00 7.72   ? 28  HIS D O   1 
ATOM   3842  C  CB  . HIS D  1 28  ? -5.395  19.340  4.564   1.00 5.78   ? 28  HIS D CB  1 
ATOM   3843  C  CG  . HIS D  1 28  ? -4.045  19.088  5.144   1.00 11.21  ? 28  HIS D CG  1 
ATOM   3844  N  ND1 . HIS D  1 28  ? -3.782  18.023  5.977   1.00 16.80  ? 28  HIS D ND1 1 
ATOM   3845  C  CD2 . HIS D  1 28  ? -2.953  19.884  5.184   1.00 11.84  ? 28  HIS D CD2 1 
ATOM   3846  C  CE1 . HIS D  1 28  ? -2.531  18.100  6.385   1.00 17.05  ? 28  HIS D CE1 1 
ATOM   3847  N  NE2 . HIS D  1 28  ? -2.012  19.227  5.933   1.00 14.90  ? 28  HIS D NE2 1 
ATOM   3848  N  N   . GLN D  1 29  ? -8.379  18.994  3.673   1.00 4.84   ? 29  GLN D N   1 
ATOM   3849  C  CA  . GLN D  1 29  ? -9.741  19.426  3.943   1.00 4.54   ? 29  GLN D CA  1 
ATOM   3850  C  C   . GLN D  1 29  ? -10.582 18.257  4.390   1.00 7.89   ? 29  GLN D C   1 
ATOM   3851  O  O   . GLN D  1 29  ? -11.356 18.332  5.366   1.00 6.25   ? 29  GLN D O   1 
ATOM   3852  C  CB  . GLN D  1 29  ? -10.375 19.987  2.668   1.00 8.08   ? 29  GLN D CB  1 
ATOM   3853  C  CG  . GLN D  1 29  ? -11.894 20.153  2.706   1.00 10.93  ? 29  GLN D CG  1 
ATOM   3854  C  CD  . GLN D  1 29  ? -12.403 20.870  1.461   1.00 17.15  ? 29  GLN D CD  1 
ATOM   3855  O  OE1 . GLN D  1 29  ? -12.136 22.058  1.285   1.00 13.52  ? 29  GLN D OE1 1 
ATOM   3856  N  NE2 . GLN D  1 29  ? -13.032 20.147  0.545   1.00 9.40   ? 29  GLN D NE2 1 
ATOM   3857  N  N   . ILE D  1 30  ? -10.429 17.164  3.651   1.00 3.78   ? 30  ILE D N   1 
ATOM   3858  C  CA  . ILE D  1 30  ? -11.191 15.960  3.962   1.00 1.48   ? 30  ILE D CA  1 
ATOM   3859  C  C   . ILE D  1 30  ? -10.867 15.467  5.371   1.00 6.19   ? 30  ILE D C   1 
ATOM   3860  O  O   . ILE D  1 30  ? -11.762 15.105  6.147   1.00 6.96   ? 30  ILE D O   1 
ATOM   3861  C  CB  . ILE D  1 30  ? -10.818 14.864  2.951   1.00 6.47   ? 30  ILE D CB  1 
ATOM   3862  C  CG1 . ILE D  1 30  ? -11.194 15.293  1.528   1.00 9.91   ? 30  ILE D CG1 1 
ATOM   3863  C  CG2 . ILE D  1 30  ? -11.521 13.533  3.232   1.00 1.20   ? 30  ILE D CG2 1 
ATOM   3864  C  CD1 . ILE D  1 30  ? -10.825 14.273  0.461   1.00 13.79  ? 30  ILE D CD1 1 
ATOM   3865  N  N   . HIS D  1 31  ? -9.591  15.487  5.617   1.00 3.91   ? 31  HIS D N   1 
ATOM   3866  C  CA  . HIS D  1 31  ? -8.962  15.029  6.853   1.00 2.17   ? 31  HIS D CA  1 
ATOM   3867  C  C   . HIS D  1 31  ? -9.500  15.783  8.078   1.00 11.66  ? 31  HIS D C   1 
ATOM   3868  O  O   . HIS D  1 31  ? -9.736  15.194  9.146   1.00 5.00   ? 31  HIS D O   1 
ATOM   3869  C  CB  . HIS D  1 31  ? -7.470  15.277  6.674   1.00 2.59   ? 31  HIS D CB  1 
ATOM   3870  C  CG  . HIS D  1 31  ? -6.621  15.048  7.907   1.00 9.69   ? 31  HIS D CG  1 
ATOM   3871  N  ND1 . HIS D  1 31  ? -6.505  13.796  8.491   1.00 15.33  ? 31  HIS D ND1 1 
ATOM   3872  C  CD2 . HIS D  1 31  ? -5.853  15.895  8.631   1.00 10.56  ? 31  HIS D CD2 1 
ATOM   3873  C  CE1 . HIS D  1 31  ? -5.690  13.908  9.522   1.00 10.95  ? 31  HIS D CE1 1 
ATOM   3874  N  NE2 . HIS D  1 31  ? -5.291  15.154  9.618   1.00 9.54   ? 31  HIS D NE2 1 
ATOM   3875  N  N   . TRP D  1 32  ? -9.683  17.064  7.886   1.00 5.25   ? 32  TRP D N   1 
ATOM   3876  C  CA  . TRP D  1 32  ? -10.119 17.964  8.951   1.00 2.56   ? 32  TRP D CA  1 
ATOM   3877  C  C   . TRP D  1 32  ? -11.631 17.965  9.149   1.00 11.90  ? 32  TRP D C   1 
ATOM   3878  O  O   . TRP D  1 32  ? -12.125 18.051  10.280  1.00 7.81   ? 32  TRP D O   1 
ATOM   3879  C  CB  . TRP D  1 32  ? -9.733  19.399  8.610   1.00 1.98   ? 32  TRP D CB  1 
ATOM   3880  C  CG  . TRP D  1 32  ? -8.239  19.647  8.743   1.00 1.48   ? 32  TRP D CG  1 
ATOM   3881  C  CD1 . TRP D  1 32  ? -7.378  18.957  9.496   1.00 1.87   ? 32  TRP D CD1 1 
ATOM   3882  C  CD2 . TRP D  1 32  ? -7.524  20.667  8.073   1.00 2.48   ? 32  TRP D CD2 1 
ATOM   3883  N  NE1 . TRP D  1 32  ? -6.092  19.549  9.306   1.00 1.82   ? 32  TRP D NE1 1 
ATOM   3884  C  CE2 . TRP D  1 32  ? -6.200  20.551  8.469   1.00 3.17   ? 32  TRP D CE2 1 
ATOM   3885  C  CE3 . TRP D  1 32  ? -7.883  21.675  7.172   1.00 4.81   ? 32  TRP D CE3 1 
ATOM   3886  C  CZ2 . TRP D  1 32  ? -5.188  21.399  8.010   1.00 2.29   ? 32  TRP D CZ2 1 
ATOM   3887  C  CZ3 . TRP D  1 32  ? -6.856  22.526  6.715   1.00 5.53   ? 32  TRP D CZ3 1 
ATOM   3888  C  CH2 . TRP D  1 32  ? -5.572  22.393  7.116   1.00 7.22   ? 32  TRP D CH2 1 
ATOM   3889  N  N   . TYR D  1 33  ? -12.353 17.861  8.057   1.00 5.15   ? 33  TYR D N   1 
ATOM   3890  C  CA  . TYR D  1 33  ? -13.808 18.016  8.108   1.00 3.06   ? 33  TYR D CA  1 
ATOM   3891  C  C   . TYR D  1 33  ? -14.604 16.708  8.170   1.00 12.26  ? 33  TYR D C   1 
ATOM   3892  O  O   . TYR D  1 33  ? -15.794 16.707  8.498   1.00 12.20  ? 33  TYR D O   1 
ATOM   3893  C  CB  . TYR D  1 33  ? -14.286 18.805  6.897   1.00 2.01   ? 33  TYR D CB  1 
ATOM   3894  C  CG  . TYR D  1 33  ? -14.028 20.299  7.069   1.00 4.70   ? 33  TYR D CG  1 
ATOM   3895  C  CD1 . TYR D  1 33  ? -14.750 21.023  8.024   1.00 11.93  ? 33  TYR D CD1 1 
ATOM   3896  C  CD2 . TYR D  1 33  ? -13.065 20.939  6.282   1.00 2.07   ? 33  TYR D CD2 1 
ATOM   3897  C  CE1 . TYR D  1 33  ? -14.507 22.391  8.194   1.00 10.94  ? 33  TYR D CE1 1 
ATOM   3898  C  CE2 . TYR D  1 33  ? -12.822 22.306  6.451   1.00 6.58   ? 33  TYR D CE2 1 
ATOM   3899  C  CZ  . TYR D  1 33  ? -13.542 23.033  7.407   1.00 15.73  ? 33  TYR D CZ  1 
ATOM   3900  O  OH  . TYR D  1 33  ? -13.305 24.361  7.572   1.00 12.05  ? 33  TYR D OH  1 
ATOM   3901  N  N   . MET D  1 34  ? -13.988 15.596  7.872   1.00 7.08   ? 34  MET D N   1 
ATOM   3902  C  CA  . MET D  1 34  ? -14.723 14.316  7.874   1.00 3.78   ? 34  MET D CA  1 
ATOM   3903  C  C   . MET D  1 34  ? -15.356 14.036  9.252   1.00 4.17   ? 34  MET D C   1 
ATOM   3904  O  O   . MET D  1 34  ? -14.859 14.484  10.293  1.00 4.79   ? 34  MET D O   1 
ATOM   3905  C  CB  . MET D  1 34  ? -13.795 13.167  7.512   1.00 8.25   ? 34  MET D CB  1 
ATOM   3906  C  CG  . MET D  1 34  ? -12.681 12.956  8.530   1.00 13.26  ? 34  MET D CG  1 
ATOM   3907  S  SD  . MET D  1 34  ? -11.685 11.532  8.163   1.00 19.32  ? 34  MET D SD  1 
ATOM   3908  C  CE  . MET D  1 34  ? -11.325 11.490  6.421   1.00 15.91  ? 34  MET D CE  1 
ATOM   3909  N  N   . ARG D  1 35  ? -16.445 13.292  9.189   1.00 9.07   ? 35  ARG D N   1 
ATOM   3910  C  CA  . ARG D  1 35  ? -17.240 12.863  10.355  1.00 10.68  ? 35  ARG D CA  1 
ATOM   3911  C  C   . ARG D  1 35  ? -17.951 11.574  9.999   1.00 12.31  ? 35  ARG D C   1 
ATOM   3912  O  O   . ARG D  1 35  ? -18.160 11.324  8.821   1.00 17.86  ? 35  ARG D O   1 
ATOM   3913  C  CB  . ARG D  1 35  ? -18.341 13.859  10.646  1.00 7.68   ? 35  ARG D CB  1 
ATOM   3914  C  CG  . ARG D  1 35  ? -17.851 15.140  11.273  1.00 15.10  ? 35  ARG D CG  1 
ATOM   3915  C  CD  . ARG D  1 35  ? -19.004 15.974  11.791  1.00 4.17   ? 35  ARG D CD  1 
ATOM   3916  N  NE  . ARG D  1 35  ? -18.593 17.321  12.128  1.00 22.13  ? 35  ARG D NE  1 
ATOM   3917  C  CZ  . ARG D  1 35  ? -19.436 18.308  12.386  1.00 35.46  ? 35  ARG D CZ  1 
ATOM   3918  N  NH1 . ARG D  1 35  ? -20.757 18.109  12.343  1.00 42.69  ? 35  ARG D NH1 1 
ATOM   3919  N  NH2 . ARG D  1 35  ? -19.040 19.543  12.700  1.00 30.09  ? 35  ARG D NH2 1 
ATOM   3920  N  N   . GLY D  1 36  ? -18.268 10.747  10.986  1.00 6.59   ? 36  GLY D N   1 
ATOM   3921  C  CA  . GLY D  1 36  ? -18.934 9.488   10.708  1.00 7.29   ? 36  GLY D CA  1 
ATOM   3922  C  C   . GLY D  1 36  ? -18.125 8.354   11.297  1.00 13.71  ? 36  GLY D C   1 
ATOM   3923  O  O   . GLY D  1 36  ? -16.928 8.496   11.607  1.00 12.59  ? 36  GLY D O   1 
ATOM   3924  N  N   . HIS D  1 37  ? -18.789 7.216   11.398  1.00 9.57   ? 37  HIS D N   1 
ATOM   3925  C  CA  . HIS D  1 37  ? -18.143 6.030   11.944  1.00 13.91  ? 37  HIS D CA  1 
ATOM   3926  C  C   . HIS D  1 37  ? -16.764 5.617   11.423  1.00 17.36  ? 37  HIS D C   1 
ATOM   3927  O  O   . HIS D  1 37  ? -16.044 4.898   12.128  1.00 15.15  ? 37  HIS D O   1 
ATOM   3928  C  CB  . HIS D  1 37  ? -19.125 4.866   11.894  1.00 19.08  ? 37  HIS D CB  1 
ATOM   3929  C  CG  . HIS D  1 37  ? -20.313 5.074   12.779  1.00 31.80  ? 37  HIS D CG  1 
ATOM   3930  N  ND1 . HIS D  1 37  ? -20.643 4.203   13.795  1.00 40.08  ? 37  HIS D ND1 1 
ATOM   3931  C  CD2 . HIS D  1 37  ? -21.187 6.100   12.860  1.00 47.96  ? 37  HIS D CD2 1 
ATOM   3932  C  CE1 . HIS D  1 37  ? -21.710 4.654   14.424  1.00 45.68  ? 37  HIS D CE1 1 
ATOM   3933  N  NE2 . HIS D  1 37  ? -22.050 5.812   13.887  1.00 49.00  ? 37  HIS D NE2 1 
ATOM   3934  N  N   . ASN D  1 38  ? -16.409 6.042   10.207  1.00 12.89  ? 38  ASN D N   1 
ATOM   3935  C  CA  . ASN D  1 38  ? -15.101 5.729   9.615   1.00 15.03  ? 38  ASN D CA  1 
ATOM   3936  C  C   . ASN D  1 38  ? -14.048 6.762   9.892   1.00 16.53  ? 38  ASN D C   1 
ATOM   3937  O  O   . ASN D  1 38  ? -12.959 6.696   9.361   1.00 14.72  ? 38  ASN D O   1 
ATOM   3938  C  CB  . ASN D  1 38  ? -15.207 5.512   8.106   1.00 14.52  ? 38  ASN D CB  1 
ATOM   3939  C  CG  . ASN D  1 38  ? -16.299 4.527   7.780   1.00 33.25  ? 38  ASN D CG  1 
ATOM   3940  O  OD1 . ASN D  1 38  ? -17.368 4.924   7.321   1.00 36.54  ? 38  ASN D OD1 1 
ATOM   3941  N  ND2 . ASN D  1 38  ? -16.111 3.273   8.202   1.00 15.80  ? 38  ASN D ND2 1 
ATOM   3942  N  N   . PHE D  1 39  ? -14.417 7.710   10.743  1.00 6.58   ? 39  PHE D N   1 
ATOM   3943  C  CA  . PHE D  1 39  ? -13.501 8.790   11.088  1.00 3.99   ? 39  PHE D CA  1 
ATOM   3944  C  C   . PHE D  1 39  ? -12.086 8.375   11.445  1.00 6.74   ? 39  PHE D C   1 
ATOM   3945  O  O   . PHE D  1 39  ? -11.123 8.872   10.862  1.00 5.69   ? 39  PHE D O   1 
ATOM   3946  C  CB  . PHE D  1 39  ? -13.992 9.651   12.252  1.00 1.00   ? 39  PHE D CB  1 
ATOM   3947  C  CG  . PHE D  1 39  ? -13.012 10.740  12.626  1.00 3.13   ? 39  PHE D CG  1 
ATOM   3948  C  CD1 . PHE D  1 39  ? -13.003 11.964  11.949  1.00 1.08   ? 39  PHE D CD1 1 
ATOM   3949  C  CD2 . PHE D  1 39  ? -12.079 10.528  13.629  1.00 4.44   ? 39  PHE D CD2 1 
ATOM   3950  C  CE1 . PHE D  1 39  ? -12.089 12.953  12.271  1.00 1.00   ? 39  PHE D CE1 1 
ATOM   3951  C  CE2 . PHE D  1 39  ? -11.162 11.495  13.972  1.00 4.03   ? 39  PHE D CE2 1 
ATOM   3952  C  CZ  . PHE D  1 39  ? -11.166 12.707  13.297  1.00 2.47   ? 39  PHE D CZ  1 
ATOM   3953  N  N   . PHE D  1 40  ? -12.000 7.481   12.423  1.00 1.49   ? 40  PHE D N   1 
ATOM   3954  C  CA  . PHE D  1 40  ? -10.666 7.113   12.832  1.00 6.82   ? 40  PHE D CA  1 
ATOM   3955  C  C   . PHE D  1 40  ? -9.811  6.600   11.685  1.00 17.33  ? 40  PHE D C   1 
ATOM   3956  O  O   . PHE D  1 40  ? -8.744  7.127   11.351  1.00 13.44  ? 40  PHE D O   1 
ATOM   3957  C  CB  . PHE D  1 40  ? -10.723 6.202   14.039  1.00 3.70   ? 40  PHE D CB  1 
ATOM   3958  C  CG  . PHE D  1 40  ? -11.186 6.924   15.266  1.00 4.52   ? 40  PHE D CG  1 
ATOM   3959  C  CD1 . PHE D  1 40  ? -10.405 7.914   15.871  1.00 1.08   ? 40  PHE D CD1 1 
ATOM   3960  C  CD2 . PHE D  1 40  ? -12.485 6.726   15.702  1.00 6.16   ? 40  PHE D CD2 1 
ATOM   3961  C  CE1 . PHE D  1 40  ? -10.844 8.608   16.971  1.00 3.45   ? 40  PHE D CE1 1 
ATOM   3962  C  CE2 . PHE D  1 40  ? -12.960 7.431   16.795  1.00 7.52   ? 40  PHE D CE2 1 
ATOM   3963  C  CZ  . PHE D  1 40  ? -12.131 8.380   17.437  1.00 1.60   ? 40  PHE D CZ  1 
ATOM   3964  N  N   . THR D  1 41  ? -10.350 5.580   11.042  1.00 13.07  ? 41  THR D N   1 
ATOM   3965  C  CA  . THR D  1 41  ? -9.605  5.003   9.943   1.00 12.32  ? 41  THR D CA  1 
ATOM   3966  C  C   . THR D  1 41  ? -9.275  5.958   8.781   1.00 12.01  ? 41  THR D C   1 
ATOM   3967  O  O   . THR D  1 41  ? -8.094  6.105   8.401   1.00 11.66  ? 41  THR D O   1 
ATOM   3968  C  CB  . THR D  1 41  ? -10.212 3.624   9.649   1.00 35.36  ? 41  THR D CB  1 
ATOM   3969  O  OG1 . THR D  1 41  ? -9.727  3.145   8.403   1.00 54.13  ? 41  THR D OG1 1 
ATOM   3970  C  CG2 . THR D  1 41  ? -11.728 3.671   9.682   1.00 68.49  ? 41  THR D CG2 1 
ATOM   3971  N  N   . LEU D  1 42  ? -10.290 6.657   8.271   1.00 7.73   ? 42  LEU D N   1 
ATOM   3972  C  CA  . LEU D  1 42  ? -10.049 7.568   7.163   1.00 4.61   ? 42  LEU D CA  1 
ATOM   3973  C  C   . LEU D  1 42  ? -9.212  8.763   7.553   1.00 9.79   ? 42  LEU D C   1 
ATOM   3974  O  O   . LEU D  1 42  ? -8.412  9.267   6.782   1.00 10.11  ? 42  LEU D O   1 
ATOM   3975  C  CB  . LEU D  1 42  ? -11.387 7.981   6.552   1.00 6.86   ? 42  LEU D CB  1 
ATOM   3976  C  CG  . LEU D  1 42  ? -11.798 7.123   5.360   1.00 11.50  ? 42  LEU D CG  1 
ATOM   3977  C  CD1 . LEU D  1 42  ? -10.990 5.850   5.176   1.00 9.22   ? 42  LEU D CD1 1 
ATOM   3978  C  CD2 . LEU D  1 42  ? -13.231 6.732   5.523   1.00 21.36  ? 42  LEU D CD2 1 
ATOM   3979  N  N   . HIS D  1 43  ? -9.358  9.217   8.786   1.00 3.22   ? 43  HIS D N   1 
ATOM   3980  C  CA  . HIS D  1 43  ? -8.566  10.359  9.242   1.00 1.48   ? 43  HIS D CA  1 
ATOM   3981  C  C   . HIS D  1 43  ? -7.090  9.993   9.099   1.00 8.75   ? 43  HIS D C   1 
ATOM   3982  O  O   . HIS D  1 43  ? -6.280  10.775  8.622   1.00 8.65   ? 43  HIS D O   1 
ATOM   3983  C  CB  . HIS D  1 43  ? -8.872  10.635  10.732  1.00 1.92   ? 43  HIS D CB  1 
ATOM   3984  C  CG  . HIS D  1 43  ? -8.180  11.845  11.288  1.00 8.72   ? 43  HIS D CG  1 
ATOM   3985  N  ND1 . HIS D  1 43  ? -8.407  13.127  10.827  1.00 10.09  ? 43  HIS D ND1 1 
ATOM   3986  C  CD2 . HIS D  1 43  ? -7.247  11.961  12.267  1.00 9.39   ? 43  HIS D CD2 1 
ATOM   3987  C  CE1 . HIS D  1 43  ? -7.662  13.980  11.505  1.00 10.43  ? 43  HIS D CE1 1 
ATOM   3988  N  NE2 . HIS D  1 43  ? -6.937  13.295  12.378  1.00 11.16  ? 43  HIS D NE2 1 
ATOM   3989  N  N   . GLU D  1 44  ? -6.735  8.780   9.501   1.00 6.85   ? 44  GLU D N   1 
ATOM   3990  C  CA  . GLU D  1 44  ? -5.340  8.364   9.406   1.00 6.48   ? 44  GLU D CA  1 
ATOM   3991  C  C   . GLU D  1 44  ? -4.939  8.106   7.966   1.00 8.35   ? 44  GLU D C   1 
ATOM   3992  O  O   . GLU D  1 44  ? -3.849  8.489   7.554   1.00 8.99   ? 44  GLU D O   1 
ATOM   3993  C  CB  . GLU D  1 44  ? -5.080  7.121   10.272  1.00 8.58   ? 44  GLU D CB  1 
ATOM   3994  C  CG  . GLU D  1 44  ? -5.385  7.392   11.765  1.00 78.56  ? 44  GLU D CG  1 
ATOM   3995  C  CD  . GLU D  1 44  ? -5.542  6.145   12.638  0.00 100.00 ? 44  GLU D CD  1 
ATOM   3996  O  OE1 . GLU D  1 44  ? -5.238  5.051   12.149  0.00 100.00 ? 44  GLU D OE1 1 
ATOM   3997  O  OE2 . GLU D  1 44  ? -6.019  6.269   13.774  0.00 100.00 ? 44  GLU D OE2 1 
ATOM   3998  N  N   . LYS D  1 45  ? -5.865  7.507   7.222   1.00 3.50   ? 45  LYS D N   1 
ATOM   3999  C  CA  . LYS D  1 45  ? -5.550  7.251   5.818   1.00 3.08   ? 45  LYS D CA  1 
ATOM   4000  C  C   . LYS D  1 45  ? -5.200  8.554   5.065   1.00 4.07   ? 45  LYS D C   1 
ATOM   4001  O  O   . LYS D  1 45  ? -4.303  8.592   4.201   1.00 5.23   ? 45  LYS D O   1 
ATOM   4002  C  CB  . LYS D  1 45  ? -6.713  6.531   5.140   1.00 6.31   ? 45  LYS D CB  1 
ATOM   4003  C  CG  . LYS D  1 45  ? -6.264  5.779   3.903   1.00 28.80  ? 45  LYS D CG  1 
ATOM   4004  C  CD  . LYS D  1 45  ? -5.497  4.533   4.311   1.00 52.83  ? 45  LYS D CD  1 
ATOM   4005  C  CE  . LYS D  1 45  ? -4.504  4.115   3.232   1.00 91.25  ? 45  LYS D CE  1 
ATOM   4006  N  NZ  . LYS D  1 45  ? -5.082  3.758   1.898   1.00 78.62  ? 45  LYS D NZ  1 
ATOM   4007  N  N   . MET D  1 46  ? -5.913  9.630   5.391   1.00 1.00   ? 46  MET D N   1 
ATOM   4008  C  CA  . MET D  1 46  ? -5.632  10.886  4.714   1.00 1.27   ? 46  MET D CA  1 
ATOM   4009  C  C   . MET D  1 46  ? -4.246  11.385  5.058   1.00 7.55   ? 46  MET D C   1 
ATOM   4010  O  O   . MET D  1 46  ? -3.573  12.011  4.215   1.00 13.46  ? 46  MET D O   1 
ATOM   4011  C  CB  . MET D  1 46  ? -6.673  11.964  5.037   1.00 1.00   ? 46  MET D CB  1 
ATOM   4012  C  CG  . MET D  1 46  ? -8.093  11.560  4.642   1.00 1.94   ? 46  MET D CG  1 
ATOM   4013  S  SD  . MET D  1 46  ? -8.248  11.248  2.872   1.00 8.97   ? 46  MET D SD  1 
ATOM   4014  C  CE  . MET D  1 46  ? -8.188  9.427   2.785   1.00 2.66   ? 46  MET D CE  1 
ATOM   4015  N  N   . ASP D  1 47  ? -3.832  11.116  6.298   1.00 5.56   ? 47  ASP D N   1 
ATOM   4016  C  CA  . ASP D  1 47  ? -2.481  11.534  6.696   1.00 8.42   ? 47  ASP D CA  1 
ATOM   4017  C  C   . ASP D  1 47  ? -1.441  10.849  5.833   1.00 7.17   ? 47  ASP D C   1 
ATOM   4018  O  O   . ASP D  1 47  ? -0.477  11.443  5.361   1.00 9.59   ? 47  ASP D O   1 
ATOM   4019  C  CB  . ASP D  1 47  ? -2.156  11.389  8.186   1.00 16.32  ? 47  ASP D CB  1 
ATOM   4020  C  CG  . ASP D  1 47  ? -2.470  12.644  9.008   1.00 77.62  ? 47  ASP D CG  1 
ATOM   4021  O  OD1 . ASP D  1 47  ? -2.512  13.755  8.440   1.00 89.46  ? 47  ASP D OD1 1 
ATOM   4022  O  OD2 . ASP D  1 47  ? -2.578  12.519  10.239  1.00 99.02  ? 47  ASP D OD2 1 
ATOM   4023  N  N   . ASP D  1 48  ? -1.748  9.617   5.468   1.00 4.57   ? 48  ASP D N   1 
ATOM   4024  C  CA  . ASP D  1 48  ? -0.837  8.863   4.625   1.00 7.66   ? 48  ASP D CA  1 
ATOM   4025  C  C   . ASP D  1 48  ? -0.819  9.397   3.210   1.00 10.08  ? 48  ASP D C   1 
ATOM   4026  O  O   . ASP D  1 48  ? 0.237   9.574   2.607   1.00 8.82   ? 48  ASP D O   1 
ATOM   4027  C  CB  . ASP D  1 48  ? -1.168  7.380   4.716   1.00 14.30  ? 48  ASP D CB  1 
ATOM   4028  C  CG  . ASP D  1 48  ? -0.977  6.785   6.150   1.00 51.79  ? 48  ASP D CG  1 
ATOM   4029  O  OD1 . ASP D  1 48  ? -0.180  7.308   6.978   1.00 53.88  ? 48  ASP D OD1 1 
ATOM   4030  O  OD2 . ASP D  1 48  ? -1.657  5.774   6.478   1.00 81.77  ? 48  ASP D OD2 1 
ATOM   4031  N  N   . LEU D  1 49  ? -1.997  9.707   2.680   1.00 5.48   ? 49  LEU D N   1 
ATOM   4032  C  CA  . LEU D  1 49  ? -2.066  10.218  1.306   1.00 4.56   ? 49  LEU D CA  1 
ATOM   4033  C  C   . LEU D  1 49  ? -1.379  11.546  1.236   1.00 1.28   ? 49  LEU D C   1 
ATOM   4034  O  O   . LEU D  1 49  ? -0.702  11.840  0.271   1.00 5.42   ? 49  LEU D O   1 
ATOM   4035  C  CB  . LEU D  1 49  ? -3.517  10.462  0.914   1.00 3.53   ? 49  LEU D CB  1 
ATOM   4036  C  CG  . LEU D  1 49  ? -4.117  9.501   -0.106  1.00 7.62   ? 49  LEU D CG  1 
ATOM   4037  C  CD1 . LEU D  1 49  ? -3.700  8.066   0.216   1.00 2.45   ? 49  LEU D CD1 1 
ATOM   4038  C  CD2 . LEU D  1 49  ? -5.641  9.668   -0.044  1.00 8.64   ? 49  LEU D CD2 1 
ATOM   4039  N  N   . TYR D  1 50  ? -1.601  12.352  2.263   1.00 1.00   ? 50  TYR D N   1 
ATOM   4040  C  CA  . TYR D  1 50  ? -1.020  13.686  2.301   1.00 2.52   ? 50  TYR D CA  1 
ATOM   4041  C  C   . TYR D  1 50  ? 0.487   13.590  2.114   1.00 7.81   ? 50  TYR D C   1 
ATOM   4042  O  O   . TYR D  1 50  ? 1.122   14.315  1.339   1.00 9.94   ? 50  TYR D O   1 
ATOM   4043  C  CB  . TYR D  1 50  ? -1.309  14.362  3.652   1.00 3.84   ? 50  TYR D CB  1 
ATOM   4044  C  CG  . TYR D  1 50  ? -0.830  15.782  3.737   1.00 10.57  ? 50  TYR D CG  1 
ATOM   4045  C  CD1 . TYR D  1 50  ? -1.649  16.816  3.296   1.00 17.18  ? 50  TYR D CD1 1 
ATOM   4046  C  CD2 . TYR D  1 50  ? 0.455   16.087  4.152   1.00 12.56  ? 50  TYR D CD2 1 
ATOM   4047  C  CE1 . TYR D  1 50  ? -1.210  18.166  3.273   1.00 21.74  ? 50  TYR D CE1 1 
ATOM   4048  C  CE2 . TYR D  1 50  ? 0.921   17.416  4.097   1.00 28.33  ? 50  TYR D CE2 1 
ATOM   4049  C  CZ  . TYR D  1 50  ? 0.080   18.466  3.672   1.00 38.60  ? 50  TYR D CZ  1 
ATOM   4050  O  OH  . TYR D  1 50  ? 0.465   19.805  3.664   1.00 33.51  ? 50  TYR D OH  1 
ATOM   4051  N  N   . SER D  1 51  ? 1.105   12.700  2.883   1.00 4.80   ? 51  SER D N   1 
ATOM   4052  C  CA  . SER D  1 51  ? 2.553   12.519  2.835   1.00 6.90   ? 51  SER D CA  1 
ATOM   4053  C  C   . SER D  1 51  ? 3.022   11.990  1.492   1.00 4.71   ? 51  SER D C   1 
ATOM   4054  O  O   . SER D  1 51  ? 3.991   12.443  0.911   1.00 4.46   ? 51  SER D O   1 
ATOM   4055  C  CB  . SER D  1 51  ? 2.977   11.581  3.977   1.00 6.85   ? 51  SER D CB  1 
ATOM   4056  O  OG  . SER D  1 51  ? 2.683   12.175  5.246   1.00 56.11  ? 51  SER D OG  1 
ATOM   4057  N  N   . GLU D  1 52  ? 2.338   10.966  1.017   1.00 1.04   ? 52  GLU D N   1 
ATOM   4058  C  CA  . GLU D  1 52  ? 2.693   10.367  -0.272  1.00 1.89   ? 52  GLU D CA  1 
ATOM   4059  C  C   . GLU D  1 52  ? 2.621   11.384  -1.419  1.00 5.89   ? 52  GLU D C   1 
ATOM   4060  O  O   . GLU D  1 52  ? 3.605   11.620  -2.139  1.00 3.30   ? 52  GLU D O   1 
ATOM   4061  C  CB  . GLU D  1 52  ? 1.731   9.207   -0.559  1.00 1.88   ? 52  GLU D CB  1 
ATOM   4062  C  CG  . GLU D  1 52  ? 1.883   8.798   -1.997  1.00 17.90  ? 52  GLU D CG  1 
ATOM   4063  C  CD  . GLU D  1 52  ? 1.194   7.485   -2.303  1.00 54.84  ? 52  GLU D CD  1 
ATOM   4064  O  OE1 . GLU D  1 52  ? 0.310   7.012   -1.574  1.00 19.70  ? 52  GLU D OE1 1 
ATOM   4065  O  OE2 . GLU D  1 52  ? 1.632   6.844   -3.258  1.00 27.77  ? 52  GLU D OE2 1 
ATOM   4066  N  N   . PHE D  1 53  ? 1.474   12.047  -1.516  1.00 2.40   ? 53  PHE D N   1 
ATOM   4067  C  CA  . PHE D  1 53  ? 1.327   13.045  -2.555  1.00 1.00   ? 53  PHE D CA  1 
ATOM   4068  C  C   . PHE D  1 53  ? 2.218   14.234  -2.435  1.00 4.30   ? 53  PHE D C   1 
ATOM   4069  O  O   . PHE D  1 53  ? 2.689   14.774  -3.437  1.00 5.11   ? 53  PHE D O   1 
ATOM   4070  C  CB  . PHE D  1 53  ? -0.117  13.313  -2.940  1.00 1.64   ? 53  PHE D CB  1 
ATOM   4071  C  CG  . PHE D  1 53  ? -0.737  12.096  -3.547  1.00 2.09   ? 53  PHE D CG  1 
ATOM   4072  C  CD1 . PHE D  1 53  ? -1.279  11.101  -2.713  1.00 2.72   ? 53  PHE D CD1 1 
ATOM   4073  C  CD2 . PHE D  1 53  ? -0.641  11.904  -4.925  1.00 1.00   ? 53  PHE D CD2 1 
ATOM   4074  C  CE1 . PHE D  1 53  ? -1.845  9.980   -3.262  1.00 2.19   ? 53  PHE D CE1 1 
ATOM   4075  C  CE2 . PHE D  1 53  ? -1.176  10.759  -5.504  1.00 7.11   ? 53  PHE D CE2 1 
ATOM   4076  C  CZ  . PHE D  1 53  ? -1.779  9.789   -4.670  1.00 7.23   ? 53  PHE D CZ  1 
ATOM   4077  N  N   . GLY D  1 54  ? 2.555   14.521  -1.188  1.00 1.00   ? 54  GLY D N   1 
ATOM   4078  C  CA  . GLY D  1 54  ? 3.491   15.610  -0.927  1.00 1.00   ? 54  GLY D CA  1 
ATOM   4079  C  C   . GLY D  1 54  ? 4.873   15.185  -1.425  1.00 6.57   ? 54  GLY D C   1 
ATOM   4080  O  O   . GLY D  1 54  ? 5.622   16.003  -1.968  1.00 7.79   ? 54  GLY D O   1 
ATOM   4081  N  N   . GLU D  1 55  ? 5.190   13.901  -1.286  1.00 4.02   ? 55  GLU D N   1 
ATOM   4082  C  CA  . GLU D  1 55  ? 6.476   13.458  -1.817  1.00 7.39   ? 55  GLU D CA  1 
ATOM   4083  C  C   . GLU D  1 55  ? 6.445   13.450  -3.354  1.00 9.55   ? 55  GLU D C   1 
ATOM   4084  O  O   . GLU D  1 55  ? 7.406   13.922  -3.977  1.00 13.18  ? 55  GLU D O   1 
ATOM   4085  C  CB  . GLU D  1 55  ? 6.867   12.069  -1.309  1.00 12.91  ? 55  GLU D CB  1 
ATOM   4086  C  CG  . GLU D  1 55  ? 7.367   11.991  0.120   1.00 67.85  ? 55  GLU D CG  1 
ATOM   4087  C  CD  . GLU D  1 55  ? 7.767   10.581  0.500   0.00 100.00 ? 55  GLU D CD  1 
ATOM   4088  O  OE1 . GLU D  1 55  ? 7.684   9.672   -0.345  0.00 100.00 ? 55  GLU D OE1 1 
ATOM   4089  O  OE2 . GLU D  1 55  ? 8.160   10.378  1.660   0.00 100.00 ? 55  GLU D OE2 1 
ATOM   4090  N  N   . GLN D  1 56  ? 5.375   12.958  -3.993  1.00 4.53   ? 56  GLN D N   1 
ATOM   4091  C  CA  . GLN D  1 56  ? 5.355   12.970  -5.470  1.00 4.61   ? 56  GLN D CA  1 
ATOM   4092  C  C   . GLN D  1 56  ? 5.611   14.406  -5.909  1.00 4.30   ? 56  GLN D C   1 
ATOM   4093  O  O   . GLN D  1 56  ? 6.338   14.701  -6.843  1.00 4.17   ? 56  GLN D O   1 
ATOM   4094  C  CB  . GLN D  1 56  ? 3.989   12.582  -6.058  1.00 6.08   ? 56  GLN D CB  1 
ATOM   4095  C  CG  . GLN D  1 56  ? 3.711   11.091  -6.077  1.00 16.66  ? 56  GLN D CG  1 
ATOM   4096  C  CD  . GLN D  1 56  ? 2.428   10.692  -6.827  1.00 28.12  ? 56  GLN D CD  1 
ATOM   4097  O  OE1 . GLN D  1 56  ? 1.884   11.440  -7.665  1.00 12.55  ? 56  GLN D OE1 1 
ATOM   4098  N  NE2 . GLN D  1 56  ? 1.957   9.473   -6.531  1.00 12.02  ? 56  GLN D NE2 1 
ATOM   4099  N  N   . MET D  1 57  ? 4.997   15.315  -5.173  1.00 1.23   ? 57  MET D N   1 
ATOM   4100  C  CA  . MET D  1 57  ? 5.095   16.705  -5.514  1.00 1.28   ? 57  MET D CA  1 
ATOM   4101  C  C   . MET D  1 57  ? 6.505   17.155  -5.529  1.00 4.52   ? 57  MET D C   1 
ATOM   4102  O  O   . MET D  1 57  ? 6.986   17.663  -6.516  1.00 11.80  ? 57  MET D O   1 
ATOM   4103  C  CB  . MET D  1 57  ? 4.217   17.512  -4.574  1.00 3.94   ? 57  MET D CB  1 
ATOM   4104  C  CG  . MET D  1 57  ? 3.892   18.894  -5.093  1.00 9.65   ? 57  MET D CG  1 
ATOM   4105  S  SD  . MET D  1 57  ? 5.242   19.928  -4.587  1.00 18.25  ? 57  MET D SD  1 
ATOM   4106  C  CE  . MET D  1 57  ? 4.729   20.154  -2.922  1.00 6.74   ? 57  MET D CE  1 
ATOM   4107  N  N   . ASP D  1 58  ? 7.212   16.915  -4.448  1.00 2.34   ? 58  ASP D N   1 
ATOM   4108  C  CA  . ASP D  1 58  ? 8.599   17.375  -4.455  1.00 3.07   ? 58  ASP D CA  1 
ATOM   4109  C  C   . ASP D  1 58  ? 9.420   16.680  -5.536  1.00 2.72   ? 58  ASP D C   1 
ATOM   4110  O  O   . ASP D  1 58  ? 10.269  17.268  -6.194  1.00 3.63   ? 58  ASP D O   1 
ATOM   4111  C  CB  . ASP D  1 58  ? 9.179   17.130  -3.055  1.00 5.90   ? 58  ASP D CB  1 
ATOM   4112  C  CG  . ASP D  1 58  ? 10.478  17.877  -2.811  1.00 17.91  ? 58  ASP D CG  1 
ATOM   4113  O  OD1 . ASP D  1 58  ? 10.491  19.129  -2.898  1.00 24.39  ? 58  ASP D OD1 1 
ATOM   4114  O  OD2 . ASP D  1 58  ? 11.453  17.165  -2.428  1.00 18.67  ? 58  ASP D OD2 1 
ATOM   4115  N  N   . GLU D  1 59  ? 9.135   15.409  -5.764  1.00 3.73   ? 59  GLU D N   1 
ATOM   4116  C  CA  . GLU D  1 59  ? 9.908   14.684  -6.770  1.00 4.34   ? 59  GLU D CA  1 
ATOM   4117  C  C   . GLU D  1 59  ? 9.627   15.186  -8.176  1.00 5.40   ? 59  GLU D C   1 
ATOM   4118  O  O   . GLU D  1 59  ? 10.538  15.219  -9.019  1.00 5.26   ? 59  GLU D O   1 
ATOM   4119  C  CB  . GLU D  1 59  ? 9.582   13.177  -6.774  1.00 9.38   ? 59  GLU D CB  1 
ATOM   4120  C  CG  . GLU D  1 59  ? 10.094  12.358  -5.607  1.00 48.34  ? 59  GLU D CG  1 
ATOM   4121  C  CD  . GLU D  1 59  ? 9.824   10.874  -5.731  0.00 100.00 ? 59  GLU D CD  1 
ATOM   4122  O  OE1 . GLU D  1 59  ? 9.922   10.340  -6.855  0.00 100.00 ? 59  GLU D OE1 1 
ATOM   4123  O  OE2 . GLU D  1 59  ? 9.592   10.215  -4.696  0.00 100.00 ? 59  GLU D OE2 1 
ATOM   4124  N  N   . VAL D  1 60  ? 8.363   15.496  -8.452  1.00 2.86   ? 60  VAL D N   1 
ATOM   4125  C  CA  . VAL D  1 60  ? 8.070   16.000  -9.771  1.00 1.17   ? 60  VAL D CA  1 
ATOM   4126  C  C   . VAL D  1 60  ? 8.810   17.329  -9.915  1.00 3.49   ? 60  VAL D C   1 
ATOM   4127  O  O   . VAL D  1 60  ? 9.491   17.584  -10.908 1.00 6.23   ? 60  VAL D O   1 
ATOM   4128  C  CB  . VAL D  1 60  ? 6.577   16.174  -9.831  1.00 5.41   ? 60  VAL D CB  1 
ATOM   4129  C  CG1 . VAL D  1 60  ? 6.174   17.119  -10.962 1.00 3.98   ? 60  VAL D CG1 1 
ATOM   4130  C  CG2 . VAL D  1 60  ? 5.950   14.807  -9.987  1.00 1.18   ? 60  VAL D CG2 1 
ATOM   4131  N  N   . ALA D  1 61  ? 8.777   18.146  -8.868  1.00 2.34   ? 61  ALA D N   1 
ATOM   4132  C  CA  . ALA D  1 61  ? 9.380   19.464  -8.949  1.00 1.00   ? 61  ALA D CA  1 
ATOM   4133  C  C   . ALA D  1 61  ? 10.831  19.313  -9.177  1.00 8.63   ? 61  ALA D C   1 
ATOM   4134  O  O   . ALA D  1 61  ? 11.411  19.988  -10.011 1.00 8.11   ? 61  ALA D O   1 
ATOM   4135  C  CB  . ALA D  1 61  ? 9.139   20.273  -7.680  1.00 1.00   ? 61  ALA D CB  1 
ATOM   4136  N  N   . GLU D  1 62  ? 11.434  18.424  -8.405  1.00 3.96   ? 62  GLU D N   1 
ATOM   4137  C  CA  . GLU D  1 62  ? 12.897  18.286  -8.545  1.00 2.90   ? 62  GLU D CA  1 
ATOM   4138  C  C   . GLU D  1 62  ? 13.327  17.671  -9.884  1.00 7.11   ? 62  GLU D C   1 
ATOM   4139  O  O   . GLU D  1 62  ? 14.417  17.952  -10.368 1.00 6.95   ? 62  GLU D O   1 
ATOM   4140  C  CB  . GLU D  1 62  ? 13.562  17.661  -7.291  1.00 2.52   ? 62  GLU D CB  1 
ATOM   4141  C  CG  . GLU D  1 62  ? 13.290  18.448  -6.023  1.00 10.48  ? 62  GLU D CG  1 
ATOM   4142  C  CD  . GLU D  1 62  ? 13.772  17.841  -4.683  1.00 12.50  ? 62  GLU D CD  1 
ATOM   4143  O  OE1 . GLU D  1 62  ? 14.213  16.659  -4.594  1.00 43.56  ? 62  GLU D OE1 1 
ATOM   4144  O  OE2 . GLU D  1 62  ? 13.737  18.683  -3.735  1.00 23.14  ? 62  GLU D OE2 1 
ATOM   4145  N  N   . ARG D  1 63  ? 12.499  16.797  -10.450 1.00 2.10   ? 63  ARG D N   1 
ATOM   4146  C  CA  . ARG D  1 63  ? 12.779  16.176  -11.742 1.00 3.13   ? 63  ARG D CA  1 
ATOM   4147  C  C   . ARG D  1 63  ? 12.714  17.306  -12.778 1.00 8.36   ? 63  ARG D C   1 
ATOM   4148  O  O   . ARG D  1 63  ? 13.541  17.383  -13.688 1.00 7.08   ? 63  ARG D O   1 
ATOM   4149  C  CB  . ARG D  1 63  ? 11.753  15.084  -12.062 1.00 2.50   ? 63  ARG D CB  1 
ATOM   4150  C  CG  . ARG D  1 63  ? 11.893  14.445  -13.445 1.00 1.27   ? 63  ARG D CG  1 
ATOM   4151  C  CD  . ARG D  1 63  ? 13.335  14.105  -13.747 1.00 3.06   ? 63  ARG D CD  1 
ATOM   4152  N  NE  . ARG D  1 63  ? 13.586  13.595  -15.108 1.00 6.94   ? 63  ARG D NE  1 
ATOM   4153  C  CZ  . ARG D  1 63  ? 14.802  13.331  -15.602 1.00 7.25   ? 63  ARG D CZ  1 
ATOM   4154  N  NH1 . ARG D  1 63  ? 15.889  13.528  -14.855 1.00 3.01   ? 63  ARG D NH1 1 
ATOM   4155  N  NH2 . ARG D  1 63  ? 14.967  12.887  -16.852 1.00 1.96   ? 63  ARG D NH2 1 
ATOM   4156  N  N   . LEU D  1 64  ? 11.784  18.237  -12.584 1.00 2.10   ? 64  LEU D N   1 
ATOM   4157  C  CA  . LEU D  1 64  ? 11.674  19.367  -13.515 1.00 3.21   ? 64  LEU D CA  1 
ATOM   4158  C  C   . LEU D  1 64  ? 12.923  20.239  -13.460 1.00 12.48  ? 64  LEU D C   1 
ATOM   4159  O  O   . LEU D  1 64  ? 13.526  20.670  -14.464 1.00 12.97  ? 64  LEU D O   1 
ATOM   4160  C  CB  . LEU D  1 64  ? 10.502  20.263  -13.088 1.00 2.53   ? 64  LEU D CB  1 
ATOM   4161  C  CG  . LEU D  1 64  ? 10.280  21.596  -13.842 1.00 9.69   ? 64  LEU D CG  1 
ATOM   4162  C  CD1 . LEU D  1 64  ? 10.191  21.288  -15.369 1.00 6.03   ? 64  LEU D CD1 1 
ATOM   4163  C  CD2 . LEU D  1 64  ? 8.978   22.275  -13.389 1.00 2.62   ? 64  LEU D CD2 1 
ATOM   4164  N  N   . LEU D  1 65  ? 13.306  20.483  -12.214 1.00 3.40   ? 65  LEU D N   1 
ATOM   4165  C  CA  . LEU D  1 65  ? 14.480  21.304  -11.984 1.00 3.23   ? 65  LEU D CA  1 
ATOM   4166  C  C   . LEU D  1 65  ? 15.668  20.581  -12.599 1.00 8.13   ? 65  LEU D C   1 
ATOM   4167  O  O   . LEU D  1 65  ? 16.507  21.183  -13.217 1.00 6.42   ? 65  LEU D O   1 
ATOM   4168  C  CB  . LEU D  1 65  ? 14.545  21.322  -10.477 1.00 3.47   ? 65  LEU D CB  1 
ATOM   4169  C  CG  . LEU D  1 65  ? 14.949  22.461  -9.562  1.00 10.66  ? 65  LEU D CG  1 
ATOM   4170  C  CD1 . LEU D  1 65  ? 14.441  23.730  -10.164 1.00 1.43   ? 65  LEU D CD1 1 
ATOM   4171  C  CD2 . LEU D  1 65  ? 14.160  22.167  -8.308  1.00 1.76   ? 65  LEU D CD2 1 
ATOM   4172  N  N   . ALA D  1 66  ? 15.698  19.267  -12.508 1.00 6.38   ? 66  ALA D N   1 
ATOM   4173  C  CA  . ALA D  1 66  ? 16.798  18.510  -13.066 1.00 5.87   ? 66  ALA D CA  1 
ATOM   4174  C  C   . ALA D  1 66  ? 16.838  18.475  -14.602 1.00 12.88  ? 66  ALA D C   1 
ATOM   4175  O  O   . ALA D  1 66  ? 17.913  18.261  -15.191 1.00 6.46   ? 66  ALA D O   1 
ATOM   4176  C  CB  . ALA D  1 66  ? 16.784  17.109  -12.496 1.00 4.96   ? 66  ALA D CB  1 
ATOM   4177  N  N   . ILE D  1 67  ? 15.689  18.629  -15.245 1.00 10.69  ? 67  ILE D N   1 
ATOM   4178  C  CA  . ILE D  1 67  ? 15.737  18.676  -16.706 1.00 7.70   ? 67  ILE D CA  1 
ATOM   4179  C  C   . ILE D  1 67  ? 15.854  20.109  -17.203 1.00 17.49  ? 67  ILE D C   1 
ATOM   4180  O  O   . ILE D  1 67  ? 15.637  20.404  -18.378 1.00 15.30  ? 67  ILE D O   1 
ATOM   4181  C  CB  . ILE D  1 67  ? 14.590  18.022  -17.427 1.00 6.29   ? 67  ILE D CB  1 
ATOM   4182  C  CG1 . ILE D  1 67  ? 13.273  18.664  -17.008 1.00 6.02   ? 67  ILE D CG1 1 
ATOM   4183  C  CG2 . ILE D  1 67  ? 14.607  16.556  -17.184 1.00 5.37   ? 67  ILE D CG2 1 
ATOM   4184  C  CD1 . ILE D  1 67  ? 12.037  17.982  -17.630 1.00 29.23  ? 67  ILE D CD1 1 
ATOM   4185  N  N   . GLY D  1 68  ? 16.236  21.012  -16.311 1.00 6.12   ? 68  GLY D N   1 
ATOM   4186  C  CA  . GLY D  1 68  ? 16.424  22.389  -16.700 1.00 1.00   ? 68  GLY D CA  1 
ATOM   4187  C  C   . GLY D  1 68  ? 15.171  23.230  -16.512 1.00 12.15  ? 68  GLY D C   1 
ATOM   4188  O  O   . GLY D  1 68  ? 15.165  24.386  -16.918 1.00 20.60  ? 68  GLY D O   1 
ATOM   4189  N  N   . GLY D  1 69  ? 14.083  22.728  -15.929 1.00 8.14   ? 69  GLY D N   1 
ATOM   4190  C  CA  . GLY D  1 69  ? 12.882  23.547  -15.746 1.00 1.00   ? 69  GLY D CA  1 
ATOM   4191  C  C   . GLY D  1 69  ? 12.830  24.480  -14.510 1.00 7.42   ? 69  GLY D C   1 
ATOM   4192  O  O   . GLY D  1 69  ? 13.760  24.575  -13.681 1.00 8.52   ? 69  GLY D O   1 
ATOM   4193  N  N   . SER D  1 70  ? 11.679  25.130  -14.333 1.00 5.01   ? 70  SER D N   1 
ATOM   4194  C  CA  . SER D  1 70  ? 11.519  26.004  -13.172 1.00 8.66   ? 70  SER D CA  1 
ATOM   4195  C  C   . SER D  1 70  ? 10.116  25.817  -12.616 1.00 17.22  ? 70  SER D C   1 
ATOM   4196  O  O   . SER D  1 70  ? 9.130   26.268  -13.180 1.00 21.06  ? 70  SER D O   1 
ATOM   4197  C  CB  . SER D  1 70  ? 11.730  27.453  -13.586 1.00 12.05  ? 70  SER D CB  1 
ATOM   4198  O  OG  . SER D  1 70  ? 13.068  27.638  -14.020 1.00 33.67  ? 70  SER D OG  1 
ATOM   4199  N  N   . PRO D  1 71  ? 9.997   25.119  -11.496 1.00 12.88  ? 71  PRO D N   1 
ATOM   4200  C  CA  . PRO D  1 71  ? 8.678   24.819  -10.981 1.00 9.58   ? 71  PRO D CA  1 
ATOM   4201  C  C   . PRO D  1 71  ? 7.967   26.047  -10.464 1.00 9.68   ? 71  PRO D C   1 
ATOM   4202  O  O   . PRO D  1 71  ? 8.577   26.973  -9.935  1.00 5.82   ? 71  PRO D O   1 
ATOM   4203  C  CB  . PRO D  1 71  ? 9.003   23.923  -9.788  1.00 10.57  ? 71  PRO D CB  1 
ATOM   4204  C  CG  . PRO D  1 71  ? 10.321  24.425  -9.291  1.00 14.30  ? 71  PRO D CG  1 
ATOM   4205  C  CD  . PRO D  1 71  ? 11.070  24.731  -10.558 1.00 6.92   ? 71  PRO D CD  1 
ATOM   4206  N  N   . PHE D  1 72  ? 6.643   26.001  -10.570 1.00 8.30   ? 72  PHE D N   1 
ATOM   4207  C  CA  . PHE D  1 72  ? 5.785   27.033  -10.000 1.00 4.81   ? 72  PHE D CA  1 
ATOM   4208  C  C   . PHE D  1 72  ? 6.074   26.897  -8.509  1.00 13.48  ? 72  PHE D C   1 
ATOM   4209  O  O   . PHE D  1 72  ? 6.253   25.792  -8.004  1.00 9.96   ? 72  PHE D O   1 
ATOM   4210  C  CB  . PHE D  1 72  ? 4.311   26.657  -10.145 1.00 5.73   ? 72  PHE D CB  1 
ATOM   4211  C  CG  . PHE D  1 72  ? 3.831   26.692  -11.550 1.00 8.35   ? 72  PHE D CG  1 
ATOM   4212  C  CD1 . PHE D  1 72  ? 4.148   27.765  -12.364 1.00 14.64  ? 72  PHE D CD1 1 
ATOM   4213  C  CD2 . PHE D  1 72  ? 3.192   25.611  -12.078 1.00 9.26   ? 72  PHE D CD2 1 
ATOM   4214  C  CE1 . PHE D  1 72  ? 3.762   27.786  -13.706 1.00 18.68  ? 72  PHE D CE1 1 
ATOM   4215  C  CE2 . PHE D  1 72  ? 2.772   25.622  -13.391 1.00 12.63  ? 72  PHE D CE2 1 
ATOM   4216  C  CZ  . PHE D  1 72  ? 3.078   26.694  -14.212 1.00 14.49  ? 72  PHE D CZ  1 
ATOM   4217  N  N   . SER D  1 73  ? 5.995   27.998  -7.776  1.00 5.83   ? 73  SER D N   1 
ATOM   4218  C  CA  . SER D  1 73  ? 6.280   27.853  -6.366  1.00 2.10   ? 73  SER D CA  1 
ATOM   4219  C  C   . SER D  1 73  ? 5.553   28.902  -5.516  1.00 7.19   ? 73  SER D C   1 
ATOM   4220  O  O   . SER D  1 73  ? 6.164   29.541  -4.681  1.00 6.99   ? 73  SER D O   1 
ATOM   4221  C  CB  . SER D  1 73  ? 7.792   27.964  -6.231  1.00 6.37   ? 73  SER D CB  1 
ATOM   4222  O  OG  . SER D  1 73  ? 8.235   29.262  -6.601  1.00 11.94  ? 73  SER D OG  1 
ATOM   4223  N  N   . THR D  1 74  ? 4.262   29.127  -5.749  1.00 4.81   ? 74  THR D N   1 
ATOM   4224  C  CA  . THR D  1 74  ? 3.450   30.108  -5.008  1.00 4.33   ? 74  THR D CA  1 
ATOM   4225  C  C   . THR D  1 74  ? 2.013   29.622  -5.189  1.00 7.57   ? 74  THR D C   1 
ATOM   4226  O  O   . THR D  1 74  ? 1.664   29.087  -6.254  1.00 10.99  ? 74  THR D O   1 
ATOM   4227  C  CB  . THR D  1 74  ? 3.465   31.506  -5.666  1.00 9.79   ? 74  THR D CB  1 
ATOM   4228  O  OG1 . THR D  1 74  ? 3.111   31.353  -7.051  1.00 12.53  ? 74  THR D OG1 1 
ATOM   4229  C  CG2 . THR D  1 74  ? 4.820   32.177  -5.506  1.00 6.88   ? 74  THR D CG2 1 
ATOM   4230  N  N   . LEU D  1 75  ? 1.193   29.799  -4.159  1.00 3.43   ? 75  LEU D N   1 
ATOM   4231  C  CA  . LEU D  1 75  ? -0.197  29.372  -4.271  1.00 6.90   ? 75  LEU D CA  1 
ATOM   4232  C  C   . LEU D  1 75  ? -0.853  29.986  -5.500  1.00 11.69  ? 75  LEU D C   1 
ATOM   4233  O  O   . LEU D  1 75  ? -1.579  29.313  -6.233  1.00 14.58  ? 75  LEU D O   1 
ATOM   4234  C  CB  . LEU D  1 75  ? -1.012  29.762  -3.044  1.00 7.10   ? 75  LEU D CB  1 
ATOM   4235  C  CG  . LEU D  1 75  ? -0.761  28.967  -1.760  1.00 13.94  ? 75  LEU D CG  1 
ATOM   4236  C  CD1 . LEU D  1 75  ? 0.661   29.210  -1.347  1.00 18.51  ? 75  LEU D CD1 1 
ATOM   4237  C  CD2 . LEU D  1 75  ? -1.644  29.445  -0.635  1.00 9.59   ? 75  LEU D CD2 1 
ATOM   4238  N  N   . LYS D  1 76  ? -0.570  31.264  -5.724  1.00 10.99  ? 76  LYS D N   1 
ATOM   4239  C  CA  . LYS D  1 76  ? -1.115  31.952  -6.884  1.00 10.91  ? 76  LYS D CA  1 
ATOM   4240  C  C   . LYS D  1 76  ? -0.799  31.124  -8.148  1.00 11.27  ? 76  LYS D C   1 
ATOM   4241  O  O   . LYS D  1 76  ? -1.701  30.738  -8.901  1.00 11.15  ? 76  LYS D O   1 
ATOM   4242  C  CB  . LYS D  1 76  ? -0.550  33.367  -6.968  1.00 14.89  ? 76  LYS D CB  1 
ATOM   4243  C  CG  . LYS D  1 76  ? -1.094  34.159  -8.141  1.00 50.34  ? 76  LYS D CG  1 
ATOM   4244  C  CD  . LYS D  1 76  ? -0.773  35.631  -8.003  1.00 99.35  ? 76  LYS D CD  1 
ATOM   4245  C  CE  . LYS D  1 76  ? -1.252  36.452  -9.193  1.00 99.87  ? 76  LYS D CE  1 
ATOM   4246  N  NZ  . LYS D  1 76  ? -0.442  36.169  -10.396 1.00 99.91  ? 76  LYS D NZ  1 
ATOM   4247  N  N   . GLU D  1 77  ? 0.463   30.775  -8.357  1.00 7.75   ? 77  GLU D N   1 
ATOM   4248  C  CA  . GLU D  1 77  ? 0.780   30.005  -9.544  1.00 5.94   ? 77  GLU D CA  1 
ATOM   4249  C  C   . GLU D  1 77  ? 0.048   28.693  -9.574  1.00 10.57  ? 77  GLU D C   1 
ATOM   4250  O  O   . GLU D  1 77  ? -0.465  28.265  -10.604 1.00 10.08  ? 77  GLU D O   1 
ATOM   4251  C  CB  . GLU D  1 77  ? 2.284   29.751  -9.611  1.00 8.19   ? 77  GLU D CB  1 
ATOM   4252  C  CG  . GLU D  1 77  ? 3.105   30.984  -9.951  1.00 11.52  ? 77  GLU D CG  1 
ATOM   4253  C  CD  . GLU D  1 77  ? 4.586   30.779  -9.763  1.00 35.25  ? 77  GLU D CD  1 
ATOM   4254  O  OE1 . GLU D  1 77  ? 4.943   30.582  -8.579  1.00 28.52  ? 77  GLU D OE1 1 
ATOM   4255  O  OE2 . GLU D  1 77  ? 5.362   30.807  -10.758 1.00 31.21  ? 77  GLU D OE2 1 
ATOM   4256  N  N   . PHE D  1 78  ? 0.010   28.055  -8.414  1.00 9.25   ? 78  PHE D N   1 
ATOM   4257  C  CA  . PHE D  1 78  ? -0.637  26.763  -8.396  1.00 7.29   ? 78  PHE D CA  1 
ATOM   4258  C  C   . PHE D  1 78  ? -2.074  26.945  -8.801  1.00 13.15  ? 78  PHE D C   1 
ATOM   4259  O  O   . PHE D  1 78  ? -2.532  26.203  -9.678  1.00 14.22  ? 78  PHE D O   1 
ATOM   4260  C  CB  . PHE D  1 78  ? -0.620  26.050  -7.054  1.00 6.26   ? 78  PHE D CB  1 
ATOM   4261  C  CG  . PHE D  1 78  ? 0.752   25.814  -6.506  1.00 4.51   ? 78  PHE D CG  1 
ATOM   4262  C  CD1 . PHE D  1 78  ? 1.830   25.718  -7.380  1.00 5.36   ? 78  PHE D CD1 1 
ATOM   4263  C  CD2 . PHE D  1 78  ? 0.964   25.783  -5.137  1.00 4.12   ? 78  PHE D CD2 1 
ATOM   4264  C  CE1 . PHE D  1 78  ? 3.106   25.443  -6.892  1.00 7.23   ? 78  PHE D CE1 1 
ATOM   4265  C  CE2 . PHE D  1 78  ? 2.222   25.508  -4.645  1.00 2.42   ? 78  PHE D CE2 1 
ATOM   4266  C  CZ  . PHE D  1 78  ? 3.299   25.368  -5.516  1.00 5.56   ? 78  PHE D CZ  1 
ATOM   4267  N  N   . LEU D  1 79  ? -2.771  27.877  -8.159  1.00 7.76   ? 79  LEU D N   1 
ATOM   4268  C  CA  . LEU D  1 79  ? -4.168  28.148  -8.524  1.00 13.70  ? 79  LEU D CA  1 
ATOM   4269  C  C   . LEU D  1 79  ? -4.347  28.475  -10.005 1.00 21.51  ? 79  LEU D C   1 
ATOM   4270  O  O   . LEU D  1 79  ? -5.249  27.971  -10.667 1.00 17.87  ? 79  LEU D O   1 
ATOM   4271  C  CB  . LEU D  1 79  ? -4.658  29.370  -7.758  1.00 16.17  ? 79  LEU D CB  1 
ATOM   4272  C  CG  . LEU D  1 79  ? -5.259  28.809  -6.473  1.00 25.77  ? 79  LEU D CG  1 
ATOM   4273  C  CD1 . LEU D  1 79  ? -5.789  29.909  -5.564  1.00 20.60  ? 79  LEU D CD1 1 
ATOM   4274  C  CD2 . LEU D  1 79  ? -6.335  27.831  -6.879  1.00 27.59  ? 79  LEU D CD2 1 
ATOM   4275  N  N   . GLU D  1 80  ? -3.461  29.308  -10.539 1.00 16.22  ? 80  GLU D N   1 
ATOM   4276  C  CA  . GLU D  1 80  ? -3.547  29.633  -11.947 1.00 17.61  ? 80  GLU D CA  1 
ATOM   4277  C  C   . GLU D  1 80  ? -3.323  28.432  -12.854 1.00 26.31  ? 80  GLU D C   1 
ATOM   4278  O  O   . GLU D  1 80  ? -3.913  28.386  -13.922 1.00 38.66  ? 80  GLU D O   1 
ATOM   4279  C  CB  . GLU D  1 80  ? -2.560  30.731  -12.300 1.00 18.51  ? 80  GLU D CB  1 
ATOM   4280  C  CG  . GLU D  1 80  ? -2.842  31.981  -11.495 1.00 62.59  ? 80  GLU D CG  1 
ATOM   4281  C  CD  . GLU D  1 80  ? -1.899  33.113  -11.812 1.00 99.68  ? 80  GLU D CD  1 
ATOM   4282  O  OE1 . GLU D  1 80  ? -0.831  32.848  -12.391 1.00 99.89  ? 80  GLU D OE1 1 
ATOM   4283  O  OE2 . GLU D  1 80  ? -2.233  34.259  -11.447 1.00 99.72  ? 80  GLU D OE2 1 
ATOM   4284  N  N   . ASN D  1 81  ? -2.470  27.481  -12.483 1.00 12.52  ? 81  ASN D N   1 
ATOM   4285  C  CA  . ASN D  1 81  ? -2.243  26.373  -13.394 1.00 10.75  ? 81  ASN D CA  1 
ATOM   4286  C  C   . ASN D  1 81  ? -2.927  25.038  -13.214 1.00 14.18  ? 81  ASN D C   1 
ATOM   4287  O  O   . ASN D  1 81  ? -2.958  24.183  -14.084 1.00 19.44  ? 81  ASN D O   1 
ATOM   4288  C  CB  . ASN D  1 81  ? -0.764  26.190  -13.671 1.00 12.87  ? 81  ASN D CB  1 
ATOM   4289  C  CG  . ASN D  1 81  ? -0.129  27.476  -14.084 1.00 14.57  ? 81  ASN D CG  1 
ATOM   4290  O  OD1 . ASN D  1 81  ? -0.014  28.387  -13.290 1.00 20.66  ? 81  ASN D OD1 1 
ATOM   4291  N  ND2 . ASN D  1 81  ? 0.216   27.604  -15.359 1.00 15.32  ? 81  ASN D ND2 1 
ATOM   4292  N  N   . ALA D  1 82  ? -3.482  24.829  -12.045 1.00 13.12  ? 82  ALA D N   1 
ATOM   4293  C  CA  . ALA D  1 82  ? -4.025  23.492  -11.794 1.00 13.44  ? 82  ALA D CA  1 
ATOM   4294  C  C   . ALA D  1 82  ? -5.237  23.081  -12.580 1.00 16.67  ? 82  ALA D C   1 
ATOM   4295  O  O   . ALA D  1 82  ? -6.145  23.886  -12.728 1.00 20.98  ? 82  ALA D O   1 
ATOM   4296  C  CB  . ALA D  1 82  ? -4.354  23.323  -10.289 1.00 12.84  ? 82  ALA D CB  1 
ATOM   4297  N  N   . SER D  1 83  ? -5.325  21.797  -12.910 1.00 7.67   ? 83  SER D N   1 
ATOM   4298  C  CA  . SER D  1 83  ? -6.541  21.264  -13.524 1.00 5.49   ? 83  SER D CA  1 
ATOM   4299  C  C   . SER D  1 83  ? -7.382  20.638  -12.411 1.00 14.84  ? 83  SER D C   1 
ATOM   4300  O  O   . SER D  1 83  ? -8.578  20.428  -12.560 1.00 17.82  ? 83  SER D O   1 
ATOM   4301  C  CB  . SER D  1 83  ? -6.278  20.294  -14.677 1.00 3.36   ? 83  SER D CB  1 
ATOM   4302  O  OG  . SER D  1 83  ? -5.318  19.364  -14.242 1.00 25.81  ? 83  SER D OG  1 
ATOM   4303  N  N   . VAL D  1 84  ? -6.768  20.352  -11.270 1.00 13.91  ? 84  VAL D N   1 
ATOM   4304  C  CA  . VAL D  1 84  ? -7.527  19.821  -10.132 1.00 9.08   ? 84  VAL D CA  1 
ATOM   4305  C  C   . VAL D  1 84  ? -8.417  20.925  -9.546  1.00 12.86  ? 84  VAL D C   1 
ATOM   4306  O  O   . VAL D  1 84  ? -7.969  22.064  -9.318  1.00 13.08  ? 84  VAL D O   1 
ATOM   4307  C  CB  . VAL D  1 84  ? -6.555  19.312  -9.017  1.00 6.67   ? 84  VAL D CB  1 
ATOM   4308  C  CG1 . VAL D  1 84  ? -7.288  18.934  -7.760  1.00 5.37   ? 84  VAL D CG1 1 
ATOM   4309  C  CG2 . VAL D  1 84  ? -5.786  18.091  -9.501  1.00 4.00   ? 84  VAL D CG2 1 
ATOM   4310  N  N   . GLU D  1 85  ? -9.670  20.583  -9.266  1.00 20.11  ? 85  GLU D N   1 
ATOM   4311  C  CA  . GLU D  1 85  ? -10.559 21.609  -8.728  1.00 21.48  ? 85  GLU D CA  1 
ATOM   4312  C  C   . GLU D  1 85  ? -10.680 21.633  -7.218  1.00 18.94  ? 85  GLU D C   1 
ATOM   4313  O  O   . GLU D  1 85  ? -10.816 20.570  -6.619  1.00 23.31  ? 85  GLU D O   1 
ATOM   4314  C  CB  . GLU D  1 85  ? -11.978 21.371  -9.255  1.00 27.58  ? 85  GLU D CB  1 
ATOM   4315  C  CG  . GLU D  1 85  ? -12.220 21.751  -10.714 1.00 73.40  ? 85  GLU D CG  1 
ATOM   4316  C  CD  . GLU D  1 85  ? -11.917 23.200  -10.987 0.00 100.00 ? 85  GLU D CD  1 
ATOM   4317  O  OE1 . GLU D  1 85  ? -11.778 23.979  -10.031 0.00 100.00 ? 85  GLU D OE1 1 
ATOM   4318  O  OE2 . GLU D  1 85  ? -11.779 23.561  -12.177 0.00 100.00 ? 85  GLU D OE2 1 
ATOM   4319  N  N   . GLU D  1 86  ? -10.788 22.810  -6.605  1.00 13.88  ? 86  GLU D N   1 
ATOM   4320  C  CA  . GLU D  1 86  ? -10.980 22.798  -5.159  1.00 15.66  ? 86  GLU D CA  1 
ATOM   4321  C  C   . GLU D  1 86  ? -12.182 23.648  -4.793  1.00 19.82  ? 86  GLU D C   1 
ATOM   4322  O  O   . GLU D  1 86  ? -12.555 24.567  -5.520  1.00 22.08  ? 86  GLU D O   1 
ATOM   4323  C  CB  . GLU D  1 86  ? -9.792  23.455  -4.466  1.00 17.37  ? 86  GLU D CB  1 
ATOM   4324  C  CG  . GLU D  1 86  ? -9.555  24.887  -4.874  1.00 39.45  ? 86  GLU D CG  1 
ATOM   4325  C  CD  . GLU D  1 86  ? -8.576  25.660  -3.981  1.00 49.81  ? 86  GLU D CD  1 
ATOM   4326  O  OE1 . GLU D  1 86  ? -7.736  25.051  -3.263  1.00 30.17  ? 86  GLU D OE1 1 
ATOM   4327  O  OE2 . GLU D  1 86  ? -8.597  26.923  -4.057  1.00 25.20  ? 86  GLU D OE2 1 
ATOM   4328  N  N   . ALA D  1 87  ? -12.754 23.406  -3.622  1.00 17.61  ? 87  ALA D N   1 
ATOM   4329  C  CA  . ALA D  1 87  ? -13.878 24.208  -3.137  1.00 17.59  ? 87  ALA D CA  1 
ATOM   4330  C  C   . ALA D  1 87  ? -13.993 24.223  -1.615  1.00 21.00  ? 87  ALA D C   1 
ATOM   4331  O  O   . ALA D  1 87  ? -14.006 23.152  -0.991  1.00 25.31  ? 87  ALA D O   1 
ATOM   4332  C  CB  . ALA D  1 87  ? -15.178 23.654  -3.685  1.00 17.81  ? 87  ALA D CB  1 
ATOM   4333  N  N   . PRO D  1 88  ? -14.162 25.444  -1.101  1.00 18.07  ? 88  PRO D N   1 
ATOM   4334  C  CA  . PRO D  1 88  ? -14.297 25.702  0.326   1.00 20.15  ? 88  PRO D CA  1 
ATOM   4335  C  C   . PRO D  1 88  ? -15.422 24.825  0.851   1.00 18.93  ? 88  PRO D C   1 
ATOM   4336  O  O   . PRO D  1 88  ? -16.391 24.476  0.182   1.00 17.30  ? 88  PRO D O   1 
ATOM   4337  C  CB  . PRO D  1 88  ? -14.687 27.178  0.379   1.00 23.55  ? 88  PRO D CB  1 
ATOM   4338  C  CG  . PRO D  1 88  ? -15.443 27.370  -0.876  1.00 28.24  ? 88  PRO D CG  1 
ATOM   4339  C  CD  . PRO D  1 88  ? -14.682 26.568  -1.898  1.00 18.81  ? 88  PRO D CD  1 
ATOM   4340  N  N   . TYR D  1 89  ? -15.208 24.387  2.082   1.00 15.48  ? 89  TYR D N   1 
ATOM   4341  C  CA  . TYR D  1 89  ? -16.145 23.455  2.686   1.00 15.28  ? 89  TYR D CA  1 
ATOM   4342  C  C   . TYR D  1 89  ? -17.168 24.323  3.404   1.00 30.98  ? 89  TYR D C   1 
ATOM   4343  O  O   . TYR D  1 89  ? -16.878 24.981  4.412   1.00 35.83  ? 89  TYR D O   1 
ATOM   4344  C  CB  . TYR D  1 89  ? -15.377 22.543  3.641   1.00 8.94   ? 89  TYR D CB  1 
ATOM   4345  C  CG  . TYR D  1 89  ? -16.211 21.478  4.241   1.00 9.80   ? 89  TYR D CG  1 
ATOM   4346  C  CD1 . TYR D  1 89  ? -16.906 21.696  5.416   1.00 13.59  ? 89  TYR D CD1 1 
ATOM   4347  C  CD2 . TYR D  1 89  ? -16.324 20.265  3.620   1.00 8.49   ? 89  TYR D CD2 1 
ATOM   4348  C  CE1 . TYR D  1 89  ? -17.684 20.709  5.982   1.00 18.36  ? 89  TYR D CE1 1 
ATOM   4349  C  CE2 . TYR D  1 89  ? -17.080 19.259  4.189   1.00 9.76   ? 89  TYR D CE2 1 
ATOM   4350  C  CZ  . TYR D  1 89  ? -17.781 19.485  5.362   1.00 20.14  ? 89  TYR D CZ  1 
ATOM   4351  O  OH  . TYR D  1 89  ? -18.571 18.516  5.961   1.00 30.93  ? 89  TYR D OH  1 
ATOM   4352  N  N   . THR D  1 90  ? -18.372 24.346  2.856   1.00 36.10  ? 90  THR D N   1 
ATOM   4353  C  CA  . THR D  1 90  ? -19.437 25.148  3.452   1.00 38.97  ? 90  THR D CA  1 
ATOM   4354  C  C   . THR D  1 90  ? -20.518 24.263  4.048   1.00 47.21  ? 90  THR D C   1 
ATOM   4355  O  O   . THR D  1 90  ? -20.713 24.125  5.251   1.00 48.46  ? 90  THR D O   1 
ATOM   4356  C  CB  . THR D  1 90  ? -20.024 26.004  2.333   1.00 51.01  ? 90  THR D CB  1 
ATOM   4357  O  OG1 . THR D  1 90  ? -20.254 25.171  1.184   1.00 56.19  ? 90  THR D OG1 1 
ATOM   4358  C  CG2 . THR D  1 90  ? -19.006 27.067  1.965   1.00 51.96  ? 90  THR D CG2 1 
ATOM   4359  N  N   . LYS D  1 91  ? -21.207 23.666  3.096   1.00 28.79  ? 91  LYS D N   1 
ATOM   4360  C  CA  . LYS D  1 91  ? -22.255 22.697  3.345   1.00 34.54  ? 91  LYS D CA  1 
ATOM   4361  C  C   . LYS D  1 91  ? -21.567 21.452  3.870   1.00 43.60  ? 91  LYS D C   1 
ATOM   4362  O  O   . LYS D  1 91  ? -20.411 21.157  3.537   1.00 51.31  ? 91  LYS D O   1 
ATOM   4363  C  CB  . LYS D  1 91  ? -23.027 22.439  2.032   1.00 47.23  ? 91  LYS D CB  1 
ATOM   4364  C  CG  . LYS D  1 91  ? -23.371 21.008  1.637   0.00 100.00 ? 91  LYS D CG  1 
ATOM   4365  C  CD  . LYS D  1 91  ? -22.120 20.253  1.279   0.00 100.00 ? 91  LYS D CD  1 
ATOM   4366  C  CE  . LYS D  1 91  ? -21.099 21.111  0.572   0.00 100.00 ? 91  LYS D CE  1 
ATOM   4367  N  NZ  . LYS D  1 91  ? -19.642 20.748  0.622   0.00 100.00 ? 91  LYS D NZ  1 
ATOM   4368  N  N   . PRO D  1 92  ? -22.329 20.702  4.646   1.00 42.05  ? 92  PRO D N   1 
ATOM   4369  C  CA  . PRO D  1 92  ? -21.858 19.462  5.218   1.00 41.81  ? 92  PRO D CA  1 
ATOM   4370  C  C   . PRO D  1 92  ? -21.864 18.328  4.193   1.00 51.00  ? 92  PRO D C   1 
ATOM   4371  O  O   . PRO D  1 92  ? -22.890 18.033  3.552   1.00 55.68  ? 92  PRO D O   1 
ATOM   4372  C  CB  . PRO D  1 92  ? -22.894 19.215  6.318   1.00 31.54  ? 92  PRO D CB  1 
ATOM   4373  C  CG  . PRO D  1 92  ? -23.123 20.593  6.830   1.00 21.23  ? 92  PRO D CG  1 
ATOM   4374  C  CD  . PRO D  1 92  ? -23.293 21.365  5.534   1.00 24.43  ? 92  PRO D CD  1 
ATOM   4375  N  N   . LYS D  1 93  ? -20.693 17.706  4.078   1.00 31.43  ? 93  LYS D N   1 
ATOM   4376  C  CA  . LYS D  1 93  ? -20.545 16.570  3.177   1.00 13.25  ? 93  LYS D CA  1 
ATOM   4377  C  C   . LYS D  1 93  ? -20.389 15.247  3.924   1.00 40.22  ? 93  LYS D C   1 
ATOM   4378  O  O   . LYS D  1 93  ? -19.905 15.181  5.037   1.00 46.69  ? 93  LYS D O   1 
ATOM   4379  C  CB  . LYS D  1 93  ? -19.422 16.796  2.145   1.00 13.37  ? 93  LYS D CB  1 
ATOM   4380  C  CG  . LYS D  1 93  ? -19.424 18.101  1.348   1.00 25.54  ? 93  LYS D CG  1 
ATOM   4381  C  CD  . LYS D  1 93  ? -18.300 18.202  0.316   1.00 87.89  ? 93  LYS D CD  1 
ATOM   4382  C  CE  . LYS D  1 93  ? -18.430 17.183  -0.802  0.00 100.00 ? 93  LYS D CE  1 
ATOM   4383  N  NZ  . LYS D  1 93  ? -17.365 17.358  -1.855  0.00 100.00 ? 93  LYS D NZ  1 
ATOM   4384  N  N   . THR D  1 94  ? -20.897 14.206  3.231   1.00 21.48  ? 94  THR D N   1 
ATOM   4385  C  CA  . THR D  1 94  ? -20.840 12.778  3.548   1.00 18.01  ? 94  THR D CA  1 
ATOM   4386  C  C   . THR D  1 94  ? -19.436 12.202  3.333   1.00 10.32  ? 94  THR D C   1 
ATOM   4387  O  O   . THR D  1 94  ? -18.666 12.664  2.484   1.00 14.85  ? 94  THR D O   1 
ATOM   4388  C  CB  . THR D  1 94  ? -21.812 11.989  2.666   1.00 51.93  ? 94  THR D CB  1 
ATOM   4389  O  OG1 . THR D  1 94  ? -23.010 11.714  3.407   1.00 57.82  ? 94  THR D OG1 1 
ATOM   4390  C  CG2 . THR D  1 94  ? -21.221 10.694  2.177   0.00 100.00 ? 94  THR D CG2 1 
ATOM   4391  N  N   . MET D  1 95  ? -19.086 11.213  4.157   1.00 15.83  ? 95  MET D N   1 
ATOM   4392  C  CA  . MET D  1 95  ? -17.777 10.561  4.090   1.00 21.20  ? 95  MET D CA  1 
ATOM   4393  C  C   . MET D  1 95  ? -17.660 10.075  2.638   1.00 22.32  ? 95  MET D C   1 
ATOM   4394  O  O   . MET D  1 95  ? -16.670 10.298  1.917   1.00 21.86  ? 95  MET D O   1 
ATOM   4395  C  CB  . MET D  1 95  ? -17.721 9.409   5.111   1.00 25.21  ? 95  MET D CB  1 
ATOM   4396  C  CG  . MET D  1 95  ? -16.357 8.770   5.195   1.00 30.43  ? 95  MET D CG  1 
ATOM   4397  S  SD  . MET D  1 95  ? -15.158 9.971   5.805   1.00 33.24  ? 95  MET D SD  1 
ATOM   4398  C  CE  . MET D  1 95  ? -15.227 9.645   7.647   1.00 26.04  ? 95  MET D CE  1 
ATOM   4399  N  N   . ASP D  1 96  ? -18.767 9.459   2.223   1.00 21.00  ? 96  ASP D N   1 
ATOM   4400  C  CA  . ASP D  1 96  ? -18.861 8.981   0.849   1.00 24.73  ? 96  ASP D CA  1 
ATOM   4401  C  C   . ASP D  1 96  ? -18.698 10.142  -0.139  1.00 16.01  ? 96  ASP D C   1 
ATOM   4402  O  O   . ASP D  1 96  ? -17.889 10.107  -1.076  1.00 18.49  ? 96  ASP D O   1 
ATOM   4403  C  CB  . ASP D  1 96  ? -20.151 8.187   0.646   1.00 28.96  ? 96  ASP D CB  1 
ATOM   4404  C  CG  . ASP D  1 96  ? -20.060 6.796   1.243   1.00 56.56  ? 96  ASP D CG  1 
ATOM   4405  O  OD1 . ASP D  1 96  ? -19.093 6.551   1.994   1.00 65.69  ? 96  ASP D OD1 1 
ATOM   4406  O  OD2 . ASP D  1 96  ? -20.896 5.938   0.901   1.00 58.82  ? 96  ASP D OD2 1 
ATOM   4407  N  N   . GLN D  1 97  ? -19.373 11.248  0.139   1.00 9.69   ? 97  GLN D N   1 
ATOM   4408  C  CA  . GLN D  1 97  ? -19.164 12.382  -0.748  1.00 14.98  ? 97  GLN D CA  1 
ATOM   4409  C  C   . GLN D  1 97  ? -17.708 12.776  -0.767  1.00 20.00  ? 97  GLN D C   1 
ATOM   4410  O  O   . GLN D  1 97  ? -17.147 13.074  -1.789  1.00 15.25  ? 97  GLN D O   1 
ATOM   4411  C  CB  . GLN D  1 97  ? -19.990 13.575  -0.283  1.00 22.08  ? 97  GLN D CB  1 
ATOM   4412  C  CG  . GLN D  1 97  ? -21.480 13.305  -0.085  1.00 41.89  ? 97  GLN D CG  1 
ATOM   4413  C  CD  . GLN D  1 97  ? -22.223 14.561  0.354   1.00 61.41  ? 97  GLN D CD  1 
ATOM   4414  O  OE1 . GLN D  1 97  ? -23.078 14.517  1.251   1.00 73.79  ? 97  GLN D OE1 1 
ATOM   4415  N  NE2 . GLN D  1 97  ? -21.904 15.692  -0.273  1.00 91.41  ? 97  GLN D NE2 1 
ATOM   4416  N  N   . LEU D  1 98  ? -17.091 12.792  0.403   1.00 13.02  ? 98  LEU D N   1 
ATOM   4417  C  CA  . LEU D  1 98  ? -15.708 13.230  0.496   1.00 11.69  ? 98  LEU D CA  1 
ATOM   4418  C  C   . LEU D  1 98  ? -14.843 12.243  -0.266  1.00 10.57  ? 98  LEU D C   1 
ATOM   4419  O  O   . LEU D  1 98  ? -14.021 12.641  -1.091  1.00 8.90   ? 98  LEU D O   1 
ATOM   4420  C  CB  . LEU D  1 98  ? -15.317 13.302  1.972   1.00 11.34  ? 98  LEU D CB  1 
ATOM   4421  C  CG  . LEU D  1 98  ? -16.025 14.455  2.712   1.00 12.09  ? 98  LEU D CG  1 
ATOM   4422  C  CD1 . LEU D  1 98  ? -15.735 14.565  4.208   1.00 10.24  ? 98  LEU D CD1 1 
ATOM   4423  C  CD2 . LEU D  1 98  ? -15.617 15.758  2.042   1.00 1.97   ? 98  LEU D CD2 1 
ATOM   4424  N  N   . MET D  1 99  ? -15.069 10.959  -0.024  1.00 4.90   ? 99  MET D N   1 
ATOM   4425  C  CA  . MET D  1 99  ? -14.281 9.933   -0.733  1.00 2.72   ? 99  MET D CA  1 
ATOM   4426  C  C   . MET D  1 99  ? -14.466 10.058  -2.256  1.00 10.85  ? 99  MET D C   1 
ATOM   4427  O  O   . MET D  1 99  ? -13.508 10.075  -3.051  1.00 12.40  ? 99  MET D O   1 
ATOM   4428  C  CB  . MET D  1 99  ? -14.664 8.541   -0.200  1.00 4.77   ? 99  MET D CB  1 
ATOM   4429  C  CG  . MET D  1 99  ? -14.175 8.391   1.252   1.00 11.30  ? 99  MET D CG  1 
ATOM   4430  S  SD  . MET D  1 99  ? -12.415 8.940   1.360   1.00 16.05  ? 99  MET D SD  1 
ATOM   4431  C  CE  . MET D  1 99  ? -12.464 10.494  1.985   1.00 10.99  ? 99  MET D CE  1 
ATOM   4432  N  N   . GLU D  1 100 ? -15.715 10.298  -2.640  1.00 12.01  ? 100 GLU D N   1 
ATOM   4433  C  CA  . GLU D  1 100 ? -15.993 10.468  -4.055  1.00 11.91  ? 100 GLU D CA  1 
ATOM   4434  C  C   . GLU D  1 100 ? -15.188 11.616  -4.635  1.00 12.20  ? 100 GLU D C   1 
ATOM   4435  O  O   . GLU D  1 100 ? -14.674 11.508  -5.758  1.00 13.64  ? 100 GLU D O   1 
ATOM   4436  C  CB  . GLU D  1 100 ? -17.476 10.580  -4.350  1.00 15.18  ? 100 GLU D CB  1 
ATOM   4437  C  CG  . GLU D  1 100 ? -18.185 9.219   -4.257  1.00 37.30  ? 100 GLU D CG  1 
ATOM   4438  C  CD  . GLU D  1 100 ? -19.687 9.271   -4.053  0.00 100.00 ? 100 GLU D CD  1 
ATOM   4439  O  OE1 . GLU D  1 100 ? -20.225 10.334  -3.698  1.00 98.06  ? 100 GLU D OE1 1 
ATOM   4440  O  OE2 . GLU D  1 100 ? -20.330 8.216   -4.187  0.00 100.00 ? 100 GLU D OE2 1 
ATOM   4441  N  N   . ASP D  1 101 ? -15.008 12.682  -3.862  1.00 12.08  ? 101 ASP D N   1 
ATOM   4442  C  CA  . ASP D  1 101 ? -14.221 13.806  -4.351  1.00 18.66  ? 101 ASP D CA  1 
ATOM   4443  C  C   . ASP D  1 101 ? -12.756 13.369  -4.450  1.00 16.60  ? 101 ASP D C   1 
ATOM   4444  O  O   . ASP D  1 101 ? -12.036 13.674  -5.399  1.00 12.44  ? 101 ASP D O   1 
ATOM   4445  C  CB  . ASP D  1 101 ? -14.393 14.985  -3.376  1.00 26.45  ? 101 ASP D CB  1 
ATOM   4446  C  CG  . ASP D  1 101 ? -13.743 16.281  -3.841  1.00 70.28  ? 101 ASP D CG  1 
ATOM   4447  O  OD1 . ASP D  1 101 ? -13.237 16.327  -4.975  1.00 74.41  ? 101 ASP D OD1 1 
ATOM   4448  O  OD2 . ASP D  1 101 ? -13.700 17.251  -3.049  1.00 79.61  ? 101 ASP D OD2 1 
ATOM   4449  N  N   . LEU D  1 102 ? -12.314 12.618  -3.453  1.00 8.93   ? 102 LEU D N   1 
ATOM   4450  C  CA  . LEU D  1 102 ? -10.930 12.182  -3.462  1.00 6.34   ? 102 LEU D CA  1 
ATOM   4451  C  C   . LEU D  1 102 ? -10.709 11.298  -4.710  1.00 8.34   ? 102 LEU D C   1 
ATOM   4452  O  O   . LEU D  1 102 ? -9.808  11.479  -5.524  1.00 8.71   ? 102 LEU D O   1 
ATOM   4453  C  CB  . LEU D  1 102 ? -10.773 11.317  -2.213  1.00 6.20   ? 102 LEU D CB  1 
ATOM   4454  C  CG  . LEU D  1 102 ? -9.413  11.176  -1.530  1.00 13.95  ? 102 LEU D CG  1 
ATOM   4455  C  CD1 . LEU D  1 102 ? -9.243  9.716   -1.121  1.00 9.03   ? 102 LEU D CD1 1 
ATOM   4456  C  CD2 . LEU D  1 102 ? -8.356  11.598  -2.524  1.00 24.99  ? 102 LEU D CD2 1 
ATOM   4457  N  N   . VAL D  1 103 ? -11.598 10.331  -4.878  1.00 1.00   ? 103 VAL D N   1 
ATOM   4458  C  CA  . VAL D  1 103 ? -11.452 9.393   -5.971  1.00 3.84   ? 103 VAL D CA  1 
ATOM   4459  C  C   . VAL D  1 103 ? -11.471 10.035  -7.338  1.00 13.23  ? 103 VAL D C   1 
ATOM   4460  O  O   . VAL D  1 103 ? -10.763 9.660   -8.290  1.00 7.55   ? 103 VAL D O   1 
ATOM   4461  C  CB  . VAL D  1 103 ? -12.567 8.382   -5.915  1.00 12.93  ? 103 VAL D CB  1 
ATOM   4462  C  CG1 . VAL D  1 103 ? -12.598 7.676   -7.235  1.00 15.05  ? 103 VAL D CG1 1 
ATOM   4463  C  CG2 . VAL D  1 103 ? -12.223 7.330   -4.880  1.00 14.37  ? 103 VAL D CG2 1 
ATOM   4464  N  N   . GLY D  1 104 ? -12.318 11.055  -7.397  1.00 7.83   ? 104 GLY D N   1 
ATOM   4465  C  CA  . GLY D  1 104 ? -12.412 11.784  -8.655  1.00 4.77   ? 104 GLY D CA  1 
ATOM   4466  C  C   . GLY D  1 104 ? -11.076 12.443  -8.981  1.00 8.95   ? 104 GLY D C   1 
ATOM   4467  O  O   . GLY D  1 104 ? -10.658 12.429  -10.139 1.00 12.49  ? 104 GLY D O   1 
ATOM   4468  N  N   . THR D  1 105 ? -10.466 13.024  -7.944  1.00 5.98   ? 105 THR D N   1 
ATOM   4469  C  CA  . THR D  1 105 ? -9.213  13.720  -8.191  1.00 5.38   ? 105 THR D CA  1 
ATOM   4470  C  C   . THR D  1 105 ? -8.122  12.743  -8.540  1.00 5.47   ? 105 THR D C   1 
ATOM   4471  O  O   . THR D  1 105 ? -7.245  12.984  -9.358  1.00 7.29   ? 105 THR D O   1 
ATOM   4472  C  CB  . THR D  1 105 ? -8.851  14.488  -6.978  1.00 11.34  ? 105 THR D CB  1 
ATOM   4473  O  OG1 . THR D  1 105 ? -9.913  15.430  -6.775  1.00 17.66  ? 105 THR D OG1 1 
ATOM   4474  C  CG2 . THR D  1 105 ? -7.566  15.200  -7.262  1.00 8.07   ? 105 THR D CG2 1 
ATOM   4475  N  N   . LEU D  1 106 ? -8.256  11.571  -7.951  1.00 3.30   ? 106 LEU D N   1 
ATOM   4476  C  CA  . LEU D  1 106 ? -7.264  10.559  -8.262  1.00 2.89   ? 106 LEU D CA  1 
ATOM   4477  C  C   . LEU D  1 106 ? -7.478  10.116  -9.726  1.00 12.66  ? 106 LEU D C   1 
ATOM   4478  O  O   . LEU D  1 106 ? -6.513  9.915   -10.485 1.00 11.57  ? 106 LEU D O   1 
ATOM   4479  C  CB  . LEU D  1 106 ? -7.436  9.369   -7.310  1.00 2.04   ? 106 LEU D CB  1 
ATOM   4480  C  CG  . LEU D  1 106 ? -7.011  9.547   -5.846  1.00 5.78   ? 106 LEU D CG  1 
ATOM   4481  C  CD1 . LEU D  1 106 ? -7.450  8.323   -5.044  1.00 2.33   ? 106 LEU D CD1 1 
ATOM   4482  C  CD2 . LEU D  1 106 ? -5.510  9.622   -5.787  1.00 1.64   ? 106 LEU D CD2 1 
ATOM   4483  N  N   . GLU D  1 107 ? -8.735  9.927   -10.118 1.00 5.28   ? 107 GLU D N   1 
ATOM   4484  C  CA  . GLU D  1 107 ? -8.893  9.531   -11.509 1.00 5.23   ? 107 GLU D CA  1 
ATOM   4485  C  C   . GLU D  1 107 ? -8.342  10.620  -12.425 1.00 11.32  ? 107 GLU D C   1 
ATOM   4486  O  O   . GLU D  1 107 ? -7.606  10.340  -13.375 1.00 8.83   ? 107 GLU D O   1 
ATOM   4487  C  CB  . GLU D  1 107 ? -10.360 9.261   -11.789 1.00 5.99   ? 107 GLU D CB  1 
ATOM   4488  C  CG  . GLU D  1 107 ? -10.820 7.963   -11.135 1.00 16.37  ? 107 GLU D CG  1 
ATOM   4489  C  CD  . GLU D  1 107 ? -12.344 7.779   -11.089 1.00 28.19  ? 107 GLU D CD  1 
ATOM   4490  O  OE1 . GLU D  1 107 ? -13.077 8.800   -11.020 1.00 39.50  ? 107 GLU D OE1 1 
ATOM   4491  O  OE2 . GLU D  1 107 ? -12.778 6.590   -11.111 1.00 30.50  ? 107 GLU D OE2 1 
ATOM   4492  N  N   . LEU D  1 108 ? -8.548  11.885  -12.075 1.00 7.78   ? 108 LEU D N   1 
ATOM   4493  C  CA  . LEU D  1 108 ? -7.982  12.951  -12.901 1.00 6.39   ? 108 LEU D CA  1 
ATOM   4494  C  C   . LEU D  1 108 ? -6.480  12.806  -13.014 1.00 10.77  ? 108 LEU D C   1 
ATOM   4495  O  O   . LEU D  1 108 ? -5.906  12.984  -14.102 1.00 14.09  ? 108 LEU D O   1 
ATOM   4496  C  CB  . LEU D  1 108 ? -8.286  14.348  -12.340 1.00 10.03  ? 108 LEU D CB  1 
ATOM   4497  C  CG  . LEU D  1 108 ? -7.751  15.605  -13.052 1.00 17.91  ? 108 LEU D CG  1 
ATOM   4498  C  CD1 . LEU D  1 108 ? -8.548  16.851  -12.704 1.00 15.23  ? 108 LEU D CD1 1 
ATOM   4499  C  CD2 . LEU D  1 108 ? -6.308  15.884  -12.693 1.00 24.16  ? 108 LEU D CD2 1 
ATOM   4500  N  N   . LEU D  1 109 ? -5.837  12.559  -11.878 1.00 5.62   ? 109 LEU D N   1 
ATOM   4501  C  CA  . LEU D  1 109 ? -4.360  12.536  -11.911 1.00 6.54   ? 109 LEU D CA  1 
ATOM   4502  C  C   . LEU D  1 109 ? -3.913  11.368  -12.768 1.00 6.88   ? 109 LEU D C   1 
ATOM   4503  O  O   . LEU D  1 109 ? -2.973  11.478  -13.566 1.00 11.05  ? 109 LEU D O   1 
ATOM   4504  C  CB  . LEU D  1 109 ? -3.766  12.408  -10.498 1.00 5.22   ? 109 LEU D CB  1 
ATOM   4505  C  CG  . LEU D  1 109 ? -3.904  13.733  -9.758  1.00 10.46  ? 109 LEU D CG  1 
ATOM   4506  C  CD1 . LEU D  1 109 ? -3.750  13.568  -8.238  1.00 11.92  ? 109 LEU D CD1 1 
ATOM   4507  C  CD2 . LEU D  1 109 ? -2.880  14.716  -10.346 1.00 7.74   ? 109 LEU D CD2 1 
ATOM   4508  N  N   . ARG D  1 110 ? -4.666  10.290  -12.606 1.00 1.57   ? 110 ARG D N   1 
ATOM   4509  C  CA  . ARG D  1 110 ? -4.322  9.073   -13.310 1.00 4.09   ? 110 ARG D CA  1 
ATOM   4510  C  C   . ARG D  1 110 ? -4.303  9.376   -14.805 1.00 12.20  ? 110 ARG D C   1 
ATOM   4511  O  O   . ARG D  1 110 ? -3.315  9.206   -15.529 1.00 8.66   ? 110 ARG D O   1 
ATOM   4512  C  CB  . ARG D  1 110 ? -5.386  8.021   -13.081 1.00 2.52   ? 110 ARG D CB  1 
ATOM   4513  C  CG  . ARG D  1 110 ? -5.068  6.764   -13.857 1.00 6.57   ? 110 ARG D CG  1 
ATOM   4514  C  CD  . ARG D  1 110 ? -6.286  5.827   -13.848 1.00 6.69   ? 110 ARG D CD  1 
ATOM   4515  N  NE  . ARG D  1 110 ? -7.527  6.515   -14.270 1.00 9.26   ? 110 ARG D NE  1 
ATOM   4516  C  CZ  . ARG D  1 110 ? -8.780  6.118   -14.013 1.00 18.73  ? 110 ARG D CZ  1 
ATOM   4517  N  NH1 . ARG D  1 110 ? -9.093  5.031   -13.295 1.00 7.60   ? 110 ARG D NH1 1 
ATOM   4518  N  NH2 . ARG D  1 110 ? -9.770  6.861   -14.481 1.00 15.02  ? 110 ARG D NH2 1 
ATOM   4519  N  N   . ASP D  1 111 ? -5.449  9.905   -15.202 1.00 8.73   ? 111 ASP D N   1 
ATOM   4520  C  CA  . ASP D  1 111 ? -5.635  10.207  -16.619 1.00 11.53  ? 111 ASP D CA  1 
ATOM   4521  C  C   . ASP D  1 111 ? -4.629  11.217  -17.128 1.00 10.14  ? 111 ASP D C   1 
ATOM   4522  O  O   . ASP D  1 111 ? -4.132  11.017  -18.240 1.00 11.50  ? 111 ASP D O   1 
ATOM   4523  C  CB  . ASP D  1 111 ? -7.078  10.592  -16.920 1.00 20.16  ? 111 ASP D CB  1 
ATOM   4524  C  CG  . ASP D  1 111 ? -8.050  9.485   -16.561 1.00 33.79  ? 111 ASP D CG  1 
ATOM   4525  O  OD1 . ASP D  1 111 ? -7.641  8.306   -16.562 1.00 24.86  ? 111 ASP D OD1 1 
ATOM   4526  O  OD2 . ASP D  1 111 ? -9.200  9.816   -16.218 1.00 59.34  ? 111 ASP D OD2 1 
ATOM   4527  N  N   . GLU D  1 112 ? -4.247  12.201  -16.315 1.00 1.99   ? 112 GLU D N   1 
ATOM   4528  C  CA  . GLU D  1 112 ? -3.264  13.149  -16.823 1.00 2.31   ? 112 GLU D CA  1 
ATOM   4529  C  C   . GLU D  1 112 ? -1.901  12.529  -16.864 1.00 12.01  ? 112 GLU D C   1 
ATOM   4530  O  O   . GLU D  1 112 ? -1.084  12.816  -17.743 1.00 13.60  ? 112 GLU D O   1 
ATOM   4531  C  CB  . GLU D  1 112 ? -3.183  14.468  -16.061 1.00 6.13   ? 112 GLU D CB  1 
ATOM   4532  C  CG  . GLU D  1 112 ? -4.534  15.190  -16.014 1.00 24.34  ? 112 GLU D CG  1 
ATOM   4533  C  CD  . GLU D  1 112 ? -4.461  16.673  -15.622 1.00 35.77  ? 112 GLU D CD  1 
ATOM   4534  O  OE1 . GLU D  1 112 ? -3.328  17.119  -15.278 1.00 16.44  ? 112 GLU D OE1 1 
ATOM   4535  O  OE2 . GLU D  1 112 ? -5.545  17.338  -15.686 1.00 23.70  ? 112 GLU D OE2 1 
ATOM   4536  N  N   . TYR D  1 113 ? -1.628  11.666  -15.896 1.00 8.63   ? 113 TYR D N   1 
ATOM   4537  C  CA  . TYR D  1 113 ? -0.280  11.082  -15.921 1.00 5.77   ? 113 TYR D CA  1 
ATOM   4538  C  C   . TYR D  1 113 ? -0.136  10.248  -17.206 1.00 9.20   ? 113 TYR D C   1 
ATOM   4539  O  O   . TYR D  1 113 ? 0.882   10.216  -17.879 1.00 8.17   ? 113 TYR D O   1 
ATOM   4540  C  CB  . TYR D  1 113 ? -0.135  10.215  -14.650 1.00 3.93   ? 113 TYR D CB  1 
ATOM   4541  C  CG  . TYR D  1 113 ? 0.292   10.998  -13.438 1.00 9.74   ? 113 TYR D CG  1 
ATOM   4542  C  CD1 . TYR D  1 113 ? -0.011  12.341  -13.338 1.00 12.58  ? 113 TYR D CD1 1 
ATOM   4543  C  CD2 . TYR D  1 113 ? 0.927   10.368  -12.387 1.00 15.34  ? 113 TYR D CD2 1 
ATOM   4544  C  CE1 . TYR D  1 113 ? 0.375   13.081  -12.256 1.00 17.55  ? 113 TYR D CE1 1 
ATOM   4545  C  CE2 . TYR D  1 113 ? 1.316   11.091  -11.288 1.00 21.54  ? 113 TYR D CE2 1 
ATOM   4546  C  CZ  . TYR D  1 113 ? 1.013   12.436  -11.219 1.00 18.95  ? 113 TYR D CZ  1 
ATOM   4547  O  OH  . TYR D  1 113 ? 1.372   13.128  -10.081 1.00 19.68  ? 113 TYR D OH  1 
ATOM   4548  N  N   . LYS D  1 114 ? -1.207  9.567   -17.548 1.00 10.16  ? 114 LYS D N   1 
ATOM   4549  C  CA  . LYS D  1 114 ? -1.207  8.707   -18.713 1.00 11.22  ? 114 LYS D CA  1 
ATOM   4550  C  C   . LYS D  1 114 ? -0.769  9.528   -19.913 1.00 13.66  ? 114 LYS D C   1 
ATOM   4551  O  O   . LYS D  1 114 ? 0.085   9.093   -20.705 1.00 12.36  ? 114 LYS D O   1 
ATOM   4552  C  CB  . LYS D  1 114 ? -2.613  8.143   -18.918 1.00 13.52  ? 114 LYS D CB  1 
ATOM   4553  C  CG  . LYS D  1 114 ? -2.686  7.190   -20.086 1.00 47.30  ? 114 LYS D CG  1 
ATOM   4554  C  CD  . LYS D  1 114 ? -1.349  6.474   -20.225 1.00 65.69  ? 114 LYS D CD  1 
ATOM   4555  C  CE  . LYS D  1 114 ? -1.358  5.548   -21.437 1.00 72.35  ? 114 LYS D CE  1 
ATOM   4556  N  NZ  . LYS D  1 114 ? -0.055  4.856   -21.655 1.00 81.25  ? 114 LYS D NZ  1 
ATOM   4557  N  N   . GLN D  1 115 ? -1.225  10.775  -19.943 1.00 8.23   ? 115 GLN D N   1 
ATOM   4558  C  CA  . GLN D  1 115 ? -0.837  11.642  -21.055 1.00 10.50  ? 115 GLN D CA  1 
ATOM   4559  C  C   . GLN D  1 115 ? 0.648   11.937  -20.944 1.00 10.99  ? 115 GLN D C   1 
ATOM   4560  O  O   . GLN D  1 115 ? 1.360   11.940  -21.956 1.00 13.29  ? 115 GLN D O   1 
ATOM   4561  C  CB  . GLN D  1 115 ? -1.508  13.035  -21.070 1.00 13.92  ? 115 GLN D CB  1 
ATOM   4562  C  CG  . GLN D  1 115 ? -3.011  13.211  -20.725 1.00 65.68  ? 115 GLN D CG  1 
ATOM   4563  C  CD  . GLN D  1 115 ? -3.924  12.245  -21.420 0.00 100.00 ? 115 GLN D CD  1 
ATOM   4564  O  OE1 . GLN D  1 115 ? -3.581  11.699  -22.465 0.00 100.00 ? 115 GLN D OE1 1 
ATOM   4565  N  NE2 . GLN D  1 115 ? -5.066  11.966  -20.806 0.00 100.00 ? 115 GLN D NE2 1 
ATOM   4566  N  N   . GLY D  1 116 ? 1.074   12.293  -19.731 1.00 6.88   ? 116 GLY D N   1 
ATOM   4567  C  CA  . GLY D  1 116 ? 2.465   12.679  -19.522 1.00 2.60   ? 116 GLY D CA  1 
ATOM   4568  C  C   . GLY D  1 116 ? 3.272   11.447  -19.874 1.00 4.17   ? 116 GLY D C   1 
ATOM   4569  O  O   . GLY D  1 116 ? 4.373   11.526  -20.413 1.00 9.95   ? 116 GLY D O   1 
ATOM   4570  N  N   . ILE D  1 117 ? 2.706   10.273  -19.620 1.00 1.00   ? 117 ILE D N   1 
ATOM   4571  C  CA  . ILE D  1 117 ? 3.505   9.110   -19.965 1.00 14.55  ? 117 ILE D CA  1 
ATOM   4572  C  C   . ILE D  1 117 ? 3.796   9.068   -21.461 1.00 13.14  ? 117 ILE D C   1 
ATOM   4573  O  O   . ILE D  1 117 ? 4.969   9.087   -21.843 1.00 51.11  ? 117 ILE D O   1 
ATOM   4574  C  CB  . ILE D  1 117 ? 2.829   7.856   -19.433 1.00 22.37  ? 117 ILE D CB  1 
ATOM   4575  C  CG1 . ILE D  1 117 ? 2.959   7.853   -17.912 1.00 9.37   ? 117 ILE D CG1 1 
ATOM   4576  C  CG2 . ILE D  1 117 ? 3.391   6.611   -20.077 1.00 22.73  ? 117 ILE D CG2 1 
ATOM   4577  C  CD1 . ILE D  1 117 ? 2.017   6.878   -17.279 1.00 2.58   ? 117 ILE D CD1 1 
ATOM   4578  N  N   . GLU D  1 118 ? 2.776   9.218   -22.277 1.00 41.44  ? 118 GLU D N   1 
ATOM   4579  C  CA  . GLU D  1 118 ? 3.013   9.238   -23.720 1.00 38.00  ? 118 GLU D CA  1 
ATOM   4580  C  C   . GLU D  1 118 ? 3.814   10.449  -24.121 1.00 14.97  ? 118 GLU D C   1 
ATOM   4581  O  O   . GLU D  1 118 ? 4.667   10.401  -25.006 1.00 10.18  ? 118 GLU D O   1 
ATOM   4582  C  CB  . GLU D  1 118 ? 1.695   9.303   -24.479 1.00 38.37  ? 118 GLU D CB  1 
ATOM   4583  C  CG  . GLU D  1 118 ? 0.848   8.062   -24.298 1.00 59.93  ? 118 GLU D CG  1 
ATOM   4584  C  CD  . GLU D  1 118 ? -0.540  8.419   -23.822 0.00 100.00 ? 118 GLU D CD  1 
ATOM   4585  O  OE1 . GLU D  1 118 ? -0.707  9.476   -23.106 0.00 100.00 ? 118 GLU D OE1 1 
ATOM   4586  O  OE2 . GLU D  1 118 ? -1.535  7.677   -24.141 0.00 100.00 ? 118 GLU D OE2 1 
ATOM   4587  N  N   . LEU D  1 119 ? 3.546   11.549  -23.479 1.00 9.12   ? 119 LEU D N   1 
ATOM   4588  C  CA  . LEU D  1 119 ? 4.252   12.761  -23.845 1.00 1.00   ? 119 LEU D CA  1 
ATOM   4589  C  C   . LEU D  1 119 ? 5.767   12.575  -23.678 1.00 27.51  ? 119 LEU D C   1 
ATOM   4590  O  O   . LEU D  1 119 ? 6.552   12.833  -24.590 1.00 1.00   ? 119 LEU D O   1 
ATOM   4591  C  CB  . LEU D  1 119 ? 3.798   13.939  -23.010 1.00 29.40  ? 119 LEU D CB  1 
ATOM   4592  C  CG  . LEU D  1 119 ? 4.796   15.092  -23.074 1.00 4.82   ? 119 LEU D CG  1 
ATOM   4593  C  CD1 . LEU D  1 119 ? 4.947   15.693  -24.476 1.00 43.11  ? 119 LEU D CD1 1 
ATOM   4594  C  CD2 . LEU D  1 119 ? 4.426   16.251  -22.153 1.00 23.38  ? 119 LEU D CD2 1 
ATOM   4595  N  N   . THR D  1 120 ? 6.178   12.119  -22.513 1.00 52.66  ? 120 THR D N   1 
ATOM   4596  C  CA  . THR D  1 120 ? 7.613   11.961  -22.203 1.00 11.82  ? 120 THR D CA  1 
ATOM   4597  C  C   . THR D  1 120 ? 8.257   10.836  -23.045 1.00 30.51  ? 120 THR D C   1 
ATOM   4598  O  O   . THR D  1 120 ? 9.479   10.819  -23.275 1.00 39.76  ? 120 THR D O   1 
ATOM   4599  C  CB  . THR D  1 120 ? 7.770   11.662  -20.713 1.00 1.00   ? 120 THR D CB  1 
ATOM   4600  O  OG1 . THR D  1 120 ? 9.137   11.722  -20.342 1.00 77.44  ? 120 THR D OG1 1 
ATOM   4601  C  CG2 . THR D  1 120 ? 7.231   10.286  -20.327 1.00 1.00   ? 120 THR D CG2 1 
ATOM   4602  N  N   . ASP D  1 121 ? 7.416   9.925   -23.501 1.00 1.00   ? 121 ASP D N   1 
ATOM   4603  C  CA  . ASP D  1 121 ? 7.848   8.752   -24.285 1.00 1.00   ? 121 ASP D CA  1 
ATOM   4604  C  C   . ASP D  1 121 ? 8.246   9.154   -25.726 1.00 32.64  ? 121 ASP D C   1 
ATOM   4605  O  O   . ASP D  1 121 ? 9.313   8.777   -26.227 1.00 44.90  ? 121 ASP D O   1 
ATOM   4606  C  CB  . ASP D  1 121 ? 6.733   7.716   -24.293 1.00 5.18   ? 121 ASP D CB  1 
ATOM   4607  C  CG  . ASP D  1 121 ? 7.145   6.401   -24.935 0.00 100.00 ? 121 ASP D CG  1 
ATOM   4608  O  OD1 . ASP D  1 121 ? 8.392   6.115   -25.076 1.00 78.83  ? 121 ASP D OD1 1 
ATOM   4609  O  OD2 . ASP D  1 121 ? 6.234   5.594   -25.343 1.00 86.71  ? 121 ASP D OD2 1 
ATOM   4610  N  N   . LYS D  1 122 ? 7.392   9.919   -26.404 1.00 13.69  ? 122 LYS D N   1 
ATOM   4611  C  CA  . LYS D  1 122 ? 7.704   10.395  -27.776 1.00 29.96  ? 122 LYS D CA  1 
ATOM   4612  C  C   . LYS D  1 122 ? 8.874   11.382  -27.726 1.00 23.28  ? 122 LYS D C   1 
ATOM   4613  O  O   . LYS D  1 122 ? 9.691   11.467  -28.650 1.00 41.66  ? 122 LYS D O   1 
ATOM   4614  C  CB  . LYS D  1 122 ? 6.522   11.123  -28.398 1.00 46.55  ? 122 LYS D CB  1 
ATOM   4615  C  CG  . LYS D  1 122 ? 5.296   10.240  -28.571 0.00 100.00 ? 122 LYS D CG  1 
ATOM   4616  C  CD  . LYS D  1 122 ? 4.014   11.055  -28.696 0.00 100.00 ? 122 LYS D CD  1 
ATOM   4617  C  CE  . LYS D  1 122 ? 2.760   10.219  -28.473 0.00 100.00 ? 122 LYS D CE  1 
ATOM   4618  N  NZ  . LYS D  1 122 ? 2.794   9.454   -27.221 0.00 100.00 ? 122 LYS D NZ  1 
ATOM   4619  N  N   . GLU D  1 123 ? 8.920   12.134  -26.638 1.00 8.20   ? 123 GLU D N   1 
ATOM   4620  C  CA  . GLU D  1 123 ? 10.006  13.097  -26.413 1.00 8.27   ? 123 GLU D CA  1 
ATOM   4621  C  C   . GLU D  1 123 ? 11.274  12.317  -26.000 1.00 20.10  ? 123 GLU D C   1 
ATOM   4622  O  O   . GLU D  1 123 ? 12.408  12.815  -25.999 1.00 42.46  ? 123 GLU D O   1 
ATOM   4623  C  CB  . GLU D  1 123 ? 9.659   14.070  -25.258 1.00 34.10  ? 123 GLU D CB  1 
ATOM   4624  C  CG  . GLU D  1 123 ? 8.503   15.049  -25.546 1.00 29.66  ? 123 GLU D CG  1 
ATOM   4625  C  CD  . GLU D  1 123 ? 8.548   16.309  -24.656 0.00 100.00 ? 123 GLU D CD  1 
ATOM   4626  O  OE1 . GLU D  1 123 ? 9.679   16.741  -24.207 1.00 4.23   ? 123 GLU D OE1 1 
ATOM   4627  O  OE2 . GLU D  1 123 ? 7.464   16.945  -24.360 1.00 17.39  ? 123 GLU D OE2 1 
ATOM   4628  N  N   . GLY D  1 124 ? 11.081  11.079  -25.515 1.00 33.28  ? 124 GLY D N   1 
ATOM   4629  C  CA  . GLY D  1 124 ? 12.202  10.227  -25.159 1.00 51.49  ? 124 GLY D CA  1 
ATOM   4630  C  C   . GLY D  1 124 ? 12.988  10.549  -23.876 1.00 30.45  ? 124 GLY D C   1 
ATOM   4631  O  O   . GLY D  1 124 ? 14.235  10.439  -23.821 1.00 13.34  ? 124 GLY D O   1 
ATOM   4632  N  N   . ASP D  1 125 ? 12.211  10.990  -22.880 1.00 23.48  ? 125 ASP D N   1 
ATOM   4633  C  CA  . ASP D  1 125 ? 12.768  11.271  -21.559 1.00 12.21  ? 125 ASP D CA  1 
ATOM   4634  C  C   . ASP D  1 125 ? 12.395  10.013  -20.778 1.00 11.44  ? 125 ASP D C   1 
ATOM   4635  O  O   . ASP D  1 125 ? 11.286  9.902   -20.237 1.00 13.88  ? 125 ASP D O   1 
ATOM   4636  C  CB  . ASP D  1 125 ? 12.095  12.509  -20.965 1.00 2.72   ? 125 ASP D CB  1 
ATOM   4637  C  CG  . ASP D  1 125 ? 12.592  12.816  -19.567 1.00 22.83  ? 125 ASP D CG  1 
ATOM   4638  O  OD1 . ASP D  1 125 ? 13.285  11.932  -18.987 1.00 21.26  ? 125 ASP D OD1 1 
ATOM   4639  O  OD2 . ASP D  1 125 ? 12.294  13.948  -19.098 1.00 14.65  ? 125 ASP D OD2 1 
ATOM   4640  N  N   . ASP D  1 126 ? 13.299  9.048   -20.765 1.00 7.41   ? 126 ASP D N   1 
ATOM   4641  C  CA  . ASP D  1 126 ? 12.997  7.775   -20.145 1.00 9.23   ? 126 ASP D CA  1 
ATOM   4642  C  C   . ASP D  1 126 ? 12.843  7.946   -18.659 1.00 6.87   ? 126 ASP D C   1 
ATOM   4643  O  O   . ASP D  1 126 ? 11.947  7.368   -18.074 1.00 9.28   ? 126 ASP D O   1 
ATOM   4644  C  CB  . ASP D  1 126 ? 14.181  6.871   -20.394 1.00 18.23  ? 126 ASP D CB  1 
ATOM   4645  C  CG  . ASP D  1 126 ? 14.579  6.862   -21.843 1.00 40.02  ? 126 ASP D CG  1 
ATOM   4646  O  OD1 . ASP D  1 126 ? 13.810  6.208   -22.579 1.00 40.45  ? 126 ASP D OD1 1 
ATOM   4647  O  OD2 . ASP D  1 126 ? 15.568  7.553   -22.200 1.00 51.94  ? 126 ASP D OD2 1 
ATOM   4648  N  N   . VAL D  1 127 ? 13.697  8.772   -18.077 1.00 3.53   ? 127 VAL D N   1 
ATOM   4649  C  CA  . VAL D  1 127 ? 13.617  8.969   -16.650 1.00 2.17   ? 127 VAL D CA  1 
ATOM   4650  C  C   . VAL D  1 127 ? 12.266  9.493   -16.251 1.00 7.96   ? 127 VAL D C   1 
ATOM   4651  O  O   . VAL D  1 127 ? 11.589  8.848   -15.446 1.00 12.48  ? 127 VAL D O   1 
ATOM   4652  C  CB  . VAL D  1 127 ? 14.777  9.831   -16.152 1.00 4.45   ? 127 VAL D CB  1 
ATOM   4653  C  CG1 . VAL D  1 127 ? 14.453  10.250  -14.678 1.00 2.60   ? 127 VAL D CG1 1 
ATOM   4654  C  CG2 . VAL D  1 127 ? 16.101  9.007   -16.246 1.00 1.00   ? 127 VAL D CG2 1 
ATOM   4655  N  N   . THR D  1 128 ? 11.852  10.599  -16.851 1.00 1.94   ? 128 THR D N   1 
ATOM   4656  C  CA  . THR D  1 128 ? 10.559  11.148  -16.470 1.00 1.00   ? 128 THR D CA  1 
ATOM   4657  C  C   . THR D  1 128 ? 9.436   10.173  -16.700 1.00 7.06   ? 128 THR D C   1 
ATOM   4658  O  O   . THR D  1 128 ? 8.511   10.018  -15.868 1.00 8.70   ? 128 THR D O   1 
ATOM   4659  C  CB  . THR D  1 128 ? 10.242  12.440  -17.146 1.00 1.46   ? 128 THR D CB  1 
ATOM   4660  O  OG1 . THR D  1 128 ? 11.325  13.324  -16.850 1.00 5.90   ? 128 THR D OG1 1 
ATOM   4661  C  CG2 . THR D  1 128 ? 9.001   13.037  -16.545 1.00 1.00   ? 128 THR D CG2 1 
ATOM   4662  N  N   . ASN D  1 129 ? 9.627   9.423   -17.773 1.00 2.19   ? 129 ASN D N   1 
ATOM   4663  C  CA  . ASN D  1 129 ? 8.625   8.432   -18.134 1.00 1.00   ? 129 ASN D CA  1 
ATOM   4664  C  C   . ASN D  1 129 ? 8.419   7.406   -17.015 1.00 3.52   ? 129 ASN D C   1 
ATOM   4665  O  O   . ASN D  1 129 ? 7.284   7.101   -16.623 1.00 4.88   ? 129 ASN D O   1 
ATOM   4666  C  CB  . ASN D  1 129 ? 9.115   7.767   -19.425 1.00 1.99   ? 129 ASN D CB  1 
ATOM   4667  C  CG  . ASN D  1 129 ? 8.185   6.660   -19.920 1.00 9.96   ? 129 ASN D CG  1 
ATOM   4668  O  OD1 . ASN D  1 129 ? 8.554   5.488   -19.882 1.00 29.30  ? 129 ASN D OD1 1 
ATOM   4669  N  ND2 . ASN D  1 129 ? 6.989   6.966   -20.387 1.00 4.47   ? 129 ASN D ND2 1 
ATOM   4670  N  N   . ASP D  1 130 ? 9.514   6.878   -16.505 1.00 2.20   ? 130 ASP D N   1 
ATOM   4671  C  CA  . ASP D  1 130 ? 9.440   5.864   -15.444 1.00 5.41   ? 130 ASP D CA  1 
ATOM   4672  C  C   . ASP D  1 130 ? 8.857   6.466   -14.159 1.00 7.23   ? 130 ASP D C   1 
ATOM   4673  O  O   . ASP D  1 130 ? 8.108   5.813   -13.432 1.00 10.65  ? 130 ASP D O   1 
ATOM   4674  C  CB  . ASP D  1 130 ? 10.808  5.261   -15.165 1.00 10.85  ? 130 ASP D CB  1 
ATOM   4675  C  CG  . ASP D  1 130 ? 10.923  3.841   -15.721 1.00 57.53  ? 130 ASP D CG  1 
ATOM   4676  O  OD1 . ASP D  1 130 ? 10.178  3.479   -16.712 1.00 57.42  ? 130 ASP D OD1 1 
ATOM   4677  O  OD2 . ASP D  1 130 ? 11.759  3.012   -15.203 1.00 94.48  ? 130 ASP D OD2 1 
ATOM   4678  N  N   . MET D  1 131 ? 9.205   7.705   -13.884 1.00 2.56   ? 131 MET D N   1 
ATOM   4679  C  CA  . MET D  1 131 ? 8.680   8.411   -12.700 1.00 7.15   ? 131 MET D CA  1 
ATOM   4680  C  C   . MET D  1 131 ? 7.159   8.305   -12.664 1.00 5.35   ? 131 MET D C   1 
ATOM   4681  O  O   . MET D  1 131 ? 6.567   7.724   -11.738 1.00 4.02   ? 131 MET D O   1 
ATOM   4682  C  CB  . MET D  1 131 ? 8.980   9.893   -12.825 1.00 13.19  ? 131 MET D CB  1 
ATOM   4683  C  CG  . MET D  1 131 ? 9.973   10.417  -11.809 1.00 18.05  ? 131 MET D CG  1 
ATOM   4684  S  SD  . MET D  1 131 ? 9.567   12.065  -11.298 1.00 15.75  ? 131 MET D SD  1 
ATOM   4685  C  CE  . MET D  1 131 ? 8.461   12.803  -12.488 1.00 13.98  ? 131 MET D CE  1 
ATOM   4686  N  N   . LEU D  1 132 ? 6.614   8.897   -13.698 1.00 3.28   ? 132 LEU D N   1 
ATOM   4687  C  CA  . LEU D  1 132 ? 5.183   8.970   -13.921 1.00 4.88   ? 132 LEU D CA  1 
ATOM   4688  C  C   . LEU D  1 132 ? 4.560   7.582   -13.817 1.00 7.20   ? 132 LEU D C   1 
ATOM   4689  O  O   . LEU D  1 132 ? 3.476   7.399   -13.257 1.00 7.32   ? 132 LEU D O   1 
ATOM   4690  C  CB  . LEU D  1 132 ? 4.907   9.534   -15.316 1.00 5.84   ? 132 LEU D CB  1 
ATOM   4691  C  CG  . LEU D  1 132 ? 4.728   11.058  -15.342 1.00 10.84  ? 132 LEU D CG  1 
ATOM   4692  C  CD1 . LEU D  1 132 ? 5.176   11.747  -14.052 1.00 7.27   ? 132 LEU D CD1 1 
ATOM   4693  C  CD2 . LEU D  1 132 ? 5.517   11.727  -16.473 1.00 5.86   ? 132 LEU D CD2 1 
ATOM   4694  N  N   . ILE D  1 133 ? 5.243   6.594   -14.348 1.00 3.41   ? 133 ILE D N   1 
ATOM   4695  C  CA  . ILE D  1 133 ? 4.687   5.246   -14.338 1.00 3.76   ? 133 ILE D CA  1 
ATOM   4696  C  C   . ILE D  1 133 ? 4.524   4.756   -12.916 1.00 8.23   ? 133 ILE D C   1 
ATOM   4697  O  O   . ILE D  1 133 ? 3.501   4.244   -12.486 1.00 7.64   ? 133 ILE D O   1 
ATOM   4698  C  CB  . ILE D  1 133 ? 5.509   4.326   -15.207 1.00 5.45   ? 133 ILE D CB  1 
ATOM   4699  C  CG1 . ILE D  1 133 ? 5.498   4.831   -16.650 1.00 7.44   ? 133 ILE D CG1 1 
ATOM   4700  C  CG2 . ILE D  1 133 ? 4.964   2.890   -15.203 1.00 2.34   ? 133 ILE D CG2 1 
ATOM   4701  C  CD1 . ILE D  1 133 ? 5.893   3.782   -17.673 1.00 1.57   ? 133 ILE D CD1 1 
ATOM   4702  N  N   . ALA D  1 134 ? 5.565   4.973   -12.142 1.00 4.20   ? 134 ALA D N   1 
ATOM   4703  C  CA  . ALA D  1 134 ? 5.540   4.544   -10.753 1.00 5.06   ? 134 ALA D CA  1 
ATOM   4704  C  C   . ALA D  1 134 ? 4.464   5.323   -10.001 1.00 6.45   ? 134 ALA D C   1 
ATOM   4705  O  O   . ALA D  1 134 ? 3.669   4.718   -9.305  1.00 9.84   ? 134 ALA D O   1 
ATOM   4706  C  CB  . ALA D  1 134 ? 6.937   4.717   -10.138 1.00 1.53   ? 134 ALA D CB  1 
ATOM   4707  N  N   . PHE D  1 135 ? 4.367   6.634   -10.163 1.00 1.00   ? 135 PHE D N   1 
ATOM   4708  C  CA  . PHE D  1 135 ? 3.238   7.260   -9.479  1.00 2.53   ? 135 PHE D CA  1 
ATOM   4709  C  C   . PHE D  1 135 ? 1.891   6.668   -9.948  1.00 5.57   ? 135 PHE D C   1 
ATOM   4710  O  O   . PHE D  1 135 ? 0.962   6.397   -9.167  1.00 8.05   ? 135 PHE D O   1 
ATOM   4711  C  CB  . PHE D  1 135 ? 3.172   8.735   -9.822  1.00 8.83   ? 135 PHE D CB  1 
ATOM   4712  C  CG  . PHE D  1 135 ? 4.371   9.501   -9.356  1.00 19.12  ? 135 PHE D CG  1 
ATOM   4713  C  CD1 . PHE D  1 135 ? 5.289   8.924   -8.473  1.00 22.99  ? 135 PHE D CD1 1 
ATOM   4714  C  CD2 . PHE D  1 135 ? 4.615   10.795  -9.829  1.00 22.86  ? 135 PHE D CD2 1 
ATOM   4715  C  CE1 . PHE D  1 135 ? 6.415   9.645   -8.039  1.00 21.55  ? 135 PHE D CE1 1 
ATOM   4716  C  CE2 . PHE D  1 135 ? 5.718   11.528  -9.374  1.00 18.56  ? 135 PHE D CE2 1 
ATOM   4717  C  CZ  . PHE D  1 135 ? 6.633   10.945  -8.495  1.00 12.94  ? 135 PHE D CZ  1 
ATOM   4718  N  N   . LYS D  1 136 ? 1.782   6.447   -11.254 1.00 4.27   ? 136 LYS D N   1 
ATOM   4719  C  CA  . LYS D  1 136 ? 0.517   5.891   -11.751 1.00 4.42   ? 136 LYS D CA  1 
ATOM   4720  C  C   . LYS D  1 136 ? 0.145   4.594   -11.052 1.00 2.86   ? 136 LYS D C   1 
ATOM   4721  O  O   . LYS D  1 136 ? -0.988  4.348   -10.647 1.00 2.27   ? 136 LYS D O   1 
ATOM   4722  C  CB  . LYS D  1 136 ? 0.464   5.751   -13.284 1.00 3.03   ? 136 LYS D CB  1 
ATOM   4723  C  CG  . LYS D  1 136 ? -0.972  5.485   -13.699 1.00 10.16  ? 136 LYS D CG  1 
ATOM   4724  C  CD  . LYS D  1 136 ? -1.246  5.526   -15.194 1.00 5.94   ? 136 LYS D CD  1 
ATOM   4725  C  CE  . LYS D  1 136 ? -1.387  4.134   -15.780 1.00 42.15  ? 136 LYS D CE  1 
ATOM   4726  N  NZ  . LYS D  1 136 ? -2.699  3.503   -15.492 1.00 14.98  ? 136 LYS D NZ  1 
ATOM   4727  N  N   . ALA D  1 137 ? 1.181   3.781   -10.906 1.00 1.00   ? 137 ALA D N   1 
ATOM   4728  C  CA  . ALA D  1 137 ? 0.943   2.494   -10.278 1.00 2.10   ? 137 ALA D CA  1 
ATOM   4729  C  C   . ALA D  1 137 ? 0.237   2.678   -8.941  1.00 7.93   ? 137 ALA D C   1 
ATOM   4730  O  O   . ALA D  1 137 ? -0.774  2.018   -8.672  1.00 9.08   ? 137 ALA D O   1 
ATOM   4731  C  CB  . ALA D  1 137 ? 2.263   1.765   -10.060 1.00 1.33   ? 137 ALA D CB  1 
ATOM   4732  N  N   . SER D  1 138 ? 0.773   3.601   -8.155  1.00 2.19   ? 138 SER D N   1 
ATOM   4733  C  CA  . SER D  1 138 ? 0.190   3.858   -6.843  1.00 1.00   ? 138 SER D CA  1 
ATOM   4734  C  C   . SER D  1 138 ? -1.252  4.437   -6.881  1.00 6.31   ? 138 SER D C   1 
ATOM   4735  O  O   . SER D  1 138 ? -2.184  3.970   -6.210  1.00 3.74   ? 138 SER D O   1 
ATOM   4736  C  CB  . SER D  1 138 ? 1.121   4.841   -6.143  1.00 1.00   ? 138 SER D CB  1 
ATOM   4737  O  OG  . SER D  1 138 ? 0.452   5.226   -4.957  1.00 36.95  ? 138 SER D OG  1 
ATOM   4738  N  N   . ILE D  1 139 ? -1.429  5.429   -7.746  1.00 2.88   ? 139 ILE D N   1 
ATOM   4739  C  CA  . ILE D  1 139 ? -2.769  6.004   -7.932  1.00 2.77   ? 139 ILE D CA  1 
ATOM   4740  C  C   . ILE D  1 139 ? -3.838  4.948   -8.247  1.00 5.65   ? 139 ILE D C   1 
ATOM   4741  O  O   . ILE D  1 139 ? -4.915  4.875   -7.619  1.00 4.35   ? 139 ILE D O   1 
ATOM   4742  C  CB  . ILE D  1 139 ? -2.719  7.041   -9.047  1.00 4.67   ? 139 ILE D CB  1 
ATOM   4743  C  CG1 . ILE D  1 139 ? -1.862  8.196   -8.557  1.00 3.99   ? 139 ILE D CG1 1 
ATOM   4744  C  CG2 . ILE D  1 139 ? -4.097  7.441   -9.438  1.00 3.35   ? 139 ILE D CG2 1 
ATOM   4745  C  CD1 . ILE D  1 139 ? -1.401  9.094   -9.629  1.00 5.64   ? 139 ILE D CD1 1 
ATOM   4746  N  N   . ASP D  1 140 ? -3.490  4.054   -9.167  1.00 3.05   ? 140 ASP D N   1 
ATOM   4747  C  CA  . ASP D  1 140 ? -4.392  2.964   -9.562  1.00 4.25   ? 140 ASP D CA  1 
ATOM   4748  C  C   . ASP D  1 140 ? -4.769  2.066   -8.389  1.00 6.70   ? 140 ASP D C   1 
ATOM   4749  O  O   . ASP D  1 140 ? -5.880  1.554   -8.306  1.00 8.11   ? 140 ASP D O   1 
ATOM   4750  C  CB  . ASP D  1 140 ? -3.757  2.071   -10.642 1.00 8.84   ? 140 ASP D CB  1 
ATOM   4751  C  CG  . ASP D  1 140 ? -3.690  2.737   -12.026 1.00 21.83  ? 140 ASP D CG  1 
ATOM   4752  O  OD1 . ASP D  1 140 ? -4.470  3.706   -12.263 1.00 12.25  ? 140 ASP D OD1 1 
ATOM   4753  O  OD2 . ASP D  1 140 ? -2.884  2.236   -12.874 1.00 16.01  ? 140 ASP D OD2 1 
ATOM   4754  N  N   . LYS D  1 141 ? -3.815  1.855   -7.486  1.00 5.46   ? 141 LYS D N   1 
ATOM   4755  C  CA  . LYS D  1 141 ? -4.082  0.980   -6.348  1.00 3.89   ? 141 LYS D CA  1 
ATOM   4756  C  C   . LYS D  1 141 ? -5.007  1.745   -5.421  1.00 3.76   ? 141 LYS D C   1 
ATOM   4757  O  O   . LYS D  1 141 ? -6.012  1.223   -4.931  1.00 7.73   ? 141 LYS D O   1 
ATOM   4758  C  CB  . LYS D  1 141 ? -2.758  0.643   -5.646  1.00 4.49   ? 141 LYS D CB  1 
ATOM   4759  C  CG  . LYS D  1 141 ? -2.860  -0.363  -4.504  1.00 46.13  ? 141 LYS D CG  1 
ATOM   4760  C  CD  . LYS D  1 141 ? -1.544  -0.395  -3.756  1.00 84.17  ? 141 LYS D CD  1 
ATOM   4761  C  CE  . LYS D  1 141 ? -1.587  -1.155  -2.449  0.00 100.00 ? 141 LYS D CE  1 
ATOM   4762  N  NZ  . LYS D  1 141 ? -1.677  -2.626  -2.607  0.00 100.00 ? 141 LYS D NZ  1 
ATOM   4763  N  N   . HIS D  1 142 ? -4.678  3.016   -5.236  1.00 1.92   ? 142 HIS D N   1 
ATOM   4764  C  CA  . HIS D  1 142 ? -5.550  3.789   -4.371  1.00 2.81   ? 142 HIS D CA  1 
ATOM   4765  C  C   . HIS D  1 142 ? -6.957  3.814   -4.940  1.00 5.77   ? 142 HIS D C   1 
ATOM   4766  O  O   . HIS D  1 142 ? -7.940  3.678   -4.204  1.00 5.88   ? 142 HIS D O   1 
ATOM   4767  C  CB  . HIS D  1 142 ? -5.081  5.247   -4.321  1.00 3.56   ? 142 HIS D CB  1 
ATOM   4768  C  CG  . HIS D  1 142 ? -3.848  5.431   -3.495  1.00 6.85   ? 142 HIS D CG  1 
ATOM   4769  N  ND1 . HIS D  1 142 ? -3.752  4.973   -2.193  1.00 8.24   ? 142 HIS D ND1 1 
ATOM   4770  C  CD2 . HIS D  1 142 ? -2.660  6.026   -3.765  1.00 7.03   ? 142 HIS D CD2 1 
ATOM   4771  C  CE1 . HIS D  1 142 ? -2.566  5.288   -1.698  1.00 5.63   ? 142 HIS D CE1 1 
ATOM   4772  N  NE2 . HIS D  1 142 ? -1.882  5.917   -2.639  1.00 6.86   ? 142 HIS D NE2 1 
ATOM   4773  N  N   . ILE D  1 143 ? -7.050  4.055   -6.246  1.00 2.98   ? 143 ILE D N   1 
ATOM   4774  C  CA  . ILE D  1 143 ? -8.378  4.097   -6.862  1.00 4.32   ? 143 ILE D CA  1 
ATOM   4775  C  C   . ILE D  1 143 ? -9.093  2.784   -6.619  1.00 8.18   ? 143 ILE D C   1 
ATOM   4776  O  O   . ILE D  1 143 ? -10.247 2.787   -6.261  1.00 4.66   ? 143 ILE D O   1 
ATOM   4777  C  CB  . ILE D  1 143 ? -8.257  4.414   -8.337  1.00 8.70   ? 143 ILE D CB  1 
ATOM   4778  C  CG1 . ILE D  1 143 ? -7.879  5.867   -8.583  1.00 2.61   ? 143 ILE D CG1 1 
ATOM   4779  C  CG2 . ILE D  1 143 ? -9.518  4.075   -9.040  1.00 8.16   ? 143 ILE D CG2 1 
ATOM   4780  C  CD1 . ILE D  1 143 ? -7.560  6.058   -10.069 1.00 1.56   ? 143 ILE D CD1 1 
ATOM   4781  N  N   . TRP D  1 144 ? -8.419  1.651   -6.701  1.00 1.55   ? 144 TRP D N   1 
ATOM   4782  C  CA  . TRP D  1 144 ? -9.124  0.404   -6.387  1.00 1.00   ? 144 TRP D CA  1 
ATOM   4783  C  C   . TRP D  1 144 ? -9.637  0.385   -4.914  1.00 8.94   ? 144 TRP D C   1 
ATOM   4784  O  O   . TRP D  1 144 ? -10.793 0.016   -4.596  1.00 9.61   ? 144 TRP D O   1 
ATOM   4785  C  CB  . TRP D  1 144 ? -8.203  -0.797  -6.667  1.00 2.70   ? 144 TRP D CB  1 
ATOM   4786  C  CG  . TRP D  1 144 ? -8.517  -2.016  -5.829  1.00 6.24   ? 144 TRP D CG  1 
ATOM   4787  C  CD1 . TRP D  1 144 ? -9.696  -2.678  -5.769  1.00 9.59   ? 144 TRP D CD1 1 
ATOM   4788  C  CD2 . TRP D  1 144 ? -7.625  -2.709  -4.938  1.00 4.93   ? 144 TRP D CD2 1 
ATOM   4789  N  NE1 . TRP D  1 144 ? -9.611  -3.718  -4.875  1.00 8.43   ? 144 TRP D NE1 1 
ATOM   4790  C  CE2 . TRP D  1 144 ? -8.348  -3.769  -4.355  1.00 8.52   ? 144 TRP D CE2 1 
ATOM   4791  C  CE3 . TRP D  1 144 ? -6.282  -2.519  -4.563  1.00 4.65   ? 144 TRP D CE3 1 
ATOM   4792  C  CZ2 . TRP D  1 144 ? -7.797  -4.643  -3.409  1.00 6.64   ? 144 TRP D CZ2 1 
ATOM   4793  C  CZ3 . TRP D  1 144 ? -5.751  -3.359  -3.581  1.00 6.00   ? 144 TRP D CZ3 1 
ATOM   4794  C  CH2 . TRP D  1 144 ? -6.494  -4.438  -3.051  1.00 7.28   ? 144 TRP D CH2 1 
ATOM   4795  N  N   . MET D  1 145 ? -8.755  0.812   -4.009  1.00 4.70   ? 145 MET D N   1 
ATOM   4796  C  CA  . MET D  1 145 ? -9.131  0.759   -2.591  1.00 3.54   ? 145 MET D CA  1 
ATOM   4797  C  C   . MET D  1 145 ? -10.288 1.718   -2.248  1.00 10.60  ? 145 MET D C   1 
ATOM   4798  O  O   . MET D  1 145 ? -11.299 1.345   -1.640  1.00 7.70   ? 145 MET D O   1 
ATOM   4799  C  CB  . MET D  1 145 ? -7.905  0.895   -1.688  1.00 2.68   ? 145 MET D CB  1 
ATOM   4800  C  CG  . MET D  1 145 ? -6.910  -0.255  -1.862  1.00 9.07   ? 145 MET D CG  1 
ATOM   4801  S  SD  . MET D  1 145 ? -5.468  -0.274  -0.737  1.00 13.06  ? 145 MET D SD  1 
ATOM   4802  C  CE  . MET D  1 145 ? -4.756  1.261   -1.306  1.00 19.28  ? 145 MET D CE  1 
ATOM   4803  N  N   . PHE D  1 146 ? -10.153 2.981   -2.639  1.00 5.39   ? 146 PHE D N   1 
ATOM   4804  C  CA  . PHE D  1 146 ? -11.226 3.890   -2.294  1.00 6.17   ? 146 PHE D CA  1 
ATOM   4805  C  C   . PHE D  1 146 ? -12.524 3.474   -2.943  1.00 10.11  ? 146 PHE D C   1 
ATOM   4806  O  O   . PHE D  1 146 ? -13.555 3.623   -2.304  1.00 9.52   ? 146 PHE D O   1 
ATOM   4807  C  CB  . PHE D  1 146 ? -10.865 5.356   -2.508  1.00 6.65   ? 146 PHE D CB  1 
ATOM   4808  C  CG  . PHE D  1 146 ? -9.891  5.856   -1.479  1.00 9.59   ? 146 PHE D CG  1 
ATOM   4809  C  CD1 . PHE D  1 146 ? -10.337 6.159   -0.198  1.00 9.50   ? 146 PHE D CD1 1 
ATOM   4810  C  CD2 . PHE D  1 146 ? -8.521  5.860   -1.709  1.00 9.44   ? 146 PHE D CD2 1 
ATOM   4811  C  CE1 . PHE D  1 146 ? -9.458  6.576   0.794   1.00 8.90   ? 146 PHE D CE1 1 
ATOM   4812  C  CE2 . PHE D  1 146 ? -7.639  6.283   -0.713  1.00 12.39  ? 146 PHE D CE2 1 
ATOM   4813  C  CZ  . PHE D  1 146 ? -8.107  6.615   0.549   1.00 10.67  ? 146 PHE D CZ  1 
ATOM   4814  N  N   . LYS D  1 147 ? -12.468 2.878   -4.134  1.00 2.46   ? 147 LYS D N   1 
ATOM   4815  C  CA  . LYS D  1 147 ? -13.699 2.433   -4.757  1.00 3.10   ? 147 LYS D CA  1 
ATOM   4816  C  C   . LYS D  1 147 ? -14.306 1.271   -4.008  1.00 9.67   ? 147 LYS D C   1 
ATOM   4817  O  O   . LYS D  1 147 ? -15.517 1.211   -3.853  1.00 10.09  ? 147 LYS D O   1 
ATOM   4818  C  CB  . LYS D  1 147 ? -13.573 2.146   -6.265  1.00 7.22   ? 147 LYS D CB  1 
ATOM   4819  C  CG  . LYS D  1 147 ? -13.441 3.418   -7.135  1.00 6.99   ? 147 LYS D CG  1 
ATOM   4820  C  CD  . LYS D  1 147 ? -14.304 3.419   -8.380  1.00 26.63  ? 147 LYS D CD  1 
ATOM   4821  C  CE  . LYS D  1 147 ? -14.580 4.830   -8.853  1.00 14.24  ? 147 LYS D CE  1 
ATOM   4822  N  NZ  . LYS D  1 147 ? -15.568 4.928   -9.973  1.00 60.39  ? 147 LYS D NZ  1 
ATOM   4823  N  N   . ALA D  1 148 ? -13.471 0.353   -3.550  1.00 4.99   ? 148 ALA D N   1 
ATOM   4824  C  CA  . ALA D  1 148 ? -14.043 -0.772  -2.810  1.00 3.92   ? 148 ALA D CA  1 
ATOM   4825  C  C   . ALA D  1 148 ? -14.663 -0.186  -1.545  1.00 7.88   ? 148 ALA D C   1 
ATOM   4826  O  O   . ALA D  1 148 ? -15.661 -0.697  -1.045  1.00 6.94   ? 148 ALA D O   1 
ATOM   4827  C  CB  . ALA D  1 148 ? -12.955 -1.789  -2.403  1.00 4.01   ? 148 ALA D CB  1 
ATOM   4828  N  N   . PHE D  1 149 ? -14.035 0.850   -1.001  1.00 4.63   ? 149 PHE D N   1 
ATOM   4829  C  CA  . PHE D  1 149 ? -14.552 1.417   0.227   1.00 3.97   ? 149 PHE D CA  1 
ATOM   4830  C  C   . PHE D  1 149 ? -15.972 1.914   -0.063  1.00 14.76  ? 149 PHE D C   1 
ATOM   4831  O  O   . PHE D  1 149 ? -16.913 1.728   0.727   1.00 13.33  ? 149 PHE D O   1 
ATOM   4832  C  CB  . PHE D  1 149 ? -13.676 2.585   0.690   1.00 4.98   ? 149 PHE D CB  1 
ATOM   4833  C  CG  . PHE D  1 149 ? -14.329 3.421   1.771   1.00 8.29   ? 149 PHE D CG  1 
ATOM   4834  C  CD1 . PHE D  1 149 ? -14.343 3.016   3.089   1.00 6.24   ? 149 PHE D CD1 1 
ATOM   4835  C  CD2 . PHE D  1 149 ? -14.972 4.591   1.466   1.00 7.60   ? 149 PHE D CD2 1 
ATOM   4836  C  CE1 . PHE D  1 149 ? -14.931 3.812   4.040   1.00 5.29   ? 149 PHE D CE1 1 
ATOM   4837  C  CE2 . PHE D  1 149 ? -15.557 5.380   2.422   1.00 6.20   ? 149 PHE D CE2 1 
ATOM   4838  C  CZ  . PHE D  1 149 ? -15.559 4.976   3.708   1.00 5.75   ? 149 PHE D CZ  1 
ATOM   4839  N  N   . LEU D  1 150 ? -16.115 2.537   -1.223  1.00 10.94  ? 150 LEU D N   1 
ATOM   4840  C  CA  . LEU D  1 150 ? -17.392 3.043   -1.686  1.00 8.16   ? 150 LEU D CA  1 
ATOM   4841  C  C   . LEU D  1 150 ? -18.327 1.960   -2.209  1.00 21.93  ? 150 LEU D C   1 
ATOM   4842  O  O   . LEU D  1 150 ? -19.411 2.220   -2.713  1.00 19.35  ? 150 LEU D O   1 
ATOM   4843  C  CB  . LEU D  1 150 ? -17.164 4.039   -2.814  1.00 3.16   ? 150 LEU D CB  1 
ATOM   4844  C  CG  . LEU D  1 150 ? -16.511 5.291   -2.227  1.00 8.64   ? 150 LEU D CG  1 
ATOM   4845  C  CD1 . LEU D  1 150 ? -16.072 6.233   -3.300  1.00 9.15   ? 150 LEU D CD1 1 
ATOM   4846  C  CD2 . LEU D  1 150 ? -17.581 6.044   -1.464  1.00 8.09   ? 150 LEU D CD2 1 
ATOM   4847  N  N   . GLY D  1 151 ? -17.919 0.705   -2.123  1.00 14.51  ? 151 GLY D N   1 
ATOM   4848  C  CA  . GLY D  1 151 ? -18.759 -0.389  -2.627  1.00 10.15  ? 151 GLY D CA  1 
ATOM   4849  C  C   . GLY D  1 151 ? -18.760 -0.567  -4.153  1.00 17.80  ? 151 GLY D C   1 
ATOM   4850  O  O   . GLY D  1 151 ? -19.605 -1.284  -4.688  1.00 24.05  ? 151 GLY D O   1 
ATOM   4851  N  N   . LYS D  1 152 ? -17.837 0.097   -4.833  1.00 15.72  ? 152 LYS D N   1 
ATOM   4852  C  CA  . LYS D  1 152 ? -17.757 0.068   -6.289  1.00 9.41   ? 152 LYS D CA  1 
ATOM   4853  C  C   . LYS D  1 152 ? -16.566 -0.738  -6.822  1.00 17.05  ? 152 LYS D C   1 
ATOM   4854  O  O   . LYS D  1 152 ? -15.644 -1.024  -6.049  1.00 15.24  ? 152 LYS D O   1 
ATOM   4855  C  CB  . LYS D  1 152 ? -17.726 1.503   -6.812  1.00 14.41  ? 152 LYS D CB  1 
ATOM   4856  C  CG  . LYS D  1 152 ? -18.958 2.324   -6.479  1.00 63.05  ? 152 LYS D CG  1 
ATOM   4857  C  CD  . LYS D  1 152 ? -20.184 1.582   -6.983  0.00 100.00 ? 152 LYS D CD  1 
ATOM   4858  C  CE  . LYS D  1 152 ? -21.523 2.192   -6.555  0.00 100.00 ? 152 LYS D CE  1 
ATOM   4859  N  NZ  . LYS D  1 152 ? -22.676 1.370   -6.978  0.00 100.00 ? 152 LYS D NZ  1 
ATOM   4860  N  N   . ALA D  1 153 ? -16.610 -1.093  -8.107  1.00 16.09  ? 153 ALA D N   1 
ATOM   4861  C  CA  . ALA D  1 153 ? -15.535 -1.791  -8.803  1.00 10.16  ? 153 ALA D CA  1 
ATOM   4862  C  C   . ALA D  1 153 ? -14.634 -0.643  -9.184  1.00 15.08  ? 153 ALA D C   1 
ATOM   4863  O  O   . ALA D  1 153 ? -15.134 0.471   -9.347  1.00 11.41  ? 153 ALA D O   1 
ATOM   4864  C  CB  . ALA D  1 153 ? -16.035 -2.455  -10.061 1.00 7.71   ? 153 ALA D CB  1 
ATOM   4865  N  N   . PRO D  1 154 ? -13.334 -0.892  -9.345  1.00 14.36  ? 154 PRO D N   1 
ATOM   4866  C  CA  . PRO D  1 154 ? -12.372 0.168   -9.649  1.00 9.88   ? 154 PRO D CA  1 
ATOM   4867  C  C   . PRO D  1 154 ? -12.689 1.029   -10.839 1.00 13.31  ? 154 PRO D C   1 
ATOM   4868  O  O   . PRO D  1 154 ? -12.685 2.290   -10.710 1.00 16.44  ? 154 PRO D O   1 
ATOM   4869  C  CB  . PRO D  1 154 ? -11.079 -0.616  -9.896  1.00 11.09  ? 154 PRO D CB  1 
ATOM   4870  C  CG  . PRO D  1 154 ? -11.369 -2.093  -9.687  1.00 12.99  ? 154 PRO D CG  1 
ATOM   4871  C  CD  . PRO D  1 154 ? -12.822 -2.264  -9.352  1.00 10.78  ? 154 PRO D CD  1 
ATOM   4872  N  N   . LEU D  1 155 ? -12.932 0.417   -11.976 1.00 18.30  ? 155 LEU D N   1 
ATOM   4873  C  CA  . LEU D  1 155 ? -13.133 1.197   -13.207 1.00 19.80  ? 155 LEU D CA  1 
ATOM   4874  C  C   . LEU D  1 155 ? -14.573 1.703   -13.319 1.00 43.56  ? 155 LEU D C   1 
ATOM   4875  O  O   . LEU D  1 155 ? -15.090 1.923   -14.428 1.00 35.66  ? 155 LEU D O   1 
ATOM   4876  C  CB  . LEU D  1 155 ? -12.613 0.405   -14.373 1.00 19.08  ? 155 LEU D CB  1 
ATOM   4877  C  CG  . LEU D  1 155 ? -11.124 0.140   -14.157 1.00 28.74  ? 155 LEU D CG  1 
ATOM   4878  C  CD1 . LEU D  1 155 ? -10.437 -0.480  -15.360 1.00 23.20  ? 155 LEU D CD1 1 
ATOM   4879  C  CD2 . LEU D  1 155 ? -10.337 1.416   -13.812 1.00 19.17  ? 155 LEU D CD2 1 
ATOM   4880  N  N   . GLU D  1 156 ? -15.128 1.851   -12.141 1.00 39.46  ? 156 GLU D N   1 
ATOM   4881  C  CA  . GLU D  1 156 ? -16.379 2.564   -11.912 1.00 1.00   ? 156 GLU D CA  1 
ATOM   4882  C  C   . GLU D  1 156 ? -17.652 1.620   -11.727 0.00 100.00 ? 156 GLU D C   1 
ATOM   4883  O  O   . GLU D  1 156 ? -18.852 1.661   -11.763 0.00 100.00 ? 156 GLU D O   1 
ATOM   4884  C  CB  . GLU D  1 156 ? -16.362 3.746   -12.889 0.00 100.00 ? 156 GLU D CB  1 
ATOM   4885  C  CG  . GLU D  1 156 ? -15.041 4.546   -12.649 1.00 70.01  ? 156 GLU D CG  1 
ATOM   4886  C  CD  . GLU D  1 156 ? -14.802 5.794   -13.515 0.00 100.00 ? 156 GLU D CD  1 
ATOM   4887  O  OE1 . GLU D  1 156 ? -15.649 6.762   -13.514 0.00 100.00 ? 156 GLU D OE1 1 
ATOM   4888  O  OE2 . GLU D  1 156 ? -13.726 5.887   -14.230 0.00 100.00 ? 156 GLU D OE2 1 
ATOM   4889  N  N   . VAL E  1 7   ? -15.968 -24.646 41.034  1.00 75.57  ? 7   VAL E N   1 
ATOM   4890  C  CA  . VAL E  1 7   ? -16.924 -23.593 40.714  1.00 74.05  ? 7   VAL E CA  1 
ATOM   4891  C  C   . VAL E  1 7   ? -17.295 -23.847 39.260  1.00 67.75  ? 7   VAL E C   1 
ATOM   4892  O  O   . VAL E  1 7   ? -18.113 -24.719 38.938  1.00 76.69  ? 7   VAL E O   1 
ATOM   4893  C  CB  . VAL E  1 7   ? -16.222 -22.178 40.602  1.00 76.95  ? 7   VAL E CB  1 
ATOM   4894  C  CG1 . VAL E  1 7   ? -17.206 -21.014 40.732  1.00 74.78  ? 7   VAL E CG1 1 
ATOM   4895  C  CG2 . VAL E  1 7   ? -15.151 -21.956 41.671  1.00 78.68  ? 7   VAL E CG2 1 
ATOM   4896  N  N   . ASP E  1 8   ? -16.619 -23.061 38.457  1.00 37.34  ? 8   ASP E N   1 
ATOM   4897  C  CA  . ASP E  1 8   ? -16.621 -23.175 37.008  1.00 28.09  ? 8   ASP E CA  1 
ATOM   4898  C  C   . ASP E  1 8   ? -15.620 -22.190 36.480  1.00 15.50  ? 8   ASP E C   1 
ATOM   4899  O  O   . ASP E  1 8   ? -15.307 -21.172 37.085  1.00 12.46  ? 8   ASP E O   1 
ATOM   4900  C  CB  . ASP E  1 8   ? -18.054 -23.146 36.445  1.00 26.84  ? 8   ASP E CB  1 
ATOM   4901  C  CG  . ASP E  1 8   ? -18.479 -21.841 35.802  1.00 34.73  ? 8   ASP E CG  1 
ATOM   4902  O  OD1 . ASP E  1 8   ? -17.922 -20.749 36.169  1.00 44.62  ? 8   ASP E OD1 1 
ATOM   4903  O  OD2 . ASP E  1 8   ? -19.418 -21.839 34.917  1.00 46.79  ? 8   ASP E OD2 1 
ATOM   4904  N  N   . THR E  1 9   ? -15.160 -22.486 35.278  1.00 7.94   ? 9   THR E N   1 
ATOM   4905  C  CA  . THR E  1 9   ? -14.149 -21.678 34.643  1.00 10.52  ? 9   THR E CA  1 
ATOM   4906  C  C   . THR E  1 9   ? -14.542 -20.239 34.542  1.00 10.57  ? 9   THR E C   1 
ATOM   4907  O  O   . THR E  1 9   ? -13.781 -19.405 35.010  1.00 9.61   ? 9   THR E O   1 
ATOM   4908  C  CB  . THR E  1 9   ? -13.722 -22.263 33.297  1.00 18.86  ? 9   THR E CB  1 
ATOM   4909  O  OG1 . THR E  1 9   ? -13.200 -23.579 33.538  1.00 15.24  ? 9   THR E OG1 1 
ATOM   4910  C  CG2 . THR E  1 9   ? -12.665 -21.406 32.627  1.00 16.44  ? 9   THR E CG2 1 
ATOM   4911  N  N   . LYS E  1 10  ? -15.746 -19.988 34.056  1.00 2.55   ? 10  LYS E N   1 
ATOM   4912  C  CA  . LYS E  1 10  ? -16.133 -18.603 33.909  1.00 3.81   ? 10  LYS E CA  1 
ATOM   4913  C  C   . LYS E  1 10  ? -16.163 -17.874 35.212  1.00 12.76  ? 10  LYS E C   1 
ATOM   4914  O  O   . LYS E  1 10  ? -15.691 -16.741 35.309  1.00 18.64  ? 10  LYS E O   1 
ATOM   4915  C  CB  . LYS E  1 10  ? -17.497 -18.487 33.282  1.00 2.76   ? 10  LYS E CB  1 
ATOM   4916  C  CG  . LYS E  1 10  ? -17.606 -19.193 31.937  1.00 6.37   ? 10  LYS E CG  1 
ATOM   4917  C  CD  . LYS E  1 10  ? -18.900 -18.709 31.289  1.00 11.35  ? 10  LYS E CD  1 
ATOM   4918  C  CE  . LYS E  1 10  ? -19.272 -19.592 30.107  1.00 56.26  ? 10  LYS E CE  1 
ATOM   4919  N  NZ  . LYS E  1 10  ? -20.656 -19.332 29.605  1.00 93.75  ? 10  LYS E NZ  1 
ATOM   4920  N  N   . GLU E  1 11  ? -16.653 -18.547 36.251  1.00 10.30  ? 11  GLU E N   1 
ATOM   4921  C  CA  . GLU E  1 11  ? -16.645 -17.880 37.550  1.00 12.77  ? 11  GLU E CA  1 
ATOM   4922  C  C   . GLU E  1 11  ? -15.218 -17.696 38.035  1.00 11.01  ? 11  GLU E C   1 
ATOM   4923  O  O   . GLU E  1 11  ? -14.921 -16.711 38.710  1.00 9.40   ? 11  GLU E O   1 
ATOM   4924  C  CB  . GLU E  1 11  ? -17.400 -18.646 38.629  1.00 18.20  ? 11  GLU E CB  1 
ATOM   4925  C  CG  . GLU E  1 11  ? -18.886 -18.342 38.710  1.00 72.56  ? 11  GLU E CG  1 
ATOM   4926  C  CD  . GLU E  1 11  ? -19.648 -18.483 37.411  0.00 100.00 ? 11  GLU E CD  1 
ATOM   4927  O  OE1 . GLU E  1 11  ? -19.370 -17.730 36.462  0.00 100.00 ? 11  GLU E OE1 1 
ATOM   4928  O  OE2 . GLU E  1 11  ? -20.569 -19.316 37.364  0.00 100.00 ? 11  GLU E OE2 1 
ATOM   4929  N  N   . PHE E  1 12  ? -14.382 -18.690 37.750  1.00 3.25   ? 12  PHE E N   1 
ATOM   4930  C  CA  . PHE E  1 12  ? -13.015 -18.602 38.228  1.00 3.71   ? 12  PHE E CA  1 
ATOM   4931  C  C   . PHE E  1 12  ? -12.317 -17.396 37.600  1.00 7.43   ? 12  PHE E C   1 
ATOM   4932  O  O   . PHE E  1 12  ? -11.730 -16.524 38.252  1.00 6.79   ? 12  PHE E O   1 
ATOM   4933  C  CB  . PHE E  1 12  ? -12.209 -19.882 37.987  1.00 5.35   ? 12  PHE E CB  1 
ATOM   4934  C  CG  . PHE E  1 12  ? -10.743 -19.720 38.331  1.00 11.18  ? 12  PHE E CG  1 
ATOM   4935  C  CD1 . PHE E  1 12  ? -10.277 -19.901 39.634  1.00 11.18  ? 12  PHE E CD1 1 
ATOM   4936  C  CD2 . PHE E  1 12  ? -9.844  -19.245 37.385  1.00 17.79  ? 12  PHE E CD2 1 
ATOM   4937  C  CE1 . PHE E  1 12  ? -8.938  -19.693 39.959  1.00 12.06  ? 12  PHE E CE1 1 
ATOM   4938  C  CE2 . PHE E  1 12  ? -8.512  -19.017 37.704  1.00 14.02  ? 12  PHE E CE2 1 
ATOM   4939  C  CZ  . PHE E  1 12  ? -8.050  -19.254 38.991  1.00 12.72  ? 12  PHE E CZ  1 
ATOM   4940  N  N   . LEU E  1 13  ? -12.407 -17.372 36.281  1.00 2.06   ? 13  LEU E N   1 
ATOM   4941  C  CA  . LEU E  1 13  ? -11.757 -16.299 35.556  1.00 3.18   ? 13  LEU E CA  1 
ATOM   4942  C  C   . LEU E  1 13  ? -12.271 -14.962 36.016  1.00 6.72   ? 13  LEU E C   1 
ATOM   4943  O  O   . LEU E  1 13  ? -11.476 -14.056 36.196  1.00 12.76  ? 13  LEU E O   1 
ATOM   4944  C  CB  . LEU E  1 13  ? -12.022 -16.447 34.065  1.00 2.67   ? 13  LEU E CB  1 
ATOM   4945  C  CG  . LEU E  1 13  ? -10.955 -17.045 33.182  1.00 7.28   ? 13  LEU E CG  1 
ATOM   4946  C  CD1 . LEU E  1 13  ? -10.003 -17.872 33.999  1.00 2.14   ? 13  LEU E CD1 1 
ATOM   4947  C  CD2 . LEU E  1 13  ? -11.577 -17.837 32.099  1.00 1.00   ? 13  LEU E CD2 1 
ATOM   4948  N  N   . ASN E  1 14  ? -13.575 -14.801 36.186  1.00 4.51   ? 14  ASN E N   1 
ATOM   4949  C  CA  . ASN E  1 14  ? -14.070 -13.480 36.549  1.00 6.90   ? 14  ASN E CA  1 
ATOM   4950  C  C   . ASN E  1 14  ? -13.551 -13.088 37.926  1.00 9.56   ? 14  ASN E C   1 
ATOM   4951  O  O   . ASN E  1 14  ? -13.238 -11.930 38.213  1.00 10.89  ? 14  ASN E O   1 
ATOM   4952  C  CB  . ASN E  1 14  ? -15.601 -13.415 36.472  1.00 3.74   ? 14  ASN E CB  1 
ATOM   4953  C  CG  . ASN E  1 14  ? -16.152 -12.109 35.874  1.00 21.52  ? 14  ASN E CG  1 
ATOM   4954  O  OD1 . ASN E  1 14  ? -15.465 -11.178 35.483  1.00 13.37  ? 14  ASN E OD1 1 
ATOM   4955  N  ND2 . ASN E  1 14  ? -17.471 -12.086 35.747  1.00 13.94  ? 14  ASN E ND2 1 
ATOM   4956  N  N   . HIS E  1 15  ? -13.440 -14.102 38.771  1.00 4.61   ? 15  HIS E N   1 
ATOM   4957  C  CA  . HIS E  1 15  ? -12.948 -13.779 40.084  1.00 6.51   ? 15  HIS E CA  1 
ATOM   4958  C  C   . HIS E  1 15  ? -11.551 -13.191 39.982  1.00 8.80   ? 15  HIS E C   1 
ATOM   4959  O  O   . HIS E  1 15  ? -11.223 -12.269 40.717  1.00 9.36   ? 15  HIS E O   1 
ATOM   4960  C  CB  . HIS E  1 15  ? -12.960 -15.033 40.941  1.00 10.46  ? 15  HIS E CB  1 
ATOM   4961  C  CG  . HIS E  1 15  ? -12.521 -14.776 42.347  1.00 18.49  ? 15  HIS E CG  1 
ATOM   4962  N  ND1 . HIS E  1 15  ? -11.359 -15.304 42.857  1.00 23.62  ? 15  HIS E ND1 1 
ATOM   4963  C  CD2 . HIS E  1 15  ? -13.040 -13.985 43.317  1.00 18.89  ? 15  HIS E CD2 1 
ATOM   4964  C  CE1 . HIS E  1 15  ? -11.193 -14.864 44.088  1.00 23.02  ? 15  HIS E CE1 1 
ATOM   4965  N  NE2 . HIS E  1 15  ? -12.200 -14.066 44.395  1.00 21.78  ? 15  HIS E NE2 1 
ATOM   4966  N  N   . GLN E  1 16  ? -10.729 -13.710 39.067  1.00 3.16   ? 16  GLN E N   1 
ATOM   4967  C  CA  . GLN E  1 16  ? -9.375  -13.182 38.832  1.00 2.53   ? 16  GLN E CA  1 
ATOM   4968  C  C   . GLN E  1 16  ? -9.368  -11.813 38.228  1.00 7.66   ? 16  GLN E C   1 
ATOM   4969  O  O   . GLN E  1 16  ? -8.530  -11.015 38.625  1.00 8.96   ? 16  GLN E O   1 
ATOM   4970  C  CB  . GLN E  1 16  ? -8.484  -14.144 38.062  1.00 1.00   ? 16  GLN E CB  1 
ATOM   4971  C  CG  . GLN E  1 16  ? -8.416  -15.512 38.781  1.00 7.49   ? 16  GLN E CG  1 
ATOM   4972  C  CD  . GLN E  1 16  ? -7.988  -15.410 40.251  1.00 18.44  ? 16  GLN E CD  1 
ATOM   4973  O  OE1 . GLN E  1 16  ? -7.324  -14.469 40.667  1.00 7.44   ? 16  GLN E OE1 1 
ATOM   4974  N  NE2 . GLN E  1 16  ? -8.401  -16.375 41.055  1.00 13.82  ? 16  GLN E NE2 1 
ATOM   4975  N  N   . VAL E  1 17  ? -10.318 -11.501 37.352  1.00 1.00   ? 17  VAL E N   1 
ATOM   4976  C  CA  . VAL E  1 17  ? -10.403 -10.142 36.837  1.00 1.20   ? 17  VAL E CA  1 
ATOM   4977  C  C   . VAL E  1 17  ? -10.587 -9.220  38.032  1.00 5.33   ? 17  VAL E C   1 
ATOM   4978  O  O   . VAL E  1 17  ? -9.965  -8.173  38.137  1.00 8.54   ? 17  VAL E O   1 
ATOM   4979  C  CB  . VAL E  1 17  ? -11.585 -9.959  35.881  1.00 2.75   ? 17  VAL E CB  1 
ATOM   4980  C  CG1 . VAL E  1 17  ? -11.789 -8.483  35.579  1.00 1.29   ? 17  VAL E CG1 1 
ATOM   4981  C  CG2 . VAL E  1 17  ? -11.417 -10.811 34.646  1.00 1.00   ? 17  VAL E CG2 1 
ATOM   4982  N  N   . ALA E  1 18  ? -11.370 -9.624  39.015  1.00 4.45   ? 18  ALA E N   1 
ATOM   4983  C  CA  . ALA E  1 18  ? -11.569 -8.782  40.179  1.00 4.10   ? 18  ALA E CA  1 
ATOM   4984  C  C   . ALA E  1 18  ? -10.254 -8.720  40.940  1.00 5.70   ? 18  ALA E C   1 
ATOM   4985  O  O   . ALA E  1 18  ? -9.771  -7.640  41.275  1.00 9.11   ? 18  ALA E O   1 
ATOM   4986  C  CB  . ALA E  1 18  ? -12.708 -9.325  41.069  1.00 2.93   ? 18  ALA E CB  1 
ATOM   4987  N  N   . ASN E  1 19  ? -9.670  -9.870  41.231  1.00 1.17   ? 19  ASN E N   1 
ATOM   4988  C  CA  . ASN E  1 19  ? -8.409  -9.856  41.973  1.00 2.11   ? 19  ASN E CA  1 
ATOM   4989  C  C   . ASN E  1 19  ? -7.282  -9.009  41.356  1.00 9.44   ? 19  ASN E C   1 
ATOM   4990  O  O   . ASN E  1 19  ? -6.590  -8.208  42.013  1.00 8.65   ? 19  ASN E O   1 
ATOM   4991  C  CB  . ASN E  1 19  ? -7.900  -11.302 42.083  1.00 4.62   ? 19  ASN E CB  1 
ATOM   4992  C  CG  . ASN E  1 19  ? -8.501  -12.052 43.224  1.00 13.54  ? 19  ASN E CG  1 
ATOM   4993  O  OD1 . ASN E  1 19  ? -9.162  -11.517 44.069  1.00 9.46   ? 19  ASN E OD1 1 
ATOM   4994  N  ND2 . ASN E  1 19  ? -8.207  -13.310 43.285  1.00 2.31   ? 19  ASN E ND2 1 
ATOM   4995  N  N   . LEU E  1 20  ? -7.101  -9.232  40.054  1.00 9.90   ? 20  LEU E N   1 
ATOM   4996  C  CA  . LEU E  1 20  ? -6.089  -8.541  39.294  1.00 7.02   ? 20  LEU E CA  1 
ATOM   4997  C  C   . LEU E  1 20  ? -6.255  -7.037  39.369  1.00 8.32   ? 20  LEU E C   1 
ATOM   4998  O  O   . LEU E  1 20  ? -5.271  -6.315  39.584  1.00 6.75   ? 20  LEU E O   1 
ATOM   4999  C  CB  . LEU E  1 20  ? -6.091  -9.116  37.903  1.00 4.99   ? 20  LEU E CB  1 
ATOM   5000  C  CG  . LEU E  1 20  ? -5.036  -10.173 37.556  1.00 4.18   ? 20  LEU E CG  1 
ATOM   5001  C  CD1 . LEU E  1 20  ? -4.132  -10.724 38.614  1.00 1.14   ? 20  LEU E CD1 1 
ATOM   5002  C  CD2 . LEU E  1 20  ? -5.530  -11.302 36.700  1.00 1.00   ? 20  LEU E CD2 1 
ATOM   5003  N  N   . ASN E  1 21  ? -7.485  -6.541  39.278  1.00 1.00   ? 21  ASN E N   1 
ATOM   5004  C  CA  . ASN E  1 21  ? -7.689  -5.107  39.403  1.00 1.00   ? 21  ASN E CA  1 
ATOM   5005  C  C   . ASN E  1 21  ? -7.375  -4.574  40.799  1.00 9.69   ? 21  ASN E C   1 
ATOM   5006  O  O   . ASN E  1 21  ? -6.922  -3.448  40.964  1.00 13.76  ? 21  ASN E O   1 
ATOM   5007  C  CB  . ASN E  1 21  ? -9.118  -4.763  39.016  1.00 6.69   ? 21  ASN E CB  1 
ATOM   5008  C  CG  . ASN E  1 21  ? -9.255  -4.561  37.562  1.00 20.67  ? 21  ASN E CG  1 
ATOM   5009  O  OD1 . ASN E  1 21  ? -8.861  -3.513  37.067  1.00 15.36  ? 21  ASN E OD1 1 
ATOM   5010  N  ND2 . ASN E  1 21  ? -9.593  -5.626  36.850  1.00 11.74  ? 21  ASN E ND2 1 
ATOM   5011  N  N   . VAL E  1 22  ? -7.569  -5.380  41.838  1.00 8.32   ? 22  VAL E N   1 
ATOM   5012  C  CA  . VAL E  1 22  ? -7.242  -4.902  43.172  1.00 5.06   ? 22  VAL E CA  1 
ATOM   5013  C  C   . VAL E  1 22  ? -5.715  -4.896  43.285  1.00 6.41   ? 22  VAL E C   1 
ATOM   5014  O  O   . VAL E  1 22  ? -5.165  -3.932  43.814  1.00 4.05   ? 22  VAL E O   1 
ATOM   5015  C  CB  . VAL E  1 22  ? -7.902  -5.743  44.299  1.00 5.18   ? 22  VAL E CB  1 
ATOM   5016  C  CG1 . VAL E  1 22  ? -7.477  -5.278  45.704  1.00 5.88   ? 22  VAL E CG1 1 
ATOM   5017  C  CG2 . VAL E  1 22  ? -9.416  -5.748  44.181  1.00 2.28   ? 22  VAL E CG2 1 
ATOM   5018  N  N   . PHE E  1 23  ? -5.058  -5.948  42.789  1.00 1.21   ? 23  PHE E N   1 
ATOM   5019  C  CA  . PHE E  1 23  ? -3.613  -6.089  42.942  1.00 1.00   ? 23  PHE E CA  1 
ATOM   5020  C  C   . PHE E  1 23  ? -2.900  -4.975  42.245  1.00 8.46   ? 23  PHE E C   1 
ATOM   5021  O  O   . PHE E  1 23  ? -1.969  -4.371  42.750  1.00 8.55   ? 23  PHE E O   1 
ATOM   5022  C  CB  . PHE E  1 23  ? -3.208  -7.432  42.326  1.00 2.44   ? 23  PHE E CB  1 
ATOM   5023  C  CG  . PHE E  1 23  ? -1.776  -7.792  42.522  1.00 4.66   ? 23  PHE E CG  1 
ATOM   5024  C  CD1 . PHE E  1 23  ? -1.091  -7.386  43.655  1.00 9.67   ? 23  PHE E CD1 1 
ATOM   5025  C  CD2 . PHE E  1 23  ? -1.096  -8.542  41.572  1.00 6.37   ? 23  PHE E CD2 1 
ATOM   5026  C  CE1 . PHE E  1 23  ? 0.252   -7.690  43.814  1.00 6.77   ? 23  PHE E CE1 1 
ATOM   5027  C  CE2 . PHE E  1 23  ? 0.247   -8.868  41.723  1.00 3.75   ? 23  PHE E CE2 1 
ATOM   5028  C  CZ  . PHE E  1 23  ? 0.924   -8.449  42.865  1.00 1.00   ? 23  PHE E CZ  1 
ATOM   5029  N  N   . THR E  1 24  ? -3.422  -4.643  41.086  1.00 2.29   ? 24  THR E N   1 
ATOM   5030  C  CA  . THR E  1 24  ? -2.832  -3.609  40.275  1.00 1.22   ? 24  THR E CA  1 
ATOM   5031  C  C   . THR E  1 24  ? -2.828  -2.265  40.940  1.00 9.41   ? 24  THR E C   1 
ATOM   5032  O  O   . THR E  1 24  ? -1.865  -1.520  40.877  1.00 4.92   ? 24  THR E O   1 
ATOM   5033  C  CB  . THR E  1 24  ? -3.540  -3.640  38.927  1.00 6.67   ? 24  THR E CB  1 
ATOM   5034  O  OG1 . THR E  1 24  ? -2.585  -3.400  37.903  1.00 37.62  ? 24  THR E OG1 1 
ATOM   5035  C  CG2 . THR E  1 24  ? -4.604  -2.620  38.828  1.00 1.64   ? 24  THR E CG2 1 
ATOM   5036  N  N   . VAL E  1 25  ? -3.892  -1.946  41.646  1.00 4.60   ? 25  VAL E N   1 
ATOM   5037  C  CA  . VAL E  1 25  ? -3.926  -0.689  42.375  1.00 2.57   ? 25  VAL E CA  1 
ATOM   5038  C  C   . VAL E  1 25  ? -2.985  -0.793  43.566  1.00 6.97   ? 25  VAL E C   1 
ATOM   5039  O  O   . VAL E  1 25  ? -2.338  0.175   43.958  1.00 3.30   ? 25  VAL E O   1 
ATOM   5040  C  CB  . VAL E  1 25  ? -5.366  -0.403  42.847  1.00 6.97   ? 25  VAL E CB  1 
ATOM   5041  C  CG1 . VAL E  1 25  ? -5.424  0.845   43.766  1.00 5.23   ? 25  VAL E CG1 1 
ATOM   5042  C  CG2 . VAL E  1 25  ? -6.245  -0.173  41.595  1.00 2.04   ? 25  VAL E CG2 1 
ATOM   5043  N  N   . LYS E  1 26  ? -2.869  -1.987  44.123  1.00 1.00   ? 26  LYS E N   1 
ATOM   5044  C  CA  . LYS E  1 26  ? -2.001  -2.186  45.271  1.00 2.24   ? 26  LYS E CA  1 
ATOM   5045  C  C   . LYS E  1 26  ? -0.568  -1.946  44.877  1.00 5.93   ? 26  LYS E C   1 
ATOM   5046  O  O   . LYS E  1 26  ? 0.194   -1.330  45.620  1.00 7.60   ? 26  LYS E O   1 
ATOM   5047  C  CB  . LYS E  1 26  ? -2.166  -3.588  45.842  1.00 2.94   ? 26  LYS E CB  1 
ATOM   5048  C  CG  . LYS E  1 26  ? -1.306  -3.825  47.050  1.00 15.15  ? 26  LYS E CG  1 
ATOM   5049  C  CD  . LYS E  1 26  ? -1.334  -5.294  47.455  1.00 29.98  ? 26  LYS E CD  1 
ATOM   5050  C  CE  . LYS E  1 26  ? -2.602  -5.759  48.115  1.00 13.17  ? 26  LYS E CE  1 
ATOM   5051  N  NZ  . LYS E  1 26  ? -2.845  -5.187  49.465  1.00 36.43  ? 26  LYS E NZ  1 
ATOM   5052  N  N   . ILE E  1 27  ? -0.247  -2.365  43.662  1.00 2.11   ? 27  ILE E N   1 
ATOM   5053  C  CA  . ILE E  1 27  ? 1.097   -2.159  43.116  1.00 2.11   ? 27  ILE E CA  1 
ATOM   5054  C  C   . ILE E  1 27  ? 1.420   -0.653  43.008  1.00 4.22   ? 27  ILE E C   1 
ATOM   5055  O  O   . ILE E  1 27  ? 2.476   -0.190  43.445  1.00 6.25   ? 27  ILE E O   1 
ATOM   5056  C  CB  . ILE E  1 27  ? 1.244   -2.904  41.739  1.00 2.48   ? 27  ILE E CB  1 
ATOM   5057  C  CG1 . ILE E  1 27  ? 1.235   -4.403  41.998  1.00 1.00   ? 27  ILE E CG1 1 
ATOM   5058  C  CG2 . ILE E  1 27  ? 2.506   -2.497  41.105  1.00 1.32   ? 27  ILE E CG2 1 
ATOM   5059  C  CD1 . ILE E  1 27  ? 1.057   -5.209  40.763  1.00 1.63   ? 27  ILE E CD1 1 
ATOM   5060  N  N   . HIS E  1 28  ? 0.459   0.120   42.525  1.00 1.86   ? 28  HIS E N   1 
ATOM   5061  C  CA  . HIS E  1 28  ? 0.619   1.544   42.459  1.00 1.21   ? 28  HIS E CA  1 
ATOM   5062  C  C   . HIS E  1 28  ? 0.825   2.152   43.841  1.00 8.26   ? 28  HIS E C   1 
ATOM   5063  O  O   . HIS E  1 28  ? 1.635   3.058   44.073  1.00 6.80   ? 28  HIS E O   1 
ATOM   5064  C  CB  . HIS E  1 28  ? -0.606  2.243   41.833  1.00 4.87   ? 28  HIS E CB  1 
ATOM   5065  C  CG  . HIS E  1 28  ? -0.470  2.469   40.381  1.00 10.85  ? 28  HIS E CG  1 
ATOM   5066  N  ND1 . HIS E  1 28  ? 0.749   2.566   39.755  1.00 17.66  ? 28  HIS E ND1 1 
ATOM   5067  C  CD2 . HIS E  1 28  ? -1.405  2.757   39.434  1.00 11.38  ? 28  HIS E CD2 1 
ATOM   5068  C  CE1 . HIS E  1 28  ? 0.568   2.874   38.470  1.00 16.20  ? 28  HIS E CE1 1 
ATOM   5069  N  NE2 . HIS E  1 28  ? -0.730  3.021   38.256  1.00 14.97  ? 28  HIS E NE2 1 
ATOM   5070  N  N   . GLN E  1 29  ? 0.065   1.669   44.819  1.00 5.72   ? 29  GLN E N   1 
ATOM   5071  C  CA  . GLN E  1 29  ? 0.177   2.190   46.173  1.00 6.28   ? 29  GLN E CA  1 
ATOM   5072  C  C   . GLN E  1 29  ? 1.590   2.077   46.716  1.00 6.92   ? 29  GLN E C   1 
ATOM   5073  O  O   . GLN E  1 29  ? 2.132   3.009   47.292  1.00 4.64   ? 29  GLN E O   1 
ATOM   5074  C  CB  . GLN E  1 29  ? -0.764  1.426   47.123  1.00 7.39   ? 29  GLN E CB  1 
ATOM   5075  C  CG  . GLN E  1 29  ? -0.443  1.640   48.619  1.00 11.09  ? 29  GLN E CG  1 
ATOM   5076  C  CD  . GLN E  1 29  ? -1.463  1.050   49.540  1.00 16.00  ? 29  GLN E CD  1 
ATOM   5077  O  OE1 . GLN E  1 29  ? -2.575  1.516   49.594  1.00 12.83  ? 29  GLN E OE1 1 
ATOM   5078  N  NE2 . GLN E  1 29  ? -1.074  -0.022  50.225  1.00 9.21   ? 29  GLN E NE2 1 
ATOM   5079  N  N   . ILE E  1 30  ? 2.205   0.904   46.511  1.00 2.70   ? 30  ILE E N   1 
ATOM   5080  C  CA  . ILE E  1 30  ? 3.527   0.609   47.023  1.00 3.17   ? 30  ILE E CA  1 
ATOM   5081  C  C   . ILE E  1 30  ? 4.610   1.520   46.536  1.00 6.48   ? 30  ILE E C   1 
ATOM   5082  O  O   . ILE E  1 30  ? 5.476   2.114   47.086  1.00 6.28   ? 30  ILE E O   1 
ATOM   5083  C  CB  . ILE E  1 30  ? 3.923   -0.855  46.694  1.00 5.60   ? 30  ILE E CB  1 
ATOM   5084  C  CG1 . ILE E  1 30  ? 3.144   -1.836  47.562  1.00 9.52   ? 30  ILE E CG1 1 
ATOM   5085  C  CG2 . ILE E  1 30  ? 5.374   -1.140  46.843  1.00 1.00   ? 30  ILE E CG2 1 
ATOM   5086  C  CD1 . ILE E  1 30  ? 3.351   -3.289  47.157  1.00 13.53  ? 30  ILE E CD1 1 
ATOM   5087  N  N   . HIS E  1 31  ? 4.448   1.668   45.206  1.00 2.65   ? 31  HIS E N   1 
ATOM   5088  C  CA  . HIS E  1 31  ? 5.292   2.390   44.303  1.00 2.43   ? 31  HIS E CA  1 
ATOM   5089  C  C   . HIS E  1 31  ? 5.265   3.872   44.452  1.00 11.32  ? 31  HIS E C   1 
ATOM   5090  O  O   . HIS E  1 31  ? 6.242   4.570   44.276  1.00 4.35   ? 31  HIS E O   1 
ATOM   5091  C  CB  . HIS E  1 31  ? 4.663   1.933   42.966  1.00 1.59   ? 31  HIS E CB  1 
ATOM   5092  C  CG  . HIS E  1 31  ? 5.054   2.807   41.833  1.00 9.93   ? 31  HIS E CG  1 
ATOM   5093  N  ND1 . HIS E  1 31  ? 6.066   2.511   40.929  1.00 14.98  ? 31  HIS E ND1 1 
ATOM   5094  C  CD2 . HIS E  1 31  ? 4.461   3.950   41.398  1.00 10.33  ? 31  HIS E CD2 1 
ATOM   5095  C  CE1 . HIS E  1 31  ? 6.082   3.441   39.982  1.00 11.03  ? 31  HIS E CE1 1 
ATOM   5096  N  NE2 . HIS E  1 31  ? 5.118   4.330   40.235  1.00 9.17   ? 31  HIS E NE2 1 
ATOM   5097  N  N   . TRP E  1 32  ? 4.083   4.329   44.861  1.00 6.29   ? 32  TRP E N   1 
ATOM   5098  C  CA  . TRP E  1 32  ? 3.878   5.764   45.167  1.00 4.21   ? 32  TRP E CA  1 
ATOM   5099  C  C   . TRP E  1 32  ? 4.399   6.096   46.565  1.00 10.77  ? 32  TRP E C   1 
ATOM   5100  O  O   . TRP E  1 32  ? 5.078   7.098   46.794  1.00 5.07   ? 32  TRP E O   1 
ATOM   5101  C  CB  . TRP E  1 32  ? 2.381   6.129   45.106  1.00 1.58   ? 32  TRP E CB  1 
ATOM   5102  C  CG  . TRP E  1 32  ? 1.822   6.240   43.733  1.00 2.05   ? 32  TRP E CG  1 
ATOM   5103  C  CD1 . TRP E  1 32  ? 2.457   6.504   42.550  1.00 1.86   ? 32  TRP E CD1 1 
ATOM   5104  C  CD2 . TRP E  1 32  ? 0.438   6.078   43.385  1.00 2.94   ? 32  TRP E CD2 1 
ATOM   5105  N  NE1 . TRP E  1 32  ? 1.586   6.540   41.539  1.00 1.88   ? 32  TRP E NE1 1 
ATOM   5106  C  CE2 . TRP E  1 32  ? 0.329   6.251   41.993  1.00 2.88   ? 32  TRP E CE2 1 
ATOM   5107  C  CE3 . TRP E  1 32  ? -0.735  5.860   44.115  1.00 4.10   ? 32  TRP E CE3 1 
ATOM   5108  C  CZ2 . TRP E  1 32  ? -0.880  6.162   41.336  1.00 2.54   ? 32  TRP E CZ2 1 
ATOM   5109  C  CZ3 . TRP E  1 32  ? -1.944  5.747   43.463  1.00 5.84   ? 32  TRP E CZ3 1 
ATOM   5110  C  CH2 . TRP E  1 32  ? -1.991  5.972   42.021  1.00 6.20   ? 32  TRP E CH2 1 
ATOM   5111  N  N   . TYR E  1 33  ? 4.084   5.220   47.519  1.00 2.23   ? 33  TYR E N   1 
ATOM   5112  C  CA  . TYR E  1 33  ? 4.399   5.463   48.915  1.00 4.28   ? 33  TYR E CA  1 
ATOM   5113  C  C   . TYR E  1 33  ? 5.738   4.970   49.437  1.00 12.49  ? 33  TYR E C   1 
ATOM   5114  O  O   . TYR E  1 33  ? 6.184   5.415   50.507  1.00 11.38  ? 33  TYR E O   1 
ATOM   5115  C  CB  . TYR E  1 33  ? 3.275   4.922   49.854  1.00 1.73   ? 33  TYR E CB  1 
ATOM   5116  C  CG  . TYR E  1 33  ? 2.039   5.765   49.794  1.00 4.95   ? 33  TYR E CG  1 
ATOM   5117  C  CD1 . TYR E  1 33  ? 1.997   7.027   50.358  1.00 12.36  ? 33  TYR E CD1 1 
ATOM   5118  C  CD2 . TYR E  1 33  ? 0.871   5.332   49.148  1.00 3.64   ? 33  TYR E CD2 1 
ATOM   5119  C  CE1 . TYR E  1 33  ? 0.845   7.826   50.280  1.00 11.35  ? 33  TYR E CE1 1 
ATOM   5120  C  CE2 . TYR E  1 33  ? -0.274  6.130   49.087  1.00 5.64   ? 33  TYR E CE2 1 
ATOM   5121  C  CZ  . TYR E  1 33  ? -0.269  7.361   49.657  1.00 15.12  ? 33  TYR E CZ  1 
ATOM   5122  O  OH  . TYR E  1 33  ? -1.388  8.153   49.584  1.00 12.09  ? 33  TYR E OH  1 
ATOM   5123  N  N   . MET E  1 34  ? 6.396   4.080   48.705  1.00 7.73   ? 34  MET E N   1 
ATOM   5124  C  CA  . MET E  1 34  ? 7.661   3.544   49.182  1.00 4.17   ? 34  MET E CA  1 
ATOM   5125  C  C   . MET E  1 34  ? 8.695   4.640   49.434  1.00 3.83   ? 34  MET E C   1 
ATOM   5126  O  O   . MET E  1 34  ? 8.689   5.712   48.851  1.00 4.15   ? 34  MET E O   1 
ATOM   5127  C  CB  . MET E  1 34  ? 8.242   2.530   48.219  1.00 6.78   ? 34  MET E CB  1 
ATOM   5128  C  CG  . MET E  1 34  ? 8.519   3.155   46.907  1.00 13.59  ? 34  MET E CG  1 
ATOM   5129  S  SD  . MET E  1 34  ? 9.416   2.035   45.745  1.00 18.70  ? 34  MET E SD  1 
ATOM   5130  C  CE  . MET E  1 34  ? 8.339   0.527   45.867  1.00 15.67  ? 34  MET E CE  1 
ATOM   5131  N  N   . ARG E  1 35  ? 9.590   4.335   50.368  1.00 9.26   ? 35  ARG E N   1 
ATOM   5132  C  CA  . ARG E  1 35  ? 10.695  5.178   50.791  1.00 10.14  ? 35  ARG E CA  1 
ATOM   5133  C  C   . ARG E  1 35  ? 11.787  4.258   51.323  1.00 12.70  ? 35  ARG E C   1 
ATOM   5134  O  O   . ARG E  1 35  ? 11.518  3.148   51.743  1.00 17.69  ? 35  ARG E O   1 
ATOM   5135  C  CB  . ARG E  1 35  ? 10.301  6.099   51.948  1.00 7.37   ? 35  ARG E CB  1 
ATOM   5136  C  CG  . ARG E  1 35  ? 9.359   7.194   51.551  1.00 14.78  ? 35  ARG E CG  1 
ATOM   5137  C  CD  . ARG E  1 35  ? 9.129   8.105   52.735  1.00 5.34   ? 35  ARG E CD  1 
ATOM   5138  N  NE  . ARG E  1 35  ? 8.080   9.121   52.473  1.00 21.61  ? 35  ARG E NE  1 
ATOM   5139  C  CZ  . ARG E  1 35  ? 7.621   9.935   53.422  1.00 35.28  ? 35  ARG E CZ  1 
ATOM   5140  N  NH1 . ARG E  1 35  ? 8.117   9.812   54.647  1.00 42.70  ? 35  ARG E NH1 1 
ATOM   5141  N  NH2 . ARG E  1 35  ? 6.680   10.819  53.107  1.00 30.12  ? 35  ARG E NH2 1 
ATOM   5142  N  N   . GLY E  1 36  ? 13.041  4.762   51.282  1.00 7.89   ? 36  GLY E N   1 
ATOM   5143  C  CA  . GLY E  1 36  ? 14.143  3.951   51.704  1.00 7.49   ? 36  GLY E CA  1 
ATOM   5144  C  C   . GLY E  1 36  ? 15.200  3.916   50.622  1.00 13.67  ? 36  GLY E C   1 
ATOM   5145  O  O   . GLY E  1 36  ? 15.046  4.369   49.501  1.00 10.93  ? 36  GLY E O   1 
ATOM   5146  N  N   . HIS E  1 37  ? 16.318  3.322   50.971  1.00 10.13  ? 37  HIS E N   1 
ATOM   5147  C  CA  . HIS E  1 37  ? 17.448  3.188   50.081  1.00 13.73  ? 37  HIS E CA  1 
ATOM   5148  C  C   . HIS E  1 37  ? 17.178  2.392   48.820  1.00 16.85  ? 37  HIS E C   1 
ATOM   5149  O  O   . HIS E  1 37  ? 17.870  2.585   47.841  1.00 14.75  ? 37  HIS E O   1 
ATOM   5150  C  CB  . HIS E  1 37  ? 18.612  2.664   50.903  1.00 18.94  ? 37  HIS E CB  1 
ATOM   5151  C  CG  . HIS E  1 37  ? 19.159  3.649   51.848  1.00 32.21  ? 37  HIS E CG  1 
ATOM   5152  N  ND1 . HIS E  1 37  ? 20.467  4.040   51.845  1.00 40.64  ? 37  HIS E ND1 1 
ATOM   5153  C  CD2 . HIS E  1 37  ? 18.538  4.367   52.808  1.00 48.23  ? 37  HIS E CD2 1 
ATOM   5154  C  CE1 . HIS E  1 37  ? 20.648  4.976   52.784  1.00 46.11  ? 37  HIS E CE1 1 
ATOM   5155  N  NE2 . HIS E  1 37  ? 19.488  5.186   53.379  1.00 48.84  ? 37  HIS E NE2 1 
ATOM   5156  N  N   . ASN E  1 38  ? 16.148  1.556   48.841  1.00 12.38  ? 38  ASN E N   1 
ATOM   5157  C  CA  . ASN E  1 38  ? 15.795  0.736   47.703  1.00 13.71  ? 38  ASN E CA  1 
ATOM   5158  C  C   . ASN E  1 38  ? 14.745  1.373   46.793  1.00 16.42  ? 38  ASN E C   1 
ATOM   5159  O  O   . ASN E  1 38  ? 14.231  0.817   45.860  1.00 15.20  ? 38  ASN E O   1 
ATOM   5160  C  CB  . ASN E  1 38  ? 15.324  -0.629  48.176  1.00 13.33  ? 38  ASN E CB  1 
ATOM   5161  C  CG  . ASN E  1 38  ? 16.315  -1.320  49.078  1.00 32.85  ? 38  ASN E CG  1 
ATOM   5162  O  OD1 . ASN E  1 38  ? 16.048  -1.540  50.246  1.00 35.41  ? 38  ASN E OD1 1 
ATOM   5163  N  ND2 . ASN E  1 38  ? 17.515  -1.587  48.531  1.00 16.48  ? 38  ASN E ND2 1 
ATOM   5164  N  N   . PHE E  1 39  ? 14.436  2.637   47.090  1.00 5.86   ? 39  PHE E N   1 
ATOM   5165  C  CA  . PHE E  1 39  ? 13.455  3.356   46.361  1.00 3.11   ? 39  PHE E CA  1 
ATOM   5166  C  C   . PHE E  1 39  ? 13.569  3.287   44.847  1.00 6.04   ? 39  PHE E C   1 
ATOM   5167  O  O   . PHE E  1 39  ? 12.702  2.920   44.131  1.00 5.97   ? 39  PHE E O   1 
ATOM   5168  C  CB  . PHE E  1 39  ? 13.398  4.835   46.711  1.00 1.00   ? 39  PHE E CB  1 
ATOM   5169  C  CG  . PHE E  1 39  ? 12.429  5.617   45.908  1.00 2.31   ? 39  PHE E CG  1 
ATOM   5170  C  CD1 . PHE E  1 39  ? 11.093  5.688   46.269  1.00 1.00   ? 39  PHE E CD1 1 
ATOM   5171  C  CD2 . PHE E  1 39  ? 12.809  6.221   44.725  1.00 4.60   ? 39  PHE E CD2 1 
ATOM   5172  C  CE1 . PHE E  1 39  ? 10.150  6.376   45.512  1.00 1.00   ? 39  PHE E CE1 1 
ATOM   5173  C  CE2 . PHE E  1 39  ? 11.903  6.931   43.931  1.00 4.28   ? 39  PHE E CE2 1 
ATOM   5174  C  CZ  . PHE E  1 39  ? 10.575  7.002   44.324  1.00 3.02   ? 39  PHE E CZ  1 
ATOM   5175  N  N   . PHE E  1 40  ? 14.690  3.699   44.319  1.00 2.07   ? 40  PHE E N   1 
ATOM   5176  C  CA  . PHE E  1 40  ? 14.841  3.743   42.874  1.00 6.60   ? 40  PHE E CA  1 
ATOM   5177  C  C   . PHE E  1 40  ? 14.629  2.405   42.214  1.00 16.64  ? 40  PHE E C   1 
ATOM   5178  O  O   . PHE E  1 40  ? 13.846  2.279   41.269  1.00 12.44  ? 40  PHE E O   1 
ATOM   5179  C  CB  . PHE E  1 40  ? 16.211  4.355   42.500  1.00 4.46   ? 40  PHE E CB  1 
ATOM   5180  C  CG  . PHE E  1 40  ? 16.309  5.815   42.885  1.00 3.81   ? 40  PHE E CG  1 
ATOM   5181  C  CD1 . PHE E  1 40  ? 15.604  6.764   42.152  1.00 1.53   ? 40  PHE E CD1 1 
ATOM   5182  C  CD2 . PHE E  1 40  ? 17.097  6.192   43.971  1.00 5.23   ? 40  PHE E CD2 1 
ATOM   5183  C  CE1 . PHE E  1 40  ? 15.679  8.111   42.515  1.00 3.95   ? 40  PHE E CE1 1 
ATOM   5184  C  CE2 . PHE E  1 40  ? 17.174  7.537   44.334  1.00 6.69   ? 40  PHE E CE2 1 
ATOM   5185  C  CZ  . PHE E  1 40  ? 16.463  8.497   43.608  1.00 1.00   ? 40  PHE E CZ  1 
ATOM   5186  N  N   . THR E  1 41  ? 15.298  1.410   42.697  1.00 13.61  ? 41  THR E N   1 
ATOM   5187  C  CA  . THR E  1 41  ? 15.197  0.105   42.067  1.00 11.84  ? 41  THR E CA  1 
ATOM   5188  C  C   . THR E  1 41  ? 13.778  -0.486  42.236  1.00 11.69  ? 41  THR E C   1 
ATOM   5189  O  O   . THR E  1 41  ? 13.171  -0.992  41.285  1.00 11.88  ? 41  THR E O   1 
ATOM   5190  C  CB  . THR E  1 41  ? 16.290  -0.808  42.606  1.00 34.61  ? 41  THR E CB  1 
ATOM   5191  O  OG1 . THR E  1 41  ? 15.920  -2.163  42.435  1.00 54.22  ? 41  THR E OG1 1 
ATOM   5192  C  CG2 . THR E  1 41  ? 16.592  -0.575  44.082  1.00 68.26  ? 41  THR E CG2 1 
ATOM   5193  N  N   . LEU E  1 42  ? 13.219  -0.421  43.432  1.00 6.59   ? 42  LEU E N   1 
ATOM   5194  C  CA  . LEU E  1 42  ? 11.880  -1.006  43.672  1.00 4.51   ? 42  LEU E CA  1 
ATOM   5195  C  C   . LEU E  1 42  ? 10.774  -0.171  42.994  1.00 10.71  ? 42  LEU E C   1 
ATOM   5196  O  O   . LEU E  1 42  ? 9.751   -0.700  42.535  1.00 9.14   ? 42  LEU E O   1 
ATOM   5197  C  CB  . LEU E  1 42  ? 11.602  -1.113  45.165  1.00 6.28   ? 42  LEU E CB  1 
ATOM   5198  C  CG  . LEU E  1 42  ? 11.758  -2.543  45.693  1.00 11.49  ? 42  LEU E CG  1 
ATOM   5199  C  CD1 . LEU E  1 42  ? 12.567  -3.444  44.760  1.00 8.27   ? 42  LEU E CD1 1 
ATOM   5200  C  CD2 . LEU E  1 42  ? 12.472  -2.600  47.041  1.00 20.71  ? 42  LEU E CD2 1 
ATOM   5201  N  N   . HIS E  1 43  ? 10.982  1.130   42.935  1.00 3.75   ? 43  HIS E N   1 
ATOM   5202  C  CA  . HIS E  1 43  ? 10.013  2.037   42.297  1.00 1.18   ? 43  HIS E CA  1 
ATOM   5203  C  C   . HIS E  1 43  ? 9.775   1.569   40.855  1.00 7.78   ? 43  HIS E C   1 
ATOM   5204  O  O   . HIS E  1 43  ? 8.634   1.461   40.390  1.00 7.61   ? 43  HIS E O   1 
ATOM   5205  C  CB  . HIS E  1 43  ? 10.557  3.471   42.313  1.00 1.92   ? 43  HIS E CB  1 
ATOM   5206  C  CG  . HIS E  1 43  ? 9.607   4.513   41.703  1.00 8.95   ? 43  HIS E CG  1 
ATOM   5207  N  ND1 . HIS E  1 43  ? 8.361   4.802   42.259  1.00 10.75  ? 43  HIS E ND1 1 
ATOM   5208  C  CD2 . HIS E  1 43  ? 9.728   5.319   40.615  1.00 9.53   ? 43  HIS E CD2 1 
ATOM   5209  C  CE1 . HIS E  1 43  ? 7.786   5.739   41.521  1.00 10.47  ? 43  HIS E CE1 1 
ATOM   5210  N  NE2 . HIS E  1 43  ? 8.589   6.057   40.537  1.00 10.25  ? 43  HIS E NE2 1 
ATOM   5211  N  N   . GLU E  1 44  ? 10.873  1.284   40.182  1.00 6.23   ? 44  GLU E N   1 
ATOM   5212  C  CA  . GLU E  1 44  ? 10.848  0.843   38.781  1.00 6.24   ? 44  GLU E CA  1 
ATOM   5213  C  C   . GLU E  1 44  ? 10.317  -0.571  38.679  1.00 8.26   ? 44  GLU E C   1 
ATOM   5214  O  O   . GLU E  1 44  ? 9.572   -0.911  37.769  1.00 9.28   ? 44  GLU E O   1 
ATOM   5215  C  CB  . GLU E  1 44  ? 12.255  0.941   38.190  1.00 8.94   ? 44  GLU E CB  1 
ATOM   5216  C  CG  . GLU E  1 44  ? 12.755  2.389   38.118  1.00 78.49  ? 44  GLU E CG  1 
ATOM   5217  C  CD  . GLU E  1 44  ? 14.265  2.501   37.919  0.00 100.00 ? 44  GLU E CD  1 
ATOM   5218  O  OE1 . GLU E  1 44  ? 14.940  1.472   37.541  0.00 100.00 ? 44  GLU E OE1 1 
ATOM   5219  O  OE2 . GLU E  1 44  ? 14.858  3.625   38.125  0.00 100.00 ? 44  GLU E OE2 1 
ATOM   5220  N  N   . LYS E  1 45  ? 10.681  -1.421  39.636  1.00 3.42   ? 45  LYS E N   1 
ATOM   5221  C  CA  . LYS E  1 45  ? 10.215  -2.799  39.644  1.00 2.93   ? 45  LYS E CA  1 
ATOM   5222  C  C   . LYS E  1 45  ? 8.683   -2.816  39.688  1.00 2.64   ? 45  LYS E C   1 
ATOM   5223  O  O   . LYS E  1 45  ? 7.988   -3.595  39.004  1.00 3.54   ? 45  LYS E O   1 
ATOM   5224  C  CB  . LYS E  1 45  ? 10.812  -3.608  40.820  1.00 6.71   ? 45  LYS E CB  1 
ATOM   5225  C  CG  . LYS E  1 45  ? 10.769  -5.101  40.569  1.00 28.61  ? 45  LYS E CG  1 
ATOM   5226  C  CD  . LYS E  1 45  ? 11.785  -5.515  39.481  1.00 52.92  ? 45  LYS E CD  1 
ATOM   5227  C  CE  . LYS E  1 45  ? 11.381  -6.732  38.667  1.00 91.16  ? 45  LYS E CE  1 
ATOM   5228  N  NZ  . LYS E  1 45  ? 11.199  -8.006  39.445  1.00 78.23  ? 45  LYS E NZ  1 
ATOM   5229  N  N   . MET E  1 46  ? 8.099   -1.928  40.476  1.00 1.00   ? 46  MET E N   1 
ATOM   5230  C  CA  . MET E  1 46  ? 6.657   -1.873  40.561  1.00 1.29   ? 46  MET E CA  1 
ATOM   5231  C  C   . MET E  1 46  ? 6.071   -1.454  39.227  1.00 7.73   ? 46  MET E C   1 
ATOM   5232  O  O   . MET E  1 46  ? 5.046   -1.987  38.804  1.00 14.07  ? 46  MET E O   1 
ATOM   5233  C  CB  . MET E  1 46  ? 6.212   -0.905  41.658  1.00 1.00   ? 46  MET E CB  1 
ATOM   5234  C  CG  . MET E  1 46  ? 6.680   -1.354  43.057  1.00 3.01   ? 46  MET E CG  1 
ATOM   5235  S  SD  . MET E  1 46  ? 6.163   -3.030  43.472  1.00 8.69   ? 46  MET E SD  1 
ATOM   5236  C  CE  . MET E  1 46  ? 7.644   -4.065  43.154  1.00 3.54   ? 46  MET E CE  1 
ATOM   5237  N  N   . ASP E  1 47  ? 6.729   -0.545  38.521  1.00 3.11   ? 47  ASP E N   1 
ATOM   5238  C  CA  . ASP E  1 47  ? 6.159   -0.210  37.220  1.00 7.49   ? 47  ASP E CA  1 
ATOM   5239  C  C   . ASP E  1 47  ? 6.067   -1.425  36.326  1.00 6.92   ? 47  ASP E C   1 
ATOM   5240  O  O   . ASP E  1 47  ? 5.106   -1.626  35.587  1.00 8.81   ? 47  ASP E O   1 
ATOM   5241  C  CB  . ASP E  1 47  ? 6.901   0.934   36.525  1.00 16.05  ? 47  ASP E CB  1 
ATOM   5242  C  CG  . ASP E  1 47  ? 6.328   2.319   36.863  1.00 77.70  ? 47  ASP E CG  1 
ATOM   5243  O  OD1 . ASP E  1 47  ? 5.176   2.366   37.342  1.00 89.88  ? 47  ASP E OD1 1 
ATOM   5244  O  OD2 . ASP E  1 47  ? 6.990   3.356   36.643  1.00 99.08  ? 47  ASP E OD2 1 
ATOM   5245  N  N   . ASP E  1 48  ? 7.055   -2.296  36.496  1.00 4.42   ? 48  ASP E N   1 
ATOM   5246  C  CA  . ASP E  1 48  ? 7.094   -3.514  35.696  1.00 8.31   ? 48  ASP E CA  1 
ATOM   5247  C  C   . ASP E  1 48  ? 5.975   -4.477  36.039  1.00 10.13  ? 48  ASP E C   1 
ATOM   5248  O  O   . ASP E  1 48  ? 5.313   -5.079  35.190  1.00 8.51   ? 48  ASP E O   1 
ATOM   5249  C  CB  . ASP E  1 48  ? 8.502   -4.131  35.712  1.00 14.08  ? 48  ASP E CB  1 
ATOM   5250  C  CG  . ASP E  1 48  ? 9.577   -3.216  35.101  1.00 51.68  ? 48  ASP E CG  1 
ATOM   5251  O  OD1 . ASP E  1 48  ? 9.257   -2.356  34.246  1.00 53.92  ? 48  ASP E OD1 1 
ATOM   5252  O  OD2 . ASP E  1 48  ? 10.760  -3.364  35.467  1.00 81.77  ? 48  ASP E OD2 1 
ATOM   5253  N  N   . LEU E  1 49  ? 5.797   -4.614  37.344  1.00 1.96   ? 49  LEU E N   1 
ATOM   5254  C  CA  . LEU E  1 49  ? 4.733   -5.458  37.870  1.00 5.49   ? 49  LEU E CA  1 
ATOM   5255  C  C   . LEU E  1 49  ? 3.356   -4.927  37.450  1.00 2.71   ? 49  LEU E C   1 
ATOM   5256  O  O   . LEU E  1 49  ? 2.445   -5.659  37.010  1.00 4.52   ? 49  LEU E O   1 
ATOM   5257  C  CB  . LEU E  1 49  ? 4.796   -5.557  39.388  1.00 2.78   ? 49  LEU E CB  1 
ATOM   5258  C  CG  . LEU E  1 49  ? 5.307   -6.875  39.972  1.00 7.06   ? 49  LEU E CG  1 
ATOM   5259  C  CD1 . LEU E  1 49  ? 6.530   -7.389  39.300  1.00 1.91   ? 49  LEU E CD1 1 
ATOM   5260  C  CD2 . LEU E  1 49  ? 5.666   -6.569  41.389  1.00 8.00   ? 49  LEU E CD2 1 
ATOM   5261  N  N   . TYR E  1 50  ? 3.231   -3.613  37.550  1.00 1.00   ? 50  TYR E N   1 
ATOM   5262  C  CA  . TYR E  1 50  ? 1.964   -3.026  37.144  1.00 2.81   ? 50  TYR E CA  1 
ATOM   5263  C  C   . TYR E  1 50  ? 1.639   -3.362  35.686  1.00 7.63   ? 50  TYR E C   1 
ATOM   5264  O  O   . TYR E  1 50  ? 0.529   -3.757  35.325  1.00 8.78   ? 50  TYR E O   1 
ATOM   5265  C  CB  . TYR E  1 50  ? 2.077   -1.511  37.291  1.00 3.14   ? 50  TYR E CB  1 
ATOM   5266  C  CG  . TYR E  1 50  ? 0.757   -0.852  37.074  1.00 11.00  ? 50  TYR E CG  1 
ATOM   5267  C  CD1 . TYR E  1 50  ? 0.350   -0.478  35.794  1.00 12.91  ? 50  TYR E CD1 1 
ATOM   5268  C  CD2 . TYR E  1 50  ? -0.124  -0.658  38.138  1.00 16.37  ? 50  TYR E CD2 1 
ATOM   5269  C  CE1 . TYR E  1 50  ? -0.894  0.142   35.617  1.00 27.81  ? 50  TYR E CE1 1 
ATOM   5270  C  CE2 . TYR E  1 50  ? -1.364  -0.078  37.957  1.00 21.28  ? 50  TYR E CE2 1 
ATOM   5271  C  CZ  . TYR E  1 50  ? -1.752  0.346   36.696  1.00 37.89  ? 50  TYR E CZ  1 
ATOM   5272  O  OH  . TYR E  1 50  ? -3.001  0.944   36.573  1.00 33.28  ? 50  TYR E OH  1 
ATOM   5273  N  N   . SER E  1 51  ? 2.624   -3.240  34.814  1.00 3.81   ? 51  SER E N   1 
ATOM   5274  C  CA  . SER E  1 51  ? 2.290   -3.529  33.437  1.00 6.67   ? 51  SER E CA  1 
ATOM   5275  C  C   . SER E  1 51  ? 1.984   -5.002  33.243  1.00 5.51   ? 51  SER E C   1 
ATOM   5276  O  O   . SER E  1 51  ? 1.050   -5.374  32.534  1.00 5.46   ? 51  SER E O   1 
ATOM   5277  C  CB  . SER E  1 51  ? 3.421   -3.075  32.523  1.00 5.58   ? 51  SER E CB  1 
ATOM   5278  O  OG  . SER E  1 51  ? 3.586   -1.670  32.677  1.00 55.67  ? 51  SER E OG  1 
ATOM   5279  N  N   . GLU E  1 52  ? 2.812   -5.829  33.866  1.00 1.59   ? 52  GLU E N   1 
ATOM   5280  C  CA  . GLU E  1 52  ? 2.610   -7.251  33.680  1.00 2.20   ? 52  GLU E CA  1 
ATOM   5281  C  C   . GLU E  1 52  ? 1.266   -7.776  34.162  1.00 6.41   ? 52  GLU E C   1 
ATOM   5282  O  O   . GLU E  1 52  ? 0.553   -8.511  33.461  1.00 4.23   ? 52  GLU E O   1 
ATOM   5283  C  CB  . GLU E  1 52  ? 3.719   -8.039  34.348  1.00 2.25   ? 52  GLU E CB  1 
ATOM   5284  C  CG  . GLU E  1 52  ? 3.356   -9.515  34.327  1.00 17.60  ? 52  GLU E CG  1 
ATOM   5285  C  CD  . GLU E  1 52  ? 4.483   -10.352 34.887  1.00 55.04  ? 52  GLU E CD  1 
ATOM   5286  O  OE1 . GLU E  1 52  ? 5.408   -9.756  35.498  1.00 20.64  ? 52  GLU E OE1 1 
ATOM   5287  O  OE2 . GLU E  1 52  ? 4.459   -11.570 34.608  1.00 27.64  ? 52  GLU E OE2 1 
ATOM   5288  N  N   . PHE E  1 53  ? 0.924   -7.368  35.376  1.00 1.52   ? 53  PHE E N   1 
ATOM   5289  C  CA  . PHE E  1 53  ? -0.337  -7.826  35.915  1.00 1.48   ? 53  PHE E CA  1 
ATOM   5290  C  C   . PHE E  1 53  ? -1.517  -7.244  35.170  1.00 4.97   ? 53  PHE E C   1 
ATOM   5291  O  O   . PHE E  1 53  ? -2.519  -7.913  34.915  1.00 5.49   ? 53  PHE E O   1 
ATOM   5292  C  CB  . PHE E  1 53  ? -0.348  -7.837  37.433  1.00 1.00   ? 53  PHE E CB  1 
ATOM   5293  C  CG  . PHE E  1 53  ? 0.512   -8.942  37.987  1.00 3.73   ? 53  PHE E CG  1 
ATOM   5294  C  CD1 . PHE E  1 53  ? 1.878   -8.750  38.133  1.00 3.56   ? 53  PHE E CD1 1 
ATOM   5295  C  CD2 . PHE E  1 53  ? 0.012   -10.226 38.199  1.00 1.00   ? 53  PHE E CD2 1 
ATOM   5296  C  CE1 . PHE E  1 53  ? 2.705   -9.747  38.601  1.00 2.40   ? 53  PHE E CE1 1 
ATOM   5297  C  CE2 . PHE E  1 53  ? 0.822   -11.217 38.672  1.00 6.32   ? 53  PHE E CE2 1 
ATOM   5298  C  CZ  . PHE E  1 53  ? 2.175   -10.988 38.822  1.00 6.34   ? 53  PHE E CZ  1 
ATOM   5299  N  N   . GLY E  1 54  ? -1.281  -6.026  34.698  1.00 1.00   ? 54  GLY E N   1 
ATOM   5300  C  CA  . GLY E  1 54  ? -2.307  -5.364  33.893  1.00 1.00   ? 54  GLY E CA  1 
ATOM   5301  C  C   . GLY E  1 54  ? -2.551  -6.163  32.623  1.00 6.47   ? 54  GLY E C   1 
ATOM   5302  O  O   . GLY E  1 54  ? -3.684  -6.286  32.152  1.00 8.12   ? 54  GLY E O   1 
ATOM   5303  N  N   . GLU E  1 55  ? -1.495  -6.754  32.099  1.00 2.13   ? 55  GLU E N   1 
ATOM   5304  C  CA  . GLU E  1 55  ? -1.722  -7.523  30.904  1.00 6.71   ? 55  GLU E CA  1 
ATOM   5305  C  C   . GLU E  1 55  ? -2.357  -8.844  31.277  1.00 9.24   ? 55  GLU E C   1 
ATOM   5306  O  O   . GLU E  1 55  ? -3.172  -9.299  30.469  1.00 12.89  ? 55  GLU E O   1 
ATOM   5307  C  CB  . GLU E  1 55  ? -0.428  -7.806  30.116  1.00 13.41  ? 55  GLU E CB  1 
ATOM   5308  C  CG  . GLU E  1 55  ? 0.214   -6.676  29.298  1.00 68.00  ? 55  GLU E CG  1 
ATOM   5309  C  CD  . GLU E  1 55  ? 1.469   -7.112  28.578  0.00 100.00 ? 55  GLU E CD  1 
ATOM   5310  O  OE1 . GLU E  1 55  ? 1.859   -8.285  28.703  0.00 100.00 ? 55  GLU E OE1 1 
ATOM   5311  O  OE2 . GLU E  1 55  ? 2.083   -6.263  27.896  0.00 100.00 ? 55  GLU E OE2 1 
ATOM   5312  N  N   . GLN E  1 56  ? -2.006  -9.442  32.424  1.00 4.67   ? 56  GLN E N   1 
ATOM   5313  C  CA  . GLN E  1 56  ? -2.636  -10.706 32.793  1.00 4.26   ? 56  GLN E CA  1 
ATOM   5314  C  C   . GLN E  1 56  ? -4.148  -10.471 32.882  1.00 4.31   ? 56  GLN E C   1 
ATOM   5315  O  O   . GLN E  1 56  ? -4.969  -11.231 32.404  1.00 3.49   ? 56  GLN E O   1 
ATOM   5316  C  CB  . GLN E  1 56  ? -2.234  -11.209 34.180  1.00 5.27   ? 56  GLN E CB  1 
ATOM   5317  C  CG  . GLN E  1 56  ? -0.986  -12.013 34.146  1.00 17.06  ? 56  GLN E CG  1 
ATOM   5318  C  CD  . GLN E  1 56  ? -0.700  -12.781 35.402  1.00 27.49  ? 56  GLN E CD  1 
ATOM   5319  O  OE1 . GLN E  1 56  ? -1.592  -13.015 36.206  1.00 13.11  ? 56  GLN E OE1 1 
ATOM   5320  N  NE2 . GLN E  1 56  ? 0.542   -13.231 35.551  1.00 11.70  ? 56  GLN E NE2 1 
ATOM   5321  N  N   . MET E  1 57  ? -4.442  -9.332  33.475  1.00 1.00   ? 57  MET E N   1 
ATOM   5322  C  CA  . MET E  1 57  ? -5.802  -8.960  33.657  1.00 1.00   ? 57  MET E CA  1 
ATOM   5323  C  C   . MET E  1 57  ? -6.521  -8.863  32.334  1.00 4.72   ? 57  MET E C   1 
ATOM   5324  O  O   . MET E  1 57  ? -7.562  -9.500  32.186  1.00 11.18  ? 57  MET E O   1 
ATOM   5325  C  CB  . MET E  1 57  ? -5.829  -7.650  34.412  1.00 3.29   ? 57  MET E CB  1 
ATOM   5326  C  CG  . MET E  1 57  ? -7.152  -7.344  35.056  1.00 9.84   ? 57  MET E CG  1 
ATOM   5327  S  SD  . MET E  1 57  ? -8.197  -6.479  33.943  1.00 15.69  ? 57  MET E SD  1 
ATOM   5328  C  CE  . MET E  1 57  ? -7.451  -4.916  34.006  1.00 7.80   ? 57  MET E CE  1 
ATOM   5329  N  N   . ASP E  1 58  ? -6.012  -8.081  31.386  1.00 1.00   ? 58  ASP E N   1 
ATOM   5330  C  CA  . ASP E  1 58  ? -6.725  -8.000  30.100  1.00 2.61   ? 58  ASP E CA  1 
ATOM   5331  C  C   . ASP E  1 58  ? -6.943  -9.384  29.406  1.00 4.79   ? 58  ASP E C   1 
ATOM   5332  O  O   . ASP E  1 58  ? -7.965  -9.656  28.748  1.00 2.49   ? 58  ASP E O   1 
ATOM   5333  C  CB  . ASP E  1 58  ? -6.080  -6.967  29.158  1.00 6.23   ? 58  ASP E CB  1 
ATOM   5334  C  CG  . ASP E  1 58  ? -7.025  -6.504  27.993  1.00 16.41  ? 58  ASP E CG  1 
ATOM   5335  O  OD1 . ASP E  1 58  ? -8.118  -5.953  28.274  1.00 22.75  ? 58  ASP E OD1 1 
ATOM   5336  O  OD2 . ASP E  1 58  ? -6.643  -6.586  26.791  1.00 20.01  ? 58  ASP E OD2 1 
ATOM   5337  N  N   . GLU E  1 59  ? -5.939  -10.241 29.530  1.00 3.88   ? 59  GLU E N   1 
ATOM   5338  C  CA  . GLU E  1 59  ? -5.965  -11.558 28.902  1.00 5.21   ? 59  GLU E CA  1 
ATOM   5339  C  C   . GLU E  1 59  ? -6.960  -12.490 29.568  1.00 4.46   ? 59  GLU E C   1 
ATOM   5340  O  O   . GLU E  1 59  ? -7.605  -13.288 28.899  1.00 2.74   ? 59  GLU E O   1 
ATOM   5341  C  CB  . GLU E  1 59  ? -4.602  -12.291 28.941  1.00 8.23   ? 59  GLU E CB  1 
ATOM   5342  C  CG  . GLU E  1 59  ? -3.482  -11.725 28.065  1.00 48.42  ? 59  GLU E CG  1 
ATOM   5343  C  CD  . GLU E  1 59  ? -2.210  -12.536 28.076  0.00 100.00 ? 59  GLU E CD  1 
ATOM   5344  O  OE1 . GLU E  1 59  ? -2.293  -13.780 28.131  0.00 100.00 ? 59  GLU E OE1 1 
ATOM   5345  O  OE2 . GLU E  1 59  ? -1.113  -11.948 27.968  0.00 100.00 ? 59  GLU E OE2 1 
ATOM   5346  N  N   . VAL E  1 60  ? -7.030  -12.462 30.889  1.00 3.62   ? 60  VAL E N   1 
ATOM   5347  C  CA  . VAL E  1 60  ? -8.010  -13.290 31.580  1.00 1.34   ? 60  VAL E CA  1 
ATOM   5348  C  C   . VAL E  1 60  ? -9.399  -12.796 31.144  1.00 3.65   ? 60  VAL E C   1 
ATOM   5349  O  O   . VAL E  1 60  ? -10.226 -13.601 30.713  1.00 5.20   ? 60  VAL E O   1 
ATOM   5350  C  CB  . VAL E  1 60  ? -7.802  -13.048 33.105  1.00 5.90   ? 60  VAL E CB  1 
ATOM   5351  C  CG1 . VAL E  1 60  ? -9.011  -13.482 33.924  1.00 2.60   ? 60  VAL E CG1 1 
ATOM   5352  C  CG2 . VAL E  1 60  ? -6.523  -13.742 33.572  1.00 1.00   ? 60  VAL E CG2 1 
ATOM   5353  N  N   . ALA E  1 61  ? -9.633  -11.480 31.178  1.00 1.00   ? 61  ALA E N   1 
ATOM   5354  C  CA  . ALA E  1 61  ? -10.926 -10.927 30.768  1.00 1.00   ? 61  ALA E CA  1 
ATOM   5355  C  C   . ALA E  1 61  ? -11.227 -11.296 29.337  1.00 8.77   ? 61  ALA E C   1 
ATOM   5356  O  O   . ALA E  1 61  ? -12.330 -11.702 29.011  1.00 7.53   ? 61  ALA E O   1 
ATOM   5357  C  CB  . ALA E  1 61  ? -10.973 -9.433  30.928  1.00 1.00   ? 61  ALA E CB  1 
ATOM   5358  N  N   . GLU E  1 62  ? -10.254 -11.165 28.456  1.00 2.51   ? 62  GLU E N   1 
ATOM   5359  C  CA  . GLU E  1 62  ? -10.543 -11.503 27.081  1.00 2.47   ? 62  GLU E CA  1 
ATOM   5360  C  C   . GLU E  1 62  ? -10.759 -13.014 26.871  1.00 8.34   ? 62  GLU E C   1 
ATOM   5361  O  O   . GLU E  1 62  ? -11.542 -13.406 26.008  1.00 6.95   ? 62  GLU E O   1 
ATOM   5362  C  CB  . GLU E  1 62  ? -9.579  -10.802 26.134  1.00 1.82   ? 62  GLU E CB  1 
ATOM   5363  C  CG  . GLU E  1 62  ? -9.643  -9.272  26.217  1.00 9.80   ? 62  GLU E CG  1 
ATOM   5364  C  CD  . GLU E  1 62  ? -8.690  -8.520  25.281  1.00 10.96  ? 62  GLU E CD  1 
ATOM   5365  O  OE1 . GLU E  1 62  ? -7.835  -9.129  24.618  1.00 42.88  ? 62  GLU E OE1 1 
ATOM   5366  O  OE2 . GLU E  1 62  ? -8.800  -7.270  25.235  1.00 21.87  ? 62  GLU E OE2 1 
ATOM   5367  N  N   . ARG E  1 63  ? -10.121 -13.879 27.657  1.00 3.26   ? 63  ARG E N   1 
ATOM   5368  C  CA  . ARG E  1 63  ? -10.298 -15.330 27.542  1.00 3.52   ? 63  ARG E CA  1 
ATOM   5369  C  C   . ARG E  1 63  ? -11.730 -15.642 28.042  1.00 8.31   ? 63  ARG E C   1 
ATOM   5370  O  O   . ARG E  1 63  ? -12.461 -16.443 27.456  1.00 7.05   ? 63  ARG E O   1 
ATOM   5371  C  CB  . ARG E  1 63  ? -9.243  -16.067 28.379  1.00 1.00   ? 63  ARG E CB  1 
ATOM   5372  C  CG  . ARG E  1 63  ? -9.448  -17.557 28.422  1.00 1.00   ? 63  ARG E CG  1 
ATOM   5373  C  CD  . ARG E  1 63  ? -9.579  -18.090 27.003  1.00 1.56   ? 63  ARG E CD  1 
ATOM   5374  N  NE  . ARG E  1 63  ? -9.813  -19.521 27.014  1.00 5.32   ? 63  ARG E NE  1 
ATOM   5375  C  CZ  . ARG E  1 63  ? -10.189 -20.259 25.990  1.00 6.08   ? 63  ARG E CZ  1 
ATOM   5376  N  NH1 . ARG E  1 63  ? -10.379 -19.741 24.802  1.00 1.00   ? 63  ARG E NH1 1 
ATOM   5377  N  NH2 . ARG E  1 63  ? -10.389 -21.533 26.133  1.00 1.68   ? 63  ARG E NH2 1 
ATOM   5378  N  N   . LEU E  1 64  ? -12.168 -14.939 29.075  1.00 1.00   ? 64  LEU E N   1 
ATOM   5379  C  CA  . LEU E  1 64  ? -13.516 -15.154 29.567  1.00 2.96   ? 64  LEU E CA  1 
ATOM   5380  C  C   . LEU E  1 64  ? -14.532 -14.829 28.462  1.00 11.67  ? 64  LEU E C   1 
ATOM   5381  O  O   . LEU E  1 64  ? -15.429 -15.603 28.151  1.00 10.24  ? 64  LEU E O   1 
ATOM   5382  C  CB  . LEU E  1 64  ? -13.727 -14.196 30.731  1.00 1.19   ? 64  LEU E CB  1 
ATOM   5383  C  CG  . LEU E  1 64  ? -15.110 -14.214 31.353  1.00 9.17   ? 64  LEU E CG  1 
ATOM   5384  C  CD1 . LEU E  1 64  ? -15.410 -15.638 31.739  1.00 5.25   ? 64  LEU E CD1 1 
ATOM   5385  C  CD2 . LEU E  1 64  ? -15.038 -13.325 32.563  1.00 2.98   ? 64  LEU E CD2 1 
ATOM   5386  N  N   . LEU E  1 65  ? -14.372 -13.645 27.887  1.00 5.33   ? 65  LEU E N   1 
ATOM   5387  C  CA  . LEU E  1 65  ? -15.237 -13.170 26.823  1.00 2.87   ? 65  LEU E CA  1 
ATOM   5388  C  C   . LEU E  1 65  ? -15.252 -14.247 25.724  1.00 9.01   ? 65  LEU E C   1 
ATOM   5389  O  O   . LEU E  1 65  ? -16.312 -14.705 25.288  1.00 5.95   ? 65  LEU E O   1 
ATOM   5390  C  CB  . LEU E  1 65  ? -14.509 -11.924 26.354  1.00 2.99   ? 65  LEU E CB  1 
ATOM   5391  C  CG  . LEU E  1 65  ? -15.149 -10.587 26.024  1.00 8.90   ? 65  LEU E CG  1 
ATOM   5392  C  CD1 . LEU E  1 65  ? -16.257 -10.449 27.034  1.00 1.51   ? 65  LEU E CD1 1 
ATOM   5393  C  CD2 . LEU E  1 65  ? -14.058 -9.565  26.320  1.00 1.00   ? 65  LEU E CD2 1 
ATOM   5394  N  N   . ALA E  1 66  ? -14.077 -14.746 25.353  1.00 6.26   ? 66  ALA E N   1 
ATOM   5395  C  CA  . ALA E  1 66  ? -13.952 -15.780 24.325  1.00 5.01   ? 66  ALA E CA  1 
ATOM   5396  C  C   . ALA E  1 66  ? -14.649 -17.106 24.630  1.00 12.12  ? 66  ALA E C   1 
ATOM   5397  O  O   . ALA E  1 66  ? -15.002 -17.858 23.706  1.00 5.43   ? 66  ALA E O   1 
ATOM   5398  C  CB  . ALA E  1 66  ? -12.491 -16.047 24.011  1.00 4.99   ? 66  ALA E CB  1 
ATOM   5399  N  N   . ILE E  1 67  ? -14.765 -17.433 25.915  1.00 10.17  ? 67  ILE E N   1 
ATOM   5400  C  CA  . ILE E  1 67  ? -15.474 -18.664 26.231  1.00 7.95   ? 67  ILE E CA  1 
ATOM   5401  C  C   . ILE E  1 67  ? -16.956 -18.377 26.494  1.00 16.86  ? 67  ILE E C   1 
ATOM   5402  O  O   . ILE E  1 67  ? -17.712 -19.188 27.014  1.00 14.48  ? 67  ILE E O   1 
ATOM   5403  C  CB  . ILE E  1 67  ? -14.906 -19.475 27.385  1.00 7.51   ? 67  ILE E CB  1 
ATOM   5404  C  CG1 . ILE E  1 67  ? -14.901 -18.639 28.659  1.00 5.62   ? 67  ILE E CG1 1 
ATOM   5405  C  CG2 . ILE E  1 67  ? -13.595 -20.097 26.997  1.00 5.00   ? 67  ILE E CG2 1 
ATOM   5406  C  CD1 . ILE E  1 67  ? -14.302 -19.381 29.815  1.00 28.95  ? 67  ILE E CD1 1 
ATOM   5407  N  N   . GLY E  1 68  ? -17.389 -17.192 26.106  1.00 7.30   ? 68  GLY E N   1 
ATOM   5408  C  CA  . GLY E  1 68  ? -18.772 -16.842 26.272  1.00 1.98   ? 68  GLY E CA  1 
ATOM   5409  C  C   . GLY E  1 68  ? -19.135 -16.177 27.574  1.00 12.21  ? 68  GLY E C   1 
ATOM   5410  O  O   . GLY E  1 68  ? -20.323 -16.068 27.869  1.00 19.44  ? 68  GLY E O   1 
ATOM   5411  N  N   . GLY E  1 69  ? -18.156 -15.721 28.348  1.00 8.12   ? 69  GLY E N   1 
ATOM   5412  C  CA  . GLY E  1 69  ? -18.450 -15.078 29.630  1.00 1.42   ? 69  GLY E CA  1 
ATOM   5413  C  C   . GLY E  1 69  ? -18.599 -13.562 29.514  1.00 6.00   ? 69  GLY E C   1 
ATOM   5414  O  O   . GLY E  1 69  ? -18.529 -13.019 28.399  1.00 5.65   ? 69  GLY E O   1 
ATOM   5415  N  N   . SER E  1 70  ? -18.749 -12.910 30.676  1.00 4.98   ? 70  SER E N   1 
ATOM   5416  C  CA  . SER E  1 70  ? -18.904 -11.452 30.761  1.00 8.37   ? 70  SER E CA  1 
ATOM   5417  C  C   . SER E  1 70  ? -18.145 -10.912 31.946  1.00 16.55  ? 70  SER E C   1 
ATOM   5418  O  O   . SER E  1 70  ? -18.575 -11.088 33.076  1.00 21.91  ? 70  SER E O   1 
ATOM   5419  C  CB  . SER E  1 70  ? -20.388 -11.127 30.952  1.00 11.80  ? 70  SER E CB  1 
ATOM   5420  O  OG  . SER E  1 70  ? -21.135 -11.585 29.836  1.00 33.50  ? 70  SER E OG  1 
ATOM   5421  N  N   . PRO E  1 71  ? -16.994 -10.311 31.703  1.00 12.93  ? 71  PRO E N   1 
ATOM   5422  C  CA  . PRO E  1 71  ? -16.151 -9.899  32.796  1.00 9.70   ? 71  PRO E CA  1 
ATOM   5423  C  C   . PRO E  1 71  ? -16.717 -8.784  33.618  1.00 8.93   ? 71  PRO E C   1 
ATOM   5424  O  O   . PRO E  1 71  ? -17.298 -7.870  33.050  1.00 5.38   ? 71  PRO E O   1 
ATOM   5425  C  CB  . PRO E  1 71  ? -14.922 -9.359  32.074  1.00 9.53   ? 71  PRO E CB  1 
ATOM   5426  C  CG  . PRO E  1 71  ? -15.407 -8.909  30.781  1.00 13.95  ? 71  PRO E CG  1 
ATOM   5427  C  CD  . PRO E  1 71  ? -16.369 -9.992  30.413  1.00 7.79   ? 71  PRO E CD  1 
ATOM   5428  N  N   . PHE E  1 72  ? -16.408 -8.786  34.909  1.00 7.28   ? 72  PHE E N   1 
ATOM   5429  C  CA  . PHE E  1 72  ? -16.780 -7.641  35.744  1.00 4.17   ? 72  PHE E CA  1 
ATOM   5430  C  C   . PHE E  1 72  ? -16.098 -6.411  35.146  1.00 12.96  ? 72  PHE E C   1 
ATOM   5431  O  O   . PHE E  1 72  ? -15.007 -6.482  34.571  1.00 10.47  ? 72  PHE E O   1 
ATOM   5432  C  CB  . PHE E  1 72  ? -16.243 -7.783  37.163  1.00 5.07   ? 72  PHE E CB  1 
ATOM   5433  C  CG  . PHE E  1 72  ? -16.788 -8.956  37.903  1.00 8.85   ? 72  PHE E CG  1 
ATOM   5434  C  CD1 . PHE E  1 72  ? -18.153 -9.101  38.075  1.00 14.17  ? 72  PHE E CD1 1 
ATOM   5435  C  CD2 . PHE E  1 72  ? -15.932 -9.911  38.447  1.00 10.14  ? 72  PHE E CD2 1 
ATOM   5436  C  CE1 . PHE E  1 72  ? -18.650 -10.192 38.774  1.00 18.13  ? 72  PHE E CE1 1 
ATOM   5437  C  CE2 . PHE E  1 72  ? -16.409 -10.988 39.189  1.00 11.87  ? 72  PHE E CE2 1 
ATOM   5438  C  CZ  . PHE E  1 72  ? -17.781 -11.135 39.343  1.00 13.52  ? 72  PHE E CZ  1 
ATOM   5439  N  N   . SER E  1 73  ? -16.685 -5.242  35.316  1.00 5.87   ? 73  SER E N   1 
ATOM   5440  C  CA  . SER E  1 73  ? -16.029 -4.115  34.675  1.00 1.84   ? 73  SER E CA  1 
ATOM   5441  C  C   . SER E  1 73  ? -16.326 -2.777  35.324  1.00 6.81   ? 73  SER E C   1 
ATOM   5442  O  O   . SER E  1 73  ? -16.535 -1.772  34.638  1.00 5.29   ? 73  SER E O   1 
ATOM   5443  C  CB  . SER E  1 73  ? -16.380 -4.098  33.190  1.00 6.18   ? 73  SER E CB  1 
ATOM   5444  O  OG  . SER E  1 73  ? -17.759 -3.932  32.963  1.00 11.83  ? 73  SER E OG  1 
ATOM   5445  N  N   . THR E  1 74  ? -16.243 -2.747  36.650  1.00 3.14   ? 74  THR E N   1 
ATOM   5446  C  CA  . THR E  1 74  ? -16.472 -1.527  37.428  1.00 4.16   ? 74  THR E CA  1 
ATOM   5447  C  C   . THR E  1 74  ? -15.753 -1.807  38.737  1.00 6.75   ? 74  THR E C   1 
ATOM   5448  O  O   . THR E  1 74  ? -15.657 -2.968  39.157  1.00 9.36   ? 74  THR E O   1 
ATOM   5449  C  CB  . THR E  1 74  ? -17.983 -1.339  37.817  1.00 10.72  ? 74  THR E CB  1 
ATOM   5450  O  OG1 . THR E  1 74  ? -18.456 -2.511  38.510  1.00 12.61  ? 74  THR E OG1 1 
ATOM   5451  C  CG2 . THR E  1 74  ? -18.867 -1.076  36.574  1.00 5.10   ? 74  THR E CG2 1 
ATOM   5452  N  N   . LEU E  1 75  ? -15.266 -0.740  39.360  1.00 4.13   ? 75  LEU E N   1 
ATOM   5453  C  CA  . LEU E  1 75  ? -14.590 -0.887  40.640  1.00 6.87   ? 75  LEU E CA  1 
ATOM   5454  C  C   . LEU E  1 75  ? -15.468 -1.582  41.672  1.00 11.58  ? 75  LEU E C   1 
ATOM   5455  O  O   . LEU E  1 75  ? -15.040 -2.419  42.451  1.00 14.44  ? 75  LEU E O   1 
ATOM   5456  C  CB  . LEU E  1 75  ? -14.178 0.467   41.188  1.00 7.25   ? 75  LEU E CB  1 
ATOM   5457  C  CG  . LEU E  1 75  ? -12.981 1.091   40.467  1.00 13.75  ? 75  LEU E CG  1 
ATOM   5458  C  CD1 . LEU E  1 75  ? -13.420 1.396   39.079  1.00 16.83  ? 75  LEU E CD1 1 
ATOM   5459  C  CD2 . LEU E  1 75  ? -12.551 2.391   41.095  1.00 9.14   ? 75  LEU E CD2 1 
ATOM   5460  N  N   . LYS E  1 76  ? -16.737 -1.218  41.655  1.00 10.35  ? 76  LYS E N   1 
ATOM   5461  C  CA  . LYS E  1 76  ? -17.687 -1.792  42.585  1.00 10.41  ? 76  LYS E CA  1 
ATOM   5462  C  C   . LYS E  1 76  ? -17.737 -3.294  42.408  1.00 10.41  ? 76  LYS E C   1 
ATOM   5463  O  O   . LYS E  1 76  ? -17.599 -4.062  43.356  1.00 10.62  ? 76  LYS E O   1 
ATOM   5464  C  CB  . LYS E  1 76  ? -19.044 -1.128  42.391  1.00 15.21  ? 76  LYS E CB  1 
ATOM   5465  C  CG  . LYS E  1 76  ? -20.157 -1.705  43.261  1.00 50.03  ? 76  LYS E CG  1 
ATOM   5466  C  CD  . LYS E  1 76  ? -21.410 -0.856  43.151  1.00 99.13  ? 76  LYS E CD  1 
ATOM   5467  C  CE  . LYS E  1 76  ? -22.546 -1.441  43.970  1.00 99.97  ? 76  LYS E CE  1 
ATOM   5468  N  NZ  . LYS E  1 76  ? -23.061 -2.706  43.418  0.00 100.00 ? 76  LYS E NZ  1 
ATOM   5469  N  N   . GLU E  1 77  ? -17.861 -3.775  41.177  1.00 7.50   ? 77  GLU E N   1 
ATOM   5470  C  CA  . GLU E  1 77  ? -17.866 -5.221  41.028  1.00 6.94   ? 77  GLU E CA  1 
ATOM   5471  C  C   . GLU E  1 77  ? -16.533 -5.831  41.467  1.00 10.34  ? 77  GLU E C   1 
ATOM   5472  O  O   . GLU E  1 77  ? -16.527 -6.935  42.028  1.00 9.68   ? 77  GLU E O   1 
ATOM   5473  C  CB  . GLU E  1 77  ? -18.090 -5.615  39.567  1.00 8.53   ? 77  GLU E CB  1 
ATOM   5474  C  CG  . GLU E  1 77  ? -19.465 -5.282  39.034  1.00 11.83  ? 77  GLU E CG  1 
ATOM   5475  C  CD  . GLU E  1 77  ? -19.616 -5.396  37.518  1.00 35.13  ? 77  GLU E CD  1 
ATOM   5476  O  OE1 . GLU E  1 77  ? -19.065 -4.526  36.810  1.00 28.06  ? 77  GLU E OE1 1 
ATOM   5477  O  OE2 . GLU E  1 77  ? -20.278 -6.361  37.060  1.00 31.07  ? 77  GLU E OE2 1 
ATOM   5478  N  N   . PHE E  1 78  ? -15.414 -5.147  41.197  1.00 8.94   ? 78  PHE E N   1 
ATOM   5479  C  CA  . PHE E  1 78  ? -14.111 -5.697  41.557  1.00 8.26   ? 78  PHE E CA  1 
ATOM   5480  C  C   . PHE E  1 78  ? -14.048 -5.817  43.062  1.00 12.58  ? 78  PHE E C   1 
ATOM   5481  O  O   . PHE E  1 78  ? -13.664 -6.861  43.592  1.00 12.74  ? 78  PHE E O   1 
ATOM   5482  C  CB  . PHE E  1 78  ? -12.932 -4.861  41.087  1.00 5.79   ? 78  PHE E CB  1 
ATOM   5483  C  CG  . PHE E  1 78  ? -12.868 -4.686  39.597  1.00 3.52   ? 78  PHE E CG  1 
ATOM   5484  C  CD1 . PHE E  1 78  ? -13.379 -5.651  38.739  1.00 3.89   ? 78  PHE E CD1 1 
ATOM   5485  C  CD2 . PHE E  1 78  ? -12.333 -3.532  39.055  1.00 4.05   ? 78  PHE E CD2 1 
ATOM   5486  C  CE1 . PHE E  1 78  ? -13.359 -5.464  37.371  1.00 6.80   ? 78  PHE E CE1 1 
ATOM   5487  C  CE2 . PHE E  1 78  ? -12.295 -3.335  37.679  1.00 1.47   ? 78  PHE E CE2 1 
ATOM   5488  C  CZ  . PHE E  1 78  ? -12.803 -4.303  36.839  1.00 4.08   ? 78  PHE E CZ  1 
ATOM   5489  N  N   . LEU E  1 79  ? -14.447 -4.758  43.764  1.00 8.14   ? 79  LEU E N   1 
ATOM   5490  C  CA  . LEU E  1 79  ? -14.433 -4.752  45.224  1.00 13.13  ? 79  LEU E CA  1 
ATOM   5491  C  C   . LEU E  1 79  ? -15.349 -5.802  45.754  1.00 20.65  ? 79  LEU E C   1 
ATOM   5492  O  O   . LEU E  1 79  ? -15.041 -6.476  46.709  1.00 17.79  ? 79  LEU E O   1 
ATOM   5493  C  CB  . LEU E  1 79  ? -14.961 -3.416  45.726  1.00 15.71  ? 79  LEU E CB  1 
ATOM   5494  C  CG  . LEU E  1 79  ? -13.766 -2.483  45.828  1.00 24.58  ? 79  LEU E CG  1 
ATOM   5495  C  CD1 . LEU E  1 79  ? -14.159 -1.104  46.311  1.00 19.86  ? 79  LEU E CD1 1 
ATOM   5496  C  CD2 . LEU E  1 79  ? -12.844 -3.178  46.820  1.00 27.00  ? 79  LEU E CD2 1 
ATOM   5497  N  N   . GLU E  1 80  ? -16.495 -5.949  45.116  1.00 15.65  ? 80  GLU E N   1 
ATOM   5498  C  CA  . GLU E  1 80  ? -17.421 -6.966  45.591  1.00 18.32  ? 80  GLU E CA  1 
ATOM   5499  C  C   . GLU E  1 80  ? -16.885 -8.389  45.403  1.00 25.69  ? 80  GLU E C   1 
ATOM   5500  O  O   . GLU E  1 80  ? -17.210 -9.297  46.165  1.00 38.34  ? 80  GLU E O   1 
ATOM   5501  C  CB  . GLU E  1 80  ? -18.798 -6.835  44.923  1.00 18.28  ? 80  GLU E CB  1 
ATOM   5502  C  CG  . GLU E  1 80  ? -19.442 -5.529  45.264  1.00 62.91  ? 80  GLU E CG  1 
ATOM   5503  C  CD  . GLU E  1 80  ? -20.759 -5.377  44.591  1.00 99.81  ? 80  GLU E CD  1 
ATOM   5504  O  OE1 . GLU E  1 80  ? -21.034 -6.120  43.637  1.00 99.50  ? 80  GLU E OE1 1 
ATOM   5505  O  OE2 . GLU E  1 80  ? -21.511 -4.492  45.041  0.00 100.00 ? 80  GLU E OE2 1 
ATOM   5506  N  N   . ASN E  1 81  ? -16.147 -8.619  44.330  1.00 12.05  ? 81  ASN E N   1 
ATOM   5507  C  CA  . ASN E  1 81  ? -15.701 -9.978  44.100  1.00 11.29  ? 81  ASN E CA  1 
ATOM   5508  C  C   . ASN E  1 81  ? -14.267 -10.414 44.451  1.00 14.56  ? 81  ASN E C   1 
ATOM   5509  O  O   . ASN E  1 81  ? -13.961 -11.618 44.458  1.00 19.39  ? 81  ASN E O   1 
ATOM   5510  C  CB  . ASN E  1 81  ? -16.047 -10.395 42.672  1.00 14.36  ? 81  ASN E CB  1 
ATOM   5511  C  CG  . ASN E  1 81  ? -17.515 -10.287 42.394  1.00 14.62  ? 81  ASN E CG  1 
ATOM   5512  O  OD1 . ASN E  1 81  ? -18.000 -9.193  42.090  1.00 20.85  ? 81  ASN E OD1 1 
ATOM   5513  N  ND2 . ASN E  1 81  ? -18.222 -11.410 42.496  1.00 15.34  ? 81  ASN E ND2 1 
ATOM   5514  N  N   . ALA E  1 82  ? -13.374 -9.456  44.677  1.00 12.82  ? 82  ALA E N   1 
ATOM   5515  C  CA  . ALA E  1 82  ? -11.980 -9.800  44.940  1.00 12.86  ? 82  ALA E CA  1 
ATOM   5516  C  C   . ALA E  1 82  ? -11.676 -10.546 46.243  1.00 16.88  ? 82  ALA E C   1 
ATOM   5517  O  O   . ALA E  1 82  ? -12.226 -10.214 47.288  1.00 20.02  ? 82  ALA E O   1 
ATOM   5518  C  CB  . ALA E  1 82  ? -11.095 -8.565  44.846  1.00 12.31  ? 82  ALA E CB  1 
ATOM   5519  N  N   . SER E  1 83  ? -10.774 -11.523 46.161  1.00 7.51   ? 83  SER E N   1 
ATOM   5520  C  CA  . SER E  1 83  ? -10.265 -12.216 47.337  1.00 4.69   ? 83  SER E CA  1 
ATOM   5521  C  C   . SER E  1 83  ? -9.010  -11.478 47.801  1.00 13.97  ? 83  SER E C   1 
ATOM   5522  O  O   . SER E  1 83  ? -8.598  -11.607 48.946  1.00 16.70  ? 83  SER E O   1 
ATOM   5523  C  CB  . SER E  1 83  ? -10.014 -13.702 47.088  1.00 3.35   ? 83  SER E CB  1 
ATOM   5524  O  OG  . SER E  1 83  ? -9.198  -13.875 45.964  1.00 25.12  ? 83  SER E OG  1 
ATOM   5525  N  N   . VAL E  1 84  ? -8.429  -10.678 46.910  1.00 12.84  ? 84  VAL E N   1 
ATOM   5526  C  CA  . VAL E  1 84  ? -7.258  -9.885  47.252  1.00 8.29   ? 84  VAL E CA  1 
ATOM   5527  C  C   . VAL E  1 84  ? -7.683  -8.734  48.153  1.00 12.48  ? 84  VAL E C   1 
ATOM   5528  O  O   . VAL E  1 84  ? -8.678  -8.071  47.877  1.00 12.03  ? 84  VAL E O   1 
ATOM   5529  C  CB  . VAL E  1 84  ? -6.572  -9.320  46.008  1.00 6.07   ? 84  VAL E CB  1 
ATOM   5530  C  CG1 . VAL E  1 84  ? -5.537  -8.262  46.365  1.00 4.59   ? 84  VAL E CG1 1 
ATOM   5531  C  CG2 . VAL E  1 84  ? -6.020  -10.430 45.158  1.00 2.89   ? 84  VAL E CG2 1 
ATOM   5532  N  N   . GLU E  1 85  ? -6.963  -8.497  49.245  1.00 21.04  ? 85  GLU E N   1 
ATOM   5533  C  CA  . GLU E  1 85  ? -7.334  -7.460  50.215  1.00 21.18  ? 85  GLU E CA  1 
ATOM   5534  C  C   . GLU E  1 85  ? -6.599  -6.181  49.964  1.00 18.24  ? 85  GLU E C   1 
ATOM   5535  O  O   . GLU E  1 85  ? -5.415  -6.221  49.680  1.00 22.39  ? 85  GLU E O   1 
ATOM   5536  C  CB  . GLU E  1 85  ? -6.977  -7.869  51.642  1.00 27.23  ? 85  GLU E CB  1 
ATOM   5537  C  CG  . GLU E  1 85  ? -7.884  -8.922  52.272  1.00 73.47  ? 85  GLU E CG  1 
ATOM   5538  C  CD  . GLU E  1 85  ? -9.331  -8.487  52.284  0.00 100.00 ? 85  GLU E CD  1 
ATOM   5539  O  OE1 . GLU E  1 85  ? -9.581  -7.287  52.077  0.00 100.00 ? 85  GLU E OE1 1 
ATOM   5540  O  OE2 . GLU E  1 85  ? -10.214 -9.347  52.465  0.00 100.00 ? 85  GLU E OE2 1 
ATOM   5541  N  N   . GLU E  1 86  ? -7.241  -5.054  50.211  1.00 13.08  ? 86  GLU E N   1 
ATOM   5542  C  CA  . GLU E  1 86  ? -6.547  -3.795  50.009  1.00 16.22  ? 86  GLU E CA  1 
ATOM   5543  C  C   . GLU E  1 86  ? -6.777  -2.939  51.241  1.00 19.63  ? 86  GLU E C   1 
ATOM   5544  O  O   . GLU E  1 86  ? -7.758  -3.143  51.955  1.00 21.37  ? 86  GLU E O   1 
ATOM   5545  C  CB  . GLU E  1 86  ? -7.098  -3.082  48.772  1.00 17.50  ? 86  GLU E CB  1 
ATOM   5546  C  CG  . GLU E  1 86  ? -8.573  -2.727  48.849  1.00 39.74  ? 86  GLU E CG  1 
ATOM   5547  C  CD  . GLU E  1 86  ? -9.018  -1.622  47.878  1.00 49.51  ? 86  GLU E CD  1 
ATOM   5548  O  OE1 . GLU E  1 86  ? -8.335  -1.355  46.853  1.00 28.76  ? 86  GLU E OE1 1 
ATOM   5549  O  OE2 . GLU E  1 86  ? -10.083 -1.008  48.145  1.00 25.46  ? 86  GLU E OE2 1 
ATOM   5550  N  N   . ALA E  1 87  ? -5.899  -1.971  51.473  1.00 15.80  ? 87  ALA E N   1 
ATOM   5551  C  CA  . ALA E  1 87  ? -6.061  -1.072  52.601  1.00 17.42  ? 87  ALA E CA  1 
ATOM   5552  C  C   . ALA E  1 87  ? -5.395  0.261   52.337  1.00 20.99  ? 87  ALA E C   1 
ATOM   5553  O  O   . ALA E  1 87  ? -4.252  0.333   51.889  1.00 25.12  ? 87  ALA E O   1 
ATOM   5554  C  CB  . ALA E  1 87  ? -5.475  -1.671  53.872  1.00 17.37  ? 87  ALA E CB  1 
ATOM   5555  N  N   . PRO E  1 88  ? -6.120  1.314   52.687  1.00 17.10  ? 88  PRO E N   1 
ATOM   5556  C  CA  . PRO E  1 88  ? -5.615  2.679   52.541  1.00 21.09  ? 88  PRO E CA  1 
ATOM   5557  C  C   . PRO E  1 88  ? -4.294  2.861   53.289  1.00 19.16  ? 88  PRO E C   1 
ATOM   5558  O  O   . PRO E  1 88  ? -4.020  2.227   54.312  1.00 16.02  ? 88  PRO E O   1 
ATOM   5559  C  CB  . PRO E  1 88  ? -6.692  3.518   53.198  1.00 23.16  ? 88  PRO E CB  1 
ATOM   5560  C  CG  . PRO E  1 88  ? -7.261  2.598   54.201  1.00 26.97  ? 88  PRO E CG  1 
ATOM   5561  C  CD  . PRO E  1 88  ? -7.300  1.258   53.547  1.00 17.92  ? 88  PRO E CD  1 
ATOM   5562  N  N   . TYR E  1 89  ? -3.463  3.717   52.717  1.00 15.65  ? 89  TYR E N   1 
ATOM   5563  C  CA  . TYR E  1 89  ? -2.147  3.927   53.278  1.00 15.33  ? 89  TYR E CA  1 
ATOM   5564  C  C   . TYR E  1 89  ? -2.212  5.081   54.219  1.00 30.32  ? 89  TYR E C   1 
ATOM   5565  O  O   . TYR E  1 89  ? -2.296  6.223   53.845  1.00 35.01  ? 89  TYR E O   1 
ATOM   5566  C  CB  . TYR E  1 89  ? -1.150  4.202   52.164  1.00 8.46   ? 89  TYR E CB  1 
ATOM   5567  C  CG  . TYR E  1 89  ? 0.251   4.215   52.693  1.00 10.06  ? 89  TYR E CG  1 
ATOM   5568  C  CD1 . TYR E  1 89  ? 1.023   3.056   52.696  1.00 8.99   ? 89  TYR E CD1 1 
ATOM   5569  C  CD2 . TYR E  1 89  ? 0.840   5.401   53.104  1.00 14.27  ? 89  TYR E CD2 1 
ATOM   5570  C  CE1 . TYR E  1 89  ? 2.381   3.102   53.096  1.00 9.32   ? 89  TYR E CE1 1 
ATOM   5571  C  CE2 . TYR E  1 89  ? 2.191   5.462   53.498  1.00 17.96  ? 89  TYR E CE2 1 
ATOM   5572  C  CZ  . TYR E  1 89  ? 2.942   4.298   53.525  1.00 19.64  ? 89  TYR E CZ  1 
ATOM   5573  O  OH  . TYR E  1 89  ? 4.237   4.312   53.978  1.00 30.82  ? 89  TYR E OH  1 
ATOM   5574  N  N   . THR E  1 90  ? -2.217  4.718   55.486  1.00 35.41  ? 90  THR E N   1 
ATOM   5575  C  CA  . THR E  1 90  ? -2.313  5.726   56.537  1.00 38.73  ? 90  THR E CA  1 
ATOM   5576  C  C   . THR E  1 90  ? -0.983  5.818   57.251  1.00 47.67  ? 90  THR E C   1 
ATOM   5577  O  O   . THR E  1 90  ? -0.254  6.803   57.201  1.00 48.42  ? 90  THR E O   1 
ATOM   5578  C  CB  . THR E  1 90  ? -3.403  5.237   57.510  1.00 51.23  ? 90  THR E CB  1 
ATOM   5579  O  OG1 . THR E  1 90  ? -3.148  3.864   57.857  1.00 57.03  ? 90  THR E OG1 1 
ATOM   5580  C  CG2 . THR E  1 90  ? -4.747  5.330   56.833  1.00 51.76  ? 90  THR E CG2 1 
ATOM   5581  N  N   . LYS E  1 91  ? -0.696  4.707   57.907  1.00 31.21  ? 91  LYS E N   1 
ATOM   5582  C  CA  . LYS E  1 91  ? 0.542   4.635   58.655  1.00 28.47  ? 91  LYS E CA  1 
ATOM   5583  C  C   . LYS E  1 91  ? 1.617   4.258   57.667  1.00 21.56  ? 91  LYS E C   1 
ATOM   5584  O  O   . LYS E  1 91  ? 1.426   3.376   56.781  1.00 20.43  ? 91  LYS E O   1 
ATOM   5585  C  CB  . LYS E  1 91  ? 0.494   3.585   59.781  1.00 42.53  ? 91  LYS E CB  1 
ATOM   5586  C  CG  . LYS E  1 91  ? 1.768   3.601   60.621  1.00 73.54  ? 91  LYS E CG  1 
ATOM   5587  C  CD  . LYS E  1 91  ? 1.907   2.261   61.247  0.00 100.00 ? 91  LYS E CD  1 
ATOM   5588  C  CE  . LYS E  1 91  ? 0.486   1.863   61.634  0.00 100.00 ? 91  LYS E CE  1 
ATOM   5589  N  NZ  . LYS E  1 91  ? 0.394   0.432   62.014  0.00 100.00 ? 91  LYS E NZ  1 
ATOM   5590  N  N   . PRO E  1 92  ? 2.730   4.913   57.825  1.00 23.95  ? 92  PRO E N   1 
ATOM   5591  C  CA  . PRO E  1 92  ? 3.914   4.646   57.060  1.00 20.33  ? 92  PRO E CA  1 
ATOM   5592  C  C   . PRO E  1 92  ? 4.256   3.217   57.305  1.00 16.96  ? 92  PRO E C   1 
ATOM   5593  O  O   . PRO E  1 92  ? 4.016   2.704   58.445  1.00 23.52  ? 92  PRO E O   1 
ATOM   5594  C  CB  . PRO E  1 92  ? 4.988   5.506   57.700  1.00 43.01  ? 92  PRO E CB  1 
ATOM   5595  C  CG  . PRO E  1 92  ? 4.358   6.211   58.886  1.00 61.48  ? 92  PRO E CG  1 
ATOM   5596  C  CD  . PRO E  1 92  ? 2.941   5.730   59.025  1.00 23.59  ? 92  PRO E CD  1 
ATOM   5597  N  N   . LYS E  1 93  ? 4.782   2.593   56.307  1.00 8.16   ? 93  LYS E N   1 
ATOM   5598  C  CA  . LYS E  1 93  ? 5.199   1.211   56.420  1.00 11.24  ? 93  LYS E CA  1 
ATOM   5599  C  C   . LYS E  1 93  ? 6.608   1.117   55.876  1.00 19.58  ? 93  LYS E C   1 
ATOM   5600  O  O   . LYS E  1 93  ? 7.101   2.031   55.203  1.00 24.45  ? 93  LYS E O   1 
ATOM   5601  C  CB  . LYS E  1 93  ? 4.215   0.321   55.664  1.00 20.47  ? 93  LYS E CB  1 
ATOM   5602  C  CG  . LYS E  1 93  ? 2.887   0.140   56.410  1.00 26.79  ? 93  LYS E CG  1 
ATOM   5603  C  CD  . LYS E  1 93  ? 1.763   -0.381  55.513  1.00 94.30  ? 93  LYS E CD  1 
ATOM   5604  C  CE  . LYS E  1 93  ? 2.171   -1.620  54.717  0.00 100.00 ? 93  LYS E CE  1 
ATOM   5605  N  NZ  . LYS E  1 93  ? 1.156   -2.044  53.734  0.00 100.00 ? 93  LYS E NZ  1 
ATOM   5606  N  N   . THR E  1 94  ? 7.232   0.025   56.186  1.00 10.84  ? 94  THR E N   1 
ATOM   5607  C  CA  . THR E  1 94  ? 8.599   -0.223  55.763  1.00 12.61  ? 94  THR E CA  1 
ATOM   5608  C  C   . THR E  1 94  ? 8.601   -0.882  54.387  1.00 27.47  ? 94  THR E C   1 
ATOM   5609  O  O   . THR E  1 94  ? 7.665   -1.611  54.027  1.00 13.24  ? 94  THR E O   1 
ATOM   5610  C  CB  . THR E  1 94  ? 9.245   -1.145  56.778  1.00 54.08  ? 94  THR E CB  1 
ATOM   5611  O  OG1 . THR E  1 94  ? 10.046  -0.386  57.669  1.00 11.54  ? 94  THR E OG1 1 
ATOM   5612  C  CG2 . THR E  1 94  ? 10.114  -2.214  56.129  1.00 74.52  ? 94  THR E CG2 1 
ATOM   5613  N  N   . MET E  1 95  ? 9.658   -0.620  53.629  1.00 15.59  ? 95  MET E N   1 
ATOM   5614  C  CA  . MET E  1 95  ? 9.787   -1.220  52.297  1.00 20.39  ? 95  MET E CA  1 
ATOM   5615  C  C   . MET E  1 95  ? 9.540   -2.726  52.433  1.00 21.65  ? 95  MET E C   1 
ATOM   5616  O  O   . MET E  1 95  ? 8.742   -3.311  51.689  1.00 22.82  ? 95  MET E O   1 
ATOM   5617  C  CB  . MET E  1 95  ? 11.157  -0.942  51.673  1.00 25.21  ? 95  MET E CB  1 
ATOM   5618  C  CG  . MET E  1 95  ? 11.222  -1.335  50.182  1.00 30.83  ? 95  MET E CG  1 
ATOM   5619  S  SD  . MET E  1 95  ? 10.494  -0.131  49.081  1.00 33.12  ? 95  MET E SD  1 
ATOM   5620  C  CE  . MET E  1 95  ? 11.618  1.231   48.855  1.00 26.35  ? 95  MET E CE  1 
ATOM   5621  N  N   . ASP E  1 96  ? 10.203  -3.327  53.417  1.00 20.26  ? 96  ASP E N   1 
ATOM   5622  C  CA  . ASP E  1 96  ? 10.008  -4.740  53.687  1.00 24.64  ? 96  ASP E CA  1 
ATOM   5623  C  C   . ASP E  1 96  ? 8.536   -4.990  53.994  1.00 15.71  ? 96  ASP E C   1 
ATOM   5624  O  O   . ASP E  1 96  ? 7.944   -5.967  53.517  1.00 17.61  ? 96  ASP E O   1 
ATOM   5625  C  CB  . ASP E  1 96  ? 10.865  -5.216  54.854  1.00 29.23  ? 96  ASP E CB  1 
ATOM   5626  C  CG  . ASP E  1 96  ? 12.308  -5.458  54.444  1.00 56.81  ? 96  ASP E CG  1 
ATOM   5627  O  OD1 . ASP E  1 96  ? 12.642  -5.058  53.306  1.00 66.00  ? 96  ASP E OD1 1 
ATOM   5628  O  OD2 . ASP E  1 96  ? 13.068  -6.117  55.203  1.00 58.97  ? 96  ASP E OD2 1 
ATOM   5629  N  N   . GLN E  1 97  ? 7.910   -4.078  54.732  1.00 9.02   ? 97  GLN E N   1 
ATOM   5630  C  CA  . GLN E  1 97  ? 6.501   -4.314  55.023  1.00 15.52  ? 97  GLN E CA  1 
ATOM   5631  C  C   . GLN E  1 97  ? 5.733   -4.330  53.705  1.00 19.83  ? 97  GLN E C   1 
ATOM   5632  O  O   . GLN E  1 97  ? 4.897   -5.191  53.452  1.00 14.00  ? 97  GLN E O   1 
ATOM   5633  C  CB  . GLN E  1 97  ? 5.927   -3.256  55.970  1.00 22.22  ? 97  GLN E CB  1 
ATOM   5634  C  CG  . GLN E  1 97  ? 6.607   -3.102  57.305  1.00 41.60  ? 97  GLN E CG  1 
ATOM   5635  C  CD  . GLN E  1 97  ? 5.949   -2.008  58.124  1.00 61.04  ? 97  GLN E CD  1 
ATOM   5636  O  OE1 . GLN E  1 97  ? 6.608   -1.175  58.711  1.00 73.58  ? 97  GLN E OE1 1 
ATOM   5637  N  NE2 . GLN E  1 97  ? 4.629   -2.049  58.139  1.00 91.31  ? 97  GLN E NE2 1 
ATOM   5638  N  N   . LEU E  1 98  ? 6.060   -3.364  52.859  1.00 13.93  ? 98  LEU E N   1 
ATOM   5639  C  CA  . LEU E  1 98  ? 5.420   -3.243  51.559  1.00 12.94  ? 98  LEU E CA  1 
ATOM   5640  C  C   . LEU E  1 98  ? 5.702   -4.501  50.749  1.00 10.80  ? 98  LEU E C   1 
ATOM   5641  O  O   . LEU E  1 98  ? 4.797   -5.107  50.178  1.00 8.11   ? 98  LEU E O   1 
ATOM   5642  C  CB  . LEU E  1 98  ? 5.982   -2.001  50.860  1.00 10.87  ? 98  LEU E CB  1 
ATOM   5643  C  CG  . LEU E  1 98  ? 5.479   -0.748  51.588  1.00 11.36  ? 98  LEU E CG  1 
ATOM   5644  C  CD1 . LEU E  1 98  ? 6.006   0.553   50.956  1.00 9.36   ? 98  LEU E CD1 1 
ATOM   5645  C  CD2 . LEU E  1 98  ? 3.950   -0.708  51.682  1.00 1.33   ? 98  LEU E CD2 1 
ATOM   5646  N  N   . MET E  1 99  ? 6.963   -4.909  50.677  1.00 3.84   ? 99  MET E N   1 
ATOM   5647  C  CA  . MET E  1 99  ? 7.245   -6.085  49.885  1.00 1.79   ? 99  MET E CA  1 
ATOM   5648  C  C   . MET E  1 99  ? 6.511   -7.279  50.455  1.00 10.20  ? 99  MET E C   1 
ATOM   5649  O  O   . MET E  1 99  ? 6.072   -8.145  49.723  1.00 12.94  ? 99  MET E O   1 
ATOM   5650  C  CB  . MET E  1 99  ? 8.733   -6.337  49.866  1.00 3.95   ? 99  MET E CB  1 
ATOM   5651  C  CG  . MET E  1 99  ? 9.430   -5.200  49.147  1.00 11.85  ? 99  MET E CG  1 
ATOM   5652  S  SD  . MET E  1 99  ? 8.782   -4.919  47.482  1.00 16.86  ? 99  MET E SD  1 
ATOM   5653  C  CE  . MET E  1 99  ? 7.764   -3.655  47.663  1.00 11.74  ? 99  MET E CE  1 
ATOM   5654  N  N   . GLU E  1 100 ? 6.359   -7.339  51.769  1.00 11.65  ? 100 GLU E N   1 
ATOM   5655  C  CA  . GLU E  1 100 ? 5.699   -8.499  52.376  1.00 12.11  ? 100 GLU E CA  1 
ATOM   5656  C  C   . GLU E  1 100 ? 4.244   -8.579  51.989  1.00 11.20  ? 100 GLU E C   1 
ATOM   5657  O  O   . GLU E  1 100 ? 3.698   -9.650  51.787  1.00 12.41  ? 100 GLU E O   1 
ATOM   5658  C  CB  . GLU E  1 100 ? 5.870   -8.514  53.896  1.00 14.69  ? 100 GLU E CB  1 
ATOM   5659  C  CG  . GLU E  1 100 ? 7.219   -9.080  54.331  1.00 36.69  ? 100 GLU E CG  1 
ATOM   5660  C  CD  . GLU E  1 100 ? 7.666   -8.726  55.719  0.00 100.00 ? 100 GLU E CD  1 
ATOM   5661  O  OE1 . GLU E  1 100 ? 7.088   -7.817  56.328  1.00 97.91  ? 100 GLU E OE1 1 
ATOM   5662  O  OE2 . GLU E  1 100 ? 8.656   -9.327  56.176  0.00 100.00 ? 100 GLU E OE2 1 
ATOM   5663  N  N   . ASP E  1 101 ? 3.648   -7.405  51.838  1.00 11.79  ? 101 ASP E N   1 
ATOM   5664  C  CA  . ASP E  1 101 ? 2.266   -7.314  51.378  1.00 18.26  ? 101 ASP E CA  1 
ATOM   5665  C  C   . ASP E  1 101 ? 2.243   -7.806  49.914  1.00 16.33  ? 101 ASP E C   1 
ATOM   5666  O  O   . ASP E  1 101 ? 1.436   -8.646  49.518  1.00 12.50  ? 101 ASP E O   1 
ATOM   5667  C  CB  . ASP E  1 101 ? 1.804   -5.849  51.470  1.00 26.30  ? 101 ASP E CB  1 
ATOM   5668  C  CG  . ASP E  1 101 ? 0.316   -5.645  51.157  1.00 70.39  ? 101 ASP E CG  1 
ATOM   5669  O  OD1 . ASP E  1 101 ? -0.408  -6.665  50.997  1.00 74.70  ? 101 ASP E OD1 1 
ATOM   5670  O  OD2 . ASP E  1 101 ? -0.132  -4.468  51.105  1.00 79.50  ? 101 ASP E OD2 1 
ATOM   5671  N  N   . LEU E  1 102 ? 3.157   -7.306  49.097  1.00 9.11   ? 102 LEU E N   1 
ATOM   5672  C  CA  . LEU E  1 102 ? 3.205   -7.734  47.711  1.00 6.14   ? 102 LEU E CA  1 
ATOM   5673  C  C   . LEU E  1 102 ? 3.331   -9.259  47.620  1.00 7.62   ? 102 LEU E C   1 
ATOM   5674  O  O   . LEU E  1 102 ? 2.612   -9.989  46.932  1.00 7.87   ? 102 LEU E O   1 
ATOM   5675  C  CB  . LEU E  1 102 ? 4.468   -7.071  47.165  1.00 5.57   ? 102 LEU E CB  1 
ATOM   5676  C  CG  . LEU E  1 102 ? 4.566   -6.806  45.676  1.00 13.44  ? 102 LEU E CG  1 
ATOM   5677  C  CD1 . LEU E  1 102 ? 5.927   -7.072  45.130  1.00 7.01   ? 102 LEU E CD1 1 
ATOM   5678  C  CD2 . LEU E  1 102 ? 3.450   -7.550  44.970  1.00 24.48  ? 102 LEU E CD2 1 
ATOM   5679  N  N   . VAL E  1 103 ? 4.293   -9.778  48.349  1.00 1.00   ? 103 VAL E N   1 
ATOM   5680  C  CA  . VAL E  1 103 ? 4.516   -11.195 48.246  1.00 3.29   ? 103 VAL E CA  1 
ATOM   5681  C  C   . VAL E  1 103 ? 3.344   -12.006 48.715  1.00 11.98  ? 103 VAL E C   1 
ATOM   5682  O  O   . VAL E  1 103 ? 3.031   -13.076 48.189  1.00 6.98   ? 103 VAL E O   1 
ATOM   5683  C  CB  . VAL E  1 103 ? 5.668   -11.557 49.167  1.00 13.08  ? 103 VAL E CB  1 
ATOM   5684  C  CG1 . VAL E  1 103 ? 5.622   -13.034 49.438  1.00 14.27  ? 103 VAL E CG1 1 
ATOM   5685  C  CG2 . VAL E  1 103 ? 6.987   -11.243 48.458  1.00 13.80  ? 103 VAL E CG2 1 
ATOM   5686  N  N   . GLY E  1 104 ? 2.721   -11.523 49.773  1.00 5.40   ? 104 GLY E N   1 
ATOM   5687  C  CA  . GLY E  1 104 ? 1.536   -12.248 50.213  1.00 3.83   ? 104 GLY E CA  1 
ATOM   5688  C  C   . GLY E  1 104 ? 0.478   -12.315 49.099  1.00 8.98   ? 104 GLY E C   1 
ATOM   5689  O  O   . GLY E  1 104 ? -0.106  -13.337 48.764  1.00 11.20  ? 104 GLY E O   1 
ATOM   5690  N  N   . THR E  1 105 ? 0.241   -11.174 48.466  1.00 6.27   ? 105 THR E N   1 
ATOM   5691  C  CA  . THR E  1 105 ? -0.742  -11.167 47.396  1.00 4.75   ? 105 THR E CA  1 
ATOM   5692  C  C   . THR E  1 105 ? -0.303  -12.096 46.275  1.00 5.22   ? 105 THR E C   1 
ATOM   5693  O  O   . THR E  1 105 ? -1.157  -12.793 45.714  1.00 7.18   ? 105 THR E O   1 
ATOM   5694  C  CB  . THR E  1 105 ? -0.969  -9.761  46.939  1.00 11.31  ? 105 THR E CB  1 
ATOM   5695  O  OG1 . THR E  1 105 ? -1.460  -9.003  48.048  1.00 16.20  ? 105 THR E OG1 1 
ATOM   5696  C  CG2 . THR E  1 105 ? -1.942  -9.802  45.763  1.00 7.45   ? 105 THR E CG2 1 
ATOM   5697  N  N   . LEU E  1 106 ? 0.986   -12.086 45.944  1.00 1.99   ? 106 LEU E N   1 
ATOM   5698  C  CA  . LEU E  1 106 ? 1.436   -13.007 44.907  1.00 2.74   ? 106 LEU E CA  1 
ATOM   5699  C  C   . LEU E  1 106 ? 1.203   -14.438 45.391  1.00 11.13  ? 106 LEU E C   1 
ATOM   5700  O  O   . LEU E  1 106 ? 0.758   -15.293 44.615  1.00 9.46   ? 106 LEU E O   1 
ATOM   5701  C  CB  . LEU E  1 106 ? 2.910   -12.848 44.606  1.00 2.40   ? 106 LEU E CB  1 
ATOM   5702  C  CG  . LEU E  1 106 ? 3.369   -11.530 43.971  1.00 5.46   ? 106 LEU E CG  1 
ATOM   5703  C  CD1 . LEU E  1 106 ? 4.895   -11.345 44.069  1.00 1.00   ? 106 LEU E CD1 1 
ATOM   5704  C  CD2 . LEU E  1 106 ? 2.924   -11.631 42.519  1.00 1.03   ? 106 LEU E CD2 1 
ATOM   5705  N  N   . GLU E  1 107 ? 1.480   -14.733 46.660  1.00 5.11   ? 107 GLU E N   1 
ATOM   5706  C  CA  . GLU E  1 107 ? 1.181   -16.097 47.097  1.00 5.00   ? 107 GLU E CA  1 
ATOM   5707  C  C   . GLU E  1 107 ? -0.324  -16.414 46.984  1.00 10.62  ? 107 GLU E C   1 
ATOM   5708  O  O   . GLU E  1 107 ? -0.729  -17.495 46.539  1.00 7.06   ? 107 GLU E O   1 
ATOM   5709  C  CB  . GLU E  1 107 ? 1.694   -16.280 48.525  1.00 5.15   ? 107 GLU E CB  1 
ATOM   5710  C  CG  . GLU E  1 107 ? 3.185   -16.374 48.544  1.00 16.95  ? 107 GLU E CG  1 
ATOM   5711  C  CD  . GLU E  1 107 ? 3.762   -16.322 49.962  1.00 28.11  ? 107 GLU E CD  1 
ATOM   5712  O  OE1 . GLU E  1 107 ? 3.163   -15.601 50.785  1.00 39.27  ? 107 GLU E OE1 1 
ATOM   5713  O  OE2 . GLU E  1 107 ? 4.806   -16.955 50.273  1.00 29.92  ? 107 GLU E OE2 1 
ATOM   5714  N  N   . LEU E  1 108 ? -1.196  -15.449 47.272  1.00 5.91   ? 108 LEU E N   1 
ATOM   5715  C  CA  . LEU E  1 108 ? -2.621  -15.725 47.113  1.00 6.37   ? 108 LEU E CA  1 
ATOM   5716  C  C   . LEU E  1 108 ? -2.974  -16.049 45.666  1.00 10.37  ? 108 LEU E C   1 
ATOM   5717  O  O   . LEU E  1 108 ? -3.684  -17.017 45.386  1.00 12.95  ? 108 LEU E O   1 
ATOM   5718  C  CB  . LEU E  1 108 ? -3.470  -14.571 47.661  1.00 9.51   ? 108 LEU E CB  1 
ATOM   5719  C  CG  . LEU E  1 108 ? -4.994  -14.577 47.488  1.00 18.36  ? 108 LEU E CG  1 
ATOM   5720  C  CD1 . LEU E  1 108 ? -5.558  -13.484 48.366  1.00 15.11  ? 108 LEU E CD1 1 
ATOM   5721  C  CD2 . LEU E  1 108 ? -5.484  -14.364 46.052  1.00 24.11  ? 108 LEU E CD2 1 
ATOM   5722  N  N   . LEU E  1 109 ? -2.467  -15.246 44.741  1.00 5.54   ? 109 LEU E N   1 
ATOM   5723  C  CA  . LEU E  1 109 ? -2.761  -15.487 43.343  1.00 5.93   ? 109 LEU E CA  1 
ATOM   5724  C  C   . LEU E  1 109 ? -2.241  -16.830 42.914  1.00 6.73   ? 109 LEU E C   1 
ATOM   5725  O  O   . LEU E  1 109 ? -2.875  -17.597 42.196  1.00 10.09  ? 109 LEU E O   1 
ATOM   5726  C  CB  . LEU E  1 109 ? -2.141  -14.404 42.484  1.00 5.16   ? 109 LEU E CB  1 
ATOM   5727  C  CG  . LEU E  1 109 ? -2.877  -13.086 42.720  1.00 9.91   ? 109 LEU E CG  1 
ATOM   5728  C  CD1 . LEU E  1 109 ? -2.147  -11.881 42.201  1.00 11.41  ? 109 LEU E CD1 1 
ATOM   5729  C  CD2 . LEU E  1 109 ? -4.215  -13.204 42.048  1.00 6.91   ? 109 LEU E CD2 1 
ATOM   5730  N  N   . ARG E  1 110 ? -1.063  -17.146 43.412  1.00 1.75   ? 110 ARG E N   1 
ATOM   5731  C  CA  . ARG E  1 110 ? -0.465  -18.417 43.017  1.00 5.28   ? 110 ARG E CA  1 
ATOM   5732  C  C   . ARG E  1 110 ? -1.414  -19.533 43.399  1.00 10.25  ? 110 ARG E C   1 
ATOM   5733  O  O   . ARG E  1 110 ? -1.742  -20.394 42.611  1.00 8.22   ? 110 ARG E O   1 
ATOM   5734  C  CB  . ARG E  1 110 ? 0.893   -18.638 43.717  1.00 2.62   ? 110 ARG E CB  1 
ATOM   5735  C  CG  . ARG E  1 110 ? 1.537   -19.999 43.438  1.00 5.91   ? 110 ARG E CG  1 
ATOM   5736  C  CD  . ARG E  1 110 ? 2.691   -20.254 44.395  1.00 6.01   ? 110 ARG E CD  1 
ATOM   5737  N  NE  . ARG E  1 110 ? 2.184   -20.200 45.755  1.00 10.14  ? 110 ARG E NE  1 
ATOM   5738  C  CZ  . ARG E  1 110 ? 2.917   -20.091 46.862  1.00 18.86  ? 110 ARG E CZ  1 
ATOM   5739  N  NH1 . ARG E  1 110 ? 4.243   -19.986 46.804  1.00 8.09   ? 110 ARG E NH1 1 
ATOM   5740  N  NH2 . ARG E  1 110 ? 2.298   -20.035 48.033  1.00 13.78  ? 110 ARG E NH2 1 
ATOM   5741  N  N   . ASP E  1 111 ? -1.840  -19.507 44.652  1.00 7.35   ? 111 ASP E N   1 
ATOM   5742  C  CA  . ASP E  1 111 ? -2.663  -20.572 45.175  1.00 10.66  ? 111 ASP E CA  1 
ATOM   5743  C  C   . ASP E  1 111 ? -4.010  -20.587 44.459  1.00 9.43   ? 111 ASP E C   1 
ATOM   5744  O  O   . ASP E  1 111 ? -4.490  -21.645 44.049  1.00 9.37   ? 111 ASP E O   1 
ATOM   5745  C  CB  . ASP E  1 111 ? -2.720  -20.455 46.701  1.00 19.65  ? 111 ASP E CB  1 
ATOM   5746  C  CG  . ASP E  1 111 ? -1.349  -20.603 47.399  1.00 33.55  ? 111 ASP E CG  1 
ATOM   5747  O  OD1 . ASP E  1 111 ? -0.450  -21.295 46.894  1.00 24.25  ? 111 ASP E OD1 1 
ATOM   5748  O  OD2 . ASP E  1 111 ? -1.170  -20.019 48.490  1.00 58.79  ? 111 ASP E OD2 1 
ATOM   5749  N  N   . GLU E  1 112 ? -4.598  -19.425 44.201  1.00 2.84   ? 112 GLU E N   1 
ATOM   5750  C  CA  . GLU E  1 112 ? -5.851  -19.481 43.493  1.00 2.33   ? 112 GLU E CA  1 
ATOM   5751  C  C   . GLU E  1 112 ? -5.639  -19.981 42.095  1.00 11.13  ? 112 GLU E C   1 
ATOM   5752  O  O   . GLU E  1 112 ? -6.439  -20.755 41.565  1.00 12.54  ? 112 GLU E O   1 
ATOM   5753  C  CB  . GLU E  1 112 ? -6.585  -18.163 43.481  1.00 5.45   ? 112 GLU E CB  1 
ATOM   5754  C  CG  . GLU E  1 112 ? -6.811  -17.710 44.896  1.00 23.12  ? 112 GLU E CG  1 
ATOM   5755  C  CD  . GLU E  1 112 ? -7.858  -16.607 45.026  1.00 35.87  ? 112 GLU E CD  1 
ATOM   5756  O  OE1 . GLU E  1 112 ? -8.391  -16.132 43.994  1.00 16.16  ? 112 GLU E OE1 1 
ATOM   5757  O  OE2 . GLU E  1 112 ? -8.172  -16.245 46.186  1.00 23.64  ? 112 GLU E OE2 1 
ATOM   5758  N  N   . TYR E  1 113 ? -4.583  -19.533 41.440  1.00 7.63   ? 113 TYR E N   1 
ATOM   5759  C  CA  . TYR E  1 113 ? -4.434  -20.042 40.077  1.00 6.05   ? 113 TYR E CA  1 
ATOM   5760  C  C   . TYR E  1 113 ? -4.326  -21.565 40.083  1.00 9.28   ? 113 TYR E C   1 
ATOM   5761  O  O   . TYR E  1 113 ? -4.820  -22.262 39.205  1.00 6.92   ? 113 TYR E O   1 
ATOM   5762  C  CB  . TYR E  1 113 ? -3.198  -19.452 39.398  1.00 3.86   ? 113 TYR E CB  1 
ATOM   5763  C  CG  . TYR E  1 113 ? -3.443  -18.074 38.852  1.00 9.73   ? 113 TYR E CG  1 
ATOM   5764  C  CD1 . TYR E  1 113 ? -4.420  -17.265 39.409  1.00 12.85  ? 113 TYR E CD1 1 
ATOM   5765  C  CD2 . TYR E  1 113 ? -2.571  -17.507 37.938  1.00 15.55  ? 113 TYR E CD2 1 
ATOM   5766  C  CE1 . TYR E  1 113 ? -4.584  -15.971 38.966  1.00 18.36  ? 113 TYR E CE1 1 
ATOM   5767  C  CE2 . TYR E  1 113 ? -2.710  -16.219 37.508  1.00 20.29  ? 113 TYR E CE2 1 
ATOM   5768  C  CZ  . TYR E  1 113 ? -3.725  -15.459 38.020  1.00 18.17  ? 113 TYR E CZ  1 
ATOM   5769  O  OH  . TYR E  1 113 ? -3.872  -14.148 37.640  1.00 18.20  ? 113 TYR E OH  1 
ATOM   5770  N  N   . LYS E  1 114 ? -3.650  -22.072 41.097  1.00 9.56   ? 114 LYS E N   1 
ATOM   5771  C  CA  . LYS E  1 114 ? -3.485  -23.513 41.191  1.00 11.30  ? 114 LYS E CA  1 
ATOM   5772  C  C   . LYS E  1 114 ? -4.863  -24.170 41.197  1.00 12.07  ? 114 LYS E C   1 
ATOM   5773  O  O   . LYS E  1 114 ? -5.090  -25.142 40.462  1.00 12.96  ? 114 LYS E O   1 
ATOM   5774  C  CB  . LYS E  1 114 ? -2.651  -23.859 42.431  1.00 14.04  ? 114 LYS E CB  1 
ATOM   5775  C  CG  . LYS E  1 114 ? -2.401  -25.343 42.606  1.00 47.62  ? 114 LYS E CG  1 
ATOM   5776  C  CD  . LYS E  1 114 ? -2.219  -25.991 41.231  1.00 65.92  ? 114 LYS E CD  1 
ATOM   5777  C  CE  . LYS E  1 114 ? -2.021  -27.501 41.321  1.00 72.18  ? 114 LYS E CE  1 
ATOM   5778  N  NZ  . LYS E  1 114 ? -1.860  -28.145 39.985  1.00 80.89  ? 114 LYS E NZ  1 
ATOM   5779  N  N   . GLN E  1 115 ? -5.812  -23.580 41.930  1.00 8.06   ? 115 GLN E N   1 
ATOM   5780  C  CA  . GLN E  1 115 ? -7.163  -24.136 41.888  1.00 10.95  ? 115 GLN E CA  1 
ATOM   5781  C  C   . GLN E  1 115 ? -7.751  -24.022 40.475  1.00 10.34  ? 115 GLN E C   1 
ATOM   5782  O  O   . GLN E  1 115 ? -8.403  -24.955 39.985  1.00 11.94  ? 115 GLN E O   1 
ATOM   5783  C  CB  . GLN E  1 115 ? -8.154  -23.396 42.786  1.00 12.70  ? 115 GLN E CB  1 
ATOM   5784  C  CG  . GLN E  1 115 ? -7.677  -22.840 44.088  1.00 65.45  ? 115 GLN E CG  1 
ATOM   5785  C  CD  . GLN E  1 115 ? -6.856  -23.849 44.878  0.00 100.00 ? 115 GLN E CD  1 
ATOM   5786  O  OE1 . GLN E  1 115 ? -7.068  -25.043 44.673  0.00 100.00 ? 115 GLN E OE1 1 
ATOM   5787  N  NE2 . GLN E  1 115 ? -6.142  -23.348 45.855  0.00 100.00 ? 115 GLN E NE2 1 
ATOM   5788  N  N   . GLY E  1 116 ? -7.608  -22.844 39.867  1.00 5.94   ? 116 GLY E N   1 
ATOM   5789  C  CA  . GLY E  1 116 ? -8.162  -22.651 38.534  1.00 2.29   ? 116 GLY E CA  1 
ATOM   5790  C  C   . GLY E  1 116 ? -7.496  -23.696 37.626  1.00 4.56   ? 116 GLY E C   1 
ATOM   5791  O  O   . GLY E  1 116 ? -8.088  -24.235 36.690  1.00 8.18   ? 116 GLY E O   1 
ATOM   5792  N  N   . ILE E  1 117 ? -6.224  -23.978 37.889  1.00 1.00   ? 117 ILE E N   1 
ATOM   5793  C  CA  . ILE E  1 117 ? -5.498  -24.890 37.019  1.00 1.00   ? 117 ILE E CA  1 
ATOM   5794  C  C   . ILE E  1 117 ? -6.105  -26.274 37.027  1.00 17.43  ? 117 ILE E C   1 
ATOM   5795  O  O   . ILE E  1 117 ? -6.163  -26.951 35.999  1.00 25.30  ? 117 ILE E O   1 
ATOM   5796  C  CB  . ILE E  1 117 ? -3.993  -24.938 37.326  1.00 1.00   ? 117 ILE E CB  1 
ATOM   5797  C  CG1 . ILE E  1 117 ? -3.334  -23.609 36.938  1.00 1.00   ? 117 ILE E CG1 1 
ATOM   5798  C  CG2 . ILE E  1 117 ? -3.275  -26.065 36.584  1.00 1.00   ? 117 ILE E CG2 1 
ATOM   5799  C  CD1 . ILE E  1 117 ? -1.818  -23.672 36.850  1.00 8.76   ? 117 ILE E CD1 1 
ATOM   5800  N  N   . GLU E  1 118 ? -6.577  -26.681 38.163  1.00 22.77  ? 118 GLU E N   1 
ATOM   5801  C  CA  . GLU E  1 118 ? -7.148  -28.017 38.283  1.00 23.91  ? 118 GLU E CA  1 
ATOM   5802  C  C   . GLU E  1 118 ? -8.600  -28.019 37.810  1.00 28.37  ? 118 GLU E C   1 
ATOM   5803  O  O   . GLU E  1 118 ? -9.049  -28.919 37.111  1.00 5.07   ? 118 GLU E O   1 
ATOM   5804  C  CB  . GLU E  1 118 ? -6.990  -28.464 39.709  1.00 34.64  ? 118 GLU E CB  1 
ATOM   5805  C  CG  . GLU E  1 118 ? -5.547  -28.278 40.153  0.00 100.00 ? 118 GLU E CG  1 
ATOM   5806  C  CD  . GLU E  1 118 ? -5.283  -28.816 41.536  0.00 100.00 ? 118 GLU E CD  1 
ATOM   5807  O  OE1 . GLU E  1 118 ? -5.937  -28.332 42.535  0.00 100.00 ? 118 GLU E OE1 1 
ATOM   5808  O  OE2 . GLU E  1 118 ? -4.414  -29.743 41.696  0.00 100.00 ? 118 GLU E OE2 1 
ATOM   5809  N  N   . LEU E  1 119 ? -9.313  -27.022 38.190  1.00 15.09  ? 119 LEU E N   1 
ATOM   5810  C  CA  . LEU E  1 119 ? -10.706 -26.849 37.786  1.00 6.55   ? 119 LEU E CA  1 
ATOM   5811  C  C   . LEU E  1 119 ? -10.822 -26.923 36.278  1.00 3.02   ? 119 LEU E C   1 
ATOM   5812  O  O   . LEU E  1 119 ? -11.608 -27.650 35.665  1.00 7.88   ? 119 LEU E O   1 
ATOM   5813  C  CB  . LEU E  1 119 ? -11.036 -25.422 38.251  1.00 3.90   ? 119 LEU E CB  1 
ATOM   5814  C  CG  . LEU E  1 119 ? -12.432 -24.930 37.958  1.00 31.31  ? 119 LEU E CG  1 
ATOM   5815  C  CD1 . LEU E  1 119 ? -13.486 -25.812 38.606  1.00 48.52  ? 119 LEU E CD1 1 
ATOM   5816  C  CD2 . LEU E  1 119 ? -12.656 -23.508 38.494  1.00 43.27  ? 119 LEU E CD2 1 
ATOM   5817  N  N   . THR E  1 120 ? -10.004 -26.118 35.676  1.00 1.70   ? 120 THR E N   1 
ATOM   5818  C  CA  . THR E  1 120 ? -10.008 -25.895 34.222  1.00 7.84   ? 120 THR E CA  1 
ATOM   5819  C  C   . THR E  1 120 ? -9.577  -27.182 33.559  1.00 27.86  ? 120 THR E C   1 
ATOM   5820  O  O   . THR E  1 120 ? -9.913  -27.457 32.401  1.00 17.42  ? 120 THR E O   1 
ATOM   5821  C  CB  . THR E  1 120 ? -9.089  -24.667 33.941  1.00 6.81   ? 120 THR E CB  1 
ATOM   5822  O  OG1 . THR E  1 120 ? -9.308  -24.182 32.624  1.00 47.84  ? 120 THR E OG1 1 
ATOM   5823  C  CG2 . THR E  1 120 ? -7.604  -25.008 34.069  1.00 11.80  ? 120 THR E CG2 1 
ATOM   5824  N  N   . ASP E  1 121 ? -8.856  -27.947 34.334  1.00 11.76  ? 121 ASP E N   1 
ATOM   5825  C  CA  . ASP E  1 121 ? -8.386  -29.245 33.898  1.00 26.52  ? 121 ASP E CA  1 
ATOM   5826  C  C   . ASP E  1 121 ? -9.546  -30.224 33.931  1.00 24.72  ? 121 ASP E C   1 
ATOM   5827  O  O   . ASP E  1 121 ? -9.843  -30.900 32.936  1.00 11.76  ? 121 ASP E O   1 
ATOM   5828  C  CB  . ASP E  1 121 ? -7.298  -29.743 34.828  1.00 29.91  ? 121 ASP E CB  1 
ATOM   5829  C  CG  . ASP E  1 121 ? -6.441  -30.817 34.180  1.00 61.78  ? 121 ASP E CG  1 
ATOM   5830  O  OD1 . ASP E  1 121 ? -6.938  -31.565 33.256  1.00 38.49  ? 121 ASP E OD1 1 
ATOM   5831  O  OD2 . ASP E  1 121 ? -5.223  -30.970 34.554  0.00 100.00 ? 121 ASP E OD2 1 
ATOM   5832  N  N   . LYS E  1 122 ? -10.164 -30.259 35.089  1.00 13.89  ? 122 LYS E N   1 
ATOM   5833  C  CA  . LYS E  1 122 ? -11.304 -31.129 35.334  1.00 6.14   ? 122 LYS E CA  1 
ATOM   5834  C  C   . LYS E  1 122 ? -12.393 -30.853 34.306  1.00 25.71  ? 122 LYS E C   1 
ATOM   5835  O  O   . LYS E  1 122 ? -12.956 -31.714 33.683  1.00 22.71  ? 122 LYS E O   1 
ATOM   5836  C  CB  . LYS E  1 122 ? -11.862 -30.892 36.734  1.00 8.96   ? 122 LYS E CB  1 
ATOM   5837  C  CG  . LYS E  1 122 ? -13.039 -31.809 37.067  1.00 52.46  ? 122 LYS E CG  1 
ATOM   5838  C  CD  . LYS E  1 122 ? -13.549 -31.613 38.492  0.00 100.00 ? 122 LYS E CD  1 
ATOM   5839  C  CE  . LYS E  1 122 ? -14.756 -32.487 38.821  0.00 100.00 ? 122 LYS E CE  1 
ATOM   5840  N  NZ  . LYS E  1 122 ? -15.232 -32.305 40.199  0.00 100.00 ? 122 LYS E NZ  1 
ATOM   5841  N  N   . GLU E  1 123 ? -12.585 -29.567 33.940  1.00 12.75  ? 123 GLU E N   1 
ATOM   5842  C  CA  . GLU E  1 123 ? -13.577 -29.305 32.913  1.00 26.12  ? 123 GLU E CA  1 
ATOM   5843  C  C   . GLU E  1 123 ? -13.135 -29.469 31.457  1.00 8.94   ? 123 GLU E C   1 
ATOM   5844  O  O   . GLU E  1 123 ? -13.897 -29.090 30.554  1.00 14.45  ? 123 GLU E O   1 
ATOM   5845  C  CB  . GLU E  1 123 ? -13.998 -27.845 33.033  1.00 35.79  ? 123 GLU E CB  1 
ATOM   5846  C  CG  . GLU E  1 123 ? -14.992 -27.433 34.090  1.00 72.41  ? 123 GLU E CG  1 
ATOM   5847  C  CD  . GLU E  1 123 ? -15.518 -26.062 33.718  0.00 100.00 ? 123 GLU E CD  1 
ATOM   5848  O  OE1 . GLU E  1 123 ? -15.493 -25.776 32.511  1.00 30.52  ? 123 GLU E OE1 1 
ATOM   5849  O  OE2 . GLU E  1 123 ? -15.806 -25.256 34.613  1.00 23.80  ? 123 GLU E OE2 1 
ATOM   5850  N  N   . GLY E  1 124 ? -11.890 -29.867 31.212  1.00 8.05   ? 124 GLY E N   1 
ATOM   5851  C  CA  . GLY E  1 124 ? -11.360 -29.973 29.846  1.00 7.36   ? 124 GLY E CA  1 
ATOM   5852  C  C   . GLY E  1 124 ? -11.123 -28.681 29.006  1.00 16.57  ? 124 GLY E C   1 
ATOM   5853  O  O   . GLY E  1 124 ? -11.173 -28.758 27.774  1.00 16.87  ? 124 GLY E O   1 
ATOM   5854  N  N   . ASP E  1 125 ? -10.906 -27.503 29.607  1.00 23.35  ? 125 ASP E N   1 
ATOM   5855  C  CA  . ASP E  1 125 ? -10.667 -26.257 28.871  1.00 12.14  ? 125 ASP E CA  1 
ATOM   5856  C  C   . ASP E  1 125 ? -9.133  -26.121 28.841  1.00 11.54  ? 125 ASP E C   1 
ATOM   5857  O  O   . ASP E  1 125 ? -8.526  -25.536 29.740  1.00 12.10  ? 125 ASP E O   1 
ATOM   5858  C  CB  . ASP E  1 125 ? -11.318 -25.060 29.577  1.00 1.56   ? 125 ASP E CB  1 
ATOM   5859  C  CG  . ASP E  1 125 ? -11.040 -23.746 28.864  1.00 22.14  ? 125 ASP E CG  1 
ATOM   5860  O  OD1 . ASP E  1 125 ? -10.237 -23.758 27.896  1.00 20.03  ? 125 ASP E OD1 1 
ATOM   5861  O  OD2 . ASP E  1 125 ? -11.672 -22.735 29.253  1.00 14.48  ? 125 ASP E OD2 1 
ATOM   5862  N  N   . ASP E  1 126 ? -8.532  -26.701 27.810  1.00 7.33   ? 126 ASP E N   1 
ATOM   5863  C  CA  . ASP E  1 126 ? -7.101  -26.778 27.655  1.00 9.03   ? 126 ASP E CA  1 
ATOM   5864  C  C   . ASP E  1 126 ? -6.493  -25.429 27.491  1.00 6.65   ? 126 ASP E C   1 
ATOM   5865  O  O   . ASP E  1 126 ? -5.450  -25.153 28.056  1.00 8.11   ? 126 ASP E O   1 
ATOM   5866  C  CB  . ASP E  1 126 ? -6.851  -27.521 26.359  1.00 16.85  ? 126 ASP E CB  1 
ATOM   5867  C  CG  . ASP E  1 126 ? -7.584  -28.825 26.347  1.00 40.04  ? 126 ASP E CG  1 
ATOM   5868  O  OD1 . ASP E  1 126 ? -7.194  -29.672 27.188  1.00 40.95  ? 126 ASP E OD1 1 
ATOM   5869  O  OD2 . ASP E  1 126 ? -8.600  -28.869 25.616  1.00 51.24  ? 126 ASP E OD2 1 
ATOM   5870  N  N   . VAL E  1 127 ? -7.175  -24.587 26.737  1.00 2.73   ? 127 VAL E N   1 
ATOM   5871  C  CA  . VAL E  1 127 ? -6.658  -23.261 26.553  1.00 2.40   ? 127 VAL E CA  1 
ATOM   5872  C  C   . VAL E  1 127 ? -6.564  -22.485 27.865  1.00 8.68   ? 127 VAL E C   1 
ATOM   5873  O  O   . VAL E  1 127 ? -5.503  -21.968 28.198  1.00 11.22  ? 127 VAL E O   1 
ATOM   5874  C  CB  . VAL E  1 127 ? -7.398  -22.511 25.431  1.00 4.19   ? 127 VAL E CB  1 
ATOM   5875  C  CG1 . VAL E  1 127 ? -7.065  -20.984 25.520  1.00 1.59   ? 127 VAL E CG1 1 
ATOM   5876  C  CG2 . VAL E  1 127 ? -7.024  -23.107 24.065  1.00 1.00   ? 127 VAL E CG2 1 
ATOM   5877  N  N   . THR E  1 128 ? -7.647  -22.382 28.624  1.00 3.84   ? 128 THR E N   1 
ATOM   5878  C  CA  . THR E  1 128 ? -7.595  -21.617 29.869  1.00 1.00   ? 128 THR E CA  1 
ATOM   5879  C  C   . THR E  1 128 ? -6.596  -22.248 30.803  1.00 6.06   ? 128 THR E C   1 
ATOM   5880  O  O   . THR E  1 128 ? -5.853  -21.543 31.508  1.00 6.18   ? 128 THR E O   1 
ATOM   5881  C  CB  . THR E  1 128 ? -8.934  -21.582 30.494  1.00 1.00   ? 128 THR E CB  1 
ATOM   5882  O  OG1 . THR E  1 128 ? -9.790  -21.049 29.488  1.00 5.30   ? 128 THR E OG1 1 
ATOM   5883  C  CG2 . THR E  1 128 ? -8.936  -20.649 31.680  1.00 1.00   ? 128 THR E CG2 1 
ATOM   5884  N  N   . ASN E  1 129 ? -6.526  -23.564 30.726  1.00 1.53   ? 129 ASN E N   1 
ATOM   5885  C  CA  . ASN E  1 129 ? -5.582  -24.259 31.573  1.00 1.00   ? 129 ASN E CA  1 
ATOM   5886  C  C   . ASN E  1 129 ? -4.140  -23.769 31.324  1.00 3.31   ? 129 ASN E C   1 
ATOM   5887  O  O   . ASN E  1 129 ? -3.446  -23.413 32.286  1.00 2.84   ? 129 ASN E O   1 
ATOM   5888  C  CB  . ASN E  1 129 ? -5.641  -25.736 31.205  1.00 1.07   ? 129 ASN E CB  1 
ATOM   5889  C  CG  . ASN E  1 129 ? -4.750  -26.602 32.067  1.00 8.06   ? 129 ASN E CG  1 
ATOM   5890  O  OD1 . ASN E  1 129 ? -3.845  -27.251 31.558  1.00 28.11  ? 129 ASN E OD1 1 
ATOM   5891  N  ND2 . ASN E  1 129 ? -5.080  -26.722 33.342  1.00 2.45   ? 129 ASN E ND2 1 
ATOM   5892  N  N   . ASP E  1 130 ? -3.705  -23.757 30.062  1.00 1.00   ? 130 ASP E N   1 
ATOM   5893  C  CA  . ASP E  1 130 ? -2.370  -23.300 29.698  1.00 5.00   ? 130 ASP E CA  1 
ATOM   5894  C  C   . ASP E  1 130 ? -2.115  -21.850 30.041  1.00 6.29   ? 130 ASP E C   1 
ATOM   5895  O  O   . ASP E  1 130 ? -1.008  -21.545 30.467  1.00 9.49   ? 130 ASP E O   1 
ATOM   5896  C  CB  . ASP E  1 130 ? -1.965  -23.533 28.242  1.00 10.62  ? 130 ASP E CB  1 
ATOM   5897  C  CG  . ASP E  1 130 ? -1.135  -24.779 28.037  1.00 57.24  ? 130 ASP E CG  1 
ATOM   5898  O  OD1 . ASP E  1 130 ? -1.104  -25.669 28.905  1.00 57.33  ? 130 ASP E OD1 1 
ATOM   5899  O  OD2 . ASP E  1 130 ? -0.480  -24.832 26.978  1.00 94.21  ? 130 ASP E OD2 1 
ATOM   5900  N  N   . MET E  1 131 ? -3.105  -20.973 29.889  1.00 2.02   ? 131 MET E N   1 
ATOM   5901  C  CA  . MET E  1 131 ? -2.938  -19.577 30.252  1.00 6.29   ? 131 MET E CA  1 
ATOM   5902  C  C   . MET E  1 131 ? -2.531  -19.483 31.719  1.00 5.46   ? 131 MET E C   1 
ATOM   5903  O  O   . MET E  1 131 ? -1.596  -18.771 32.070  1.00 5.23   ? 131 MET E O   1 
ATOM   5904  C  CB  . MET E  1 131 ? -4.256  -18.823 30.288  1.00 12.67  ? 131 MET E CB  1 
ATOM   5905  C  CG  . MET E  1 131 ? -4.770  -18.071 29.105  1.00 17.99  ? 131 MET E CG  1 
ATOM   5906  S  SD  . MET E  1 131 ? -5.744  -16.663 29.786  1.00 15.00  ? 131 MET E SD  1 
ATOM   5907  C  CE  . MET E  1 131 ? -6.633  -17.244 31.230  1.00 13.77  ? 131 MET E CE  1 
ATOM   5908  N  N   . LEU E  1 132 ? -3.349  -20.078 32.577  1.00 2.45   ? 132 LEU E N   1 
ATOM   5909  C  CA  . LEU E  1 132 ? -3.130  -20.009 34.014  1.00 4.45   ? 132 LEU E CA  1 
ATOM   5910  C  C   . LEU E  1 132 ? -1.731  -20.571 34.331  1.00 7.85   ? 132 LEU E C   1 
ATOM   5911  O  O   . LEU E  1 132 ? -0.977  -20.038 35.157  1.00 8.69   ? 132 LEU E O   1 
ATOM   5912  C  CB  . LEU E  1 132 ? -4.243  -20.830 34.658  1.00 5.52   ? 132 LEU E CB  1 
ATOM   5913  C  CG  . LEU E  1 132 ? -5.518  -20.135 35.131  1.00 10.65  ? 132 LEU E CG  1 
ATOM   5914  C  CD1 . LEU E  1 132 ? -5.683  -18.697 34.710  1.00 7.33   ? 132 LEU E CD1 1 
ATOM   5915  C  CD2 . LEU E  1 132 ? -6.729  -20.986 34.844  1.00 5.10   ? 132 LEU E CD2 1 
ATOM   5916  N  N   . ILE E  1 133 ? -1.344  -21.642 33.646  1.00 2.58   ? 133 ILE E N   1 
ATOM   5917  C  CA  . ILE E  1 133 ? -0.046  -22.198 33.944  1.00 3.17   ? 133 ILE E CA  1 
ATOM   5918  C  C   . ILE E  1 133 ? 1.057   -21.195 33.690  1.00 7.80   ? 133 ILE E C   1 
ATOM   5919  O  O   . ILE E  1 133 ? 1.911   -20.932 34.520  1.00 6.81   ? 133 ILE E O   1 
ATOM   5920  C  CB  . ILE E  1 133 ? 0.148   -23.490 33.176  1.00 5.56   ? 133 ILE E CB  1 
ATOM   5921  C  CG1 . ILE E  1 133 ? -0.888  -24.462 33.709  1.00 7.74   ? 133 ILE E CG1 1 
ATOM   5922  C  CG2 . ILE E  1 133 ? 1.543   -24.044 33.479  1.00 1.87   ? 133 ILE E CG2 1 
ATOM   5923  C  CD1 . ILE E  1 133 ? -0.810  -25.843 33.141  1.00 1.53   ? 133 ILE E CD1 1 
ATOM   5924  N  N   . ALA E  1 134 ? 0.968   -20.543 32.550  1.00 4.19   ? 134 ALA E N   1 
ATOM   5925  C  CA  . ALA E  1 134 ? 1.984   -19.561 32.204  1.00 2.82   ? 134 ALA E CA  1 
ATOM   5926  C  C   . ALA E  1 134 ? 1.932   -18.376 33.139  1.00 6.07   ? 134 ALA E C   1 
ATOM   5927  O  O   . ALA E  1 134 ? 3.005   -17.928 33.547  1.00 10.34  ? 134 ALA E O   1 
ATOM   5928  C  CB  . ALA E  1 134 ? 1.826   -19.117 30.770  1.00 1.00   ? 134 ALA E CB  1 
ATOM   5929  N  N   . PHE E  1 135 ? 0.764   -17.897 33.551  1.00 1.00   ? 135 PHE E N   1 
ATOM   5930  C  CA  . PHE E  1 135 ? 0.862   -16.826 34.516  1.00 2.42   ? 135 PHE E CA  1 
ATOM   5931  C  C   . PHE E  1 135 ? 1.469   -17.374 35.834  1.00 4.99   ? 135 PHE E C   1 
ATOM   5932  O  O   . PHE E  1 135 ? 2.232   -16.665 36.507  1.00 7.15   ? 135 PHE E O   1 
ATOM   5933  C  CB  . PHE E  1 135 ? -0.503  -16.321 34.901  1.00 9.87   ? 135 PHE E CB  1 
ATOM   5934  C  CG  . PHE E  1 135 ? -1.313  -15.797 33.759  1.00 18.72  ? 135 PHE E CG  1 
ATOM   5935  C  CD1 . PHE E  1 135 ? -0.680  -15.418 32.602  1.00 22.25  ? 135 PHE E CD1 1 
ATOM   5936  C  CD2 . PHE E  1 135 ? -2.685  -15.600 33.894  1.00 22.42  ? 135 PHE E CD2 1 
ATOM   5937  C  CE1 . PHE E  1 135 ? -1.414  -14.834 31.591  1.00 21.26  ? 135 PHE E CE1 1 
ATOM   5938  C  CE2 . PHE E  1 135 ? -3.405  -14.984 32.908  1.00 18.56  ? 135 PHE E CE2 1 
ATOM   5939  C  CZ  . PHE E  1 135 ? -2.759  -14.617 31.726  1.00 13.28  ? 135 PHE E CZ  1 
ATOM   5940  N  N   . LYS E  1 136 ? 1.149   -18.625 36.187  1.00 2.96   ? 136 LYS E N   1 
ATOM   5941  C  CA  . LYS E  1 136 ? 1.697   -19.176 37.423  1.00 5.04   ? 136 LYS E CA  1 
ATOM   5942  C  C   . LYS E  1 136 ? 3.201   -19.224 37.384  1.00 2.10   ? 136 LYS E C   1 
ATOM   5943  O  O   . LYS E  1 136 ? 3.885   -18.893 38.360  1.00 3.46   ? 136 LYS E O   1 
ATOM   5944  C  CB  . LYS E  1 136 ? 1.182   -20.541 37.885  1.00 3.18   ? 136 LYS E CB  1 
ATOM   5945  C  CG  . LYS E  1 136 ? 1.605   -20.853 39.330  1.00 9.27   ? 136 LYS E CG  1 
ATOM   5946  C  CD  . LYS E  1 136 ? 0.941   -22.047 40.012  1.00 6.04   ? 136 LYS E CD  1 
ATOM   5947  C  CE  . LYS E  1 136 ? 1.758   -23.317 39.885  1.00 42.62  ? 136 LYS E CE  1 
ATOM   5948  N  NZ  . LYS E  1 136 ? 2.810   -23.202 40.905  1.00 15.78  ? 136 LYS E NZ  1 
ATOM   5949  N  N   . ALA E  1 137 ? 3.704   -19.662 36.242  1.00 1.00   ? 137 ALA E N   1 
ATOM   5950  C  CA  . ALA E  1 137 ? 5.158   -19.733 36.113  1.00 2.72   ? 137 ALA E CA  1 
ATOM   5951  C  C   . ALA E  1 137 ? 5.820   -18.410 36.492  1.00 6.95   ? 137 ALA E C   1 
ATOM   5952  O  O   . ALA E  1 137 ? 6.775   -18.371 37.258  1.00 7.11   ? 137 ALA E O   1 
ATOM   5953  C  CB  . ALA E  1 137 ? 5.498   -20.089 34.691  1.00 1.00   ? 137 ALA E CB  1 
ATOM   5954  N  N   . SER E  1 138 ? 5.256   -17.306 36.013  1.00 1.37   ? 138 SER E N   1 
ATOM   5955  C  CA  . SER E  1 138 ? 5.748   -15.981 36.328  1.00 1.44   ? 138 SER E CA  1 
ATOM   5956  C  C   . SER E  1 138 ? 5.598   -15.605 37.805  1.00 5.89   ? 138 SER E C   1 
ATOM   5957  O  O   . SER E  1 138 ? 6.519   -15.085 38.467  1.00 4.12   ? 138 SER E O   1 
ATOM   5958  C  CB  . SER E  1 138 ? 5.038   -14.952 35.434  1.00 1.30   ? 138 SER E CB  1 
ATOM   5959  O  OG  . SER E  1 138 ? 5.353   -13.631 35.855  1.00 36.19  ? 138 SER E OG  1 
ATOM   5960  N  N   . ILE E  1 139 ? 4.404   -15.850 38.326  1.00 1.67   ? 139 ILE E N   1 
ATOM   5961  C  CA  . ILE E  1 139 ? 4.217   -15.540 39.734  1.00 3.63   ? 139 ILE E CA  1 
ATOM   5962  C  C   . ILE E  1 139 ? 5.252   -16.227 40.648  1.00 5.15   ? 139 ILE E C   1 
ATOM   5963  O  O   . ILE E  1 139 ? 5.812   -15.621 41.569  1.00 3.44   ? 139 ILE E O   1 
ATOM   5964  C  CB  . ILE E  1 139 ? 2.778   -15.911 40.127  1.00 5.32   ? 139 ILE E CB  1 
ATOM   5965  C  CG1 . ILE E  1 139 ? 1.791   -14.923 39.483  1.00 5.22   ? 139 ILE E CG1 1 
ATOM   5966  C  CG2 . ILE E  1 139 ? 2.568   -15.871 41.611  1.00 2.70   ? 139 ILE E CG2 1 
ATOM   5967  C  CD1 . ILE E  1 139 ? 0.369   -15.442 39.480  1.00 5.74   ? 139 ILE E CD1 1 
ATOM   5968  N  N   . ASP E  1 140 ? 5.526   -17.496 40.343  1.00 1.63   ? 140 ASP E N   1 
ATOM   5969  C  CA  . ASP E  1 140 ? 6.470   -18.305 41.116  1.00 4.93   ? 140 ASP E CA  1 
ATOM   5970  C  C   . ASP E  1 140 ? 7.854   -17.660 41.095  1.00 6.75   ? 140 ASP E C   1 
ATOM   5971  O  O   . ASP E  1 140 ? 8.503   -17.639 42.126  1.00 6.84   ? 140 ASP E O   1 
ATOM   5972  C  CB  . ASP E  1 140 ? 6.558   -19.756 40.633  1.00 9.17   ? 140 ASP E CB  1 
ATOM   5973  C  CG  . ASP E  1 140 ? 5.347   -20.611 40.985  1.00 20.33  ? 140 ASP E CG  1 
ATOM   5974  O  OD1 . ASP E  1 140 ? 4.579   -20.261 41.890  1.00 10.96  ? 140 ASP E OD1 1 
ATOM   5975  O  OD2 . ASP E  1 140 ? 5.150   -21.675 40.365  1.00 14.29  ? 140 ASP E OD2 1 
ATOM   5976  N  N   . LYS E  1 141 ? 8.274   -17.168 39.935  1.00 4.37   ? 141 LYS E N   1 
ATOM   5977  C  CA  . LYS E  1 141 ? 9.572   -16.525 39.774  1.00 4.36   ? 141 LYS E CA  1 
ATOM   5978  C  C   . LYS E  1 141 ? 9.598   -15.222 40.556  1.00 3.78   ? 141 LYS E C   1 
ATOM   5979  O  O   . LYS E  1 141 ? 10.572  -14.941 41.244  1.00 6.36   ? 141 LYS E O   1 
ATOM   5980  C  CB  . LYS E  1 141 ? 9.906   -16.233 38.311  1.00 5.80   ? 141 LYS E CB  1 
ATOM   5981  C  CG  . LYS E  1 141 ? 11.249  -15.634 38.014  1.00 45.75  ? 141 LYS E CG  1 
ATOM   5982  C  CD  . LYS E  1 141 ? 11.225  -15.283 36.548  1.00 84.01  ? 141 LYS E CD  1 
ATOM   5983  C  CE  . LYS E  1 141 ? 12.466  -14.539 36.125  0.00 100.00 ? 141 LYS E CE  1 
ATOM   5984  N  NZ  . LYS E  1 141 ? 13.660  -15.415 36.026  0.00 100.00 ? 141 LYS E NZ  1 
ATOM   5985  N  N   . HIS E  1 142 ? 8.490   -14.485 40.541  1.00 3.83   ? 142 HIS E N   1 
ATOM   5986  C  CA  . HIS E  1 142 ? 8.457   -13.263 41.320  1.00 1.86   ? 142 HIS E CA  1 
ATOM   5987  C  C   . HIS E  1 142 ? 8.522   -13.555 42.790  1.00 5.37   ? 142 HIS E C   1 
ATOM   5988  O  O   . HIS E  1 142 ? 9.176   -12.860 43.561  1.00 6.13   ? 142 HIS E O   1 
ATOM   5989  C  CB  . HIS E  1 142 ? 7.184   -12.464 41.129  1.00 2.90   ? 142 HIS E CB  1 
ATOM   5990  C  CG  . HIS E  1 142 ? 7.098   -11.818 39.784  1.00 6.70   ? 142 HIS E CG  1 
ATOM   5991  N  ND1 . HIS E  1 142 ? 8.066   -10.957 39.310  1.00 8.41   ? 142 HIS E ND1 1 
ATOM   5992  C  CD2 . HIS E  1 142 ? 6.163   -11.921 38.808  1.00 6.89   ? 142 HIS E CD2 1 
ATOM   5993  C  CE1 . HIS E  1 142 ? 7.718   -10.545 38.105  1.00 5.81   ? 142 HIS E CE1 1 
ATOM   5994  N  NE2 . HIS E  1 142 ? 6.581   -11.131 37.768  1.00 6.77   ? 142 HIS E NE2 1 
ATOM   5995  N  N   . ILE E  1 143 ? 7.808   -14.594 43.191  1.00 3.13   ? 143 ILE E N   1 
ATOM   5996  C  CA  . ILE E  1 143 ? 7.835   -14.957 44.582  1.00 5.21   ? 143 ILE E CA  1 
ATOM   5997  C  C   . ILE E  1 143 ? 9.259   -15.304 44.989  1.00 7.83   ? 143 ILE E C   1 
ATOM   5998  O  O   . ILE E  1 143 ? 9.734   -14.919 46.052  1.00 1.38   ? 143 ILE E O   1 
ATOM   5999  C  CB  . ILE E  1 143 ? 6.880   -16.114 44.814  1.00 8.58   ? 143 ILE E CB  1 
ATOM   6000  C  CG1 . ILE E  1 143 ? 5.430   -15.629 44.741  1.00 2.53   ? 143 ILE E CG1 1 
ATOM   6001  C  CG2 . ILE E  1 143 ? 7.213   -16.803 46.107  1.00 7.78   ? 143 ILE E CG2 1 
ATOM   6002  C  CD1 . ILE E  1 143 ? 4.452   -16.780 44.906  1.00 1.16   ? 143 ILE E CD1 1 
ATOM   6003  N  N   . TRP E  1 144 ? 9.994   -16.004 44.140  1.00 3.33   ? 144 TRP E N   1 
ATOM   6004  C  CA  . TRP E  1 144 ? 11.360  -16.330 44.508  1.00 1.00   ? 144 TRP E CA  1 
ATOM   6005  C  C   . TRP E  1 144 ? 12.195  -15.062 44.669  1.00 8.22   ? 144 TRP E C   1 
ATOM   6006  O  O   . TRP E  1 144 ? 12.855  -14.835 45.700  1.00 10.95  ? 144 TRP E O   1 
ATOM   6007  C  CB  . TRP E  1 144 ? 11.972  -17.321 43.513  1.00 1.00   ? 144 TRP E CB  1 
ATOM   6008  C  CG  . TRP E  1 144 ? 13.480  -17.179 43.395  1.00 7.15   ? 144 TRP E CG  1 
ATOM   6009  C  CD1 . TRP E  1 144 ? 14.386  -17.266 44.419  1.00 9.33   ? 144 TRP E CD1 1 
ATOM   6010  C  CD2 . TRP E  1 144 ? 14.236  -16.880 42.206  1.00 4.86   ? 144 TRP E CD2 1 
ATOM   6011  N  NE1 . TRP E  1 144 ? 15.630  -17.005 43.954  1.00 7.44   ? 144 TRP E NE1 1 
ATOM   6012  C  CE2 . TRP E  1 144 ? 15.576  -16.763 42.604  1.00 7.91   ? 144 TRP E CE2 1 
ATOM   6013  C  CE3 . TRP E  1 144 ? 13.904  -16.657 40.863  1.00 4.75   ? 144 TRP E CE3 1 
ATOM   6014  C  CZ2 . TRP E  1 144 ? 16.602  -16.458 41.694  1.00 6.90   ? 144 TRP E CZ2 1 
ATOM   6015  C  CZ3 . TRP E  1 144 ? 14.905  -16.315 39.962  1.00 6.89   ? 144 TRP E CZ3 1 
ATOM   6016  C  CH2 . TRP E  1 144 ? 16.242  -16.230 40.380  1.00 6.34   ? 144 TRP E CH2 1 
ATOM   6017  N  N   . MET E  1 145 ? 12.084  -14.183 43.687  1.00 4.22   ? 145 MET E N   1 
ATOM   6018  C  CA  . MET E  1 145 ? 12.850  -12.956 43.770  1.00 2.55   ? 145 MET E CA  1 
ATOM   6019  C  C   . MET E  1 145 ? 12.493  -12.030 44.917  1.00 9.76   ? 145 MET E C   1 
ATOM   6020  O  O   . MET E  1 145 ? 13.359  -11.484 45.585  1.00 6.70   ? 145 MET E O   1 
ATOM   6021  C  CB  . MET E  1 145 ? 12.895  -12.236 42.415  1.00 3.08   ? 145 MET E CB  1 
ATOM   6022  C  CG  . MET E  1 145 ? 13.435  -13.094 41.266  1.00 7.58   ? 145 MET E CG  1 
ATOM   6023  S  SD  . MET E  1 145 ? 13.523  -12.262 39.656  1.00 12.41  ? 145 MET E SD  1 
ATOM   6024  C  CE  . MET E  1 145 ? 11.785  -11.896 39.433  1.00 20.10  ? 145 MET E CE  1 
ATOM   6025  N  N   . PHE E  1 146 ? 11.204  -11.811 45.127  1.00 4.51   ? 146 PHE E N   1 
ATOM   6026  C  CA  . PHE E  1 146 ? 10.871  -10.916 46.229  1.00 7.60   ? 146 PHE E CA  1 
ATOM   6027  C  C   . PHE E  1 146 ? 11.288  -11.489 47.592  1.00 10.07  ? 146 PHE E C   1 
ATOM   6028  O  O   . PHE E  1 146 ? 11.715  -10.759 48.483  1.00 8.22   ? 146 PHE E O   1 
ATOM   6029  C  CB  . PHE E  1 146 ? 9.436   -10.353 46.157  1.00 7.47   ? 146 PHE E CB  1 
ATOM   6030  C  CG  . PHE E  1 146 ? 9.269   -9.275  45.116  1.00 8.48   ? 146 PHE E CG  1 
ATOM   6031  C  CD1 . PHE E  1 146 ? 9.684   -7.963  45.361  1.00 8.23   ? 146 PHE E CD1 1 
ATOM   6032  C  CD2 . PHE E  1 146 ? 8.813   -9.603  43.854  1.00 9.11   ? 146 PHE E CD2 1 
ATOM   6033  C  CE1 . PHE E  1 146 ? 9.599   -6.978  44.391  1.00 8.27   ? 146 PHE E CE1 1 
ATOM   6034  C  CE2 . PHE E  1 146 ? 8.741   -8.622  42.869  1.00 12.42  ? 146 PHE E CE2 1 
ATOM   6035  C  CZ  . PHE E  1 146 ? 9.133   -7.316  43.140  1.00 10.54  ? 146 PHE E CZ  1 
ATOM   6036  N  N   . LYS E  1 147 ? 11.213  -12.806 47.718  1.00 1.80   ? 147 LYS E N   1 
ATOM   6037  C  CA  . LYS E  1 147 ? 11.573  -13.428 48.974  1.00 3.00   ? 147 LYS E CA  1 
ATOM   6038  C  C   . LYS E  1 147 ? 13.065  -13.271 49.120  1.00 9.80   ? 147 LYS E C   1 
ATOM   6039  O  O   . LYS E  1 147 ? 13.518  -12.953 50.209  1.00 10.35  ? 147 LYS E O   1 
ATOM   6040  C  CB  . LYS E  1 147 ? 11.104  -14.873 49.099  1.00 5.57   ? 147 LYS E CB  1 
ATOM   6041  C  CG  . LYS E  1 147 ? 9.609   -14.925 49.449  1.00 7.04   ? 147 LYS E CG  1 
ATOM   6042  C  CD  . LYS E  1 147 ? 9.235   -15.987 50.457  1.00 26.50  ? 147 LYS E CD  1 
ATOM   6043  C  CE  . LYS E  1 147 ? 7.940   -15.571 51.149  1.00 13.29  ? 147 LYS E CE  1 
ATOM   6044  N  NZ  . LYS E  1 147 ? 7.509   -16.504 52.215  1.00 60.16  ? 147 LYS E NZ  1 
ATOM   6045  N  N   . ALA E  1 148 ? 13.792  -13.418 48.018  1.00 4.75   ? 148 ALA E N   1 
ATOM   6046  C  CA  . ALA E  1 148 ? 15.245  -13.280 48.128  1.00 4.82   ? 148 ALA E CA  1 
ATOM   6047  C  C   . ALA E  1 148 ? 15.567  -11.860 48.564  1.00 7.03   ? 148 ALA E C   1 
ATOM   6048  O  O   . ALA E  1 148 ? 16.406  -11.649 49.434  1.00 7.71   ? 148 ALA E O   1 
ATOM   6049  C  CB  . ALA E  1 148 ? 15.965  -13.659 46.829  1.00 4.59   ? 148 ALA E CB  1 
ATOM   6050  N  N   . PHE E  1 149 ? 14.833  -10.904 48.014  1.00 5.22   ? 149 PHE E N   1 
ATOM   6051  C  CA  . PHE E  1 149 ? 14.999  -9.521  48.431  1.00 3.42   ? 149 PHE E CA  1 
ATOM   6052  C  C   . PHE E  1 149 ? 14.839  -9.336  49.945  1.00 14.22  ? 149 PHE E C   1 
ATOM   6053  O  O   . PHE E  1 149 ? 15.536  -8.580  50.620  1.00 13.45  ? 149 PHE E O   1 
ATOM   6054  C  CB  . PHE E  1 149 ? 13.940  -8.678  47.727  1.00 4.53   ? 149 PHE E CB  1 
ATOM   6055  C  CG  . PHE E  1 149 ? 13.906  -7.274  48.226  1.00 6.60   ? 149 PHE E CG  1 
ATOM   6056  C  CD1 . PHE E  1 149 ? 14.865  -6.354  47.845  1.00 6.22   ? 149 PHE E CD1 1 
ATOM   6057  C  CD2 . PHE E  1 149 ? 12.937  -6.901  49.109  1.00 6.73   ? 149 PHE E CD2 1 
ATOM   6058  C  CE1 . PHE E  1 149 ? 14.849  -5.057  48.372  1.00 5.07   ? 149 PHE E CE1 1 
ATOM   6059  C  CE2 . PHE E  1 149 ? 12.892  -5.625  49.620  1.00 6.89   ? 149 PHE E CE2 1 
ATOM   6060  C  CZ  . PHE E  1 149 ? 13.852  -4.682  49.266  1.00 6.17   ? 149 PHE E CZ  1 
ATOM   6061  N  N   . LEU E  1 150 ? 13.872  -10.050 50.487  1.00 10.66  ? 150 LEU E N   1 
ATOM   6062  C  CA  . LEU E  1 150 ? 13.530  -10.007 51.901  1.00 9.08   ? 150 LEU E CA  1 
ATOM   6063  C  C   . LEU E  1 150 ? 14.434  -10.932 52.700  1.00 21.54  ? 150 LEU E C   1 
ATOM   6064  O  O   . LEU E  1 150 ? 14.328  -11.017 53.916  1.00 19.65  ? 150 LEU E O   1 
ATOM   6065  C  CB  . LEU E  1 150 ? 12.085  -10.455 52.096  1.00 4.11   ? 150 LEU E CB  1 
ATOM   6066  C  CG  . LEU E  1 150 ? 11.067  -9.446  51.558  1.00 7.97   ? 150 LEU E CG  1 
ATOM   6067  C  CD1 . LEU E  1 150 ? 9.658   -10.051 51.494  1.00 9.35   ? 150 LEU E CD1 1 
ATOM   6068  C  CD2 . LEU E  1 150 ? 11.077  -8.240  52.493  1.00 6.54   ? 150 LEU E CD2 1 
ATOM   6069  N  N   . GLY E  1 151 ? 15.326  -11.650 52.032  1.00 13.36  ? 151 GLY E N   1 
ATOM   6070  C  CA  . GLY E  1 151 ? 16.241  -12.492 52.785  1.00 10.67  ? 151 GLY E CA  1 
ATOM   6071  C  C   . GLY E  1 151 ? 15.716  -13.871 53.127  1.00 16.99  ? 151 GLY E C   1 
ATOM   6072  O  O   . GLY E  1 151 ? 16.319  -14.615 53.913  1.00 23.97  ? 151 GLY E O   1 
ATOM   6073  N  N   . LYS E  1 152 ? 14.624  -14.224 52.462  1.00 16.09  ? 152 LYS E N   1 
ATOM   6074  C  CA  . LYS E  1 152 ? 13.974  -15.502 52.715  1.00 9.92   ? 152 LYS E CA  1 
ATOM   6075  C  C   . LYS E  1 152 ? 14.069  -16.449 51.531  1.00 16.41  ? 152 LYS E C   1 
ATOM   6076  O  O   . LYS E  1 152 ? 14.316  -16.051 50.386  1.00 13.86  ? 152 LYS E O   1 
ATOM   6077  C  CB  . LYS E  1 152 ? 12.508  -15.274 53.138  1.00 13.68  ? 152 LYS E CB  1 
ATOM   6078  C  CG  . LYS E  1 152 ? 12.277  -14.385 54.351  1.00 62.71  ? 152 LYS E CG  1 
ATOM   6079  C  CD  . LYS E  1 152 ? 12.983  -15.042 55.524  0.00 100.00 ? 152 LYS E CD  1 
ATOM   6080  C  CE  . LYS E  1 152 ? 13.005  -14.200 56.778  0.00 100.00 ? 152 LYS E CE  1 
ATOM   6081  N  NZ  . LYS E  1 152 ? 13.816  -14.862 57.828  0.00 100.00 ? 152 LYS E NZ  1 
ATOM   6082  N  N   . ALA E  1 153 ? 13.819  -17.717 51.828  1.00 15.75  ? 153 ALA E N   1 
ATOM   6083  C  CA  . ALA E  1 153 ? 13.760  -18.756 50.812  1.00 10.52  ? 153 ALA E CA  1 
ATOM   6084  C  C   . ALA E  1 153 ? 12.359  -18.603 50.238  1.00 14.72  ? 153 ALA E C   1 
ATOM   6085  O  O   . ALA E  1 153 ? 11.452  -18.100 50.907  1.00 11.29  ? 153 ALA E O   1 
ATOM   6086  C  CB  . ALA E  1 153 ? 13.937  -20.137 51.440  1.00 7.56   ? 153 ALA E CB  1 
ATOM   6087  N  N   . PRO E  1 154 ? 12.153  -19.048 49.002  1.00 14.32  ? 154 PRO E N   1 
ATOM   6088  C  CA  . PRO E  1 154 ? 10.866  -18.908 48.328  1.00 9.77   ? 154 PRO E CA  1 
ATOM   6089  C  C   . PRO E  1 154 ? 9.647   -19.464 49.032  1.00 13.26  ? 154 PRO E C   1 
ATOM   6090  O  O   . PRO E  1 154 ? 8.649   -18.767 49.228  1.00 17.44  ? 154 PRO E O   1 
ATOM   6091  C  CB  . PRO E  1 154 ? 11.075  -19.666 47.017  1.00 10.73  ? 154 PRO E CB  1 
ATOM   6092  C  CG  . PRO E  1 154 ? 12.556  -19.690 46.858  1.00 12.27  ? 154 PRO E CG  1 
ATOM   6093  C  CD  . PRO E  1 154 ? 13.135  -19.783 48.208  1.00 11.11  ? 154 PRO E CD  1 
ATOM   6094  N  N   . LEU E  1 155 ? 9.726   -20.737 49.379  1.00 19.10  ? 155 LEU E N   1 
ATOM   6095  C  CA  . LEU E  1 155 ? 8.577   -21.303 50.044  1.00 19.41  ? 155 LEU E CA  1 
ATOM   6096  C  C   . LEU E  1 155 ? 8.616   -21.156 51.545  1.00 45.51  ? 155 LEU E C   1 
ATOM   6097  O  O   . LEU E  1 155 ? 7.739   -21.632 52.243  1.00 35.97  ? 155 LEU E O   1 
ATOM   6098  C  CB  . LEU E  1 155 ? 8.419   -22.754 49.621  1.00 18.76  ? 155 LEU E CB  1 
ATOM   6099  C  CG  . LEU E  1 155 ? 8.487   -22.801 48.098  1.00 27.36  ? 155 LEU E CG  1 
ATOM   6100  C  CD1 . LEU E  1 155 ? 8.415   -24.223 47.630  1.00 22.66  ? 155 LEU E CD1 1 
ATOM   6101  C  CD2 . LEU E  1 155 ? 7.381   -21.951 47.491  1.00 19.01  ? 155 LEU E CD2 1 
ATOM   6102  N  N   . GLU E  1 156 ? 9.691   -20.616 52.085  1.00 40.44  ? 156 GLU E N   1 
ATOM   6103  C  CA  . GLU E  1 156 ? 9.777   -20.479 53.532  1.00 93.95  ? 156 GLU E CA  1 
ATOM   6104  C  C   . GLU E  1 156 ? 9.029   -19.223 53.925  0.00 100.00 ? 156 GLU E C   1 
ATOM   6105  O  O   . GLU E  1 156 ? 9.101   -18.239 53.200  1.00 54.33  ? 156 GLU E O   1 
ATOM   6106  C  CB  . GLU E  1 156 ? 11.216  -20.427 54.053  1.00 18.16  ? 156 GLU E CB  1 
ATOM   6107  C  CG  . GLU E  1 156 ? 11.819  -21.708 54.664  0.00 100.00 ? 156 GLU E CG  1 
ATOM   6108  C  CD  . GLU E  1 156 ? 12.082  -22.920 53.767  0.00 100.00 ? 156 GLU E CD  1 
ATOM   6109  O  OE1 . GLU E  1 156 ? 11.651  -22.955 52.608  0.00 100.00 ? 156 GLU E OE1 1 
ATOM   6110  O  OE2 . GLU E  1 156 ? 12.745  -23.866 54.276  0.00 100.00 ? 156 GLU E OE2 1 
ATOM   6111  N  N   . VAL F  1 7   ? 27.344  -1.019  -30.328 1.00 75.54  ? 7   VAL F N   1 
ATOM   6112  C  CA  . VAL F  1 7   ? 27.833  -2.186  -29.567 1.00 74.55  ? 7   VAL F CA  1 
ATOM   6113  C  C   . VAL F  1 7   ? 26.731  -3.191  -29.137 1.00 68.08  ? 7   VAL F C   1 
ATOM   6114  O  O   . VAL F  1 7   ? 25.735  -3.402  -29.852 1.00 76.74  ? 7   VAL F O   1 
ATOM   6115  C  CB  . VAL F  1 7   ? 28.762  -1.726  -28.391 1.00 77.05  ? 7   VAL F CB  1 
ATOM   6116  C  CG1 . VAL F  1 7   ? 29.453  -2.888  -27.713 1.00 74.57  ? 7   VAL F CG1 1 
ATOM   6117  C  CG2 . VAL F  1 7   ? 29.817  -0.748  -28.885 1.00 78.34  ? 7   VAL F CG2 1 
ATOM   6118  N  N   . ASP F  1 8   ? 26.909  -3.819  -27.976 1.00 37.69  ? 8   ASP F N   1 
ATOM   6119  C  CA  . ASP F  1 8   ? 25.884  -4.724  -27.493 1.00 28.19  ? 8   ASP F CA  1 
ATOM   6120  C  C   . ASP F  1 8   ? 25.751  -4.521  -26.013 1.00 15.88  ? 8   ASP F C   1 
ATOM   6121  O  O   . ASP F  1 8   ? 26.541  -3.802  -25.385 1.00 11.73  ? 8   ASP F O   1 
ATOM   6122  C  CB  . ASP F  1 8   ? 25.963  -6.167  -27.956 1.00 26.10  ? 8   ASP F CB  1 
ATOM   6123  C  CG  . ASP F  1 8   ? 26.950  -6.983  -27.148 1.00 34.44  ? 8   ASP F CG  1 
ATOM   6124  O  OD1 . ASP F  1 8   ? 27.682  -6.409  -26.311 1.00 44.14  ? 8   ASP F OD1 1 
ATOM   6125  O  OD2 . ASP F  1 8   ? 26.930  -8.219  -27.350 1.00 46.07  ? 8   ASP F OD2 1 
ATOM   6126  N  N   . THR F  1 9   ? 24.687  -5.094  -25.479 1.00 8.67   ? 9   THR F N   1 
ATOM   6127  C  CA  . THR F  1 9   ? 24.399  -4.795  -24.100 1.00 10.96  ? 9   THR F CA  1 
ATOM   6128  C  C   . THR F  1 9   ? 25.527  -5.240  -23.229 1.00 9.84   ? 9   THR F C   1 
ATOM   6129  O  O   . THR F  1 9   ? 25.971  -4.432  -22.420 1.00 9.25   ? 9   THR F O   1 
ATOM   6130  C  CB  . THR F  1 9   ? 23.034  -5.375  -23.738 1.00 18.36  ? 9   THR F CB  1 
ATOM   6131  O  OG1 . THR F  1 9   ? 22.085  -4.729  -24.597 1.00 14.94  ? 9   THR F OG1 1 
ATOM   6132  C  CG2 . THR F  1 9   ? 22.710  -5.112  -22.261 1.00 17.18  ? 9   THR F CG2 1 
ATOM   6133  N  N   . LYS F  1 10  ? 25.996  -6.451  -23.487 1.00 1.37   ? 10  LYS F N   1 
ATOM   6134  C  CA  . LYS F  1 10  ? 27.072  -6.967  -22.673 1.00 4.99   ? 10  LYS F CA  1 
ATOM   6135  C  C   . LYS F  1 10  ? 28.283  -6.072  -22.637 1.00 13.10  ? 10  LYS F C   1 
ATOM   6136  O  O   . LYS F  1 10  ? 28.832  -5.754  -21.592 1.00 19.63  ? 10  LYS F O   1 
ATOM   6137  C  CB  . LYS F  1 10  ? 27.485  -8.369  -23.083 1.00 3.33   ? 10  LYS F CB  1 
ATOM   6138  C  CG  . LYS F  1 10  ? 26.372  -9.357  -22.924 1.00 5.09   ? 10  LYS F CG  1 
ATOM   6139  C  CD  . LYS F  1 10  ? 26.962  -10.753 -23.066 1.00 10.41  ? 10  LYS F CD  1 
ATOM   6140  C  CE  . LYS F  1 10  ? 25.866  -11.795 -23.307 1.00 56.03  ? 10  LYS F CE  1 
ATOM   6141  N  NZ  . LYS F  1 10  ? 26.373  -13.133 -23.714 1.00 93.57  ? 10  LYS F NZ  1 
ATOM   6142  N  N   . GLU F  1 11  ? 28.651  -5.583  -23.804 1.00 9.52   ? 11  GLU F N   1 
ATOM   6143  C  CA  . GLU F  1 11  ? 29.808  -4.722  -23.861 1.00 12.98  ? 11  GLU F CA  1 
ATOM   6144  C  C   . GLU F  1 11  ? 29.531  -3.403  -23.168 1.00 10.61  ? 11  GLU F C   1 
ATOM   6145  O  O   . GLU F  1 11  ? 30.414  -2.766  -22.587 1.00 9.24   ? 11  GLU F O   1 
ATOM   6146  C  CB  . GLU F  1 11  ? 30.237  -4.485  -25.305 1.00 18.71  ? 11  GLU F CB  1 
ATOM   6147  C  CG  . GLU F  1 11  ? 31.193  -5.468  -25.938 1.00 72.32  ? 11  GLU F CG  1 
ATOM   6148  C  CD  . GLU F  1 11  ? 30.753  -6.907  -25.965 0.00 100.00 ? 11  GLU F CD  1 
ATOM   6149  O  OE1 . GLU F  1 11  ? 30.596  -7.480  -24.874 0.00 100.00 ? 11  GLU F OE1 1 
ATOM   6150  O  OE2 . GLU F  1 11  ? 30.604  -7.462  -27.068 0.00 100.00 ? 11  GLU F OE2 1 
ATOM   6151  N  N   . PHE F  1 12  ? 28.299  -2.936  -23.311 1.00 4.29   ? 12  PHE F N   1 
ATOM   6152  C  CA  . PHE F  1 12  ? 27.994  -1.648  -22.710 1.00 3.35   ? 12  PHE F CA  1 
ATOM   6153  C  C   . PHE F  1 12  ? 28.091  -1.766  -21.201 1.00 6.24   ? 12  PHE F C   1 
ATOM   6154  O  O   . PHE F  1 12  ? 28.764  -0.977  -20.531 1.00 6.19   ? 12  PHE F O   1 
ATOM   6155  C  CB  . PHE F  1 12  ? 26.590  -1.204  -23.058 1.00 6.00   ? 12  PHE F CB  1 
ATOM   6156  C  CG  . PHE F  1 12  ? 26.186  0.014   -22.271 1.00 11.09  ? 12  PHE F CG  1 
ATOM   6157  C  CD1 . PHE F  1 12  ? 26.523  1.283   -22.711 1.00 10.83  ? 12  PHE F CD1 1 
ATOM   6158  C  CD2 . PHE F  1 12  ? 25.566  -0.126  -21.046 1.00 17.41  ? 12  PHE F CD2 1 
ATOM   6159  C  CE1 . PHE F  1 12  ? 26.210  2.412   -21.987 1.00 12.41  ? 12  PHE F CE1 1 
ATOM   6160  C  CE2 . PHE F  1 12  ? 25.274  0.994   -20.303 1.00 13.74  ? 12  PHE F CE2 1 
ATOM   6161  C  CZ  . PHE F  1 12  ? 25.595  2.259   -20.774 1.00 13.02  ? 12  PHE F CZ  1 
ATOM   6162  N  N   . LEU F  1 13  ? 27.408  -2.776  -20.682 1.00 1.00   ? 13  LEU F N   1 
ATOM   6163  C  CA  . LEU F  1 13  ? 27.476  -3.053  -19.250 1.00 4.68   ? 13  LEU F CA  1 
ATOM   6164  C  C   . LEU F  1 13  ? 28.897  -3.197  -18.729 1.00 6.77   ? 13  LEU F C   1 
ATOM   6165  O  O   . LEU F  1 13  ? 29.332  -2.491  -17.818 1.00 12.18  ? 13  LEU F O   1 
ATOM   6166  C  CB  . LEU F  1 13  ? 26.700  -4.325  -18.936 1.00 2.52   ? 13  LEU F CB  1 
ATOM   6167  C  CG  . LEU F  1 13  ? 25.286  -4.079  -18.437 1.00 7.64   ? 13  LEU F CG  1 
ATOM   6168  C  CD1 . LEU F  1 13  ? 24.641  -2.716  -18.638 1.00 2.03   ? 13  LEU F CD1 1 
ATOM   6169  C  CD2 . LEU F  1 13  ? 24.365  -5.231  -18.743 1.00 1.00   ? 13  LEU F CD2 1 
ATOM   6170  N  N   . ASN F  1 14  ? 29.709  -4.038  -19.350 1.00 3.97   ? 14  ASN F N   1 
ATOM   6171  C  CA  . ASN F  1 14  ? 31.082  -4.162  -18.869 1.00 6.76   ? 14  ASN F CA  1 
ATOM   6172  C  C   . ASN F  1 14  ? 31.857  -2.868  -18.895 1.00 10.10  ? 14  ASN F C   1 
ATOM   6173  O  O   . ASN F  1 14  ? 32.664  -2.567  -18.037 1.00 12.07  ? 14  ASN F O   1 
ATOM   6174  C  CB  . ASN F  1 14  ? 31.823  -5.189  -19.720 1.00 4.82   ? 14  ASN F CB  1 
ATOM   6175  C  CG  . ASN F  1 14  ? 32.582  -6.169  -18.852 1.00 22.85  ? 14  ASN F CG  1 
ATOM   6176  O  OD1 . ASN F  1 14  ? 32.607  -6.035  -17.607 1.00 14.93  ? 14  ASN F OD1 1 
ATOM   6177  N  ND2 . ASN F  1 14  ? 33.156  -7.184  -19.497 1.00 13.00  ? 14  ASN F ND2 1 
ATOM   6178  N  N   . HIS F  1 15  ? 31.569  -2.075  -19.913 1.00 6.66   ? 15  HIS F N   1 
ATOM   6179  C  CA  . HIS F  1 15  ? 32.235  -0.784  -20.041 1.00 6.90   ? 15  HIS F CA  1 
ATOM   6180  C  C   . HIS F  1 15  ? 31.897  0.057   -18.824 1.00 8.14   ? 15  HIS F C   1 
ATOM   6181  O  O   . HIS F  1 15  ? 32.778  0.774   -18.343 1.00 9.15   ? 15  HIS F O   1 
ATOM   6182  C  CB  . HIS F  1 15  ? 31.882  -0.047  -21.354 1.00 10.23  ? 15  HIS F CB  1 
ATOM   6183  C  CG  . HIS F  1 15  ? 32.602  1.259   -21.524 1.00 18.40  ? 15  HIS F CG  1 
ATOM   6184  N  ND1 . HIS F  1 15  ? 31.967  2.483   -21.484 1.00 24.54  ? 15  HIS F ND1 1 
ATOM   6185  C  CD2 . HIS F  1 15  ? 33.920  1.545   -21.672 1.00 19.35  ? 15  HIS F CD2 1 
ATOM   6186  C  CE1 . HIS F  1 15  ? 32.851  3.457   -21.617 1.00 22.60  ? 15  HIS F CE1 1 
ATOM   6187  N  NE2 . HIS F  1 15  ? 34.049  2.915   -21.717 1.00 21.18  ? 15  HIS F NE2 1 
ATOM   6188  N  N   . GLN F  1 16  ? 30.659  -0.012  -18.345 1.00 2.33   ? 16  GLN F N   1 
ATOM   6189  C  CA  . GLN F  1 16  ? 30.321  0.751   -17.144 1.00 2.76   ? 16  GLN F CA  1 
ATOM   6190  C  C   . GLN F  1 16  ? 30.947  0.160   -15.883 1.00 7.47   ? 16  GLN F C   1 
ATOM   6191  O  O   . GLN F  1 16  ? 31.355  0.934   -15.019 1.00 7.19   ? 16  GLN F O   1 
ATOM   6192  C  CB  . GLN F  1 16  ? 28.813  0.897   -17.005 1.00 1.31   ? 16  GLN F CB  1 
ATOM   6193  C  CG  . GLN F  1 16  ? 28.269  1.538   -18.273 1.00 8.24   ? 16  GLN F CG  1 
ATOM   6194  C  CD  . GLN F  1 16  ? 28.957  2.863   -18.602 1.00 19.36  ? 16  GLN F CD  1 
ATOM   6195  O  OE1 . GLN F  1 16  ? 29.458  3.575   -17.726 1.00 8.79   ? 16  GLN F OE1 1 
ATOM   6196  N  NE2 . GLN F  1 16  ? 28.970  3.208   -19.884 1.00 12.51  ? 16  GLN F NE2 1 
ATOM   6197  N  N   . VAL F  1 17  ? 31.113  -1.168  -15.807 1.00 2.03   ? 17  VAL F N   1 
ATOM   6198  C  CA  . VAL F  1 17  ? 31.790  -1.719  -14.642 1.00 1.48   ? 17  VAL F CA  1 
ATOM   6199  C  C   . VAL F  1 17  ? 33.140  -1.037  -14.575 1.00 6.19   ? 17  VAL F C   1 
ATOM   6200  O  O   . VAL F  1 17  ? 33.567  -0.557  -13.535 1.00 9.43   ? 17  VAL F O   1 
ATOM   6201  C  CB  . VAL F  1 17  ? 31.988  -3.231  -14.753 1.00 3.35   ? 17  VAL F CB  1 
ATOM   6202  C  CG1 . VAL F  1 17  ? 32.965  -3.716  -13.687 1.00 2.01   ? 17  VAL F CG1 1 
ATOM   6203  C  CG2 . VAL F  1 17  ? 30.649  -3.953  -14.611 1.00 1.69   ? 17  VAL F CG2 1 
ATOM   6204  N  N   . ALA F  1 18  ? 33.816  -0.917  -15.716 1.00 4.47   ? 18  ALA F N   1 
ATOM   6205  C  CA  . ALA F  1 18  ? 35.105  -0.222  -15.702 1.00 4.41   ? 18  ALA F CA  1 
ATOM   6206  C  C   . ALA F  1 18  ? 34.924  1.217   -15.255 1.00 5.30   ? 18  ALA F C   1 
ATOM   6207  O  O   . ALA F  1 18  ? 35.664  1.699   -14.412 1.00 8.74   ? 18  ALA F O   1 
ATOM   6208  C  CB  . ALA F  1 18  ? 35.775  -0.270  -17.071 1.00 3.02   ? 18  ALA F CB  1 
ATOM   6209  N  N   . ASN F  1 19  ? 34.020  1.966   -15.865 1.00 2.51   ? 19  ASN F N   1 
ATOM   6210  C  CA  . ASN F  1 19  ? 33.935  3.381   -15.514 1.00 2.03   ? 19  ASN F CA  1 
ATOM   6211  C  C   . ASN F  1 19  ? 33.629  3.577   -14.044 1.00 9.74   ? 19  ASN F C   1 
ATOM   6212  O  O   . ASN F  1 19  ? 34.191  4.445   -13.373 1.00 9.24   ? 19  ASN F O   1 
ATOM   6213  C  CB  . ASN F  1 19  ? 32.771  4.047   -16.237 1.00 4.45   ? 19  ASN F CB  1 
ATOM   6214  C  CG  . ASN F  1 19  ? 33.067  4.365   -17.693 1.00 15.24  ? 19  ASN F CG  1 
ATOM   6215  O  OD1 . ASN F  1 19  ? 34.230  4.489   -18.111 1.00 8.91   ? 19  ASN F OD1 1 
ATOM   6216  N  ND2 . ASN F  1 19  ? 31.995  4.627   -18.429 1.00 3.96   ? 19  ASN F ND2 1 
ATOM   6217  N  N   . LEU F  1 20  ? 32.664  2.799   -13.569 1.00 11.10  ? 20  LEU F N   1 
ATOM   6218  C  CA  . LEU F  1 20  ? 32.206  2.900   -12.179 1.00 6.18   ? 20  LEU F CA  1 
ATOM   6219  C  C   . LEU F  1 20  ? 33.388  2.662   -11.258 1.00 7.63   ? 20  LEU F C   1 
ATOM   6220  O  O   . LEU F  1 20  ? 33.645  3.446   -10.368 1.00 8.11   ? 20  LEU F O   1 
ATOM   6221  C  CB  . LEU F  1 20  ? 31.035  1.941   -11.984 1.00 4.93   ? 20  LEU F CB  1 
ATOM   6222  C  CG  . LEU F  1 20  ? 29.616  2.495   -11.995 1.00 3.26   ? 20  LEU F CG  1 
ATOM   6223  C  CD1 . LEU F  1 20  ? 29.408  3.952   -12.325 1.00 1.71   ? 20  LEU F CD1 1 
ATOM   6224  C  CD2 . LEU F  1 20  ? 28.607  1.587   -12.687 1.00 1.53   ? 20  LEU F CD2 1 
ATOM   6225  N  N   . ASN F  1 21  ? 34.225  1.683   -11.541 1.00 1.34   ? 21  ASN F N   1 
ATOM   6226  C  CA  . ASN F  1 21  ? 35.405  1.513   -10.704 1.00 1.25   ? 21  ASN F CA  1 
ATOM   6227  C  C   . ASN F  1 21  ? 36.364  2.669   -10.699 1.00 8.35   ? 21  ASN F C   1 
ATOM   6228  O  O   . ASN F  1 21  ? 36.955  2.987   -9.682  1.00 14.42  ? 21  ASN F O   1 
ATOM   6229  C  CB  . ASN F  1 21  ? 36.143  0.218   -11.022 1.00 6.08   ? 21  ASN F CB  1 
ATOM   6230  C  CG  . ASN F  1 21  ? 35.529  -0.953  -10.274 1.00 21.25  ? 21  ASN F CG  1 
ATOM   6231  O  OD1 . ASN F  1 21  ? 35.790  -1.151  -9.081  1.00 16.02  ? 21  ASN F OD1 1 
ATOM   6232  N  ND2 . ASN F  1 21  ? 34.608  -1.659  -10.935 1.00 11.78  ? 21  ASN F ND2 1 
ATOM   6233  N  N   . VAL F  1 22  ? 36.513  3.357   -11.807 1.00 8.85   ? 22  VAL F N   1 
ATOM   6234  C  CA  . VAL F  1 22  ? 37.397  4.510   -11.795 1.00 5.90   ? 22  VAL F CA  1 
ATOM   6235  C  C   . VAL F  1 22  ? 36.689  5.663   -11.075 1.00 5.93   ? 22  VAL F C   1 
ATOM   6236  O  O   . VAL F  1 22  ? 37.285  6.449   -10.342 1.00 1.89   ? 22  VAL F O   1 
ATOM   6237  C  CB  . VAL F  1 22  ? 37.752  4.964   -13.242 1.00 5.63   ? 22  VAL F CB  1 
ATOM   6238  C  CG1 . VAL F  1 22  ? 38.592  6.235   -13.290 1.00 6.47   ? 22  VAL F CG1 1 
ATOM   6239  C  CG2 . VAL F  1 22  ? 38.448  3.838   -13.986 1.00 3.15   ? 22  VAL F CG2 1 
ATOM   6240  N  N   . PHE F  1 23  ? 35.385  5.784   -11.300 1.00 1.80   ? 23  PHE F N   1 
ATOM   6241  C  CA  . PHE F  1 23  ? 34.688  6.877   -10.644 1.00 2.97   ? 23  PHE F CA  1 
ATOM   6242  C  C   . PHE F  1 23  ? 34.748  6.791   -9.106  1.00 9.65   ? 23  PHE F C   1 
ATOM   6243  O  O   . PHE F  1 23  ? 34.925  7.744   -8.354  1.00 7.92   ? 23  PHE F O   1 
ATOM   6244  C  CB  . PHE F  1 23  ? 33.220  6.851   -11.097 1.00 2.46   ? 23  PHE F CB  1 
ATOM   6245  C  CG  . PHE F  1 23  ? 32.433  8.027   -10.587 1.00 5.06   ? 23  PHE F CG  1 
ATOM   6246  C  CD1 . PHE F  1 23  ? 33.035  9.276   -10.448 1.00 10.68  ? 23  PHE F CD1 1 
ATOM   6247  C  CD2 . PHE F  1 23  ? 31.074  7.919   -10.365 1.00 5.41   ? 23  PHE F CD2 1 
ATOM   6248  C  CE1 . PHE F  1 23  ? 32.246  10.378  -10.041 1.00 8.33   ? 23  PHE F CE1 1 
ATOM   6249  C  CE2 . PHE F  1 23  ? 30.307  9.006   -9.916  1.00 3.79   ? 23  PHE F CE2 1 
ATOM   6250  C  CZ  . PHE F  1 23  ? 30.878  10.243  -9.774  1.00 1.11   ? 23  PHE F CZ  1 
ATOM   6251  N  N   . THR F  1 24  ? 34.608  5.561   -8.664  1.00 3.30   ? 24  THR F N   1 
ATOM   6252  C  CA  . THR F  1 24  ? 34.569  5.315   -7.246  1.00 2.23   ? 24  THR F CA  1 
ATOM   6253  C  C   . THR F  1 24  ? 35.871  5.736   -6.589  1.00 10.10  ? 24  THR F C   1 
ATOM   6254  O  O   . THR F  1 24  ? 35.900  6.367   -5.532  1.00 6.04   ? 24  THR F O   1 
ATOM   6255  C  CB  . THR F  1 24  ? 34.147  3.870   -7.102  1.00 6.62   ? 24  THR F CB  1 
ATOM   6256  O  OG1 . THR F  1 24  ? 33.220  3.741   -6.042  1.00 37.06  ? 24  THR F OG1 1 
ATOM   6257  C  CG2 . THR F  1 24  ? 35.265  2.897   -6.952  1.00 2.09   ? 24  THR F CG2 1 
ATOM   6258  N  N   . VAL F  1 25  ? 36.985  5.482   -7.263  1.00 4.90   ? 25  VAL F N   1 
ATOM   6259  C  CA  . VAL F  1 25  ? 38.279  5.862   -6.709  1.00 1.97   ? 25  VAL F CA  1 
ATOM   6260  C  C   . VAL F  1 25  ? 38.378  7.365   -6.764  1.00 7.39   ? 25  VAL F C   1 
ATOM   6261  O  O   . VAL F  1 25  ? 38.881  8.006   -5.854  1.00 4.41   ? 25  VAL F O   1 
ATOM   6262  C  CB  . VAL F  1 25  ? 39.417  5.171   -7.493  1.00 5.78   ? 25  VAL F CB  1 
ATOM   6263  C  CG1 . VAL F  1 25  ? 40.759  5.655   -7.048  1.00 5.69   ? 25  VAL F CG1 1 
ATOM   6264  C  CG2 . VAL F  1 25  ? 39.326  3.669   -7.324  1.00 1.35   ? 25  VAL F CG2 1 
ATOM   6265  N  N   . LYS F  1 26  ? 37.824  7.945   -7.815  1.00 1.03   ? 26  LYS F N   1 
ATOM   6266  C  CA  . LYS F  1 26  ? 37.927  9.383   -7.921  1.00 1.84   ? 26  LYS F CA  1 
ATOM   6267  C  C   . LYS F  1 26  ? 37.214  10.036  -6.748  1.00 6.24   ? 26  LYS F C   1 
ATOM   6268  O  O   . LYS F  1 26  ? 37.671  11.034  -6.181  1.00 7.75   ? 26  LYS F O   1 
ATOM   6269  C  CB  . LYS F  1 26  ? 37.297  9.829   -9.245  1.00 3.31   ? 26  LYS F CB  1 
ATOM   6270  C  CG  . LYS F  1 26  ? 37.404  11.322  -9.461  1.00 14.87  ? 26  LYS F CG  1 
ATOM   6271  C  CD  . LYS F  1 26  ? 36.652  11.725  -10.713 1.00 29.95  ? 26  LYS F CD  1 
ATOM   6272  C  CE  . LYS F  1 26  ? 37.371  11.287  -11.967 1.00 14.13  ? 26  LYS F CE  1 
ATOM   6273  N  NZ  . LYS F  1 26  ? 38.619  12.080  -12.259 1.00 36.55  ? 26  LYS F NZ  1 
ATOM   6274  N  N   . ILE F  1 27  ? 36.053  9.477   -6.410  1.00 2.90   ? 27  ILE F N   1 
ATOM   6275  C  CA  . ILE F  1 27  ? 35.257  9.990   -5.299  1.00 1.92   ? 27  ILE F CA  1 
ATOM   6276  C  C   . ILE F  1 27  ? 36.083  9.958   -4.012  1.00 6.17   ? 27  ILE F C   1 
ATOM   6277  O  O   . ILE F  1 27  ? 36.048  10.887  -3.201  1.00 8.70   ? 27  ILE F O   1 
ATOM   6278  C  CB  . ILE F  1 27  ? 33.965  9.169   -5.178  1.00 2.65   ? 27  ILE F CB  1 
ATOM   6279  C  CG1 . ILE F  1 27  ? 33.020  9.447   -6.350  1.00 1.19   ? 27  ILE F CG1 1 
ATOM   6280  C  CG2 . ILE F  1 27  ? 33.182  9.489   -3.904  1.00 1.86   ? 27  ILE F CG2 1 
ATOM   6281  C  CD1 . ILE F  1 27  ? 31.890  8.433   -6.473  1.00 1.72   ? 27  ILE F CD1 1 
ATOM   6282  N  N   . HIS F  1 28  ? 36.840  8.895   -3.828  1.00 2.62   ? 28  HIS F N   1 
ATOM   6283  C  CA  . HIS F  1 28  ? 37.687  8.775   -2.633  1.00 2.07   ? 28  HIS F CA  1 
ATOM   6284  C  C   . HIS F  1 28  ? 38.746  9.879   -2.634  1.00 8.03   ? 28  HIS F C   1 
ATOM   6285  O  O   . HIS F  1 28  ? 39.032  10.499  -1.603  1.00 7.77   ? 28  HIS F O   1 
ATOM   6286  C  CB  . HIS F  1 28  ? 38.395  7.427   -2.601  1.00 5.65   ? 28  HIS F CB  1 
ATOM   6287  C  CG  . HIS F  1 28  ? 37.724  6.417   -1.669  1.00 11.35  ? 28  HIS F CG  1 
ATOM   6288  N  ND1 . HIS F  1 28  ? 36.842  6.805   -0.663  1.00 17.17  ? 28  HIS F ND1 1 
ATOM   6289  C  CD2 . HIS F  1 28  ? 37.807  5.065   -1.602  1.00 12.57  ? 28  HIS F CD2 1 
ATOM   6290  C  CE1 . HIS F  1 28  ? 36.428  5.715   -0.039  1.00 15.75  ? 28  HIS F CE1 1 
ATOM   6291  N  NE2 . HIS F  1 28  ? 36.994  4.669   -0.588  1.00 15.34  ? 28  HIS F NE2 1 
ATOM   6292  N  N   . GLN F  1 29  ? 39.308  10.102  -3.805  1.00 5.27   ? 29  GLN F N   1 
ATOM   6293  C  CA  . GLN F  1 29  ? 40.355  11.113  -3.986  1.00 5.47   ? 29  GLN F CA  1 
ATOM   6294  C  C   . GLN F  1 29  ? 39.876  12.479  -3.480  1.00 7.04   ? 29  GLN F C   1 
ATOM   6295  O  O   . GLN F  1 29  ? 40.542  13.132  -2.668  1.00 5.45   ? 29  GLN F O   1 
ATOM   6296  C  CB  . GLN F  1 29  ? 40.721  11.246  -5.458  1.00 7.84   ? 29  GLN F CB  1 
ATOM   6297  C  CG  . GLN F  1 29  ? 41.640  12.438  -5.727  1.00 11.44  ? 29  GLN F CG  1 
ATOM   6298  C  CD  . GLN F  1 29  ? 42.201  12.444  -7.146  1.00 17.14  ? 29  GLN F CD  1 
ATOM   6299  O  OE1 . GLN F  1 29  ? 43.068  11.633  -7.466  1.00 13.62  ? 29  GLN F OE1 1 
ATOM   6300  N  NE2 . GLN F  1 29  ? 41.752  13.318  -8.025  1.00 10.15  ? 29  GLN F NE2 1 
ATOM   6301  N  N   . ILE F  1 30  ? 38.725  12.883  -3.977  1.00 2.68   ? 30  ILE F N   1 
ATOM   6302  C  CA  . ILE F  1 30  ? 38.121  14.175  -3.613  1.00 3.05   ? 30  ILE F CA  1 
ATOM   6303  C  C   . ILE F  1 30  ? 37.838  14.224  -2.112  1.00 6.79   ? 30  ILE F C   1 
ATOM   6304  O  O   . ILE F  1 30  ? 38.065  15.251  -1.455  1.00 7.65   ? 30  ILE F O   1 
ATOM   6305  C  CB  . ILE F  1 30  ? 36.801  14.359  -4.359  1.00 6.03   ? 30  ILE F CB  1 
ATOM   6306  C  CG1 . ILE F  1 30  ? 36.997  14.577  -5.859  1.00 9.35   ? 30  ILE F CG1 1 
ATOM   6307  C  CG2 . ILE F  1 30  ? 35.998  15.561  -3.859  1.00 1.49   ? 30  ILE F CG2 1 
ATOM   6308  C  CD1 . ILE F  1 30  ? 35.699  14.449  -6.656  1.00 14.17  ? 30  ILE F CD1 1 
ATOM   6309  N  N   . HIS F  1 31  ? 37.358  13.097  -1.658  1.00 3.00   ? 31  HIS F N   1 
ATOM   6310  C  CA  . HIS F  1 31  ? 36.958  12.854  -0.270  1.00 2.67   ? 31  HIS F CA  1 
ATOM   6311  C  C   . HIS F  1 31  ? 38.156  13.017  0.684   1.00 11.87  ? 31  HIS F C   1 
ATOM   6312  O  O   . HIS F  1 31  ? 38.032  13.585  1.780   1.00 5.52   ? 31  HIS F O   1 
ATOM   6313  C  CB  . HIS F  1 31  ? 36.393  11.431  -0.218  1.00 2.94   ? 31  HIS F CB  1 
ATOM   6314  C  CG  . HIS F  1 31  ? 36.132  10.880  1.179   1.00 9.98   ? 31  HIS F CG  1 
ATOM   6315  N  ND1 . HIS F  1 31  ? 35.106  11.363  1.983   1.00 15.23  ? 31  HIS F ND1 1 
ATOM   6316  C  CD2 . HIS F  1 31  ? 36.746  9.898   1.886   1.00 10.36  ? 31  HIS F CD2 1 
ATOM   6317  C  CE1 . HIS F  1 31  ? 35.120  10.682  3.115   1.00 12.66  ? 31  HIS F CE1 1 
ATOM   6318  N  NE2 . HIS F  1 31  ? 36.092  9.804   3.072   1.00 9.68   ? 31  HIS F NE2 1 
ATOM   6319  N  N   . TRP F  1 32  ? 39.296  12.524  0.240   1.00 5.46   ? 32  TRP F N   1 
ATOM   6320  C  CA  . TRP F  1 32  ? 40.531  12.532  1.044   1.00 2.13   ? 32  TRP F CA  1 
ATOM   6321  C  C   . TRP F  1 32  ? 41.307  13.851  0.951   1.00 11.35  ? 32  TRP F C   1 
ATOM   6322  O  O   . TRP F  1 32  ? 41.898  14.316  1.933   1.00 7.18   ? 32  TRP F O   1 
ATOM   6323  C  CB  . TRP F  1 32  ? 41.508  11.455  0.554   1.00 1.89   ? 32  TRP F CB  1 
ATOM   6324  C  CG  . TRP F  1 32  ? 41.082  10.035  0.917   1.00 1.65   ? 32  TRP F CG  1 
ATOM   6325  C  CD1 . TRP F  1 32  ? 40.334  9.662   1.961   1.00 4.03   ? 32  TRP F CD1 1 
ATOM   6326  C  CD2 . TRP F  1 32  ? 41.427  8.870   0.183   1.00 2.66   ? 32  TRP F CD2 1 
ATOM   6327  N  NE1 . TRP F  1 32  ? 40.182  8.242   1.881   1.00 3.61   ? 32  TRP F NE1 1 
ATOM   6328  C  CE2 . TRP F  1 32  ? 40.824  7.799   0.828   1.00 3.21   ? 32  TRP F CE2 1 
ATOM   6329  C  CE3 . TRP F  1 32  ? 42.184  8.632   -0.971  1.00 3.66   ? 32  TRP F CE3 1 
ATOM   6330  C  CZ2 . TRP F  1 32  ? 40.915  6.479   0.372   1.00 1.82   ? 32  TRP F CZ2 1 
ATOM   6331  C  CZ3 . TRP F  1 32  ? 42.277  7.297   -1.420  1.00 6.04   ? 32  TRP F CZ3 1 
ATOM   6332  C  CH2 . TRP F  1 32  ? 41.670  6.273   -0.780  1.00 6.57   ? 32  TRP F CH2 1 
ATOM   6333  N  N   . TYR F  1 33  ? 41.298  14.452  -0.221  1.00 3.23   ? 33  TYR F N   1 
ATOM   6334  C  CA  . TYR F  1 33  ? 42.146  15.630  -0.474  1.00 3.45   ? 33  TYR F CA  1 
ATOM   6335  C  C   . TYR F  1 33  ? 41.439  16.991  -0.343  1.00 11.61  ? 33  TYR F C   1 
ATOM   6336  O  O   . TYR F  1 33  ? 42.084  18.043  -0.289  1.00 12.53  ? 33  TYR F O   1 
ATOM   6337  C  CB  . TYR F  1 33  ? 42.731  15.542  -1.878  1.00 2.95   ? 33  TYR F CB  1 
ATOM   6338  C  CG  . TYR F  1 33  ? 43.907  14.570  -1.935  1.00 5.03   ? 33  TYR F CG  1 
ATOM   6339  C  CD1 . TYR F  1 33  ? 45.136  14.938  -1.378  1.00 12.25  ? 33  TYR F CD1 1 
ATOM   6340  C  CD2 . TYR F  1 33  ? 43.754  13.313  -2.533  1.00 3.33   ? 33  TYR F CD2 1 
ATOM   6341  C  CE1 . TYR F  1 33  ? 46.215  14.045  -1.411  1.00 10.76  ? 33  TYR F CE1 1 
ATOM   6342  C  CE2 . TYR F  1 33  ? 44.834  12.420  -2.568  1.00 5.96   ? 33  TYR F CE2 1 
ATOM   6343  C  CZ  . TYR F  1 33  ? 46.064  12.786  -2.005  1.00 15.92  ? 33  TYR F CZ  1 
ATOM   6344  O  OH  . TYR F  1 33  ? 47.111  11.917  -2.034  1.00 12.49  ? 33  TYR F OH  1 
ATOM   6345  N  N   . MET F  1 34  ? 40.134  17.014  -0.278  1.00 5.80   ? 34  MET F N   1 
ATOM   6346  C  CA  . MET F  1 34  ? 39.411  18.302  -0.208  1.00 2.88   ? 34  MET F CA  1 
ATOM   6347  C  C   . MET F  1 34  ? 39.787  19.104  1.021   1.00 4.40   ? 34  MET F C   1 
ATOM   6348  O  O   . MET F  1 34  ? 40.129  18.576  2.064   1.00 5.97   ? 34  MET F O   1 
ATOM   6349  C  CB  . MET F  1 34  ? 37.902  18.064  -0.184  1.00 7.21   ? 34  MET F CB  1 
ATOM   6350  C  CG  . MET F  1 34  ? 37.437  17.302  1.053   1.00 13.39  ? 34  MET F CG  1 
ATOM   6351  S  SD  . MET F  1 34  ? 35.672  17.098  1.115   1.00 19.20  ? 34  MET F SD  1 
ATOM   6352  C  CE  . MET F  1 34  ? 35.063  16.585  -0.477  1.00 15.96  ? 34  MET F CE  1 
ATOM   6353  N  N   . ARG F  1 35  ? 39.641  20.412  0.892   1.00 8.94   ? 35  ARG F N   1 
ATOM   6354  C  CA  . ARG F  1 35  ? 39.943  21.343  1.966   1.00 10.80  ? 35  ARG F CA  1 
ATOM   6355  C  C   . ARG F  1 35  ? 39.095  22.542  1.664   1.00 12.93  ? 35  ARG F C   1 
ATOM   6356  O  O   . ARG F  1 35  ? 38.708  22.740  0.509   1.00 18.19  ? 35  ARG F O   1 
ATOM   6357  C  CB  . ARG F  1 35  ? 41.386  21.833  1.958   1.00 8.61   ? 35  ARG F CB  1 
ATOM   6358  C  CG  . ARG F  1 35  ? 42.382  20.779  2.273   1.00 15.20  ? 35  ARG F CG  1 
ATOM   6359  C  CD  . ARG F  1 35  ? 43.729  21.438  2.427   1.00 5.74   ? 35  ARG F CD  1 
ATOM   6360  N  NE  . ARG F  1 35  ? 44.803  20.447  2.645   1.00 22.18  ? 35  ARG F NE  1 
ATOM   6361  C  CZ  . ARG F  1 35  ? 46.117  20.699  2.569   1.00 35.61  ? 35  ARG F CZ  1 
ATOM   6362  N  NH1 . ARG F  1 35  ? 46.527  21.923  2.275   1.00 42.99  ? 35  ARG F NH1 1 
ATOM   6363  N  NH2 . ARG F  1 35  ? 47.016  19.744  2.767   1.00 29.99  ? 35  ARG F NH2 1 
ATOM   6364  N  N   . GLY F  1 36  ? 38.805  23.300  2.720   1.00 7.22   ? 36  GLY F N   1 
ATOM   6365  C  CA  . GLY F  1 36  ? 37.982  24.492  2.616   1.00 7.18   ? 36  GLY F CA  1 
ATOM   6366  C  C   . GLY F  1 36  ? 36.784  24.459  3.543   1.00 13.50  ? 36  GLY F C   1 
ATOM   6367  O  O   . GLY F  1 36  ? 36.373  23.405  4.047   1.00 12.68  ? 36  GLY F O   1 
ATOM   6368  N  N   . HIS F  1 37  ? 36.161  25.616  3.686   1.00 9.40   ? 37  HIS F N   1 
ATOM   6369  C  CA  . HIS F  1 37  ? 34.986  25.692  4.531   1.00 13.91  ? 37  HIS F CA  1 
ATOM   6370  C  C   . HIS F  1 37  ? 33.895  24.646  4.351   1.00 17.88  ? 37  HIS F C   1 
ATOM   6371  O  O   . HIS F  1 37  ? 33.132  24.434  5.316   1.00 16.03  ? 37  HIS F O   1 
ATOM   6372  C  CB  . HIS F  1 37  ? 34.405  27.120  4.515   1.00 19.32  ? 37  HIS F CB  1 
ATOM   6373  C  CG  . HIS F  1 37  ? 35.355  28.119  5.084   1.00 32.06  ? 37  HIS F CG  1 
ATOM   6374  N  ND1 . HIS F  1 37  ? 35.052  28.897  6.175   1.00 40.45  ? 37  HIS F ND1 1 
ATOM   6375  C  CD2 . HIS F  1 37  ? 36.659  28.352  4.810   1.00 48.39  ? 37  HIS F CD2 1 
ATOM   6376  C  CE1 . HIS F  1 37  ? 36.100  29.629  6.499   1.00 46.01  ? 37  HIS F CE1 1 
ATOM   6377  N  NE2 . HIS F  1 37  ? 37.090  29.316  5.687   1.00 49.07  ? 37  HIS F NE2 1 
ATOM   6378  N  N   . ASN F  1 38  ? 33.807  24.047  3.161   1.00 13.24  ? 38  ASN F N   1 
ATOM   6379  C  CA  . ASN F  1 38  ? 32.778  23.045  2.878   1.00 13.67  ? 38  ASN F CA  1 
ATOM   6380  C  C   . ASN F  1 38  ? 33.256  21.621  3.189   1.00 17.17  ? 38  ASN F C   1 
ATOM   6381  O  O   . ASN F  1 38  ? 32.573  20.614  2.977   1.00 15.58  ? 38  ASN F O   1 
ATOM   6382  C  CB  . ASN F  1 38  ? 32.225  23.151  1.450   1.00 13.89  ? 38  ASN F CB  1 
ATOM   6383  C  CG  . ASN F  1 38  ? 31.788  24.559  1.133   1.00 32.99  ? 38  ASN F CG  1 
ATOM   6384  O  OD1 . ASN F  1 38  ? 32.518  25.273  0.444   1.00 37.26  ? 38  ASN F OD1 1 
ATOM   6385  N  ND2 . ASN F  1 38  ? 30.701  25.008  1.762   1.00 15.77  ? 38  ASN F ND2 1 
ATOM   6386  N  N   . PHE F  1 39  ? 34.446  21.557  3.764   1.00 6.96   ? 39  PHE F N   1 
ATOM   6387  C  CA  . PHE F  1 39  ? 34.952  20.247  4.121   1.00 4.55   ? 39  PHE F CA  1 
ATOM   6388  C  C   . PHE F  1 39  ? 34.008  19.246  4.788   1.00 6.72   ? 39  PHE F C   1 
ATOM   6389  O  O   . PHE F  1 39  ? 33.810  18.147  4.264   1.00 7.24   ? 39  PHE F O   1 
ATOM   6390  C  CB  . PHE F  1 39  ? 36.204  20.354  4.989   1.00 1.00   ? 39  PHE F CB  1 
ATOM   6391  C  CG  . PHE F  1 39  ? 36.735  19.005  5.355   1.00 3.11   ? 39  PHE F CG  1 
ATOM   6392  C  CD1 . PHE F  1 39  ? 37.497  18.293  4.442   1.00 1.00   ? 39  PHE F CD1 1 
ATOM   6393  C  CD2 . PHE F  1 39  ? 36.372  18.413  6.558   1.00 5.15   ? 39  PHE F CD2 1 
ATOM   6394  C  CE1 . PHE F  1 39  ? 37.962  17.038  4.744   1.00 1.09   ? 39  PHE F CE1 1 
ATOM   6395  C  CE2 . PHE F  1 39  ? 36.847  17.149  6.882   1.00 4.22   ? 39  PHE F CE2 1 
ATOM   6396  C  CZ  . PHE F  1 39  ? 37.654  16.477  5.967   1.00 2.75   ? 39  PHE F CZ  1 
ATOM   6397  N  N   . PHE F  1 40  ? 33.443  19.610  5.931   1.00 1.89   ? 40  PHE F N   1 
ATOM   6398  C  CA  . PHE F  1 40  ? 32.644  18.609  6.615   1.00 6.86   ? 40  PHE F CA  1 
ATOM   6399  C  C   . PHE F  1 40  ? 31.492  18.100  5.777   1.00 17.42  ? 40  PHE F C   1 
ATOM   6400  O  O   . PHE F  1 40  ? 31.319  16.917  5.547   1.00 13.40  ? 40  PHE F O   1 
ATOM   6401  C  CB  . PHE F  1 40  ? 32.177  19.219  7.912   1.00 4.06   ? 40  PHE F CB  1 
ATOM   6402  C  CG  . PHE F  1 40  ? 33.301  19.437  8.857   1.00 4.09   ? 40  PHE F CG  1 
ATOM   6403  C  CD1 . PHE F  1 40  ? 33.881  18.347  9.494   1.00 1.60   ? 40  PHE F CD1 1 
ATOM   6404  C  CD2 . PHE F  1 40  ? 33.837  20.696  9.054   1.00 5.76   ? 40  PHE F CD2 1 
ATOM   6405  C  CE1 . PHE F  1 40  ? 34.930  18.544  10.404  1.00 4.64   ? 40  PHE F CE1 1 
ATOM   6406  C  CE2 . PHE F  1 40  ? 34.900  20.906  9.962   1.00 7.60   ? 40  PHE F CE2 1 
ATOM   6407  C  CZ  . PHE F  1 40  ? 35.454  19.829  10.643  1.00 1.56   ? 40  PHE F CZ  1 
ATOM   6408  N  N   . THR F  1 41  ? 30.740  19.027  5.217   1.00 14.47  ? 41  THR F N   1 
ATOM   6409  C  CA  . THR F  1 41  ? 29.608  18.632  4.432   1.00 12.76  ? 41  THR F CA  1 
ATOM   6410  C  C   . THR F  1 41  ? 29.970  17.841  3.183   1.00 10.20  ? 41  THR F C   1 
ATOM   6411  O  O   . THR F  1 41  ? 29.492  16.730  2.949   1.00 12.28  ? 41  THR F O   1 
ATOM   6412  C  CB  . THR F  1 41  ? 28.649  19.828  4.305   1.00 34.91  ? 41  THR F CB  1 
ATOM   6413  O  OG1 . THR F  1 41  ? 27.727  19.611  3.238   1.00 54.09  ? 41  THR F OG1 1 
ATOM   6414  C  CG2 . THR F  1 41  ? 29.411  21.127  4.081   1.00 68.30  ? 41  THR F CG2 1 
ATOM   6415  N  N   . LEU F  1 42  ? 30.864  18.348  2.362   1.00 7.16   ? 42  LEU F N   1 
ATOM   6416  C  CA  . LEU F  1 42  ? 31.219  17.581  1.180   1.00 6.33   ? 42  LEU F CA  1 
ATOM   6417  C  C   . LEU F  1 42  ? 31.981  16.306  1.514   1.00 10.24  ? 42  LEU F C   1 
ATOM   6418  O  O   . LEU F  1 42  ? 31.869  15.307  0.813   1.00 9.94   ? 42  LEU F O   1 
ATOM   6419  C  CB  . LEU F  1 42  ? 32.011  18.478  0.231   1.00 6.95   ? 42  LEU F CB  1 
ATOM   6420  C  CG  . LEU F  1 42  ? 31.213  19.116  -0.906  1.00 11.13  ? 42  LEU F CG  1 
ATOM   6421  C  CD1 . LEU F  1 42  ? 29.745  19.112  -0.631  1.00 8.29   ? 42  LEU F CD1 1 
ATOM   6422  C  CD2 . LEU F  1 42  ? 31.684  20.533  -0.946  1.00 21.91  ? 42  LEU F CD2 1 
ATOM   6423  N  N   . HIS F  1 43  ? 32.759  16.308  2.584   1.00 3.18   ? 43  HIS F N   1 
ATOM   6424  C  CA  . HIS F  1 43  ? 33.477  15.095  2.954   1.00 3.68   ? 43  HIS F CA  1 
ATOM   6425  C  C   . HIS F  1 43  ? 32.449  13.991  3.203   1.00 7.95   ? 43  HIS F C   1 
ATOM   6426  O  O   . HIS F  1 43  ? 32.624  12.857  2.772   1.00 9.13   ? 43  HIS F O   1 
ATOM   6427  C  CB  . HIS F  1 43  ? 34.238  15.344  4.274   1.00 2.88   ? 43  HIS F CB  1 
ATOM   6428  C  CG  . HIS F  1 43  ? 35.048  14.174  4.731   1.00 7.93   ? 43  HIS F CG  1 
ATOM   6429  N  ND1 . HIS F  1 43  ? 36.136  13.716  4.022   1.00 10.38  ? 43  HIS F ND1 1 
ATOM   6430  C  CD2 . HIS F  1 43  ? 34.932  13.363  5.811   1.00 11.11  ? 43  HIS F CD2 1 
ATOM   6431  C  CE1 . HIS F  1 43  ? 36.644  12.661  4.641   1.00 10.75  ? 43  HIS F CE1 1 
ATOM   6432  N  NE2 . HIS F  1 43  ? 35.925  12.415  5.722   1.00 10.18  ? 43  HIS F NE2 1 
ATOM   6433  N  N   . GLU F  1 44  ? 31.358  14.340  3.855   1.00 5.23   ? 44  GLU F N   1 
ATOM   6434  C  CA  . GLU F  1 44  ? 30.362  13.317  4.100   1.00 6.85   ? 44  GLU F CA  1 
ATOM   6435  C  C   . GLU F  1 44  ? 29.587  12.993  2.839   1.00 8.74   ? 44  GLU F C   1 
ATOM   6436  O  O   . GLU F  1 44  ? 29.280  11.812  2.608   1.00 9.28   ? 44  GLU F O   1 
ATOM   6437  C  CB  . GLU F  1 44  ? 29.439  13.750  5.246   1.00 8.90   ? 44  GLU F CB  1 
ATOM   6438  C  CG  . GLU F  1 44  ? 30.179  14.005  6.549   1.00 78.36  ? 44  GLU F CG  1 
ATOM   6439  C  CD  . GLU F  1 44  ? 29.396  14.828  7.528   0.00 100.00 ? 44  GLU F CD  1 
ATOM   6440  O  OE1 . GLU F  1 44  ? 28.190  15.055  7.331   0.00 100.00 ? 44  GLU F OE1 1 
ATOM   6441  O  OE2 . GLU F  1 44  ? 30.006  15.294  8.502   0.00 100.00 ? 44  GLU F OE2 1 
ATOM   6442  N  N   . LYS F  1 45  ? 29.281  14.003  2.022   1.00 3.28   ? 45  LYS F N   1 
ATOM   6443  C  CA  . LYS F  1 45  ? 28.544  13.718  0.790   1.00 2.67   ? 45  LYS F CA  1 
ATOM   6444  C  C   . LYS F  1 45  ? 29.286  12.709  -0.120  1.00 3.77   ? 45  LYS F C   1 
ATOM   6445  O  O   . LYS F  1 45  ? 28.676  11.847  -0.766  1.00 4.67   ? 45  LYS F O   1 
ATOM   6446  C  CB  . LYS F  1 45  ? 28.311  15.031  0.046   1.00 7.07   ? 45  LYS F CB  1 
ATOM   6447  C  CG  . LYS F  1 45  ? 27.205  14.915  -0.973  1.00 28.45  ? 45  LYS F CG  1 
ATOM   6448  C  CD  . LYS F  1 45  ? 25.869  14.940  -0.238  1.00 53.20  ? 45  LYS F CD  1 
ATOM   6449  C  CE  . LYS F  1 45  ? 24.742  14.237  -1.007  1.00 91.48  ? 45  LYS F CE  1 
ATOM   6450  N  NZ  . LYS F  1 45  ? 24.336  14.787  -2.337  1.00 78.36  ? 45  LYS F NZ  1 
ATOM   6451  N  N   . MET F  1 46  ? 30.620  12.776  -0.131  1.00 1.68   ? 46  MET F N   1 
ATOM   6452  C  CA  . MET F  1 46  ? 31.423  11.889  -0.942  1.00 1.00   ? 46  MET F CA  1 
ATOM   6453  C  C   . MET F  1 46  ? 31.295  10.457  -0.445  1.00 7.56   ? 46  MET F C   1 
ATOM   6454  O  O   . MET F  1 46  ? 31.353  9.511   -1.222  1.00 12.91  ? 46  MET F O   1 
ATOM   6455  C  CB  . MET F  1 46  ? 32.884  12.326  -0.930  1.00 1.00   ? 46  MET F CB  1 
ATOM   6456  C  CG  . MET F  1 46  ? 33.098  13.674  -1.622  1.00 2.91   ? 46  MET F CG  1 
ATOM   6457  S  SD  . MET F  1 46  ? 32.371  13.619  -3.320  1.00 10.97  ? 46  MET F SD  1 
ATOM   6458  C  CE  . MET F  1 46  ? 30.778  14.577  -3.132  1.00 2.68   ? 46  MET F CE  1 
ATOM   6459  N  N   . ASP F  1 47  ? 31.131  10.290  0.864   1.00 5.27   ? 47  ASP F N   1 
ATOM   6460  C  CA  . ASP F  1 47  ? 30.990  8.956   1.438   1.00 8.55   ? 47  ASP F CA  1 
ATOM   6461  C  C   . ASP F  1 47  ? 29.690  8.377   0.931   1.00 7.94   ? 47  ASP F C   1 
ATOM   6462  O  O   . ASP F  1 47  ? 29.612  7.200   0.585   1.00 10.62  ? 47  ASP F O   1 
ATOM   6463  C  CB  . ASP F  1 47  ? 31.058  8.925   2.971   1.00 16.02  ? 47  ASP F CB  1 
ATOM   6464  C  CG  . ASP F  1 47  ? 32.486  8.674   3.505   1.00 77.55  ? 47  ASP F CG  1 
ATOM   6465  O  OD1 . ASP F  1 47  ? 33.313  8.227   2.712   1.00 89.75  ? 47  ASP F OD1 1 
ATOM   6466  O  OD2 . ASP F  1 47  ? 32.650  8.846   4.676   1.00 98.82  ? 47  ASP F OD2 1 
ATOM   6467  N  N   . ASP F  1 48  ? 28.695  9.247   0.773   1.00 4.55   ? 48  ASP F N   1 
ATOM   6468  C  CA  . ASP F  1 48  ? 27.399  8.818   0.244   1.00 8.43   ? 48  ASP F CA  1 
ATOM   6469  C  C   . ASP F  1 48  ? 27.468  8.425   -1.233  1.00 11.28  ? 48  ASP F C   1 
ATOM   6470  O  O   . ASP F  1 48  ? 26.864  7.416   -1.640  1.00 8.65   ? 48  ASP F O   1 
ATOM   6471  C  CB  . ASP F  1 48  ? 26.325  9.884   0.509   1.00 14.33  ? 48  ASP F CB  1 
ATOM   6472  C  CG  . ASP F  1 48  ? 26.081  10.146  2.037   1.00 52.20  ? 48  ASP F CG  1 
ATOM   6473  O  OD1 . ASP F  1 48  ? 26.386  9.276   2.897   1.00 54.96  ? 48  ASP F OD1 1 
ATOM   6474  O  OD2 . ASP F  1 48  ? 25.565  11.232  2.396   1.00 81.40  ? 48  ASP F OD2 1 
ATOM   6475  N  N   . LEU F  1 49  ? 28.211  9.226   -1.999  1.00 5.50   ? 49  LEU F N   1 
ATOM   6476  C  CA  . LEU F  1 49  ? 28.381  8.959   -3.418  1.00 4.31   ? 49  LEU F CA  1 
ATOM   6477  C  C   . LEU F  1 49  ? 29.172  7.688   -3.616  1.00 1.24   ? 49  LEU F C   1 
ATOM   6478  O  O   . LEU F  1 49  ? 28.911  6.888   -4.517  1.00 5.46   ? 49  LEU F O   1 
ATOM   6479  C  CB  . LEU F  1 49  ? 29.119  10.118  -4.063  1.00 3.10   ? 49  LEU F CB  1 
ATOM   6480  C  CG  . LEU F  1 49  ? 28.300  10.940  -5.040  1.00 7.10   ? 49  LEU F CG  1 
ATOM   6481  C  CD1 . LEU F  1 49  ? 27.010  11.313  -4.403  1.00 1.41   ? 49  LEU F CD1 1 
ATOM   6482  C  CD2 . LEU F  1 49  ? 29.147  12.151  -5.286  1.00 9.13   ? 49  LEU F CD2 1 
ATOM   6483  N  N   . TYR F  1 50  ? 30.144  7.509   -2.739  1.00 1.00   ? 50  TYR F N   1 
ATOM   6484  C  CA  . TYR F  1 50  ? 30.994  6.344   -2.852  1.00 1.53   ? 50  TYR F CA  1 
ATOM   6485  C  C   . TYR F  1 50  ? 30.145  5.109   -2.690  1.00 8.10   ? 50  TYR F C   1 
ATOM   6486  O  O   . TYR F  1 50  ? 30.270  4.132   -3.422  1.00 9.80   ? 50  TYR F O   1 
ATOM   6487  C  CB  . TYR F  1 50  ? 32.057  6.367   -1.744  1.00 3.71   ? 50  TYR F CB  1 
ATOM   6488  C  CG  . TYR F  1 50  ? 33.034  5.229   -1.859  1.00 10.68  ? 50  TYR F CG  1 
ATOM   6489  C  CD1 . TYR F  1 50  ? 34.176  5.354   -2.668  1.00 17.85  ? 50  TYR F CD1 1 
ATOM   6490  C  CD2 . TYR F  1 50  ? 32.796  3.980   -1.274  1.00 12.53  ? 50  TYR F CD2 1 
ATOM   6491  C  CE1 . TYR F  1 50  ? 35.103  4.282   -2.848  1.00 22.53  ? 50  TYR F CE1 1 
ATOM   6492  C  CE2 . TYR F  1 50  ? 33.702  2.910   -1.474  1.00 28.28  ? 50  TYR F CE2 1 
ATOM   6493  C  CZ  . TYR F  1 50  ? 34.861  3.062   -2.240  1.00 37.70  ? 50  TYR F CZ  1 
ATOM   6494  O  OH  . TYR F  1 50  ? 35.777  2.053   -2.425  1.00 31.88  ? 50  TYR F OH  1 
ATOM   6495  N  N   . SER F  1 51  ? 29.287  5.106   -1.691  1.00 4.05   ? 51  SER F N   1 
ATOM   6496  C  CA  . SER F  1 51  ? 28.461  3.924   -1.479  1.00 6.95   ? 51  SER F CA  1 
ATOM   6497  C  C   . SER F  1 51  ? 27.452  3.700   -2.593  1.00 4.55   ? 51  SER F C   1 
ATOM   6498  O  O   . SER F  1 51  ? 27.157  2.602   -3.056  1.00 4.61   ? 51  SER F O   1 
ATOM   6499  C  CB  . SER F  1 51  ? 27.738  4.010   -0.123  1.00 5.84   ? 51  SER F CB  1 
ATOM   6500  O  OG  . SER F  1 51  ? 28.683  4.122   0.927   1.00 55.78  ? 51  SER F OG  1 
ATOM   6501  N  N   . GLU F  1 52  ? 26.901  4.815   -3.030  1.00 1.00   ? 52  GLU F N   1 
ATOM   6502  C  CA  . GLU F  1 52  ? 25.899  4.691   -4.067  1.00 1.48   ? 52  GLU F CA  1 
ATOM   6503  C  C   . GLU F  1 52  ? 26.469  4.143   -5.372  1.00 5.36   ? 52  GLU F C   1 
ATOM   6504  O  O   . GLU F  1 52  ? 26.005  3.160   -5.939  1.00 4.88   ? 52  GLU F O   1 
ATOM   6505  C  CB  . GLU F  1 52  ? 25.231  6.041   -4.295  1.00 2.03   ? 52  GLU F CB  1 
ATOM   6506  C  CG  . GLU F  1 52  ? 24.350  5.973   -5.525  1.00 17.89  ? 52  GLU F CG  1 
ATOM   6507  C  CD  . GLU F  1 52  ? 23.509  7.211   -5.796  1.00 55.02  ? 52  GLU F CD  1 
ATOM   6508  O  OE1 . GLU F  1 52  ? 23.771  8.262   -5.188  1.00 20.68  ? 52  GLU F OE1 1 
ATOM   6509  O  OE2 . GLU F  1 52  ? 22.544  7.090   -6.579  1.00 27.40  ? 52  GLU F OE2 1 
ATOM   6510  N  N   . PHE F  1 53  ? 27.519  4.762   -5.875  1.00 2.24   ? 53  PHE F N   1 
ATOM   6511  C  CA  . PHE F  1 53  ? 28.073  4.257   -7.120  1.00 1.52   ? 53  PHE F CA  1 
ATOM   6512  C  C   . PHE F  1 53  ? 28.656  2.845   -7.031  1.00 5.31   ? 53  PHE F C   1 
ATOM   6513  O  O   . PHE F  1 53  ? 28.611  2.004   -7.933  1.00 4.34   ? 53  PHE F O   1 
ATOM   6514  C  CB  . PHE F  1 53  ? 28.911  5.365   -7.728  1.00 1.00   ? 53  PHE F CB  1 
ATOM   6515  C  CG  . PHE F  1 53  ? 28.030  6.461   -8.264  1.00 3.12   ? 53  PHE F CG  1 
ATOM   6516  C  CD1 . PHE F  1 53  ? 27.420  6.334   -9.509  1.00 1.00   ? 53  PHE F CD1 1 
ATOM   6517  C  CD2 . PHE F  1 53  ? 27.674  7.524   -7.453  1.00 3.56   ? 53  PHE F CD2 1 
ATOM   6518  C  CE1 . PHE F  1 53  ? 26.608  7.336   -9.984  1.00 6.71   ? 53  PHE F CE1 1 
ATOM   6519  C  CE2 . PHE F  1 53  ? 26.851  8.517   -7.914  1.00 2.98   ? 53  PHE F CE2 1 
ATOM   6520  C  CZ  . PHE F  1 53  ? 26.321  8.437   -9.180  1.00 6.83   ? 53  PHE F CZ  1 
ATOM   6521  N  N   . GLY F  1 54  ? 29.071  2.527   -5.808  1.00 3.45   ? 54  GLY F N   1 
ATOM   6522  C  CA  . GLY F  1 54  ? 29.648  1.214   -5.522  1.00 1.72   ? 54  GLY F CA  1 
ATOM   6523  C  C   . GLY F  1 54  ? 28.528  0.234   -5.697  1.00 6.52   ? 54  GLY F C   1 
ATOM   6524  O  O   . GLY F  1 54  ? 28.746  -0.846  -6.234  1.00 7.75   ? 54  GLY F O   1 
ATOM   6525  N  N   . GLU F  1 55  ? 27.345  0.624   -5.260  1.00 2.46   ? 55  GLU F N   1 
ATOM   6526  C  CA  . GLU F  1 55  ? 26.268  -0.349  -5.444  1.00 7.38   ? 55  GLU F CA  1 
ATOM   6527  C  C   . GLU F  1 55  ? 25.879  -0.400  -6.937  1.00 9.04   ? 55  GLU F C   1 
ATOM   6528  O  O   . GLU F  1 55  ? 25.555  -1.494  -7.407  1.00 13.02  ? 55  GLU F O   1 
ATOM   6529  C  CB  . GLU F  1 55  ? 24.989  -0.073  -4.595  1.00 12.91  ? 55  GLU F CB  1 
ATOM   6530  C  CG  . GLU F  1 55  ? 25.046  -0.215  -3.082  1.00 68.07  ? 55  GLU F CG  1 
ATOM   6531  C  CD  . GLU F  1 55  ? 23.754  0.147   -2.400  0.00 100.00 ? 55  GLU F CD  1 
ATOM   6532  O  OE1 . GLU F  1 55  ? 22.801  0.615   -3.064  0.00 100.00 ? 55  GLU F OE1 1 
ATOM   6533  O  OE2 . GLU F  1 55  ? 23.683  0.032   -1.158  0.00 100.00 ? 55  GLU F OE2 1 
ATOM   6534  N  N   . GLN F  1 56  ? 25.857  0.725   -7.664  1.00 5.41   ? 56  GLN F N   1 
ATOM   6535  C  CA  . GLN F  1 56  ? 25.475  0.709   -9.083  1.00 4.59   ? 56  GLN F CA  1 
ATOM   6536  C  C   . GLN F  1 56  ? 26.401  -0.290  -9.750  1.00 4.21   ? 56  GLN F C   1 
ATOM   6537  O  O   . GLN F  1 56  ? 25.989  -1.136  -10.566 1.00 3.30   ? 56  GLN F O   1 
ATOM   6538  C  CB  . GLN F  1 56  ? 25.731  2.046   -9.781  1.00 5.46   ? 56  GLN F CB  1 
ATOM   6539  C  CG  . GLN F  1 56  ? 24.584  3.000   -9.594  1.00 16.65  ? 56  GLN F CG  1 
ATOM   6540  C  CD  . GLN F  1 56  ? 24.644  4.158   -10.558 1.00 27.48  ? 56  GLN F CD  1 
ATOM   6541  O  OE1 . GLN F  1 56  ? 25.386  4.129   -11.549 1.00 13.22  ? 56  GLN F OE1 1 
ATOM   6542  N  NE2 . GLN F  1 56  ? 23.847  5.183   -10.278 1.00 12.03  ? 56  GLN F NE2 1 
ATOM   6543  N  N   . MET F  1 57  ? 27.655  -0.150  -9.346  1.00 1.00   ? 57  MET F N   1 
ATOM   6544  C  CA  . MET F  1 57  ? 28.699  -0.987  -9.880  1.00 1.16   ? 57  MET F CA  1 
ATOM   6545  C  C   . MET F  1 57  ? 28.435  -2.467  -9.682  1.00 4.35   ? 57  MET F C   1 
ATOM   6546  O  O   . MET F  1 57  ? 28.403  -3.225  -10.648 1.00 12.28  ? 57  MET F O   1 
ATOM   6547  C  CB  . MET F  1 57  ? 30.022  -0.564  -9.241  1.00 4.35   ? 57  MET F CB  1 
ATOM   6548  C  CG  . MET F  1 57  ? 31.240  -0.996  -10.019 1.00 10.11  ? 57  MET F CG  1 
ATOM   6549  S  SD  . MET F  1 57  ? 31.609  -2.660  -9.627  1.00 16.38  ? 57  MET F SD  1 
ATOM   6550  C  CE  . MET F  1 57  ? 32.433  -2.343  -8.033  1.00 8.50   ? 57  MET F CE  1 
ATOM   6551  N  N   . ASP F  1 58  ? 28.162  -2.870  -8.447  1.00 2.49   ? 58  ASP F N   1 
ATOM   6552  C  CA  . ASP F  1 58  ? 27.890  -4.285  -8.223  1.00 2.38   ? 58  ASP F CA  1 
ATOM   6553  C  C   . ASP F  1 58  ? 26.657  -4.742  -9.002  1.00 3.19   ? 58  ASP F C   1 
ATOM   6554  O  O   . ASP F  1 58  ? 26.646  -5.834  -9.568  1.00 3.91   ? 58  ASP F O   1 
ATOM   6555  C  CB  . ASP F  1 58  ? 27.750  -4.631  -6.723  1.00 5.69   ? 58  ASP F CB  1 
ATOM   6556  C  CG  . ASP F  1 58  ? 27.939  -6.136  -6.431  1.00 15.87  ? 58  ASP F CG  1 
ATOM   6557  O  OD1 . ASP F  1 58  ? 28.983  -6.748  -6.763  1.00 22.23  ? 58  ASP F OD1 1 
ATOM   6558  O  OD2 . ASP F  1 58  ? 27.085  -6.726  -5.745  1.00 19.88  ? 58  ASP F OD2 1 
ATOM   6559  N  N   . GLU F  1 59  ? 25.623  -3.907  -9.033  1.00 3.74   ? 59  GLU F N   1 
ATOM   6560  C  CA  . GLU F  1 59  ? 24.398  -4.223  -9.783  1.00 5.27   ? 59  GLU F CA  1 
ATOM   6561  C  C   . GLU F  1 59  ? 24.577  -4.375  -11.293 1.00 4.73   ? 59  GLU F C   1 
ATOM   6562  O  O   . GLU F  1 59  ? 23.996  -5.240  -11.931 1.00 3.48   ? 59  GLU F O   1 
ATOM   6563  C  CB  . GLU F  1 59  ? 23.278  -3.194  -9.551  1.00 8.25   ? 59  GLU F CB  1 
ATOM   6564  C  CG  . GLU F  1 59  ? 22.648  -3.148  -8.173  1.00 47.51  ? 59  GLU F CG  1 
ATOM   6565  C  CD  . GLU F  1 59  ? 21.494  -2.172  -8.072  1.00 99.86  ? 59  GLU F CD  1 
ATOM   6566  O  OE1 . GLU F  1 59  ? 20.701  -2.089  -9.031  0.00 100.00 ? 59  GLU F OE1 1 
ATOM   6567  O  OE2 . GLU F  1 59  ? 21.322  -1.542  -7.008  0.00 100.00 ? 59  GLU F OE2 1 
ATOM   6568  N  N   . VAL F  1 60  ? 25.376  -3.491  -11.857 1.00 3.76   ? 60  VAL F N   1 
ATOM   6569  C  CA  . VAL F  1 60  ? 25.624  -3.578  -13.276 1.00 1.38   ? 60  VAL F CA  1 
ATOM   6570  C  C   . VAL F  1 60  ? 26.339  -4.904  -13.454 1.00 4.21   ? 60  VAL F C   1 
ATOM   6571  O  O   . VAL F  1 60  ? 25.966  -5.730  -14.270 1.00 6.49   ? 60  VAL F O   1 
ATOM   6572  C  CB  . VAL F  1 60  ? 26.541  -2.392  -13.610 1.00 4.85   ? 60  VAL F CB  1 
ATOM   6573  C  CG1 . VAL F  1 60  ? 27.199  -2.582  -14.963 1.00 2.64   ? 60  VAL F CG1 1 
ATOM   6574  C  CG2 . VAL F  1 60  ? 25.694  -1.108  -13.580 1.00 1.69   ? 60  VAL F CG2 1 
ATOM   6575  N  N   . ALA F  1 61  ? 27.329  -5.153  -12.617 1.00 1.55   ? 61  ALA F N   1 
ATOM   6576  C  CA  . ALA F  1 61  ? 28.109  -6.350  -12.848 1.00 1.51   ? 61  ALA F CA  1 
ATOM   6577  C  C   . ALA F  1 61  ? 27.221  -7.546  -12.724 1.00 8.12   ? 61  ALA F C   1 
ATOM   6578  O  O   . ALA F  1 61  ? 27.246  -8.487  -13.499 1.00 8.81   ? 61  ALA F O   1 
ATOM   6579  C  CB  . ALA F  1 61  ? 29.320  -6.419  -11.928 1.00 1.81   ? 61  ALA F CB  1 
ATOM   6580  N  N   . GLU F  1 62  ? 26.412  -7.513  -11.700 1.00 2.85   ? 62  GLU F N   1 
ATOM   6581  C  CA  . GLU F  1 62  ? 25.614  -8.719  -11.553 1.00 3.07   ? 62  GLU F CA  1 
ATOM   6582  C  C   . GLU F  1 62  ? 24.564  -8.870  -12.651 1.00 7.67   ? 62  GLU F C   1 
ATOM   6583  O  O   . GLU F  1 62  ? 24.183  -9.970  -13.001 1.00 6.72   ? 62  GLU F O   1 
ATOM   6584  C  CB  . GLU F  1 62  ? 25.117  -8.877  -10.106 1.00 2.76   ? 62  GLU F CB  1 
ATOM   6585  C  CG  . GLU F  1 62  ? 26.245  -9.011  -9.061  1.00 9.57   ? 62  GLU F CG  1 
ATOM   6586  C  CD  . GLU F  1 62  ? 25.795  -9.058  -7.577  1.00 11.37  ? 62  GLU F CD  1 
ATOM   6587  O  OE1 . GLU F  1 62  ? 24.589  -8.863  -7.242  1.00 42.10  ? 62  GLU F OE1 1 
ATOM   6588  O  OE2 . GLU F  1 62  ? 26.735  -9.267  -6.757  1.00 22.64  ? 62  GLU F OE2 1 
ATOM   6589  N  N   . ARG F  1 63  ? 24.103  -7.772  -13.227 1.00 2.44   ? 63  ARG F N   1 
ATOM   6590  C  CA  . ARG F  1 63  ? 23.114  -7.880  -14.283 1.00 3.37   ? 63  ARG F CA  1 
ATOM   6591  C  C   . ARG F  1 63  ? 23.841  -8.496  -15.467 1.00 8.42   ? 63  ARG F C   1 
ATOM   6592  O  O   . ARG F  1 63  ? 23.329  -9.384  -16.149 1.00 7.35   ? 63  ARG F O   1 
ATOM   6593  C  CB  . ARG F  1 63  ? 22.553  -6.504  -14.604 1.00 1.85   ? 63  ARG F CB  1 
ATOM   6594  C  CG  . ARG F  1 63  ? 21.631  -6.479  -15.811 1.00 1.00   ? 63  ARG F CG  1 
ATOM   6595  C  CD  . ARG F  1 63  ? 20.488  -7.492  -15.704 1.00 2.87   ? 63  ARG F CD  1 
ATOM   6596  N  NE  . ARG F  1 63  ? 19.655  -7.555  -16.906 1.00 5.82   ? 63  ARG F NE  1 
ATOM   6597  C  CZ  . ARG F  1 63  ? 18.755  -8.505  -17.161 1.00 7.26   ? 63  ARG F CZ  1 
ATOM   6598  N  NH1 . ARG F  1 63  ? 18.514  -9.490  -16.291 1.00 3.41   ? 63  ARG F NH1 1 
ATOM   6599  N  NH2 . ARG F  1 63  ? 18.071  -8.510  -18.297 1.00 1.39   ? 63  ARG F NH2 1 
ATOM   6600  N  N   . LEU F  1 64  ? 25.093  -8.099  -15.675 1.00 1.43   ? 64  LEU F N   1 
ATOM   6601  C  CA  . LEU F  1 64  ? 25.877  -8.650  -16.790 1.00 2.80   ? 64  LEU F CA  1 
ATOM   6602  C  C   . LEU F  1 64  ? 25.968  -10.138 -16.651 1.00 12.14  ? 64  LEU F C   1 
ATOM   6603  O  O   . LEU F  1 64  ? 25.715  -10.904 -17.574 1.00 12.09  ? 64  LEU F O   1 
ATOM   6604  C  CB  . LEU F  1 64  ? 27.297  -8.088  -16.763 1.00 1.61   ? 64  LEU F CB  1 
ATOM   6605  C  CG  . LEU F  1 64  ? 28.279  -8.593  -17.832 1.00 9.11   ? 64  LEU F CG  1 
ATOM   6606  C  CD1 . LEU F  1 64  ? 27.708  -8.471  -19.221 1.00 4.95   ? 64  LEU F CD1 1 
ATOM   6607  C  CD2 . LEU F  1 64  ? 29.548  -7.776  -17.751 1.00 2.43   ? 64  LEU F CD2 1 
ATOM   6608  N  N   . LEU F  1 65  ? 26.355  -10.513 -15.452 1.00 4.03   ? 65  LEU F N   1 
ATOM   6609  C  CA  . LEU F  1 65  ? 26.511  -11.924 -15.162 1.00 2.59   ? 65  LEU F CA  1 
ATOM   6610  C  C   . LEU F  1 65  ? 25.192  -12.632 -15.466 1.00 8.70   ? 65  LEU F C   1 
ATOM   6611  O  O   . LEU F  1 65  ? 25.162  -13.688 -16.072 1.00 6.66   ? 65  LEU F O   1 
ATOM   6612  C  CB  . LEU F  1 65  ? 26.785  -11.912 -13.677 1.00 2.85   ? 65  LEU F CB  1 
ATOM   6613  C  CG  . LEU F  1 65  ? 27.867  -12.722 -12.985 1.00 10.62  ? 65  LEU F CG  1 
ATOM   6614  C  CD1 . LEU F  1 65  ? 29.083  -12.910 -13.829 1.00 1.00   ? 65  LEU F CD1 1 
ATOM   6615  C  CD2 . LEU F  1 65  ? 28.212  -11.824 -11.792 1.00 1.00   ? 65  LEU F CD2 1 
ATOM   6616  N  N   . ALA F  1 66  ? 24.073  -12.027 -15.078 1.00 6.34   ? 66  ALA F N   1 
ATOM   6617  C  CA  . ALA F  1 66  ? 22.795  -12.660 -15.265 1.00 4.48   ? 66  ALA F CA  1 
ATOM   6618  C  C   . ALA F  1 66  ? 22.404  -12.811 -16.720 1.00 11.71  ? 66  ALA F C   1 
ATOM   6619  O  O   . ALA F  1 66  ? 21.576  -13.653 -17.067 1.00 5.91   ? 66  ALA F O   1 
ATOM   6620  C  CB  . ALA F  1 66  ? 21.757  -11.866 -14.520 1.00 4.01   ? 66  ALA F CB  1 
ATOM   6621  N  N   . ILE F  1 67  ? 22.881  -11.900 -17.557 1.00 9.89   ? 67  ILE F N   1 
ATOM   6622  C  CA  . ILE F  1 67  ? 22.537  -12.025 -18.962 1.00 8.55   ? 67  ILE F CA  1 
ATOM   6623  C  C   . ILE F  1 67  ? 23.555  -12.884 -19.707 1.00 16.98  ? 67  ILE F C   1 
ATOM   6624  O  O   . ILE F  1 67  ? 23.655  -12.883 -20.925 1.00 14.64  ? 67  ILE F O   1 
ATOM   6625  C  CB  . ILE F  1 67  ? 22.330  -10.697 -19.679 1.00 7.60   ? 67  ILE F CB  1 
ATOM   6626  C  CG1 . ILE F  1 67  ? 23.642  -9.927  -19.738 1.00 5.40   ? 67  ILE F CG1 1 
ATOM   6627  C  CG2 . ILE F  1 67  ? 21.068  -9.974  -19.162 1.00 3.37   ? 67  ILE F CG2 1 
ATOM   6628  C  CD1 . ILE F  1 67  ? 23.494  -8.569  -20.383 1.00 28.18  ? 67  ILE F CD1 1 
ATOM   6629  N  N   . GLY F  1 68  ? 24.327  -13.646 -18.948 1.00 8.16   ? 68  GLY F N   1 
ATOM   6630  C  CA  . GLY F  1 68  ? 25.364  -14.493 -19.524 1.00 1.26   ? 68  GLY F CA  1 
ATOM   6631  C  C   . GLY F  1 68  ? 26.726  -13.826 -19.828 1.00 12.05  ? 68  GLY F C   1 
ATOM   6632  O  O   . GLY F  1 68  ? 27.562  -14.420 -20.494 1.00 19.21  ? 68  GLY F O   1 
ATOM   6633  N  N   . GLY F  1 69  ? 26.985  -12.626 -19.331 1.00 8.00   ? 69  GLY F N   1 
ATOM   6634  C  CA  . GLY F  1 69  ? 28.258  -11.950 -19.530 1.00 1.61   ? 69  GLY F CA  1 
ATOM   6635  C  C   . GLY F  1 69  ? 29.314  -12.285 -18.470 1.00 6.60   ? 69  GLY F C   1 
ATOM   6636  O  O   . GLY F  1 69  ? 29.058  -13.051 -17.545 1.00 6.29   ? 69  GLY F O   1 
ATOM   6637  N  N   . SER F  1 70  ? 30.481  -11.648 -18.587 1.00 4.95   ? 70  SER F N   1 
ATOM   6638  C  CA  . SER F  1 70  ? 31.588  -11.826 -17.660 1.00 7.81   ? 70  SER F CA  1 
ATOM   6639  C  C   . SER F  1 70  ? 32.250  -10.479 -17.378 1.00 16.05  ? 70  SER F C   1 
ATOM   6640  O  O   . SER F  1 70  ? 32.999  -9.945  -18.183 1.00 21.01  ? 70  SER F O   1 
ATOM   6641  C  CB  . SER F  1 70  ? 32.590  -12.770 -18.321 1.00 12.13  ? 70  SER F CB  1 
ATOM   6642  O  OG  . SER F  1 70  ? 32.003  -14.058 -18.514 1.00 33.62  ? 70  SER F OG  1 
ATOM   6643  N  N   . PRO F  1 71  ? 31.975  -9.914  -16.210 1.00 13.83  ? 71  PRO F N   1 
ATOM   6644  C  CA  . PRO F  1 71  ? 32.502  -8.588  -15.896 1.00 10.59  ? 71  PRO F CA  1 
ATOM   6645  C  C   . PRO F  1 71  ? 34.001  -8.530  -15.735 1.00 8.63   ? 71  PRO F C   1 
ATOM   6646  O  O   . PRO F  1 71  ? 34.622  -9.451  -15.219 1.00 3.75   ? 71  PRO F O   1 
ATOM   6647  C  CB  . PRO F  1 71  ? 31.860  -8.287  -14.541 1.00 9.43   ? 71  PRO F CB  1 
ATOM   6648  C  CG  . PRO F  1 71  ? 31.677  -9.639  -13.930 1.00 14.15  ? 71  PRO F CG  1 
ATOM   6649  C  CD  . PRO F  1 71  ? 31.268  -10.513 -15.066 1.00 6.92   ? 71  PRO F CD  1 
ATOM   6650  N  N   . PHE F  1 72  ? 34.546  -7.382  -16.114 1.00 7.58   ? 72  PHE F N   1 
ATOM   6651  C  CA  . PHE F  1 72  ? 35.964  -7.134  -15.895 1.00 4.94   ? 72  PHE F CA  1 
ATOM   6652  C  C   . PHE F  1 72  ? 36.111  -7.193  -14.378 1.00 13.83  ? 72  PHE F C   1 
ATOM   6653  O  O   . PHE F  1 72  ? 35.202  -6.835  -13.625 1.00 10.43  ? 72  PHE F O   1 
ATOM   6654  C  CB  . PHE F  1 72  ? 36.369  -5.730  -16.301 1.00 5.25   ? 72  PHE F CB  1 
ATOM   6655  C  CG  . PHE F  1 72  ? 36.237  -5.459  -17.773 1.00 8.62   ? 72  PHE F CG  1 
ATOM   6656  C  CD1 . PHE F  1 72  ? 36.807  -6.312  -18.702 1.00 14.92  ? 72  PHE F CD1 1 
ATOM   6657  C  CD2 . PHE F  1 72  ? 35.553  -4.340  -18.228 1.00 10.19  ? 72  PHE F CD2 1 
ATOM   6658  C  CE1 . PHE F  1 72  ? 36.702  -6.037  -20.081 1.00 18.78  ? 72  PHE F CE1 1 
ATOM   6659  C  CE2 . PHE F  1 72  ? 35.432  -4.049  -19.575 1.00 12.32  ? 72  PHE F CE2 1 
ATOM   6660  C  CZ  . PHE F  1 72  ? 36.009  -4.895  -20.501 1.00 13.72  ? 72  PHE F CZ  1 
ATOM   6661  N  N   . SER F  1 73  ? 37.293  -7.542  -13.904 1.00 5.98   ? 73  SER F N   1 
ATOM   6662  C  CA  . SER F  1 73  ? 37.411  -7.676  -12.475 1.00 2.11   ? 73  SER F CA  1 
ATOM   6663  C  C   . SER F  1 73  ? 38.819  -7.582  -11.998 1.00 8.36   ? 73  SER F C   1 
ATOM   6664  O  O   . SER F  1 73  ? 39.203  -8.364  -11.135 1.00 7.19   ? 73  SER F O   1 
ATOM   6665  C  CB  . SER F  1 73  ? 36.802  -9.011  -12.078 1.00 5.37   ? 73  SER F CB  1 
ATOM   6666  O  OG  . SER F  1 73  ? 37.483  -10.070 -12.696 1.00 11.02  ? 73  SER F OG  1 
ATOM   6667  N  N   . THR F  1 74  ? 39.553  -6.604  -12.533 1.00 3.58   ? 74  THR F N   1 
ATOM   6668  C  CA  . THR F  1 74  ? 40.919  -6.298  -12.128 1.00 3.56   ? 74  THR F CA  1 
ATOM   6669  C  C   . THR F  1 74  ? 41.102  -4.814  -12.428 1.00 7.36   ? 74  THR F C   1 
ATOM   6670  O  O   . THR F  1 74  ? 40.425  -4.296  -13.320 1.00 11.61  ? 74  THR F O   1 
ATOM   6671  C  CB  . THR F  1 74  ? 41.961  -7.042  -12.960 1.00 10.12  ? 74  THR F CB  1 
ATOM   6672  O  OG1 . THR F  1 74  ? 41.801  -6.701  -14.342 1.00 12.20  ? 74  THR F OG1 1 
ATOM   6673  C  CG2 . THR F  1 74  ? 41.875  -8.560  -12.711 1.00 5.77   ? 74  THR F CG2 1 
ATOM   6674  N  N   . LEU F  1 75  ? 41.963  -4.119  -11.683 1.00 4.13   ? 75  LEU F N   1 
ATOM   6675  C  CA  . LEU F  1 75  ? 42.192  -2.698  -11.953 1.00 6.70   ? 75  LEU F CA  1 
ATOM   6676  C  C   . LEU F  1 75  ? 42.750  -2.588  -13.357 1.00 11.62  ? 75  LEU F C   1 
ATOM   6677  O  O   . LEU F  1 75  ? 42.460  -1.643  -14.069 1.00 16.30  ? 75  LEU F O   1 
ATOM   6678  C  CB  . LEU F  1 75  ? 43.247  -2.077  -11.031 1.00 7.77   ? 75  LEU F CB  1 
ATOM   6679  C  CG  . LEU F  1 75  ? 42.779  -1.858  -9.584  1.00 14.66  ? 75  LEU F CG  1 
ATOM   6680  C  CD1 . LEU F  1 75  ? 42.383  -3.205  -8.992  1.00 17.31  ? 75  LEU F CD1 1 
ATOM   6681  C  CD2 . LEU F  1 75  ? 43.851  -1.206  -8.710  1.00 8.82   ? 75  LEU F CD2 1 
ATOM   6682  N  N   . LYS F  1 76  ? 43.601  -3.537  -13.722 1.00 10.35  ? 76  LYS F N   1 
ATOM   6683  C  CA  . LYS F  1 76  ? 44.147  -3.473  -15.062 1.00 10.57  ? 76  LYS F CA  1 
ATOM   6684  C  C   . LYS F  1 76  ? 43.033  -3.428  -16.108 1.00 10.09  ? 76  LYS F C   1 
ATOM   6685  O  O   . LYS F  1 76  ? 42.985  -2.506  -16.924 1.00 10.31  ? 76  LYS F O   1 
ATOM   6686  C  CB  . LYS F  1 76  ? 45.079  -4.653  -15.299 1.00 15.41  ? 76  LYS F CB  1 
ATOM   6687  C  CG  . LYS F  1 76  ? 45.717  -4.619  -16.703 1.00 50.57  ? 76  LYS F CG  1 
ATOM   6688  C  CD  . LYS F  1 76  ? 46.853  -5.611  -16.792 1.00 99.44  ? 76  LYS F CD  1 
ATOM   6689  C  CE  . LYS F  1 76  ? 47.455  -5.706  -18.175 0.00 100.00 ? 76  LYS F CE  1 
ATOM   6690  N  NZ  . LYS F  1 76  ? 46.534  -6.377  -19.123 0.00 100.00 ? 76  LYS F NZ  1 
ATOM   6691  N  N   . GLU F  1 77  ? 42.094  -4.361  -16.015 1.00 7.03   ? 77  GLU F N   1 
ATOM   6692  C  CA  . GLU F  1 77  ? 40.978  -4.315  -16.945 1.00 6.97   ? 77  GLU F CA  1 
ATOM   6693  C  C   . GLU F  1 77  ? 40.193  -3.029  -16.896 1.00 10.38  ? 77  GLU F C   1 
ATOM   6694  O  O   . GLU F  1 77  ? 39.775  -2.495  -17.923 1.00 10.24  ? 77  GLU F O   1 
ATOM   6695  C  CB  . GLU F  1 77  ? 39.993  -5.456  -16.765 1.00 7.99   ? 77  GLU F CB  1 
ATOM   6696  C  CG  . GLU F  1 77  ? 40.613  -6.781  -17.149 1.00 11.57  ? 77  GLU F CG  1 
ATOM   6697  C  CD  . GLU F  1 77  ? 39.756  -7.955  -16.697 1.00 35.20  ? 77  GLU F CD  1 
ATOM   6698  O  OE1 . GLU F  1 77  ? 39.689  -8.172  -15.453 1.00 28.91  ? 77  GLU F OE1 1 
ATOM   6699  O  OE2 . GLU F  1 77  ? 39.167  -8.661  -17.561 1.00 31.00  ? 77  GLU F OE2 1 
ATOM   6700  N  N   . PHE F  1 78  ? 39.991  -2.546  -15.676 1.00 8.00   ? 78  PHE F N   1 
ATOM   6701  C  CA  . PHE F  1 78  ? 39.224  -1.324  -15.510 1.00 7.76   ? 78  PHE F CA  1 
ATOM   6702  C  C   . PHE F  1 78  ? 39.905  -0.173  -16.228 1.00 12.83  ? 78  PHE F C   1 
ATOM   6703  O  O   . PHE F  1 78  ? 39.251  0.590   -16.950 1.00 13.45  ? 78  PHE F O   1 
ATOM   6704  C  CB  . PHE F  1 78  ? 38.945  -0.945  -14.044 1.00 6.44   ? 78  PHE F CB  1 
ATOM   6705  C  CG  . PHE F  1 78  ? 38.230  -1.997  -13.240 1.00 4.61   ? 78  PHE F CG  1 
ATOM   6706  C  CD1 . PHE F  1 78  ? 37.358  -2.885  -13.854 1.00 4.48   ? 78  PHE F CD1 1 
ATOM   6707  C  CD2 . PHE F  1 78  ? 38.481  -2.124  -11.880 1.00 3.16   ? 78  PHE F CD2 1 
ATOM   6708  C  CE1 . PHE F  1 78  ? 36.707  -3.842  -13.108 1.00 7.44   ? 78  PHE F CE1 1 
ATOM   6709  C  CE2 . PHE F  1 78  ? 37.860  -3.097  -11.154 1.00 1.19   ? 78  PHE F CE2 1 
ATOM   6710  C  CZ  . PHE F  1 78  ? 36.970  -3.951  -11.752 1.00 3.98   ? 78  PHE F CZ  1 
ATOM   6711  N  N   . LEU F  1 79  ? 41.211  -0.054  -15.982 1.00 8.13   ? 79  LEU F N   1 
ATOM   6712  C  CA  . LEU F  1 79  ? 42.011  1.011   -16.579 1.00 13.40  ? 79  LEU F CA  1 
ATOM   6713  C  C   . LEU F  1 79  ? 42.000  0.908   -18.099 1.00 21.52  ? 79  LEU F C   1 
ATOM   6714  O  O   . LEU F  1 79  ? 41.924  1.898   -18.824 1.00 18.45  ? 79  LEU F O   1 
ATOM   6715  C  CB  . LEU F  1 79  ? 43.448  0.900   -16.111 1.00 15.90  ? 79  LEU F CB  1 
ATOM   6716  C  CG  . LEU F  1 79  ? 43.545  1.672   -14.811 1.00 24.79  ? 79  LEU F CG  1 
ATOM   6717  C  CD1 . LEU F  1 79  ? 44.964  1.685   -14.276 1.00 19.51  ? 79  LEU F CD1 1 
ATOM   6718  C  CD2 . LEU F  1 79  ? 43.165  3.046   -15.298 1.00 27.62  ? 79  LEU F CD2 1 
ATOM   6719  N  N   . GLU F  1 80  ? 42.074  -0.332  -18.556 1.00 15.98  ? 80  GLU F N   1 
ATOM   6720  C  CA  . GLU F  1 80  ? 42.061  -0.554  -19.997 1.00 18.44  ? 80  GLU F CA  1 
ATOM   6721  C  C   . GLU F  1 80  ? 40.734  -0.191  -20.652 1.00 26.32  ? 80  GLU F C   1 
ATOM   6722  O  O   . GLU F  1 80  ? 40.724  0.215   -21.811 1.00 38.44  ? 80  GLU F O   1 
ATOM   6723  C  CB  . GLU F  1 80  ? 42.456  -1.984  -20.380 1.00 18.54  ? 80  GLU F CB  1 
ATOM   6724  C  CG  . GLU F  1 80  ? 43.855  -2.327  -19.912 1.00 62.97  ? 80  GLU F CG  1 
ATOM   6725  C  CD  . GLU F  1 80  ? 44.263  -3.738  -20.221 0.00 100.00 ? 80  GLU F CD  1 
ATOM   6726  O  OE1 . GLU F  1 80  ? 43.387  -4.582  -20.470 1.00 99.71  ? 80  GLU F OE1 1 
ATOM   6727  O  OE2 . GLU F  1 80  ? 45.480  -3.993  -20.206 0.00 100.00 ? 80  GLU F OE2 1 
ATOM   6728  N  N   . ASN F  1 81  ? 39.620  -0.406  -19.962 1.00 12.77  ? 81  ASN F N   1 
ATOM   6729  C  CA  . ASN F  1 81  ? 38.366  -0.128  -20.623 1.00 10.26  ? 81  ASN F CA  1 
ATOM   6730  C  C   . ASN F  1 81  ? 37.629  1.135   -20.300 1.00 14.21  ? 81  ASN F C   1 
ATOM   6731  O  O   . ASN F  1 81  ? 36.643  1.449   -20.949 1.00 18.83  ? 81  ASN F O   1 
ATOM   6732  C  CB  . ASN F  1 81  ? 37.477  -1.364  -20.543 1.00 14.31  ? 81  ASN F CB  1 
ATOM   6733  C  CG  . ASN F  1 81  ? 38.184  -2.607  -21.068 1.00 15.31  ? 81  ASN F CG  1 
ATOM   6734  O  OD1 . ASN F  1 81  ? 39.018  -3.185  -20.387 1.00 21.86  ? 81  ASN F OD1 1 
ATOM   6735  N  ND2 . ASN F  1 81  ? 37.884  -2.997  -22.298 1.00 15.44  ? 81  ASN F ND2 1 
ATOM   6736  N  N   . ALA F  1 82  ? 38.020  1.835   -19.249 1.00 13.52  ? 82  ALA F N   1 
ATOM   6737  C  CA  . ALA F  1 82  ? 37.223  2.982   -18.841 1.00 12.25  ? 82  ALA F CA  1 
ATOM   6738  C  C   . ALA F  1 82  ? 37.209  4.184   -19.753 1.00 16.28  ? 82  ALA F C   1 
ATOM   6739  O  O   . ALA F  1 82  ? 38.236  4.585   -20.265 1.00 20.08  ? 82  ALA F O   1 
ATOM   6740  C  CB  . ALA F  1 82  ? 37.646  3.432   -17.436 1.00 12.83  ? 82  ALA F CB  1 
ATOM   6741  N  N   . SER F  1 83  ? 36.079  4.869   -19.826 1.00 8.08   ? 83  SER F N   1 
ATOM   6742  C  CA  . SER F  1 83  ? 36.051  6.112   -20.573 1.00 4.96   ? 83  SER F CA  1 
ATOM   6743  C  C   . SER F  1 83  ? 36.227  7.222   -19.567 1.00 14.20  ? 83  SER F C   1 
ATOM   6744  O  O   . SER F  1 83  ? 36.592  8.337   -19.916 1.00 17.43  ? 83  SER F O   1 
ATOM   6745  C  CB  . SER F  1 83  ? 34.791  6.302   -21.417 1.00 3.37   ? 83  SER F CB  1 
ATOM   6746  O  OG  . SER F  1 83  ? 33.620  6.015   -20.699 1.00 25.21  ? 83  SER F OG  1 
ATOM   6747  N  N   . VAL F  1 84  ? 35.935  6.925   -18.311 1.00 12.41  ? 84  VAL F N   1 
ATOM   6748  C  CA  . VAL F  1 84  ? 36.123  7.920   -17.257 1.00 9.00   ? 84  VAL F CA  1 
ATOM   6749  C  C   . VAL F  1 84  ? 37.639  8.164   -17.050 1.00 12.97  ? 84  VAL F C   1 
ATOM   6750  O  O   . VAL F  1 84  ? 38.436  7.216   -17.006 1.00 12.16  ? 84  VAL F O   1 
ATOM   6751  C  CB  . VAL F  1 84  ? 35.501  7.389   -15.941 1.00 6.73   ? 84  VAL F CB  1 
ATOM   6752  C  CG1 . VAL F  1 84  ? 35.908  8.256   -14.770 1.00 5.82   ? 84  VAL F CG1 1 
ATOM   6753  C  CG2 . VAL F  1 84  ? 33.970  7.334   -16.038 1.00 3.81   ? 84  VAL F CG2 1 
ATOM   6754  N  N   . GLU F  1 85  ? 38.053  9.426   -16.965 1.00 19.80  ? 85  GLU F N   1 
ATOM   6755  C  CA  . GLU F  1 85  ? 39.470  9.769   -16.807 1.00 21.45  ? 85  GLU F CA  1 
ATOM   6756  C  C   . GLU F  1 85  ? 39.937  9.999   -15.384 1.00 18.62  ? 85  GLU F C   1 
ATOM   6757  O  O   . GLU F  1 85  ? 39.274  10.671  -14.592 1.00 22.96  ? 85  GLU F O   1 
ATOM   6758  C  CB  . GLU F  1 85  ? 39.786  11.087  -17.516 1.00 27.04  ? 85  GLU F CB  1 
ATOM   6759  C  CG  . GLU F  1 85  ? 39.833  10.996  -19.036 1.00 73.14  ? 85  GLU F CG  1 
ATOM   6760  C  CD  . GLU F  1 85  ? 40.816  9.973   -19.501 0.00 100.00 ? 85  GLU F CD  1 
ATOM   6761  O  OE1 . GLU F  1 85  ? 41.627  9.516   -18.676 0.00 100.00 ? 85  GLU F OE1 1 
ATOM   6762  O  OE2 . GLU F  1 85  ? 40.763  9.587   -20.688 0.00 100.00 ? 85  GLU F OE2 1 
ATOM   6763  N  N   . GLU F  1 86  ? 41.146  9.560   -15.073 1.00 13.01  ? 86  GLU F N   1 
ATOM   6764  C  CA  . GLU F  1 86  ? 41.578  9.816   -13.704 1.00 16.43  ? 86  GLU F CA  1 
ATOM   6765  C  C   . GLU F  1 86  ? 42.946  10.473  -13.683 1.00 19.71  ? 86  GLU F C   1 
ATOM   6766  O  O   . GLU F  1 86  ? 43.730  10.318  -14.617 1.00 21.02  ? 86  GLU F O   1 
ATOM   6767  C  CB  . GLU F  1 86  ? 41.668  8.507   -12.907 1.00 17.69  ? 86  GLU F CB  1 
ATOM   6768  C  CG  . GLU F  1 86  ? 42.641  7.477   -13.470 1.00 39.65  ? 86  GLU F CG  1 
ATOM   6769  C  CD  . GLU F  1 86  ? 43.067  6.385   -12.477 1.00 49.45  ? 86  GLU F CD  1 
ATOM   6770  O  OE1 . GLU F  1 86  ? 42.370  6.071   -11.473 1.00 29.05  ? 86  GLU F OE1 1 
ATOM   6771  O  OE2 . GLU F  1 86  ? 44.115  5.774   -12.768 1.00 25.00  ? 86  GLU F OE2 1 
ATOM   6772  N  N   . ALA F  1 87  ? 43.263  11.169  -12.600 1.00 16.77  ? 87  ALA F N   1 
ATOM   6773  C  CA  . ALA F  1 87  ? 44.590  11.771  -12.527 1.00 17.03  ? 87  ALA F CA  1 
ATOM   6774  C  C   . ALA F  1 87  ? 45.030  11.926  -11.082 1.00 20.14  ? 87  ALA F C   1 
ATOM   6775  O  O   . ALA F  1 87  ? 44.292  12.418  -10.222 1.00 25.82  ? 87  ALA F O   1 
ATOM   6776  C  CB  . ALA F  1 87  ? 44.610  13.119  -13.213 1.00 17.92  ? 87  ALA F CB  1 
ATOM   6777  N  N   . PRO F  1 88  ? 46.270  11.539  -10.833 1.00 17.68  ? 88  PRO F N   1 
ATOM   6778  C  CA  . PRO F  1 88  ? 46.869  11.652  -9.523  1.00 20.46  ? 88  PRO F CA  1 
ATOM   6779  C  C   . PRO F  1 88  ? 46.756  13.079  -9.036  1.00 18.69  ? 88  PRO F C   1 
ATOM   6780  O  O   . PRO F  1 88  ? 46.677  14.033  -9.799  1.00 16.52  ? 88  PRO F O   1 
ATOM   6781  C  CB  . PRO F  1 88  ? 48.328  11.302  -9.780  1.00 23.22  ? 88  PRO F CB  1 
ATOM   6782  C  CG  . PRO F  1 88  ? 48.525  11.697  -11.189 1.00 27.74  ? 88  PRO F CG  1 
ATOM   6783  C  CD  . PRO F  1 88  ? 47.264  11.363  -11.900 1.00 18.99  ? 88  PRO F CD  1 
ATOM   6784  N  N   . TYR F  1 89  ? 46.664  13.175  -7.722  1.00 15.39  ? 89  TYR F N   1 
ATOM   6785  C  CA  . TYR F  1 89  ? 46.515  14.482  -7.143  1.00 14.79  ? 89  TYR F CA  1 
ATOM   6786  C  C   . TYR F  1 89  ? 47.880  14.972  -6.742  1.00 30.11  ? 89  TYR F C   1 
ATOM   6787  O  O   . TYR F  1 89  ? 48.495  14.505  -5.791  1.00 35.25  ? 89  TYR F O   1 
ATOM   6788  C  CB  . TYR F  1 89  ? 45.597  14.381  -5.945  1.00 9.15   ? 89  TYR F CB  1 
ATOM   6789  C  CG  . TYR F  1 89  ? 45.248  15.721  -5.343  1.00 11.14  ? 89  TYR F CG  1 
ATOM   6790  C  CD1 . TYR F  1 89  ? 46.043  16.289  -4.349  1.00 14.31  ? 89  TYR F CD1 1 
ATOM   6791  C  CD2 . TYR F  1 89  ? 44.106  16.386  -5.745  1.00 8.98   ? 89  TYR F CD2 1 
ATOM   6792  C  CE1 . TYR F  1 89  ? 45.681  17.494  -3.780  1.00 18.33  ? 89  TYR F CE1 1 
ATOM   6793  C  CE2 . TYR F  1 89  ? 43.722  17.563  -5.151  1.00 9.47   ? 89  TYR F CE2 1 
ATOM   6794  C  CZ  . TYR F  1 89  ? 44.514  18.124  -4.172  1.00 20.36  ? 89  TYR F CZ  1 
ATOM   6795  O  OH  . TYR F  1 89  ? 44.151  19.344  -3.625  1.00 31.48  ? 89  TYR F OH  1 
ATOM   6796  N  N   . THR F  1 90  ? 48.341  15.941  -7.512  1.00 35.55  ? 90  THR F N   1 
ATOM   6797  C  CA  . THR F  1 90  ? 49.660  16.533  -7.308  1.00 38.85  ? 90  THR F CA  1 
ATOM   6798  C  C   . THR F  1 90  ? 49.484  17.955  -6.836  1.00 48.10  ? 90  THR F C   1 
ATOM   6799  O  O   . THR F  1 90  ? 49.818  18.295  -5.689  1.00 48.98  ? 90  THR F O   1 
ATOM   6800  C  CB  . THR F  1 90  ? 50.361  16.536  -8.661  1.00 51.19  ? 90  THR F CB  1 
ATOM   6801  O  OG1 . THR F  1 90  ? 49.489  17.055  -9.656  1.00 56.49  ? 90  THR F OG1 1 
ATOM   6802  C  CG2 . THR F  1 90  ? 50.785  15.135  -9.103  1.00 52.41  ? 90  THR F CG2 1 
ATOM   6803  N  N   . LYS F  1 91  ? 48.958  18.718  -7.760  1.00 53.66  ? 91  LYS F N   1 
ATOM   6804  C  CA  . LYS F  1 91  ? 48.670  20.116  -7.541  1.00 64.05  ? 91  LYS F CA  1 
ATOM   6805  C  C   . LYS F  1 91  ? 47.440  20.264  -6.681  1.00 53.06  ? 91  LYS F C   1 
ATOM   6806  O  O   . LYS F  1 91  ? 46.521  19.425  -6.728  1.00 32.93  ? 91  LYS F O   1 
ATOM   6807  C  CB  . LYS F  1 91  ? 48.377  20.846  -8.852  1.00 68.77  ? 91  LYS F CB  1 
ATOM   6808  C  CG  . LYS F  1 91  ? 47.900  22.291  -8.630  0.00 100.00 ? 91  LYS F CG  1 
ATOM   6809  C  CD  . LYS F  1 91  ? 46.598  22.620  -9.368  0.00 100.00 ? 91  LYS F CD  1 
ATOM   6810  C  CE  . LYS F  1 91  ? 46.588  22.120  -10.815 0.00 100.00 ? 91  LYS F CE  1 
ATOM   6811  N  NZ  . LYS F  1 91  ? 45.368  22.505  -11.546 0.00 100.00 ? 91  LYS F NZ  1 
ATOM   6812  N  N   . PRO F  1 92  ? 47.438  21.299  -5.885  1.00 57.17  ? 92  PRO F N   1 
ATOM   6813  C  CA  . PRO F  1 92  ? 46.301  21.640  -5.089  1.00 72.42  ? 92  PRO F CA  1 
ATOM   6814  C  C   . PRO F  1 92  ? 45.175  22.015  -5.992  1.00 22.12  ? 92  PRO F C   1 
ATOM   6815  O  O   . PRO F  1 92  ? 45.380  22.797  -6.962  1.00 25.68  ? 92  PRO F O   1 
ATOM   6816  C  CB  . PRO F  1 92  ? 46.764  22.853  -4.319  1.00 84.57  ? 92  PRO F CB  1 
ATOM   6817  C  CG  . PRO F  1 92  ? 48.190  23.158  -4.751  1.00 83.17  ? 92  PRO F CG  1 
ATOM   6818  C  CD  . PRO F  1 92  ? 48.607  22.152  -5.758  1.00 62.37  ? 92  PRO F CD  1 
ATOM   6819  N  N   . LYS F  1 93  ? 44.020  21.485  -5.726  1.00 23.10  ? 93  LYS F N   1 
ATOM   6820  C  CA  . LYS F  1 93  ? 42.855  21.872  -6.503  1.00 26.23  ? 93  LYS F CA  1 
ATOM   6821  C  C   . LYS F  1 93  ? 41.912  22.595  -5.539  1.00 52.41  ? 93  LYS F C   1 
ATOM   6822  O  O   . LYS F  1 93  ? 42.208  22.718  -4.336  1.00 65.85  ? 93  LYS F O   1 
ATOM   6823  C  CB  . LYS F  1 93  ? 42.246  20.647  -7.183  1.00 32.90  ? 93  LYS F CB  1 
ATOM   6824  C  CG  . LYS F  1 93  ? 42.759  20.471  -8.622  1.00 7.50   ? 93  LYS F CG  1 
ATOM   6825  C  CD  . LYS F  1 93  ? 43.139  19.027  -8.954  1.00 78.36  ? 93  LYS F CD  1 
ATOM   6826  C  CE  . LYS F  1 93  ? 41.959  18.065  -8.820  0.00 100.00 ? 93  LYS F CE  1 
ATOM   6827  N  NZ  . LYS F  1 93  ? 42.335  16.660  -9.027  1.00 27.54  ? 93  LYS F NZ  1 
ATOM   6828  N  N   . THR F  1 94  ? 40.816  23.067  -6.087  1.00 40.63  ? 94  THR F N   1 
ATOM   6829  C  CA  . THR F  1 94  ? 39.775  23.800  -5.335  1.00 52.94  ? 94  THR F CA  1 
ATOM   6830  C  C   . THR F  1 94  ? 38.602  22.883  -5.030  1.00 26.18  ? 94  THR F C   1 
ATOM   6831  O  O   . THR F  1 94  ? 38.426  21.838  -5.673  1.00 15.31  ? 94  THR F O   1 
ATOM   6832  C  CB  . THR F  1 94  ? 39.213  24.933  -6.200  1.00 76.77  ? 94  THR F CB  1 
ATOM   6833  O  OG1 . THR F  1 94  ? 39.964  26.117  -6.013  0.00 100.00 ? 94  THR F OG1 1 
ATOM   6834  C  CG2 . THR F  1 94  ? 37.748  25.262  -5.888  1.00 18.83  ? 94  THR F CG2 1 
ATOM   6835  N  N   . MET F  1 95  ? 37.811  23.279  -4.053  1.00 15.90  ? 95  MET F N   1 
ATOM   6836  C  CA  . MET F  1 95  ? 36.600  22.531  -3.748  1.00 21.19  ? 95  MET F CA  1 
ATOM   6837  C  C   . MET F  1 95  ? 35.756  22.571  -5.010  1.00 22.39  ? 95  MET F C   1 
ATOM   6838  O  O   . MET F  1 95  ? 35.168  21.571  -5.431  1.00 22.72  ? 95  MET F O   1 
ATOM   6839  C  CB  . MET F  1 95  ? 35.848  23.145  -2.569  1.00 25.67  ? 95  MET F CB  1 
ATOM   6840  C  CG  . MET F  1 95  ? 34.745  22.223  -2.033  1.00 30.99  ? 95  MET F CG  1 
ATOM   6841  S  SD  . MET F  1 95  ? 35.367  20.667  -1.430  1.00 32.76  ? 95  MET F SD  1 
ATOM   6842  C  CE  . MET F  1 95  ? 35.590  20.749  0.334   1.00 26.73  ? 95  MET F CE  1 
ATOM   6843  N  N   . ASP F  1 96  ? 35.741  23.747  -5.604  1.00 21.02  ? 96  ASP F N   1 
ATOM   6844  C  CA  . ASP F  1 96  ? 35.019  23.958  -6.848  1.00 24.76  ? 96  ASP F CA  1 
ATOM   6845  C  C   . ASP F  1 96  ? 35.712  23.178  -7.949  1.00 15.30  ? 96  ASP F C   1 
ATOM   6846  O  O   . ASP F  1 96  ? 35.085  22.510  -8.789  1.00 18.75  ? 96  ASP F O   1 
ATOM   6847  C  CB  . ASP F  1 96  ? 34.954  25.441  -7.174  1.00 29.36  ? 96  ASP F CB  1 
ATOM   6848  C  CG  . ASP F  1 96  ? 33.868  26.137  -6.367  1.00 56.98  ? 96  ASP F CG  1 
ATOM   6849  O  OD1 . ASP F  1 96  ? 33.353  25.538  -5.346  1.00 66.06  ? 96  ASP F OD1 1 
ATOM   6850  O  OD2 . ASP F  1 96  ? 33.469  27.312  -6.701  1.00 59.45  ? 96  ASP F OD2 1 
ATOM   6851  N  N   . GLN F  1 97  ? 37.031  23.201  -7.919  1.00 9.30   ? 97  GLN F N   1 
ATOM   6852  C  CA  . GLN F  1 97  ? 37.684  22.449  -8.973  1.00 14.80  ? 97  GLN F CA  1 
ATOM   6853  C  C   . GLN F  1 97  ? 37.330  20.992  -8.823  1.00 20.12  ? 97  GLN F C   1 
ATOM   6854  O  O   . GLN F  1 97  ? 37.046  20.358  -9.840  1.00 14.99  ? 97  GLN F O   1 
ATOM   6855  C  CB  . GLN F  1 97  ? 39.201  22.583  -8.915  1.00 22.34  ? 97  GLN F CB  1 
ATOM   6856  C  CG  . GLN F  1 97  ? 39.715  24.010  -9.041  1.00 41.67  ? 97  GLN F CG  1 
ATOM   6857  C  CD  . GLN F  1 97  ? 41.230  24.076  -9.031  1.00 61.46  ? 97  GLN F CD  1 
ATOM   6858  O  OE1 . GLN F  1 97  ? 41.819  24.932  -8.366  1.00 73.96  ? 97  GLN F OE1 1 
ATOM   6859  N  NE2 . GLN F  1 97  ? 41.866  23.185  -9.783  1.00 91.53  ? 97  GLN F NE2 1 
ATOM   6860  N  N   . LEU F  1 98  ? 37.355  20.491  -7.591  1.00 13.72  ? 98  LEU F N   1 
ATOM   6861  C  CA  . LEU F  1 98  ? 37.055  19.092  -7.328  1.00 12.56  ? 98  LEU F CA  1 
ATOM   6862  C  C   . LEU F  1 98  ? 35.603  18.752  -7.724  1.00 10.97  ? 98  LEU F C   1 
ATOM   6863  O  O   . LEU F  1 98  ? 35.305  17.737  -8.383  1.00 8.27   ? 98  LEU F O   1 
ATOM   6864  C  CB  . LEU F  1 98  ? 37.293  18.838  -5.827  1.00 11.52  ? 98  LEU F CB  1 
ATOM   6865  C  CG  . LEU F  1 98  ? 38.777  18.981  -5.500  1.00 11.13  ? 98  LEU F CG  1 
ATOM   6866  C  CD1 . LEU F  1 98  ? 39.061  18.827  -4.014  1.00 8.79   ? 98  LEU F CD1 1 
ATOM   6867  C  CD2 . LEU F  1 98  ? 39.498  17.950  -6.342  1.00 1.74   ? 98  LEU F CD2 1 
ATOM   6868  N  N   . MET F  1 99  ? 34.710  19.664  -7.360  1.00 5.09   ? 99  MET F N   1 
ATOM   6869  C  CA  . MET F  1 99  ? 33.309  19.435  -7.681  1.00 2.94   ? 99  MET F CA  1 
ATOM   6870  C  C   . MET F  1 99  ? 33.114  19.389  -9.199  1.00 10.44  ? 99  MET F C   1 
ATOM   6871  O  O   . MET F  1 99  ? 32.460  18.498  -9.764  1.00 12.33  ? 99  MET F O   1 
ATOM   6872  C  CB  . MET F  1 99  ? 32.416  20.462  -6.997  1.00 4.42   ? 99  MET F CB  1 
ATOM   6873  C  CG  . MET F  1 99  ? 32.408  20.303  -5.485  1.00 11.81  ? 99  MET F CG  1 
ATOM   6874  S  SD  . MET F  1 99  ? 31.995  18.637  -4.964  1.00 16.60  ? 99  MET F SD  1 
ATOM   6875  C  CE  . MET F  1 99  ? 33.557  17.962  -4.671  1.00 11.31  ? 99  MET F CE  1 
ATOM   6876  N  N   . GLU F  1 100 ? 33.790  20.331  -9.846  1.00 11.55  ? 100 GLU F N   1 
ATOM   6877  C  CA  . GLU F  1 100 ? 33.689  20.393  -11.313 1.00 12.29  ? 100 GLU F CA  1 
ATOM   6878  C  C   . GLU F  1 100 ? 34.108  19.072  -11.986 1.00 11.32  ? 100 GLU F C   1 
ATOM   6879  O  O   . GLU F  1 100 ? 33.482  18.601  -12.943 1.00 11.78  ? 100 GLU F O   1 
ATOM   6880  C  CB  . GLU F  1 100 ? 34.417  21.616  -11.871 1.00 15.14  ? 100 GLU F CB  1 
ATOM   6881  C  CG  . GLU F  1 100 ? 33.620  22.876  -11.643 1.00 36.82  ? 100 GLU F CG  1 
ATOM   6882  C  CD  . GLU F  1 100 ? 34.427  24.160  -11.761 1.00 99.88  ? 100 GLU F CD  1 
ATOM   6883  O  OE1 . GLU F  1 100 ? 35.672  24.100  -11.726 1.00 98.06  ? 100 GLU F OE1 1 
ATOM   6884  O  OE2 . GLU F  1 100 ? 33.809  25.241  -11.836 1.00 99.97  ? 100 GLU F OE2 1 
ATOM   6885  N  N   . ASP F  1 101 ? 35.134  18.426  -11.420 1.00 13.19  ? 101 ASP F N   1 
ATOM   6886  C  CA  . ASP F  1 101 ? 35.641  17.143  -11.909 1.00 17.60  ? 101 ASP F CA  1 
ATOM   6887  C  C   . ASP F  1 101 ? 34.542  16.110  -11.609 1.00 17.17  ? 101 ASP F C   1 
ATOM   6888  O  O   . ASP F  1 101 ? 34.212  15.254  -12.442 1.00 13.77  ? 101 ASP F O   1 
ATOM   6889  C  CB  . ASP F  1 101 ? 36.925  16.796  -11.138 1.00 25.97  ? 101 ASP F CB  1 
ATOM   6890  C  CG  . ASP F  1 101 ? 37.614  15.543  -11.669 1.00 70.41  ? 101 ASP F CG  1 
ATOM   6891  O  OD1 . ASP F  1 101 ? 37.147  15.009  -12.707 1.00 74.92  ? 101 ASP F OD1 1 
ATOM   6892  O  OD2 . ASP F  1 101 ? 38.586  15.078  -11.024 1.00 79.53  ? 101 ASP F OD2 1 
ATOM   6893  N  N   . LEU F  1 102 ? 33.963  16.186  -10.410 1.00 10.72  ? 102 LEU F N   1 
ATOM   6894  C  CA  . LEU F  1 102 ? 32.922  15.231  -10.059 1.00 6.95   ? 102 LEU F CA  1 
ATOM   6895  C  C   . LEU F  1 102 ? 31.764  15.415  -11.053 1.00 7.67   ? 102 LEU F C   1 
ATOM   6896  O  O   . LEU F  1 102 ? 31.204  14.483  -11.642 1.00 8.47   ? 102 LEU F O   1 
ATOM   6897  C  CB  . LEU F  1 102 ? 32.445  15.629  -8.668  1.00 5.84   ? 102 LEU F CB  1 
ATOM   6898  C  CG  . LEU F  1 102 ? 31.826  14.543  -7.796  1.00 12.77  ? 102 LEU F CG  1 
ATOM   6899  C  CD1 . LEU F  1 102 ? 30.656  15.150  -7.074  1.00 8.23   ? 102 LEU F CD1 1 
ATOM   6900  C  CD2 . LEU F  1 102 ? 31.414  13.362  -8.632  1.00 24.53  ? 102 LEU F CD2 1 
ATOM   6901  N  N   . VAL F  1 103 ? 31.370  16.664  -11.229 1.00 2.29   ? 103 VAL F N   1 
ATOM   6902  C  CA  . VAL F  1 103 ? 30.214  16.865  -12.093 1.00 4.00   ? 103 VAL F CA  1 
ATOM   6903  C  C   . VAL F  1 103 ? 30.451  16.457  -13.534 1.00 12.50  ? 103 VAL F C   1 
ATOM   6904  O  O   . VAL F  1 103 ? 29.572  15.996  -14.278 1.00 7.59   ? 103 VAL F O   1 
ATOM   6905  C  CB  . VAL F  1 103 ? 29.852  18.327  -12.104 1.00 13.14  ? 103 VAL F CB  1 
ATOM   6906  C  CG1 . VAL F  1 103 ? 28.926  18.561  -13.262 1.00 14.21  ? 103 VAL F CG1 1 
ATOM   6907  C  CG2 . VAL F  1 103 ? 29.097  18.654  -10.837 1.00 13.85  ? 103 VAL F CG2 1 
ATOM   6908  N  N   . GLY F  1 104 ? 31.684  16.684  -13.960 1.00 5.83   ? 104 GLY F N   1 
ATOM   6909  C  CA  . GLY F  1 104 ? 31.995  16.330  -15.340 1.00 3.40   ? 104 GLY F CA  1 
ATOM   6910  C  C   . GLY F  1 104 ? 31.804  14.839  -15.520 1.00 9.06   ? 104 GLY F C   1 
ATOM   6911  O  O   . GLY F  1 104 ? 31.214  14.377  -16.488 1.00 13.71  ? 104 GLY F O   1 
ATOM   6912  N  N   . THR F  1 105 ? 32.267  14.078  -14.543 1.00 5.39   ? 105 THR F N   1 
ATOM   6913  C  CA  . THR F  1 105 ? 32.217  12.636  -14.606 1.00 4.01   ? 105 THR F CA  1 
ATOM   6914  C  C   . THR F  1 105 ? 30.794  12.189  -14.574 1.00 4.84   ? 105 THR F C   1 
ATOM   6915  O  O   . THR F  1 105 ? 30.435  11.254  -15.267 1.00 8.09   ? 105 THR F O   1 
ATOM   6916  C  CB  . THR F  1 105 ? 33.051  11.977  -13.507 1.00 12.41  ? 105 THR F CB  1 
ATOM   6917  O  OG1 . THR F  1 105 ? 34.420  12.397  -13.632 1.00 17.15  ? 105 THR F OG1 1 
ATOM   6918  C  CG2 . THR F  1 105 ? 32.906  10.479  -13.578 1.00 7.68   ? 105 THR F CG2 1 
ATOM   6919  N  N   . LEU F  1 106 ? 30.021  12.916  -13.788 1.00 2.76   ? 106 LEU F N   1 
ATOM   6920  C  CA  . LEU F  1 106 ? 28.590  12.592  -13.720 1.00 3.46   ? 106 LEU F CA  1 
ATOM   6921  C  C   . LEU F  1 106 ? 27.961  12.818  -15.105 1.00 11.79  ? 106 LEU F C   1 
ATOM   6922  O  O   . LEU F  1 106 ? 27.174  12.020  -15.630 1.00 10.42  ? 106 LEU F O   1 
ATOM   6923  C  CB  . LEU F  1 106 ? 27.868  13.408  -12.638 1.00 1.38   ? 106 LEU F CB  1 
ATOM   6924  C  CG  . LEU F  1 106 ? 28.217  13.020  -11.194 1.00 6.11   ? 106 LEU F CG  1 
ATOM   6925  C  CD1 . LEU F  1 106 ? 27.685  14.112  -10.282 1.00 2.77   ? 106 LEU F CD1 1 
ATOM   6926  C  CD2 . LEU F  1 106 ? 27.528  11.695  -10.824 1.00 1.47   ? 106 LEU F CD2 1 
ATOM   6927  N  N   . GLU F  1 107 ? 28.314  13.930  -15.733 1.00 3.88   ? 107 GLU F N   1 
ATOM   6928  C  CA  . GLU F  1 107 ? 27.761  14.199  -17.040 1.00 5.20   ? 107 GLU F CA  1 
ATOM   6929  C  C   . GLU F  1 107 ? 28.161  13.113  -18.034 1.00 11.21  ? 107 GLU F C   1 
ATOM   6930  O  O   . GLU F  1 107 ? 27.340  12.594  -18.804 1.00 7.94   ? 107 GLU F O   1 
ATOM   6931  C  CB  . GLU F  1 107 ? 28.220  15.568  -17.470 1.00 5.18   ? 107 GLU F CB  1 
ATOM   6932  C  CG  . GLU F  1 107 ? 27.450  16.617  -16.705 1.00 15.90  ? 107 GLU F CG  1 
ATOM   6933  C  CD  . GLU F  1 107 ? 27.966  18.029  -16.962 1.00 27.93  ? 107 GLU F CD  1 
ATOM   6934  O  OE1 . GLU F  1 107 ? 29.195  18.177  -17.196 1.00 38.94  ? 107 GLU F OE1 1 
ATOM   6935  O  OE2 . GLU F  1 107 ? 27.124  18.961  -16.898 1.00 30.29  ? 107 GLU F OE2 1 
ATOM   6936  N  N   . LEU F  1 108 ? 29.412  12.681  -17.953 1.00 7.04   ? 108 LEU F N   1 
ATOM   6937  C  CA  . LEU F  1 108 ? 29.829  11.597  -18.824 1.00 6.70   ? 108 LEU F CA  1 
ATOM   6938  C  C   . LEU F  1 108 ? 28.984  10.344  -18.624 1.00 10.05  ? 108 LEU F C   1 
ATOM   6939  O  O   . LEU F  1 108 ? 28.542  9.758   -19.602 1.00 11.82  ? 108 LEU F O   1 
ATOM   6940  C  CB  . LEU F  1 108 ? 31.302  11.262  -18.615 1.00 10.20  ? 108 LEU F CB  1 
ATOM   6941  C  CG  . LEU F  1 108 ? 31.941  10.092  -19.385 1.00 18.96  ? 108 LEU F CG  1 
ATOM   6942  C  CD1 . LEU F  1 108 ? 33.459  10.216  -19.391 1.00 14.76  ? 108 LEU F CD1 1 
ATOM   6943  C  CD2 . LEU F  1 108 ? 31.512  8.703   -18.904 1.00 23.83  ? 108 LEU F CD2 1 
ATOM   6944  N  N   . LEU F  1 109 ? 28.820  9.900   -17.381 1.00 5.19   ? 109 LEU F N   1 
ATOM   6945  C  CA  . LEU F  1 109 ? 28.047  8.691   -17.098 1.00 5.98   ? 109 LEU F CA  1 
ATOM   6946  C  C   . LEU F  1 109 ? 26.616  8.844   -17.577 1.00 7.09   ? 109 LEU F C   1 
ATOM   6947  O  O   . LEU F  1 109 ? 26.046  7.937   -18.170 1.00 10.45  ? 109 LEU F O   1 
ATOM   6948  C  CB  . LEU F  1 109 ? 28.055  8.385   -15.599 1.00 5.50   ? 109 LEU F CB  1 
ATOM   6949  C  CG  . LEU F  1 109 ? 29.467  7.970   -15.186 1.00 10.64  ? 109 LEU F CG  1 
ATOM   6950  C  CD1 . LEU F  1 109 ? 29.597  7.951   -13.671 1.00 12.26  ? 109 LEU F CD1 1 
ATOM   6951  C  CD2 . LEU F  1 109 ? 29.674  6.546   -15.684 1.00 7.23   ? 109 LEU F CD2 1 
ATOM   6952  N  N   . ARG F  1 110 ? 26.065  10.033  -17.375 1.00 1.50   ? 110 ARG F N   1 
ATOM   6953  C  CA  . ARG F  1 110 ? 24.698  10.306  -17.798 1.00 4.84   ? 110 ARG F CA  1 
ATOM   6954  C  C   . ARG F  1 110 ? 24.609  10.050  -19.315 1.00 11.73  ? 110 ARG F C   1 
ATOM   6955  O  O   . ARG F  1 110 ? 23.792  9.294   -19.857 1.00 9.29   ? 110 ARG F O   1 
ATOM   6956  C  CB  . ARG F  1 110 ? 24.357  11.774  -17.555 1.00 3.08   ? 110 ARG F CB  1 
ATOM   6957  C  CG  . ARG F  1 110 ? 22.940  12.135  -17.998 1.00 5.55   ? 110 ARG F CG  1 
ATOM   6958  C  CD  . ARG F  1 110 ? 22.701  13.639  -17.998 1.00 5.65   ? 110 ARG F CD  1 
ATOM   6959  N  NE  . ARG F  1 110 ? 23.745  14.277  -18.789 1.00 9.89   ? 110 ARG F NE  1 
ATOM   6960  C  CZ  . ARG F  1 110 ? 24.063  15.571  -18.748 1.00 18.34  ? 110 ARG F CZ  1 
ATOM   6961  N  NH1 . ARG F  1 110 ? 23.451  16.431  -17.927 1.00 7.95   ? 110 ARG F NH1 1 
ATOM   6962  N  NH2 . ARG F  1 110 ? 25.041  15.995  -19.554 1.00 14.46  ? 110 ARG F NH2 1 
ATOM   6963  N  N   . ASP F  1 111 ? 25.483  10.744  -20.026 1.00 8.10   ? 111 ASP F N   1 
ATOM   6964  C  CA  . ASP F  1 111 ? 25.452  10.620  -21.474 1.00 11.11  ? 111 ASP F CA  1 
ATOM   6965  C  C   . ASP F  1 111 ? 25.658  9.181   -21.933 1.00 10.30  ? 111 ASP F C   1 
ATOM   6966  O  O   . ASP F  1 111 ? 24.879  8.693   -22.756 1.00 10.75  ? 111 ASP F O   1 
ATOM   6967  C  CB  . ASP F  1 111 ? 26.453  11.619  -22.059 1.00 19.63  ? 111 ASP F CB  1 
ATOM   6968  C  CG  . ASP F  1 111 ? 26.134  13.062  -21.637 1.00 34.12  ? 111 ASP F CG  1 
ATOM   6969  O  OD1 . ASP F  1 111 ? 24.946  13.317  -21.311 1.00 25.39  ? 111 ASP F OD1 1 
ATOM   6970  O  OD2 . ASP F  1 111 ? 27.040  13.925  -21.609 1.00 58.93  ? 111 ASP F OD2 1 
ATOM   6971  N  N   . GLU F  1 112 ? 26.632  8.487   -21.344 1.00 4.56   ? 112 GLU F N   1 
ATOM   6972  C  CA  . GLU F  1 112 ? 26.803  7.108   -21.770 1.00 2.35   ? 112 GLU F CA  1 
ATOM   6973  C  C   . GLU F  1 112 ? 25.598  6.272   -21.402 1.00 11.46  ? 112 GLU F C   1 
ATOM   6974  O  O   . GLU F  1 112 ? 25.199  5.415   -22.172 1.00 14.02  ? 112 GLU F O   1 
ATOM   6975  C  CB  . GLU F  1 112 ? 28.072  6.497   -21.192 1.00 5.70   ? 112 GLU F CB  1 
ATOM   6976  C  CG  . GLU F  1 112 ? 29.295  7.354   -21.533 1.00 23.28  ? 112 GLU F CG  1 
ATOM   6977  C  CD  . GLU F  1 112 ? 30.593  6.575   -21.382 1.00 35.93  ? 112 GLU F CD  1 
ATOM   6978  O  OE1 . GLU F  1 112 ? 30.509  5.385   -21.000 1.00 17.86  ? 112 GLU F OE1 1 
ATOM   6979  O  OE2 . GLU F  1 112 ? 31.664  7.141   -21.701 1.00 23.72  ? 112 GLU F OE2 1 
ATOM   6980  N  N   . TYR F  1 113 ? 25.016  6.469   -20.225 1.00 7.76   ? 113 TYR F N   1 
ATOM   6981  C  CA  . TYR F  1 113 ? 23.872  5.640   -19.874 1.00 5.71   ? 113 TYR F CA  1 
ATOM   6982  C  C   . TYR F  1 113 ? 22.797  5.860   -20.921 1.00 9.09   ? 113 TYR F C   1 
ATOM   6983  O  O   . TYR F  1 113 ? 22.153  4.902   -21.360 1.00 7.52   ? 113 TYR F O   1 
ATOM   6984  C  CB  . TYR F  1 113 ? 23.344  5.969   -18.469 1.00 4.78   ? 113 TYR F CB  1 
ATOM   6985  C  CG  . TYR F  1 113 ? 24.127  5.312   -17.368 1.00 9.50   ? 113 TYR F CG  1 
ATOM   6986  C  CD1 . TYR F  1 113 ? 25.474  4.989   -17.538 1.00 11.95  ? 113 TYR F CD1 1 
ATOM   6987  C  CD2 . TYR F  1 113 ? 23.551  5.120   -16.130 1.00 15.79  ? 113 TYR F CD2 1 
ATOM   6988  C  CE1 . TYR F  1 113 ? 26.187  4.409   -16.522 1.00 18.46  ? 113 TYR F CE1 1 
ATOM   6989  C  CE2 . TYR F  1 113 ? 24.243  4.548   -15.106 1.00 20.80  ? 113 TYR F CE2 1 
ATOM   6990  C  CZ  . TYR F  1 113 ? 25.570  4.213   -15.293 1.00 18.64  ? 113 TYR F CZ  1 
ATOM   6991  O  OH  . TYR F  1 113 ? 26.205  3.656   -14.208 1.00 18.47  ? 113 TYR F OH  1 
ATOM   6992  N  N   . LYS F  1 114 ? 22.661  7.113   -21.334 1.00 10.27  ? 114 LYS F N   1 
ATOM   6993  C  CA  . LYS F  1 114 ? 21.671  7.474   -22.348 1.00 10.83  ? 114 LYS F CA  1 
ATOM   6994  C  C   . LYS F  1 114 ? 21.809  6.589   -23.573 1.00 12.53  ? 114 LYS F C   1 
ATOM   6995  O  O   . LYS F  1 114 ? 20.845  5.943   -24.009 1.00 13.75  ? 114 LYS F O   1 
ATOM   6996  C  CB  . LYS F  1 114 ? 21.730  8.962   -22.674 1.00 13.99  ? 114 LYS F CB  1 
ATOM   6997  C  CG  . LYS F  1 114 ? 20.631  9.421   -23.609 1.00 47.99  ? 114 LYS F CG  1 
ATOM   6998  C  CD  . LYS F  1 114 ? 19.382  8.567   -23.425 1.00 65.96  ? 114 LYS F CD  1 
ATOM   6999  C  CE  . LYS F  1 114 ? 18.296  8.913   -24.430 1.00 72.25  ? 114 LYS F CE  1 
ATOM   7000  N  NZ  . LYS F  1 114 ? 17.056  8.106   -24.249 1.00 81.58  ? 114 LYS F NZ  1 
ATOM   7001  N  N   . GLN F  1 115 ? 23.043  6.402   -24.027 1.00 8.60   ? 115 GLN F N   1 
ATOM   7002  C  CA  . GLN F  1 115 ? 23.266  5.483   -25.142 1.00 9.35   ? 115 GLN F CA  1 
ATOM   7003  C  C   . GLN F  1 115 ? 22.857  4.060   -24.753 1.00 10.62  ? 115 GLN F C   1 
ATOM   7004  O  O   . GLN F  1 115 ? 22.317  3.341   -25.588 1.00 12.84  ? 115 GLN F O   1 
ATOM   7005  C  CB  . GLN F  1 115 ? 24.754  5.344   -25.505 1.00 13.39  ? 115 GLN F CB  1 
ATOM   7006  C  CG  . GLN F  1 115 ? 25.691  6.543   -25.414 1.00 65.44  ? 115 GLN F CG  1 
ATOM   7007  C  CD  . GLN F  1 115 ? 25.139  7.779   -26.076 0.00 100.00 ? 115 GLN F CD  1 
ATOM   7008  O  OE1 . GLN F  1 115 ? 24.281  7.692   -26.912 0.00 100.00 ? 115 GLN F OE1 1 
ATOM   7009  N  NE2 . GLN F  1 115 ? 25.590  8.940   -25.644 0.00 100.00 ? 115 GLN F NE2 1 
ATOM   7010  N  N   . GLY F  1 116 ? 23.241  3.623   -23.554 1.00 6.96   ? 116 GLY F N   1 
ATOM   7011  C  CA  . GLY F  1 116 ? 22.970  2.262   -23.106 1.00 3.65   ? 116 GLY F CA  1 
ATOM   7012  C  C   . GLY F  1 116 ? 21.450  2.128   -23.054 1.00 2.56   ? 116 GLY F C   1 
ATOM   7013  O  O   . GLY F  1 116 ? 20.828  1.104   -23.339 1.00 8.56   ? 116 GLY F O   1 
ATOM   7014  N  N   . ILE F  1 117 ? 20.852  3.239   -22.685 1.00 6.00   ? 117 ILE F N   1 
ATOM   7015  C  CA  . ILE F  1 117 ? 19.422  3.215   -22.630 1.00 10.47  ? 117 ILE F CA  1 
ATOM   7016  C  C   . ILE F  1 117 ? 18.795  3.012   -23.998 1.00 13.83  ? 117 ILE F C   1 
ATOM   7017  O  O   . ILE F  1 117 ? 18.000  2.098   -24.152 1.00 6.74   ? 117 ILE F O   1 
ATOM   7018  C  CB  . ILE F  1 117 ? 18.949  4.473   -21.942 1.00 24.02  ? 117 ILE F CB  1 
ATOM   7019  C  CG1 . ILE F  1 117 ? 19.605  4.434   -20.558 1.00 21.02  ? 117 ILE F CG1 1 
ATOM   7020  C  CG2 . ILE F  1 117 ? 17.431  4.393   -21.817 1.00 24.35  ? 117 ILE F CG2 1 
ATOM   7021  C  CD1 . ILE F  1 117 ? 19.117  5.389   -19.543 1.00 1.00   ? 117 ILE F CD1 1 
ATOM   7022  N  N   . GLU F  1 118 ? 19.144  3.807   -25.007 1.00 15.34  ? 118 GLU F N   1 
ATOM   7023  C  CA  . GLU F  1 118 ? 18.573  3.619   -26.339 1.00 23.44  ? 118 GLU F CA  1 
ATOM   7024  C  C   . GLU F  1 118 ? 18.884  2.203   -26.823 1.00 22.84  ? 118 GLU F C   1 
ATOM   7025  O  O   . GLU F  1 118 ? 18.091  1.414   -27.349 1.00 14.80  ? 118 GLU F O   1 
ATOM   7026  C  CB  . GLU F  1 118 ? 19.301  4.606   -27.265 1.00 36.10  ? 118 GLU F CB  1 
ATOM   7027  C  CG  . GLU F  1 118 ? 19.658  5.945   -26.594 1.00 55.84  ? 118 GLU F CG  1 
ATOM   7028  C  CD  . GLU F  1 118 ? 20.784  6.732   -27.256 0.00 100.00 ? 118 GLU F CD  1 
ATOM   7029  O  OE1 . GLU F  1 118 ? 21.637  6.066   -27.873 0.00 100.00 ? 118 GLU F OE1 1 
ATOM   7030  O  OE2 . GLU F  1 118 ? 20.885  7.977   -27.217 1.00 78.32  ? 118 GLU F OE2 1 
ATOM   7031  N  N   . LEU F  1 119 ? 20.111  1.820   -26.548 1.00 13.39  ? 119 LEU F N   1 
ATOM   7032  C  CA  . LEU F  1 119 ? 20.514  0.531   -27.048 1.00 9.35   ? 119 LEU F CA  1 
ATOM   7033  C  C   . LEU F  1 119 ? 19.715  -0.656  -26.541 1.00 7.14   ? 119 LEU F C   1 
ATOM   7034  O  O   . LEU F  1 119 ? 19.294  -1.519  -27.335 1.00 12.16  ? 119 LEU F O   1 
ATOM   7035  C  CB  . LEU F  1 119 ? 21.980  0.447   -26.640 1.00 25.67  ? 119 LEU F CB  1 
ATOM   7036  C  CG  . LEU F  1 119 ? 22.638  -0.918  -26.549 1.00 44.24  ? 119 LEU F CG  1 
ATOM   7037  C  CD1 . LEU F  1 119 ? 22.169  -1.892  -27.611 1.00 51.04  ? 119 LEU F CD1 1 
ATOM   7038  C  CD2 . LEU F  1 119 ? 24.164  -0.806  -26.711 1.00 41.90  ? 119 LEU F CD2 1 
ATOM   7039  N  N   . THR F  1 120 ? 19.562  -0.669  -25.260 1.00 14.20  ? 120 THR F N   1 
ATOM   7040  C  CA  . THR F  1 120 ? 18.874  -1.736  -24.548 1.00 23.37  ? 120 THR F CA  1 
ATOM   7041  C  C   . THR F  1 120 ? 17.416  -1.827  -25.003 1.00 5.77   ? 120 THR F C   1 
ATOM   7042  O  O   . THR F  1 120 ? 16.814  -2.913  -25.007 1.00 9.13   ? 120 THR F O   1 
ATOM   7043  C  CB  . THR F  1 120 ? 18.968  -1.431  -23.065 1.00 1.86   ? 120 THR F CB  1 
ATOM   7044  O  OG1 . THR F  1 120 ? 20.295  -1.674  -22.616 1.00 29.70  ? 120 THR F OG1 1 
ATOM   7045  C  CG2 . THR F  1 120 ? 18.025  -2.274  -22.225 1.00 1.00   ? 120 THR F CG2 1 
ATOM   7046  N  N   . ASP F  1 121 ? 16.902  -0.674  -25.361 1.00 20.54  ? 121 ASP F N   1 
ATOM   7047  C  CA  . ASP F  1 121 ? 15.533  -0.520  -25.861 1.00 36.41  ? 121 ASP F CA  1 
ATOM   7048  C  C   . ASP F  1 121 ? 15.435  -1.255  -27.183 1.00 31.12  ? 121 ASP F C   1 
ATOM   7049  O  O   . ASP F  1 121 ? 14.666  -2.220  -27.332 1.00 17.94  ? 121 ASP F O   1 
ATOM   7050  C  CB  . ASP F  1 121 ? 15.263  0.976   -26.057 1.00 36.60  ? 121 ASP F CB  1 
ATOM   7051  C  CG  . ASP F  1 121 ? 13.862  1.311   -26.576 1.00 72.21  ? 121 ASP F CG  1 
ATOM   7052  O  OD1 . ASP F  1 121 ? 12.873  0.535   -26.321 1.00 99.37  ? 121 ASP F OD1 1 
ATOM   7053  O  OD2 . ASP F  1 121 ? 13.670  2.388   -27.269 1.00 72.79  ? 121 ASP F OD2 1 
ATOM   7054  N  N   . LYS F  1 122 ? 16.239  -0.759  -28.090 1.00 30.70  ? 122 LYS F N   1 
ATOM   7055  C  CA  . LYS F  1 122 ? 16.343  -1.317  -29.419 1.00 48.79  ? 122 LYS F CA  1 
ATOM   7056  C  C   . LYS F  1 122 ? 16.542  -2.798  -29.268 1.00 24.39  ? 122 LYS F C   1 
ATOM   7057  O  O   . LYS F  1 122 ? 15.744  -3.553  -29.810 1.00 22.79  ? 122 LYS F O   1 
ATOM   7058  C  CB  . LYS F  1 122 ? 17.493  -0.636  -30.159 1.00 38.71  ? 122 LYS F CB  1 
ATOM   7059  C  CG  . LYS F  1 122 ? 17.176  0.825   -30.501 1.00 55.90  ? 122 LYS F CG  1 
ATOM   7060  C  CD  . LYS F  1 122 ? 15.762  1.006   -31.061 1.00 44.24  ? 122 LYS F CD  1 
ATOM   7061  C  CE  . LYS F  1 122 ? 15.461  2.439   -31.508 1.00 21.63  ? 122 LYS F CE  1 
ATOM   7062  N  NZ  . LYS F  1 122 ? 14.136  2.580   -32.135 1.00 87.59  ? 122 LYS F NZ  1 
ATOM   7063  N  N   . GLU F  1 123 ? 17.469  -3.203  -28.425 1.00 33.50  ? 123 GLU F N   1 
ATOM   7064  C  CA  . GLU F  1 123 ? 17.728  -4.634  -28.208 1.00 35.17  ? 123 GLU F CA  1 
ATOM   7065  C  C   . GLU F  1 123 ? 16.633  -5.456  -27.534 1.00 49.19  ? 123 GLU F C   1 
ATOM   7066  O  O   . GLU F  1 123 ? 16.737  -6.679  -27.421 1.00 85.63  ? 123 GLU F O   1 
ATOM   7067  C  CB  . GLU F  1 123 ? 19.034  -4.810  -27.435 1.00 34.44  ? 123 GLU F CB  1 
ATOM   7068  C  CG  . GLU F  1 123 ? 19.973  -5.894  -27.930 0.00 100.00 ? 123 GLU F CG  1 
ATOM   7069  C  CD  . GLU F  1 123 ? 20.987  -5.426  -28.948 1.00 67.79  ? 123 GLU F CD  1 
ATOM   7070  O  OE1 . GLU F  1 123 ? 20.650  -4.614  -29.852 1.00 62.29  ? 123 GLU F OE1 1 
ATOM   7071  O  OE2 . GLU F  1 123 ? 22.151  -5.803  -28.867 0.00 100.00 ? 123 GLU F OE2 1 
ATOM   7072  N  N   . GLY F  1 124 ? 15.582  -4.803  -26.997 1.00 29.34  ? 124 GLY F N   1 
ATOM   7073  C  CA  . GLY F  1 124 ? 14.558  -5.542  -26.290 1.00 46.38  ? 124 GLY F CA  1 
ATOM   7074  C  C   . GLY F  1 124 ? 14.930  -6.100  -24.891 1.00 22.10  ? 124 GLY F C   1 
ATOM   7075  O  O   . GLY F  1 124 ? 14.216  -6.989  -24.417 1.00 17.71  ? 124 GLY F O   1 
ATOM   7076  N  N   . ASP F  1 125 ? 16.027  -5.648  -24.258 1.00 23.55  ? 125 ASP F N   1 
ATOM   7077  C  CA  . ASP F  1 125 ? 16.422  -6.116  -22.921 1.00 12.30  ? 125 ASP F CA  1 
ATOM   7078  C  C   . ASP F  1 125 ? 15.792  -5.138  -21.948 1.00 11.34  ? 125 ASP F C   1 
ATOM   7079  O  O   . ASP F  1 125 ? 16.399  -4.174  -21.539 1.00 12.32  ? 125 ASP F O   1 
ATOM   7080  C  CB  . ASP F  1 125 ? 17.935  -6.121  -22.675 1.00 3.47   ? 125 ASP F CB  1 
ATOM   7081  C  CG  . ASP F  1 125 ? 18.300  -6.594  -21.280 1.00 22.03  ? 125 ASP F CG  1 
ATOM   7082  O  OD1 . ASP F  1 125 ? 17.410  -6.676  -20.406 1.00 20.46  ? 125 ASP F OD1 1 
ATOM   7083  O  OD2 . ASP F  1 125 ? 19.510  -6.882  -21.121 1.00 14.01  ? 125 ASP F OD2 1 
ATOM   7084  N  N   . ASP F  1 126 ? 14.554  -5.430  -21.607 1.00 7.90   ? 126 ASP F N   1 
ATOM   7085  C  CA  . ASP F  1 126 ? 13.723  -4.553  -20.808 1.00 9.39   ? 126 ASP F CA  1 
ATOM   7086  C  C   . ASP F  1 126 ? 14.305  -4.334  -19.446 1.00 6.93   ? 126 ASP F C   1 
ATOM   7087  O  O   . ASP F  1 126 ? 14.426  -3.193  -19.004 1.00 8.95   ? 126 ASP F O   1 
ATOM   7088  C  CB  . ASP F  1 126 ? 12.353  -5.190  -20.658 1.00 17.86  ? 126 ASP F CB  1 
ATOM   7089  C  CG  . ASP F  1 126 ? 11.770  -5.568  -21.996 1.00 39.42  ? 126 ASP F CG  1 
ATOM   7090  O  OD1 . ASP F  1 126 ? 11.434  -4.655  -22.772 1.00 40.21  ? 126 ASP F OD1 1 
ATOM   7091  O  OD2 . ASP F  1 126 ? 11.785  -6.772  -22.308 1.00 51.51  ? 126 ASP F OD2 1 
ATOM   7092  N  N   . VAL F  1 127 ? 14.733  -5.437  -18.851 1.00 2.67   ? 127 VAL F N   1 
ATOM   7093  C  CA  . VAL F  1 127 ? 15.359  -5.335  -17.530 1.00 2.60   ? 127 VAL F CA  1 
ATOM   7094  C  C   . VAL F  1 127 ? 16.597  -4.432  -17.461 1.00 8.71   ? 127 VAL F C   1 
ATOM   7095  O  O   . VAL F  1 127 ? 16.617  -3.456  -16.705 1.00 11.97  ? 127 VAL F O   1 
ATOM   7096  C  CB  . VAL F  1 127 ? 15.606  -6.724  -16.895 1.00 3.97   ? 127 VAL F CB  1 
ATOM   7097  C  CG1 . VAL F  1 127 ? 16.524  -6.522  -15.690 1.00 2.96   ? 127 VAL F CG1 1 
ATOM   7098  C  CG2 . VAL F  1 127 ? 14.290  -7.427  -16.546 1.00 1.00   ? 127 VAL F CG2 1 
ATOM   7099  N  N   . THR F  1 128 ? 17.572  -4.674  -18.334 1.00 2.40   ? 128 THR F N   1 
ATOM   7100  C  CA  . THR F  1 128 ? 18.718  -3.778  -18.320 1.00 1.90   ? 128 THR F CA  1 
ATOM   7101  C  C   . THR F  1 128 ? 18.335  -2.326  -18.563 1.00 5.94   ? 128 THR F C   1 
ATOM   7102  O  O   . THR F  1 128 ? 18.805  -1.384  -17.907 1.00 6.53   ? 128 THR F O   1 
ATOM   7103  C  CB  . THR F  1 128 ? 19.794  -4.269  -19.288 1.00 1.11   ? 128 THR F CB  1 
ATOM   7104  O  OG1 . THR F  1 128 ? 20.028  -5.642  -18.961 1.00 4.40   ? 128 THR F OG1 1 
ATOM   7105  C  CG2 . THR F  1 128 ? 21.085  -3.476  -19.159 1.00 1.00   ? 128 THR F CG2 1 
ATOM   7106  N  N   . ASN F  1 129 ? 17.395  -2.180  -19.475 1.00 2.01   ? 129 ASN F N   1 
ATOM   7107  C  CA  . ASN F  1 129 ? 16.896  -0.851  -19.830 1.00 1.29   ? 129 ASN F CA  1 
ATOM   7108  C  C   . ASN F  1 129 ? 16.417  -0.068  -18.586 1.00 3.35   ? 129 ASN F C   1 
ATOM   7109  O  O   . ASN F  1 129 ? 16.761  1.101   -18.341 1.00 4.79   ? 129 ASN F O   1 
ATOM   7110  C  CB  . ASN F  1 129 ? 15.724  -1.037  -20.827 1.00 3.32   ? 129 ASN F CB  1 
ATOM   7111  C  CG  . ASN F  1 129 ? 15.074  0.291   -21.273 1.00 8.71   ? 129 ASN F CG  1 
ATOM   7112  O  OD1 . ASN F  1 129 ? 13.918  0.563   -20.934 1.00 27.75  ? 129 ASN F OD1 1 
ATOM   7113  N  ND2 . ASN F  1 129 ? 15.794  1.116   -22.028 1.00 3.54   ? 129 ASN F ND2 1 
ATOM   7114  N  N   . ASP F  1 130 ? 15.583  -0.761  -17.817 1.00 1.39   ? 130 ASP F N   1 
ATOM   7115  C  CA  . ASP F  1 130 ? 15.055  -0.134  -16.600 1.00 6.15   ? 130 ASP F CA  1 
ATOM   7116  C  C   . ASP F  1 130 ? 16.121  0.148   -15.540 1.00 7.77   ? 130 ASP F C   1 
ATOM   7117  O  O   . ASP F  1 130 ? 16.021  1.184   -14.862 1.00 10.09  ? 130 ASP F O   1 
ATOM   7118  C  CB  . ASP F  1 130 ? 13.882  -0.887  -15.967 1.00 11.09  ? 130 ASP F CB  1 
ATOM   7119  C  CG  . ASP F  1 130 ? 12.489  -0.285  -16.296 1.00 57.89  ? 130 ASP F CG  1 
ATOM   7120  O  OD1 . ASP F  1 130 ? 12.289  0.464   -17.288 1.00 57.58  ? 130 ASP F OD1 1 
ATOM   7121  O  OD2 . ASP F  1 130 ? 11.568  -0.592  -15.494 1.00 94.58  ? 130 ASP F OD2 1 
ATOM   7122  N  N   . MET F  1 131 ? 17.126  -0.726  -15.438 1.00 3.17   ? 131 MET F N   1 
ATOM   7123  C  CA  . MET F  1 131 ? 18.159  -0.448  -14.477 1.00 6.03   ? 131 MET F CA  1 
ATOM   7124  C  C   . MET F  1 131 ? 18.799  0.883   -14.781 1.00 4.73   ? 131 MET F C   1 
ATOM   7125  O  O   . MET F  1 131 ? 19.028  1.726   -13.913 1.00 3.71   ? 131 MET F O   1 
ATOM   7126  C  CB  . MET F  1 131 ? 19.343  -1.372  -14.680 1.00 12.45  ? 131 MET F CB  1 
ATOM   7127  C  CG  . MET F  1 131 ? 19.419  -2.686  -13.923 1.00 17.63  ? 131 MET F CG  1 
ATOM   7128  S  SD  . MET F  1 131 ? 21.227  -2.922  -13.588 1.00 16.06  ? 131 MET F SD  1 
ATOM   7129  C  CE  . MET F  1 131 ? 22.051  -2.476  -15.221 1.00 13.45  ? 131 MET F CE  1 
ATOM   7130  N  N   . LEU F  1 132 ? 19.214  0.987   -16.031 1.00 3.66   ? 132 LEU F N   1 
ATOM   7131  C  CA  . LEU F  1 132 ? 19.946  2.153   -16.494 1.00 4.30   ? 132 LEU F CA  1 
ATOM   7132  C  C   . LEU F  1 132 ? 19.133  3.402   -16.301 1.00 6.83   ? 132 LEU F C   1 
ATOM   7133  O  O   . LEU F  1 132 ? 19.675  4.438   -15.891 1.00 7.63   ? 132 LEU F O   1 
ATOM   7134  C  CB  . LEU F  1 132 ? 20.269  1.944   -17.965 1.00 6.40   ? 132 LEU F CB  1 
ATOM   7135  C  CG  . LEU F  1 132 ? 21.637  1.355   -18.330 1.00 10.34  ? 132 LEU F CG  1 
ATOM   7136  C  CD1 . LEU F  1 132 ? 22.365  0.754   -17.133 1.00 6.38   ? 132 LEU F CD1 1 
ATOM   7137  C  CD2 . LEU F  1 132 ? 21.501  0.303   -19.456 1.00 6.27   ? 132 LEU F CD2 1 
ATOM   7138  N  N   . ILE F  1 133 ? 17.833  3.302   -16.582 1.00 3.46   ? 133 ILE F N   1 
ATOM   7139  C  CA  . ILE F  1 133 ? 16.978  4.493   -16.434 1.00 2.60   ? 133 ILE F CA  1 
ATOM   7140  C  C   . ILE F  1 133 ? 16.996  4.956   -14.968 1.00 8.22   ? 133 ILE F C   1 
ATOM   7141  O  O   . ILE F  1 133 ? 17.264  6.118   -14.629 1.00 6.88   ? 133 ILE F O   1 
ATOM   7142  C  CB  . ILE F  1 133 ? 15.557  4.209   -16.879 1.00 5.56   ? 133 ILE F CB  1 
ATOM   7143  C  CG1 . ILE F  1 133 ? 15.624  3.966   -18.375 1.00 8.42   ? 133 ILE F CG1 1 
ATOM   7144  C  CG2 . ILE F  1 133 ? 14.660  5.390   -16.597 1.00 2.15   ? 133 ILE F CG2 1 
ATOM   7145  C  CD1 . ILE F  1 133 ? 14.278  3.772   -19.074 1.00 1.88   ? 133 ILE F CD1 1 
ATOM   7146  N  N   . ALA F  1 134 ? 16.833  4.009   -14.052 1.00 4.04   ? 134 ALA F N   1 
ATOM   7147  C  CA  . ALA F  1 134 ? 16.909  4.355   -12.624 1.00 2.88   ? 134 ALA F CA  1 
ATOM   7148  C  C   . ALA F  1 134 ? 18.248  4.991   -12.215 1.00 6.19   ? 134 ALA F C   1 
ATOM   7149  O  O   . ALA F  1 134 ? 18.273  5.999   -11.512 1.00 8.86   ? 134 ALA F O   1 
ATOM   7150  C  CB  . ALA F  1 134 ? 16.587  3.113   -11.784 1.00 1.69   ? 134 ALA F CB  1 
ATOM   7151  N  N   . PHE F  1 135 ? 19.362  4.427   -12.679 1.00 1.29   ? 135 PHE F N   1 
ATOM   7152  C  CA  . PHE F  1 135 ? 20.618  5.035   -12.294 1.00 1.73   ? 135 PHE F CA  1 
ATOM   7153  C  C   . PHE F  1 135 ? 20.665  6.409   -12.916 1.00 5.18   ? 135 PHE F C   1 
ATOM   7154  O  O   . PHE F  1 135 ? 21.213  7.340   -12.340 1.00 7.48   ? 135 PHE F O   1 
ATOM   7155  C  CB  . PHE F  1 135 ? 21.816  4.295   -12.868 1.00 8.98   ? 135 PHE F CB  1 
ATOM   7156  C  CG  . PHE F  1 135 ? 21.933  2.878   -12.402 1.00 18.38  ? 135 PHE F CG  1 
ATOM   7157  C  CD1 . PHE F  1 135 ? 21.235  2.431   -11.281 1.00 22.37  ? 135 PHE F CD1 1 
ATOM   7158  C  CD2 . PHE F  1 135 ? 22.805  2.000   -13.035 1.00 22.57  ? 135 PHE F CD2 1 
ATOM   7159  C  CE1 . PHE F  1 135 ? 21.380  1.114   -10.808 1.00 21.50  ? 135 PHE F CE1 1 
ATOM   7160  C  CE2 . PHE F  1 135 ? 23.006  0.696   -12.552 1.00 18.62  ? 135 PHE F CE2 1 
ATOM   7161  C  CZ  . PHE F  1 135 ? 22.266  0.235   -11.448 1.00 13.33  ? 135 PHE F CZ  1 
ATOM   7162  N  N   . LYS F  1 136 ? 20.119  6.550   -14.121 1.00 3.71   ? 136 LYS F N   1 
ATOM   7163  C  CA  . LYS F  1 136 ? 20.189  7.886   -14.741 1.00 4.03   ? 136 LYS F CA  1 
ATOM   7164  C  C   . LYS F  1 136 ? 19.429  8.945   -13.903 1.00 2.78   ? 136 LYS F C   1 
ATOM   7165  O  O   . LYS F  1 136 ? 19.861  10.090  -13.662 1.00 2.83   ? 136 LYS F O   1 
ATOM   7166  C  CB  . LYS F  1 136 ? 19.720  7.906   -16.214 1.00 2.09   ? 136 LYS F CB  1 
ATOM   7167  C  CG  . LYS F  1 136 ? 20.121  9.233   -16.846 1.00 9.30   ? 136 LYS F CG  1 
ATOM   7168  C  CD  . LYS F  1 136 ? 19.892  9.322   -18.340 1.00 6.33   ? 136 LYS F CD  1 
ATOM   7169  C  CE  . LYS F  1 136 ? 18.610  10.068  -18.677 1.00 42.53  ? 136 LYS F CE  1 
ATOM   7170  N  NZ  . LYS F  1 136 ? 18.802  11.508  -18.508 1.00 15.12  ? 136 LYS F NZ  1 
ATOM   7171  N  N   . ALA F  1 137 ? 18.275  8.472   -13.451 1.00 1.00   ? 137 ALA F N   1 
ATOM   7172  C  CA  . ALA F  1 137 ? 17.447  9.364   -12.655 1.00 2.72   ? 137 ALA F CA  1 
ATOM   7173  C  C   . ALA F  1 137 ? 18.292  9.952   -11.531 1.00 7.72   ? 137 ALA F C   1 
ATOM   7174  O  O   . ALA F  1 137 ? 18.308  11.171  -11.325 1.00 8.93   ? 137 ALA F O   1 
ATOM   7175  C  CB  . ALA F  1 137 ? 16.285  8.562   -12.097 1.00 1.73   ? 137 ALA F CB  1 
ATOM   7176  N  N   . SER F  1 138 ? 19.032  9.058   -10.876 1.00 1.00   ? 138 SER F N   1 
ATOM   7177  C  CA  . SER F  1 138 ? 19.846  9.525   -9.770  1.00 1.00   ? 138 SER F CA  1 
ATOM   7178  C  C   . SER F  1 138 ? 20.979  10.456  -10.181 1.00 5.45   ? 138 SER F C   1 
ATOM   7179  O  O   . SER F  1 138 ? 21.274  11.494  -9.557  1.00 4.16   ? 138 SER F O   1 
ATOM   7180  C  CB  . SER F  1 138 ? 20.366  8.304   -9.034  1.00 1.37   ? 138 SER F CB  1 
ATOM   7181  O  OG  . SER F  1 138 ? 21.319  8.737   -8.079  1.00 36.73  ? 138 SER F OG  1 
ATOM   7182  N  N   . ILE F  1 139 ? 21.615  10.074  -11.275 1.00 2.29   ? 139 ILE F N   1 
ATOM   7183  C  CA  . ILE F  1 139 ? 22.691  10.945  -11.708 1.00 3.32   ? 139 ILE F CA  1 
ATOM   7184  C  C   . ILE F  1 139 ? 22.233  12.375  -12.001 1.00 5.26   ? 139 ILE F C   1 
ATOM   7185  O  O   . ILE F  1 139 ? 22.888  13.376  -11.668 1.00 3.08   ? 139 ILE F O   1 
ATOM   7186  C  CB  . ILE F  1 139 ? 23.360  10.311  -12.910 1.00 5.68   ? 139 ILE F CB  1 
ATOM   7187  C  CG1 . ILE F  1 139 ? 24.134  9.063   -12.497 1.00 4.90   ? 139 ILE F CG1 1 
ATOM   7188  C  CG2 . ILE F  1 139 ? 24.304  11.249  -13.619 1.00 1.56   ? 139 ILE F CG2 1 
ATOM   7189  C  CD1 . ILE F  1 139 ? 24.291  8.109   -13.658 1.00 6.62   ? 139 ILE F CD1 1 
ATOM   7190  N  N   . ASP F  1 140 ? 21.070  12.438  -12.637 1.00 2.85   ? 140 ASP F N   1 
ATOM   7191  C  CA  . ASP F  1 140 ? 20.493  13.723  -13.052 1.00 2.88   ? 140 ASP F CA  1 
ATOM   7192  C  C   . ASP F  1 140 ? 20.277  14.586  -11.836 1.00 6.81   ? 140 ASP F C   1 
ATOM   7193  O  O   . ASP F  1 140 ? 20.617  15.760  -11.830 1.00 9.93   ? 140 ASP F O   1 
ATOM   7194  C  CB  . ASP F  1 140 ? 19.172  13.516  -13.784 1.00 10.18  ? 140 ASP F CB  1 
ATOM   7195  C  CG  . ASP F  1 140 ? 19.347  13.042  -15.233 1.00 21.36  ? 140 ASP F CG  1 
ATOM   7196  O  OD1 . ASP F  1 140 ? 20.465  13.226  -15.754 1.00 11.60  ? 140 ASP F OD1 1 
ATOM   7197  O  OD2 . ASP F  1 140 ? 18.384  12.559  -15.879 1.00 14.66  ? 140 ASP F OD2 1 
ATOM   7198  N  N   . LYS F  1 141 ? 19.768  13.985  -10.774 1.00 4.81   ? 141 LYS F N   1 
ATOM   7199  C  CA  . LYS F  1 141 ? 19.517  14.755  -9.550  1.00 3.66   ? 141 LYS F CA  1 
ATOM   7200  C  C   . LYS F  1 141 ? 20.828  15.277  -8.951  1.00 4.04   ? 141 LYS F C   1 
ATOM   7201  O  O   . LYS F  1 141 ? 21.004  16.456  -8.597  1.00 8.28   ? 141 LYS F O   1 
ATOM   7202  C  CB  . LYS F  1 141 ? 18.745  13.850  -8.577  1.00 5.73   ? 141 LYS F CB  1 
ATOM   7203  C  CG  . LYS F  1 141 ? 18.297  14.520  -7.262  1.00 46.18  ? 141 LYS F CG  1 
ATOM   7204  C  CD  . LYS F  1 141 ? 17.812  13.461  -6.297  1.00 84.19  ? 141 LYS F CD  1 
ATOM   7205  C  CE  . LYS F  1 141 ? 17.486  13.953  -4.910  0.00 100.00 ? 141 LYS F CE  1 
ATOM   7206  N  NZ  . LYS F  1 141 ? 16.235  14.739  -4.830  0.00 100.00 ? 141 LYS F NZ  1 
ATOM   7207  N  N   . HIS F  1 142 ? 21.799  14.375  -8.921  1.00 3.73   ? 142 HIS F N   1 
ATOM   7208  C  CA  . HIS F  1 142 ? 23.087  14.773  -8.391  1.00 2.00   ? 142 HIS F CA  1 
ATOM   7209  C  C   . HIS F  1 142 ? 23.612  15.881  -9.237  1.00 5.57   ? 142 HIS F C   1 
ATOM   7210  O  O   . HIS F  1 142 ? 24.193  16.856  -8.726  1.00 7.63   ? 142 HIS F O   1 
ATOM   7211  C  CB  . HIS F  1 142 ? 24.067  13.635  -8.568  1.00 3.22   ? 142 HIS F CB  1 
ATOM   7212  C  CG  . HIS F  1 142 ? 23.875  12.548  -7.555  1.00 7.27   ? 142 HIS F CG  1 
ATOM   7213  N  ND1 . HIS F  1 142 ? 23.859  12.792  -6.192  1.00 8.40   ? 142 HIS F ND1 1 
ATOM   7214  C  CD2 . HIS F  1 142 ? 23.762  11.200  -7.695  1.00 7.47   ? 142 HIS F CD2 1 
ATOM   7215  C  CE1 . HIS F  1 142 ? 23.695  11.646  -5.545  1.00 6.42   ? 142 HIS F CE1 1 
ATOM   7216  N  NE2 . HIS F  1 142 ? 23.620  10.666  -6.429  1.00 7.15   ? 142 HIS F NE2 1 
ATOM   7217  N  N   . ILE F  1 143 ? 23.471  15.704  -10.543 1.00 2.91   ? 143 ILE F N   1 
ATOM   7218  C  CA  . ILE F  1 143 ? 23.988  16.777  -11.384 1.00 5.03   ? 143 ILE F CA  1 
ATOM   7219  C  C   . ILE F  1 143 ? 23.371  18.126  -11.051 1.00 8.47   ? 143 ILE F C   1 
ATOM   7220  O  O   . ILE F  1 143 ? 24.091  19.126  -11.030 1.00 3.02   ? 143 ILE F O   1 
ATOM   7221  C  CB  . ILE F  1 143 ? 23.807  16.448  -12.850 1.00 9.62   ? 143 ILE F CB  1 
ATOM   7222  C  CG1 . ILE F  1 143 ? 24.797  15.352  -13.262 1.00 3.42   ? 143 ILE F CG1 1 
ATOM   7223  C  CG2 . ILE F  1 143 ? 24.068  17.705  -13.661 1.00 8.61   ? 143 ILE F CG2 1 
ATOM   7224  C  CD1 . ILE F  1 143 ? 24.534  14.963  -14.727 1.00 1.27   ? 143 ILE F CD1 1 
ATOM   7225  N  N   . TRP F  1 144 ? 22.068  18.104  -10.752 1.00 3.65   ? 144 TRP F N   1 
ATOM   7226  C  CA  . TRP F  1 144 ? 21.323  19.314  -10.390 1.00 1.00   ? 144 TRP F CA  1 
ATOM   7227  C  C   . TRP F  1 144 ? 21.884  19.892  -9.093  1.00 7.82   ? 144 TRP F C   1 
ATOM   7228  O  O   . TRP F  1 144 ? 22.291  21.061  -9.019  1.00 11.06  ? 144 TRP F O   1 
ATOM   7229  C  CB  . TRP F  1 144 ? 19.814  19.073  -10.324 1.00 1.97   ? 144 TRP F CB  1 
ATOM   7230  C  CG  . TRP F  1 144 ? 19.101  20.054  -9.394  1.00 6.37   ? 144 TRP F CG  1 
ATOM   7231  C  CD1 . TRP F  1 144 ? 19.190  21.426  -9.390  1.00 10.05  ? 144 TRP F CD1 1 
ATOM   7232  C  CD2 . TRP F  1 144 ? 18.330  19.713  -8.223  1.00 5.54   ? 144 TRP F CD2 1 
ATOM   7233  N  NE1 . TRP F  1 144 ? 18.529  21.944  -8.286  1.00 9.18   ? 144 TRP F NE1 1 
ATOM   7234  C  CE2 . TRP F  1 144 ? 17.976  20.916  -7.587  1.00 7.80   ? 144 TRP F CE2 1 
ATOM   7235  C  CE3 . TRP F  1 144 ? 17.975  18.500  -7.633  1.00 5.32   ? 144 TRP F CE3 1 
ATOM   7236  C  CZ2 . TRP F  1 144 ? 17.236  20.937  -6.406  1.00 6.72   ? 144 TRP F CZ2 1 
ATOM   7237  C  CZ3 . TRP F  1 144 ? 17.206  18.533  -6.488  1.00 6.40   ? 144 TRP F CZ3 1 
ATOM   7238  C  CH2 . TRP F  1 144 ? 16.862  19.744  -5.878  1.00 6.80   ? 144 TRP F CH2 1 
ATOM   7239  N  N   . MET F  1 145 ? 21.977  19.024  -8.087  1.00 5.14   ? 145 MET F N   1 
ATOM   7240  C  CA  . MET F  1 145 ? 22.548  19.506  -6.822  1.00 2.55   ? 145 MET F CA  1 
ATOM   7241  C  C   . MET F  1 145 ? 24.032  19.987  -6.872  1.00 9.89   ? 145 MET F C   1 
ATOM   7242  O  O   . MET F  1 145 ? 24.410  21.001  -6.260  1.00 7.22   ? 145 MET F O   1 
ATOM   7243  C  CB  . MET F  1 145 ? 22.333  18.484  -5.696  1.00 3.37   ? 145 MET F CB  1 
ATOM   7244  C  CG  . MET F  1 145 ? 20.909  18.041  -5.597  1.00 8.31   ? 145 MET F CG  1 
ATOM   7245  S  SD  . MET F  1 145 ? 20.602  16.879  -4.240  1.00 13.85  ? 145 MET F SD  1 
ATOM   7246  C  CE  . MET F  1 145 ? 21.527  15.578  -4.855  1.00 20.57  ? 145 MET F CE  1 
ATOM   7247  N  N   . PHE F  1 146 ? 24.920  19.240  -7.532  1.00 4.67   ? 146 PHE F N   1 
ATOM   7248  C  CA  . PHE F  1 146 ? 26.305  19.723  -7.509  1.00 6.12   ? 146 PHE F CA  1 
ATOM   7249  C  C   . PHE F  1 146 ? 26.411  21.030  -8.282  1.00 9.67   ? 146 PHE F C   1 
ATOM   7250  O  O   . PHE F  1 146 ? 27.211  21.908  -7.945  1.00 8.80   ? 146 PHE F O   1 
ATOM   7251  C  CB  . PHE F  1 146 ? 27.299  18.629  -7.904  1.00 7.23   ? 146 PHE F CB  1 
ATOM   7252  C  CG  . PHE F  1 146 ? 27.553  17.642  -6.795  1.00 9.63   ? 146 PHE F CG  1 
ATOM   7253  C  CD1 . PHE F  1 146 ? 28.385  17.975  -5.720  1.00 9.60   ? 146 PHE F CD1 1 
ATOM   7254  C  CD2 . PHE F  1 146 ? 26.802  16.484  -6.698  1.00 10.00  ? 146 PHE F CD2 1 
ATOM   7255  C  CE1 . PHE F  1 146 ? 28.560  17.133  -4.613  1.00 8.92   ? 146 PHE F CE1 1 
ATOM   7256  C  CE2 . PHE F  1 146 ? 26.956  15.614  -5.591  1.00 12.19  ? 146 PHE F CE2 1 
ATOM   7257  C  CZ  . PHE F  1 146 ? 27.841  15.923  -4.546  1.00 10.68  ? 146 PHE F CZ  1 
ATOM   7258  N  N   . LYS F  1 147 ? 25.549  21.169  -9.291  1.00 3.19   ? 147 LYS F N   1 
ATOM   7259  C  CA  . LYS F  1 147 ? 25.596  22.383  -10.101 1.00 3.58   ? 147 LYS F CA  1 
ATOM   7260  C  C   . LYS F  1 147 ? 25.123  23.549  -9.271  1.00 10.01  ? 147 LYS F C   1 
ATOM   7261  O  O   . LYS F  1 147 ? 25.763  24.592  -9.193  1.00 10.45  ? 147 LYS F O   1 
ATOM   7262  C  CB  . LYS F  1 147 ? 24.951  22.290  -11.492 1.00 5.08   ? 147 LYS F CB  1 
ATOM   7263  C  CG  . LYS F  1 147 ? 25.846  21.512  -12.459 1.00 7.56   ? 147 LYS F CG  1 
ATOM   7264  C  CD  . LYS F  1 147 ? 25.885  22.068  -13.869 1.00 26.97  ? 147 LYS F CD  1 
ATOM   7265  C  CE  . LYS F  1 147 ? 27.125  21.579  -14.634 1.00 13.32  ? 147 LYS F CE  1 
ATOM   7266  N  NZ  . LYS F  1 147 ? 27.282  22.271  -15.956 1.00 60.26  ? 147 LYS F NZ  1 
ATOM   7267  N  N   . ALA F  1 148 ? 24.047  23.276  -8.560  1.00 5.87   ? 148 ALA F N   1 
ATOM   7268  C  CA  . ALA F  1 148 ? 23.555  24.339  -7.697  1.00 5.59   ? 148 ALA F CA  1 
ATOM   7269  C  C   . ALA F  1 148 ? 24.624  24.731  -6.698  1.00 7.30   ? 148 ALA F C   1 
ATOM   7270  O  O   . ALA F  1 148 ? 24.765  25.910  -6.412  1.00 6.38   ? 148 ALA F O   1 
ATOM   7271  C  CB  . ALA F  1 148 ? 22.284  23.918  -6.971  1.00 4.70   ? 148 ALA F CB  1 
ATOM   7272  N  N   . PHE F  1 149 ? 25.358  23.755  -6.170  1.00 5.94   ? 149 PHE F N   1 
ATOM   7273  C  CA  . PHE F  1 149 ? 26.402  24.022  -5.184  1.00 2.90   ? 149 PHE F CA  1 
ATOM   7274  C  C   . PHE F  1 149 ? 27.419  24.946  -5.819  1.00 14.60  ? 149 PHE F C   1 
ATOM   7275  O  O   . PHE F  1 149 ? 27.963  25.827  -5.129  1.00 14.34  ? 149 PHE F O   1 
ATOM   7276  C  CB  . PHE F  1 149 ? 27.093  22.720  -4.806  1.00 4.77   ? 149 PHE F CB  1 
ATOM   7277  C  CG  . PHE F  1 149 ? 28.412  22.914  -4.071  1.00 8.14   ? 149 PHE F CG  1 
ATOM   7278  C  CD1 . PHE F  1 149 ? 28.426  23.204  -2.712  1.00 7.83   ? 149 PHE F CD1 1 
ATOM   7279  C  CD2 . PHE F  1 149 ? 29.654  22.772  -4.723  1.00 7.49   ? 149 PHE F CD2 1 
ATOM   7280  C  CE1 . PHE F  1 149 ? 29.658  23.387  -2.046  1.00 5.82   ? 149 PHE F CE1 1 
ATOM   7281  C  CE2 . PHE F  1 149 ? 30.856  22.960  -4.055  1.00 6.18   ? 149 PHE F CE2 1 
ATOM   7282  C  CZ  . PHE F  1 149 ? 30.866  23.268  -2.717  1.00 5.01   ? 149 PHE F CZ  1 
ATOM   7283  N  N   . LEU F  1 150 ? 27.697  24.675  -7.100  1.00 11.10  ? 150 LEU F N   1 
ATOM   7284  C  CA  . LEU F  1 150 ? 28.656  25.454  -7.897  1.00 9.03   ? 150 LEU F CA  1 
ATOM   7285  C  C   . LEU F  1 150 ? 28.104  26.793  -8.421  1.00 22.45  ? 150 LEU F C   1 
ATOM   7286  O  O   . LEU F  1 150 ? 28.785  27.529  -9.136  1.00 20.28  ? 150 LEU F O   1 
ATOM   7287  C  CB  . LEU F  1 150 ? 29.108  24.627  -9.102  1.00 4.50   ? 150 LEU F CB  1 
ATOM   7288  C  CG  . LEU F  1 150 ? 30.126  23.561  -8.700  1.00 8.82   ? 150 LEU F CG  1 
ATOM   7289  C  CD1 . LEU F  1 150 ? 30.401  22.729  -9.924  1.00 9.68   ? 150 LEU F CD1 1 
ATOM   7290  C  CD2 . LEU F  1 150 ? 31.449  24.120  -8.265  1.00 6.43   ? 150 LEU F CD2 1 
ATOM   7291  N  N   . GLY F  1 151 ? 26.841  27.076  -8.132  1.00 14.75  ? 151 GLY F N   1 
ATOM   7292  C  CA  . GLY F  1 151 ? 26.233  28.311  -8.581  1.00 9.75   ? 151 GLY F CA  1 
ATOM   7293  C  C   . GLY F  1 151 ? 25.676  28.257  -9.980  1.00 17.12  ? 151 GLY F C   1 
ATOM   7294  O  O   . GLY F  1 151 ? 25.289  29.261  -10.549 1.00 24.44  ? 151 GLY F O   1 
ATOM   7295  N  N   . LYS F  1 152 ? 25.626  27.070  -10.544 1.00 15.47  ? 152 LYS F N   1 
ATOM   7296  C  CA  . LYS F  1 152 ? 25.144  26.983  -11.899 1.00 9.13   ? 152 LYS F CA  1 
ATOM   7297  C  C   . LYS F  1 152 ? 23.789  26.312  -12.050 1.00 16.60  ? 152 LYS F C   1 
ATOM   7298  O  O   . LYS F  1 152 ? 23.282  25.686  -11.122 1.00 14.87  ? 152 LYS F O   1 
ATOM   7299  C  CB  . LYS F  1 152 ? 26.221  26.212  -12.656 1.00 14.91  ? 152 LYS F CB  1 
ATOM   7300  C  CG  . LYS F  1 152 ? 27.611  26.868  -12.663 1.00 62.96  ? 152 LYS F CG  1 
ATOM   7301  C  CD  . LYS F  1 152 ? 27.485  28.260  -13.284 0.00 100.00 ? 152 LYS F CD  1 
ATOM   7302  C  CE  . LYS F  1 152 ? 28.737  29.100  -13.260 0.00 100.00 ? 152 LYS F CE  1 
ATOM   7303  N  NZ  . LYS F  1 152 ? 28.457  30.488  -13.722 0.00 100.00 ? 152 LYS F NZ  1 
ATOM   7304  N  N   . ALA F  1 153 ? 23.216  26.439  -13.241 1.00 15.75  ? 153 ALA F N   1 
ATOM   7305  C  CA  . ALA F  1 153 ? 21.948  25.780  -13.528 1.00 10.58  ? 153 ALA F CA  1 
ATOM   7306  C  C   . ALA F  1 153 ? 22.441  24.390  -13.903 1.00 15.67  ? 153 ALA F C   1 
ATOM   7307  O  O   . ALA F  1 153 ? 23.600  24.218  -14.228 1.00 12.00  ? 153 ALA F O   1 
ATOM   7308  C  CB  . ALA F  1 153 ? 21.218  26.431  -14.727 1.00 7.96   ? 153 ALA F CB  1 
ATOM   7309  N  N   . PRO F  1 154 ? 21.554  23.406  -13.898 1.00 14.74  ? 154 PRO F N   1 
ATOM   7310  C  CA  . PRO F  1 154 ? 21.917  22.009  -14.167 1.00 10.28  ? 154 PRO F CA  1 
ATOM   7311  C  C   . PRO F  1 154 ? 22.497  21.730  -15.552 1.00 14.92  ? 154 PRO F C   1 
ATOM   7312  O  O   . PRO F  1 154 ? 23.502  21.038  -15.697 1.00 18.17  ? 154 PRO F O   1 
ATOM   7313  C  CB  . PRO F  1 154 ? 20.570  21.263  -14.077 1.00 11.01  ? 154 PRO F CB  1 
ATOM   7314  C  CG  . PRO F  1 154 ? 19.606  22.184  -13.321 1.00 13.20  ? 154 PRO F CG  1 
ATOM   7315  C  CD  . PRO F  1 154 ? 20.125  23.604  -13.591 1.00 11.52  ? 154 PRO F CD  1 
ATOM   7316  N  N   . LEU F  1 155 ? 21.779  22.184  -16.572 1.00 19.82  ? 155 LEU F N   1 
ATOM   7317  C  CA  . LEU F  1 155 ? 22.234  21.928  -17.919 1.00 19.54  ? 155 LEU F CA  1 
ATOM   7318  C  C   . LEU F  1 155 ? 23.129  23.050  -18.416 1.00 43.71  ? 155 LEU F C   1 
ATOM   7319  O  O   . LEU F  1 155 ? 23.622  23.057  -19.543 1.00 35.56  ? 155 LEU F O   1 
ATOM   7320  C  CB  . LEU F  1 155 ? 21.031  21.660  -18.823 1.00 18.88  ? 155 LEU F CB  1 
ATOM   7321  C  CG  . LEU F  1 155 ? 20.208  20.524  -18.195 1.00 28.06  ? 155 LEU F CG  1 
ATOM   7322  C  CD1 . LEU F  1 155 ? 18.966  20.217  -19.025 1.00 23.29  ? 155 LEU F CD1 1 
ATOM   7323  C  CD2 . LEU F  1 155 ? 21.039  19.282  -17.902 1.00 19.02  ? 155 LEU F CD2 1 
ATOM   7324  N  N   . GLU F  1 156 ? 23.284  24.028  -17.542 1.00 59.15  ? 156 GLU F N   1 
ATOM   7325  C  CA  . GLU F  1 156 ? 24.069  25.222  -17.770 0.00 100.00 ? 156 GLU F CA  1 
ATOM   7326  C  C   . GLU F  1 156 ? 25.226  24.992  -18.740 0.00 100.00 ? 156 GLU F C   1 
ATOM   7327  O  O   . GLU F  1 156 ? 26.145  25.810  -18.806 0.00 100.00 ? 156 GLU F O   1 
ATOM   7328  C  CB  . GLU F  1 156 ? 24.719  25.634  -16.463 1.00 35.27  ? 156 GLU F CB  1 
ATOM   7329  C  CG  . GLU F  1 156 ? 25.138  27.098  -16.286 0.00 100.00 ? 156 GLU F CG  1 
ATOM   7330  C  CD  . GLU F  1 156 ? 24.002  28.079  -16.079 0.00 100.00 ? 156 GLU F CD  1 
ATOM   7331  O  OE1 . GLU F  1 156 ? 22.946  27.963  -16.667 0.00 100.00 ? 156 GLU F OE1 1 
ATOM   7332  O  OE2 . GLU F  1 156 ? 24.141  29.047  -15.258 1.00 95.69  ? 156 GLU F OE2 1 
ATOM   7333  N  N   . VAL G  1 7   ? -12.134 24.050  47.008  1.00 75.91  ? 7   VAL G N   1 
ATOM   7334  C  CA  . VAL G  1 7   ? -10.967 23.186  47.145  1.00 74.02  ? 7   VAL G CA  1 
ATOM   7335  C  C   . VAL G  1 7   ? -9.580  23.851  46.866  1.00 68.04  ? 7   VAL G C   1 
ATOM   7336  O  O   . VAL G  1 7   ? -9.490  24.968  46.347  1.00 77.14  ? 7   VAL G O   1 
ATOM   7337  C  CB  . VAL G  1 7   ? -10.944 21.936  46.278  1.00 76.85  ? 7   VAL G CB  1 
ATOM   7338  C  CG1 . VAL G  1 7   ? -10.950 20.642  47.095  1.00 74.70  ? 7   VAL G CG1 1 
ATOM   7339  C  CG2 . VAL G  1 7   ? -12.145 21.839  45.335  1.00 78.70  ? 7   VAL G CG2 1 
ATOM   7340  N  N   . ASP G  1 8   ? -8.516  23.100  47.267  1.00 38.03  ? 8   ASP G N   1 
ATOM   7341  C  CA  . ASP G  1 8   ? -7.075  23.463  47.051  1.00 28.87  ? 8   ASP G CA  1 
ATOM   7342  C  C   . ASP G  1 8   ? -6.450  22.424  46.094  1.00 15.77  ? 8   ASP G C   1 
ATOM   7343  O  O   . ASP G  1 8   ? -7.031  21.359  45.844  1.00 11.38  ? 8   ASP G O   1 
ATOM   7344  C  CB  . ASP G  1 8   ? -6.296  23.506  48.384  1.00 26.23  ? 8   ASP G CB  1 
ATOM   7345  C  CG  . ASP G  1 8   ? -5.903  22.126  48.928  1.00 34.17  ? 8   ASP G CG  1 
ATOM   7346  O  OD1 . ASP G  1 8   ? -6.355  21.059  48.367  1.00 44.19  ? 8   ASP G OD1 1 
ATOM   7347  O  OD2 . ASP G  1 8   ? -5.126  22.033  49.958  1.00 46.42  ? 8   ASP G OD2 1 
ATOM   7348  N  N   . THR G  1 9   ? -5.279  22.753  45.580  1.00 8.10   ? 9   THR G N   1 
ATOM   7349  C  CA  . THR G  1 9   ? -4.581  21.920  44.578  1.00 10.13  ? 9   THR G CA  1 
ATOM   7350  C  C   . THR G  1 9   ? -4.494  20.441  44.994  1.00 10.45  ? 9   THR G C   1 
ATOM   7351  O  O   . THR G  1 9   ? -4.877  19.538  44.241  1.00 7.97   ? 9   THR G O   1 
ATOM   7352  C  CB  . THR G  1 9   ? -3.173  22.450  44.329  1.00 18.03  ? 9   THR G CB  1 
ATOM   7353  O  OG1 . THR G  1 9   ? -3.239  23.818  43.950  1.00 14.20  ? 9   THR G OG1 1 
ATOM   7354  C  CG2 . THR G  1 9   ? -2.451  21.701  43.206  1.00 16.76  ? 9   THR G CG2 1 
ATOM   7355  N  N   . LYS G  1 10  ? -3.985  20.189  46.182  1.00 1.45   ? 10  LYS G N   1 
ATOM   7356  C  CA  . LYS G  1 10  ? -3.831  18.805  46.670  1.00 4.90   ? 10  LYS G CA  1 
ATOM   7357  C  C   . LYS G  1 10  ? -5.151  18.043  46.541  1.00 13.06  ? 10  LYS G C   1 
ATOM   7358  O  O   . LYS G  1 10  ? -5.205  16.926  46.013  1.00 19.45  ? 10  LYS G O   1 
ATOM   7359  C  CB  . LYS G  1 10  ? -3.394  18.802  48.126  1.00 3.00   ? 10  LYS G CB  1 
ATOM   7360  C  CG  . LYS G  1 10  ? -1.969  19.315  48.302  1.00 6.71   ? 10  LYS G CG  1 
ATOM   7361  C  CD  . LYS G  1 10  ? -1.340  18.889  49.625  1.00 10.49  ? 10  LYS G CD  1 
ATOM   7362  C  CE  . LYS G  1 10  ? -0.204  19.813  50.060  1.00 55.96  ? 10  LYS G CE  1 
ATOM   7363  N  NZ  . LYS G  1 10  ? 0.209   19.595  51.452  1.00 93.86  ? 10  LYS G NZ  1 
ATOM   7364  N  N   . GLU G  1 11  ? -6.199  18.663  47.032  1.00 9.55   ? 11  GLU G N   1 
ATOM   7365  C  CA  . GLU G  1 11  ? -7.532  18.065  46.984  1.00 13.69  ? 11  GLU G CA  1 
ATOM   7366  C  C   . GLU G  1 11  ? -7.981  17.908  45.538  1.00 10.67  ? 11  GLU G C   1 
ATOM   7367  O  O   . GLU G  1 11  ? -8.628  16.914  45.241  1.00 9.64   ? 11  GLU G O   1 
ATOM   7368  C  CB  . GLU G  1 11  ? -8.544  18.957  47.710  1.00 19.42  ? 11  GLU G CB  1 
ATOM   7369  C  CG  . GLU G  1 11  ? -8.802  18.522  49.154  1.00 72.91  ? 11  GLU G CG  1 
ATOM   7370  C  CD  . GLU G  1 11  ? -7.570  18.674  50.043  0.00 100.00 ? 11  GLU G CD  1 
ATOM   7371  O  OE1 . GLU G  1 11  ? -6.541  17.920  49.850  0.00 100.00 ? 11  GLU G OE1 1 
ATOM   7372  O  OE2 . GLU G  1 11  ? -7.557  19.557  50.983  0.00 100.00 ? 11  GLU G OE2 1 
ATOM   7373  N  N   . PHE G  1 12  ? -7.694  18.903  44.701  1.00 2.31   ? 12  PHE G N   1 
ATOM   7374  C  CA  . PHE G  1 12  ? -8.110  18.795  43.338  1.00 1.95   ? 12  PHE G CA  1 
ATOM   7375  C  C   . PHE G  1 12  ? -7.360  17.634  42.722  1.00 7.30   ? 12  PHE G C   1 
ATOM   7376  O  O   . PHE G  1 12  ? -7.929  16.724  42.111  1.00 6.47   ? 12  PHE G O   1 
ATOM   7377  C  CB  . PHE G  1 12  ? -7.758  20.050  42.586  1.00 5.94   ? 12  PHE G CB  1 
ATOM   7378  C  CG  . PHE G  1 12  ? -8.018  19.890  41.113  1.00 11.45  ? 12  PHE G CG  1 
ATOM   7379  C  CD1 . PHE G  1 12  ? -9.281  20.105  40.570  1.00 10.90  ? 12  PHE G CD1 1 
ATOM   7380  C  CD2 . PHE G  1 12  ? -7.024  19.379  40.262  1.00 17.88  ? 12  PHE G CD2 1 
ATOM   7381  C  CE1 . PHE G  1 12  ? -9.505  19.937  39.218  1.00 12.85  ? 12  PHE G CE1 1 
ATOM   7382  C  CE2 . PHE G  1 12  ? -7.249  19.194  38.897  1.00 13.89  ? 12  PHE G CE2 1 
ATOM   7383  C  CZ  . PHE G  1 12  ? -8.496  19.466  38.375  1.00 13.05  ? 12  PHE G CZ  1 
ATOM   7384  N  N   . LEU G  1 13  ? -6.066  17.633  42.962  1.00 2.82   ? 13  LEU G N   1 
ATOM   7385  C  CA  . LEU G  1 13  ? -5.304  16.539  42.393  1.00 3.82   ? 13  LEU G CA  1 
ATOM   7386  C  C   . LEU G  1 13  ? -5.752  15.178  42.806  1.00 5.82   ? 13  LEU G C   1 
ATOM   7387  O  O   . LEU G  1 13  ? -5.985  14.324  41.970  1.00 11.19  ? 13  LEU G O   1 
ATOM   7388  C  CB  . LEU G  1 13  ? -3.820  16.736  42.629  1.00 2.38   ? 13  LEU G CB  1 
ATOM   7389  C  CG  . LEU G  1 13  ? -2.951  17.336  41.523  1.00 7.06   ? 13  LEU G CG  1 
ATOM   7390  C  CD1 . LEU G  1 13  ? -3.622  18.040  40.390  1.00 1.44   ? 13  LEU G CD1 1 
ATOM   7391  C  CD2 . LEU G  1 13  ? -1.854  18.196  42.139  1.00 1.00   ? 13  LEU G CD2 1 
ATOM   7392  N  N   . ASN G  1 14  ? -5.935  14.989  44.096  1.00 1.87   ? 14  ASN G N   1 
ATOM   7393  C  CA  . ASN G  1 14  ? -6.355  13.663  44.534  1.00 6.11   ? 14  ASN G CA  1 
ATOM   7394  C  C   . ASN G  1 14  ? -7.724  13.277  43.939  1.00 10.61  ? 14  ASN G C   1 
ATOM   7395  O  O   . ASN G  1 14  ? -7.992  12.106  43.598  1.00 11.75  ? 14  ASN G O   1 
ATOM   7396  C  CB  . ASN G  1 14  ? -6.376  13.671  46.058  1.00 3.33   ? 14  ASN G CB  1 
ATOM   7397  C  CG  . ASN G  1 14  ? -5.903  12.366  46.649  1.00 21.13  ? 14  ASN G CG  1 
ATOM   7398  O  OD1 . ASN G  1 14  ? -5.524  11.418  45.970  1.00 13.99  ? 14  ASN G OD1 1 
ATOM   7399  N  ND2 . ASN G  1 14  ? -5.871  12.342  47.965  1.00 12.14  ? 14  ASN G ND2 1 
ATOM   7400  N  N   . HIS G  1 15  ? -8.564  14.298  43.745  1.00 5.39   ? 15  HIS G N   1 
ATOM   7401  C  CA  . HIS G  1 15  ? -9.867  14.017  43.185  1.00 7.65   ? 15  HIS G CA  1 
ATOM   7402  C  C   . HIS G  1 15  ? -9.685  13.399  41.806  1.00 8.03   ? 15  HIS G C   1 
ATOM   7403  O  O   . HIS G  1 15  ? -10.398 12.469  41.436  1.00 9.18   ? 15  HIS G O   1 
ATOM   7404  C  CB  . HIS G  1 15  ? -10.750 15.260  43.158  1.00 9.43   ? 15  HIS G CB  1 
ATOM   7405  C  CG  . HIS G  1 15  ? -12.127 14.985  42.636  1.00 18.40  ? 15  HIS G CG  1 
ATOM   7406  N  ND1 . HIS G  1 15  ? -12.584 15.498  41.440  1.00 24.29  ? 15  HIS G ND1 1 
ATOM   7407  C  CD2 . HIS G  1 15  ? -13.126 14.205  43.118  1.00 18.95  ? 15  HIS G CD2 1 
ATOM   7408  C  CE1 . HIS G  1 15  ? -13.812 15.072  41.227  1.00 22.66  ? 15  HIS G CE1 1 
ATOM   7409  N  NE2 . HIS G  1 15  ? -14.161 14.271  42.221  1.00 21.53  ? 15  HIS G NE2 1 
ATOM   7410  N  N   . GLN G  1 16  ? -8.703  13.889  41.071  1.00 2.34   ? 16  GLN G N   1 
ATOM   7411  C  CA  . GLN G  1 16  ? -8.475  13.360  39.737  1.00 2.76   ? 16  GLN G CA  1 
ATOM   7412  C  C   . GLN G  1 16  ? -7.876  11.983  39.762  1.00 7.18   ? 16  GLN G C   1 
ATOM   7413  O  O   . GLN G  1 16  ? -8.139  11.181  38.867  1.00 6.97   ? 16  GLN G O   1 
ATOM   7414  C  CB  . GLN G  1 16  ? -7.692  14.327  38.858  1.00 1.02   ? 16  GLN G CB  1 
ATOM   7415  C  CG  . GLN G  1 16  ? -8.376  15.684  38.827  1.00 7.41   ? 16  GLN G CG  1 
ATOM   7416  C  CD  . GLN G  1 16  ? -9.829  15.566  38.372  1.00 18.48  ? 16  GLN G CD  1 
ATOM   7417  O  OE1 . GLN G  1 16  ? -10.190 14.664  37.624  1.00 6.13   ? 16  GLN G OE1 1 
ATOM   7418  N  NE2 . GLN G  1 16  ? -10.659 16.504  38.807  1.00 13.21  ? 16  GLN G NE2 1 
ATOM   7419  N  N   . VAL G  1 17  ? -7.165  11.712  40.854  1.00 2.64   ? 17  VAL G N   1 
ATOM   7420  C  CA  . VAL G  1 17  ? -6.587  10.382  40.938  1.00 1.98   ? 17  VAL G CA  1 
ATOM   7421  C  C   . VAL G  1 17  ? -7.752  9.413   40.980  1.00 5.05   ? 17  VAL G C   1 
ATOM   7422  O  O   . VAL G  1 17  ? -7.815  8.435   40.251  1.00 8.97   ? 17  VAL G O   1 
ATOM   7423  C  CB  . VAL G  1 17  ? -5.630  10.178  42.141  1.00 2.86   ? 17  VAL G CB  1 
ATOM   7424  C  CG1 . VAL G  1 17  ? -5.275  8.669   42.319  1.00 1.00   ? 17  VAL G CG1 1 
ATOM   7425  C  CG2 . VAL G  1 17  ? -4.350  11.024  41.993  1.00 1.00   ? 17  VAL G CG2 1 
ATOM   7426  N  N   . ALA G  1 18  ? -8.744  9.745   41.790  1.00 4.11   ? 18  ALA G N   1 
ATOM   7427  C  CA  . ALA G  1 18  ? -9.945  8.930   41.866  1.00 3.84   ? 18  ALA G CA  1 
ATOM   7428  C  C   . ALA G  1 18  ? -10.663 8.874   40.528  1.00 4.22   ? 18  ALA G C   1 
ATOM   7429  O  O   . ALA G  1 18  ? -10.962 7.794   40.051  1.00 8.51   ? 18  ALA G O   1 
ATOM   7430  C  CB  . ALA G  1 18  ? -10.859 9.474   42.925  1.00 3.14   ? 18  ALA G CB  1 
ATOM   7431  N  N   . ASN G  1 19  ? -10.920 10.014  39.888  1.00 1.70   ? 19  ASN G N   1 
ATOM   7432  C  CA  . ASN G  1 19  ? -11.601 10.033  38.586  1.00 2.76   ? 19  ASN G CA  1 
ATOM   7433  C  C   . ASN G  1 19  ? -10.909 9.193   37.510  1.00 9.13   ? 19  ASN G C   1 
ATOM   7434  O  O   . ASN G  1 19  ? -11.549 8.453   36.761  1.00 9.05   ? 19  ASN G O   1 
ATOM   7435  C  CB  . ASN G  1 19  ? -11.702 11.443  37.995  1.00 4.32   ? 19  ASN G CB  1 
ATOM   7436  C  CG  . ASN G  1 19  ? -12.805 12.244  38.608  1.00 14.65  ? 19  ASN G CG  1 
ATOM   7437  O  OD1 . ASN G  1 19  ? -13.650 11.700  39.315  1.00 9.68   ? 19  ASN G OD1 1 
ATOM   7438  N  ND2 . ASN G  1 19  ? -12.832 13.525  38.317  1.00 2.70   ? 19  ASN G ND2 1 
ATOM   7439  N  N   . LEU G  1 20  ? -9.603  9.399   37.407  1.00 9.80   ? 20  LEU G N   1 
ATOM   7440  C  CA  . LEU G  1 20  ? -8.823  8.731   36.394  1.00 6.86   ? 20  LEU G CA  1 
ATOM   7441  C  C   . LEU G  1 20  ? -8.887  7.213   36.568  1.00 7.62   ? 20  LEU G C   1 
ATOM   7442  O  O   . LEU G  1 20  ? -9.073  6.480   35.590  1.00 6.74   ? 20  LEU G O   1 
ATOM   7443  C  CB  . LEU G  1 20  ? -7.445  9.358   36.445  1.00 4.96   ? 20  LEU G CB  1 
ATOM   7444  C  CG  . LEU G  1 20  ? -6.994  10.366  35.389  1.00 3.22   ? 20  LEU G CG  1 
ATOM   7445  C  CD1 . LEU G  1 20  ? -8.043  10.922  34.485  1.00 1.61   ? 20  LEU G CD1 1 
ATOM   7446  C  CD2 . LEU G  1 20  ? -6.137  11.480  35.941  1.00 1.00   ? 20  LEU G CD2 1 
ATOM   7447  N  N   . ASN G  1 21  ? -8.851  6.733   37.807  1.00 1.00   ? 21  ASN G N   1 
ATOM   7448  C  CA  . ASN G  1 21  ? -9.003  5.299   38.038  1.00 1.16   ? 21  ASN G CA  1 
ATOM   7449  C  C   . ASN G  1 21  ? -10.339 4.715   37.654  1.00 8.74   ? 21  ASN G C   1 
ATOM   7450  O  O   . ASN G  1 21  ? -10.420 3.579   37.215  1.00 13.00  ? 21  ASN G O   1 
ATOM   7451  C  CB  . ASN G  1 21  ? -8.694  4.914   39.472  1.00 6.27   ? 21  ASN G CB  1 
ATOM   7452  C  CG  . ASN G  1 21  ? -7.218  4.760   39.678  1.00 20.79  ? 21  ASN G CG  1 
ATOM   7453  O  OD1 . ASN G  1 21  ? -6.696  3.715   39.337  1.00 16.22  ? 21  ASN G OD1 1 
ATOM   7454  N  ND2 . ASN G  1 21  ? -6.503  5.837   39.979  1.00 11.26  ? 21  ASN G ND2 1 
ATOM   7455  N  N   . VAL G  1 22  ? -11.385 5.513   37.777  1.00 8.83   ? 22  VAL G N   1 
ATOM   7456  C  CA  . VAL G  1 22  ? -12.691 5.055   37.365  1.00 5.79   ? 22  VAL G CA  1 
ATOM   7457  C  C   . VAL G  1 22  ? -12.755 5.123   35.846  1.00 5.23   ? 22  VAL G C   1 
ATOM   7458  O  O   . VAL G  1 22  ? -13.253 4.199   35.189  1.00 3.85   ? 22  VAL G O   1 
ATOM   7459  C  CB  . VAL G  1 22  ? -13.820 5.924   37.947  1.00 5.95   ? 22  VAL G CB  1 
ATOM   7460  C  CG1 . VAL G  1 22  ? -15.207 5.498   37.439  1.00 5.73   ? 22  VAL G CG1 1 
ATOM   7461  C  CG2 . VAL G  1 22  ? -13.794 5.903   39.472  1.00 2.74   ? 22  VAL G CG2 1 
ATOM   7462  N  N   . PHE G  1 23  ? -12.201 6.182   35.274  1.00 1.00   ? 23  PHE G N   1 
ATOM   7463  C  CA  . PHE G  1 23  ? -12.274 6.304   33.827  1.00 1.00   ? 23  PHE G CA  1 
ATOM   7464  C  C   . PHE G  1 23  ? -11.579 5.157   33.119  1.00 9.46   ? 23  PHE G C   1 
ATOM   7465  O  O   . PHE G  1 23  ? -12.013 4.571   32.110  1.00 7.42   ? 23  PHE G O   1 
ATOM   7466  C  CB  . PHE G  1 23  ? -11.567 7.587   33.437  1.00 2.15   ? 23  PHE G CB  1 
ATOM   7467  C  CG  . PHE G  1 23  ? -11.676 7.889   31.973  1.00 4.74   ? 23  PHE G CG  1 
ATOM   7468  C  CD1 . PHE G  1 23  ? -12.798 7.463   31.249  1.00 11.81  ? 23  PHE G CD1 1 
ATOM   7469  C  CD2 . PHE G  1 23  ? -10.756 8.709   31.368  1.00 5.11   ? 23  PHE G CD2 1 
ATOM   7470  C  CE1 . PHE G  1 23  ? -12.958 7.807   29.897  1.00 7.29   ? 23  PHE G CE1 1 
ATOM   7471  C  CE2 . PHE G  1 23  ? -10.874 9.012   30.028  1.00 2.73   ? 23  PHE G CE2 1 
ATOM   7472  C  CZ  . PHE G  1 23  ? -11.993 8.583   29.292  1.00 1.39   ? 23  PHE G CZ  1 
ATOM   7473  N  N   . THR G  1 24  ? -10.435 4.837   33.694  1.00 2.48   ? 24  THR G N   1 
ATOM   7474  C  CA  . THR G  1 24  ? -9.637  3.804   33.077  1.00 1.36   ? 24  THR G CA  1 
ATOM   7475  C  C   . THR G  1 24  ? -10.353 2.460   33.027  1.00 9.18   ? 24  THR G C   1 
ATOM   7476  O  O   . THR G  1 24  ? -10.270 1.710   32.061  1.00 3.79   ? 24  THR G O   1 
ATOM   7477  C  CB  . THR G  1 24  ? -8.295  3.837   33.810  1.00 7.29   ? 24  THR G CB  1 
ATOM   7478  O  OG1 . THR G  1 24  ? -7.230  3.722   32.866  1.00 37.19  ? 24  THR G OG1 1 
ATOM   7479  C  CG2 . THR G  1 24  ? -8.213  2.842   34.943  1.00 1.84   ? 24  THR G CG2 1 
ATOM   7480  N  N   . VAL G  1 25  ? -11.078 2.157   34.092  1.00 4.81   ? 25  VAL G N   1 
ATOM   7481  C  CA  . VAL G  1 25  ? -11.806 0.903   34.127  1.00 2.65   ? 25  VAL G CA  1 
ATOM   7482  C  C   . VAL G  1 25  ? -12.960 0.993   33.121  1.00 7.25   ? 25  VAL G C   1 
ATOM   7483  O  O   . VAL G  1 25  ? -13.358 0.043   32.445  1.00 3.94   ? 25  VAL G O   1 
ATOM   7484  C  CB  . VAL G  1 25  ? -12.295 0.573   35.549  1.00 6.69   ? 25  VAL G CB  1 
ATOM   7485  C  CG1 . VAL G  1 25  ? -13.150 -0.699  35.582  1.00 5.40   ? 25  VAL G CG1 1 
ATOM   7486  C  CG2 . VAL G  1 25  ? -11.071 0.396   36.427  1.00 1.00   ? 25  VAL G CG2 1 
ATOM   7487  N  N   . LYS G  1 26  ? -13.467 2.208   32.979  1.00 1.00   ? 26  LYS G N   1 
ATOM   7488  C  CA  . LYS G  1 26  ? -14.554 2.370   32.025  1.00 3.18   ? 26  LYS G CA  1 
ATOM   7489  C  C   . LYS G  1 26  ? -14.044 2.126   30.594  1.00 6.42   ? 26  LYS G C   1 
ATOM   7490  O  O   . LYS G  1 26  ? -14.709 1.499   29.781  1.00 8.05   ? 26  LYS G O   1 
ATOM   7491  C  CB  . LYS G  1 26  ? -15.228 3.730   32.186  1.00 2.91   ? 26  LYS G CB  1 
ATOM   7492  C  CG  . LYS G  1 26  ? -16.354 3.974   31.233  1.00 14.12  ? 26  LYS G CG  1 
ATOM   7493  C  CD  . LYS G  1 26  ? -16.764 5.442   31.263  1.00 29.90  ? 26  LYS G CD  1 
ATOM   7494  C  CE  . LYS G  1 26  ? -17.439 5.881   32.576  1.00 13.40  ? 26  LYS G CE  1 
ATOM   7495  N  NZ  . LYS G  1 26  ? -18.787 5.296   32.765  1.00 36.58  ? 26  LYS G NZ  1 
ATOM   7496  N  N   . ILE G  1 27  ? -12.822 2.539   30.307  1.00 2.60   ? 27  ILE G N   1 
ATOM   7497  C  CA  . ILE G  1 27  ? -12.271 2.345   28.987  1.00 1.00   ? 27  ILE G CA  1 
ATOM   7498  C  C   . ILE G  1 27  ? -12.152 0.883   28.771  1.00 3.74   ? 27  ILE G C   1 
ATOM   7499  O  O   . ILE G  1 27  ? -12.491 0.367   27.731  1.00 6.19   ? 27  ILE G O   1 
ATOM   7500  C  CB  . ILE G  1 27  ? -10.923 3.066   28.847  1.00 3.40   ? 27  ILE G CB  1 
ATOM   7501  C  CG1 . ILE G  1 27  ? -11.136 4.587   28.895  1.00 1.00   ? 27  ILE G CG1 1 
ATOM   7502  C  CG2 . ILE G  1 27  ? -10.210 2.665   27.581  1.00 1.00   ? 27  ILE G CG2 1 
ATOM   7503  C  CD1 . ILE G  1 27  ? -9.908  5.418   29.160  1.00 1.00   ? 27  ILE G CD1 1 
ATOM   7504  N  N   . HIS G  1 28  ? -11.761 0.154   29.795  1.00 1.70   ? 28  HIS G N   1 
ATOM   7505  C  CA  . HIS G  1 28  ? -11.660 -1.290  29.619  1.00 2.26   ? 28  HIS G CA  1 
ATOM   7506  C  C   . HIS G  1 28  ? -13.009 -1.952  29.320  1.00 8.81   ? 28  HIS G C   1 
ATOM   7507  O  O   . HIS G  1 28  ? -13.098 -2.898  28.525  1.00 6.81   ? 28  HIS G O   1 
ATOM   7508  C  CB  . HIS G  1 28  ? -11.058 -1.954  30.861  1.00 5.12   ? 28  HIS G CB  1 
ATOM   7509  C  CG  . HIS G  1 28  ? -9.585  -2.202  30.785  1.00 11.04  ? 28  HIS G CG  1 
ATOM   7510  N  ND1 . HIS G  1 28  ? -8.894  -2.293  29.599  1.00 16.55  ? 28  HIS G ND1 1 
ATOM   7511  C  CD2 . HIS G  1 28  ? -8.727  -2.592  31.749  1.00 12.27  ? 28  HIS G CD2 1 
ATOM   7512  C  CE1 . HIS G  1 28  ? -7.643  -2.624  29.849  1.00 16.53  ? 28  HIS G CE1 1 
ATOM   7513  N  NE2 . HIS G  1 28  ? -7.514  -2.795  31.148  1.00 15.42  ? 28  HIS G NE2 1 
ATOM   7514  N  N   . GLN G  1 29  ? -14.055 -1.477  30.000  1.00 4.85   ? 29  GLN G N   1 
ATOM   7515  C  CA  . GLN G  1 29  ? -15.395 -2.032  29.802  1.00 5.34   ? 29  GLN G CA  1 
ATOM   7516  C  C   . GLN G  1 29  ? -15.828 -1.900  28.355  1.00 6.81   ? 29  GLN G C   1 
ATOM   7517  O  O   . GLN G  1 29  ? -16.311 -2.829  27.724  1.00 4.20   ? 29  GLN G O   1 
ATOM   7518  C  CB  . GLN G  1 29  ? -16.378 -1.306  30.719  1.00 7.32   ? 29  GLN G CB  1 
ATOM   7519  C  CG  . GLN G  1 29  ? -17.828 -1.480  30.358  1.00 11.33  ? 29  GLN G CG  1 
ATOM   7520  C  CD  . GLN G  1 29  ? -18.779 -0.847  31.357  1.00 16.35  ? 29  GLN G CD  1 
ATOM   7521  O  OE1 . GLN G  1 29  ? -18.920 -1.325  32.480  1.00 11.86  ? 29  GLN G OE1 1 
ATOM   7522  N  NE2 . GLN G  1 29  ? -19.460 0.220   30.932  1.00 9.94   ? 29  GLN G NE2 1 
ATOM   7523  N  N   . ILE G  1 30  ? -15.647 -0.701  27.826  1.00 2.56   ? 30  ILE G N   1 
ATOM   7524  C  CA  . ILE G  1 30  ? -16.002 -0.412  26.443  1.00 1.54   ? 30  ILE G CA  1 
ATOM   7525  C  C   . ILE G  1 30  ? -15.228 -1.286  25.485  1.00 7.36   ? 30  ILE G C   1 
ATOM   7526  O  O   . ILE G  1 30  ? -15.731 -1.762  24.434  1.00 6.25   ? 30  ILE G O   1 
ATOM   7527  C  CB  . ILE G  1 30  ? -15.581 1.055   26.134  1.00 5.01   ? 30  ILE G CB  1 
ATOM   7528  C  CG1 . ILE G  1 30  ? -16.470 2.012   26.920  1.00 9.96   ? 30  ILE G CG1 1 
ATOM   7529  C  CG2 . ILE G  1 30  ? -15.707 1.395   24.694  1.00 1.48   ? 30  ILE G CG2 1 
ATOM   7530  C  CD1 . ILE G  1 30  ? -16.151 3.494   26.671  1.00 13.39  ? 30  ILE G CD1 1 
ATOM   7531  N  N   . HIS G  1 31  ? -14.010 -1.519  25.906  1.00 3.90   ? 31  HIS G N   1 
ATOM   7532  C  CA  . HIS G  1 31  ? -13.083 -2.259  25.052  1.00 2.16   ? 31  HIS G CA  1 
ATOM   7533  C  C   . HIS G  1 31  ? -13.338 -3.731  24.995  1.00 10.86  ? 31  HIS G C   1 
ATOM   7534  O  O   . HIS G  1 31  ? -13.103 -4.399  24.041  1.00 5.64   ? 31  HIS G O   1 
ATOM   7535  C  CB  . HIS G  1 31  ? -11.775 -1.971  25.732  1.00 3.02   ? 31  HIS G CB  1 
ATOM   7536  C  CG  . HIS G  1 31  ? -10.658 -2.821  25.274  1.00 9.31   ? 31  HIS G CG  1 
ATOM   7537  N  ND1 . HIS G  1 31  ? -9.979  -2.551  24.098  1.00 14.62  ? 31  HIS G ND1 1 
ATOM   7538  C  CD2 . HIS G  1 31  ? -9.953  -3.810  25.896  1.00 10.05  ? 31  HIS G CD2 1 
ATOM   7539  C  CE1 . HIS G  1 31  ? -8.964  -3.399  23.971  1.00 11.65  ? 31  HIS G CE1 1 
ATOM   7540  N  NE2 . HIS G  1 31  ? -8.938  -4.196  25.032  1.00 9.54   ? 31  HIS G NE2 1 
ATOM   7541  N  N   . TRP G  1 32  ? -13.880 -4.184  26.091  1.00 4.63   ? 32  TRP G N   1 
ATOM   7542  C  CA  . TRP G  1 32  ? -14.189 -5.588  26.139  1.00 2.92   ? 32  TRP G CA  1 
ATOM   7543  C  C   . TRP G  1 32  ? -15.562 -5.865  25.608  1.00 10.92  ? 32  TRP G C   1 
ATOM   7544  O  O   . TRP G  1 32  ? -15.789 -6.888  24.972  1.00 6.35   ? 32  TRP G O   1 
ATOM   7545  C  CB  . TRP G  1 32  ? -14.183 -6.016  27.603  1.00 1.64   ? 32  TRP G CB  1 
ATOM   7546  C  CG  . TRP G  1 32  ? -12.831 -6.046  28.288  1.00 2.85   ? 32  TRP G CG  1 
ATOM   7547  C  CD1 . TRP G  1 32  ? -11.633 -6.337  27.686  1.00 1.84   ? 32  TRP G CD1 1 
ATOM   7548  C  CD2 . TRP G  1 32  ? -12.552 -5.899  29.701  1.00 1.95   ? 32  TRP G CD2 1 
ATOM   7549  N  NE1 . TRP G  1 32  ? -10.655 -6.337  28.604  1.00 2.23   ? 32  TRP G NE1 1 
ATOM   7550  C  CE2 . TRP G  1 32  ? -11.172 -6.125  29.861  1.00 3.20   ? 32  TRP G CE2 1 
ATOM   7551  C  CE3 . TRP G  1 32  ? -13.328 -5.680  30.849  1.00 4.22   ? 32  TRP G CE3 1 
ATOM   7552  C  CZ2 . TRP G  1 32  ? -10.546 -5.949  31.085  1.00 1.00   ? 32  TRP G CZ2 1 
ATOM   7553  C  CZ3 . TRP G  1 32  ? -12.703 -5.597  32.072  1.00 6.61   ? 32  TRP G CZ3 1 
ATOM   7554  C  CH2 . TRP G  1 32  ? -11.291 -5.713  32.181  1.00 7.00   ? 32  TRP G CH2 1 
ATOM   7555  N  N   . TYR G  1 33  ? -16.513 -5.002  25.914  1.00 2.18   ? 33  TYR G N   1 
ATOM   7556  C  CA  . TYR G  1 33  ? -17.872 -5.274  25.494  1.00 3.77   ? 33  TYR G CA  1 
ATOM   7557  C  C   . TYR G  1 33  ? -18.301 -4.785  24.128  1.00 11.91  ? 33  TYR G C   1 
ATOM   7558  O  O   . TYR G  1 33  ? -19.358 -5.164  23.646  1.00 12.42  ? 33  TYR G O   1 
ATOM   7559  C  CB  . TYR G  1 33  ? -18.850 -4.754  26.561  1.00 2.44   ? 33  TYR G CB  1 
ATOM   7560  C  CG  . TYR G  1 33  ? -18.849 -5.605  27.816  1.00 4.86   ? 33  TYR G CG  1 
ATOM   7561  C  CD1 . TYR G  1 33  ? -19.457 -6.852  27.834  1.00 11.73  ? 33  TYR G CD1 1 
ATOM   7562  C  CD2 . TYR G  1 33  ? -18.191 -5.212  28.992  1.00 3.62   ? 33  TYR G CD2 1 
ATOM   7563  C  CE1 . TYR G  1 33  ? -19.462 -7.647  28.945  1.00 10.66  ? 33  TYR G CE1 1 
ATOM   7564  C  CE2 . TYR G  1 33  ? -18.195 -6.014  30.131  1.00 5.55   ? 33  TYR G CE2 1 
ATOM   7565  C  CZ  . TYR G  1 33  ? -18.845 -7.233  30.091  1.00 15.21  ? 33  TYR G CZ  1 
ATOM   7566  O  OH  . TYR G  1 33  ? -18.890 -8.108  31.166  1.00 12.93  ? 33  TYR G OH  1 
ATOM   7567  N  N   . MET G  1 34  ? -17.549 -3.893  23.511  1.00 7.24   ? 34  MET G N   1 
ATOM   7568  C  CA  . MET G  1 34  ? -18.035 -3.367  22.260  1.00 4.59   ? 34  MET G CA  1 
ATOM   7569  C  C   . MET G  1 34  ? -18.303 -4.433  21.226  1.00 3.56   ? 34  MET G C   1 
ATOM   7570  O  O   . MET G  1 34  ? -17.666 -5.480  21.259  1.00 3.85   ? 34  MET G O   1 
ATOM   7571  C  CB  . MET G  1 34  ? -17.035 -2.351  21.726  1.00 6.91   ? 34  MET G CB  1 
ATOM   7572  C  CG  . MET G  1 34  ? -15.687 -2.956  21.453  1.00 12.61  ? 34  MET G CG  1 
ATOM   7573  S  SD  . MET G  1 34  ? -14.641 -1.828  20.585  1.00 18.42  ? 34  MET G SD  1 
ATOM   7574  C  CE  . MET G  1 34  ? -14.601 -0.392  21.607  1.00 15.03  ? 34  MET G CE  1 
ATOM   7575  N  N   . ARG G  1 35  ? -19.201 -4.146  20.284  1.00 9.20   ? 35  ARG G N   1 
ATOM   7576  C  CA  . ARG G  1 35  ? -19.518 -5.036  19.168  1.00 10.27  ? 35  ARG G CA  1 
ATOM   7577  C  C   . ARG G  1 35  ? -19.981 -4.146  18.042  1.00 11.55  ? 35  ARG G C   1 
ATOM   7578  O  O   . ARG G  1 35  ? -20.406 -3.029  18.299  1.00 15.93  ? 35  ARG G O   1 
ATOM   7579  C  CB  . ARG G  1 35  ? -20.656 -5.993  19.451  1.00 8.10   ? 35  ARG G CB  1 
ATOM   7580  C  CG  . ARG G  1 35  ? -20.292 -7.015  20.471  1.00 13.92  ? 35  ARG G CG  1 
ATOM   7581  C  CD  . ARG G  1 35  ? -21.483 -7.927  20.502  1.00 4.58   ? 35  ARG G CD  1 
ATOM   7582  N  NE  . ARG G  1 35  ? -21.309 -8.908  21.561  1.00 22.66  ? 35  ARG G NE  1 
ATOM   7583  C  CZ  . ARG G  1 35  ? -22.270 -9.702  22.017  1.00 35.44  ? 35  ARG G CZ  1 
ATOM   7584  N  NH1 . ARG G  1 35  ? -23.490 -9.632  21.502  1.00 42.08  ? 35  ARG G NH1 1 
ATOM   7585  N  NH2 . ARG G  1 35  ? -22.009 -10.557 22.994  1.00 30.16  ? 35  ARG G NH2 1 
ATOM   7586  N  N   . GLY G  1 36  ? -19.809 -4.612  16.808  1.00 8.29   ? 36  GLY G N   1 
ATOM   7587  C  CA  . GLY G  1 36  ? -20.192 -3.818  15.639  1.00 8.25   ? 36  GLY G CA  1 
ATOM   7588  C  C   . GLY G  1 36  ? -19.062 -3.695  14.624  1.00 13.49  ? 36  GLY G C   1 
ATOM   7589  O  O   . GLY G  1 36  ? -17.913 -4.039  14.901  1.00 12.20  ? 36  GLY G O   1 
ATOM   7590  N  N   . HIS G  1 37  ? -19.417 -3.141  13.473  1.00 8.41   ? 37  HIS G N   1 
ATOM   7591  C  CA  . HIS G  1 37  ? -18.445 -2.977  12.407  1.00 14.19  ? 37  HIS G CA  1 
ATOM   7592  C  C   . HIS G  1 37  ? -17.162 -2.215  12.762  1.00 17.65  ? 37  HIS G C   1 
ATOM   7593  O  O   . HIS G  1 37  ? -16.105 -2.424  12.143  1.00 15.51  ? 37  HIS G O   1 
ATOM   7594  C  CB  . HIS G  1 37  ? -19.140 -2.435  11.130  1.00 19.48  ? 37  HIS G CB  1 
ATOM   7595  C  CG  . HIS G  1 37  ? -20.073 -3.419  10.510  1.00 31.46  ? 37  HIS G CG  1 
ATOM   7596  N  ND1 . HIS G  1 37  ? -19.949 -3.860  9.216   1.00 39.83  ? 37  HIS G ND1 1 
ATOM   7597  C  CD2 . HIS G  1 37  ? -21.085 -4.121  11.060  1.00 48.41  ? 37  HIS G CD2 1 
ATOM   7598  C  CE1 . HIS G  1 37  ? -20.867 -4.772  8.982   1.00 45.84  ? 37  HIS G CE1 1 
ATOM   7599  N  NE2 . HIS G  1 37  ? -21.573 -4.953  10.086  1.00 49.30  ? 37  HIS G NE2 1 
ATOM   7600  N  N   . ASN G  1 38  ? -17.233 -1.336  13.754  1.00 13.46  ? 38  ASN G N   1 
ATOM   7601  C  CA  . ASN G  1 38  ? -16.069 -0.569  14.128  1.00 13.69  ? 38  ASN G CA  1 
ATOM   7602  C  C   . ASN G  1 38  ? -15.239 -1.274  15.181  1.00 16.55  ? 38  ASN G C   1 
ATOM   7603  O  O   . ASN G  1 38  ? -14.294 -0.727  15.730  1.00 14.96  ? 38  ASN G O   1 
ATOM   7604  C  CB  . ASN G  1 38  ? -16.531 0.802   14.610  1.00 13.88  ? 38  ASN G CB  1 
ATOM   7605  C  CG  . ASN G  1 38  ? -17.368 1.481   13.570  1.00 33.24  ? 38  ASN G CG  1 
ATOM   7606  O  OD1 . ASN G  1 38  ? -18.581 1.638   13.748  1.00 37.21  ? 38  ASN G OD1 1 
ATOM   7607  N  ND2 . ASN G  1 38  ? -16.743 1.800   12.434  1.00 16.20  ? 38  ASN G ND2 1 
ATOM   7608  N  N   . PHE G  1 39  ? -15.584 -2.511  15.473  1.00 6.65   ? 39  PHE G N   1 
ATOM   7609  C  CA  . PHE G  1 39  ? -14.868 -3.205  16.527  1.00 4.52   ? 39  PHE G CA  1 
ATOM   7610  C  C   . PHE G  1 39  ? -13.372 -3.140  16.465  1.00 5.33   ? 39  PHE G C   1 
ATOM   7611  O  O   . PHE G  1 39  ? -12.721 -2.741  17.429  1.00 4.45   ? 39  PHE G O   1 
ATOM   7612  C  CB  . PHE G  1 39  ? -15.278 -4.667  16.598  1.00 1.00   ? 39  PHE G CB  1 
ATOM   7613  C  CG  . PHE G  1 39  ? -14.467 -5.428  17.592  1.00 2.97   ? 39  PHE G CG  1 
ATOM   7614  C  CD1 . PHE G  1 39  ? -14.879 -5.500  18.915  1.00 1.30   ? 39  PHE G CD1 1 
ATOM   7615  C  CD2 . PHE G  1 39  ? -13.291 -6.059  17.239  1.00 4.60   ? 39  PHE G CD2 1 
ATOM   7616  C  CE1 . PHE G  1 39  ? -14.136 -6.205  19.872  1.00 1.00   ? 39  PHE G CE1 1 
ATOM   7617  C  CE2 . PHE G  1 39  ? -12.538 -6.773  18.178  1.00 4.19   ? 39  PHE G CE2 1 
ATOM   7618  C  CZ  . PHE G  1 39  ? -12.947 -6.841  19.515  1.00 1.00   ? 39  PHE G CZ  1 
ATOM   7619  N  N   . PHE G  1 40  ? -12.839 -3.517  15.309  1.00 2.13   ? 40  PHE G N   1 
ATOM   7620  C  CA  . PHE G  1 40  ? -11.386 -3.540  15.229  1.00 7.83   ? 40  PHE G CA  1 
ATOM   7621  C  C   . PHE G  1 40  ? -10.704 -2.213  15.543  1.00 17.52  ? 40  PHE G C   1 
ATOM   7622  O  O   . PHE G  1 40  ? -9.873  -2.095  16.458  1.00 12.86  ? 40  PHE G O   1 
ATOM   7623  C  CB  . PHE G  1 40  ? -10.884 -4.172  13.932  1.00 3.51   ? 40  PHE G CB  1 
ATOM   7624  C  CG  . PHE G  1 40  ? -11.235 -5.627  13.826  1.00 3.56   ? 40  PHE G CG  1 
ATOM   7625  C  CD1 . PHE G  1 40  ? -10.572 -6.585  14.589  1.00 1.47   ? 40  PHE G CD1 1 
ATOM   7626  C  CD2 . PHE G  1 40  ? -12.268 -6.047  13.009  1.00 5.48   ? 40  PHE G CD2 1 
ATOM   7627  C  CE1 . PHE G  1 40  ? -10.874 -7.940  14.494  1.00 4.01   ? 40  PHE G CE1 1 
ATOM   7628  C  CE2 . PHE G  1 40  ? -12.606 -7.389  12.945  1.00 7.81   ? 40  PHE G CE2 1 
ATOM   7629  C  CZ  . PHE G  1 40  ? -11.889 -8.352  13.663  1.00 1.86   ? 40  PHE G CZ  1 
ATOM   7630  N  N   . THR G  1 41  ? -11.172 -1.197  14.841  1.00 13.70  ? 41  THR G N   1 
ATOM   7631  C  CA  . THR G  1 41  ? -10.620 0.109   15.063  1.00 12.15  ? 41  THR G CA  1 
ATOM   7632  C  C   . THR G  1 41  ? -10.828 0.659   16.463  1.00 10.62  ? 41  THR G C   1 
ATOM   7633  O  O   . THR G  1 41  ? -9.877  1.087   17.088  1.00 11.76  ? 41  THR G O   1 
ATOM   7634  C  CB  . THR G  1 41  ? -10.983 0.989   13.865  1.00 34.84  ? 41  THR G CB  1 
ATOM   7635  O  OG1 . THR G  1 41  ? -10.797 2.364   14.193  1.00 54.11  ? 41  THR G OG1 1 
ATOM   7636  C  CG2 . THR G  1 41  ? -12.393 0.717   13.403  1.00 68.27  ? 41  THR G CG2 1 
ATOM   7637  N  N   . LEU G  1 42  ? -12.040 0.624   16.998  1.00 7.44   ? 42  LEU G N   1 
ATOM   7638  C  CA  . LEU G  1 42  ? -12.281 1.169   18.321  1.00 5.41   ? 42  LEU G CA  1 
ATOM   7639  C  C   . LEU G  1 42  ? -11.695 0.296   19.400  1.00 9.76   ? 42  LEU G C   1 
ATOM   7640  O  O   . LEU G  1 42  ? -11.352 0.817   20.459  1.00 9.42   ? 42  LEU G O   1 
ATOM   7641  C  CB  . LEU G  1 42  ? -13.766 1.364   18.525  1.00 5.81   ? 42  LEU G CB  1 
ATOM   7642  C  CG  . LEU G  1 42  ? -14.295 2.759   18.251  1.00 11.01  ? 42  LEU G CG  1 
ATOM   7643  C  CD1 . LEU G  1 42  ? -13.344 3.612   17.455  1.00 8.24   ? 42  LEU G CD1 1 
ATOM   7644  C  CD2 . LEU G  1 42  ? -15.539 2.602   17.427  1.00 21.32  ? 42  LEU G CD2 1 
ATOM   7645  N  N   . HIS G  1 43  ? -11.578 -0.998  19.160  1.00 2.46   ? 43  HIS G N   1 
ATOM   7646  C  CA  . HIS G  1 43  ? -10.984 -1.858  20.174  1.00 1.60   ? 43  HIS G CA  1 
ATOM   7647  C  C   . HIS G  1 43  ? -9.535  -1.407  20.414  1.00 8.04   ? 43  HIS G C   1 
ATOM   7648  O  O   . HIS G  1 43  ? -9.094  -1.244  21.553  1.00 7.61   ? 43  HIS G O   1 
ATOM   7649  C  CB  . HIS G  1 43  ? -10.984 -3.306  19.685  1.00 2.22   ? 43  HIS G CB  1 
ATOM   7650  C  CG  . HIS G  1 43  ? -10.464 -4.308  20.683  1.00 8.44   ? 43  HIS G CG  1 
ATOM   7651  N  ND1 . HIS G  1 43  ? -11.077 -4.568  21.896  1.00 10.09  ? 43  HIS G ND1 1 
ATOM   7652  C  CD2 . HIS G  1 43  ? -9.400  -5.144  20.622  1.00 9.78   ? 43  HIS G CD2 1 
ATOM   7653  C  CE1 . HIS G  1 43  ? -10.416 -5.523  22.530  1.00 9.87   ? 43  HIS G CE1 1 
ATOM   7654  N  NE2 . HIS G  1 43  ? -9.401  -5.894  21.774  1.00 10.29  ? 43  HIS G NE2 1 
ATOM   7655  N  N   . GLU G  1 44  ? -8.803  -1.162  19.338  1.00 5.29   ? 44  GLU G N   1 
ATOM   7656  C  CA  . GLU G  1 44  ? -7.429  -0.706  19.499  1.00 6.42   ? 44  GLU G CA  1 
ATOM   7657  C  C   . GLU G  1 44  ? -7.350  0.694   20.051  1.00 8.35   ? 44  GLU G C   1 
ATOM   7658  O  O   . GLU G  1 44  ? -6.510  0.970   20.893  1.00 9.03   ? 44  GLU G O   1 
ATOM   7659  C  CB  . GLU G  1 44  ? -6.652  -0.795  18.178  1.00 8.13   ? 44  GLU G CB  1 
ATOM   7660  C  CG  . GLU G  1 44  ? -6.683  -2.220  17.602  1.00 78.60  ? 44  GLU G CG  1 
ATOM   7661  C  CD  . GLU G  1 44  ? -6.421  -2.329  16.108  0.00 100.00 ? 44  GLU G CD  1 
ATOM   7662  O  OE1 . GLU G  1 44  ? -6.029  -1.323  15.500  0.00 100.00 ? 44  GLU G OE1 1 
ATOM   7663  O  OE2 . GLU G  1 44  ? -6.630  -3.415  15.543  0.00 100.00 ? 44  GLU G OE2 1 
ATOM   7664  N  N   . LYS G  1 45  ? -8.232  1.589   19.609  1.00 2.42   ? 45  LYS G N   1 
ATOM   7665  C  CA  . LYS G  1 45  ? -8.262  2.957   20.108  1.00 2.83   ? 45  LYS G CA  1 
ATOM   7666  C  C   . LYS G  1 45  ? -8.464  2.946   21.603  1.00 2.73   ? 45  LYS G C   1 
ATOM   7667  O  O   . LYS G  1 45  ? -7.903  3.781   22.285  1.00 3.94   ? 45  LYS G O   1 
ATOM   7668  C  CB  . LYS G  1 45  ? -9.376  3.791   19.456  1.00 7.39   ? 45  LYS G CB  1 
ATOM   7669  C  CG  . LYS G  1 45  ? -9.168  5.281   19.489  1.00 27.81  ? 45  LYS G CG  1 
ATOM   7670  C  CD  . LYS G  1 45  ? -8.086  5.650   18.502  1.00 52.71  ? 45  LYS G CD  1 
ATOM   7671  C  CE  . LYS G  1 45  ? -7.349  6.928   18.905  1.00 91.50  ? 45  LYS G CE  1 
ATOM   7672  N  NZ  . LYS G  1 45  ? -8.142  8.190   19.089  1.00 78.25  ? 45  LYS G NZ  1 
ATOM   7673  N  N   . MET G  1 46  ? -9.257  2.037   22.154  1.00 1.00   ? 46  MET G N   1 
ATOM   7674  C  CA  . MET G  1 46  ? -9.468  2.063   23.591  1.00 1.00   ? 46  MET G CA  1 
ATOM   7675  C  C   . MET G  1 46  ? -8.165  1.706   24.272  1.00 7.31   ? 46  MET G C   1 
ATOM   7676  O  O   . MET G  1 46  ? -7.850  2.224   25.333  1.00 11.81  ? 46  MET G O   1 
ATOM   7677  C  CB  . MET G  1 46  ? -10.616 1.150   24.048  1.00 1.00   ? 46  MET G CB  1 
ATOM   7678  C  CG  . MET G  1 46  ? -12.013 1.515   23.557  1.00 2.37   ? 46  MET G CG  1 
ATOM   7679  S  SD  . MET G  1 46  ? -12.456 3.218   23.953  1.00 7.06   ? 46  MET G SD  1 
ATOM   7680  C  CE  . MET G  1 46  ? -11.972 4.206   22.478  1.00 3.33   ? 46  MET G CE  1 
ATOM   7681  N  N   . ASP G  1 47  ? -7.381  0.831   23.647  1.00 5.41   ? 47  ASP G N   1 
ATOM   7682  C  CA  . ASP G  1 47  ? -6.106  0.418   24.231  1.00 8.61   ? 47  ASP G CA  1 
ATOM   7683  C  C   . ASP G  1 47  ? -5.225  1.655   24.349  1.00 7.76   ? 47  ASP G C   1 
ATOM   7684  O  O   . ASP G  1 47  ? -4.568  1.926   25.371  1.00 11.02  ? 47  ASP G O   1 
ATOM   7685  C  CB  . ASP G  1 47  ? -5.429  -0.764  23.508  1.00 15.25  ? 47  ASP G CB  1 
ATOM   7686  C  CG  . ASP G  1 47  ? -5.789  -2.130  24.101  1.00 77.46  ? 47  ASP G CG  1 
ATOM   7687  O  OD1 . ASP G  1 47  ? -6.233  -2.229  25.265  1.00 89.61  ? 47  ASP G OD1 1 
ATOM   7688  O  OD2 . ASP G  1 47  ? -5.500  -3.134  23.406  1.00 99.04  ? 47  ASP G OD2 1 
ATOM   7689  N  N   . ASP G  1 48  ? -5.310  2.500   23.333  1.00 3.61   ? 48  ASP G N   1 
ATOM   7690  C  CA  . ASP G  1 48  ? -4.520  3.718   23.382  1.00 7.99   ? 48  ASP G CA  1 
ATOM   7691  C  C   . ASP G  1 48  ? -4.939  4.686   24.483  1.00 10.32  ? 48  ASP G C   1 
ATOM   7692  O  O   . ASP G  1 48  ? -4.076  5.280   25.160  1.00 8.10   ? 48  ASP G O   1 
ATOM   7693  C  CB  . ASP G  1 48  ? -4.444  4.343   21.991  1.00 13.31  ? 48  ASP G CB  1 
ATOM   7694  C  CG  . ASP G  1 48  ? -3.825  3.406   20.939  1.00 51.63  ? 48  ASP G CG  1 
ATOM   7695  O  OD1 . ASP G  1 48  ? -3.017  2.494   21.270  1.00 54.02  ? 48  ASP G OD1 1 
ATOM   7696  O  OD2 . ASP G  1 48  ? -4.137  3.591   19.736  1.00 81.92  ? 48  ASP G OD2 1 
ATOM   7697  N  N   . LEU G  1 49  ? -6.253  4.851   24.638  1.00 4.34   ? 49  LEU G N   1 
ATOM   7698  C  CA  . LEU G  1 49  ? -6.814  5.704   25.680  1.00 4.58   ? 49  LEU G CA  1 
ATOM   7699  C  C   . LEU G  1 49  ? -6.408  5.171   27.065  1.00 1.38   ? 49  LEU G C   1 
ATOM   7700  O  O   . LEU G  1 49  ? -5.960  5.875   27.963  1.00 3.72   ? 49  LEU G O   1 
ATOM   7701  C  CB  . LEU G  1 49  ? -8.337  5.733   25.542  1.00 2.98   ? 49  LEU G CB  1 
ATOM   7702  C  CG  . LEU G  1 49  ? -8.936  7.045   25.031  1.00 7.74   ? 49  LEU G CG  1 
ATOM   7703  C  CD1 . LEU G  1 49  ? -8.171  7.503   23.813  1.00 1.85   ? 49  LEU G CD1 1 
ATOM   7704  C  CD2 . LEU G  1 49  ? -10.369 6.818   24.656  1.00 7.57   ? 49  LEU G CD2 1 
ATOM   7705  N  N   . TYR G  1 50  ? -6.517  3.856   27.212  1.00 1.51   ? 50  TYR G N   1 
ATOM   7706  C  CA  . TYR G  1 50  ? -6.227  3.241   28.500  1.00 2.55   ? 50  TYR G CA  1 
ATOM   7707  C  C   . TYR G  1 50  ? -4.821  3.591   28.942  1.00 6.90   ? 50  TYR G C   1 
ATOM   7708  O  O   . TYR G  1 50  ? -4.539  3.907   30.085  1.00 7.82   ? 50  TYR G O   1 
ATOM   7709  C  CB  . TYR G  1 50  ? -6.377  1.726   28.384  1.00 4.17   ? 50  TYR G CB  1 
ATOM   7710  C  CG  . TYR G  1 50  ? -6.240  1.014   29.691  1.00 10.92  ? 50  TYR G CG  1 
ATOM   7711  C  CD1 . TYR G  1 50  ? -7.344  0.821   30.511  1.00 17.52  ? 50  TYR G CD1 1 
ATOM   7712  C  CD2 . TYR G  1 50  ? -4.992  0.596   30.131  1.00 12.18  ? 50  TYR G CD2 1 
ATOM   7713  C  CE1 . TYR G  1 50  ? -7.247  0.194   31.755  1.00 21.41  ? 50  TYR G CE1 1 
ATOM   7714  C  CE2 . TYR G  1 50  ? -4.872  0.030   31.392  1.00 27.76  ? 50  TYR G CE2 1 
ATOM   7715  C  CZ  . TYR G  1 50  ? -5.994  -0.209  32.190  1.00 37.86  ? 50  TYR G CZ  1 
ATOM   7716  O  OH  . TYR G  1 50  ? -5.911  -0.852  33.413  1.00 32.84  ? 50  TYR G OH  1 
ATOM   7717  N  N   . SER G  1 51  ? -3.912  3.458   27.998  1.00 4.56   ? 51  SER G N   1 
ATOM   7718  C  CA  . SER G  1 51  ? -2.527  3.725   28.324  1.00 6.70   ? 51  SER G CA  1 
ATOM   7719  C  C   . SER G  1 51  ? -2.334  5.197   28.578  1.00 5.00   ? 51  SER G C   1 
ATOM   7720  O  O   . SER G  1 51  ? -1.629  5.585   29.497  1.00 5.07   ? 51  SER G O   1 
ATOM   7721  C  CB  . SER G  1 51  ? -1.610  3.266   27.190  1.00 6.33   ? 51  SER G CB  1 
ATOM   7722  O  OG  . SER G  1 51  ? -1.664  1.848   27.101  1.00 55.65  ? 51  SER G OG  1 
ATOM   7723  N  N   . GLU G  1 52  ? -2.916  6.040   27.736  1.00 1.00   ? 52  GLU G N   1 
ATOM   7724  C  CA  . GLU G  1 52  ? -2.739  7.459   27.952  1.00 1.75   ? 52  GLU G CA  1 
ATOM   7725  C  C   . GLU G  1 52  ? -3.318  7.979   29.268  1.00 5.89   ? 52  GLU G C   1 
ATOM   7726  O  O   . GLU G  1 52  ? -2.695  8.772   29.977  1.00 2.56   ? 52  GLU G O   1 
ATOM   7727  C  CB  . GLU G  1 52  ? -3.392  8.207   26.818  1.00 1.00   ? 52  GLU G CB  1 
ATOM   7728  C  CG  . GLU G  1 52  ? -3.458  9.654   27.183  1.00 17.27  ? 52  GLU G CG  1 
ATOM   7729  C  CD  . GLU G  1 52  ? -3.975  10.506  26.043  1.00 55.38  ? 52  GLU G CD  1 
ATOM   7730  O  OE1 . GLU G  1 52  ? -4.576  9.938   25.097  1.00 21.35  ? 52  GLU G OE1 1 
ATOM   7731  O  OE2 . GLU G  1 52  ? -3.665  11.721  26.070  1.00 27.07  ? 52  GLU G OE2 1 
ATOM   7732  N  N   . PHE G  1 53  ? -4.512  7.519   29.615  1.00 1.93   ? 53  PHE G N   1 
ATOM   7733  C  CA  . PHE G  1 53  ? -5.091  8.040   30.836  1.00 1.32   ? 53  PHE G CA  1 
ATOM   7734  C  C   . PHE G  1 53  ? -4.450  7.405   32.053  1.00 4.65   ? 53  PHE G C   1 
ATOM   7735  O  O   . PHE G  1 53  ? -4.352  8.031   33.104  1.00 4.77   ? 53  PHE G O   1 
ATOM   7736  C  CB  . PHE G  1 53  ? -6.614  8.054   30.767  1.00 1.02   ? 53  PHE G CB  1 
ATOM   7737  C  CG  . PHE G  1 53  ? -7.139  9.141   29.867  1.00 2.55   ? 53  PHE G CG  1 
ATOM   7738  C  CD1 . PHE G  1 53  ? -7.356  10.426  30.367  1.00 1.00   ? 53  PHE G CD1 1 
ATOM   7739  C  CD2 . PHE G  1 53  ? -7.299  8.900   28.492  1.00 3.04   ? 53  PHE G CD2 1 
ATOM   7740  C  CE1 . PHE G  1 53  ? -7.764  11.440  29.521  1.00 5.69   ? 53  PHE G CE1 1 
ATOM   7741  C  CE2 . PHE G  1 53  ? -7.706  9.871   27.660  1.00 2.67   ? 53  PHE G CE2 1 
ATOM   7742  C  CZ  . PHE G  1 53  ? -7.937  11.137  28.171  1.00 6.74   ? 53  PHE G CZ  1 
ATOM   7743  N  N   . GLY G  1 54  ? -3.926  6.204   31.863  1.00 1.00   ? 54  GLY G N   1 
ATOM   7744  C  CA  . GLY G  1 54  ? -3.196  5.534   32.935  1.00 1.00   ? 54  GLY G CA  1 
ATOM   7745  C  C   . GLY G  1 54  ? -1.927  6.333   33.226  1.00 6.55   ? 54  GLY G C   1 
ATOM   7746  O  O   . GLY G  1 54  ? -1.506  6.494   34.353  1.00 7.25   ? 54  GLY G O   1 
ATOM   7747  N  N   . GLU G  1 55  ? -1.325  6.912   32.209  1.00 2.09   ? 55  GLU G N   1 
ATOM   7748  C  CA  . GLU G  1 55  ? -0.170  7.745   32.480  1.00 6.93   ? 55  GLU G CA  1 
ATOM   7749  C  C   . GLU G  1 55  ? -0.594  9.068   33.107  1.00 9.00   ? 55  GLU G C   1 
ATOM   7750  O  O   . GLU G  1 55  ? 0.121   9.505   33.993  1.00 12.60  ? 55  GLU G O   1 
ATOM   7751  C  CB  . GLU G  1 55  ? 0.705   8.016   31.238  1.00 12.87  ? 55  GLU G CB  1 
ATOM   7752  C  CG  . GLU G  1 55  ? 1.514   6.876   30.629  1.00 67.98  ? 55  GLU G CG  1 
ATOM   7753  C  CD  . GLU G  1 55  ? 2.253   7.308   29.375  0.00 100.00 ? 55  GLU G CD  1 
ATOM   7754  O  OE1 . GLU G  1 55  ? 2.157   8.480   28.977  0.00 100.00 ? 55  GLU G OE1 1 
ATOM   7755  O  OE2 . GLU G  1 55  ? 2.940   6.445   28.788  0.00 100.00 ? 55  GLU G OE2 1 
ATOM   7756  N  N   . GLN G  1 56  ? -1.699  9.702   32.695  1.00 5.64   ? 56  GLN G N   1 
ATOM   7757  C  CA  . GLN G  1 56  ? -2.121  10.957  33.303  1.00 3.94   ? 56  GLN G CA  1 
ATOM   7758  C  C   . GLN G  1 56  ? -2.262  10.678  34.769  1.00 3.48   ? 56  GLN G C   1 
ATOM   7759  O  O   . GLN G  1 56  ? -1.800  11.398  35.626  1.00 2.15   ? 56  GLN G O   1 
ATOM   7760  C  CB  . GLN G  1 56  ? -3.490  11.390  32.813  1.00 4.80   ? 56  GLN G CB  1 
ATOM   7761  C  CG  . GLN G  1 56  ? -3.400  12.203  31.562  1.00 17.13  ? 56  GLN G CG  1 
ATOM   7762  C  CD  . GLN G  1 56  ? -4.630  12.951  31.197  1.00 27.27  ? 56  GLN G CD  1 
ATOM   7763  O  OE1 . GLN G  1 56  ? -5.500  13.205  32.020  1.00 11.80  ? 56  GLN G OE1 1 
ATOM   7764  N  NE2 . GLN G  1 56  ? -4.692  13.347  29.931  1.00 11.44  ? 56  GLN G NE2 1 
ATOM   7765  N  N   . MET G  1 57  ? -2.895  9.558   35.034  1.00 1.00   ? 57  MET G N   1 
ATOM   7766  C  CA  . MET G  1 57  ? -3.131  9.171   36.391  1.00 1.25   ? 57  MET G CA  1 
ATOM   7767  C  C   . MET G  1 57  ? -1.843  9.078   37.194  1.00 4.45   ? 57  MET G C   1 
ATOM   7768  O  O   . MET G  1 57  ? -1.693  9.783   38.190  1.00 11.53  ? 57  MET G O   1 
ATOM   7769  C  CB  . MET G  1 57  ? -3.948  7.877   36.387  1.00 4.11   ? 57  MET G CB  1 
ATOM   7770  C  CG  . MET G  1 57  ? -4.611  7.551   37.704  1.00 10.22  ? 57  MET G CG  1 
ATOM   7771  S  SD  . MET G  1 57  ? -3.564  6.598   38.820  1.00 16.59  ? 57  MET G SD  1 
ATOM   7772  C  CE  . MET G  1 57  ? -3.467  5.110   38.025  1.00 7.41   ? 57  MET G CE  1 
ATOM   7773  N  N   . ASP G  1 58  ? -0.897  8.241   36.786  1.00 1.00   ? 58  ASP G N   1 
ATOM   7774  C  CA  . ASP G  1 58  ? 0.353   8.174   37.535  1.00 3.53   ? 58  ASP G CA  1 
ATOM   7775  C  C   . ASP G  1 58  ? 1.003   9.564   37.661  1.00 3.37   ? 58  ASP G C   1 
ATOM   7776  O  O   . ASP G  1 58  ? 1.547   9.889   38.727  1.00 3.52   ? 58  ASP G O   1 
ATOM   7777  C  CB  . ASP G  1 58  ? 1.338   7.152   36.936  1.00 5.64   ? 58  ASP G CB  1 
ATOM   7778  C  CG  . ASP G  1 58  ? 2.440   6.715   37.931  1.00 15.96  ? 58  ASP G CG  1 
ATOM   7779  O  OD1 . ASP G  1 58  ? 2.093   6.196   39.021  1.00 22.53  ? 58  ASP G OD1 1 
ATOM   7780  O  OD2 . ASP G  1 58  ? 3.657   6.810   37.581  1.00 19.96  ? 58  ASP G OD2 1 
ATOM   7781  N  N   . GLU G  1 59  ? 0.946   10.401  36.626  1.00 3.35   ? 59  GLU G N   1 
ATOM   7782  C  CA  . GLU G  1 59  ? 1.588   11.712  36.742  1.00 4.95   ? 59  GLU G CA  1 
ATOM   7783  C  C   . GLU G  1 59  ? 0.904   12.635  37.736  1.00 5.20   ? 59  GLU G C   1 
ATOM   7784  O  O   . GLU G  1 59  ? 1.565   13.413  38.426  1.00 5.20   ? 59  GLU G O   1 
ATOM   7785  C  CB  . GLU G  1 59  ? 1.676   12.490  35.409  1.00 8.25   ? 59  GLU G CB  1 
ATOM   7786  C  CG  . GLU G  1 59  ? 2.579   11.902  34.328  1.00 48.01  ? 59  GLU G CG  1 
ATOM   7787  C  CD  . GLU G  1 59  ? 2.605   12.708  33.045  0.00 100.00 ? 59  GLU G CD  1 
ATOM   7788  O  OE1 . GLU G  1 59  ? 2.542   13.955  33.127  0.00 100.00 ? 59  GLU G OE1 1 
ATOM   7789  O  OE2 . GLU G  1 59  ? 2.785   12.139  31.953  1.00 99.73  ? 59  GLU G OE2 1 
ATOM   7790  N  N   . VAL G  1 60  ? -0.420  12.571  37.775  1.00 1.89   ? 60  VAL G N   1 
ATOM   7791  C  CA  . VAL G  1 60  ? -1.168  13.411  38.683  1.00 1.00   ? 60  VAL G CA  1 
ATOM   7792  C  C   . VAL G  1 60  ? -0.792  12.958  40.087  1.00 3.74   ? 60  VAL G C   1 
ATOM   7793  O  O   . VAL G  1 60  ? -0.391  13.734  40.945  1.00 5.72   ? 60  VAL G O   1 
ATOM   7794  C  CB  . VAL G  1 60  ? -2.666  13.189  38.410  1.00 5.03   ? 60  VAL G CB  1 
ATOM   7795  C  CG1 . VAL G  1 60  ? -3.519  13.714  39.559  1.00 3.01   ? 60  VAL G CG1 1 
ATOM   7796  C  CG2 . VAL G  1 60  ? -3.097  13.946  37.162  1.00 1.27   ? 60  VAL G CG2 1 
ATOM   7797  N  N   . ALA G  1 61  ? -0.832  11.649  40.284  1.00 1.00   ? 61  ALA G N   1 
ATOM   7798  C  CA  . ALA G  1 61  ? -0.492  11.113  41.583  1.00 1.00   ? 61  ALA G CA  1 
ATOM   7799  C  C   . ALA G  1 61  ? 0.901   11.510  41.999  1.00 7.98   ? 61  ALA G C   1 
ATOM   7800  O  O   . ALA G  1 61  ? 1.123   11.920  43.135  1.00 6.67   ? 61  ALA G O   1 
ATOM   7801  C  CB  . ALA G  1 61  ? -0.669  9.605   41.612  1.00 1.00   ? 61  ALA G CB  1 
ATOM   7802  N  N   . GLU G  1 62  ? 1.834   11.396  41.061  1.00 3.90   ? 62  GLU G N   1 
ATOM   7803  C  CA  . GLU G  1 62  ? 3.208   11.747  41.396  1.00 3.68   ? 62  GLU G CA  1 
ATOM   7804  C  C   . GLU G  1 62  ? 3.402   13.224  41.646  1.00 7.39   ? 62  GLU G C   1 
ATOM   7805  O  O   . GLU G  1 62  ? 4.173   13.602  42.509  1.00 5.29   ? 62  GLU G O   1 
ATOM   7806  C  CB  . GLU G  1 62  ? 4.241   11.062  40.494  1.00 1.99   ? 62  GLU G CB  1 
ATOM   7807  C  CG  . GLU G  1 62  ? 4.197   9.521   40.631  1.00 9.15   ? 62  GLU G CG  1 
ATOM   7808  C  CD  . GLU G  1 62  ? 5.094   8.741   39.676  1.00 11.13  ? 62  GLU G CD  1 
ATOM   7809  O  OE1 . GLU G  1 62  ? 5.714   9.362   38.773  1.00 42.87  ? 62  GLU G OE1 1 
ATOM   7810  O  OE2 . GLU G  1 62  ? 5.056   7.490   39.815  1.00 23.03  ? 62  GLU G OE2 1 
ATOM   7811  N  N   . ARG G  1 63  ? 2.648   14.050  40.946  1.00 1.13   ? 63  ARG G N   1 
ATOM   7812  C  CA  . ARG G  1 63  ? 2.752   15.480  41.153  1.00 4.09   ? 63  ARG G CA  1 
ATOM   7813  C  C   . ARG G  1 63  ? 2.220   15.817  42.536  1.00 6.96   ? 63  ARG G C   1 
ATOM   7814  O  O   . ARG G  1 63  ? 2.741   16.682  43.226  1.00 6.15   ? 63  ARG G O   1 
ATOM   7815  C  CB  . ARG G  1 63  ? 1.965   16.251  40.093  1.00 1.00   ? 63  ARG G CB  1 
ATOM   7816  C  CG  . ARG G  1 63  ? 1.977   17.747  40.293  1.00 1.00   ? 63  ARG G CG  1 
ATOM   7817  C  CD  . ARG G  1 63  ? 3.366   18.319  40.352  1.00 1.00   ? 63  ARG G CD  1 
ATOM   7818  N  NE  . ARG G  1 63  ? 3.260   19.720  40.638  1.00 4.24   ? 63  ARG G NE  1 
ATOM   7819  C  CZ  . ARG G  1 63  ? 4.279   20.421  41.063  1.00 6.03   ? 63  ARG G CZ  1 
ATOM   7820  N  NH1 . ARG G  1 63  ? 5.446   19.852  41.222  1.00 2.19   ? 63  ARG G NH1 1 
ATOM   7821  N  NH2 . ARG G  1 63  ? 4.111   21.692  41.335  1.00 1.70   ? 63  ARG G NH2 1 
ATOM   7822  N  N   . LEU G  1 64  ? 1.190   15.101  42.942  1.00 1.00   ? 64  LEU G N   1 
ATOM   7823  C  CA  . LEU G  1 64  ? 0.607   15.354  44.248  1.00 3.76   ? 64  LEU G CA  1 
ATOM   7824  C  C   . LEU G  1 64  ? 1.638   15.035  45.319  1.00 11.67  ? 64  LEU G C   1 
ATOM   7825  O  O   . LEU G  1 64  ? 1.853   15.781  46.275  1.00 10.89  ? 64  LEU G O   1 
ATOM   7826  C  CB  . LEU G  1 64  ? -0.612  14.435  44.444  1.00 1.00   ? 64  LEU G CB  1 
ATOM   7827  C  CG  . LEU G  1 64  ? -1.331  14.436  45.802  1.00 9.22   ? 64  LEU G CG  1 
ATOM   7828  C  CD1 . LEU G  1 64  ? -1.742  15.860  46.220  1.00 4.77   ? 64  LEU G CD1 1 
ATOM   7829  C  CD2 . LEU G  1 64  ? -2.495  13.434  45.850  1.00 3.16   ? 64  LEU G CD2 1 
ATOM   7830  N  N   . LEU G  1 65  ? 2.269   13.882  45.171  1.00 3.58   ? 65  LEU G N   1 
ATOM   7831  C  CA  . LEU G  1 65  ? 3.278   13.404  46.114  1.00 3.45   ? 65  LEU G CA  1 
ATOM   7832  C  C   . LEU G  1 65  ? 4.394   14.470  46.190  1.00 8.73   ? 65  LEU G C   1 
ATOM   7833  O  O   . LEU G  1 65  ? 4.776   14.989  47.227  1.00 4.91   ? 65  LEU G O   1 
ATOM   7834  C  CB  . LEU G  1 65  ? 3.695   12.131  45.419  1.00 2.34   ? 65  LEU G CB  1 
ATOM   7835  C  CG  . LEU G  1 65  ? 4.004   10.813  46.077  1.00 8.95   ? 65  LEU G CG  1 
ATOM   7836  C  CD1 . LEU G  1 65  ? 3.049   10.630  47.184  1.00 2.39   ? 65  LEU G CD1 1 
ATOM   7837  C  CD2 . LEU G  1 65  ? 3.685   9.796   45.006  1.00 1.00   ? 65  LEU G CD2 1 
ATOM   7838  N  N   . ALA G  1 66  ? 4.821   14.948  45.031  1.00 5.78   ? 66  ALA G N   1 
ATOM   7839  C  CA  . ALA G  1 66  ? 5.839   15.971  44.955  1.00 4.79   ? 66  ALA G CA  1 
ATOM   7840  C  C   . ALA G  1 66  ? 5.482   17.282  45.630  1.00 11.98  ? 66  ALA G C   1 
ATOM   7841  O  O   . ALA G  1 66  ? 6.390   18.066  45.924  1.00 5.56   ? 66  ALA G O   1 
ATOM   7842  C  CB  . ALA G  1 66  ? 6.134   16.235  43.519  1.00 4.52   ? 66  ALA G CB  1 
ATOM   7843  N  N   . ILE G  1 67  ? 4.203   17.611  45.717  1.00 11.48  ? 67  ILE G N   1 
ATOM   7844  C  CA  . ILE G  1 67  ? 3.808   18.839  46.377  1.00 8.05   ? 67  ILE G CA  1 
ATOM   7845  C  C   . ILE G  1 67  ? 3.481   18.560  47.829  1.00 16.60  ? 67  ILE G C   1 
ATOM   7846  O  O   . ILE G  1 67  ? 2.861   19.374  48.495  1.00 15.02  ? 67  ILE G O   1 
ATOM   7847  C  CB  . ILE G  1 67  ? 2.692   19.638  45.747  1.00 6.42   ? 67  ILE G CB  1 
ATOM   7848  C  CG1 . ILE G  1 67  ? 1.395   18.844  45.662  1.00 5.48   ? 67  ILE G CG1 1 
ATOM   7849  C  CG2 . ILE G  1 67  ? 3.169   20.184  44.420  1.00 4.06   ? 67  ILE G CG2 1 
ATOM   7850  C  CD1 . ILE G  1 67  ? 0.267   19.644  45.011  1.00 28.24  ? 67  ILE G CD1 1 
ATOM   7851  N  N   . GLY G  1 68  ? 3.890   17.390  48.286  1.00 5.71   ? 68  GLY G N   1 
ATOM   7852  C  CA  . GLY G  1 68  ? 3.665   17.009  49.653  1.00 1.00   ? 68  GLY G CA  1 
ATOM   7853  C  C   . GLY G  1 68  ? 2.345   16.382  49.998  1.00 11.49  ? 68  GLY G C   1 
ATOM   7854  O  O   . GLY G  1 68  ? 2.019   16.279  51.178  1.00 18.63  ? 68  GLY G O   1 
ATOM   7855  N  N   . GLY G  1 69  ? 1.603   15.943  48.992  1.00 7.17   ? 69  GLY G N   1 
ATOM   7856  C  CA  . GLY G  1 69  ? 0.327   15.292  49.204  1.00 1.09   ? 69  GLY G CA  1 
ATOM   7857  C  C   . GLY G  1 69  ? 0.377   13.791  49.388  1.00 5.52   ? 69  GLY G C   1 
ATOM   7858  O  O   . GLY G  1 69  ? 1.442   13.192  49.361  1.00 6.06   ? 69  GLY G O   1 
ATOM   7859  N  N   . SER G  1 70  ? -0.785  13.163  49.499  1.00 4.34   ? 70  SER G N   1 
ATOM   7860  C  CA  . SER G  1 70  ? -0.869  11.718  49.624  1.00 7.83   ? 70  SER G CA  1 
ATOM   7861  C  C   . SER G  1 70  ? -1.979  11.162  48.762  1.00 16.97  ? 70  SER G C   1 
ATOM   7862  O  O   . SER G  1 70  ? -3.140  11.274  49.127  1.00 21.48  ? 70  SER G O   1 
ATOM   7863  C  CB  . SER G  1 70  ? -1.113  11.404  51.096  1.00 11.23  ? 70  SER G CB  1 
ATOM   7864  O  OG  . SER G  1 70  ? -0.053  11.957  51.852  1.00 34.12  ? 70  SER G OG  1 
ATOM   7865  N  N   . PRO G  1 71  ? -1.663  10.558  47.625  1.00 13.69  ? 71  PRO G N   1 
ATOM   7866  C  CA  . PRO G  1 71  ? -2.732  10.059  46.753  1.00 10.26  ? 71  PRO G CA  1 
ATOM   7867  C  C   . PRO G  1 71  ? -3.614  8.953   47.317  1.00 8.87   ? 71  PRO G C   1 
ATOM   7868  O  O   . PRO G  1 71  ? -3.150  8.053   48.028  1.00 4.42   ? 71  PRO G O   1 
ATOM   7869  C  CB  . PRO G  1 71  ? -1.972  9.465   45.554  1.00 9.22   ? 71  PRO G CB  1 
ATOM   7870  C  CG  . PRO G  1 71  ? -0.606  9.107   46.086  1.00 14.67  ? 71  PRO G CG  1 
ATOM   7871  C  CD  . PRO G  1 71  ? -0.324  10.171  47.136  1.00 7.06   ? 71  PRO G CD  1 
ATOM   7872  N  N   . PHE G  1 72  ? -4.882  8.988   46.933  1.00 7.39   ? 72  PHE G N   1 
ATOM   7873  C  CA  . PHE G  1 72  ? -5.724  7.866   47.314  1.00 4.26   ? 72  PHE G CA  1 
ATOM   7874  C  C   . PHE G  1 72  ? -5.106  6.658   46.618  1.00 13.71  ? 72  PHE G C   1 
ATOM   7875  O  O   . PHE G  1 72  ? -4.552  6.769   45.510  1.00 9.35   ? 72  PHE G O   1 
ATOM   7876  C  CB  . PHE G  1 72  ? -7.089  8.036   46.664  1.00 5.92   ? 72  PHE G CB  1 
ATOM   7877  C  CG  . PHE G  1 72  ? -7.849  9.206   47.179  1.00 8.51   ? 72  PHE G CG  1 
ATOM   7878  C  CD1 . PHE G  1 72  ? -8.086  9.337   48.536  1.00 13.74  ? 72  PHE G CD1 1 
ATOM   7879  C  CD2 . PHE G  1 72  ? -8.328  10.159  46.297  1.00 9.60   ? 72  PHE G CD2 1 
ATOM   7880  C  CE1 . PHE G  1 72  ? -8.811  10.388  49.010  1.00 18.31  ? 72  PHE G CE1 1 
ATOM   7881  C  CE2 . PHE G  1 72  ? -9.075  11.203  46.753  1.00 12.33  ? 72  PHE G CE2 1 
ATOM   7882  C  CZ  . PHE G  1 72  ? -9.304  11.330  48.114  1.00 13.72  ? 72  PHE G CZ  1 
ATOM   7883  N  N   . SER G  1 73  ? -5.310  5.485   47.189  1.00 5.70   ? 73  SER G N   1 
ATOM   7884  C  CA  . SER G  1 73  ? -4.663  4.349   46.577  1.00 1.80   ? 73  SER G CA  1 
ATOM   7885  C  C   . SER G  1 73  ? -5.317  3.021   46.834  1.00 7.01   ? 73  SER G C   1 
ATOM   7886  O  O   . SER G  1 73  ? -4.649  2.002   47.039  1.00 5.77   ? 73  SER G O   1 
ATOM   7887  C  CB  . SER G  1 73  ? -3.201  4.337   46.981  1.00 6.29   ? 73  SER G CB  1 
ATOM   7888  O  OG  . SER G  1 73  ? -3.129  4.255   48.389  1.00 12.01  ? 73  SER G OG  1 
ATOM   7889  N  N   . THR G  1 74  ? -6.644  3.031   46.763  1.00 3.24   ? 74  THR G N   1 
ATOM   7890  C  CA  . THR G  1 74  ? -7.419  1.806   46.921  1.00 4.39   ? 74  THR G CA  1 
ATOM   7891  C  C   . THR G  1 74  ? -8.673  2.062   46.096  1.00 6.73   ? 74  THR G C   1 
ATOM   7892  O  O   . THR G  1 74  ? -9.063  3.206   45.914  1.00 8.74   ? 74  THR G O   1 
ATOM   7893  C  CB  . THR G  1 74  ? -7.860  1.541   48.398  1.00 10.30  ? 74  THR G CB  1 
ATOM   7894  O  OG1 . THR G  1 74  ? -8.555  2.690   48.873  1.00 12.16  ? 74  THR G OG1 1 
ATOM   7895  C  CG2 . THR G  1 74  ? -6.680  1.273   49.316  1.00 5.68   ? 74  THR G CG2 1 
ATOM   7896  N  N   . LEU G  1 75  ? -9.276  1.003   45.576  1.00 4.93   ? 75  LEU G N   1 
ATOM   7897  C  CA  . LEU G  1 75  ? -10.529 1.127   44.830  1.00 7.11   ? 75  LEU G CA  1 
ATOM   7898  C  C   . LEU G  1 75  ? -11.583 1.789   45.691  1.00 11.65  ? 75  LEU G C   1 
ATOM   7899  O  O   . LEU G  1 75  ? -12.339 2.647   45.239  1.00 15.11  ? 75  LEU G O   1 
ATOM   7900  C  CB  . LEU G  1 75  ? -11.067 -0.245  44.414  1.00 6.99   ? 75  LEU G CB  1 
ATOM   7901  C  CG  . LEU G  1 75  ? -10.306 -0.894  43.250  1.00 14.26  ? 75  LEU G CG  1 
ATOM   7902  C  CD1 . LEU G  1 75  ? -8.900  -1.203  43.664  1.00 17.55  ? 75  LEU G CD1 1 
ATOM   7903  C  CD2 . LEU G  1 75  ? -10.931 -2.178  42.845  1.00 9.14   ? 75  LEU G CD2 1 
ATOM   7904  N  N   . LYS G  1 76  ? -11.602 1.394   46.957  1.00 10.45  ? 76  LYS G N   1 
ATOM   7905  C  CA  . LYS G  1 76  ? -12.577 1.966   47.872  1.00 10.80  ? 76  LYS G CA  1 
ATOM   7906  C  C   . LYS G  1 76  ? -12.439 3.458   47.911  1.00 10.25  ? 76  LYS G C   1 
ATOM   7907  O  O   . LYS G  1 76  ? -13.447 4.152   47.719  1.00 10.46  ? 76  LYS G O   1 
ATOM   7908  C  CB  . LYS G  1 76  ? -12.419 1.403   49.279  1.00 15.30  ? 76  LYS G CB  1 
ATOM   7909  C  CG  . LYS G  1 76  ? -13.394 1.968   50.295  1.00 49.84  ? 76  LYS G CG  1 
ATOM   7910  C  CD  . LYS G  1 76  ? -13.378 1.102   51.533  1.00 99.17  ? 76  LYS G CD  1 
ATOM   7911  C  CE  . LYS G  1 76  ? -14.297 1.663   52.602  1.00 99.91  ? 76  LYS G CE  1 
ATOM   7912  N  NZ  . LYS G  1 76  ? -13.723 2.921   53.169  0.00 100.00 ? 76  LYS G NZ  1 
ATOM   7913  N  N   . GLU G  1 77  ? -11.220 3.950   48.109  1.00 6.82   ? 77  GLU G N   1 
ATOM   7914  C  CA  . GLU G  1 77  ? -11.070 5.406   48.111  1.00 6.52   ? 77  GLU G CA  1 
ATOM   7915  C  C   . GLU G  1 77  ? -11.452 6.027   46.768  1.00 11.02  ? 77  GLU G C   1 
ATOM   7916  O  O   . GLU G  1 77  ? -12.024 7.113   46.732  1.00 10.15  ? 77  GLU G O   1 
ATOM   7917  C  CB  . GLU G  1 77  ? -9.643  5.860   48.451  1.00 9.00   ? 77  GLU G CB  1 
ATOM   7918  C  CG  . GLU G  1 77  ? -9.194  5.544   49.874  1.00 12.22  ? 77  GLU G CG  1 
ATOM   7919  C  CD  . GLU G  1 77  ? -7.695  5.618   50.044  1.00 34.72  ? 77  GLU G CD  1 
ATOM   7920  O  OE1 . GLU G  1 77  ? -7.014  4.772   49.446  1.00 28.16  ? 77  GLU G OE1 1 
ATOM   7921  O  OE2 . GLU G  1 77  ? -7.207  6.521   50.747  1.00 30.20  ? 77  GLU G OE2 1 
ATOM   7922  N  N   . PHE G  1 78  ? -11.109 5.356   45.663  1.00 9.23   ? 78  PHE G N   1 
ATOM   7923  C  CA  . PHE G  1 78  ? -11.385 5.921   44.347  1.00 7.31   ? 78  PHE G CA  1 
ATOM   7924  C  C   . PHE G  1 78  ? -12.888 6.020   44.269  1.00 12.26  ? 78  PHE G C   1 
ATOM   7925  O  O   . PHE G  1 78  ? -13.378 7.074   43.925  1.00 13.16  ? 78  PHE G O   1 
ATOM   7926  C  CB  . PHE G  1 78  ? -10.887 5.087   43.164  1.00 5.60   ? 78  PHE G CB  1 
ATOM   7927  C  CG  . PHE G  1 78  ? -9.414  4.870   43.148  1.00 4.14   ? 78  PHE G CG  1 
ATOM   7928  C  CD1 . PHE G  1 78  ? -8.548  5.823   43.705  1.00 5.37   ? 78  PHE G CD1 1 
ATOM   7929  C  CD2 . PHE G  1 78  ? -8.860  3.731   42.610  1.00 3.57   ? 78  PHE G CD2 1 
ATOM   7930  C  CE1 . PHE G  1 78  ? -7.157  5.661   43.735  1.00 6.88   ? 78  PHE G CE1 1 
ATOM   7931  C  CE2 . PHE G  1 78  ? -7.467  3.580   42.621  1.00 2.19   ? 78  PHE G CE2 1 
ATOM   7932  C  CZ  . PHE G  1 78  ? -6.623  4.517   43.209  1.00 4.39   ? 78  PHE G CZ  1 
ATOM   7933  N  N   . LEU G  1 79  ? -13.595 4.938   44.571  1.00 7.25   ? 79  LEU G N   1 
ATOM   7934  C  CA  . LEU G  1 79  ? -15.063 4.946   44.517  1.00 13.82  ? 79  LEU G CA  1 
ATOM   7935  C  C   . LEU G  1 79  ? -15.716 6.040   45.352  1.00 21.26  ? 79  LEU G C   1 
ATOM   7936  O  O   . LEU G  1 79  ? -16.634 6.740   44.933  1.00 17.73  ? 79  LEU G O   1 
ATOM   7937  C  CB  . LEU G  1 79  ? -15.642 3.620   44.982  1.00 16.28  ? 79  LEU G CB  1 
ATOM   7938  C  CG  . LEU G  1 79  ? -15.766 2.658   43.807  1.00 24.90  ? 79  LEU G CG  1 
ATOM   7939  C  CD1 . LEU G  1 79  ? -16.345 1.291   44.147  1.00 19.75  ? 79  LEU G CD1 1 
ATOM   7940  C  CD2 . LEU G  1 79  ? -16.549 3.425   42.778  1.00 27.11  ? 79  LEU G CD2 1 
ATOM   7941  N  N   . GLU G  1 80  ? -15.180 6.208   46.549  1.00 16.51  ? 80  GLU G N   1 
ATOM   7942  C  CA  . GLU G  1 80  ? -15.678 7.219   47.460  1.00 17.20  ? 80  GLU G CA  1 
ATOM   7943  C  C   . GLU G  1 80  ? -15.439 8.617   46.956  1.00 25.59  ? 80  GLU G C   1 
ATOM   7944  O  O   . GLU G  1 80  ? -16.194 9.517   47.308  1.00 38.34  ? 80  GLU G O   1 
ATOM   7945  C  CB  . GLU G  1 80  ? -15.056 7.064   48.842  1.00 17.95  ? 80  GLU G CB  1 
ATOM   7946  C  CG  . GLU G  1 80  ? -15.338 5.705   49.448  1.00 62.61  ? 80  GLU G CG  1 
ATOM   7947  C  CD  . GLU G  1 80  ? -14.758 5.536   50.815  0.00 100.00 ? 80  GLU G CD  1 
ATOM   7948  O  OE1 . GLU G  1 80  ? -13.812 6.261   51.156  1.00 99.68  ? 80  GLU G OE1 1 
ATOM   7949  O  OE2 . GLU G  1 80  ? -15.252 4.659   51.541  0.00 100.00 ? 80  GLU G OE2 1 
ATOM   7950  N  N   . ASN G  1 81  ? -14.387 8.832   46.178  1.00 12.32  ? 81  ASN G N   1 
ATOM   7951  C  CA  . ASN G  1 81  ? -14.110 10.197  45.769  1.00 10.81  ? 81  ASN G CA  1 
ATOM   7952  C  C   . ASN G  1 81  ? -14.406 10.633  44.345  1.00 13.76  ? 81  ASN G C   1 
ATOM   7953  O  O   . ASN G  1 81  ? -14.386 11.816  44.022  1.00 18.46  ? 81  ASN G O   1 
ATOM   7954  C  CB  . ASN G  1 81  ? -12.693 10.582  46.186  1.00 13.79  ? 81  ASN G CB  1 
ATOM   7955  C  CG  . ASN G  1 81  ? -12.482 10.458  47.667  1.00 14.45  ? 81  ASN G CG  1 
ATOM   7956  O  OD1 . ASN G  1 81  ? -12.236 9.364   48.168  1.00 21.23  ? 81  ASN G OD1 1 
ATOM   7957  N  ND2 . ASN G  1 81  ? -12.577 11.585  48.377  1.00 14.97  ? 81  ASN G ND2 1 
ATOM   7958  N  N   . ALA G  1 82  ? -14.550 9.653   43.466  1.00 12.58  ? 82  ALA G N   1 
ATOM   7959  C  CA  . ALA G  1 82  ? -14.666 10.058  42.077  1.00 13.03  ? 82  ALA G CA  1 
ATOM   7960  C  C   . ALA G  1 82  ? -15.943 10.814  41.731  1.00 17.43  ? 82  ALA G C   1 
ATOM   7961  O  O   . ALA G  1 82  ? -17.022 10.470  42.231  1.00 20.39  ? 82  ALA G O   1 
ATOM   7962  C  CB  . ALA G  1 82  ? -14.570 8.793   41.207  1.00 11.92  ? 82  ALA G CB  1 
ATOM   7963  N  N   . SER G  1 83  ? -15.838 11.775  40.813  1.00 7.40   ? 83  SER G N   1 
ATOM   7964  C  CA  . SER G  1 83  ? -16.994 12.433  40.193  1.00 4.86   ? 83  SER G CA  1 
ATOM   7965  C  C   . SER G  1 83  ? -17.435 11.707  38.893  1.00 14.74  ? 83  SER G C   1 
ATOM   7966  O  O   . SER G  1 83  ? -18.567 11.746  38.419  1.00 17.68  ? 83  SER G O   1 
ATOM   7967  C  CB  . SER G  1 83  ? -16.725 13.922  39.996  1.00 2.20   ? 83  SER G CB  1 
ATOM   7968  O  OG  . SER G  1 83  ? -15.548 14.136  39.262  1.00 24.94  ? 83  SER G OG  1 
ATOM   7969  N  N   . VAL G  1 84  ? -16.538 10.945  38.293  1.00 12.72  ? 84  VAL G N   1 
ATOM   7970  C  CA  . VAL G  1 84  ? -16.856 10.142  37.128  1.00 8.89   ? 84  VAL G CA  1 
ATOM   7971  C  C   . VAL G  1 84  ? -17.768 9.008   37.596  1.00 13.28  ? 84  VAL G C   1 
ATOM   7972  O  O   . VAL G  1 84  ? -17.540 8.337   38.601  1.00 12.15  ? 84  VAL G O   1 
ATOM   7973  C  CB  . VAL G  1 84  ? -15.551 9.542   36.588  1.00 5.65   ? 84  VAL G CB  1 
ATOM   7974  C  CG1 . VAL G  1 84  ? -15.830 8.566   35.503  1.00 4.68   ? 84  VAL G CG1 1 
ATOM   7975  C  CG2 . VAL G  1 84  ? -14.682 10.609  36.052  1.00 3.68   ? 84  VAL G CG2 1 
ATOM   7976  N  N   . GLU G  1 85  ? -18.808 8.744   36.819  1.00 20.62  ? 85  GLU G N   1 
ATOM   7977  C  CA  . GLU G  1 85  ? -19.749 7.672   37.169  1.00 21.56  ? 85  GLU G CA  1 
ATOM   7978  C  C   . GLU G  1 85  ? -19.435 6.403   36.433  1.00 17.33  ? 85  GLU G C   1 
ATOM   7979  O  O   . GLU G  1 85  ? -19.056 6.462   35.269  1.00 21.64  ? 85  GLU G O   1 
ATOM   7980  C  CB  . GLU G  1 85  ? -21.140 8.115   36.718  1.00 27.62  ? 85  GLU G CB  1 
ATOM   7981  C  CG  . GLU G  1 85  ? -21.816 9.153   37.583  1.00 73.37  ? 85  GLU G CG  1 
ATOM   7982  C  CD  . GLU G  1 85  ? -21.896 8.718   39.037  0.00 100.00 ? 85  GLU G CD  1 
ATOM   7983  O  OE1 . GLU G  1 85  ? -21.713 7.518   39.289  0.00 100.00 ? 85  GLU G OE1 1 
ATOM   7984  O  OE2 . GLU G  1 85  ? -22.126 9.574   39.911  0.00 100.00 ? 85  GLU G OE2 1 
ATOM   7985  N  N   . GLU G  1 86  ? -19.729 5.282   37.065  1.00 12.21  ? 86  GLU G N   1 
ATOM   7986  C  CA  . GLU G  1 86  ? -19.538 4.001   36.384  1.00 16.94  ? 86  GLU G CA  1 
ATOM   7987  C  C   . GLU G  1 86  ? -20.784 3.138   36.572  1.00 19.95  ? 86  GLU G C   1 
ATOM   7988  O  O   . GLU G  1 86  ? -21.524 3.287   37.550  1.00 19.89  ? 86  GLU G O   1 
ATOM   7989  C  CB  . GLU G  1 86  ? -18.344 3.185   36.925  1.00 16.76  ? 86  GLU G CB  1 
ATOM   7990  C  CG  . GLU G  1 86  ? -18.397 2.922   38.430  1.00 39.80  ? 86  GLU G CG  1 
ATOM   7991  C  CD  . GLU G  1 86  ? -17.477 1.834   38.945  1.00 49.20  ? 86  GLU G CD  1 
ATOM   7992  O  OE1 . GLU G  1 86  ? -16.435 1.548   38.336  1.00 28.97  ? 86  GLU G OE1 1 
ATOM   7993  O  OE2 . GLU G  1 86  ? -17.774 1.285   40.018  1.00 24.45  ? 86  GLU G OE2 1 
ATOM   7994  N  N   . ALA G  1 87  ? -20.966 2.184   35.661  1.00 17.53  ? 87  ALA G N   1 
ATOM   7995  C  CA  . ALA G  1 87  ? -22.072 1.241   35.763  1.00 17.10  ? 87  ALA G CA  1 
ATOM   7996  C  C   . ALA G  1 87  ? -21.773 -0.084  35.106  1.00 19.74  ? 87  ALA G C   1 
ATOM   7997  O  O   . ALA G  1 87  ? -21.280 -0.158  33.997  1.00 24.73  ? 87  ALA G O   1 
ATOM   7998  C  CB  . ALA G  1 87  ? -23.314 1.835   35.149  1.00 17.87  ? 87  ALA G CB  1 
ATOM   7999  N  N   . PRO G  1 88  ? -22.147 -1.155  35.796  1.00 17.44  ? 88  PRO G N   1 
ATOM   8000  C  CA  . PRO G  1 88  ? -21.940 -2.516  35.323  1.00 20.82  ? 88  PRO G CA  1 
ATOM   8001  C  C   . PRO G  1 88  ? -22.569 -2.677  33.968  1.00 18.44  ? 88  PRO G C   1 
ATOM   8002  O  O   . PRO G  1 88  ? -23.506 -1.993  33.612  1.00 16.60  ? 88  PRO G O   1 
ATOM   8003  C  CB  . PRO G  1 88  ? -22.675 -3.367  36.347  1.00 22.99  ? 88  PRO G CB  1 
ATOM   8004  C  CG  . PRO G  1 88  ? -23.676 -2.458  36.909  1.00 27.32  ? 88  PRO G CG  1 
ATOM   8005  C  CD  . PRO G  1 88  ? -23.119 -1.089  36.900  1.00 18.89  ? 88  PRO G CD  1 
ATOM   8006  N  N   . TYR G  1 89  ? -21.991 -3.545  33.171  1.00 14.81  ? 89  TYR G N   1 
ATOM   8007  C  CA  . TYR G  1 89  ? -22.535 -3.719  31.836  1.00 15.56  ? 89  TYR G CA  1 
ATOM   8008  C  C   . TYR G  1 89  ? -23.513 -4.876  31.904  1.00 30.02  ? 89  TYR G C   1 
ATOM   8009  O  O   . TYR G  1 89  ? -23.105 -6.008  32.120  1.00 35.12  ? 89  TYR G O   1 
ATOM   8010  C  CB  . TYR G  1 89  ? -21.408 -3.981  30.849  1.00 7.98   ? 89  TYR G CB  1 
ATOM   8011  C  CG  . TYR G  1 89  ? -21.844 -3.987  29.415  1.00 9.99   ? 89  TYR G CG  1 
ATOM   8012  C  CD1 . TYR G  1 89  ? -22.256 -5.162  28.824  1.00 13.58  ? 89  TYR G CD1 1 
ATOM   8013  C  CD2 . TYR G  1 89  ? -21.775 -2.843  28.620  1.00 9.24   ? 89  TYR G CD2 1 
ATOM   8014  C  CE1 . TYR G  1 89  ? -22.606 -5.204  27.495  1.00 18.21  ? 89  TYR G CE1 1 
ATOM   8015  C  CE2 . TYR G  1 89  ? -22.098 -2.895  27.270  1.00 8.84   ? 89  TYR G CE2 1 
ATOM   8016  C  CZ  . TYR G  1 89  ? -22.514 -4.084  26.720  1.00 18.87  ? 89  TYR G CZ  1 
ATOM   8017  O  OH  . TYR G  1 89  ? -22.860 -4.165  25.396  1.00 30.39  ? 89  TYR G OH  1 
ATOM   8018  N  N   . THR G  1 90  ? -24.799 -4.575  31.770  1.00 35.12  ? 90  THR G N   1 
ATOM   8019  C  CA  . THR G  1 90  ? -25.855 -5.565  31.831  1.00 38.38  ? 90  THR G CA  1 
ATOM   8020  C  C   . THR G  1 90  ? -26.534 -5.710  30.484  1.00 47.57  ? 90  THR G C   1 
ATOM   8021  O  O   . THR G  1 90  ? -26.443 -6.690  29.764  1.00 48.57  ? 90  THR G O   1 
ATOM   8022  C  CB  . THR G  1 90  ? -26.874 -5.077  32.834  1.00 50.83  ? 90  THR G CB  1 
ATOM   8023  O  OG1 . THR G  1 90  ? -27.210 -3.717  32.525  1.00 57.01  ? 90  THR G OG1 1 
ATOM   8024  C  CG2 . THR G  1 90  ? -26.234 -5.141  34.208  1.00 51.80  ? 90  THR G CG2 1 
ATOM   8025  N  N   . LYS G  1 91  ? -27.239 -4.670  30.106  1.00 29.78  ? 91  LYS G N   1 
ATOM   8026  C  CA  . LYS G  1 91  ? -27.890 -4.703  28.809  1.00 35.54  ? 91  LYS G CA  1 
ATOM   8027  C  C   . LYS G  1 91  ? -26.821 -4.483  27.725  1.00 27.97  ? 91  LYS G C   1 
ATOM   8028  O  O   . LYS G  1 91  ? -25.889 -3.698  27.887  1.00 12.21  ? 91  LYS G O   1 
ATOM   8029  C  CB  . LYS G  1 91  ? -28.935 -3.566  28.862  1.00 36.43  ? 91  LYS G CB  1 
ATOM   8030  C  CG  . LYS G  1 91  ? -29.918 -3.395  27.727  1.00 78.64  ? 91  LYS G CG  1 
ATOM   8031  C  CD  . LYS G  1 91  ? -30.780 -2.145  27.901  0.00 100.00 ? 91  LYS G CD  1 
ATOM   8032  C  CE  . LYS G  1 91  ? -31.558 -2.116  29.197  1.00 66.24  ? 91  LYS G CE  1 
ATOM   8033  N  NZ  . LYS G  1 91  ? -32.649 -1.078  29.211  0.00 100.00 ? 91  LYS G NZ  1 
ATOM   8034  N  N   . PRO G  1 92  ? -26.925 -5.102  26.559  1.00 35.86  ? 92  PRO G N   1 
ATOM   8035  C  CA  . PRO G  1 92  ? -25.910 -4.766  25.572  1.00 40.76  ? 92  PRO G CA  1 
ATOM   8036  C  C   . PRO G  1 92  ? -26.036 -3.283  25.146  1.00 44.56  ? 92  PRO G C   1 
ATOM   8037  O  O   . PRO G  1 92  ? -27.086 -2.646  25.367  1.00 40.33  ? 92  PRO G O   1 
ATOM   8038  C  CB  . PRO G  1 92  ? -26.153 -5.725  24.415  1.00 36.64  ? 92  PRO G CB  1 
ATOM   8039  C  CG  . PRO G  1 92  ? -27.243 -6.728  24.870  1.00 7.30   ? 92  PRO G CG  1 
ATOM   8040  C  CD  . PRO G  1 92  ? -27.712 -6.314  26.242  1.00 1.93   ? 92  PRO G CD  1 
ATOM   8041  N  N   . LYS G  1 93  ? -24.976 -2.717  24.608  1.00 34.39  ? 93  LYS G N   1 
ATOM   8042  C  CA  . LYS G  1 93  ? -25.009 -1.314  24.207  1.00 16.10  ? 93  LYS G CA  1 
ATOM   8043  C  C   . LYS G  1 93  ? -24.355 -1.118  22.858  1.00 10.94  ? 93  LYS G C   1 
ATOM   8044  O  O   . LYS G  1 93  ? -23.377 -1.776  22.503  1.00 12.30  ? 93  LYS G O   1 
ATOM   8045  C  CB  . LYS G  1 93  ? -24.432 -0.388  25.291  1.00 7.00   ? 93  LYS G CB  1 
ATOM   8046  C  CG  . LYS G  1 93  ? -25.180 -0.439  26.623  1.00 44.28  ? 93  LYS G CG  1 
ATOM   8047  C  CD  . LYS G  1 93  ? -24.297 -0.040  27.816  1.00 34.46  ? 93  LYS G CD  1 
ATOM   8048  C  CE  . LYS G  1 93  ? -23.798 1.408   27.743  0.00 100.00 ? 93  LYS G CE  1 
ATOM   8049  N  NZ  . LYS G  1 93  ? -22.810 1.747   28.790  1.00 35.10  ? 93  LYS G NZ  1 
ATOM   8050  N  N   . THR G  1 94  ? -24.966 -0.220  22.151  1.00 1.00   ? 94  THR G N   1 
ATOM   8051  C  CA  . THR G  1 94  ? -24.547 0.166   20.828  1.00 7.34   ? 94  THR G CA  1 
ATOM   8052  C  C   . THR G  1 94  ? -23.152 0.783   20.917  1.00 12.16  ? 94  THR G C   1 
ATOM   8053  O  O   . THR G  1 94  ? -22.741 1.275   21.976  1.00 4.84   ? 94  THR G O   1 
ATOM   8054  C  CB  . THR G  1 94  ? -25.567 1.175   20.340  1.00 11.00  ? 94  THR G CB  1 
ATOM   8055  O  OG1 . THR G  1 94  ? -26.324 0.617   19.282  1.00 16.38  ? 94  THR G OG1 1 
ATOM   8056  C  CG2 . THR G  1 94  ? -24.933 2.477   19.876  1.00 1.00   ? 94  THR G CG2 1 
ATOM   8057  N  N   . MET G  1 95  ? -22.437 0.744   19.807  1.00 14.74  ? 95  MET G N   1 
ATOM   8058  C  CA  . MET G  1 95  ? -21.096 1.345   19.737  1.00 20.37  ? 95  MET G CA  1 
ATOM   8059  C  C   . MET G  1 95  ? -21.217 2.799   20.102  1.00 22.08  ? 95  MET G C   1 
ATOM   8060  O  O   . MET G  1 95  ? -20.401 3.354   20.817  1.00 22.79  ? 95  MET G O   1 
ATOM   8061  C  CB  . MET G  1 95  ? -20.533 1.224   18.319  1.00 25.28  ? 95  MET G CB  1 
ATOM   8062  C  CG  . MET G  1 95  ? -19.089 1.718   18.208  1.00 30.31  ? 95  MET G CG  1 
ATOM   8063  S  SD  . MET G  1 95  ? -17.948 0.727   19.147  1.00 31.96  ? 95  MET G SD  1 
ATOM   8064  C  CE  . MET G  1 95  ? -17.584 -0.773  18.261  1.00 26.21  ? 95  MET G CE  1 
ATOM   8065  N  N   . ASP G  1 96  ? -22.185 3.439   19.477  1.00 20.36  ? 96  ASP G N   1 
ATOM   8066  C  CA  . ASP G  1 96  ? -22.408 4.855   19.671  1.00 24.37  ? 96  ASP G CA  1 
ATOM   8067  C  C   . ASP G  1 96  ? -22.771 5.105   21.110  1.00 14.81  ? 96  ASP G C   1 
ATOM   8068  O  O   . ASP G  1 96  ? -22.306 6.066   21.711  1.00 17.54  ? 96  ASP G O   1 
ATOM   8069  C  CB  . ASP G  1 96  ? -23.503 5.360   18.738  1.00 29.48  ? 96  ASP G CB  1 
ATOM   8070  C  CG  . ASP G  1 96  ? -22.977 5.564   17.321  1.00 57.03  ? 96  ASP G CG  1 
ATOM   8071  O  OD1 . ASP G  1 96  ? -21.813 5.168   17.095  1.00 65.73  ? 96  ASP G OD1 1 
ATOM   8072  O  OD2 . ASP G  1 96  ? -23.676 6.205   16.503  1.00 59.25  ? 96  ASP G OD2 1 
ATOM   8073  N  N   . GLN G  1 97  ? -23.519 4.183   21.688  1.00 8.38   ? 97  GLN G N   1 
ATOM   8074  C  CA  . GLN G  1 97  ? -23.860 4.422   23.079  1.00 14.75  ? 97  GLN G CA  1 
ATOM   8075  C  C   . GLN G  1 97  ? -22.603 4.452   23.932  1.00 19.88  ? 97  GLN G C   1 
ATOM   8076  O  O   . GLN G  1 97  ? -22.446 5.288   24.813  1.00 15.12  ? 97  GLN G O   1 
ATOM   8077  C  CB  . GLN G  1 97  ? -24.796 3.348   23.602  1.00 22.37  ? 97  GLN G CB  1 
ATOM   8078  C  CG  . GLN G  1 97  ? -26.093 3.226   22.843  1.00 41.78  ? 97  GLN G CG  1 
ATOM   8079  C  CD  . GLN G  1 97  ? -26.961 2.190   23.491  1.00 61.11  ? 97  GLN G CD  1 
ATOM   8080  O  OE1 . GLN G  1 97  ? -27.507 1.327   22.806  1.00 73.99  ? 97  GLN G OE1 1 
ATOM   8081  N  NE2 . GLN G  1 97  ? -27.088 2.239   24.806  1.00 91.31  ? 97  GLN G NE2 1 
ATOM   8082  N  N   . LEU G  1 98  ? -21.718 3.501   23.676  1.00 13.49  ? 98  LEU G N   1 
ATOM   8083  C  CA  . LEU G  1 98  ? -20.452 3.416   24.396  1.00 12.12  ? 98  LEU G CA  1 
ATOM   8084  C  C   . LEU G  1 98  ? -19.591 4.650   24.158  1.00 9.33   ? 98  LEU G C   1 
ATOM   8085  O  O   . LEU G  1 98  ? -19.058 5.232   25.084  1.00 7.80   ? 98  LEU G O   1 
ATOM   8086  C  CB  . LEU G  1 98  ? -19.701 2.163   23.924  1.00 11.62  ? 98  LEU G CB  1 
ATOM   8087  C  CG  . LEU G  1 98  ? -20.450 0.873   24.297  1.00 11.38  ? 98  LEU G CG  1 
ATOM   8088  C  CD1 . LEU G  1 98  ? -19.849 -0.434  23.811  1.00 9.75   ? 98  LEU G CD1 1 
ATOM   8089  C  CD2 . LEU G  1 98  ? -20.560 0.799   25.791  1.00 1.61   ? 98  LEU G CD2 1 
ATOM   8090  N  N   . MET G  1 99  ? -19.474 5.064   22.907  1.00 3.42   ? 99  MET G N   1 
ATOM   8091  C  CA  . MET G  1 99  ? -18.686 6.241   22.618  1.00 1.54   ? 99  MET G CA  1 
ATOM   8092  C  C   . MET G  1 99  ? -19.261 7.460   23.323  1.00 10.75  ? 99  MET G C   1 
ATOM   8093  O  O   . MET G  1 99  ? -18.539 8.310   23.831  1.00 12.01  ? 99  MET G O   1 
ATOM   8094  C  CB  . MET G  1 99  ? -18.620 6.471   21.114  1.00 4.70   ? 99  MET G CB  1 
ATOM   8095  C  CG  . MET G  1 99  ? -17.771 5.407   20.415  1.00 11.71  ? 99  MET G CG  1 
ATOM   8096  S  SD  . MET G  1 99  ? -16.053 5.050   21.133  1.00 14.72  ? 99  MET G SD  1 
ATOM   8097  C  CE  . MET G  1 99  ? -16.351 3.822   22.266  1.00 11.72  ? 99  MET G CE  1 
ATOM   8098  N  N   . GLU G  1 100 ? -20.585 7.535   23.377  1.00 12.83  ? 100 GLU G N   1 
ATOM   8099  C  CA  . GLU G  1 100 ? -21.236 8.669   24.013  1.00 11.81  ? 100 GLU G CA  1 
ATOM   8100  C  C   . GLU G  1 100 ? -20.908 8.711   25.503  1.00 11.60  ? 100 GLU G C   1 
ATOM   8101  O  O   . GLU G  1 100 ? -20.711 9.782   26.084  1.00 12.04  ? 100 GLU G O   1 
ATOM   8102  C  CB  . GLU G  1 100 ? -22.739 8.690   23.706  1.00 14.82  ? 100 GLU G CB  1 
ATOM   8103  C  CG  . GLU G  1 100 ? -23.129 9.283   22.329  1.00 36.77  ? 100 GLU G CG  1 
ATOM   8104  C  CD  . GLU G  1 100 ? -24.529 8.930   21.848  1.00 99.99  ? 100 GLU G CD  1 
ATOM   8105  O  OE1 . GLU G  1 100 ? -25.205 8.038   22.414  1.00 97.92  ? 100 GLU G OE1 1 
ATOM   8106  O  OE2 . GLU G  1 100 ? -24.948 9.511   20.846  0.00 100.00 ? 100 GLU G OE2 1 
ATOM   8107  N  N   . ASP G  1 101 ? -20.772 7.540   26.106  1.00 11.73  ? 101 ASP G N   1 
ATOM   8108  C  CA  . ASP G  1 101 ? -20.411 7.461   27.507  1.00 17.46  ? 101 ASP G CA  1 
ATOM   8109  C  C   . ASP G  1 101 ? -18.953 7.890   27.605  1.00 16.31  ? 101 ASP G C   1 
ATOM   8110  O  O   . ASP G  1 101 ? -18.564 8.674   28.453  1.00 13.39  ? 101 ASP G O   1 
ATOM   8111  C  CB  . ASP G  1 101 ? -20.643 6.024   27.976  1.00 25.59  ? 101 ASP G CB  1 
ATOM   8112  C  CG  . ASP G  1 101 ? -20.446 5.835   29.483  1.00 70.48  ? 101 ASP G CG  1 
ATOM   8113  O  OD1 . ASP G  1 101 ? -20.324 6.852   30.197  1.00 74.50  ? 101 ASP G OD1 1 
ATOM   8114  O  OD2 . ASP G  1 101 ? -20.423 4.677   29.963  1.00 79.60  ? 101 ASP G OD2 1 
ATOM   8115  N  N   . LEU G  1 102 ? -18.121 7.454   26.675  1.00 8.96   ? 102 LEU G N   1 
ATOM   8116  C  CA  . LEU G  1 102 ? -16.725 7.844   26.705  1.00 5.59   ? 102 LEU G CA  1 
ATOM   8117  C  C   . LEU G  1 102 ? -16.631 9.361   26.588  1.00 8.29   ? 102 LEU G C   1 
ATOM   8118  O  O   . LEU G  1 102 ? -15.970 10.060  27.369  1.00 9.65   ? 102 LEU G O   1 
ATOM   8119  C  CB  . LEU G  1 102 ? -16.145 7.209   25.452  1.00 5.24   ? 102 LEU G CB  1 
ATOM   8120  C  CG  . LEU G  1 102 ? -14.655 6.973   25.441  1.00 13.38  ? 102 LEU G CG  1 
ATOM   8121  C  CD1 . LEU G  1 102 ? -13.997 7.353   24.163  1.00 8.41   ? 102 LEU G CD1 1 
ATOM   8122  C  CD2 . LEU G  1 102 ? -14.003 7.712   26.565  1.00 25.02  ? 102 LEU G CD2 1 
ATOM   8123  N  N   . VAL G  1 103 ? -17.290 9.892   25.572  1.00 1.00   ? 103 VAL G N   1 
ATOM   8124  C  CA  . VAL G  1 103 ? -17.231 11.320  25.348  1.00 4.12   ? 103 VAL G CA  1 
ATOM   8125  C  C   . VAL G  1 103 ? -17.768 12.163  26.499  1.00 12.01  ? 103 VAL G C   1 
ATOM   8126  O  O   . VAL G  1 103 ? -17.310 13.269  26.812  1.00 7.67   ? 103 VAL G O   1 
ATOM   8127  C  CB  . VAL G  1 103 ? -18.024 11.708  24.101  1.00 12.75  ? 103 VAL G CB  1 
ATOM   8128  C  CG1 . VAL G  1 103 ? -18.317 13.197  24.126  1.00 13.83  ? 103 VAL G CG1 1 
ATOM   8129  C  CG2 . VAL G  1 103 ? -17.198 11.397  22.888  1.00 13.91  ? 103 VAL G CG2 1 
ATOM   8130  N  N   . GLY G  1 104 ? -18.780 11.619  27.141  1.00 6.10   ? 104 GLY G N   1 
ATOM   8131  C  CA  . GLY G  1 104 ? -19.337 12.358  28.260  1.00 4.57   ? 104 GLY G CA  1 
ATOM   8132  C  C   . GLY G  1 104 ? -18.276 12.466  29.359  1.00 9.96   ? 104 GLY G C   1 
ATOM   8133  O  O   . GLY G  1 104 ? -18.054 13.534  29.962  1.00 12.29  ? 104 GLY G O   1 
ATOM   8134  N  N   . THR G  1 105 ? -17.622 11.340  29.643  1.00 6.45   ? 105 THR G N   1 
ATOM   8135  C  CA  . THR G  1 105 ? -16.615 11.355  30.698  1.00 4.75   ? 105 THR G CA  1 
ATOM   8136  C  C   . THR G  1 105 ? -15.468 12.286  30.339  1.00 4.26   ? 105 THR G C   1 
ATOM   8137  O  O   . THR G  1 105 ? -14.908 12.976  31.182  1.00 6.70   ? 105 THR G O   1 
ATOM   8138  C  CB  . THR G  1 105 ? -16.117 9.948   30.967  1.00 12.19  ? 105 THR G CB  1 
ATOM   8139  O  OG1 . THR G  1 105 ? -17.209 9.151   31.447  1.00 16.70  ? 105 THR G OG1 1 
ATOM   8140  C  CG2 . THR G  1 105 ? -15.012 10.018  32.007  1.00 7.63   ? 105 THR G CG2 1 
ATOM   8141  N  N   . LEU G  1 106 ? -15.128 12.316  29.055  1.00 2.16   ? 106 LEU G N   1 
ATOM   8142  C  CA  . LEU G  1 106 ? -14.054 13.202  28.663  1.00 3.13   ? 106 LEU G CA  1 
ATOM   8143  C  C   . LEU G  1 106 ? -14.547 14.629  28.963  1.00 11.63  ? 106 LEU G C   1 
ATOM   8144  O  O   . LEU G  1 106 ? -13.789 15.465  29.486  1.00 9.35   ? 106 LEU G O   1 
ATOM   8145  C  CB  . LEU G  1 106 ? -13.743 13.020  27.172  1.00 2.62   ? 106 LEU G CB  1 
ATOM   8146  C  CG  . LEU G  1 106 ? -13.093 11.689  26.790  1.00 5.18   ? 106 LEU G CG  1 
ATOM   8147  C  CD1 . LEU G  1 106 ? -13.048 11.698  25.261  1.00 2.11   ? 106 LEU G CD1 1 
ATOM   8148  C  CD2 . LEU G  1 106 ? -11.687 11.780  27.307  1.00 1.02   ? 106 LEU G CD2 1 
ATOM   8149  N  N   . GLU G  1 107 ? -15.805 14.905  28.619  1.00 4.00   ? 107 GLU G N   1 
ATOM   8150  C  CA  . GLU G  1 107 ? -16.300 16.250  28.831  1.00 5.32   ? 107 GLU G CA  1 
ATOM   8151  C  C   . GLU G  1 107 ? -16.210 16.640  30.303  1.00 10.79  ? 107 GLU G C   1 
ATOM   8152  O  O   . GLU G  1 107 ? -15.760 17.745  30.654  1.00 7.31   ? 107 GLU G O   1 
ATOM   8153  C  CB  . GLU G  1 107 ? -17.685 16.426  28.222  1.00 5.61   ? 107 GLU G CB  1 
ATOM   8154  C  CG  . GLU G  1 107 ? -17.644 16.501  26.717  1.00 16.18  ? 107 GLU G CG  1 
ATOM   8155  C  CD  . GLU G  1 107 ? -19.015 16.468  26.099  1.00 27.24  ? 107 GLU G CD  1 
ATOM   8156  O  OE1 . GLU G  1 107 ? -19.899 15.841  26.688  1.00 38.69  ? 107 GLU G OE1 1 
ATOM   8157  O  OE2 . GLU G  1 107 ? -19.212 17.068  25.017  1.00 29.82  ? 107 GLU G OE2 1 
ATOM   8158  N  N   . LEU G  1 108 ? -16.560 15.685  31.163  1.00 5.91   ? 108 LEU G N   1 
ATOM   8159  C  CA  . LEU G  1 108 ? -16.457 15.926  32.587  1.00 6.20   ? 108 LEU G CA  1 
ATOM   8160  C  C   . LEU G  1 108 ? -15.027 16.238  32.983  1.00 9.94   ? 108 LEU G C   1 
ATOM   8161  O  O   . LEU G  1 108 ? -14.766 17.221  33.681  1.00 12.11  ? 108 LEU G O   1 
ATOM   8162  C  CB  . LEU G  1 108 ? -16.967 14.733  33.374  1.00 10.40  ? 108 LEU G CB  1 
ATOM   8163  C  CG  . LEU G  1 108 ? -16.963 14.767  34.905  1.00 17.97  ? 108 LEU G CG  1 
ATOM   8164  C  CD1 . LEU G  1 108 ? -17.888 13.706  35.437  1.00 14.83  ? 108 LEU G CD1 1 
ATOM   8165  C  CD2 . LEU G  1 108 ? -15.567 14.496  35.447  1.00 24.48  ? 108 LEU G CD2 1 
ATOM   8166  N  N   . LEU G  1 109 ? -14.087 15.433  32.499  1.00 5.47   ? 109 LEU G N   1 
ATOM   8167  C  CA  . LEU G  1 109 ? -12.705 15.646  32.883  1.00 5.29   ? 109 LEU G CA  1 
ATOM   8168  C  C   . LEU G  1 109 ? -12.257 16.971  32.357  1.00 6.46   ? 109 LEU G C   1 
ATOM   8169  O  O   . LEU G  1 109 ? -11.589 17.688  33.080  1.00 10.48  ? 109 LEU G O   1 
ATOM   8170  C  CB  . LEU G  1 109 ? -11.793 14.531  32.362  1.00 5.14   ? 109 LEU G CB  1 
ATOM   8171  C  CG  . LEU G  1 109 ? -12.064 13.198  33.052  1.00 10.48  ? 109 LEU G CG  1 
ATOM   8172  C  CD1 . LEU G  1 109 ? -11.387 12.065  32.331  1.00 11.58  ? 109 LEU G CD1 1 
ATOM   8173  C  CD2 . LEU G  1 109 ? -11.485 13.260  34.449  1.00 7.65   ? 109 LEU G CD2 1 
ATOM   8174  N  N   . ARG G  1 110 ? -12.631 17.295  31.125  1.00 1.76   ? 110 ARG G N   1 
ATOM   8175  C  CA  . ARG G  1 110 ? -12.198 18.575  30.573  1.00 5.05   ? 110 ARG G CA  1 
ATOM   8176  C  C   . ARG G  1 110 ? -12.658 19.708  31.486  1.00 10.83  ? 110 ARG G C   1 
ATOM   8177  O  O   . ARG G  1 110 ? -11.926 20.634  31.820  1.00 7.69   ? 110 ARG G O   1 
ATOM   8178  C  CB  . ARG G  1 110 ? -12.895 18.829  29.239  1.00 2.48   ? 110 ARG G CB  1 
ATOM   8179  C  CG  . ARG G  1 110 ? -12.581 20.184  28.617  1.00 6.19   ? 110 ARG G CG  1 
ATOM   8180  C  CD  . ARG G  1 110 ? -13.481 20.528  27.443  1.00 4.59   ? 110 ARG G CD  1 
ATOM   8181  N  NE  . ARG G  1 110 ? -14.876 20.425  27.837  1.00 9.40   ? 110 ARG G NE  1 
ATOM   8182  C  CZ  . ARG G  1 110 ? -15.917 20.264  27.024  1.00 18.28  ? 110 ARG G CZ  1 
ATOM   8183  N  NH1 . ARG G  1 110 ? -15.794 20.224  25.701  1.00 7.15   ? 110 ARG G NH1 1 
ATOM   8184  N  NH2 . ARG G  1 110 ? -17.112 20.135  27.575  1.00 13.88  ? 110 ARG G NH2 1 
ATOM   8185  N  N   . ASP G  1 111 ? -13.920 19.632  31.892  1.00 7.87   ? 111 ASP G N   1 
ATOM   8186  C  CA  . ASP G  1 111 ? -14.481 20.714  32.699  1.00 11.18  ? 111 ASP G CA  1 
ATOM   8187  C  C   . ASP G  1 111 ? -13.843 20.770  34.078  1.00 9.41   ? 111 ASP G C   1 
ATOM   8188  O  O   . ASP G  1 111 ? -13.511 21.858  34.570  1.00 9.14   ? 111 ASP G O   1 
ATOM   8189  C  CB  . ASP G  1 111 ? -16.027 20.692  32.712  1.00 20.17  ? 111 ASP G CB  1 
ATOM   8190  C  CG  . ASP G  1 111 ? -16.661 20.875  31.311  1.00 34.02  ? 111 ASP G CG  1 
ATOM   8191  O  OD1 . ASP G  1 111 ? -16.103 21.620  30.464  1.00 24.58  ? 111 ASP G OD1 1 
ATOM   8192  O  OD2 . ASP G  1 111 ? -17.725 20.248  31.062  1.00 59.51  ? 111 ASP G OD2 1 
ATOM   8193  N  N   . GLU G  1 112 ? -13.611 19.621  34.699  1.00 3.46   ? 112 GLU G N   1 
ATOM   8194  C  CA  . GLU G  1 112 ? -12.981 19.687  36.009  1.00 2.73   ? 112 GLU G CA  1 
ATOM   8195  C  C   . GLU G  1 112 ? -11.563 20.211  35.905  1.00 10.98  ? 112 GLU G C   1 
ATOM   8196  O  O   . GLU G  1 112 ? -11.064 20.959  36.726  1.00 11.80  ? 112 GLU G O   1 
ATOM   8197  C  CB  . GLU G  1 112 ? -13.018 18.317  36.667  1.00 4.85   ? 112 GLU G CB  1 
ATOM   8198  C  CG  . GLU G  1 112 ? -14.452 17.903  36.899  1.00 23.79  ? 112 GLU G CG  1 
ATOM   8199  C  CD  . GLU G  1 112 ? -14.611 16.809  37.939  1.00 35.57  ? 112 GLU G CD  1 
ATOM   8200  O  OE1 . GLU G  1 112 ? -13.620 16.325  38.489  1.00 17.45  ? 112 GLU G OE1 1 
ATOM   8201  O  OE2 . GLU G  1 112 ? -15.733 16.390  38.251  1.00 23.36  ? 112 GLU G OE2 1 
ATOM   8202  N  N   . TYR G  1 113 ? -10.878 19.817  34.844  1.00 8.27   ? 113 TYR G N   1 
ATOM   8203  C  CA  . TYR G  1 113 ? -9.498  20.262  34.696  1.00 5.16   ? 113 TYR G CA  1 
ATOM   8204  C  C   . TYR G  1 113 ? -9.486  21.761  34.580  1.00 8.94   ? 113 TYR G C   1 
ATOM   8205  O  O   . TYR G  1 113 ? -8.619  22.438  35.154  1.00 6.62   ? 113 TYR G O   1 
ATOM   8206  C  CB  . TYR G  1 113 ? -8.853  19.597  33.479  1.00 3.43   ? 113 TYR G CB  1 
ATOM   8207  C  CG  . TYR G  1 113 ? -8.313  18.211  33.716  1.00 9.75   ? 113 TYR G CG  1 
ATOM   8208  C  CD1 . TYR G  1 113 ? -8.859  17.401  34.694  1.00 13.03  ? 113 TYR G CD1 1 
ATOM   8209  C  CD2 . TYR G  1 113 ? -7.322  17.686  32.919  1.00 14.52  ? 113 TYR G CD2 1 
ATOM   8210  C  CE1 . TYR G  1 113 ? -8.417  16.128  34.874  1.00 17.75  ? 113 TYR G CE1 1 
ATOM   8211  C  CE2 . TYR G  1 113 ? -6.893  16.414  33.093  1.00 20.60  ? 113 TYR G CE2 1 
ATOM   8212  C  CZ  . TYR G  1 113 ? -7.445  15.621  34.062  1.00 17.81  ? 113 TYR G CZ  1 
ATOM   8213  O  OH  . TYR G  1 113 ? -7.016  14.324  34.195  1.00 17.60  ? 113 TYR G OH  1 
ATOM   8214  N  N   . LYS G  1 114 ? -10.476 22.269  33.853  1.00 9.31   ? 114 LYS G N   1 
ATOM   8215  C  CA  . LYS G  1 114 ? -10.577 23.714  33.714  1.00 10.53  ? 114 LYS G CA  1 
ATOM   8216  C  C   . LYS G  1 114 ? -10.595 24.383  35.109  1.00 12.73  ? 114 LYS G C   1 
ATOM   8217  O  O   . LYS G  1 114 ? -9.843  25.319  35.419  1.00 12.85  ? 114 LYS G O   1 
ATOM   8218  C  CB  . LYS G  1 114 ? -11.785 24.072  32.846  1.00 13.84  ? 114 LYS G CB  1 
ATOM   8219  C  CG  . LYS G  1 114 ? -11.927 25.542  32.540  1.00 47.48  ? 114 LYS G CG  1 
ATOM   8220  C  CD  . LYS G  1 114 ? -10.551 26.161  32.380  1.00 65.50  ? 114 LYS G CD  1 
ATOM   8221  C  CE  . LYS G  1 114 ? -10.650 27.673  32.157  1.00 72.05  ? 114 LYS G CE  1 
ATOM   8222  N  NZ  . LYS G  1 114 ? -9.334  28.381  32.073  1.00 80.98  ? 114 LYS G NZ  1 
ATOM   8223  N  N   . GLN G  1 115 ? -11.387 23.821  36.013  1.00 8.77   ? 115 GLN G N   1 
ATOM   8224  C  CA  . GLN G  1 115 ? -11.432 24.351  37.373  1.00 10.25  ? 115 GLN G CA  1 
ATOM   8225  C  C   . GLN G  1 115 ? -10.043 24.250  37.988  1.00 10.73  ? 115 GLN G C   1 
ATOM   8226  O  O   . GLN G  1 115 ? -9.603  25.214  38.617  1.00 12.42  ? 115 GLN G O   1 
ATOM   8227  C  CB  . GLN G  1 115 ? -12.338 23.569  38.336  1.00 13.03  ? 115 GLN G CB  1 
ATOM   8228  C  CG  . GLN G  1 115 ? -13.685 23.014  37.827  1.00 65.40  ? 115 GLN G CG  1 
ATOM   8229  C  CD  . GLN G  1 115 ? -14.482 23.994  37.025  0.00 100.00 ? 115 GLN G CD  1 
ATOM   8230  O  OE1 . GLN G  1 115 ? -14.296 25.204  37.123  0.00 100.00 ? 115 GLN G OE1 1 
ATOM   8231  N  NE2 . GLN G  1 115 ? -15.361 23.494  36.166  0.00 100.00 ? 115 GLN G NE2 1 
ATOM   8232  N  N   . GLY G  1 116 ? -9.405  23.082  37.907  1.00 6.37   ? 116 GLY G N   1 
ATOM   8233  C  CA  . GLY G  1 116 ? -8.122  22.926  38.543  1.00 2.65   ? 116 GLY G CA  1 
ATOM   8234  C  C   . GLY G  1 116 ? -7.185  23.945  37.908  1.00 2.57   ? 116 GLY G C   1 
ATOM   8235  O  O   . GLY G  1 116 ? -6.305  24.534  38.523  1.00 7.25   ? 116 GLY G O   1 
ATOM   8236  N  N   . ILE G  1 117 ? -7.372  24.177  36.616  1.00 1.57   ? 117 ILE G N   1 
ATOM   8237  C  CA  . ILE G  1 117 ? -6.434  25.069  35.949  1.00 1.00   ? 117 ILE G CA  1 
ATOM   8238  C  C   . ILE G  1 117 ? -6.464  26.475  36.500  1.00 1.00   ? 117 ILE G C   1 
ATOM   8239  O  O   . ILE G  1 117 ? -5.416  27.087  36.748  1.00 1.00   ? 117 ILE G O   1 
ATOM   8240  C  CB  . ILE G  1 117 ? -6.654  25.089  34.428  1.00 1.00   ? 117 ILE G CB  1 
ATOM   8241  C  CG1 . ILE G  1 117 ? -6.021  23.851  33.789  1.00 6.28   ? 117 ILE G CG1 1 
ATOM   8242  C  CG2 . ILE G  1 117 ? -6.028  26.313  33.757  1.00 1.00   ? 117 ILE G CG2 1 
ATOM   8243  C  CD1 . ILE G  1 117 ? -6.555  23.533  32.404  1.00 2.68   ? 117 ILE G CD1 1 
ATOM   8244  N  N   . GLU G  1 118 ? -7.640  26.979  36.694  1.00 6.55   ? 118 GLU G N   1 
ATOM   8245  C  CA  . GLU G  1 118 ? -7.780  28.336  37.185  1.00 9.95   ? 118 GLU G CA  1 
ATOM   8246  C  C   . GLU G  1 118 ? -7.336  28.412  38.648  1.00 18.24  ? 118 GLU G C   1 
ATOM   8247  O  O   . GLU G  1 118 ? -6.623  29.341  39.045  1.00 4.75   ? 118 GLU G O   1 
ATOM   8248  C  CB  . GLU G  1 118 ? -9.200  28.799  36.952  1.00 13.66  ? 118 GLU G CB  1 
ATOM   8249  C  CG  . GLU G  1 118 ? -9.352  29.290  35.521  1.00 30.90  ? 118 GLU G CG  1 
ATOM   8250  C  CD  . GLU G  1 118 ? -10.786 29.513  35.102  0.00 100.00 ? 118 GLU G CD  1 
ATOM   8251  O  OE1 . GLU G  1 118 ? -11.738 28.955  35.760  0.00 100.00 ? 118 GLU G OE1 1 
ATOM   8252  O  OE2 . GLU G  1 118 ? -11.031 30.268  34.092  0.00 100.00 ? 118 GLU G OE2 1 
ATOM   8253  N  N   . LEU G  1 119 ? -7.746  27.425  39.420  1.00 1.00   ? 119 LEU G N   1 
ATOM   8254  C  CA  . LEU G  1 119 ? -7.405  27.344  40.858  1.00 5.51   ? 119 LEU G CA  1 
ATOM   8255  C  C   . LEU G  1 119 ? -5.866  27.399  41.019  1.00 12.53  ? 119 LEU G C   1 
ATOM   8256  O  O   . LEU G  1 119 ? -5.325  28.261  41.730  1.00 6.35   ? 119 LEU G O   1 
ATOM   8257  C  CB  . LEU G  1 119 ? -8.059  26.067  41.431  1.00 1.00   ? 119 LEU G CB  1 
ATOM   8258  C  CG  . LEU G  1 119 ? -7.173  25.202  42.336  1.00 3.73   ? 119 LEU G CG  1 
ATOM   8259  C  CD1 . LEU G  1 119 ? -6.955  25.802  43.728  1.00 20.05  ? 119 LEU G CD1 1 
ATOM   8260  C  CD2 . LEU G  1 119 ? -7.778  23.810  42.579  1.00 19.29  ? 119 LEU G CD2 1 
ATOM   8261  N  N   . THR G  1 120 ? -5.222  26.487  40.326  1.00 7.24   ? 120 THR G N   1 
ATOM   8262  C  CA  . THR G  1 120 ? -3.756  26.317  40.310  1.00 8.39   ? 120 THR G CA  1 
ATOM   8263  C  C   . THR G  1 120 ? -3.034  27.603  39.895  1.00 4.12   ? 120 THR G C   1 
ATOM   8264  O  O   . THR G  1 120 ? -1.932  27.922  40.369  1.00 2.50   ? 120 THR G O   1 
ATOM   8265  C  CB  . THR G  1 120 ? -3.422  25.238  39.292  1.00 18.86  ? 120 THR G CB  1 
ATOM   8266  O  OG1 . THR G  1 120 ? -3.521  23.963  39.903  1.00 20.62  ? 120 THR G OG1 1 
ATOM   8267  C  CG2 . THR G  1 120 ? -2.026  25.376  38.701  1.00 23.85  ? 120 THR G CG2 1 
ATOM   8268  N  N   . ASP G  1 121 ? -3.655  28.311  39.004  1.00 8.38   ? 121 ASP G N   1 
ATOM   8269  C  CA  . ASP G  1 121 ? -3.102  29.548  38.501  1.00 5.00   ? 121 ASP G CA  1 
ATOM   8270  C  C   . ASP G  1 121 ? -3.196  30.618  39.588  1.00 19.74  ? 121 ASP G C   1 
ATOM   8271  O  O   . ASP G  1 121 ? -2.246  31.368  39.848  1.00 19.92  ? 121 ASP G O   1 
ATOM   8272  C  CB  . ASP G  1 121 ? -3.876  29.948  37.259  1.00 1.00   ? 121 ASP G CB  1 
ATOM   8273  C  CG  . ASP G  1 121 ? -3.924  31.447  37.037  1.00 75.28  ? 121 ASP G CG  1 
ATOM   8274  O  OD1 . ASP G  1 121 ? -2.927  32.176  37.390  0.00 100.00 ? 121 ASP G OD1 1 
ATOM   8275  O  OD2 . ASP G  1 121 ? -4.963  31.975  36.492  0.00 100.00 ? 121 ASP G OD2 1 
ATOM   8276  N  N   . LYS G  1 122 ? -4.342  30.675  40.227  1.00 3.54   ? 122 LYS G N   1 
ATOM   8277  C  CA  . LYS G  1 122 ? -4.562  31.678  41.259  1.00 4.04   ? 122 LYS G CA  1 
ATOM   8278  C  C   . LYS G  1 122 ? -3.629  31.395  42.451  1.00 4.10   ? 122 LYS G C   1 
ATOM   8279  O  O   . LYS G  1 122 ? -3.046  32.322  43.027  1.00 1.00   ? 122 LYS G O   1 
ATOM   8280  C  CB  . LYS G  1 122 ? -6.052  31.746  41.612  1.00 1.00   ? 122 LYS G CB  1 
ATOM   8281  C  CG  . LYS G  1 122 ? -6.743  32.882  40.834  1.00 24.77  ? 122 LYS G CG  1 
ATOM   8282  C  CD  . LYS G  1 122 ? -8.239  32.672  40.591  1.00 88.26  ? 122 LYS G CD  1 
ATOM   8283  C  CE  . LYS G  1 122 ? -8.728  33.286  39.271  0.00 100.00 ? 122 LYS G CE  1 
ATOM   8284  N  NZ  . LYS G  1 122 ? -8.256  32.538  38.094  0.00 100.00 ? 122 LYS G NZ  1 
ATOM   8285  N  N   . GLU G  1 123 ? -3.471  30.120  42.784  1.00 1.00   ? 123 GLU G N   1 
ATOM   8286  C  CA  . GLU G  1 123 ? -2.599  29.702  43.909  1.00 8.53   ? 123 GLU G CA  1 
ATOM   8287  C  C   . GLU G  1 123 ? -1.106  29.787  43.538  1.00 12.57  ? 123 GLU G C   1 
ATOM   8288  O  O   . GLU G  1 123 ? -0.226  29.611  44.384  1.00 8.35   ? 123 GLU G O   1 
ATOM   8289  C  CB  . GLU G  1 123 ? -2.860  28.252  44.312  1.00 2.42   ? 123 GLU G CB  1 
ATOM   8290  C  CG  . GLU G  1 123 ? -4.096  28.064  45.199  1.00 19.18  ? 123 GLU G CG  1 
ATOM   8291  C  CD  . GLU G  1 123 ? -4.200  26.649  45.783  0.00 100.00 ? 123 GLU G CD  1 
ATOM   8292  O  OE1 . GLU G  1 123 ? -3.166  25.877  45.794  1.00 73.37  ? 123 GLU G OE1 1 
ATOM   8293  O  OE2 . GLU G  1 123 ? -5.319  26.226  46.271  0.00 100.00 ? 123 GLU G OE2 1 
ATOM   8294  N  N   . GLY G  1 124 ? -0.832  30.021  42.275  1.00 6.88   ? 124 GLY G N   1 
ATOM   8295  C  CA  . GLY G  1 124 ? 0.554   30.180  41.797  1.00 5.08   ? 124 GLY G CA  1 
ATOM   8296  C  C   . GLY G  1 124 ? 1.363   28.864  41.818  1.00 34.52  ? 124 GLY G C   1 
ATOM   8297  O  O   . GLY G  1 124 ? 2.577   28.860  42.075  1.00 43.00  ? 124 GLY G O   1 
ATOM   8298  N  N   . ASP G  1 125 ? 0.699   27.754  41.570  1.00 24.16  ? 125 ASP G N   1 
ATOM   8299  C  CA  . ASP G  1 125 ? 1.404   26.475  41.401  1.00 12.37  ? 125 ASP G CA  1 
ATOM   8300  C  C   . ASP G  1 125 ? 1.539   26.288  39.901  1.00 11.02  ? 125 ASP G C   1 
ATOM   8301  O  O   . ASP G  1 125 ? 0.739   25.600  39.264  1.00 12.61  ? 125 ASP G O   1 
ATOM   8302  C  CB  . ASP G  1 125 ? 0.635   25.310  42.021  1.00 1.98   ? 125 ASP G CB  1 
ATOM   8303  C  CG  . ASP G  1 125 ? 1.347   23.971  41.801  1.00 22.19  ? 125 ASP G CG  1 
ATOM   8304  O  OD1 . ASP G  1 125 ? 2.324   23.894  40.960  1.00 20.94  ? 125 ASP G OD1 1 
ATOM   8305  O  OD2 . ASP G  1 125 ? 0.973   22.927  42.456  1.00 12.99  ? 125 ASP G OD2 1 
ATOM   8306  N  N   . ASP G  1 126 ? 2.540   26.939  39.371  1.00 6.30   ? 126 ASP G N   1 
ATOM   8307  C  CA  . ASP G  1 126 ? 2.776   26.979  37.929  1.00 10.46  ? 126 ASP G CA  1 
ATOM   8308  C  C   . ASP G  1 126 ? 2.977   25.610  37.325  1.00 6.99   ? 126 ASP G C   1 
ATOM   8309  O  O   . ASP G  1 126 ? 2.509   25.324  36.219  1.00 6.95   ? 126 ASP G O   1 
ATOM   8310  C  CB  . ASP G  1 126 ? 4.012   27.792  37.641  1.00 17.86  ? 126 ASP G CB  1 
ATOM   8311  C  CG  . ASP G  1 126 ? 4.003   29.072  38.441  1.00 39.48  ? 126 ASP G CG  1 
ATOM   8312  O  OD1 . ASP G  1 126 ? 3.240   30.038  38.072  1.00 40.75  ? 126 ASP G OD1 1 
ATOM   8313  O  OD2 . ASP G  1 126 ? 4.740   29.171  39.487  1.00 51.22  ? 126 ASP G OD2 1 
ATOM   8314  N  N   . VAL G  1 127 ? 3.674   24.767  38.027  1.00 2.42   ? 127 VAL G N   1 
ATOM   8315  C  CA  . VAL G  1 127 ? 3.947   23.454  37.478  1.00 2.62   ? 127 VAL G CA  1 
ATOM   8316  C  C   . VAL G  1 127 ? 2.641   22.657  37.347  1.00 8.58   ? 127 VAL G C   1 
ATOM   8317  O  O   . VAL G  1 127 ? 2.323   22.121  36.284  1.00 11.44  ? 127 VAL G O   1 
ATOM   8318  C  CB  . VAL G  1 127 ? 4.997   22.730  38.305  1.00 4.02   ? 127 VAL G CB  1 
ATOM   8319  C  CG1 . VAL G  1 127 ? 5.050   21.231  38.007  1.00 1.00   ? 127 VAL G CG1 1 
ATOM   8320  C  CG2 . VAL G  1 127 ? 6.412   23.261  38.030  1.00 1.38   ? 127 VAL G CG2 1 
ATOM   8321  N  N   . THR G  1 128 ? 1.850   22.570  38.405  1.00 1.92   ? 128 THR G N   1 
ATOM   8322  C  CA  . THR G  1 128 ? 0.600   21.787  38.309  1.00 1.00   ? 128 THR G CA  1 
ATOM   8323  C  C   . THR G  1 128 ? -0.309  22.392  37.227  1.00 6.70   ? 128 THR G C   1 
ATOM   8324  O  O   . THR G  1 128 ? -0.968  21.675  36.466  1.00 7.18   ? 128 THR G O   1 
ATOM   8325  C  CB  . THR G  1 128 ? -0.125  21.710  39.650  1.00 1.00   ? 128 THR G CB  1 
ATOM   8326  O  OG1 . THR G  1 128 ? 0.725   21.106  40.617  1.00 5.90   ? 128 THR G OG1 1 
ATOM   8327  C  CG2 . THR G  1 128 ? -1.397  20.858  39.579  1.00 1.00   ? 128 THR G CG2 1 
ATOM   8328  N  N   . ASN G  1 129 ? -0.317  23.706  37.170  1.00 1.53   ? 129 ASN G N   1 
ATOM   8329  C  CA  . ASN G  1 129 ? -1.103  24.445  36.171  1.00 1.00   ? 129 ASN G CA  1 
ATOM   8330  C  C   . ASN G  1 129 ? -0.768  23.937  34.765  1.00 2.95   ? 129 ASN G C   1 
ATOM   8331  O  O   . ASN G  1 129 ? -1.617  23.610  33.947  1.00 2.93   ? 129 ASN G O   1 
ATOM   8332  C  CB  . ASN G  1 129 ? -0.743  25.928  36.249  1.00 1.30   ? 129 ASN G CB  1 
ATOM   8333  C  CG  . ASN G  1 129 ? -1.554  26.787  35.289  1.00 8.26   ? 129 ASN G CG  1 
ATOM   8334  O  OD1 . ASN G  1 129 ? -0.985  27.429  34.409  1.00 27.36  ? 129 ASN G OD1 1 
ATOM   8335  N  ND2 . ASN G  1 129 ? -2.866  26.838  35.412  1.00 5.04   ? 129 ASN G ND2 1 
ATOM   8336  N  N   . ASP G  1 130 ? 0.512   23.937  34.441  1.00 1.00   ? 130 ASP G N   1 
ATOM   8337  C  CA  . ASP G  1 130 ? 0.907   23.489  33.116  1.00 5.29   ? 130 ASP G CA  1 
ATOM   8338  C  C   . ASP G  1 130 ? 0.591   22.021  32.878  1.00 7.66   ? 130 ASP G C   1 
ATOM   8339  O  O   . ASP G  1 130 ? 0.264   21.698  31.740  1.00 9.28   ? 130 ASP G O   1 
ATOM   8340  C  CB  . ASP G  1 130 ? 2.390   23.733  32.787  1.00 10.42  ? 130 ASP G CB  1 
ATOM   8341  C  CG  . ASP G  1 130 ? 2.659   25.001  31.975  1.00 57.83  ? 130 ASP G CG  1 
ATOM   8342  O  OD1 . ASP G  1 130 ? 1.805   25.904  31.886  1.00 57.80  ? 130 ASP G OD1 1 
ATOM   8343  O  OD2 . ASP G  1 130 ? 3.753   25.060  31.368  1.00 94.51  ? 130 ASP G OD2 1 
ATOM   8344  N  N   . MET G  1 131 ? 0.703   21.158  33.891  1.00 3.44   ? 131 MET G N   1 
ATOM   8345  C  CA  . MET G  1 131 ? 0.417   19.745  33.654  1.00 6.49   ? 131 MET G CA  1 
ATOM   8346  C  C   . MET G  1 131 ? -1.027  19.645  33.190  1.00 4.97   ? 131 MET G C   1 
ATOM   8347  O  O   . MET G  1 131 ? -1.319  18.920  32.249  1.00 3.90   ? 131 MET G O   1 
ATOM   8348  C  CB  . MET G  1 131 ? 0.277   18.968  34.955  1.00 12.26  ? 131 MET G CB  1 
ATOM   8349  C  CG  . MET G  1 131 ? 1.463   18.305  35.568  1.00 17.60  ? 131 MET G CG  1 
ATOM   8350  S  SD  . MET G  1 131 ? 0.704   16.856  36.393  1.00 15.81  ? 131 MET G SD  1 
ATOM   8351  C  CE  . MET G  1 131 ? -0.786  17.473  37.263  1.00 13.39  ? 131 MET G CE  1 
ATOM   8352  N  N   . LEU G  1 132 ? -1.898  20.275  33.971  1.00 2.17   ? 132 LEU G N   1 
ATOM   8353  C  CA  . LEU G  1 132 ? -3.327  20.223  33.708  1.00 4.97   ? 132 LEU G CA  1 
ATOM   8354  C  C   . LEU G  1 132 ? -3.612  20.738  32.325  1.00 6.47   ? 132 LEU G C   1 
ATOM   8355  O  O   . LEU G  1 132 ? -4.414  20.152  31.598  1.00 7.00   ? 132 LEU G O   1 
ATOM   8356  C  CB  . LEU G  1 132 ? -4.055  21.042  34.766  1.00 5.54   ? 132 LEU G CB  1 
ATOM   8357  C  CG  . LEU G  1 132 ? -4.591  20.342  36.011  1.00 10.21  ? 132 LEU G CG  1 
ATOM   8358  C  CD1 . LEU G  1 132 ? -4.091  18.925  36.188  1.00 7.18   ? 132 LEU G CD1 1 
ATOM   8359  C  CD2 . LEU G  1 132 ? -4.379  21.208  37.248  1.00 4.50   ? 132 LEU G CD2 1 
ATOM   8360  N  N   . ILE G  1 133 ? -2.950  21.830  31.974  1.00 1.86   ? 133 ILE G N   1 
ATOM   8361  C  CA  . ILE G  1 133 ? -3.196  22.371  30.640  1.00 3.52   ? 133 ILE G CA  1 
ATOM   8362  C  C   . ILE G  1 133 ? -2.901  21.366  29.516  1.00 8.24   ? 133 ILE G C   1 
ATOM   8363  O  O   . ILE G  1 133 ? -3.696  21.122  28.601  1.00 5.84   ? 133 ILE G O   1 
ATOM   8364  C  CB  . ILE G  1 133 ? -2.481  23.709  30.433  1.00 5.91   ? 133 ILE G CB  1 
ATOM   8365  C  CG1 . ILE G  1 133 ? -3.033  24.692  31.472  1.00 7.19   ? 133 ILE G CG1 1 
ATOM   8366  C  CG2 . ILE G  1 133 ? -2.689  24.209  28.973  1.00 1.66   ? 133 ILE G CG2 1 
ATOM   8367  C  CD1 . ILE G  1 133 ? -2.373  26.059  31.426  1.00 1.34   ? 133 ILE G CD1 1 
ATOM   8368  N  N   . ALA G  1 134 ? -1.774  20.684  29.655  1.00 5.02   ? 134 ALA G N   1 
ATOM   8369  C  CA  . ALA G  1 134 ? -1.337  19.733  28.651  1.00 2.42   ? 134 ALA G CA  1 
ATOM   8370  C  C   . ALA G  1 134 ? -2.318  18.582  28.593  1.00 6.35   ? 134 ALA G C   1 
ATOM   8371  O  O   . ALA G  1 134 ? -2.712  18.194  27.486  1.00 8.18   ? 134 ALA G O   1 
ATOM   8372  C  CB  . ALA G  1 134 ? 0.087   19.264  28.986  1.00 1.26   ? 134 ALA G CB  1 
ATOM   8373  N  N   . PHE G  1 135 ? -2.773  18.079  29.741  1.00 1.37   ? 135 PHE G N   1 
ATOM   8374  C  CA  . PHE G  1 135 ? -3.776  17.027  29.677  1.00 1.76   ? 135 PHE G CA  1 
ATOM   8375  C  C   . PHE G  1 135 ? -5.040  17.576  28.991  1.00 4.85   ? 135 PHE G C   1 
ATOM   8376  O  O   . PHE G  1 135 ? -5.695  16.926  28.177  1.00 8.12   ? 135 PHE G O   1 
ATOM   8377  C  CB  . PHE G  1 135 ? -4.194  16.578  31.073  1.00 9.39   ? 135 PHE G CB  1 
ATOM   8378  C  CG  . PHE G  1 135 ? -3.100  15.973  31.889  1.00 18.33  ? 135 PHE G CG  1 
ATOM   8379  C  CD1 . PHE G  1 135 ? -1.902  15.602  31.302  1.00 22.55  ? 135 PHE G CD1 1 
ATOM   8380  C  CD2 . PHE G  1 135 ? -3.275  15.772  33.248  1.00 22.27  ? 135 PHE G CD2 1 
ATOM   8381  C  CE1 . PHE G  1 135 ? -0.914  15.005  32.077  1.00 20.96  ? 135 PHE G CE1 1 
ATOM   8382  C  CE2 . PHE G  1 135 ? -2.306  15.143  34.024  1.00 18.09  ? 135 PHE G CE2 1 
ATOM   8383  C  CZ  . PHE G  1 135 ? -1.112  14.765  33.437  1.00 12.26  ? 135 PHE G CZ  1 
ATOM   8384  N  N   . LYS G  1 136 ? -5.421  18.800  29.327  1.00 3.36   ? 136 LYS G N   1 
ATOM   8385  C  CA  . LYS G  1 136 ? -6.626  19.288  28.709  1.00 4.01   ? 136 LYS G CA  1 
ATOM   8386  C  C   . LYS G  1 136 ? -6.530  19.308  27.196  1.00 2.54   ? 136 LYS G C   1 
ATOM   8387  O  O   . LYS G  1 136 ? -7.480  19.007  26.470  1.00 2.75   ? 136 LYS G O   1 
ATOM   8388  C  CB  . LYS G  1 136 ? -7.047  20.648  29.265  1.00 3.35   ? 136 LYS G CB  1 
ATOM   8389  C  CG  . LYS G  1 136 ? -8.467  21.007  28.804  1.00 8.69   ? 136 LYS G CG  1 
ATOM   8390  C  CD  . LYS G  1 136 ? -9.043  22.297  29.376  1.00 5.97   ? 136 LYS G CD  1 
ATOM   8391  C  CE  . LYS G  1 136 ? -9.034  23.489  28.444  1.00 42.07  ? 136 LYS G CE  1 
ATOM   8392  N  NZ  . LYS G  1 136 ? -10.146 23.385  27.458  1.00 14.47  ? 136 LYS G NZ  1 
ATOM   8393  N  N   . ALA G  1 137 ? -5.374  19.749  26.736  1.00 1.05   ? 137 ALA G N   1 
ATOM   8394  C  CA  . ALA G  1 137 ? -5.162  19.872  25.306  1.00 1.35   ? 137 ALA G CA  1 
ATOM   8395  C  C   . ALA G  1 137 ? -5.522  18.560  24.645  1.00 6.73   ? 137 ALA G C   1 
ATOM   8396  O  O   . ALA G  1 137 ? -6.236  18.523  23.645  1.00 7.27   ? 137 ALA G O   1 
ATOM   8397  C  CB  . ALA G  1 137 ? -3.717  20.188  25.063  1.00 1.00   ? 137 ALA G CB  1 
ATOM   8398  N  N   . SER G  1 138 ? -5.080  17.478  25.268  1.00 1.00   ? 138 SER G N   1 
ATOM   8399  C  CA  . SER G  1 138 ? -5.307  16.183  24.673  1.00 1.07   ? 138 SER G CA  1 
ATOM   8400  C  C   . SER G  1 138 ? -6.772  15.807  24.719  1.00 5.78   ? 138 SER G C   1 
ATOM   8401  O  O   . SER G  1 138 ? -7.335  15.268  23.763  1.00 3.14   ? 138 SER G O   1 
ATOM   8402  C  CB  . SER G  1 138 ? -4.439  15.166  25.416  1.00 1.00   ? 138 SER G CB  1 
ATOM   8403  O  OG  . SER G  1 138 ? -4.813  13.855  25.037  1.00 36.79  ? 138 SER G OG  1 
ATOM   8404  N  N   . ILE G  1 139 ? -7.351  16.041  25.889  1.00 1.28   ? 139 ILE G N   1 
ATOM   8405  C  CA  . ILE G  1 139 ? -8.742  15.705  26.049  1.00 2.87   ? 139 ILE G CA  1 
ATOM   8406  C  C   . ILE G  1 139 ? -9.552  16.411  24.978  1.00 5.53   ? 139 ILE G C   1 
ATOM   8407  O  O   . ILE G  1 139 ? -10.419 15.831  24.336  1.00 3.07   ? 139 ILE G O   1 
ATOM   8408  C  CB  . ILE G  1 139 ? -9.218  16.085  27.431  1.00 4.70   ? 139 ILE G CB  1 
ATOM   8409  C  CG1 . ILE G  1 139 ? -8.631  15.091  28.435  1.00 5.59   ? 139 ILE G CG1 1 
ATOM   8410  C  CG2 . ILE G  1 139 ? -10.734 16.145  27.502  1.00 1.00   ? 139 ILE G CG2 1 
ATOM   8411  C  CD1 . ILE G  1 139 ? -8.549  15.651  29.855  1.00 5.49   ? 139 ILE G CD1 1 
ATOM   8412  N  N   . ASP G  1 140 ? -9.239  17.678  24.767  1.00 1.90   ? 140 ASP G N   1 
ATOM   8413  C  CA  . ASP G  1 140 ? -9.982  18.441  23.778  1.00 4.17   ? 140 ASP G CA  1 
ATOM   8414  C  C   . ASP G  1 140 ? -9.929  17.820  22.377  1.00 8.18   ? 140 ASP G C   1 
ATOM   8415  O  O   . ASP G  1 140 ? -10.942 17.779  21.672  1.00 10.02  ? 140 ASP G O   1 
ATOM   8416  C  CB  . ASP G  1 140 ? -9.493  19.891  23.718  1.00 8.91   ? 140 ASP G CB  1 
ATOM   8417  C  CG  . ASP G  1 140 ? -9.950  20.741  24.896  1.00 21.30  ? 140 ASP G CG  1 
ATOM   8418  O  OD1 . ASP G  1 140 ? -10.942 20.369  25.566  1.00 11.00  ? 140 ASP G OD1 1 
ATOM   8419  O  OD2 . ASP G  1 140 ? -9.331  21.820  25.074  1.00 15.68  ? 140 ASP G OD2 1 
ATOM   8420  N  N   . LYS G  1 141 ? -8.753  17.333  21.995  1.00 4.85   ? 141 LYS G N   1 
ATOM   8421  C  CA  . LYS G  1 141 ? -8.534  16.733  20.697  1.00 2.93   ? 141 LYS G CA  1 
ATOM   8422  C  C   . LYS G  1 141 ? -9.356  15.470  20.651  1.00 3.16   ? 141 LYS G C   1 
ATOM   8423  O  O   . LYS G  1 141 ? -10.086 15.262  19.684  1.00 7.84   ? 141 LYS G O   1 
ATOM   8424  C  CB  . LYS G  1 141 ? -7.054  16.433  20.538  1.00 4.49   ? 141 LYS G CB  1 
ATOM   8425  C  CG  . LYS G  1 141 ? -6.674  15.863  19.187  1.00 45.96  ? 141 LYS G CG  1 
ATOM   8426  C  CD  . LYS G  1 141 ? -5.238  15.387  19.252  1.00 84.20  ? 141 LYS G CD  1 
ATOM   8427  C  CE  . LYS G  1 141 ? -4.781  14.662  18.013  0.00 100.00 ? 141 LYS G CE  1 
ATOM   8428  N  NZ  . LYS G  1 141 ? -4.593  15.544  16.837  0.00 100.00 ? 141 LYS G NZ  1 
ATOM   8429  N  N   . HIS G  1 142 ? -9.291  14.632  21.684  1.00 2.86   ? 142 HIS G N   1 
ATOM   8430  C  CA  . HIS G  1 142 ? -10.111 13.417  21.691  1.00 2.51   ? 142 HIS G CA  1 
ATOM   8431  C  C   . HIS G  1 142 ? -11.597 13.765  21.557  1.00 5.45   ? 142 HIS G C   1 
ATOM   8432  O  O   . HIS G  1 142 ? -12.383 13.079  20.906  1.00 6.32   ? 142 HIS G O   1 
ATOM   8433  C  CB  . HIS G  1 142 ? -9.985  12.665  23.031  1.00 3.14   ? 142 HIS G CB  1 
ATOM   8434  C  CG  . HIS G  1 142 ? -8.651  12.034  23.228  1.00 7.30   ? 142 HIS G CG  1 
ATOM   8435  N  ND1 . HIS G  1 142 ? -8.107  11.193  22.276  1.00 8.63   ? 142 HIS G ND1 1 
ATOM   8436  C  CD2 . HIS G  1 142 ? -7.747  12.114  24.239  1.00 7.20   ? 142 HIS G CD2 1 
ATOM   8437  C  CE1 . HIS G  1 142 ? -6.917  10.791  22.696  1.00 6.85   ? 142 HIS G CE1 1 
ATOM   8438  N  NE2 . HIS G  1 142 ? -6.672  11.344  23.872  1.00 7.27   ? 142 HIS G NE2 1 
ATOM   8439  N  N   . ILE G  1 143 ? -11.989 14.824  22.246  1.00 2.90   ? 143 ILE G N   1 
ATOM   8440  C  CA  . ILE G  1 143 ? -13.386 15.170  22.220  1.00 5.36   ? 143 ILE G CA  1 
ATOM   8441  C  C   . ILE G  1 143 ? -13.758 15.493  20.776  1.00 9.00   ? 143 ILE G C   1 
ATOM   8442  O  O   . ILE G  1 143 ? -14.819 15.069  20.301  1.00 3.38   ? 143 ILE G O   1 
ATOM   8443  C  CB  . ILE G  1 143 ? -13.688 16.315  23.190  1.00 8.66   ? 143 ILE G CB  1 
ATOM   8444  C  CG1 . ILE G  1 143 ? -13.653 15.832  24.638  1.00 2.83   ? 143 ILE G CG1 1 
ATOM   8445  C  CG2 . ILE G  1 143 ? -15.070 16.879  22.891  1.00 7.16   ? 143 ILE G CG2 1 
ATOM   8446  C  CD1 . ILE G  1 143 ? -13.814 16.950  25.670  1.00 2.04   ? 143 ILE G CD1 1 
ATOM   8447  N  N   . TRP G  1 144 ? -12.898 16.244  20.099  1.00 2.94   ? 144 TRP G N   1 
ATOM   8448  C  CA  . TRP G  1 144 ? -13.194 16.579  18.721  1.00 1.00   ? 144 TRP G CA  1 
ATOM   8449  C  C   . TRP G  1 144 ? -13.303 15.316  17.879  1.00 7.47   ? 144 TRP G C   1 
ATOM   8450  O  O   . TRP G  1 144 ? -14.242 15.167  17.112  1.00 8.80   ? 144 TRP G O   1 
ATOM   8451  C  CB  . TRP G  1 144 ? -12.125 17.495  18.154  1.00 1.75   ? 144 TRP G CB  1 
ATOM   8452  C  CG  . TRP G  1 144 ? -11.952 17.332  16.670  1.00 6.93   ? 144 TRP G CG  1 
ATOM   8453  C  CD1 . TRP G  1 144 ? -12.921 17.403  15.704  1.00 10.24  ? 144 TRP G CD1 1 
ATOM   8454  C  CD2 . TRP G  1 144 ? -10.760 16.984  15.975  1.00 5.25   ? 144 TRP G CD2 1 
ATOM   8455  N  NE1 . TRP G  1 144 ? -12.412 17.176  14.449  1.00 6.85   ? 144 TRP G NE1 1 
ATOM   8456  C  CE2 . TRP G  1 144 ? -11.076 16.919  14.594  1.00 8.44   ? 144 TRP G CE2 1 
ATOM   8457  C  CE3 . TRP G  1 144 ? -9.442  16.756  16.381  1.00 5.35   ? 144 TRP G CE3 1 
ATOM   8458  C  CZ2 . TRP G  1 144 ? -10.139 16.543  13.623  1.00 8.12   ? 144 TRP G CZ2 1 
ATOM   8459  C  CZ3 . TRP G  1 144 ? -8.506  16.424  15.418  1.00 6.63   ? 144 TRP G CZ3 1 
ATOM   8460  C  CH2 . TRP G  1 144 ? -8.870  16.278  14.060  1.00 6.66   ? 144 TRP G CH2 1 
ATOM   8461  N  N   . MET G  1 145 ? -12.397 14.363  18.080  1.00 4.53   ? 145 MET G N   1 
ATOM   8462  C  CA  . MET G  1 145 ? -12.380 13.111  17.314  1.00 2.69   ? 145 MET G CA  1 
ATOM   8463  C  C   . MET G  1 145 ? -13.529 12.145  17.560  1.00 9.90   ? 145 MET G C   1 
ATOM   8464  O  O   . MET G  1 145 ? -14.116 11.603  16.607  1.00 6.96   ? 145 MET G O   1 
ATOM   8465  C  CB  . MET G  1 145 ? -11.013 12.424  17.404  1.00 3.63   ? 145 MET G CB  1 
ATOM   8466  C  CG  . MET G  1 145 ? -9.888  13.315  16.900  1.00 8.25   ? 145 MET G CG  1 
ATOM   8467  S  SD  . MET G  1 145 ? -8.332  12.436  16.760  1.00 11.53  ? 145 MET G SD  1 
ATOM   8468  C  CE  . MET G  1 145 ? -8.134  12.090  18.503  1.00 20.32  ? 145 MET G CE  1 
ATOM   8469  N  N   . PHE G  1 146 ? -13.844 11.928  18.837  1.00 4.31   ? 146 PHE G N   1 
ATOM   8470  C  CA  . PHE G  1 146 ? -14.955 11.037  19.154  1.00 6.23   ? 146 PHE G CA  1 
ATOM   8471  C  C   . PHE G  1 146 ? -16.281 11.645  18.718  1.00 10.18  ? 146 PHE G C   1 
ATOM   8472  O  O   . PHE G  1 146 ? -17.183 10.909  18.356  1.00 8.41   ? 146 PHE G O   1 
ATOM   8473  C  CB  . PHE G  1 146 ? -14.957 10.511  20.599  1.00 7.55   ? 146 PHE G CB  1 
ATOM   8474  C  CG  . PHE G  1 146 ? -13.908 9.469   20.833  1.00 9.32   ? 146 PHE G CG  1 
ATOM   8475  C  CD1 . PHE G  1 146 ? -14.133 8.157   20.439  1.00 8.97   ? 146 PHE G CD1 1 
ATOM   8476  C  CD2 . PHE G  1 146 ? -12.649 9.824   21.288  1.00 9.12   ? 146 PHE G CD2 1 
ATOM   8477  C  CE1 . PHE G  1 146 ? -13.157 7.169   20.568  1.00 9.16   ? 146 PHE G CE1 1 
ATOM   8478  C  CE2 . PHE G  1 146 ? -11.646 8.853   21.405  1.00 12.39  ? 146 PHE G CE2 1 
ATOM   8479  C  CZ  . PHE G  1 146 ? -11.896 7.520   21.059  1.00 10.91  ? 146 PHE G CZ  1 
ATOM   8480  N  N   . LYS G  1 147 ? -16.420 12.966  18.746  1.00 2.88   ? 147 LYS G N   1 
ATOM   8481  C  CA  . LYS G  1 147 ? -17.631 13.607  18.254  1.00 2.89   ? 147 LYS G CA  1 
ATOM   8482  C  C   . LYS G  1 147 ? -17.747 13.468  16.737  1.00 9.38   ? 147 LYS G C   1 
ATOM   8483  O  O   . LYS G  1 147 ? -18.804 13.134  16.209  1.00 11.01  ? 147 LYS G O   1 
ATOM   8484  C  CB  . LYS G  1 147 ? -17.823 15.052  18.728  1.00 5.29   ? 147 LYS G CB  1 
ATOM   8485  C  CG  . LYS G  1 147 ? -18.223 15.065  20.194  1.00 8.21   ? 147 LYS G CG  1 
ATOM   8486  C  CD  . LYS G  1 147 ? -19.277 16.116  20.513  1.00 26.90  ? 147 LYS G CD  1 
ATOM   8487  C  CE  . LYS G  1 147 ? -19.927 15.762  21.830  1.00 12.80  ? 147 LYS G CE  1 
ATOM   8488  N  NZ  . LYS G  1 147 ? -21.048 16.665  22.179  1.00 60.42  ? 147 LYS G NZ  1 
ATOM   8489  N  N   . ALA G  1 148 ? -16.653 13.652  16.018  1.00 4.46   ? 148 ALA G N   1 
ATOM   8490  C  CA  . ALA G  1 148 ? -16.683 13.474  14.578  1.00 3.46   ? 148 ALA G CA  1 
ATOM   8491  C  C   . ALA G  1 148 ? -17.058 12.041  14.305  1.00 7.34   ? 148 ALA G C   1 
ATOM   8492  O  O   . ALA G  1 148 ? -17.890 11.782  13.452  1.00 7.39   ? 148 ALA G O   1 
ATOM   8493  C  CB  . ALA G  1 148 ? -15.345 13.777  13.953  1.00 3.47   ? 148 ALA G CB  1 
ATOM   8494  N  N   . PHE G  1 149 ? -16.541 11.070  15.047  1.00 5.74   ? 149 PHE G N   1 
ATOM   8495  C  CA  . PHE G  1 149 ? -16.930 9.676   14.821  1.00 3.91   ? 149 PHE G CA  1 
ATOM   8496  C  C   . PHE G  1 149 ? -18.423 9.512   14.983  1.00 14.37  ? 149 PHE G C   1 
ATOM   8497  O  O   . PHE G  1 149 ? -19.079 8.708   14.329  1.00 13.59  ? 149 PHE G O   1 
ATOM   8498  C  CB  . PHE G  1 149 ? -16.310 8.824   15.909  1.00 3.69   ? 149 PHE G CB  1 
ATOM   8499  C  CG  . PHE G  1 149 ? -16.853 7.440   15.953  1.00 7.87   ? 149 PHE G CG  1 
ATOM   8500  C  CD1 . PHE G  1 149 ? -16.458 6.486   15.013  1.00 7.16   ? 149 PHE G CD1 1 
ATOM   8501  C  CD2 . PHE G  1 149 ? -17.722 7.050   16.937  1.00 6.66   ? 149 PHE G CD2 1 
ATOM   8502  C  CE1 . PHE G  1 149 ? -16.938 5.194   15.064  1.00 4.82   ? 149 PHE G CE1 1 
ATOM   8503  C  CE2 . PHE G  1 149 ? -18.223 5.760   16.960  1.00 5.84   ? 149 PHE G CE2 1 
ATOM   8504  C  CZ  . PHE G  1 149 ? -17.806 4.822   16.046  1.00 4.81   ? 149 PHE G CZ  1 
ATOM   8505  N  N   . LEU G  1 150 ? -18.962 10.229  15.949  1.00 10.61  ? 150 LEU G N   1 
ATOM   8506  C  CA  . LEU G  1 150 ? -20.396 10.169  16.223  1.00 9.38   ? 150 LEU G CA  1 
ATOM   8507  C  C   . LEU G  1 150 ? -21.183 11.104  15.291  1.00 21.68  ? 150 LEU G C   1 
ATOM   8508  O  O   . LEU G  1 150 ? -22.396 11.256  15.390  1.00 19.52  ? 150 LEU G O   1 
ATOM   8509  C  CB  . LEU G  1 150 ? -20.671 10.570  17.673  1.00 4.37   ? 150 LEU G CB  1 
ATOM   8510  C  CG  . LEU G  1 150 ? -20.282 9.577   18.763  1.00 7.48   ? 150 LEU G CG  1 
ATOM   8511  C  CD1 . LEU G  1 150 ? -20.333 10.171  20.122  1.00 8.66   ? 150 LEU G CD1 1 
ATOM   8512  C  CD2 . LEU G  1 150 ? -21.193 8.393   18.687  1.00 6.00   ? 150 LEU G CD2 1 
ATOM   8513  N  N   . GLY G  1 151 ? -20.524 11.778  14.364  1.00 13.38  ? 151 GLY G N   1 
ATOM   8514  C  CA  . GLY G  1 151 ? -21.298 12.629  13.470  1.00 10.21  ? 151 GLY G CA  1 
ATOM   8515  C  C   . GLY G  1 151 ? -21.587 14.025  14.004  1.00 17.88  ? 151 GLY G C   1 
ATOM   8516  O  O   . GLY G  1 151 ? -22.354 14.782  13.424  1.00 24.48  ? 151 GLY G O   1 
ATOM   8517  N  N   . LYS G  1 152 ? -20.981 14.359  15.123  1.00 14.84  ? 152 LYS G N   1 
ATOM   8518  C  CA  . LYS G  1 152 ? -21.282 15.642  15.743  1.00 10.01  ? 152 LYS G CA  1 
ATOM   8519  C  C   . LYS G  1 152 ? -20.139 16.646  15.698  1.00 16.24  ? 152 LYS G C   1 
ATOM   8520  O  O   . LYS G  1 152 ? -18.986 16.293  15.418  1.00 15.98  ? 152 LYS G O   1 
ATOM   8521  C  CB  . LYS G  1 152 ? -21.762 15.437  17.196  1.00 14.59  ? 152 LYS G CB  1 
ATOM   8522  C  CG  . LYS G  1 152 ? -22.982 14.559  17.363  1.00 62.52  ? 152 LYS G CG  1 
ATOM   8523  C  CD  . LYS G  1 152 ? -24.088 15.213  16.586  0.00 100.00 ? 152 LYS G CD  1 
ATOM   8524  C  CE  . LYS G  1 152 ? -25.344 14.380  16.489  0.00 100.00 ? 152 LYS G CE  1 
ATOM   8525  N  NZ  . LYS G  1 152 ? -26.342 15.053  15.617  0.00 100.00 ? 152 LYS G NZ  1 
ATOM   8526  N  N   . ALA G  1 153 ? -20.488 17.895  15.975  1.00 14.88  ? 153 ALA G N   1 
ATOM   8527  C  CA  . ALA G  1 153 ? -19.461 18.924  16.064  1.00 10.62  ? 153 ALA G CA  1 
ATOM   8528  C  C   . ALA G  1 153 ? -18.880 18.782  17.480  1.00 14.87  ? 153 ALA G C   1 
ATOM   8529  O  O   . ALA G  1 153 ? -19.555 18.257  18.385  1.00 11.47  ? 153 ALA G O   1 
ATOM   8530  C  CB  . ALA G  1 153 ? -20.061 20.285  15.874  1.00 7.49   ? 153 ALA G CB  1 
ATOM   8531  N  N   . PRO G  1 154 ? -17.643 19.208  17.734  1.00 13.50  ? 154 PRO G N   1 
ATOM   8532  C  CA  . PRO G  1 154 ? -17.008 19.036  19.041  1.00 10.64  ? 154 PRO G CA  1 
ATOM   8533  C  C   . PRO G  1 154 ? -17.770 19.642  20.204  1.00 14.17  ? 154 PRO G C   1 
ATOM   8534  O  O   . PRO G  1 154 ? -18.009 18.935  21.229  1.00 17.46  ? 154 PRO G O   1 
ATOM   8535  C  CB  . PRO G  1 154 ? -15.642 19.643  18.868  1.00 11.23  ? 154 PRO G CB  1 
ATOM   8536  C  CG  . PRO G  1 154 ? -15.522 20.112  17.430  1.00 12.68  ? 154 PRO G CG  1 
ATOM   8537  C  CD  . PRO G  1 154 ? -16.820 19.874  16.728  1.00 10.47  ? 154 PRO G CD  1 
ATOM   8538  N  N   . LEU G  1 155 ? -18.141 20.890  20.118  1.00 19.54  ? 155 LEU G N   1 
ATOM   8539  C  CA  . LEU G  1 155 ? -18.846 21.522  21.239  1.00 19.88  ? 155 LEU G CA  1 
ATOM   8540  C  C   . LEU G  1 155 ? -20.337 21.355  21.074  1.00 46.22  ? 155 LEU G C   1 
ATOM   8541  O  O   . LEU G  1 155 ? -21.119 21.719  21.959  1.00 35.71  ? 155 LEU G O   1 
ATOM   8542  C  CB  . LEU G  1 155 ? -18.433 22.954  21.330  1.00 19.28  ? 155 LEU G CB  1 
ATOM   8543  C  CG  . LEU G  1 155 ? -16.927 23.032  21.396  1.00 27.61  ? 155 LEU G CG  1 
ATOM   8544  C  CD1 . LEU G  1 155 ? -16.420 24.443  21.610  1.00 22.97  ? 155 LEU G CD1 1 
ATOM   8545  C  CD2 . LEU G  1 155 ? -16.355 22.165  22.523  1.00 19.04  ? 155 LEU G CD2 1 
ATOM   8546  N  N   . GLU G  1 156 ? -20.696 20.829  19.929  1.00 54.11  ? 156 GLU G N   1 
ATOM   8547  C  CA  . GLU G  1 156 ? -22.081 20.464  19.683  1.00 56.20  ? 156 GLU G CA  1 
ATOM   8548  C  C   . GLU G  1 156 ? -22.537 19.802  20.972  1.00 79.88  ? 156 GLU G C   1 
ATOM   8549  O  O   . GLU G  1 156 ? -22.086 18.692  21.278  1.00 34.56  ? 156 GLU G O   1 
ATOM   8550  C  CB  . GLU G  1 156 ? -22.103 19.368  18.634  1.00 23.60  ? 156 GLU G CB  1 
ATOM   8551  C  CG  . GLU G  1 156 ? -23.500 18.958  18.237  1.00 43.37  ? 156 GLU G CG  1 
ATOM   8552  C  CD  . GLU G  1 156 ? -23.862 19.608  16.934  0.00 100.00 ? 156 GLU G CD  1 
ATOM   8553  O  OE1 . GLU G  1 156 ? -23.759 20.885  16.824  0.00 100.00 ? 156 GLU G OE1 1 
ATOM   8554  O  OE2 . GLU G  1 156 ? -24.241 18.885  15.950  0.00 100.00 ? 156 GLU G OE2 1 
ATOM   8555  N  N   . VAL H  1 7   ? 61.187  0.585   5.782   1.00 75.60  ? 7   VAL H N   1 
ATOM   8556  C  CA  . VAL H  1 7   ? 60.296  1.382   4.863   1.00 73.50  ? 7   VAL H CA  1 
ATOM   8557  C  C   . VAL H  1 7   ? 60.268  2.768   5.668   1.00 67.96  ? 7   VAL H C   1 
ATOM   8558  O  O   . VAL H  1 7   ? 61.312  3.302   6.085   1.00 77.13  ? 7   VAL H O   1 
ATOM   8559  C  CB  . VAL H  1 7   ? 58.919  0.741   4.759   1.00 77.02  ? 7   VAL H CB  1 
ATOM   8560  C  CG1 . VAL H  1 7   ? 58.217  1.045   3.434   1.00 74.64  ? 7   VAL H CG1 1 
ATOM   8561  C  CG2 . VAL H  1 7   ? 58.960  -0.785  4.868   1.00 78.73  ? 7   VAL H CG2 1 
ATOM   8562  N  N   . ASP H  1 8   ? 59.083  3.320   5.921   1.00 37.65  ? 8   ASP H N   1 
ATOM   8563  C  CA  . ASP H  1 8   ? 58.820  4.520   6.817   1.00 28.99  ? 8   ASP H CA  1 
ATOM   8564  C  C   . ASP H  1 8   ? 57.297  4.530   6.940   1.00 15.93  ? 8   ASP H C   1 
ATOM   8565  O  O   . ASP H  1 8   ? 56.592  4.178   5.992   1.00 11.93  ? 8   ASP H O   1 
ATOM   8566  C  CB  . ASP H  1 8   ? 59.485  5.833   6.295   1.00 26.14  ? 8   ASP H CB  1 
ATOM   8567  C  CG  . ASP H  1 8   ? 58.517  6.875   5.697   1.00 34.70  ? 8   ASP H CG  1 
ATOM   8568  O  OD1 . ASP H  1 8   ? 57.526  6.476   4.981   1.00 44.89  ? 8   ASP H OD1 1 
ATOM   8569  O  OD2 . ASP H  1 8   ? 58.707  8.146   5.877   1.00 46.96  ? 8   ASP H OD2 1 
ATOM   8570  N  N   . THR H  1 9   ? 56.773  4.881   8.084   1.00 7.63   ? 9   THR H N   1 
ATOM   8571  C  CA  . THR H  1 9   ? 55.319  4.759   8.302   1.00 9.87   ? 9   THR H CA  1 
ATOM   8572  C  C   . THR H  1 9   ? 54.498  5.267   7.101   1.00 10.16  ? 9   THR H C   1 
ATOM   8573  O  O   . THR H  1 9   ? 53.612  4.575   6.587   1.00 8.20   ? 9   THR H O   1 
ATOM   8574  C  CB  . THR H  1 9   ? 54.887  5.481   9.566   1.00 18.80  ? 9   THR H CB  1 
ATOM   8575  O  OG1 . THR H  1 9   ? 55.600  4.953   10.677  1.00 15.31  ? 9   THR H OG1 1 
ATOM   8576  C  CG2 . THR H  1 9   ? 53.394  5.302   9.861   1.00 16.54  ? 9   THR H CG2 1 
ATOM   8577  N  N   . LYS H  1 10  ? 54.778  6.467   6.650   1.00 1.02   ? 10  LYS H N   1 
ATOM   8578  C  CA  . LYS H  1 10  ? 54.017  7.053   5.532   1.00 4.73   ? 10  LYS H CA  1 
ATOM   8579  C  C   . LYS H  1 10  ? 54.037  6.129   4.316   1.00 13.24  ? 10  LYS H C   1 
ATOM   8580  O  O   . LYS H  1 10  ? 52.997  5.803   3.730   1.00 18.87  ? 10  LYS H O   1 
ATOM   8581  C  CB  . LYS H  1 10  ? 54.599  8.401   5.151   1.00 2.63   ? 10  LYS H CB  1 
ATOM   8582  C  CG  . LYS H  1 10  ? 54.357  9.448   6.231   1.00 5.30   ? 10  LYS H CG  1 
ATOM   8583  C  CD  . LYS H  1 10  ? 54.471  10.876  5.713   1.00 11.09  ? 10  LYS H CD  1 
ATOM   8584  C  CE  . LYS H  1 10  ? 54.739  11.883  6.829   1.00 56.27  ? 10  LYS H CE  1 
ATOM   8585  N  NZ  . LYS H  1 10  ? 55.116  13.210  6.323   1.00 94.02  ? 10  LYS H NZ  1 
ATOM   8586  N  N   . GLU H  1 11  ? 55.223  5.721   3.945   1.00 9.26   ? 11  GLU H N   1 
ATOM   8587  C  CA  . GLU H  1 11  ? 55.382  4.832   2.803   1.00 12.88  ? 11  GLU H CA  1 
ATOM   8588  C  C   . GLU H  1 11  ? 54.695  3.524   3.087   1.00 11.07  ? 11  GLU H C   1 
ATOM   8589  O  O   . GLU H  1 11  ? 54.145  2.926   2.165   1.00 9.16   ? 11  GLU H O   1 
ATOM   8590  C  CB  . GLU H  1 11  ? 56.872  4.559   2.543   1.00 19.36  ? 11  GLU H CB  1 
ATOM   8591  C  CG  . GLU H  1 11  ? 57.500  5.495   1.501   1.00 72.46  ? 11  GLU H CG  1 
ATOM   8592  C  CD  . GLU H  1 11  ? 57.496  6.960   1.936   0.00 100.00 ? 11  GLU H CD  1 
ATOM   8593  O  OE1 . GLU H  1 11  ? 56.375  7.580   2.077   0.00 100.00 ? 11  GLU H OE1 1 
ATOM   8594  O  OE2 . GLU H  1 11  ? 58.608  7.572   2.160   0.00 100.00 ? 11  GLU H OE2 1 
ATOM   8595  N  N   . PHE H  1 12  ? 54.814  3.031   4.312   1.00 3.63   ? 12  PHE H N   1 
ATOM   8596  C  CA  . PHE H  1 12  ? 54.168  1.769   4.567   1.00 2.59   ? 12  PHE H CA  1 
ATOM   8597  C  C   . PHE H  1 12  ? 52.678  1.885   4.412   1.00 7.31   ? 12  PHE H C   1 
ATOM   8598  O  O   . PHE H  1 12  ? 52.039  1.095   3.738   1.00 6.68   ? 12  PHE H O   1 
ATOM   8599  C  CB  . PHE H  1 12  ? 54.437  1.299   5.979   1.00 4.92   ? 12  PHE H CB  1 
ATOM   8600  C  CG  . PHE H  1 12  ? 53.643  0.087   6.320   1.00 10.58  ? 12  PHE H CG  1 
ATOM   8601  C  CD1 . PHE H  1 12  ? 54.107  -1.187  6.022   1.00 10.88  ? 12  PHE H CD1 1 
ATOM   8602  C  CD2 . PHE H  1 12  ? 52.413  0.210   6.913   1.00 16.76  ? 12  PHE H CD2 1 
ATOM   8603  C  CE1 . PHE H  1 12  ? 53.372  -2.335  6.305   1.00 11.76  ? 12  PHE H CE1 1 
ATOM   8604  C  CE2 . PHE H  1 12  ? 51.650  -0.931  7.201   1.00 13.55  ? 12  PHE H CE2 1 
ATOM   8605  C  CZ  . PHE H  1 12  ? 52.114  -2.200  6.892   1.00 13.25  ? 12  PHE H CZ  1 
ATOM   8606  N  N   . LEU H  1 13  ? 52.104  2.889   5.042   1.00 2.86   ? 13  LEU H N   1 
ATOM   8607  C  CA  . LEU H  1 13  ? 50.674  3.080   4.935   1.00 3.11   ? 13  LEU H CA  1 
ATOM   8608  C  C   . LEU H  1 13  ? 50.207  3.231   3.505   1.00 7.19   ? 13  LEU H C   1 
ATOM   8609  O  O   . LEU H  1 13  ? 49.254  2.564   3.083   1.00 11.51  ? 13  LEU H O   1 
ATOM   8610  C  CB  . LEU H  1 13  ? 50.269  4.322   5.719   1.00 2.11   ? 13  LEU H CB  1 
ATOM   8611  C  CG  . LEU H  1 13  ? 49.681  4.132   7.109   1.00 6.85   ? 13  LEU H CG  1 
ATOM   8612  C  CD1 . LEU H  1 13  ? 50.035  2.803   7.719   1.00 2.42   ? 13  LEU H CD1 1 
ATOM   8613  C  CD2 . LEU H  1 13  ? 50.006  5.330   7.961   1.00 1.00   ? 13  LEU H CD2 1 
ATOM   8614  N  N   . ASN H  1 14  ? 50.880  4.075   2.729   1.00 4.37   ? 14  ASN H N   1 
ATOM   8615  C  CA  . ASN H  1 14  ? 50.449  4.263   1.338   1.00 6.29   ? 14  ASN H CA  1 
ATOM   8616  C  C   . ASN H  1 14  ? 50.546  2.974   0.519   1.00 9.75   ? 14  ASN H C   1 
ATOM   8617  O  O   . ASN H  1 14  ? 49.783  2.695   -0.398  1.00 10.70  ? 14  ASN H O   1 
ATOM   8618  C  CB  . ASN H  1 14  ? 51.257  5.383   0.709   1.00 2.71   ? 14  ASN H CB  1 
ATOM   8619  C  CG  . ASN H  1 14  ? 50.444  6.285   -0.189  1.00 21.75  ? 14  ASN H CG  1 
ATOM   8620  O  OD1 . ASN H  1 14  ? 49.225  6.151   -0.345  1.00 14.13  ? 14  ASN H OD1 1 
ATOM   8621  N  ND2 . ASN H  1 14  ? 51.151  7.228   -0.808  1.00 13.25  ? 14  ASN H ND2 1 
ATOM   8622  N  N   . HIS H  1 15  ? 51.496  2.130   0.893   1.00 6.53   ? 15  HIS H N   1 
ATOM   8623  C  CA  . HIS H  1 15  ? 51.637  0.861   0.211   1.00 6.58   ? 15  HIS H CA  1 
ATOM   8624  C  C   . HIS H  1 15  ? 50.396  0.040   0.511   1.00 7.60   ? 15  HIS H C   1 
ATOM   8625  O  O   . HIS H  1 15  ? 49.936  -0.673  -0.340  1.00 8.19   ? 15  HIS H O   1 
ATOM   8626  C  CB  . HIS H  1 15  ? 52.899  0.142   0.684   1.00 9.18   ? 15  HIS H CB  1 
ATOM   8627  C  CG  . HIS H  1 15  ? 53.101  -1.148  -0.037  1.00 18.36  ? 15  HIS H CG  1 
ATOM   8628  N  ND1 . HIS H  1 15  ? 53.031  -2.370  0.598   1.00 24.50  ? 15  HIS H ND1 1 
ATOM   8629  C  CD2 . HIS H  1 15  ? 53.273  -1.422  -1.354  1.00 19.23  ? 15  HIS H CD2 1 
ATOM   8630  C  CE1 . HIS H  1 15  ? 53.178  -3.337  -0.293  1.00 22.65  ? 15  HIS H CE1 1 
ATOM   8631  N  NE2 . HIS H  1 15  ? 53.329  -2.786  -1.485  1.00 21.19  ? 15  HIS H NE2 1 
ATOM   8632  N  N   . GLN H  1 16  ? 49.854  0.122   1.715   1.00 2.56   ? 16  GLN H N   1 
ATOM   8633  C  CA  . GLN H  1 16  ? 48.670  -0.633  2.055   1.00 1.58   ? 16  GLN H CA  1 
ATOM   8634  C  C   . GLN H  1 16  ? 47.432  -0.022  1.367   1.00 7.80   ? 16  GLN H C   1 
ATOM   8635  O  O   . GLN H  1 16  ? 46.521  -0.732  0.916   1.00 7.26   ? 16  GLN H O   1 
ATOM   8636  C  CB  . GLN H  1 16  ? 48.567  -0.776  3.567   1.00 1.00   ? 16  GLN H CB  1 
ATOM   8637  C  CG  . GLN H  1 16  ? 49.794  -1.403  4.168   1.00 6.60   ? 16  GLN H CG  1 
ATOM   8638  C  CD  . GLN H  1 16  ? 50.097  -2.734  3.529   1.00 18.55  ? 16  GLN H CD  1 
ATOM   8639  O  OE1 . GLN H  1 16  ? 49.217  -3.351  2.957   1.00 7.56   ? 16  GLN H OE1 1 
ATOM   8640  N  NE2 . GLN H  1 16  ? 51.324  -3.203  3.631   1.00 12.82  ? 16  GLN H NE2 1 
ATOM   8641  N  N   . VAL H  1 17  ? 47.379  1.299   1.204   1.00 2.57   ? 17  VAL H N   1 
ATOM   8642  C  CA  . VAL H  1 17  ? 46.256  1.863   0.456   1.00 1.64   ? 17  VAL H CA  1 
ATOM   8643  C  C   . VAL H  1 17  ? 46.207  1.154   -0.909  1.00 5.67   ? 17  VAL H C   1 
ATOM   8644  O  O   . VAL H  1 17  ? 45.185  0.625   -1.301  1.00 9.04   ? 17  VAL H O   1 
ATOM   8645  C  CB  . VAL H  1 17  ? 46.407  3.371   0.240   1.00 2.25   ? 17  VAL H CB  1 
ATOM   8646  C  CG1 . VAL H  1 17  ? 45.362  3.857   -0.758  1.00 1.00   ? 17  VAL H CG1 1 
ATOM   8647  C  CG2 . VAL H  1 17  ? 46.271  4.094   1.588   1.00 1.49   ? 17  VAL H CG2 1 
ATOM   8648  N  N   . ALA H  1 18  ? 47.355  1.033   -1.566  1.00 4.10   ? 18  ALA H N   1 
ATOM   8649  C  CA  . ALA H  1 18  ? 47.477  0.315   -2.821  1.00 5.10   ? 18  ALA H CA  1 
ATOM   8650  C  C   . ALA H  1 18  ? 46.993  -1.130  -2.651  1.00 6.05   ? 18  ALA H C   1 
ATOM   8651  O  O   . ALA H  1 18  ? 46.046  -1.541  -3.323  1.00 9.54   ? 18  ALA H O   1 
ATOM   8652  C  CB  . ALA H  1 18  ? 48.883  0.358   -3.420  1.00 1.85   ? 18  ALA H CB  1 
ATOM   8653  N  N   . ASN H  1 19  ? 47.639  -1.890  -1.787  1.00 1.34   ? 19  ASN H N   1 
ATOM   8654  C  CA  . ASN H  1 19  ? 47.228  -3.271  -1.585  1.00 2.26   ? 19  ASN H CA  1 
ATOM   8655  C  C   . ASN H  1 19  ? 45.737  -3.492  -1.334  1.00 8.94   ? 19  ASN H C   1 
ATOM   8656  O  O   . ASN H  1 19  ? 45.110  -4.419  -1.864  1.00 8.36   ? 19  ASN H O   1 
ATOM   8657  C  CB  . ASN H  1 19  ? 47.926  -3.858  -0.361  1.00 4.61   ? 19  ASN H CB  1 
ATOM   8658  C  CG  . ASN H  1 19  ? 49.290  -4.286  -0.686  1.00 14.66  ? 19  ASN H CG  1 
ATOM   8659  O  OD1 . ASN H  1 19  ? 49.657  -4.398  -1.853  1.00 10.70  ? 19  ASN H OD1 1 
ATOM   8660  N  ND2 . ASN H  1 19  ? 50.041  -4.608  0.343   1.00 2.86   ? 19  ASN H ND2 1 
ATOM   8661  N  N   . LEU H  1 20  ? 45.210  -2.643  -0.462  1.00 10.33  ? 20  LEU H N   1 
ATOM   8662  C  CA  . LEU H  1 20  ? 43.820  -2.756  -0.040  1.00 7.24   ? 20  LEU H CA  1 
ATOM   8663  C  C   . LEU H  1 20  ? 42.894  -2.553  -1.249  1.00 8.53   ? 20  LEU H C   1 
ATOM   8664  O  O   . LEU H  1 20  ? 41.936  -3.302  -1.467  1.00 7.87   ? 20  LEU H O   1 
ATOM   8665  C  CB  . LEU H  1 20  ? 43.591  -1.785  1.130   1.00 5.08   ? 20  LEU H CB  1 
ATOM   8666  C  CG  . LEU H  1 20  ? 43.528  -2.362  2.532   1.00 4.47   ? 20  LEU H CG  1 
ATOM   8667  C  CD1 . LEU H  1 20  ? 43.896  -3.815  2.715   1.00 1.85   ? 20  LEU H CD1 1 
ATOM   8668  C  CD2 . LEU H  1 20  ? 44.204  -1.441  3.521   1.00 1.00   ? 20  LEU H CD2 1 
ATOM   8669  N  N   . ASN H  1 21  ? 43.228  -1.582  -2.092  1.00 1.78   ? 21  ASN H N   1 
ATOM   8670  C  CA  . ASN H  1 21  ? 42.448  -1.398  -3.304  1.00 1.61   ? 21  ASN H CA  1 
ATOM   8671  C  C   . ASN H  1 21  ? 42.434  -2.585  -4.268  1.00 9.59   ? 21  ASN H C   1 
ATOM   8672  O  O   . ASN H  1 21  ? 41.413  -2.942  -4.848  1.00 13.05  ? 21  ASN H O   1 
ATOM   8673  C  CB  . ASN H  1 21  ? 42.874  -0.126  -4.016  1.00 6.04   ? 21  ASN H CB  1 
ATOM   8674  C  CG  . ASN H  1 21  ? 42.132  1.072   -3.449  1.00 21.38  ? 21  ASN H CG  1 
ATOM   8675  O  OD1 . ASN H  1 21  ? 40.959  1.310   -3.803  1.00 16.16  ? 21  ASN H OD1 1 
ATOM   8676  N  ND2 . ASN H  1 21  ? 42.728  1.694   -2.410  1.00 11.49  ? 21  ASN H ND2 1 
ATOM   8677  N  N   . VAL H  1 22  ? 43.568  -3.260  -4.399  1.00 9.81   ? 22  VAL H N   1 
ATOM   8678  C  CA  . VAL H  1 22  ? 43.651  -4.451  -5.237  1.00 5.38   ? 22  VAL H CA  1 
ATOM   8679  C  C   . VAL H  1 22  ? 42.833  -5.556  -4.567  1.00 6.00   ? 22  VAL H C   1 
ATOM   8680  O  O   . VAL H  1 22  ? 42.083  -6.269  -5.244  1.00 2.13   ? 22  VAL H O   1 
ATOM   8681  C  CB  . VAL H  1 22  ? 45.138  -4.893  -5.425  1.00 4.76   ? 22  VAL H CB  1 
ATOM   8682  C  CG1 . VAL H  1 22  ? 45.255  -6.158  -6.223  1.00 5.99   ? 22  VAL H CG1 1 
ATOM   8683  C  CG2 . VAL H  1 22  ? 45.898  -3.804  -6.130  1.00 3.58   ? 22  VAL H CG2 1 
ATOM   8684  N  N   . PHE H  1 23  ? 43.011  -5.713  -3.255  1.00 2.41   ? 23  PHE H N   1 
ATOM   8685  C  CA  . PHE H  1 23  ? 42.359  -6.819  -2.554  1.00 1.16   ? 23  PHE H CA  1 
ATOM   8686  C  C   . PHE H  1 23  ? 40.866  -6.696  -2.652  1.00 8.85   ? 23  PHE H C   1 
ATOM   8687  O  O   . PHE H  1 23  ? 40.134  -7.631  -2.906  1.00 7.72   ? 23  PHE H O   1 
ATOM   8688  C  CB  . PHE H  1 23  ? 42.802  -6.794  -1.098  1.00 2.71   ? 23  PHE H CB  1 
ATOM   8689  C  CG  . PHE H  1 23  ? 42.294  -7.946  -0.305  1.00 5.75   ? 23  PHE H CG  1 
ATOM   8690  C  CD1 . PHE H  1 23  ? 42.169  -9.188  -0.880  1.00 10.50  ? 23  PHE H CD1 1 
ATOM   8691  C  CD2 . PHE H  1 23  ? 42.005  -7.808  1.031   1.00 5.45   ? 23  PHE H CD2 1 
ATOM   8692  C  CE1 . PHE H  1 23  ? 41.733  -10.264 -0.121  1.00 7.24   ? 23  PHE H CE1 1 
ATOM   8693  C  CE2 . PHE H  1 23  ? 41.549  -8.860  1.789   1.00 3.24   ? 23  PHE H CE2 1 
ATOM   8694  C  CZ  . PHE H  1 23  ? 41.418  -10.115 1.208   1.00 1.29   ? 23  PHE H CZ  1 
ATOM   8695  N  N   . THR H  1 24  ? 40.431  -5.468  -2.529  1.00 2.59   ? 24  THR H N   1 
ATOM   8696  C  CA  . THR H  1 24  ? 39.021  -5.258  -2.568  1.00 1.21   ? 24  THR H CA  1 
ATOM   8697  C  C   . THR H  1 24  ? 38.409  -5.654  -3.892  1.00 9.84   ? 24  THR H C   1 
ATOM   8698  O  O   . THR H  1 24  ? 37.373  -6.314  -3.912  1.00 4.42   ? 24  THR H O   1 
ATOM   8699  C  CB  . THR H  1 24  ? 38.823  -3.829  -2.161  1.00 6.54   ? 24  THR H CB  1 
ATOM   8700  O  OG1 . THR H  1 24  ? 37.716  -3.762  -1.275  1.00 37.43  ? 24  THR H OG1 1 
ATOM   8701  C  CG2 . THR H  1 24  ? 38.632  -2.906  -3.345  1.00 2.58   ? 24  THR H CG2 1 
ATOM   8702  N  N   . VAL H  1 25  ? 39.055  -5.322  -5.006  1.00 5.43   ? 25  VAL H N   1 
ATOM   8703  C  CA  . VAL H  1 25  ? 38.549  -5.751  -6.298  1.00 1.32   ? 25  VAL H CA  1 
ATOM   8704  C  C   . VAL H  1 25  ? 38.665  -7.258  -6.412  1.00 6.99   ? 25  VAL H C   1 
ATOM   8705  O  O   . VAL H  1 25  ? 37.822  -7.931  -7.003  1.00 3.77   ? 25  VAL H O   1 
ATOM   8706  C  CB  . VAL H  1 25  ? 39.365  -5.062  -7.389  1.00 6.92   ? 25  VAL H CB  1 
ATOM   8707  C  CG1 . VAL H  1 25  ? 39.010  -5.554  -8.792  1.00 5.52   ? 25  VAL H CG1 1 
ATOM   8708  C  CG2 . VAL H  1 25  ? 39.067  -3.583  -7.265  1.00 1.44   ? 25  VAL H CG2 1 
ATOM   8709  N  N   . LYS H  1 26  ? 39.689  -7.832  -5.799  1.00 1.64   ? 26  LYS H N   1 
ATOM   8710  C  CA  . LYS H  1 26  ? 39.791  -9.273  -5.883  1.00 2.27   ? 26  LYS H CA  1 
ATOM   8711  C  C   . LYS H  1 26  ? 38.601  -9.958  -5.223  1.00 4.93   ? 26  LYS H C   1 
ATOM   8712  O  O   . LYS H  1 26  ? 38.089  -10.988 -5.644  1.00 7.18   ? 26  LYS H O   1 
ATOM   8713  C  CB  . LYS H  1 26  ? 41.110  -9.704  -5.261  1.00 2.75   ? 26  LYS H CB  1 
ATOM   8714  C  CG  . LYS H  1 26  ? 41.301  -11.208 -5.295  1.00 15.14  ? 26  LYS H CG  1 
ATOM   8715  C  CD  . LYS H  1 26  ? 42.550  -11.603 -4.496  1.00 29.67  ? 26  LYS H CD  1 
ATOM   8716  C  CE  . LYS H  1 26  ? 43.859  -11.166 -5.155  1.00 13.13  ? 26  LYS H CE  1 
ATOM   8717  N  NZ  . LYS H  1 26  ? 44.161  -12.059 -6.313  1.00 36.80  ? 26  LYS H NZ  1 
ATOM   8718  N  N   . ILE H  1 27  ? 38.180  -9.360  -4.125  1.00 2.81   ? 27  ILE H N   1 
ATOM   8719  C  CA  . ILE H  1 27  ? 37.056  -9.885  -3.348  1.00 3.92   ? 27  ILE H CA  1 
ATOM   8720  C  C   . ILE H  1 27  ? 35.826  -9.862  -4.225  1.00 4.49   ? 27  ILE H C   1 
ATOM   8721  O  O   . ILE H  1 27  ? 35.106  -10.829 -4.295  1.00 6.86   ? 27  ILE H O   1 
ATOM   8722  C  CB  . ILE H  1 27  ? 36.857  -9.081  -2.050  1.00 2.56   ? 27  ILE H CB  1 
ATOM   8723  C  CG1 . ILE H  1 27  ? 38.020  -9.379  -1.105  1.00 1.00   ? 27  ILE H CG1 1 
ATOM   8724  C  CG2 . ILE H  1 27  ? 35.599  -9.576  -1.374  1.00 1.19   ? 27  ILE H CG2 1 
ATOM   8725  C  CD1 . ILE H  1 27  ? 38.091  -8.459  0.078   1.00 1.12   ? 27  ILE H CD1 1 
ATOM   8726  N  N   . HIS H  1 28  ? 35.614  -8.792  -4.952  1.00 1.68   ? 28  HIS H N   1 
ATOM   8727  C  CA  . HIS H  1 28  ? 34.515  -8.716  -5.910  1.00 2.55   ? 28  HIS H CA  1 
ATOM   8728  C  C   . HIS H  1 28  ? 34.615  -9.780  -6.994  1.00 8.37   ? 28  HIS H C   1 
ATOM   8729  O  O   . HIS H  1 28  ? 33.644  -10.427 -7.377  1.00 7.89   ? 28  HIS H O   1 
ATOM   8730  C  CB  . HIS H  1 28  ? 34.382  -7.358  -6.628  1.00 5.27   ? 28  HIS H CB  1 
ATOM   8731  C  CG  . HIS H  1 28  ? 33.495  -6.369  -5.945  1.00 10.94  ? 28  HIS H CG  1 
ATOM   8732  N  ND1 . HIS H  1 28  ? 32.437  -6.719  -5.125  1.00 17.83  ? 28  HIS H ND1 1 
ATOM   8733  C  CD2 . HIS H  1 28  ? 33.427  -5.017  -6.087  1.00 11.83  ? 28  HIS H CD2 1 
ATOM   8734  C  CE1 . HIS H  1 28  ? 31.795  -5.641  -4.720  1.00 16.94  ? 28  HIS H CE1 1 
ATOM   8735  N  NE2 . HIS H  1 28  ? 32.370  -4.583  -5.304  1.00 14.69  ? 28  HIS H NE2 1 
ATOM   8736  N  N   . GLN H  1 29  ? 35.831  -9.993  -7.479  1.00 5.02   ? 29  GLN H N   1 
ATOM   8737  C  CA  . GLN H  1 29  ? 35.987  -11.038 -8.475  1.00 4.79   ? 29  GLN H CA  1 
ATOM   8738  C  C   . GLN H  1 29  ? 35.481  -12.373 -7.976  1.00 7.32   ? 29  GLN H C   1 
ATOM   8739  O  O   . GLN H  1 29  ? 34.696  -13.059 -8.641  1.00 5.83   ? 29  GLN H O   1 
ATOM   8740  C  CB  . GLN H  1 29  ? 37.458  -11.149 -8.845  1.00 7.20   ? 29  GLN H CB  1 
ATOM   8741  C  CG  . GLN H  1 29  ? 37.806  -12.412 -9.625  1.00 11.38  ? 29  GLN H CG  1 
ATOM   8742  C  CD  . GLN H  1 29  ? 39.207  -12.359 -10.201 1.00 16.38  ? 29  GLN H CD  1 
ATOM   8743  O  OE1 . GLN H  1 29  ? 39.498  -11.502 -11.079 1.00 12.22  ? 29  GLN H OE1 1 
ATOM   8744  N  NE2 . GLN H  1 29  ? 40.076  -13.241 -9.683  1.00 10.87  ? 29  GLN H NE2 1 
ATOM   8745  N  N   . ILE H  1 30  ? 35.935  -12.765 -6.799  1.00 2.56   ? 30  ILE H N   1 
ATOM   8746  C  CA  . ILE H  1 30  ? 35.545  -14.043 -6.264  1.00 1.00   ? 30  ILE H CA  1 
ATOM   8747  C  C   . ILE H  1 30  ? 34.032  -14.106 -6.088  1.00 6.80   ? 30  ILE H C   1 
ATOM   8748  O  O   . ILE H  1 30  ? 33.387  -15.119 -6.396  1.00 6.52   ? 30  ILE H O   1 
ATOM   8749  C  CB  . ILE H  1 30  ? 36.214  -14.217 -4.869  1.00 4.82   ? 30  ILE H CB  1 
ATOM   8750  C  CG1 . ILE H  1 30  ? 37.735  -14.343 -5.015  1.00 10.67  ? 30  ILE H CG1 1 
ATOM   8751  C  CG2 . ILE H  1 30  ? 35.725  -15.460 -4.122  1.00 1.00   ? 30  ILE H CG2 1 
ATOM   8752  C  CD1 . ILE H  1 30  ? 38.488  -14.321 -3.693  1.00 13.61  ? 30  ILE H CD1 1 
ATOM   8753  N  N   . HIS H  1 31  ? 33.552  -13.003 -5.598  1.00 3.15   ? 31  HIS H N   1 
ATOM   8754  C  CA  . HIS H  1 31  ? 32.151  -12.779 -5.268  1.00 4.31   ? 31  HIS H CA  1 
ATOM   8755  C  C   . HIS H  1 31  ? 31.247  -12.938 -6.494  1.00 11.15  ? 31  HIS H C   1 
ATOM   8756  O  O   . HIS H  1 31  ? 30.132  -13.471 -6.403  1.00 4.54   ? 31  HIS H O   1 
ATOM   8757  C  CB  . HIS H  1 31  ? 32.075  -11.369 -4.698  1.00 2.05   ? 31  HIS H CB  1 
ATOM   8758  C  CG  . HIS H  1 31  ? 30.670  -10.822 -4.492  1.00 9.30   ? 31  HIS H CG  1 
ATOM   8759  N  ND1 . HIS H  1 31  ? 29.808  -11.347 -3.539  1.00 15.27  ? 31  HIS H ND1 1 
ATOM   8760  C  CD2 . HIS H  1 31  ? 30.007  -9.807  -5.100  1.00 10.47  ? 31  HIS H CD2 1 
ATOM   8761  C  CE1 . HIS H  1 31  ? 28.681  -10.660 -3.589  1.00 10.91  ? 31  HIS H CE1 1 
ATOM   8762  N  NE2 . HIS H  1 31  ? 28.784  -9.738  -4.515  1.00 9.50   ? 31  HIS H NE2 1 
ATOM   8763  N  N   . TRP H  1 32  ? 31.748  -12.484 -7.619  1.00 5.06   ? 32  TRP H N   1 
ATOM   8764  C  CA  . TRP H  1 32  ? 30.985  -12.496 -8.875  1.00 4.42   ? 32  TRP H CA  1 
ATOM   8765  C  C   . TRP H  1 32  ? 31.074  -13.831 -9.620  1.00 11.04  ? 32  TRP H C   1 
ATOM   8766  O  O   . TRP H  1 32  ? 30.077  -14.331 -10.156 1.00 6.37   ? 32  TRP H O   1 
ATOM   8767  C  CB  . TRP H  1 32  ? 31.518  -11.429 -9.830  1.00 1.12   ? 32  TRP H CB  1 
ATOM   8768  C  CG  . TRP H  1 32  ? 31.122  -10.018 -9.411  1.00 1.61   ? 32  TRP H CG  1 
ATOM   8769  C  CD1 . TRP H  1 32  ? 30.052  -9.671  -8.690  1.00 1.84   ? 32  TRP H CD1 1 
ATOM   8770  C  CD2 . TRP H  1 32  ? 31.845  -8.840  -9.726  1.00 2.45   ? 32  TRP H CD2 1 
ATOM   8771  N  NE1 . TRP H  1 32  ? 30.094  -8.252  -8.538  1.00 4.03   ? 32  TRP H NE1 1 
ATOM   8772  C  CE2 . TRP H  1 32  ? 31.154  -7.784  -9.150  1.00 3.15   ? 32  TRP H CE2 1 
ATOM   8773  C  CE3 . TRP H  1 32  ? 33.020  -8.577  -10.442 1.00 4.52   ? 32  TRP H CE3 1 
ATOM   8774  C  CZ2 . TRP H  1 32  ? 31.572  -6.453  -9.242  1.00 1.10   ? 32  TRP H CZ2 1 
ATOM   8775  C  CZ3 . TRP H  1 32  ? 33.433  -7.231  -10.533 1.00 6.01   ? 32  TRP H CZ3 1 
ATOM   8776  C  CH2 . TRP H  1 32  ? 32.742  -6.220  -9.960  1.00 6.18   ? 32  TRP H CH2 1 
ATOM   8777  N  N   . TYR H  1 33  ? 32.259  -14.401 -9.641  1.00 2.95   ? 33  TYR H N   1 
ATOM   8778  C  CA  . TYR H  1 33  ? 32.517  -15.598 -10.459 1.00 2.63   ? 33  TYR H CA  1 
ATOM   8779  C  C   . TYR H  1 33  ? 32.371  -16.941 -9.733  1.00 12.08  ? 33  TYR H C   1 
ATOM   8780  O  O   . TYR H  1 33  ? 32.356  -18.007 -10.357 1.00 13.10  ? 33  TYR H O   1 
ATOM   8781  C  CB  . TYR H  1 33  ? 33.933  -15.550 -11.010 1.00 2.94   ? 33  TYR H CB  1 
ATOM   8782  C  CG  . TYR H  1 33  ? 34.051  -14.552 -12.152 1.00 4.94   ? 33  TYR H CG  1 
ATOM   8783  C  CD1 . TYR H  1 33  ? 33.483  -14.855 -13.392 1.00 11.93  ? 33  TYR H CD1 1 
ATOM   8784  C  CD2 . TYR H  1 33  ? 34.717  -13.339 -11.955 1.00 2.55   ? 33  TYR H CD2 1 
ATOM   8785  C  CE1 . TYR H  1 33  ? 33.572  -13.932 -14.440 1.00 11.91  ? 33  TYR H CE1 1 
ATOM   8786  C  CE2 . TYR H  1 33  ? 34.810  -12.418 -13.003 1.00 5.45   ? 33  TYR H CE2 1 
ATOM   8787  C  CZ  . TYR H  1 33  ? 34.235  -12.714 -14.246 1.00 16.24  ? 33  TYR H CZ  1 
ATOM   8788  O  OH  . TYR H  1 33  ? 34.317  -11.817 -15.264 1.00 12.94  ? 33  TYR H OH  1 
ATOM   8789  N  N   . MET H  1 34  ? 32.258  -16.943 -8.433  1.00 7.81   ? 34  MET H N   1 
ATOM   8790  C  CA  . MET H  1 34  ? 32.175  -18.228 -7.718  1.00 4.10   ? 34  MET H CA  1 
ATOM   8791  C  C   . MET H  1 34  ? 30.989  -19.042 -8.183  1.00 3.46   ? 34  MET H C   1 
ATOM   8792  O  O   . MET H  1 34  ? 29.940  -18.529 -8.569  1.00 4.71   ? 34  MET H O   1 
ATOM   8793  C  CB  . MET H  1 34  ? 32.092  -18.006 -6.206  1.00 7.51   ? 34  MET H CB  1 
ATOM   8794  C  CG  . MET H  1 34  ? 30.878  -17.192 -5.768  1.00 12.21  ? 34  MET H CG  1 
ATOM   8795  S  SD  . MET H  1 34  ? 30.696  -17.132 -3.997  1.00 19.61  ? 34  MET H SD  1 
ATOM   8796  C  CE  . MET H  1 34  ? 32.201  -16.546 -3.247  1.00 16.11  ? 34  MET H CE  1 
ATOM   8797  N  N   . ARG H  1 35  ? 31.126  -20.347 -8.039  1.00 9.42   ? 35  ARG H N   1 
ATOM   8798  C  CA  . ARG H  1 35  ? 30.089  -21.324 -8.368  1.00 10.61  ? 35  ARG H CA  1 
ATOM   8799  C  C   . ARG H  1 35  ? 30.290  -22.546 -7.475  1.00 12.36  ? 35  ARG H C   1 
ATOM   8800  O  O   . ARG H  1 35  ? 31.397  -22.763 -6.990  1.00 17.01  ? 35  ARG H O   1 
ATOM   8801  C  CB  . ARG H  1 35  ? 30.180  -21.789 -9.813  1.00 7.88   ? 35  ARG H CB  1 
ATOM   8802  C  CG  . ARG H  1 35  ? 29.806  -20.696 -10.763 1.00 14.89  ? 35  ARG H CG  1 
ATOM   8803  C  CD  . ARG H  1 35  ? 29.683  -21.329 -12.129 1.00 4.69   ? 35  ARG H CD  1 
ATOM   8804  N  NE  . ARG H  1 35  ? 29.554  -20.352 -13.204 1.00 21.72  ? 35  ARG H NE  1 
ATOM   8805  C  CZ  . ARG H  1 35  ? 29.698  -20.668 -14.486 1.00 35.26  ? 35  ARG H CZ  1 
ATOM   8806  N  NH1 . ARG H  1 35  ? 29.961  -21.915 -14.860 1.00 42.16  ? 35  ARG H NH1 1 
ATOM   8807  N  NH2 . ARG H  1 35  ? 29.581  -19.719 -15.398 1.00 30.13  ? 35  ARG H NH2 1 
ATOM   8808  N  N   . GLY H  1 36  ? 29.231  -23.294 -7.198  1.00 7.76   ? 36  GLY H N   1 
ATOM   8809  C  CA  . GLY H  1 36  ? 29.345  -24.456 -6.336  1.00 6.62   ? 36  GLY H CA  1 
ATOM   8810  C  C   . GLY H  1 36  ? 28.331  -24.382 -5.210  1.00 13.43  ? 36  GLY H C   1 
ATOM   8811  O  O   . GLY H  1 36  ? 27.742  -23.334 -4.935  1.00 12.49  ? 36  GLY H O   1 
ATOM   8812  N  N   . HIS H  1 37  ? 28.209  -25.500 -4.513  1.00 10.09  ? 37  HIS H N   1 
ATOM   8813  C  CA  . HIS H  1 37  ? 27.268  -25.615 -3.418  1.00 13.55  ? 37  HIS H CA  1 
ATOM   8814  C  C   . HIS H  1 37  ? 27.400  -24.564 -2.313  1.00 17.78  ? 37  HIS H C   1 
ATOM   8815  O  O   . HIS H  1 37  ? 26.453  -24.322 -1.566  1.00 15.68  ? 37  HIS H O   1 
ATOM   8816  C  CB  . HIS H  1 37  ? 27.336  -27.052 -2.871  1.00 18.60  ? 37  HIS H CB  1 
ATOM   8817  C  CG  . HIS H  1 37  ? 26.804  -28.061 -3.828  1.00 31.47  ? 37  HIS H CG  1 
ATOM   8818  N  ND1 . HIS H  1 37  ? 25.740  -28.884 -3.538  1.00 40.62  ? 37  HIS H ND1 1 
ATOM   8819  C  CD2 . HIS H  1 37  ? 27.093  -28.276 -5.132  1.00 48.44  ? 37  HIS H CD2 1 
ATOM   8820  C  CE1 . HIS H  1 37  ? 25.425  -29.591 -4.607  1.00 45.94  ? 37  HIS H CE1 1 
ATOM   8821  N  NE2 . HIS H  1 37  ? 26.231  -29.239 -5.593  1.00 49.26  ? 37  HIS H NE2 1 
ATOM   8822  N  N   . ASN H  1 38  ? 28.579  -23.959 -2.178  1.00 13.15  ? 38  ASN H N   1 
ATOM   8823  C  CA  . ASN H  1 38  ? 28.804  -22.962 -1.118  1.00 14.35  ? 38  ASN H CA  1 
ATOM   8824  C  C   . ASN H  1 38  ? 28.523  -21.540 -1.606  1.00 17.08  ? 38  ASN H C   1 
ATOM   8825  O  O   . ASN H  1 38  ? 28.825  -20.558 -0.936  1.00 14.54  ? 38  ASN H O   1 
ATOM   8826  C  CB  . ASN H  1 38  ? 30.245  -23.075 -0.580  1.00 14.13  ? 38  ASN H CB  1 
ATOM   8827  C  CG  . ASN H  1 38  ? 30.590  -24.501 -0.138  1.00 33.66  ? 38  ASN H CG  1 
ATOM   8828  O  OD1 . ASN H  1 38  ? 31.344  -25.225 -0.790  1.00 36.91  ? 38  ASN H OD1 1 
ATOM   8829  N  ND2 . ASN H  1 38  ? 29.951  -24.932 0.929   1.00 16.60  ? 38  ASN H ND2 1 
ATOM   8830  N  N   . PHE H  1 39  ? 27.987  -21.473 -2.820  1.00 6.56   ? 39  PHE H N   1 
ATOM   8831  C  CA  . PHE H  1 39  ? 27.719  -20.180 -3.379  1.00 3.58   ? 39  PHE H CA  1 
ATOM   8832  C  C   . PHE H  1 39  ? 26.993  -19.190 -2.457  1.00 6.44   ? 39  PHE H C   1 
ATOM   8833  O  O   . PHE H  1 39  ? 27.437  -18.050 -2.260  1.00 6.44   ? 39  PHE H O   1 
ATOM   8834  C  CB  . PHE H  1 39  ? 26.919  -20.312 -4.668  1.00 1.13   ? 39  PHE H CB  1 
ATOM   8835  C  CG  . PHE H  1 39  ? 26.576  -18.966 -5.243  1.00 3.81   ? 39  PHE H CG  1 
ATOM   8836  C  CD1 . PHE H  1 39  ? 27.489  -18.305 -6.064  1.00 1.00   ? 39  PHE H CD1 1 
ATOM   8837  C  CD2 . PHE H  1 39  ? 25.373  -18.336 -4.900  1.00 5.09   ? 39  PHE H CD2 1 
ATOM   8838  C  CE1 . PHE H  1 39  ? 27.175  -17.046 -6.599  1.00 1.00   ? 39  PHE H CE1 1 
ATOM   8839  C  CE2 . PHE H  1 39  ? 25.048  -17.067 -5.395  1.00 4.15   ? 39  PHE H CE2 1 
ATOM   8840  C  CZ  . PHE H  1 39  ? 25.958  -16.418 -6.264  1.00 2.33   ? 39  PHE H CZ  1 
ATOM   8841  N  N   . PHE H  1 40  ? 25.859  -19.591 -1.901  1.00 2.48   ? 40  PHE H N   1 
ATOM   8842  C  CA  . PHE H  1 40  ? 25.096  -18.607 -1.140  1.00 7.14   ? 40  PHE H CA  1 
ATOM   8843  C  C   . PHE H  1 40  ? 25.909  -18.069 0.016   1.00 17.55  ? 40  PHE H C   1 
ATOM   8844  O  O   . PHE H  1 40  ? 26.095  -16.865 0.157   1.00 14.55  ? 40  PHE H O   1 
ATOM   8845  C  CB  . PHE H  1 40  ? 23.714  -19.078 -0.720  1.00 4.51   ? 40  PHE H CB  1 
ATOM   8846  C  CG  . PHE H  1 40  ? 22.813  -19.328 -1.884  1.00 3.20   ? 40  PHE H CG  1 
ATOM   8847  C  CD1 . PHE H  1 40  ? 22.308  -18.244 -2.561  1.00 1.53   ? 40  PHE H CD1 1 
ATOM   8848  C  CD2 . PHE H  1 40  ? 22.615  -20.610 -2.374  1.00 5.32   ? 40  PHE H CD2 1 
ATOM   8849  C  CE1 . PHE H  1 40  ? 21.532  -18.398 -3.676  1.00 4.69   ? 40  PHE H CE1 1 
ATOM   8850  C  CE2 . PHE H  1 40  ? 21.817  -20.805 -3.484  1.00 7.79   ? 40  PHE H CE2 1 
ATOM   8851  C  CZ  . PHE H  1 40  ? 21.267  -19.682 -4.146  1.00 2.76   ? 40  PHE H CZ  1 
ATOM   8852  N  N   . THR H  1 41  ? 26.449  -19.009 0.772   1.00 13.72  ? 41  THR H N   1 
ATOM   8853  C  CA  . THR H  1 41  ? 27.206  -18.625 1.929   1.00 12.13  ? 41  THR H CA  1 
ATOM   8854  C  C   . THR H  1 41  ? 28.450  -17.807 1.624   1.00 11.40  ? 41  THR H C   1 
ATOM   8855  O  O   . THR H  1 41  ? 28.656  -16.692 2.147   1.00 11.79  ? 41  THR H O   1 
ATOM   8856  C  CB  . THR H  1 41  ? 27.314  -19.814 2.882   1.00 34.92  ? 41  THR H CB  1 
ATOM   8857  O  OG1 . THR H  1 41  ? 28.337  -19.581 3.844   1.00 54.16  ? 41  THR H OG1 1 
ATOM   8858  C  CG2 . THR H  1 41  ? 27.608  -21.110 2.140   1.00 68.20  ? 41  THR H CG2 1 
ATOM   8859  N  N   . LEU H  1 42  ? 29.257  -18.273 0.689   1.00 6.79   ? 42  LEU H N   1 
ATOM   8860  C  CA  . LEU H  1 42  ? 30.453  -17.506 0.386   1.00 4.51   ? 42  LEU H CA  1 
ATOM   8861  C  C   . LEU H  1 42  ? 30.203  -16.201 -0.354  1.00 10.08  ? 42  LEU H C   1 
ATOM   8862  O  O   . LEU H  1 42  ? 30.932  -15.210 -0.214  1.00 9.41   ? 42  LEU H O   1 
ATOM   8863  C  CB  . LEU H  1 42  ? 31.427  -18.408 -0.356  1.00 6.91   ? 42  LEU H CB  1 
ATOM   8864  C  CG  . LEU H  1 42  ? 32.504  -19.092 0.495   1.00 11.10  ? 42  LEU H CG  1 
ATOM   8865  C  CD1 . LEU H  1 42  ? 32.291  -19.063 1.962   1.00 8.69   ? 42  LEU H CD1 1 
ATOM   8866  C  CD2 . LEU H  1 42  ? 32.603  -20.535 0.082   1.00 21.35  ? 42  LEU H CD2 1 
ATOM   8867  N  N   . HIS H  1 43  ? 29.128  -16.205 -1.135  1.00 2.77   ? 43  HIS H N   1 
ATOM   8868  C  CA  . HIS H  1 43  ? 28.781  -15.006 -1.882  1.00 1.94   ? 43  HIS H CA  1 
ATOM   8869  C  C   . HIS H  1 43  ? 28.555  -13.891 -0.862  1.00 8.88   ? 43  HIS H C   1 
ATOM   8870  O  O   . HIS H  1 43  ? 29.027  -12.770 -0.990  1.00 8.37   ? 43  HIS H O   1 
ATOM   8871  C  CB  . HIS H  1 43  ? 27.522  -15.275 -2.720  1.00 2.01   ? 43  HIS H CB  1 
ATOM   8872  C  CG  . HIS H  1 43  ? 27.079  -14.097 -3.537  1.00 8.83   ? 43  HIS H CG  1 
ATOM   8873  N  ND1 . HIS H  1 43  ? 27.805  -13.639 -4.619  1.00 10.48  ? 43  HIS H ND1 1 
ATOM   8874  C  CD2 . HIS H  1 43  ? 25.998  -13.282 -3.440  1.00 10.68  ? 43  HIS H CD2 1 
ATOM   8875  C  CE1 . HIS H  1 43  ? 27.194  -12.587 -5.145  1.00 9.87   ? 43  HIS H CE1 1 
ATOM   8876  N  NE2 . HIS H  1 43  ? 26.104  -12.344 -4.442  1.00 10.74  ? 43  HIS H NE2 1 
ATOM   8877  N  N   . GLU H  1 44  ? 27.843  -14.227 0.195   1.00 5.55   ? 44  GLU H N   1 
ATOM   8878  C  CA  . GLU H  1 44  ? 27.548  -13.228 1.220   1.00 7.06   ? 44  GLU H CA  1 
ATOM   8879  C  C   . GLU H  1 44  ? 28.766  -12.875 2.049   1.00 8.43   ? 44  GLU H C   1 
ATOM   8880  O  O   . GLU H  1 44  ? 28.962  -11.708 2.382   1.00 8.91   ? 44  GLU H O   1 
ATOM   8881  C  CB  . GLU H  1 44  ? 26.372  -13.707 2.120   1.00 9.50   ? 44  GLU H CB  1 
ATOM   8882  C  CG  . GLU H  1 44  ? 25.049  -13.982 1.323   1.00 78.69  ? 44  GLU H CG  1 
ATOM   8883  C  CD  . GLU H  1 44  ? 24.008  -14.800 2.045   0.00 100.00 ? 44  GLU H CD  1 
ATOM   8884  O  OE1 . GLU H  1 44  ? 24.149  -15.002 3.263   0.00 100.00 ? 44  GLU H OE1 1 
ATOM   8885  O  OE2 . GLU H  1 44  ? 23.068  -15.255 1.371   0.00 100.00 ? 44  GLU H OE2 1 
ATOM   8886  N  N   . LYS H  1 45  ? 29.601  -13.866 2.353   1.00 2.94   ? 45  LYS H N   1 
ATOM   8887  C  CA  . LYS H  1 45  ? 30.829  -13.646 3.115   1.00 2.85   ? 45  LYS H CA  1 
ATOM   8888  C  C   . LYS H  1 45  ? 31.748  -12.636 2.420   1.00 3.41   ? 45  LYS H C   1 
ATOM   8889  O  O   . LYS H  1 45  ? 32.329  -11.737 2.996   1.00 3.88   ? 45  LYS H O   1 
ATOM   8890  C  CB  . LYS H  1 45  ? 31.517  -14.975 3.339   1.00 6.38   ? 45  LYS H CB  1 
ATOM   8891  C  CG  . LYS H  1 45  ? 32.440  -14.882 4.524   1.00 28.29  ? 45  LYS H CG  1 
ATOM   8892  C  CD  . LYS H  1 45  ? 31.648  -14.870 5.829   1.00 52.93  ? 45  LYS H CD  1 
ATOM   8893  C  CE  . LYS H  1 45  ? 32.365  -14.171 6.987   1.00 91.14  ? 45  LYS H CE  1 
ATOM   8894  N  NZ  . LYS H  1 45  ? 33.679  -14.697 7.453   1.00 78.44  ? 45  LYS H NZ  1 
ATOM   8895  N  N   . MET H  1 46  ? 31.808  -12.729 1.099   1.00 1.00   ? 46  MET H N   1 
ATOM   8896  C  CA  . MET H  1 46  ? 32.616  -11.818 0.296   1.00 1.00   ? 46  MET H CA  1 
ATOM   8897  C  C   . MET H  1 46  ? 32.120  -10.372 0.401   1.00 7.17   ? 46  MET H C   1 
ATOM   8898  O  O   . MET H  1 46  ? 32.913  -9.418  0.331   1.00 12.58  ? 46  MET H O   1 
ATOM   8899  C  CB  . MET H  1 46  ? 32.712  -12.301 -1.108  1.00 1.00   ? 46  MET H CB  1 
ATOM   8900  C  CG  . MET H  1 46  ? 33.441  -13.629 -1.259  1.00 3.09   ? 46  MET H CG  1 
ATOM   8901  S  SD  . MET H  1 46  ? 35.034  -13.627 -0.482  1.00 8.07   ? 46  MET H SD  1 
ATOM   8902  C  CE  . MET H  1 46  ? 34.928  -14.516 1.051   1.00 3.93   ? 46  MET H CE  1 
ATOM   8903  N  N   . ASP H  1 47  ? 30.827  -10.216 0.596   1.00 5.67   ? 47  ASP H N   1 
ATOM   8904  C  CA  . ASP H  1 47  ? 30.223  -8.881  0.716   1.00 8.52   ? 47  ASP H CA  1 
ATOM   8905  C  C   . ASP H  1 47  ? 30.667  -8.266  2.004   1.00 7.09   ? 47  ASP H C   1 
ATOM   8906  O  O   . ASP H  1 47  ? 30.868  -7.048  2.093   1.00 8.83   ? 47  ASP H O   1 
ATOM   8907  C  CB  . ASP H  1 47  ? 28.701  -8.981  0.675   1.00 15.99  ? 47  ASP H CB  1 
ATOM   8908  C  CG  . ASP H  1 47  ? 28.163  -8.616  -0.708  1.00 77.54  ? 47  ASP H CG  1 
ATOM   8909  O  OD1 . ASP H  1 47  ? 28.918  -7.975  -1.539  1.00 89.65  ? 47  ASP H OD1 1 
ATOM   8910  O  OD2 . ASP H  1 47  ? 26.968  -8.948  -1.046  1.00 98.78  ? 47  ASP H OD2 1 
ATOM   8911  N  N   . ASP H  1 48  ? 30.810  -9.149  2.943   1.00 4.00   ? 48  ASP H N   1 
ATOM   8912  C  CA  . ASP H  1 48  ? 31.224  -8.788  4.274   1.00 8.26   ? 48  ASP H CA  1 
ATOM   8913  C  C   . ASP H  1 48  ? 32.694  -8.367  4.248   1.00 10.60  ? 48  ASP H C   1 
ATOM   8914  O  O   . ASP H  1 48  ? 33.064  -7.328  4.803   1.00 8.65   ? 48  ASP H O   1 
ATOM   8915  C  CB  . ASP H  1 48  ? 30.959  -9.961  5.206   1.00 14.34  ? 48  ASP H CB  1 
ATOM   8916  C  CG  . ASP H  1 48  ? 29.464  -10.123 5.505   1.00 51.11  ? 48  ASP H CG  1 
ATOM   8917  O  OD1 . ASP H  1 48  ? 28.641  -9.165  5.222   1.00 53.85  ? 48  ASP H OD1 1 
ATOM   8918  O  OD2 . ASP H  1 48  ? 29.022  -11.208 6.039   1.00 81.20  ? 48  ASP H OD2 1 
ATOM   8919  N  N   . LEU H  1 49  ? 33.511  -9.174  3.594   1.00 4.02   ? 49  LEU H N   1 
ATOM   8920  C  CA  . LEU H  1 49  ? 34.957  -8.897  3.480   1.00 3.37   ? 49  LEU H CA  1 
ATOM   8921  C  C   . LEU H  1 49  ? 35.192  -7.579  2.742   1.00 2.15   ? 49  LEU H C   1 
ATOM   8922  O  O   . LEU H  1 49  ? 36.031  -6.758  3.139   1.00 5.44   ? 49  LEU H O   1 
ATOM   8923  C  CB  . LEU H  1 49  ? 35.649  -9.993  2.678   1.00 3.18   ? 49  LEU H CB  1 
ATOM   8924  C  CG  . LEU H  1 49  ? 36.535  -10.905 3.523   1.00 8.43   ? 49  LEU H CG  1 
ATOM   8925  C  CD1 . LEU H  1 49  ? 35.888  -11.301 4.849   1.00 3.86   ? 49  LEU H CD1 1 
ATOM   8926  C  CD2 . LEU H  1 49  ? 36.870  -12.214 2.805   1.00 7.98   ? 49  LEU H CD2 1 
ATOM   8927  N  N   . TYR H  1 50  ? 34.442  -7.421  1.670   1.00 1.93   ? 50  TYR H N   1 
ATOM   8928  C  CA  . TYR H  1 50  ? 34.520  -6.223  0.837   1.00 1.74   ? 50  TYR H CA  1 
ATOM   8929  C  C   . TYR H  1 50  ? 34.300  -5.006  1.697   1.00 7.22   ? 50  TYR H C   1 
ATOM   8930  O  O   . TYR H  1 50  ? 34.989  -3.990  1.599   1.00 8.69   ? 50  TYR H O   1 
ATOM   8931  C  CB  . TYR H  1 50  ? 33.447  -6.257  -0.251  1.00 3.68   ? 50  TYR H CB  1 
ATOM   8932  C  CG  . TYR H  1 50  ? 33.612  -5.117  -1.252  1.00 10.45  ? 50  TYR H CG  1 
ATOM   8933  C  CD1 . TYR H  1 50  ? 34.418  -5.293  -2.381  1.00 17.63  ? 50  TYR H CD1 1 
ATOM   8934  C  CD2 . TYR H  1 50  ? 32.967  -3.892  -1.036  1.00 12.31  ? 50  TYR H CD2 1 
ATOM   8935  C  CE1 . TYR H  1 50  ? 34.599  -4.239  -3.287  1.00 21.67  ? 50  TYR H CE1 1 
ATOM   8936  C  CE2 . TYR H  1 50  ? 33.144  -2.839  -1.945  1.00 27.84  ? 50  TYR H CE2 1 
ATOM   8937  C  CZ  . TYR H  1 50  ? 33.964  -3.011  -3.068  1.00 37.90  ? 50  TYR H CZ  1 
ATOM   8938  O  OH  . TYR H  1 50  ? 34.147  -1.985  -3.945  1.00 31.66  ? 50  TYR H OH  1 
ATOM   8939  N  N   . SER H  1 51  ? 33.275  -5.050  2.524   1.00 4.61   ? 51  SER H N   1 
ATOM   8940  C  CA  . SER H  1 51  ? 32.985  -3.852  3.288   1.00 6.94   ? 51  SER H CA  1 
ATOM   8941  C  C   . SER H  1 51  ? 34.081  -3.624  4.312   1.00 5.62   ? 51  SER H C   1 
ATOM   8942  O  O   . SER H  1 51  ? 34.504  -2.506  4.557   1.00 5.20   ? 51  SER H O   1 
ATOM   8943  C  CB  . SER H  1 51  ? 31.599  -3.996  3.939   1.00 5.60   ? 51  SER H CB  1 
ATOM   8944  O  OG  . SER H  1 51  ? 30.573  -4.090  2.971   1.00 55.70  ? 51  SER H OG  1 
ATOM   8945  N  N   . GLU H  1 52  ? 34.487  -4.705  4.961   1.00 1.00   ? 52  GLU H N   1 
ATOM   8946  C  CA  . GLU H  1 52  ? 35.476  -4.555  6.004   1.00 1.12   ? 52  GLU H CA  1 
ATOM   8947  C  C   . GLU H  1 52  ? 36.765  -3.979  5.492   1.00 5.59   ? 52  GLU H C   1 
ATOM   8948  O  O   . GLU H  1 52  ? 37.306  -3.019  6.023   1.00 3.08   ? 52  GLU H O   1 
ATOM   8949  C  CB  . GLU H  1 52  ? 35.769  -5.930  6.581   1.00 2.04   ? 52  GLU H CB  1 
ATOM   8950  C  CG  . GLU H  1 52  ? 36.939  -5.869  7.526   1.00 17.67  ? 52  GLU H CG  1 
ATOM   8951  C  CD  . GLU H  1 52  ? 37.109  -7.113  8.360   1.00 55.26  ? 52  GLU H CD  1 
ATOM   8952  O  OE1 . GLU H  1 52  ? 36.485  -8.159  8.056   1.00 20.98  ? 52  GLU H OE1 1 
ATOM   8953  O  OE2 . GLU H  1 52  ? 37.852  -7.000  9.359   1.00 28.22  ? 52  GLU H OE2 1 
ATOM   8954  N  N   . PHE H  1 53  ? 37.270  -4.640  4.466   1.00 1.76   ? 53  PHE H N   1 
ATOM   8955  C  CA  . PHE H  1 53  ? 38.536  -4.215  3.929   1.00 2.13   ? 53  PHE H CA  1 
ATOM   8956  C  C   . PHE H  1 53  ? 38.471  -2.850  3.314   1.00 4.83   ? 53  PHE H C   1 
ATOM   8957  O  O   . PHE H  1 53  ? 39.415  -2.082  3.395   1.00 5.58   ? 53  PHE H O   1 
ATOM   8958  C  CB  . PHE H  1 53  ? 39.163  -5.334  3.125   1.00 1.14   ? 53  PHE H CB  1 
ATOM   8959  C  CG  . PHE H  1 53  ? 39.690  -6.426  3.999   1.00 1.60   ? 53  PHE H CG  1 
ATOM   8960  C  CD1 . PHE H  1 53  ? 40.957  -6.358  4.554   1.00 1.00   ? 53  PHE H CD1 1 
ATOM   8961  C  CD2 . PHE H  1 53  ? 38.872  -7.462  4.364   1.00 2.86   ? 53  PHE H CD2 1 
ATOM   8962  C  CE1 . PHE H  1 53  ? 41.425  -7.354  5.365   1.00 6.38   ? 53  PHE H CE1 1 
ATOM   8963  C  CE2 . PHE H  1 53  ? 39.335  -8.478  5.171   1.00 2.41   ? 53  PHE H CE2 1 
ATOM   8964  C  CZ  . PHE H  1 53  ? 40.608  -8.424  5.689   1.00 6.64   ? 53  PHE H CZ  1 
ATOM   8965  N  N   . GLY H  1 54  ? 37.283  -2.489  2.856   1.00 1.23   ? 54  GLY H N   1 
ATOM   8966  C  CA  . GLY H  1 54  ? 37.080  -1.155  2.292   1.00 1.00   ? 54  GLY H CA  1 
ATOM   8967  C  C   . GLY H  1 54  ? 37.183  -0.149  3.401   1.00 5.39   ? 54  GLY H C   1 
ATOM   8968  O  O   . GLY H  1 54  ? 37.652  0.970   3.219   1.00 6.50   ? 54  GLY H O   1 
ATOM   8969  N  N   . GLU H  1 55  ? 36.778  -0.553  4.592   1.00 2.47   ? 55  GLU H N   1 
ATOM   8970  C  CA  . GLU H  1 55  ? 36.904  0.413   5.676   1.00 6.81   ? 55  GLU H CA  1 
ATOM   8971  C  C   . GLU H  1 55  ? 38.358  0.478   6.118   1.00 8.88   ? 55  GLU H C   1 
ATOM   8972  O  O   . GLU H  1 55  ? 38.791  1.570   6.481   1.00 12.73  ? 55  GLU H O   1 
ATOM   8973  C  CB  . GLU H  1 55  ? 36.020  0.068   6.907   1.00 13.61  ? 55  GLU H CB  1 
ATOM   8974  C  CG  . GLU H  1 55  ? 34.490  0.220   6.818   1.00 68.05  ? 55  GLU H CG  1 
ATOM   8975  C  CD  . GLU H  1 55  ? 33.734  -0.148  8.066   0.00 100.00 ? 55  GLU H CD  1 
ATOM   8976  O  OE1 . GLU H  1 55  ? 34.348  -0.635  9.035   0.00 100.00 ? 55  GLU H OE1 1 
ATOM   8977  O  OE2 . GLU H  1 55  ? 32.497  0.004   8.082   0.00 100.00 ? 55  GLU H OE2 1 
ATOM   8978  N  N   . GLN H  1 56  ? 39.087  -0.638  6.143   1.00 5.01   ? 56  GLN H N   1 
ATOM   8979  C  CA  . GLN H  1 56  ? 40.470  -0.601  6.587   1.00 3.63   ? 56  GLN H CA  1 
ATOM   8980  C  C   . GLN H  1 56  ? 41.165  0.369   5.670   1.00 3.82   ? 56  GLN H C   1 
ATOM   8981  O  O   . GLN H  1 56  ? 42.002  1.160   6.074   1.00 3.92   ? 56  GLN H O   1 
ATOM   8982  C  CB  . GLN H  1 56  ? 41.215  -1.915  6.412   1.00 5.18   ? 56  GLN H CB  1 
ATOM   8983  C  CG  . GLN H  1 56  ? 41.023  -2.879  7.555   1.00 17.38  ? 56  GLN H CG  1 
ATOM   8984  C  CD  . GLN H  1 56  ? 41.930  -4.088  7.530   1.00 26.91  ? 56  GLN H CD  1 
ATOM   8985  O  OE1 . GLN H  1 56  ? 42.992  -4.073  6.917   1.00 11.42  ? 56  GLN H OE1 1 
ATOM   8986  N  NE2 . GLN H  1 56  ? 41.525  -5.131  8.248   1.00 11.54  ? 56  GLN H NE2 1 
ATOM   8987  N  N   . MET H  1 57  ? 40.763  0.303   4.417   1.00 1.00   ? 57  MET H N   1 
ATOM   8988  C  CA  . MET H  1 57  ? 41.349  1.136   3.391   1.00 1.00   ? 57  MET H CA  1 
ATOM   8989  C  C   . MET H  1 57  ? 41.177  2.588   3.688   1.00 4.21   ? 57  MET H C   1 
ATOM   8990  O  O   . MET H  1 57  ? 42.120  3.357   3.772   1.00 11.13  ? 57  MET H O   1 
ATOM   8991  C  CB  . MET H  1 57  ? 40.777  0.724   2.036   1.00 4.25   ? 57  MET H CB  1 
ATOM   8992  C  CG  . MET H  1 57  ? 41.666  1.121   0.877   1.00 9.06   ? 57  MET H CG  1 
ATOM   8993  S  SD  . MET H  1 57  ? 41.130  2.715   0.343   1.00 17.94  ? 57  MET H SD  1 
ATOM   8994  C  CE  . MET H  1 57  ? 39.628  2.313   -0.428  1.00 6.66   ? 57  MET H CE  1 
ATOM   8995  N  N   . ASP H  1 58  ? 39.931  2.956   3.881   1.00 1.19   ? 58  ASP H N   1 
ATOM   8996  C  CA  . ASP H  1 58  ? 39.681  4.363   4.182   1.00 3.15   ? 58  ASP H CA  1 
ATOM   8997  C  C   . ASP H  1 58  ? 40.443  4.821   5.450   1.00 3.11   ? 58  ASP H C   1 
ATOM   8998  O  O   . ASP H  1 58  ? 40.991  5.923   5.496   1.00 2.75   ? 58  ASP H O   1 
ATOM   8999  C  CB  . ASP H  1 58  ? 38.179  4.718   4.242   1.00 5.67   ? 58  ASP H CB  1 
ATOM   9000  C  CG  . ASP H  1 58  ? 37.905  6.241   4.104   1.00 16.72  ? 58  ASP H CG  1 
ATOM   9001  O  OD1 . ASP H  1 58  ? 38.282  6.832   3.071   1.00 23.53  ? 58  ASP H OD1 1 
ATOM   9002  O  OD2 . ASP H  1 58  ? 37.265  6.908   4.939   1.00 19.11  ? 58  ASP H OD2 1 
ATOM   9003  N  N   . GLU H  1 59  ? 40.479  3.971   6.478   1.00 4.27   ? 59  GLU H N   1 
ATOM   9004  C  CA  . GLU H  1 59  ? 41.131  4.311   7.736   1.00 5.07   ? 59  GLU H CA  1 
ATOM   9005  C  C   . GLU H  1 59  ? 42.617  4.444   7.577   1.00 3.83   ? 59  GLU H C   1 
ATOM   9006  O  O   . GLU H  1 59  ? 43.240  5.282   8.197   1.00 3.44   ? 59  GLU H O   1 
ATOM   9007  C  CB  . GLU H  1 59  ? 40.880  3.232   8.799   1.00 8.15   ? 59  GLU H CB  1 
ATOM   9008  C  CG  . GLU H  1 59  ? 39.472  3.174   9.358   1.00 48.02  ? 59  GLU H CG  1 
ATOM   9009  C  CD  . GLU H  1 59  ? 39.310  2.275   10.549  0.00 100.00 ? 59  GLU H CD  1 
ATOM   9010  O  OE1 . GLU H  1 59  ? 40.228  2.184   11.382  0.00 100.00 ? 59  GLU H OE1 1 
ATOM   9011  O  OE2 . GLU H  1 59  ? 38.235  1.665   10.679  0.00 100.00 ? 59  GLU H OE2 1 
ATOM   9012  N  N   . VAL H  1 60  ? 43.199  3.560   6.789   1.00 2.27   ? 60  VAL H N   1 
ATOM   9013  C  CA  . VAL H  1 60  ? 44.638  3.631   6.562   1.00 1.85   ? 60  VAL H CA  1 
ATOM   9014  C  C   . VAL H  1 60  ? 44.924  4.967   5.855   1.00 4.00   ? 60  VAL H C   1 
ATOM   9015  O  O   . VAL H  1 60  ? 45.761  5.760   6.316   1.00 6.04   ? 60  VAL H O   1 
ATOM   9016  C  CB  . VAL H  1 60  ? 45.070  2.429   5.710   1.00 5.28   ? 60  VAL H CB  1 
ATOM   9017  C  CG1 . VAL H  1 60  ? 46.436  2.635   5.098   1.00 2.98   ? 60  VAL H CG1 1 
ATOM   9018  C  CG2 . VAL H  1 60  ? 45.110  1.206   6.586   1.00 1.76   ? 60  VAL H CG2 1 
ATOM   9019  N  N   . ALA H  1 61  ? 44.141  5.235   4.804   1.00 1.19   ? 61  ALA H N   1 
ATOM   9020  C  CA  . ALA H  1 61  ? 44.337  6.482   4.050   1.00 1.50   ? 61  ALA H CA  1 
ATOM   9021  C  C   . ALA H  1 61  ? 44.126  7.721   4.912   1.00 8.76   ? 61  ALA H C   1 
ATOM   9022  O  O   . ALA H  1 61  ? 44.875  8.707   4.839   1.00 7.68   ? 61  ALA H O   1 
ATOM   9023  C  CB  . ALA H  1 61  ? 43.481  6.546   2.805   1.00 1.16   ? 61  ALA H CB  1 
ATOM   9024  N  N   . GLU H  1 62  ? 43.111  7.656   5.765   1.00 3.32   ? 62  GLU H N   1 
ATOM   9025  C  CA  . GLU H  1 62  ? 42.889  8.833   6.588   1.00 2.48   ? 62  GLU H CA  1 
ATOM   9026  C  C   . GLU H  1 62  ? 43.960  8.958   7.677   1.00 7.71   ? 62  GLU H C   1 
ATOM   9027  O  O   . GLU H  1 62  ? 44.323  10.066  8.082   1.00 5.59   ? 62  GLU H O   1 
ATOM   9028  C  CB  . GLU H  1 62  ? 41.429  8.926   7.035   1.00 2.94   ? 62  GLU H CB  1 
ATOM   9029  C  CG  . GLU H  1 62  ? 40.483  9.225   5.853   1.00 9.22   ? 62  GLU H CG  1 
ATOM   9030  C  CD  . GLU H  1 62  ? 38.988  9.176   6.171   1.00 11.42  ? 62  GLU H CD  1 
ATOM   9031  O  OE1 . GLU H  1 62  ? 38.673  8.983   7.367   1.00 43.44  ? 62  GLU H OE1 1 
ATOM   9032  O  OE2 . GLU H  1 62  ? 38.166  9.217   5.223   1.00 22.88  ? 62  GLU H OE2 1 
ATOM   9033  N  N   . ARG H  1 63  ? 44.532  7.842   8.099   1.00 2.36   ? 63  ARG H N   1 
ATOM   9034  C  CA  . ARG H  1 63  ? 45.574  7.914   9.110   1.00 3.90   ? 63  ARG H CA  1 
ATOM   9035  C  C   . ARG H  1 63  ? 46.799  8.530   8.463   1.00 8.17   ? 63  ARG H C   1 
ATOM   9036  O  O   . ARG H  1 63  ? 47.513  9.359   9.031   1.00 6.31   ? 63  ARG H O   1 
ATOM   9037  C  CB  . ARG H  1 63  ? 45.915  6.518   9.663   1.00 1.62   ? 63  ARG H CB  1 
ATOM   9038  C  CG  . ARG H  1 63  ? 47.047  6.513   10.687  1.00 1.00   ? 63  ARG H CG  1 
ATOM   9039  C  CD  . ARG H  1 63  ? 46.818  7.479   11.843  1.00 2.32   ? 63  ARG H CD  1 
ATOM   9040  N  NE  . ARG H  1 63  ? 47.967  7.563   12.741  1.00 5.75   ? 63  ARG H NE  1 
ATOM   9041  C  CZ  . ARG H  1 63  ? 48.188  8.522   13.638  1.00 6.65   ? 63  ARG H CZ  1 
ATOM   9042  N  NH1 . ARG H  1 63  ? 47.379  9.546   13.774  1.00 1.84   ? 63  ARG H NH1 1 
ATOM   9043  N  NH2 . ARG H  1 63  ? 49.272  8.511   14.381  1.00 1.00   ? 63  ARG H NH2 1 
ATOM   9044  N  N   . LEU H  1 64  ? 47.044  8.133   7.224   1.00 1.11   ? 64  LEU H N   1 
ATOM   9045  C  CA  . LEU H  1 64  ? 48.171  8.723   6.533   1.00 2.80   ? 64  LEU H CA  1 
ATOM   9046  C  C   . LEU H  1 64  ? 48.018  10.231  6.363   1.00 11.63  ? 64  LEU H C   1 
ATOM   9047  O  O   . LEU H  1 64  ? 48.940  11.025  6.573   1.00 10.88  ? 64  LEU H O   1 
ATOM   9048  C  CB  . LEU H  1 64  ? 48.225  8.117   5.136   1.00 2.16   ? 64  LEU H CB  1 
ATOM   9049  C  CG  . LEU H  1 64  ? 49.324  8.603   4.174   1.00 9.04   ? 64  LEU H CG  1 
ATOM   9050  C  CD1 . LEU H  1 64  ? 50.706  8.466   4.806   1.00 5.01   ? 64  LEU H CD1 1 
ATOM   9051  C  CD2 . LEU H  1 64  ? 49.265  7.791   2.895   1.00 2.94   ? 64  LEU H CD2 1 
ATOM   9052  N  N   . LEU H  1 65  ? 46.814  10.621  5.979   1.00 3.68   ? 65  LEU H N   1 
ATOM   9053  C  CA  . LEU H  1 65  ? 46.507  12.023  5.781   1.00 2.70   ? 65  LEU H CA  1 
ATOM   9054  C  C   . LEU H  1 65  ? 46.767  12.729  7.093   1.00 9.04   ? 65  LEU H C   1 
ATOM   9055  O  O   . LEU H  1 65  ? 47.442  13.755  7.152   1.00 7.02   ? 65  LEU H O   1 
ATOM   9056  C  CB  . LEU H  1 65  ? 45.019  12.022  5.516   1.00 2.95   ? 65  LEU H CB  1 
ATOM   9057  C  CG  . LEU H  1 65  ? 44.372  12.790  4.364   1.00 10.74  ? 65  LEU H CG  1 
ATOM   9058  C  CD1 . LEU H  1 65  ? 45.307  12.951  3.186   1.00 1.01   ? 65  LEU H CD1 1 
ATOM   9059  C  CD2 . LEU H  1 65  ? 43.245  11.852  3.897   1.00 1.44   ? 65  LEU H CD2 1 
ATOM   9060  N  N   . ALA H  1 66  ? 46.353  12.108  8.195   1.00 6.55   ? 66  ALA H N   1 
ATOM   9061  C  CA  . ALA H  1 66  ? 46.508  12.709  9.511   1.00 5.31   ? 66  ALA H CA  1 
ATOM   9062  C  C   . ALA H  1 66  ? 47.933  12.835  10.001  1.00 12.04  ? 66  ALA H C   1 
ATOM   9063  O  O   . ALA H  1 66  ? 48.236  13.637  10.889  1.00 5.50   ? 66  ALA H O   1 
ATOM   9064  C  CB  . ALA H  1 66  ? 45.666  11.940  10.540  1.00 5.60   ? 66  ALA H CB  1 
ATOM   9065  N  N   . ILE H  1 67  ? 48.811  11.968  9.524   1.00 10.75  ? 67  ILE H N   1 
ATOM   9066  C  CA  . ILE H  1 67  ? 50.195  12.103  9.957   1.00 7.85   ? 67  ILE H CA  1 
ATOM   9067  C  C   . ILE H  1 67  ? 50.967  12.987  8.964   1.00 17.74  ? 67  ILE H C   1 
ATOM   9068  O  O   . ILE H  1 67  ? 52.205  13.059  8.970   1.00 15.42  ? 67  ILE H O   1 
ATOM   9069  C  CB  . ILE H  1 67  ? 50.937  10.797  10.168  1.00 6.64   ? 67  ILE H CB  1 
ATOM   9070  C  CG1 . ILE H  1 67  ? 50.980  9.968   8.878   1.00 5.57   ? 67  ILE H CG1 1 
ATOM   9071  C  CG2 . ILE H  1 67  ? 50.387  10.103  11.408  1.00 3.59   ? 67  ILE H CG2 1 
ATOM   9072  C  CD1 . ILE H  1 67  ? 51.727  8.655   9.007   1.00 28.39  ? 67  ILE H CD1 1 
ATOM   9073  N  N   . GLY H  1 68  ? 50.245  13.667  8.080   1.00 7.05   ? 68  GLY H N   1 
ATOM   9074  C  CA  . GLY H  1 68  ? 50.862  14.553  7.101   1.00 2.14   ? 68  GLY H CA  1 
ATOM   9075  C  C   . GLY H  1 68  ? 51.161  13.951  5.732   1.00 12.27  ? 68  GLY H C   1 
ATOM   9076  O  O   . GLY H  1 68  ? 51.844  14.575  4.941   1.00 19.57  ? 68  GLY H O   1 
ATOM   9077  N  N   . GLY H  1 69  ? 50.667  12.758  5.449   1.00 8.12   ? 69  GLY H N   1 
ATOM   9078  C  CA  . GLY H  1 69  ? 50.946  12.131  4.160   1.00 1.51   ? 69  GLY H CA  1 
ATOM   9079  C  C   . GLY H  1 69  ? 49.938  12.374  3.031   1.00 6.40   ? 69  GLY H C   1 
ATOM   9080  O  O   . GLY H  1 69  ? 48.939  13.118  3.169   1.00 6.59   ? 69  GLY H O   1 
ATOM   9081  N  N   . SER H  1 70  ? 50.164  11.675  1.927   1.00 4.08   ? 70  SER H N   1 
ATOM   9082  C  CA  . SER H  1 70  ? 49.243  11.891  0.825   1.00 8.55   ? 70  SER H CA  1 
ATOM   9083  C  C   . SER H  1 70  ? 48.981  10.564  0.179   1.00 16.70  ? 70  SER H C   1 
ATOM   9084  O  O   . SER H  1 70  ? 49.877  9.978   -0.408  1.00 21.56  ? 70  SER H O   1 
ATOM   9085  C  CB  . SER H  1 70  ? 49.904  12.817  -0.191  1.00 11.77  ? 70  SER H CB  1 
ATOM   9086  O  OG  . SER H  1 70  ? 50.277  14.022  0.446   1.00 33.64  ? 70  SER H OG  1 
ATOM   9087  N  N   . PRO H  1 71  ? 47.776  10.046  0.321   1.00 12.33  ? 71  PRO H N   1 
ATOM   9088  C  CA  . PRO H  1 71  ? 47.505  8.715   -0.183  1.00 9.53   ? 71  PRO H CA  1 
ATOM   9089  C  C   . PRO H  1 71  ? 47.451  8.632   -1.685  1.00 9.09   ? 71  PRO H C   1 
ATOM   9090  O  O   . PRO H  1 71  ? 46.984  9.574   -2.317  1.00 5.17   ? 71  PRO H O   1 
ATOM   9091  C  CB  . PRO H  1 71  ? 46.073  8.454   0.292   1.00 9.58   ? 71  PRO H CB  1 
ATOM   9092  C  CG  . PRO H  1 71  ? 45.480  9.800   0.530   1.00 15.16  ? 71  PRO H CG  1 
ATOM   9093  C  CD  . PRO H  1 71  ? 46.610  10.711  0.928   1.00 6.74   ? 71  PRO H CD  1 
ATOM   9094  N  N   . PHE H  1 72  ? 47.839  7.478   -2.219  1.00 7.70   ? 72  PHE H N   1 
ATOM   9095  C  CA  . PHE H  1 72  ? 47.664  7.220   -3.648  1.00 5.73   ? 72  PHE H CA  1 
ATOM   9096  C  C   . PHE H  1 72  ? 46.159  7.311   -3.843  1.00 13.59  ? 72  PHE H C   1 
ATOM   9097  O  O   . PHE H  1 72  ? 45.353  7.041   -2.956  1.00 10.39  ? 72  PHE H O   1 
ATOM   9098  C  CB  . PHE H  1 72  ? 48.069  5.803   -4.042  1.00 5.02   ? 72  PHE H CB  1 
ATOM   9099  C  CG  . PHE H  1 72  ? 49.528  5.551   -3.811  1.00 8.77   ? 72  PHE H CG  1 
ATOM   9100  C  CD1 . PHE H  1 72  ? 50.481  6.435   -4.311  1.00 14.22  ? 72  PHE H CD1 1 
ATOM   9101  C  CD2 . PHE H  1 72  ? 49.972  4.450   -3.075  1.00 9.79   ? 72  PHE H CD2 1 
ATOM   9102  C  CE1 . PHE H  1 72  ? 51.852  6.198   -4.087  1.00 18.28  ? 72  PHE H CE1 1 
ATOM   9103  C  CE2 . PHE H  1 72  ? 51.319  4.208   -2.853  1.00 11.19  ? 72  PHE H CE2 1 
ATOM   9104  C  CZ  . PHE H  1 72  ? 52.259  5.086   -3.367  1.00 13.44  ? 72  PHE H CZ  1 
ATOM   9105  N  N   . SER H  1 73  ? 45.761  7.684   -5.041  1.00 5.58   ? 73  SER H N   1 
ATOM   9106  C  CA  . SER H  1 73  ? 44.346  7.844   -5.245  1.00 3.53   ? 73  SER H CA  1 
ATOM   9107  C  C   . SER H  1 73  ? 43.856  7.675   -6.685  1.00 7.69   ? 73  SER H C   1 
ATOM   9108  O  O   . SER H  1 73  ? 42.969  8.428   -7.108  1.00 5.67   ? 73  SER H O   1 
ATOM   9109  C  CB  . SER H  1 73  ? 43.896  9.173   -4.631  1.00 6.50   ? 73  SER H CB  1 
ATOM   9110  O  OG  . SER H  1 73  ? 44.470  10.291  -5.273  1.00 12.61  ? 73  SER H OG  1 
ATOM   9111  N  N   . THR H  1 74  ? 44.416  6.681   -7.388  1.00 3.25   ? 74  THR H N   1 
ATOM   9112  C  CA  . THR H  1 74  ? 44.030  6.376   -8.759  1.00 3.27   ? 74  THR H CA  1 
ATOM   9113  C  C   . THR H  1 74  ? 44.407  4.908   -8.896  1.00 7.90   ? 74  THR H C   1 
ATOM   9114  O  O   . THR H  1 74  ? 45.356  4.471   -8.233  1.00 10.76  ? 74  THR H O   1 
ATOM   9115  C  CB  . THR H  1 74  ? 44.911  7.130   -9.785  1.00 10.58  ? 74  THR H CB  1 
ATOM   9116  O  OG1 . THR H  1 74  ? 46.298  6.865   -9.492  1.00 13.49  ? 74  THR H OG1 1 
ATOM   9117  C  CG2 . THR H  1 74  ? 44.650  8.646   -9.768  1.00 6.41   ? 74  THR H CG2 1 
ATOM   9118  N  N   . LEU H  1 75  ? 43.665  4.190   -9.748  1.00 4.63   ? 75  LEU H N   1 
ATOM   9119  C  CA  . LEU H  1 75  ? 43.939  2.779   -10.026 1.00 6.95   ? 75  LEU H CA  1 
ATOM   9120  C  C   . LEU H  1 75  ? 45.376  2.644   -10.511 1.00 11.52  ? 75  LEU H C   1 
ATOM   9121  O  O   . LEU H  1 75  ? 46.047  1.669   -10.215 1.00 15.61  ? 75  LEU H O   1 
ATOM   9122  C  CB  . LEU H  1 75  ? 43.034  2.211   -11.136 1.00 7.09   ? 75  LEU H CB  1 
ATOM   9123  C  CG  . LEU H  1 75  ? 41.584  2.025   -10.706 1.00 14.18  ? 75  LEU H CG  1 
ATOM   9124  C  CD1 . LEU H  1 75  ? 40.917  3.352   -10.392 1.00 17.10  ? 75  LEU H CD1 1 
ATOM   9125  C  CD2 . LEU H  1 75  ? 40.810  1.367   -11.785 1.00 9.07   ? 75  LEU H CD2 1 
ATOM   9126  N  N   . LYS H  1 76  ? 45.833  3.611   -11.291 1.00 10.10  ? 76  LYS H N   1 
ATOM   9127  C  CA  . LYS H  1 76  ? 47.169  3.536   -11.831 1.00 11.15  ? 76  LYS H CA  1 
ATOM   9128  C  C   . LYS H  1 76  ? 48.136  3.516   -10.664 1.00 10.44  ? 76  LYS H C   1 
ATOM   9129  O  O   . LYS H  1 76  ? 48.952  2.590   -10.560 1.00 11.44  ? 76  LYS H O   1 
ATOM   9130  C  CB  . LYS H  1 76  ? 47.444  4.694   -12.807 1.00 15.42  ? 76  LYS H CB  1 
ATOM   9131  C  CG  . LYS H  1 76  ? 48.855  4.726   -13.382 1.00 49.96  ? 76  LYS H CG  1 
ATOM   9132  C  CD  . LYS H  1 76  ? 48.937  5.746   -14.496 1.00 99.28  ? 76  LYS H CD  1 
ATOM   9133  C  CE  . LYS H  1 76  ? 50.351  5.857   -15.043 1.00 99.93  ? 76  LYS H CE  1 
ATOM   9134  N  NZ  . LYS H  1 76  ? 51.246  6.510   -14.063 0.00 100.00 ? 76  LYS H NZ  1 
ATOM   9135  N  N   . GLU H  1 77  ? 48.036  4.481   -9.755  1.00 7.16   ? 77  GLU H N   1 
ATOM   9136  C  CA  . GLU H  1 77  ? 48.975  4.427   -8.629  1.00 6.32   ? 77  GLU H CA  1 
ATOM   9137  C  C   . GLU H  1 77  ? 48.838  3.134   -7.841  1.00 10.02  ? 77  GLU H C   1 
ATOM   9138  O  O   . GLU H  1 77  ? 49.834  2.621   -7.345  1.00 10.65  ? 77  GLU H O   1 
ATOM   9139  C  CB  . GLU H  1 77  ? 48.745  5.579   -7.656  1.00 8.66   ? 77  GLU H CB  1 
ATOM   9140  C  CG  . GLU H  1 77  ? 49.070  6.934   -8.238  1.00 11.44  ? 77  GLU H CG  1 
ATOM   9141  C  CD  . GLU H  1 77  ? 48.524  8.110   -7.458  1.00 34.74  ? 77  GLU H CD  1 
ATOM   9142  O  OE1 . GLU H  1 77  ? 47.306  8.367   -7.520  1.00 27.81  ? 77  GLU H OE1 1 
ATOM   9143  O  OE2 . GLU H  1 77  ? 49.345  8.809   -6.845  1.00 30.61  ? 77  GLU H OE2 1 
ATOM   9144  N  N   . PHE H  1 78  ? 47.613  2.632   -7.677  1.00 8.03   ? 78  PHE H N   1 
ATOM   9145  C  CA  . PHE H  1 78  ? 47.440  1.414   -6.891  1.00 7.95   ? 78  PHE H CA  1 
ATOM   9146  C  C   . PHE H  1 78  ? 48.186  0.296   -7.588  1.00 12.38  ? 78  PHE H C   1 
ATOM   9147  O  O   . PHE H  1 78  ? 48.936  -0.456  -6.963  1.00 12.71  ? 78  PHE H O   1 
ATOM   9148  C  CB  . PHE H  1 78  ? 45.970  1.006   -6.680  1.00 6.70   ? 78  PHE H CB  1 
ATOM   9149  C  CG  . PHE H  1 78  ? 45.114  2.047   -6.010  1.00 4.82   ? 78  PHE H CG  1 
ATOM   9150  C  CD1 . PHE H  1 78  ? 45.674  2.942   -5.097  1.00 4.16   ? 78  PHE H CD1 1 
ATOM   9151  C  CD2 . PHE H  1 78  ? 43.781  2.185   -6.343  1.00 4.71   ? 78  PHE H CD2 1 
ATOM   9152  C  CE1 . PHE H  1 78  ? 44.933  3.929   -4.478  1.00 7.60   ? 78  PHE H CE1 1 
ATOM   9153  C  CE2 . PHE H  1 78  ? 43.007  3.164   -5.711  1.00 1.58   ? 78  PHE H CE2 1 
ATOM   9154  C  CZ  . PHE H  1 78  ? 43.592  4.044   -4.805  1.00 4.81   ? 78  PHE H CZ  1 
ATOM   9155  N  N   . LEU H  1 79  ? 47.943  0.157   -8.887  1.00 7.84   ? 79  LEU H N   1 
ATOM   9156  C  CA  . LEU H  1 79  ? 48.601  -0.889  -9.654  1.00 13.69  ? 79  LEU H CA  1 
ATOM   9157  C  C   . LEU H  1 79  ? 50.109  -0.812  -9.595  1.00 21.38  ? 79  LEU H C   1 
ATOM   9158  O  O   . LEU H  1 79  ? 50.833  -1.789  -9.454  1.00 17.37  ? 79  LEU H O   1 
ATOM   9159  C  CB  . LEU H  1 79  ? 48.165  -0.784  -11.113 1.00 16.33  ? 79  LEU H CB  1 
ATOM   9160  C  CG  . LEU H  1 79  ? 46.896  -1.617  -11.310 1.00 24.95  ? 79  LEU H CG  1 
ATOM   9161  C  CD1 . LEU H  1 79  ? 46.352  -1.647  -12.740 1.00 19.48  ? 79  LEU H CD1 1 
ATOM   9162  C  CD2 . LEU H  1 79  ? 47.357  -2.999  -10.876 1.00 27.55  ? 79  LEU H CD2 1 
ATOM   9163  N  N   . GLU H  1 80  ? 50.617  0.398   -9.704  1.00 16.43  ? 80  GLU H N   1 
ATOM   9164  C  CA  . GLU H  1 80  ? 52.051  0.570   -9.622  1.00 17.57  ? 80  GLU H CA  1 
ATOM   9165  C  C   . GLU H  1 80  ? 52.615  0.242   -8.264  1.00 25.40  ? 80  GLU H C   1 
ATOM   9166  O  O   . GLU H  1 80  ? 53.766  -0.148  -8.175  1.00 38.47  ? 80  GLU H O   1 
ATOM   9167  C  CB  . GLU H  1 80  ? 52.431  2.005   -9.974  1.00 19.23  ? 80  GLU H CB  1 
ATOM   9168  C  CG  . GLU H  1 80  ? 51.987  2.398   -11.371 1.00 63.10  ? 80  GLU H CG  1 
ATOM   9169  C  CD  . GLU H  1 80  ? 52.311  3.820   -11.740 0.00 100.00 ? 80  GLU H CD  1 
ATOM   9170  O  OE1 . GLU H  1 80  ? 52.537  4.663   -10.854 1.00 99.87  ? 80  GLU H OE1 1 
ATOM   9171  O  OE2 . GLU H  1 80  ? 52.335  4.091   -12.964 0.00 100.00 ? 80  GLU H OE2 1 
ATOM   9172  N  N   . ASN H  1 81  ? 51.866  0.455   -7.199  1.00 12.33  ? 81  ASN H N   1 
ATOM   9173  C  CA  . ASN H  1 81  ? 52.454  0.194   -5.898  1.00 10.60  ? 81  ASN H CA  1 
ATOM   9174  C  C   . ASN H  1 81  ? 52.088  -1.074  -5.147  1.00 14.05  ? 81  ASN H C   1 
ATOM   9175  O  O   . ASN H  1 81  ? 52.777  -1.454  -4.188  1.00 18.91  ? 81  ASN H O   1 
ATOM   9176  C  CB  . ASN H  1 81  ? 52.315  1.405   -4.986  1.00 13.40  ? 81  ASN H CB  1 
ATOM   9177  C  CG  . ASN H  1 81  ? 52.911  2.618   -5.620  1.00 14.50  ? 81  ASN H CG  1 
ATOM   9178  O  OD1 . ASN H  1 81  ? 52.298  3.246   -6.494  1.00 21.60  ? 81  ASN H OD1 1 
ATOM   9179  N  ND2 . ASN H  1 81  ? 54.128  2.955   -5.217  1.00 14.92  ? 81  ASN H ND2 1 
ATOM   9180  N  N   . ALA H  1 82  ? 51.011  -1.727  -5.558  1.00 12.88  ? 82  ALA H N   1 
ATOM   9181  C  CA  . ALA H  1 82  ? 50.597  -2.886  -4.802  1.00 12.80  ? 82  ALA H CA  1 
ATOM   9182  C  C   . ALA H  1 82  ? 51.530  -4.069  -4.805  1.00 16.65  ? 82  ALA H C   1 
ATOM   9183  O  O   . ALA H  1 82  ? 52.104  -4.366  -5.829  1.00 19.34  ? 82  ALA H O   1 
ATOM   9184  C  CB  . ALA H  1 82  ? 49.261  -3.323  -5.306  1.00 12.39  ? 82  ALA H CB  1 
ATOM   9185  N  N   . SER H  1 83  ? 51.599  -4.801  -3.696  1.00 8.02   ? 83  SER H N   1 
ATOM   9186  C  CA  . SER H  1 83  ? 52.371  -6.040  -3.613  1.00 4.11   ? 83  SER H CA  1 
ATOM   9187  C  C   . SER H  1 83  ? 51.331  -7.162  -3.782  1.00 14.48  ? 83  SER H C   1 
ATOM   9188  O  O   . SER H  1 83  ? 51.652  -8.318  -4.077  1.00 17.43  ? 83  SER H O   1 
ATOM   9189  C  CB  . SER H  1 83  ? 53.133  -6.183  -2.286  1.00 3.98   ? 83  SER H CB  1 
ATOM   9190  O  OG  . SER H  1 83  ? 52.356  -5.878  -1.144  1.00 25.71  ? 83  SER H OG  1 
ATOM   9191  N  N   . VAL H  1 84  ? 50.067  -6.842  -3.560  1.00 12.53  ? 84  VAL H N   1 
ATOM   9192  C  CA  . VAL H  1 84  ? 49.042  -7.855  -3.731  1.00 8.96   ? 84  VAL H CA  1 
ATOM   9193  C  C   . VAL H  1 84  ? 48.889  -8.083  -5.226  1.00 12.24  ? 84  VAL H C   1 
ATOM   9194  O  O   . VAL H  1 84  ? 48.847  -7.109  -5.988  1.00 12.13  ? 84  VAL H O   1 
ATOM   9195  C  CB  . VAL H  1 84  ? 47.688  -7.304  -3.175  1.00 7.04   ? 84  VAL H CB  1 
ATOM   9196  C  CG1 . VAL H  1 84  ? 46.495  -8.141  -3.631  1.00 5.96   ? 84  VAL H CG1 1 
ATOM   9197  C  CG2 . VAL H  1 84  ? 47.695  -7.242  -1.668  1.00 3.15   ? 84  VAL H CG2 1 
ATOM   9198  N  N   . GLU H  1 85  ? 48.807  -9.339  -5.655  1.00 20.35  ? 85  GLU H N   1 
ATOM   9199  C  CA  . GLU H  1 85  ? 48.728  -9.666  -7.086  1.00 22.05  ? 85  GLU H CA  1 
ATOM   9200  C  C   . GLU H  1 85  ? 47.317  -9.877  -7.592  1.00 18.14  ? 85  GLU H C   1 
ATOM   9201  O  O   . GLU H  1 85  ? 46.521  -10.536 -6.918  1.00 23.36  ? 85  GLU H O   1 
ATOM   9202  C  CB  . GLU H  1 85  ? 49.443  -10.981 -7.410  1.00 27.40  ? 85  GLU H CB  1 
ATOM   9203  C  CG  . GLU H  1 85  ? 50.975  -10.901 -7.413  1.00 73.46  ? 85  GLU H CG  1 
ATOM   9204  C  CD  . GLU H  1 85  ? 51.484  -9.872  -8.372  0.00 100.00 ? 85  GLU H CD  1 
ATOM   9205  O  OE1 . GLU H  1 85  ? 50.701  -9.442  -9.235  0.00 100.00 ? 85  GLU H OE1 1 
ATOM   9206  O  OE2 . GLU H  1 85  ? 52.648  -9.466  -8.243  0.00 100.00 ? 85  GLU H OE2 1 
ATOM   9207  N  N   . GLU H  1 86  ? 46.998  -9.442  -8.803  1.00 12.13  ? 86  GLU H N   1 
ATOM   9208  C  CA  . GLU H  1 86  ? 45.652  -9.700  -9.307  1.00 16.69  ? 86  GLU H CA  1 
ATOM   9209  C  C   . GLU H  1 86  ? 45.714  -10.356 -10.684 1.00 20.11  ? 86  GLU H C   1 
ATOM   9210  O  O   . GLU H  1 86  ? 46.673  -10.192 -11.432 1.00 21.25  ? 86  GLU H O   1 
ATOM   9211  C  CB  . GLU H  1 86  ? 44.856  -8.403  -9.456  1.00 17.88  ? 86  GLU H CB  1 
ATOM   9212  C  CG  . GLU H  1 86  ? 45.497  -7.379  -10.399 1.00 39.81  ? 86  GLU H CG  1 
ATOM   9213  C  CD  . GLU H  1 86  ? 44.576  -6.268  -10.904 1.00 49.13  ? 86  GLU H CD  1 
ATOM   9214  O  OE1 . GLU H  1 86  ? 43.550  -5.948  -10.247 1.00 29.27  ? 86  GLU H OE1 1 
ATOM   9215  O  OE2 . GLU H  1 86  ? 44.922  -5.671  -11.959 1.00 24.60  ? 86  GLU H OE2 1 
ATOM   9216  N  N   . ALA H  1 87  ? 44.641  -11.018 -11.070 1.00 15.89  ? 87  ALA H N   1 
ATOM   9217  C  CA  . ALA H  1 87  ? 44.623  -11.612 -12.397 1.00 17.48  ? 87  ALA H CA  1 
ATOM   9218  C  C   . ALA H  1 87  ? 43.226  -11.780 -12.934 1.00 20.17  ? 87  ALA H C   1 
ATOM   9219  O  O   . ALA H  1 87  ? 42.368  -12.335 -12.281 1.00 26.61  ? 87  ALA H O   1 
ATOM   9220  C  CB  . ALA H  1 87  ? 45.281  -12.973 -12.383 1.00 18.07  ? 87  ALA H CB  1 
ATOM   9221  N  N   . PRO H  1 88  ? 43.020  -11.398 -14.180 1.00 17.08  ? 88  PRO H N   1 
ATOM   9222  C  CA  . PRO H  1 88  ? 41.742  -11.539 -14.861 1.00 20.31  ? 88  PRO H CA  1 
ATOM   9223  C  C   . PRO H  1 88  ? 41.206  -12.944 -14.769 1.00 17.94  ? 88  PRO H C   1 
ATOM   9224  O  O   . PRO H  1 88  ? 41.975  -13.894 -14.669 1.00 15.76  ? 88  PRO H O   1 
ATOM   9225  C  CB  . PRO H  1 88  ? 42.085  -11.245 -16.322 1.00 23.47  ? 88  PRO H CB  1 
ATOM   9226  C  CG  . PRO H  1 88  ? 43.534  -11.610 -16.436 1.00 27.80  ? 88  PRO H CG  1 
ATOM   9227  C  CD  . PRO H  1 88  ? 44.167  -11.298 -15.093 1.00 19.10  ? 88  PRO H CD  1 
ATOM   9228  N  N   . TYR H  1 89  ? 39.888  -13.038 -14.711 1.00 15.23  ? 89  TYR H N   1 
ATOM   9229  C  CA  . TYR H  1 89  ? 39.288  -14.341 -14.543 1.00 15.54  ? 89  TYR H CA  1 
ATOM   9230  C  C   . TYR H  1 89  ? 39.009  -14.857 -15.926 1.00 30.41  ? 89  TYR H C   1 
ATOM   9231  O  O   . TYR H  1 89  ? 38.150  -14.332 -16.607 1.00 35.47  ? 89  TYR H O   1 
ATOM   9232  C  CB  . TYR H  1 89  ? 38.013  -14.207 -13.741 1.00 8.50   ? 89  TYR H CB  1 
ATOM   9233  C  CG  . TYR H  1 89  ? 37.442  -15.536 -13.373 1.00 10.05  ? 89  TYR H CG  1 
ATOM   9234  C  CD1 . TYR H  1 89  ? 37.811  -16.177 -12.197 1.00 8.15   ? 89  TYR H CD1 1 
ATOM   9235  C  CD2 . TYR H  1 89  ? 36.500  -16.145 -14.192 1.00 13.85  ? 89  TYR H CD2 1 
ATOM   9236  C  CE1 . TYR H  1 89  ? 37.230  -17.388 -11.847 1.00 9.30   ? 89  TYR H CE1 1 
ATOM   9237  C  CE2 . TYR H  1 89  ? 35.915  -17.366 -13.850 1.00 18.72  ? 89  TYR H CE2 1 
ATOM   9238  C  CZ  . TYR H  1 89  ? 36.294  -17.988 -12.679 1.00 20.23  ? 89  TYR H CZ  1 
ATOM   9239  O  OH  . TYR H  1 89  ? 35.720  -19.191 -12.323 1.00 31.53  ? 89  TYR H OH  1 
ATOM   9240  N  N   . THR H  1 90  ? 39.788  -15.831 -16.361 1.00 35.15  ? 90  THR H N   1 
ATOM   9241  C  CA  . THR H  1 90  ? 39.634  -16.408 -17.689 1.00 38.42  ? 90  THR H CA  1 
ATOM   9242  C  C   . THR H  1 90  ? 39.146  -17.841 -17.599 1.00 47.88  ? 90  THR H C   1 
ATOM   9243  O  O   . THR H  1 90  ? 38.000  -18.172 -17.918 1.00 48.27  ? 90  THR H O   1 
ATOM   9244  C  CB  . THR H  1 90  ? 40.992  -16.423 -18.361 1.00 50.85  ? 90  THR H CB  1 
ATOM   9245  O  OG1 . THR H  1 90  ? 41.920  -17.014 -17.496 1.00 57.14  ? 90  THR H OG1 1 
ATOM   9246  C  CG2 . THR H  1 90  ? 41.434  -14.999 -18.570 1.00 51.68  ? 90  THR H CG2 1 
ATOM   9247  N  N   . LYS H  1 91  ? 40.076  -18.710 -17.227 1.00 50.59  ? 91  LYS H N   1 
ATOM   9248  C  CA  . LYS H  1 91  ? 39.723  -20.105 -17.047 1.00 56.03  ? 91  LYS H CA  1 
ATOM   9249  C  C   . LYS H  1 91  ? 39.026  -20.190 -15.695 1.00 52.18  ? 91  LYS H C   1 
ATOM   9250  O  O   . LYS H  1 91  ? 39.498  -19.611 -14.701 1.00 43.41  ? 91  LYS H O   1 
ATOM   9251  C  CB  . LYS H  1 91  ? 40.943  -21.041 -17.155 1.00 65.86  ? 91  LYS H CB  1 
ATOM   9252  C  CG  . LYS H  1 91  ? 41.306  -21.381 -18.603 0.00 100.00 ? 91  LYS H CG  1 
ATOM   9253  C  CD  . LYS H  1 91  ? 42.054  -22.712 -18.754 0.00 100.00 ? 91  LYS H CD  1 
ATOM   9254  C  CE  . LYS H  1 91  ? 42.033  -23.230 -20.196 0.00 100.00 ? 91  LYS H CE  1 
ATOM   9255  N  NZ  . LYS H  1 91  ? 42.911  -24.390 -20.420 0.00 100.00 ? 91  LYS H NZ  1 
ATOM   9256  N  N   . PRO H  1 92  ? 37.880  -20.865 -15.614 1.00 52.59  ? 92  PRO H N   1 
ATOM   9257  C  CA  . PRO H  1 92  ? 37.122  -20.946 -14.381 1.00 52.81  ? 92  PRO H CA  1 
ATOM   9258  C  C   . PRO H  1 92  ? 37.887  -21.643 -13.307 1.00 50.91  ? 92  PRO H C   1 
ATOM   9259  O  O   . PRO H  1 92  ? 38.791  -22.476 -13.610 1.00 64.58  ? 92  PRO H O   1 
ATOM   9260  C  CB  . PRO H  1 92  ? 35.894  -21.733 -14.752 1.00 55.23  ? 92  PRO H CB  1 
ATOM   9261  C  CG  . PRO H  1 92  ? 36.013  -22.106 -16.217 1.00 71.90  ? 92  PRO H CG  1 
ATOM   9262  C  CD  . PRO H  1 92  ? 37.314  -21.592 -16.744 1.00 62.49  ? 92  PRO H CD  1 
ATOM   9263  N  N   . LYS H  1 93  ? 37.527  -21.314 -12.095 1.00 27.73  ? 93  LYS H N   1 
ATOM   9264  C  CA  . LYS H  1 93  ? 38.154  -21.920 -10.945 1.00 16.06  ? 93  LYS H CA  1 
ATOM   9265  C  C   . LYS H  1 93  ? 37.102  -22.435 -9.993  1.00 18.34  ? 93  LYS H C   1 
ATOM   9266  O  O   . LYS H  1 93  ? 35.921  -22.078 -10.084 1.00 19.00  ? 93  LYS H O   1 
ATOM   9267  C  CB  . LYS H  1 93  ? 39.050  -20.917 -10.232 1.00 17.15  ? 93  LYS H CB  1 
ATOM   9268  C  CG  . LYS H  1 93  ? 40.171  -20.388 -11.127 1.00 16.53  ? 93  LYS H CG  1 
ATOM   9269  C  CD  . LYS H  1 93  ? 40.566  -18.948 -10.792 1.00 26.91  ? 93  LYS H CD  1 
ATOM   9270  C  CE  . LYS H  1 93  ? 41.342  -18.827 -9.479  1.00 67.53  ? 93  LYS H CE  1 
ATOM   9271  N  NZ  . LYS H  1 93  ? 41.916  -17.485 -9.258  1.00 58.80  ? 93  LYS H NZ  1 
ATOM   9272  N  N   . THR H  1 94  ? 37.620  -23.245 -9.156  1.00 22.05  ? 94  THR H N   1 
ATOM   9273  C  CA  . THR H  1 94  ? 36.921  -23.913 -8.099  1.00 22.83  ? 94  THR H CA  1 
ATOM   9274  C  C   . THR H  1 94  ? 36.773  -22.950 -6.946  1.00 28.26  ? 94  THR H C   1 
ATOM   9275  O  O   . THR H  1 94  ? 37.504  -21.966 -6.845  1.00 34.39  ? 94  THR H O   1 
ATOM   9276  C  CB  . THR H  1 94  ? 37.885  -25.018 -7.683  1.00 19.99  ? 94  THR H CB  1 
ATOM   9277  O  OG1 . THR H  1 94  ? 37.570  -26.215 -8.353  1.00 25.72  ? 94  THR H OG1 1 
ATOM   9278  C  CG2 . THR H  1 94  ? 37.916  -25.261 -6.186  1.00 1.00   ? 94  THR H CG2 1 
ATOM   9279  N  N   . MET H  1 95  ? 35.828  -23.306 -6.082  1.00 15.99  ? 95  MET H N   1 
ATOM   9280  C  CA  . MET H  1 95  ? 35.509  -22.520 -4.908  1.00 20.53  ? 95  MET H CA  1 
ATOM   9281  C  C   . MET H  1 95  ? 36.752  -22.568 -4.033  1.00 21.62  ? 95  MET H C   1 
ATOM   9282  O  O   . MET H  1 95  ? 37.220  -21.541 -3.538  1.00 22.29  ? 95  MET H O   1 
ATOM   9283  C  CB  . MET H  1 95  ? 34.255  -23.028 -4.176  1.00 24.99  ? 95  MET H CB  1 
ATOM   9284  C  CG  . MET H  1 95  ? 33.736  -22.060 -3.094  1.00 30.76  ? 95  MET H CG  1 
ATOM   9285  S  SD  . MET H  1 95  ? 33.097  -20.427 -3.537  1.00 32.78  ? 95  MET H SD  1 
ATOM   9286  C  CE  . MET H  1 95  ? 31.460  -20.982 -4.142  1.00 26.17  ? 95  MET H CE  1 
ATOM   9287  N  N   . ASP H  1 96  ? 37.331  -23.748 -3.906  1.00 20.85  ? 96  ASP H N   1 
ATOM   9288  C  CA  . ASP H  1 96  ? 38.563  -23.928 -3.150  1.00 25.09  ? 96  ASP H CA  1 
ATOM   9289  C  C   . ASP H  1 96  ? 39.720  -23.135 -3.720  1.00 15.30  ? 96  ASP H C   1 
ATOM   9290  O  O   . ASP H  1 96  ? 40.430  -22.472 -2.984  1.00 18.40  ? 96  ASP H O   1 
ATOM   9291  C  CB  . ASP H  1 96  ? 38.932  -25.404 -3.006  1.00 28.83  ? 96  ASP H CB  1 
ATOM   9292  C  CG  . ASP H  1 96  ? 38.059  -26.114 -1.997  1.00 56.92  ? 96  ASP H CG  1 
ATOM   9293  O  OD1 . ASP H  1 96  ? 37.109  -25.466 -1.512  1.00 65.89  ? 96  ASP H OD1 1 
ATOM   9294  O  OD2 . ASP H  1 96  ? 38.379  -27.261 -1.613  1.00 59.44  ? 96  ASP H OD2 1 
ATOM   9295  N  N   . GLN H  1 97  ? 39.834  -23.107 -5.040  1.00 8.25   ? 97  GLN H N   1 
ATOM   9296  C  CA  . GLN H  1 97  ? 40.881  -22.313 -5.626  1.00 14.59  ? 97  GLN H CA  1 
ATOM   9297  C  C   . GLN H  1 97  ? 40.714  -20.841 -5.299  1.00 19.69  ? 97  GLN H C   1 
ATOM   9298  O  O   . GLN H  1 97  ? 41.638  -20.120 -4.993  1.00 14.76  ? 97  GLN H O   1 
ATOM   9299  C  CB  . GLN H  1 97  ? 40.845  -22.467 -7.143  1.00 22.32  ? 97  GLN H CB  1 
ATOM   9300  C  CG  . GLN H  1 97  ? 40.964  -23.890 -7.690  1.00 41.99  ? 97  GLN H CG  1 
ATOM   9301  C  CD  . GLN H  1 97  ? 40.975  -23.927 -9.214  1.00 61.09  ? 97  GLN H CD  1 
ATOM   9302  O  OE1 . GLN H  1 97  ? 40.305  -24.759 -9.829  1.00 73.60  ? 97  GLN H OE1 1 
ATOM   9303  N  NE2 . GLN H  1 97  ? 41.747  -23.033 -9.829  1.00 91.33  ? 97  GLN H NE2 1 
ATOM   9304  N  N   . LEU H  1 98  ? 39.495  -20.342 -5.403  1.00 13.19  ? 98  LEU H N   1 
ATOM   9305  C  CA  . LEU H  1 98  ? 39.220  -18.942 -5.089  1.00 13.07  ? 98  LEU H CA  1 
ATOM   9306  C  C   . LEU H  1 98  ? 39.547  -18.678 -3.623  1.00 10.11  ? 98  LEU H C   1 
ATOM   9307  O  O   . LEU H  1 98  ? 40.261  -17.740 -3.314  1.00 8.37   ? 98  LEU H O   1 
ATOM   9308  C  CB  . LEU H  1 98  ? 37.742  -18.674 -5.348  1.00 11.06  ? 98  LEU H CB  1 
ATOM   9309  C  CG  . LEU H  1 98  ? 37.436  -18.850 -6.840  1.00 11.61  ? 98  LEU H CG  1 
ATOM   9310  C  CD1 . LEU H  1 98  ? 35.953  -18.664 -7.241  1.00 9.88   ? 98  LEU H CD1 1 
ATOM   9311  C  CD2 . LEU H  1 98  ? 38.257  -17.802 -7.558  1.00 1.92   ? 98  LEU H CD2 1 
ATOM   9312  N  N   . MET H  1 99  ? 39.046  -19.496 -2.699  1.00 3.52   ? 99  MET H N   1 
ATOM   9313  C  CA  . MET H  1 99  ? 39.325  -19.324 -1.289  1.00 2.17   ? 99  MET H CA  1 
ATOM   9314  C  C   . MET H  1 99  ? 40.819  -19.351 -1.029  1.00 10.74  ? 99  MET H C   1 
ATOM   9315  O  O   . MET H  1 99  ? 41.317  -18.558 -0.235  1.00 13.29  ? 99  MET H O   1 
ATOM   9316  C  CB  . MET H  1 99  ? 38.623  -20.424 -0.494  1.00 5.05   ? 99  MET H CB  1 
ATOM   9317  C  CG  . MET H  1 99  ? 37.109  -20.217 -0.437  1.00 11.54  ? 99  MET H CG  1 
ATOM   9318  S  SD  . MET H  1 99  ? 36.603  -18.479 -0.018  1.00 16.07  ? 99  MET H SD  1 
ATOM   9319  C  CE  . MET H  1 99  ? 36.568  -17.730 -1.537  1.00 11.53  ? 99  MET H CE  1 
ATOM   9320  N  N   . GLU H  1 100 ? 41.538  -20.216 -1.741  1.00 11.78  ? 100 GLU H N   1 
ATOM   9321  C  CA  . GLU H  1 100 ? 42.983  -20.296 -1.587  1.00 12.23  ? 100 GLU H CA  1 
ATOM   9322  C  C   . GLU H  1 100 ? 43.649  -19.023 -2.039  1.00 10.75  ? 100 GLU H C   1 
ATOM   9323  O  O   . GLU H  1 100 ? 44.588  -18.565 -1.412  1.00 12.09  ? 100 GLU H O   1 
ATOM   9324  C  CB  . GLU H  1 100 ? 43.593  -21.517 -2.269  1.00 14.44  ? 100 GLU H CB  1 
ATOM   9325  C  CG  . GLU H  1 100 ? 43.369  -22.803 -1.465  1.00 36.60  ? 100 GLU H CG  1 
ATOM   9326  C  CD  . GLU H  1 100 ? 43.508  -24.096 -2.258  0.00 100.00 ? 100 GLU H CD  1 
ATOM   9327  O  OE1 . GLU H  1 100 ? 43.539  -24.077 -3.502  1.00 98.32  ? 100 GLU H OE1 1 
ATOM   9328  O  OE2 . GLU H  1 100 ? 43.570  -25.168 -1.633  0.00 100.00 ? 100 GLU H OE2 1 
ATOM   9329  N  N   . ASP H  1 101 ? 43.108  -18.396 -3.067  1.00 10.95  ? 101 ASP H N   1 
ATOM   9330  C  CA  . ASP H  1 101 ? 43.655  -17.115 -3.480  1.00 18.19  ? 101 ASP H CA  1 
ATOM   9331  C  C   . ASP H  1 101 ? 43.351  -16.052 -2.399  1.00 16.08  ? 101 ASP H C   1 
ATOM   9332  O  O   . ASP H  1 101 ? 44.165  -15.218 -2.026  1.00 12.38  ? 101 ASP H O   1 
ATOM   9333  C  CB  . ASP H  1 101 ? 43.070  -16.758 -4.861  1.00 26.59  ? 101 ASP H CB  1 
ATOM   9334  C  CG  . ASP H  1 101 ? 43.559  -15.410 -5.450  1.00 70.63  ? 101 ASP H CG  1 
ATOM   9335  O  OD1 . ASP H  1 101 ? 44.587  -14.857 -4.997  1.00 74.56  ? 101 ASP H OD1 1 
ATOM   9336  O  OD2 . ASP H  1 101 ? 42.942  -14.911 -6.424  1.00 79.54  ? 101 ASP H OD2 1 
ATOM   9337  N  N   . LEU H  1 102 ? 42.160  -16.130 -1.832  1.00 9.03   ? 102 LEU H N   1 
ATOM   9338  C  CA  . LEU H  1 102 ? 41.736  -15.180 -0.821  1.00 6.82   ? 102 LEU H CA  1 
ATOM   9339  C  C   . LEU H  1 102 ? 42.662  -15.342 0.369   1.00 7.94   ? 102 LEU H C   1 
ATOM   9340  O  O   . LEU H  1 102 ? 43.284  -14.398 0.837   1.00 8.69   ? 102 LEU H O   1 
ATOM   9341  C  CB  . LEU H  1 102 ? 40.357  -15.636 -0.395  1.00 5.19   ? 102 LEU H CB  1 
ATOM   9342  C  CG  . LEU H  1 102 ? 39.472  -14.551 0.204   1.00 14.43  ? 102 LEU H CG  1 
ATOM   9343  C  CD1 . LEU H  1 102 ? 38.652  -15.138 1.321   1.00 8.94   ? 102 LEU H CD1 1 
ATOM   9344  C  CD2 . LEU H  1 102 ? 40.263  -13.330 0.634   1.00 25.08  ? 102 LEU H CD2 1 
ATOM   9345  N  N   . VAL H  1 103 ? 42.797  -16.582 0.812   1.00 1.00   ? 103 VAL H N   1 
ATOM   9346  C  CA  . VAL H  1 103 ? 43.642  -16.857 1.951   1.00 3.94   ? 103 VAL H CA  1 
ATOM   9347  C  C   . VAL H  1 103 ? 45.085  -16.417 1.786   1.00 12.05  ? 103 VAL H C   1 
ATOM   9348  O  O   . VAL H  1 103 ? 45.689  -15.837 2.691   1.00 7.05   ? 103 VAL H O   1 
ATOM   9349  C  CB  . VAL H  1 103 ? 43.592  -18.315 2.259   1.00 12.51  ? 103 VAL H CB  1 
ATOM   9350  C  CG1 . VAL H  1 103 ? 44.724  -18.606 3.202   1.00 13.87  ? 103 VAL H CG1 1 
ATOM   9351  C  CG2 . VAL H  1 103 ? 42.329  -18.547 3.021   1.00 13.13  ? 103 VAL H CG2 1 
ATOM   9352  N  N   . GLY H  1 104 ? 45.618  -16.642 0.593   1.00 5.99   ? 104 GLY H N   1 
ATOM   9353  C  CA  . GLY H  1 104 ? 46.979  -16.252 0.278   1.00 3.64   ? 104 GLY H CA  1 
ATOM   9354  C  C   . GLY H  1 104 ? 47.130  -14.740 0.432   1.00 8.48   ? 104 GLY H C   1 
ATOM   9355  O  O   . GLY H  1 104 ? 48.093  -14.227 0.997   1.00 11.11  ? 104 GLY H O   1 
ATOM   9356  N  N   . THR H  1 105 ? 46.170  -14.000 -0.084  1.00 6.06   ? 105 THR H N   1 
ATOM   9357  C  CA  . THR H  1 105 ? 46.274  -12.558 0.040   1.00 5.48   ? 105 THR H CA  1 
ATOM   9358  C  C   . THR H  1 105 ? 46.155  -12.141 1.492   1.00 3.74   ? 105 THR H C   1 
ATOM   9359  O  O   . THR H  1 105 ? 46.827  -11.222 1.929   1.00 7.11   ? 105 THR H O   1 
ATOM   9360  C  CB  . THR H  1 105 ? 45.195  -11.887 -0.789  1.00 11.56  ? 105 THR H CB  1 
ATOM   9361  O  OG1 . THR H  1 105 ? 45.357  -12.310 -2.141  1.00 15.84  ? 105 THR H OG1 1 
ATOM   9362  C  CG2 . THR H  1 105 ? 45.362  -10.403 -0.690  1.00 7.63   ? 105 THR H CG2 1 
ATOM   9363  N  N   . LEU H  1 106 ? 45.332  -12.850 2.256   1.00 2.18   ? 106 LEU H N   1 
ATOM   9364  C  CA  . LEU H  1 106 ? 45.186  -12.491 3.641   1.00 2.56   ? 106 LEU H CA  1 
ATOM   9365  C  C   . LEU H  1 106 ? 46.535  -12.702 4.277   1.00 11.22  ? 106 LEU H C   1 
ATOM   9366  O  O   . LEU H  1 106 ? 47.028  -11.839 5.009   1.00 9.53   ? 106 LEU H O   1 
ATOM   9367  C  CB  . LEU H  1 106 ? 44.093  -13.309 4.312   1.00 1.65   ? 106 LEU H CB  1 
ATOM   9368  C  CG  . LEU H  1 106 ? 42.651  -12.922 3.979   1.00 4.69   ? 106 LEU H CG  1 
ATOM   9369  C  CD1 . LEU H  1 106 ? 41.697  -13.970 4.492   1.00 1.25   ? 106 LEU H CD1 1 
ATOM   9370  C  CD2 . LEU H  1 106 ? 42.204  -11.575 4.493   1.00 1.56   ? 106 LEU H CD2 1 
ATOM   9371  N  N   . GLU H  1 107 ? 47.153  -13.834 3.969   1.00 4.55   ? 107 GLU H N   1 
ATOM   9372  C  CA  . GLU H  1 107 ? 48.461  -14.087 4.550   1.00 5.54   ? 107 GLU H CA  1 
ATOM   9373  C  C   . GLU H  1 107 ? 49.467  -13.007 4.216   1.00 10.51  ? 107 GLU H C   1 
ATOM   9374  O  O   . GLU H  1 107 ? 50.194  -12.523 5.072   1.00 7.99   ? 107 GLU H O   1 
ATOM   9375  C  CB  . GLU H  1 107 ? 48.946  -15.487 4.213   1.00 5.23   ? 107 GLU H CB  1 
ATOM   9376  C  CG  . GLU H  1 107 ? 48.229  -16.573 4.966   1.00 15.68  ? 107 GLU H CG  1 
ATOM   9377  C  CD  . GLU H  1 107 ? 48.492  -17.960 4.398   1.00 28.28  ? 107 GLU H CD  1 
ATOM   9378  O  OE1 . GLU H  1 107 ? 48.723  -18.095 3.168   1.00 39.64  ? 107 GLU H OE1 1 
ATOM   9379  O  OE2 . GLU H  1 107 ? 48.469  -18.924 5.196   1.00 29.84  ? 107 GLU H OE2 1 
ATOM   9380  N  N   . LEU H  1 108 ? 49.433  -12.546 2.968   1.00 4.97   ? 108 LEU H N   1 
ATOM   9381  C  CA  . LEU H  1 108 ? 50.352  -11.498 2.573   1.00 7.01   ? 108 LEU H CA  1 
ATOM   9382  C  C   . LEU H  1 108 ? 50.070  -10.263 3.423   1.00 10.91  ? 108 LEU H C   1 
ATOM   9383  O  O   . LEU H  1 108 ? 51.005  -9.652  3.953   1.00 11.86  ? 108 LEU H O   1 
ATOM   9384  C  CB  . LEU H  1 108 ? 50.229  -11.203 1.079   1.00 9.86   ? 108 LEU H CB  1 
ATOM   9385  C  CG  . LEU H  1 108 ? 51.030  -10.023 0.519   1.00 17.99  ? 108 LEU H CG  1 
ATOM   9386  C  CD1 . LEU H  1 108 ? 51.064  -10.177 -0.990  1.00 15.26  ? 108 LEU H CD1 1 
ATOM   9387  C  CD2 . LEU H  1 108 ? 50.475  -8.644  0.873   1.00 24.35  ? 108 LEU H CD2 1 
ATOM   9388  N  N   . LEU H  1 109 ? 48.800  -9.889  3.539   1.00 4.58   ? 109 LEU H N   1 
ATOM   9389  C  CA  . LEU H  1 109 ? 48.500  -8.695  4.320   1.00 6.87   ? 109 LEU H CA  1 
ATOM   9390  C  C   . LEU H  1 109 ? 48.943  -8.847  5.781   1.00 7.64   ? 109 LEU H C   1 
ATOM   9391  O  O   . LEU H  1 109 ? 49.534  -7.954  6.376   1.00 11.58  ? 109 LEU H O   1 
ATOM   9392  C  CB  . LEU H  1 109 ? 47.014  -8.345  4.226   1.00 5.15   ? 109 LEU H CB  1 
ATOM   9393  C  CG  . LEU H  1 109 ? 46.721  -7.868  2.807   1.00 10.69  ? 109 LEU H CG  1 
ATOM   9394  C  CD1 . LEU H  1 109 ? 45.206  -7.880  2.703   1.00 11.81  ? 109 LEU H CD1 1 
ATOM   9395  C  CD2 . LEU H  1 109 ? 47.225  -6.444  2.700   1.00 7.01   ? 109 LEU H CD2 1 
ATOM   9396  N  N   . ARG H  1 110 ? 48.731  -10.033 6.334   1.00 2.28   ? 110 ARG H N   1 
ATOM   9397  C  CA  . ARG H  1 110 ? 49.145  -10.320 7.706   1.00 4.43   ? 110 ARG H CA  1 
ATOM   9398  C  C   . ARG H  1 110 ? 50.629  -10.073 7.890   1.00 10.65  ? 110 ARG H C   1 
ATOM   9399  O  O   . ARG H  1 110 ? 51.074  -9.350  8.778   1.00 8.74   ? 110 ARG H O   1 
ATOM   9400  C  CB  . ARG H  1 110 ? 48.989  -11.810 7.989   1.00 1.70   ? 110 ARG H CB  1 
ATOM   9401  C  CG  . ARG H  1 110 ? 49.340  -12.138 9.428   1.00 5.95   ? 110 ARG H CG  1 
ATOM   9402  C  CD  . ARG H  1 110 ? 49.355  -13.616 9.661   1.00 5.17   ? 110 ARG H CD  1 
ATOM   9403  N  NE  . ARG H  1 110 ? 50.203  -14.226 8.668   1.00 8.92   ? 110 ARG H NE  1 
ATOM   9404  C  CZ  . ARG H  1 110 ? 50.181  -15.506 8.346   1.00 17.05  ? 110 ARG H CZ  1 
ATOM   9405  N  NH1 . ARG H  1 110 ? 49.338  -16.337 8.937   1.00 7.89   ? 110 ARG H NH1 1 
ATOM   9406  N  NH2 . ARG H  1 110 ? 50.986  -15.941 7.394   1.00 13.55  ? 110 ARG H NH2 1 
ATOM   9407  N  N   . ASP H  1 111 ? 51.408  -10.697 7.023   1.00 8.57   ? 111 ASP H N   1 
ATOM   9408  C  CA  . ASP H  1 111 ? 52.850  -10.555 7.103   1.00 10.85  ? 111 ASP H CA  1 
ATOM   9409  C  C   . ASP H  1 111 ? 53.281  -9.115  6.871   1.00 9.31   ? 111 ASP H C   1 
ATOM   9410  O  O   . ASP H  1 111 ? 54.045  -8.596  7.659   1.00 10.04  ? 111 ASP H O   1 
ATOM   9411  C  CB  . ASP H  1 111 ? 53.488  -11.563 6.154   1.00 19.37  ? 111 ASP H CB  1 
ATOM   9412  C  CG  . ASP H  1 111 ? 53.110  -13.017 6.498   1.00 33.68  ? 111 ASP H CG  1 
ATOM   9413  O  OD1 . ASP H  1 111 ? 52.832  -13.313 7.688   1.00 24.22  ? 111 ASP H OD1 1 
ATOM   9414  O  OD2 . ASP H  1 111 ? 53.069  -13.891 5.599   1.00 58.81  ? 111 ASP H OD2 1 
ATOM   9415  N  N   . GLU H  1 112 ? 52.732  -8.400  5.891   1.00 3.88   ? 112 GLU H N   1 
ATOM   9416  C  CA  . GLU H  1 112 ? 53.124  -7.007  5.747   1.00 3.02   ? 112 GLU H CA  1 
ATOM   9417  C  C   . GLU H  1 112 ? 52.743  -6.140  6.934   1.00 11.25  ? 112 GLU H C   1 
ATOM   9418  O  O   . GLU H  1 112 ? 53.499  -5.264  7.347   1.00 12.27  ? 112 GLU H O   1 
ATOM   9419  C  CB  . GLU H  1 112 ? 52.605  -6.408  4.448   1.00 4.79   ? 112 GLU H CB  1 
ATOM   9420  C  CG  . GLU H  1 112 ? 53.091  -7.205  3.257   1.00 23.13  ? 112 GLU H CG  1 
ATOM   9421  C  CD  . GLU H  1 112 ? 53.017  -6.458  1.935   1.00 35.95  ? 112 GLU H CD  1 
ATOM   9422  O  OE1 . GLU H  1 112 ? 52.568  -5.290  1.974   1.00 18.46  ? 112 GLU H OE1 1 
ATOM   9423  O  OE2 . GLU H  1 112 ? 53.450  -7.029  0.905   1.00 22.48  ? 112 GLU H OE2 1 
ATOM   9424  N  N   . TYR H  1 113 ? 51.556  -6.364  7.471   1.00 7.10   ? 113 TYR H N   1 
ATOM   9425  C  CA  . TYR H  1 113 ? 51.127  -5.596  8.637   1.00 6.33   ? 113 TYR H CA  1 
ATOM   9426  C  C   . TYR H  1 113 ? 52.107  -5.861  9.777   1.00 8.53   ? 113 TYR H C   1 
ATOM   9427  O  O   . TYR H  1 113 ? 52.479  -4.970  10.557  1.00 6.89   ? 113 TYR H O   1 
ATOM   9428  C  CB  . TYR H  1 113 ? 49.701  -5.949  9.076   1.00 3.84   ? 113 TYR H CB  1 
ATOM   9429  C  CG  . TYR H  1 113 ? 48.645  -5.227  8.289   1.00 9.65   ? 113 TYR H CG  1 
ATOM   9430  C  CD1 . TYR H  1 113 ? 48.869  -4.863  6.978   1.00 12.74  ? 113 TYR H CD1 1 
ATOM   9431  C  CD2 . TYR H  1 113 ? 47.383  -5.059  8.793   1.00 15.34  ? 113 TYR H CD2 1 
ATOM   9432  C  CE1 . TYR H  1 113 ? 47.880  -4.322  6.184   1.00 17.38  ? 113 TYR H CE1 1 
ATOM   9433  C  CE2 . TYR H  1 113 ? 46.390  -4.494  8.018   1.00 20.52  ? 113 TYR H CE2 1 
ATOM   9434  C  CZ  . TYR H  1 113 ? 46.643  -4.134  6.714   1.00 17.63  ? 113 TYR H CZ  1 
ATOM   9435  O  OH  . TYR H  1 113 ? 45.683  -3.555  5.941   1.00 17.68  ? 113 TYR H OH  1 
ATOM   9436  N  N   . LYS H  1 114 ? 52.617  -7.087  9.812   1.00 8.74   ? 114 LYS H N   1 
ATOM   9437  C  CA  . LYS H  1 114 ? 53.546  -7.373  10.889  1.00 10.98  ? 114 LYS H CA  1 
ATOM   9438  C  C   . LYS H  1 114 ? 54.771  -6.456  10.819  1.00 12.76  ? 114 LYS H C   1 
ATOM   9439  O  O   . LYS H  1 114 ? 55.224  -5.857  11.802  1.00 13.81  ? 114 LYS H O   1 
ATOM   9440  C  CB  . LYS H  1 114 ? 53.858  -8.859  10.846  1.00 13.43  ? 114 LYS H CB  1 
ATOM   9441  C  CG  . LYS H  1 114 ? 54.801  -9.283  11.945  1.00 47.91  ? 114 LYS H CG  1 
ATOM   9442  C  CD  . LYS H  1 114 ? 54.545  -8.472  13.203  1.00 65.75  ? 114 LYS H CD  1 
ATOM   9443  C  CE  . LYS H  1 114 ? 55.511  -8.838  14.324  1.00 72.49  ? 114 LYS H CE  1 
ATOM   9444  N  NZ  . LYS H  1 114 ? 55.275  -8.030  15.567  1.00 81.36  ? 114 LYS H NZ  1 
ATOM   9445  N  N   . GLN H  1 115 ? 55.228  -6.253  9.589   1.00 8.59   ? 115 GLN H N   1 
ATOM   9446  C  CA  . GLN H  1 115 ? 56.368  -5.386  9.314   1.00 10.75  ? 115 GLN H CA  1 
ATOM   9447  C  C   . GLN H  1 115 ? 55.996  -3.986  9.695   1.00 10.29  ? 115 GLN H C   1 
ATOM   9448  O  O   . GLN H  1 115 ? 56.835  -3.284  10.217  1.00 12.33  ? 115 GLN H O   1 
ATOM   9449  C  CB  . GLN H  1 115 ? 56.744  -5.254  7.837   1.00 13.02  ? 115 GLN H CB  1 
ATOM   9450  C  CG  . GLN H  1 115 ? 56.799  -6.469  6.910   1.00 65.05  ? 115 GLN H CG  1 
ATOM   9451  C  CD  . GLN H  1 115 ? 57.455  -7.661  7.544   1.00 99.92  ? 115 GLN H CD  1 
ATOM   9452  O  OE1 . GLN H  1 115 ? 58.259  -7.548  8.480   1.00 99.98  ? 115 GLN H OE1 1 
ATOM   9453  N  NE2 . GLN H  1 115 ? 57.068  -8.845  7.096   0.00 100.00 ? 115 GLN H NE2 1 
ATOM   9454  N  N   . GLY H  1 116 ? 54.796  -3.549  9.332   1.00 6.11   ? 116 GLY H N   1 
ATOM   9455  C  CA  . GLY H  1 116 ? 54.416  -2.171  9.650   1.00 2.72   ? 116 GLY H CA  1 
ATOM   9456  C  C   . GLY H  1 116 ? 54.290  -2.019  11.180  1.00 3.44   ? 116 GLY H C   1 
ATOM   9457  O  O   . GLY H  1 116 ? 54.570  -0.971  11.756  1.00 7.84   ? 116 GLY H O   1 
ATOM   9458  N  N   . ILE H  1 117 ? 53.882  -3.103  11.826  1.00 1.00   ? 117 ILE H N   1 
ATOM   9459  C  CA  . ILE H  1 117 ? 53.687  -3.013  13.248  1.00 5.82   ? 117 ILE H CA  1 
ATOM   9460  C  C   . ILE H  1 117 ? 55.044  -2.716  13.871  1.00 12.35  ? 117 ILE H C   1 
ATOM   9461  O  O   . ILE H  1 117 ? 55.198  -1.808  14.706  1.00 14.58  ? 117 ILE H O   1 
ATOM   9462  C  CB  . ILE H  1 117 ? 53.053  -4.297  13.776  1.00 4.44   ? 117 ILE H CB  1 
ATOM   9463  C  CG1 . ILE H  1 117 ? 51.592  -4.336  13.375  1.00 1.00   ? 117 ILE H CG1 1 
ATOM   9464  C  CG2 . ILE H  1 117 ? 53.179  -4.400  15.292  1.00 2.87   ? 117 ILE H CG2 1 
ATOM   9465  C  CD1 . ILE H  1 117 ? 50.989  -5.703  13.658  1.00 1.00   ? 117 ILE H CD1 1 
ATOM   9466  N  N   . GLU H  1 118 ? 56.055  -3.457  13.424  1.00 1.00   ? 118 GLU H N   1 
ATOM   9467  C  CA  . GLU H  1 118 ? 57.395  -3.211  13.949  1.00 15.05  ? 118 GLU H CA  1 
ATOM   9468  C  C   . GLU H  1 118 ? 57.952  -1.837  13.629  1.00 4.39   ? 118 GLU H C   1 
ATOM   9469  O  O   . GLU H  1 118 ? 58.482  -1.089  14.441  1.00 8.83   ? 118 GLU H O   1 
ATOM   9470  C  CB  . GLU H  1 118 ? 58.321  -4.209  13.271  1.00 13.12  ? 118 GLU H CB  1 
ATOM   9471  C  CG  . GLU H  1 118 ? 58.185  -5.618  13.822  1.00 28.05  ? 118 GLU H CG  1 
ATOM   9472  C  CD  . GLU H  1 118 ? 58.667  -5.639  15.231  0.00 100.00 ? 118 GLU H CD  1 
ATOM   9473  O  OE1 . GLU H  1 118 ? 59.814  -5.234  15.443  0.00 100.00 ? 118 GLU H OE1 1 
ATOM   9474  O  OE2 . GLU H  1 118 ? 57.863  -5.932  16.148  0.00 100.00 ? 118 GLU H OE2 1 
ATOM   9475  N  N   . LEU H  1 119 ? 57.792  -1.470  12.372  1.00 3.12   ? 119 LEU H N   1 
ATOM   9476  C  CA  . LEU H  1 119 ? 58.312  -0.195  11.914  1.00 5.85   ? 119 LEU H CA  1 
ATOM   9477  C  C   . LEU H  1 119 ? 57.671  0.994   12.621  1.00 6.14   ? 119 LEU H C   1 
ATOM   9478  O  O   . LEU H  1 119 ? 58.355  1.956   13.003  1.00 6.78   ? 119 LEU H O   1 
ATOM   9479  C  CB  . LEU H  1 119 ? 58.021  -0.146  10.412  1.00 9.70   ? 119 LEU H CB  1 
ATOM   9480  C  CG  . LEU H  1 119 ? 58.053  1.210   9.723   1.00 21.61  ? 119 LEU H CG  1 
ATOM   9481  C  CD1 . LEU H  1 119 ? 58.058  1.058   8.192   1.00 15.94  ? 119 LEU H CD1 1 
ATOM   9482  C  CD2 . LEU H  1 119 ? 56.837  2.076   10.044  1.00 33.40  ? 119 LEU H CD2 1 
ATOM   9483  N  N   . THR H  1 120 ? 56.377  0.906   12.766  1.00 3.24   ? 120 THR H N   1 
ATOM   9484  C  CA  . THR H  1 120 ? 55.588  1.957   13.404  1.00 9.66   ? 120 THR H CA  1 
ATOM   9485  C  C   . THR H  1 120 ? 55.987  2.047   14.882  1.00 2.85   ? 120 THR H C   1 
ATOM   9486  O  O   . THR H  1 120 ? 56.011  3.120   15.492  1.00 9.68   ? 120 THR H O   1 
ATOM   9487  C  CB  . THR H  1 120 ? 54.111  1.631   13.209  1.00 1.00   ? 120 THR H CB  1 
ATOM   9488  O  OG1 . THR H  1 120 ? 53.305  2.661   13.743  1.00 79.10  ? 120 THR H OG1 1 
ATOM   9489  C  CG2 . THR H  1 120 ? 53.698  0.316   13.865  1.00 6.37   ? 120 THR H CG2 1 
ATOM   9490  N  N   . ASP H  1 121 ? 56.307  0.912   15.437  1.00 1.00   ? 121 ASP H N   1 
ATOM   9491  C  CA  . ASP H  1 121 ? 56.755  0.835   16.822  1.00 1.00   ? 121 ASP H CA  1 
ATOM   9492  C  C   . ASP H  1 121 ? 58.149  1.467   16.906  1.00 13.98  ? 121 ASP H C   1 
ATOM   9493  O  O   . ASP H  1 121 ? 58.433  2.273   17.801  1.00 1.20   ? 121 ASP H O   1 
ATOM   9494  C  CB  . ASP H  1 121 ? 56.800  -0.645  17.207  1.00 1.00   ? 121 ASP H CB  1 
ATOM   9495  C  CG  . ASP H  1 121 ? 57.293  -0.899  18.622  1.00 22.89  ? 121 ASP H CG  1 
ATOM   9496  O  OD1 . ASP H  1 121 ? 56.992  -0.075  19.562  1.00 29.44  ? 121 ASP H OD1 1 
ATOM   9497  O  OD2 . ASP H  1 121 ? 58.006  -1.943  18.871  1.00 15.13  ? 121 ASP H OD2 1 
ATOM   9498  N  N   . LYS H  1 122 ? 59.023  1.063   15.987  1.00 19.58  ? 122 LYS H N   1 
ATOM   9499  C  CA  . LYS H  1 122 ? 60.392  1.555   16.022  1.00 15.93  ? 122 LYS H CA  1 
ATOM   9500  C  C   . LYS H  1 122 ? 60.371  3.084   15.932  1.00 27.67  ? 122 LYS H C   1 
ATOM   9501  O  O   . LYS H  1 122 ? 61.180  3.765   16.547  1.00 20.69  ? 122 LYS H O   1 
ATOM   9502  C  CB  . LYS H  1 122 ? 61.283  0.909   14.949  1.00 1.80   ? 122 LYS H CB  1 
ATOM   9503  C  CG  . LYS H  1 122 ? 61.390  -0.623  14.871  1.00 90.05  ? 122 LYS H CG  1 
ATOM   9504  C  CD  . LYS H  1 122 ? 62.277  -1.070  13.692  1.00 60.44  ? 122 LYS H CD  1 
ATOM   9505  C  CE  . LYS H  1 122 ? 62.854  -2.467  13.761  1.00 78.09  ? 122 LYS H CE  1 
ATOM   9506  N  NZ  . LYS H  1 122 ? 62.022  -3.607  13.233  1.00 73.42  ? 122 LYS H NZ  1 
ATOM   9507  N  N   . GLU H  1 123 ? 59.414  3.605   15.158  1.00 13.98  ? 123 GLU H N   1 
ATOM   9508  C  CA  . GLU H  1 123 ? 59.276  5.033   14.957  1.00 16.59  ? 123 GLU H CA  1 
ATOM   9509  C  C   . GLU H  1 123 ? 58.422  5.783   16.004  1.00 23.58  ? 123 GLU H C   1 
ATOM   9510  O  O   . GLU H  1 123 ? 58.259  7.013   15.911  1.00 10.33  ? 123 GLU H O   1 
ATOM   9511  C  CB  . GLU H  1 123 ? 58.745  5.393   13.558  1.00 21.04  ? 123 GLU H CB  1 
ATOM   9512  C  CG  . GLU H  1 123 ? 59.604  5.098   12.325  1.00 3.36   ? 123 GLU H CG  1 
ATOM   9513  C  CD  . GLU H  1 123 ? 58.934  5.449   10.982  0.00 100.00 ? 123 GLU H CD  1 
ATOM   9514  O  OE1 . GLU H  1 123 ? 58.244  6.461   10.882  1.00 11.63  ? 123 GLU H OE1 1 
ATOM   9515  O  OE2 . GLU H  1 123 ? 59.008  4.686   9.997   1.00 47.60  ? 123 GLU H OE2 1 
ATOM   9516  N  N   . GLY H  1 124 ? 57.909  5.067   17.009  1.00 1.00   ? 124 GLY H N   1 
ATOM   9517  C  CA  . GLY H  1 124 ? 57.095  5.788   18.018  1.00 1.00   ? 124 GLY H CA  1 
ATOM   9518  C  C   . GLY H  1 124 ? 55.707  6.271   17.564  1.00 1.00   ? 124 GLY H C   1 
ATOM   9519  O  O   . GLY H  1 124 ? 55.135  7.256   18.091  1.00 1.10   ? 124 GLY H O   1 
ATOM   9520  N  N   . ASP H  1 125 ? 55.187  5.658   16.509  1.00 22.31  ? 125 ASP H N   1 
ATOM   9521  C  CA  . ASP H  1 125 ? 53.882  6.135   16.099  1.00 11.48  ? 125 ASP H CA  1 
ATOM   9522  C  C   . ASP H  1 125 ? 52.941  5.159   16.738  1.00 10.97  ? 125 ASP H C   1 
ATOM   9523  O  O   . ASP H  1 125 ? 52.542  4.183   16.119  1.00 12.27  ? 125 ASP H O   1 
ATOM   9524  C  CB  . ASP H  1 125 ? 53.647  6.100   14.598  1.00 2.60   ? 125 ASP H CB  1 
ATOM   9525  C  CG  . ASP H  1 125 ? 52.309  6.675   14.210  1.00 22.18  ? 125 ASP H CG  1 
ATOM   9526  O  OD1 . ASP H  1 125 ? 51.387  6.835   15.024  1.00 21.26  ? 125 ASP H OD1 1 
ATOM   9527  O  OD2 . ASP H  1 125 ? 52.171  7.036   13.040  1.00 14.02  ? 125 ASP H OD2 1 
ATOM   9528  N  N   . ASP H  1 126 ? 52.640  5.413   17.999  1.00 6.88   ? 126 ASP H N   1 
ATOM   9529  C  CA  . ASP H  1 126 ? 51.750  4.563   18.780  1.00 10.38  ? 126 ASP H CA  1 
ATOM   9530  C  C   . ASP H  1 126 ? 50.382  4.374   18.141  1.00 7.39   ? 126 ASP H C   1 
ATOM   9531  O  O   . ASP H  1 126 ? 49.880  3.253   18.082  1.00 7.62   ? 126 ASP H O   1 
ATOM   9532  C  CB  . ASP H  1 126 ? 51.555  5.234   20.141  1.00 17.58  ? 126 ASP H CB  1 
ATOM   9533  C  CG  . ASP H  1 126 ? 52.866  5.648   20.741  1.00 39.51  ? 126 ASP H CG  1 
ATOM   9534  O  OD1 . ASP H  1 126 ? 53.634  4.727   21.096  1.00 40.07  ? 126 ASP H OD1 1 
ATOM   9535  O  OD2 . ASP H  1 126 ? 53.148  6.862   20.656  1.00 51.02  ? 126 ASP H OD2 1 
ATOM   9536  N  N   . VAL H  1 127 ? 49.804  5.465   17.644  1.00 2.07   ? 127 VAL H N   1 
ATOM   9537  C  CA  . VAL H  1 127 ? 48.495  5.373   17.020  1.00 1.45   ? 127 VAL H CA  1 
ATOM   9538  C  C   . VAL H  1 127 ? 48.521  4.412   15.807  1.00 9.21   ? 127 VAL H C   1 
ATOM   9539  O  O   . VAL H  1 127 ? 47.788  3.408   15.795  1.00 11.92  ? 127 VAL H O   1 
ATOM   9540  C  CB  . VAL H  1 127 ? 47.914  6.782   16.770  1.00 4.23   ? 127 VAL H CB  1 
ATOM   9541  C  CG1 . VAL H  1 127 ? 46.708  6.700   15.824  1.00 2.30   ? 127 VAL H CG1 1 
ATOM   9542  C  CG2 . VAL H  1 127 ? 47.479  7.426   18.096  1.00 1.32   ? 127 VAL H CG2 1 
ATOM   9543  N  N   . THR H  1 128 ? 49.374  4.682   14.824  1.00 2.49   ? 128 THR H N   1 
ATOM   9544  C  CA  . THR H  1 128 ? 49.398  3.805   13.673  1.00 1.00   ? 128 THR H CA  1 
ATOM   9545  C  C   . THR H  1 128 ? 49.700  2.381   14.078  1.00 5.89   ? 128 THR H C   1 
ATOM   9546  O  O   . THR H  1 128 ? 49.088  1.415   13.590  1.00 7.61   ? 128 THR H O   1 
ATOM   9547  C  CB  . THR H  1 128 ? 50.387  4.326   12.673  1.00 1.00   ? 128 THR H CB  1 
ATOM   9548  O  OG1 . THR H  1 128 ? 50.056  5.710   12.508  1.00 3.49   ? 128 THR H OG1 1 
ATOM   9549  C  CG2 . THR H  1 128 ? 50.297  3.512   11.380  1.00 1.00   ? 128 THR H CG2 1 
ATOM   9550  N  N   . ASN H  1 129 ? 50.554  2.257   15.081  1.00 1.22   ? 129 ASN H N   1 
ATOM   9551  C  CA  . ASN H  1 129 ? 50.883  0.927   15.597  1.00 1.13   ? 129 ASN H CA  1 
ATOM   9552  C  C   . ASN H  1 129 ? 49.602  0.165   16.054  1.00 3.42   ? 129 ASN H C   1 
ATOM   9553  O  O   . ASN H  1 129 ? 49.361  -1.010  15.703  1.00 3.46   ? 129 ASN H O   1 
ATOM   9554  C  CB  . ASN H  1 129 ? 51.926  1.108   16.708  1.00 1.20   ? 129 ASN H CB  1 
ATOM   9555  C  CG  . ASN H  1 129 ? 52.300  -0.192  17.386  1.00 7.30   ? 129 ASN H CG  1 
ATOM   9556  O  OD1 . ASN H  1 129 ? 51.859  -0.496  18.501  1.00 27.16  ? 129 ASN H OD1 1 
ATOM   9557  N  ND2 . ASN H  1 129 ? 53.076  -1.003  16.684  1.00 2.58   ? 129 ASN H ND2 1 
ATOM   9558  N  N   . ASP H  1 130 ? 48.770  0.842   16.851  1.00 1.04   ? 130 ASP H N   1 
ATOM   9559  C  CA  . ASP H  1 130 ? 47.557  0.205   17.319  1.00 5.14   ? 130 ASP H CA  1 
ATOM   9560  C  C   . ASP H  1 130 ? 46.582  -0.118  16.194  1.00 6.86   ? 130 ASP H C   1 
ATOM   9561  O  O   . ASP H  1 130 ? 45.954  -1.181  16.210  1.00 8.87   ? 130 ASP H O   1 
ATOM   9562  C  CB  . ASP H  1 130 ? 46.872  0.967   18.457  1.00 10.65  ? 130 ASP H CB  1 
ATOM   9563  C  CG  . ASP H  1 130 ? 47.139  0.374   19.851  1.00 57.49  ? 130 ASP H CG  1 
ATOM   9564  O  OD1 . ASP H  1 130 ? 48.131  -0.347  20.098  1.00 57.39  ? 130 ASP H OD1 1 
ATOM   9565  O  OD2 . ASP H  1 130 ? 46.302  0.629   20.737  1.00 94.16  ? 130 ASP H OD2 1 
ATOM   9566  N  N   . MET H  1 131 ? 46.497  0.759   15.194  1.00 2.61   ? 131 MET H N   1 
ATOM   9567  C  CA  . MET H  1 131 ? 45.563  0.480   14.120  1.00 6.56   ? 131 MET H CA  1 
ATOM   9568  C  C   . MET H  1 131 ? 45.925  -0.845  13.515  1.00 4.82   ? 131 MET H C   1 
ATOM   9569  O  O   . MET H  1 131 ? 45.062  -1.667  13.237  1.00 4.47   ? 131 MET H O   1 
ATOM   9570  C  CB  . MET H  1 131 ? 45.754  1.414   12.930  1.00 12.64  ? 131 MET H CB  1 
ATOM   9571  C  CG  . MET H  1 131 ? 45.081  2.757   12.854  1.00 17.84  ? 131 MET H CG  1 
ATOM   9572  S  SD  . MET H  1 131 ? 44.891  3.071   11.067  1.00 16.27  ? 131 MET H SD  1 
ATOM   9573  C  CE  . MET H  1 131 ? 46.449  2.631   10.230  1.00 12.90  ? 131 MET H CE  1 
ATOM   9574  N  N   . LEU H  1 132 ? 47.205  -0.941  13.165  1.00 2.09   ? 132 LEU H N   1 
ATOM   9575  C  CA  . LEU H  1 132 ? 47.683  -2.089  12.420  1.00 5.05   ? 132 LEU H CA  1 
ATOM   9576  C  C   . LEU H  1 132 ? 47.465  -3.349  13.223  1.00 6.66   ? 132 LEU H C   1 
ATOM   9577  O  O   . LEU H  1 132 ? 47.126  -4.410  12.691  1.00 6.96   ? 132 LEU H O   1 
ATOM   9578  C  CB  . LEU H  1 132 ? 49.151  -1.858  12.131  1.00 6.06   ? 132 LEU H CB  1 
ATOM   9579  C  CG  . LEU H  1 132 ? 49.569  -1.275  10.783  1.00 9.83   ? 132 LEU H CG  1 
ATOM   9580  C  CD1 . LEU H  1 132 ? 48.484  -0.701  9.918   1.00 6.86   ? 132 LEU H CD1 1 
ATOM   9581  C  CD2 . LEU H  1 132 ? 50.659  -0.259  10.990  1.00 6.67   ? 132 LEU H CD2 1 
ATOM   9582  N  N   . ILE H  1 133 ? 47.653  -3.224  14.528  1.00 1.90   ? 133 ILE H N   1 
ATOM   9583  C  CA  . ILE H  1 133 ? 47.469  -4.416  15.345  1.00 2.97   ? 133 ILE H CA  1 
ATOM   9584  C  C   . ILE H  1 133 ? 46.028  -4.893  15.286  1.00 8.53   ? 133 ILE H C   1 
ATOM   9585  O  O   . ILE H  1 133 ? 45.767  -6.092  15.110  1.00 6.61   ? 133 ILE H O   1 
ATOM   9586  C  CB  . ILE H  1 133 ? 47.859  -4.159  16.809  1.00 6.10   ? 133 ILE H CB  1 
ATOM   9587  C  CG1 . ILE H  1 133 ? 49.327  -3.756  16.845  1.00 9.17   ? 133 ILE H CG1 1 
ATOM   9588  C  CG2 . ILE H  1 133 ? 47.668  -5.388  17.688  1.00 1.00   ? 133 ILE H CG2 1 
ATOM   9589  C  CD1 . ILE H  1 133 ? 49.956  -3.653  18.249  1.00 1.00   ? 133 ILE H CD1 1 
ATOM   9590  N  N   . ALA H  1 134 ? 45.101  -3.949  15.421  1.00 5.11   ? 134 ALA H N   1 
ATOM   9591  C  CA  . ALA H  1 134 ? 43.670  -4.269  15.318  1.00 2.43   ? 134 ALA H CA  1 
ATOM   9592  C  C   . ALA H  1 134 ? 43.331  -4.849  13.940  1.00 6.00   ? 134 ALA H C   1 
ATOM   9593  O  O   . ALA H  1 134 ? 42.686  -5.886  13.881  1.00 9.39   ? 134 ALA H O   1 
ATOM   9594  C  CB  . ALA H  1 134 ? 42.828  -3.048  15.585  1.00 1.00   ? 134 ALA H CB  1 
ATOM   9595  N  N   . PHE H  1 135 ? 43.792  -4.265  12.836  1.00 1.00   ? 135 PHE H N   1 
ATOM   9596  C  CA  . PHE H  1 135 ? 43.507  -4.930  11.584  1.00 1.50   ? 135 PHE H CA  1 
ATOM   9597  C  C   . PHE H  1 135 ? 44.131  -6.329  11.605  1.00 4.52   ? 135 PHE H C   1 
ATOM   9598  O  O   . PHE H  1 135 ? 43.531  -7.254  11.086  1.00 7.66   ? 135 PHE H O   1 
ATOM   9599  C  CB  . PHE H  1 135 ? 44.173  -4.207  10.424  1.00 9.24   ? 135 PHE H CB  1 
ATOM   9600  C  CG  . PHE H  1 135 ? 43.686  -2.812  10.231  1.00 18.84  ? 135 PHE H CG  1 
ATOM   9601  C  CD1 . PHE H  1 135 ? 42.559  -2.366  10.893  1.00 22.76  ? 135 PHE H CD1 1 
ATOM   9602  C  CD2 . PHE H  1 135 ? 44.336  -1.942  9.382   1.00 21.89  ? 135 PHE H CD2 1 
ATOM   9603  C  CE1 . PHE H  1 135 ? 42.103  -1.080  10.712  1.00 21.10  ? 135 PHE H CE1 1 
ATOM   9604  C  CE2 . PHE H  1 135 ? 43.843  -0.670  9.180   1.00 17.84  ? 135 PHE H CE2 1 
ATOM   9605  C  CZ  . PHE H  1 135 ? 42.755  -0.230  9.867   1.00 12.68  ? 135 PHE H CZ  1 
ATOM   9606  N  N   . LYS H  1 136 ? 45.324  -6.504  12.169  1.00 3.36   ? 136 LYS H N   1 
ATOM   9607  C  CA  . LYS H  1 136 ? 45.932  -7.821  12.148  1.00 3.79   ? 136 LYS H CA  1 
ATOM   9608  C  C   . LYS H  1 136 ? 45.116  -8.863  12.924  1.00 3.52   ? 136 LYS H C   1 
ATOM   9609  O  O   . LYS H  1 136 ? 44.964  -10.042 12.551  1.00 2.44   ? 136 LYS H O   1 
ATOM   9610  C  CB  . LYS H  1 136 ? 47.382  -7.817  12.619  1.00 1.72   ? 136 LYS H CB  1 
ATOM   9611  C  CG  . LYS H  1 136 ? 47.987  -9.171  12.310  1.00 8.85   ? 136 LYS H CG  1 
ATOM   9612  C  CD  . LYS H  1 136 ? 49.507  -9.319  12.578  1.00 6.32   ? 136 LYS H CD  1 
ATOM   9613  C  CE  . LYS H  1 136 ? 49.855  -10.048 13.873  1.00 42.43  ? 136 LYS H CE  1 
ATOM   9614  N  NZ  . LYS H  1 136 ? 49.648  -11.522 13.775  1.00 14.15  ? 136 LYS H NZ  1 
ATOM   9615  N  N   . ALA H  1 137 ? 44.541  -8.393  14.022  1.00 1.00   ? 137 ALA H N   1 
ATOM   9616  C  CA  . ALA H  1 137 ? 43.708  -9.307  14.801  1.00 2.39   ? 137 ALA H CA  1 
ATOM   9617  C  C   . ALA H  1 137 ? 42.610  -9.898  13.938  1.00 7.79   ? 137 ALA H C   1 
ATOM   9618  O  O   . ALA H  1 137 ? 42.389  -11.099 13.922  1.00 7.14   ? 137 ALA H O   1 
ATOM   9619  C  CB  . ALA H  1 137 ? 43.071  -8.526  15.927  1.00 1.00   ? 137 ALA H CB  1 
ATOM   9620  N  N   . SER H  1 138 ? 41.942  -9.049  13.171  1.00 1.68   ? 138 SER H N   1 
ATOM   9621  C  CA  . SER H  1 138 ? 40.884  -9.534  12.317  1.00 1.00   ? 138 SER H CA  1 
ATOM   9622  C  C   . SER H  1 138 ? 41.369  -10.479 11.195  1.00 6.24   ? 138 SER H C   1 
ATOM   9623  O  O   . SER H  1 138 ? 40.782  -11.529 10.911  1.00 3.49   ? 138 SER H O   1 
ATOM   9624  C  CB  . SER H  1 138 ? 40.141  -8.309  11.803  1.00 1.00   ? 138 SER H CB  1 
ATOM   9625  O  OG  . SER H  1 138 ? 39.213  -8.712  10.811  1.00 35.86  ? 138 SER H OG  1 
ATOM   9626  N  N   . ILE H  1 139 ? 42.466  -10.108 10.549  1.00 2.31   ? 139 ILE H N   1 
ATOM   9627  C  CA  . ILE H  1 139 ? 42.986  -10.910 9.457   1.00 2.62   ? 139 ILE H CA  1 
ATOM   9628  C  C   . ILE H  1 139 ? 43.335  -12.276 9.966   1.00 5.11   ? 139 ILE H C   1 
ATOM   9629  O  O   . ILE H  1 139 ? 42.984  -13.288 9.378   1.00 5.39   ? 139 ILE H O   1 
ATOM   9630  C  CB  . ILE H  1 139 ? 44.223  -10.251 8.870   1.00 5.84   ? 139 ILE H CB  1 
ATOM   9631  C  CG1 . ILE H  1 139 ? 43.818  -8.989  8.070   1.00 5.27   ? 139 ILE H CG1 1 
ATOM   9632  C  CG2 . ILE H  1 139 ? 44.969  -11.254 8.012   1.00 1.88   ? 139 ILE H CG2 1 
ATOM   9633  C  CD1 . ILE H  1 139 ? 44.948  -8.061  7.747   1.00 5.29   ? 139 ILE H CD1 1 
ATOM   9634  N  N   . ASP H  1 140 ? 43.932  -12.342 11.140  1.00 1.50   ? 140 ASP H N   1 
ATOM   9635  C  CA  . ASP H  1 140 ? 44.264  -13.634 11.747  1.00 3.99   ? 140 ASP H CA  1 
ATOM   9636  C  C   . ASP H  1 140 ? 43.051  -14.506 11.941  1.00 6.03   ? 140 ASP H C   1 
ATOM   9637  O  O   . ASP H  1 140 ? 43.101  -15.704 11.713  1.00 7.22   ? 140 ASP H O   1 
ATOM   9638  C  CB  . ASP H  1 140 ? 44.919  -13.441 13.128  1.00 9.33   ? 140 ASP H CB  1 
ATOM   9639  C  CG  . ASP H  1 140 ? 46.353  -12.935 13.033  1.00 21.05  ? 140 ASP H CG  1 
ATOM   9640  O  OD1 . ASP H  1 140 ? 46.929  -13.025 11.916  1.00 12.67  ? 140 ASP H OD1 1 
ATOM   9641  O  OD2 . ASP H  1 140 ? 46.923  -12.478 14.053  1.00 13.39  ? 140 ASP H OD2 1 
ATOM   9642  N  N   . LYS H  1 141 ? 41.951  -13.899 12.370  1.00 4.55   ? 141 LYS H N   1 
ATOM   9643  C  CA  . LYS H  1 141 ? 40.726  -14.647 12.598  1.00 3.43   ? 141 LYS H CA  1 
ATOM   9644  C  C   . LYS H  1 141 ? 40.206  -15.138 11.270  1.00 2.49   ? 141 LYS H C   1 
ATOM   9645  O  O   . LYS H  1 141 ? 39.856  -16.305 11.182  1.00 6.14   ? 141 LYS H O   1 
ATOM   9646  C  CB  . LYS H  1 141 ? 39.685  -13.783 13.309  1.00 5.64   ? 141 LYS H CB  1 
ATOM   9647  C  CG  . LYS H  1 141 ? 38.398  -14.452 13.746  1.00 46.13  ? 141 LYS H CG  1 
ATOM   9648  C  CD  . LYS H  1 141 ? 37.422  -13.351 14.124  1.00 84.03  ? 141 LYS H CD  1 
ATOM   9649  C  CE  . LYS H  1 141 ? 36.020  -13.873 14.356  1.00 99.90  ? 141 LYS H CE  1 
ATOM   9650  N  NZ  . LYS H  1 141 ? 35.877  -14.686 15.592  0.00 100.00 ? 141 LYS H NZ  1 
ATOM   9651  N  N   . HIS H  1 142 ? 40.226  -14.274 10.257  1.00 3.04   ? 142 HIS H N   1 
ATOM   9652  C  CA  . HIS H  1 142 ? 39.772  -14.664 8.923   1.00 2.86   ? 142 HIS H CA  1 
ATOM   9653  C  C   . HIS H  1 142 ? 40.607  -15.815 8.432   1.00 5.51   ? 142 HIS H C   1 
ATOM   9654  O  O   . HIS H  1 142 ? 40.103  -16.792 7.846   1.00 5.24   ? 142 HIS H O   1 
ATOM   9655  C  CB  . HIS H  1 142 ? 39.929  -13.546 7.907   1.00 2.49   ? 142 HIS H CB  1 
ATOM   9656  C  CG  . HIS H  1 142 ? 38.948  -12.446 8.115   1.00 6.02   ? 142 HIS H CG  1 
ATOM   9657  N  ND1 . HIS H  1 142 ? 37.606  -12.691 8.291   1.00 8.42   ? 142 HIS H ND1 1 
ATOM   9658  C  CD2 . HIS H  1 142 ? 39.098  -11.105 8.147   1.00 7.07   ? 142 HIS H CD2 1 
ATOM   9659  C  CE1 . HIS H  1 142 ? 36.970  -11.545 8.429   1.00 5.99   ? 142 HIS H CE1 1 
ATOM   9660  N  NE2 . HIS H  1 142 ? 37.853  -10.566 8.352   1.00 5.42   ? 142 HIS H NE2 1 
ATOM   9661  N  N   . ILE H  1 143 ? 41.902  -15.670 8.665   1.00 1.00   ? 143 ILE H N   1 
ATOM   9662  C  CA  . ILE H  1 143 ? 42.786  -16.720 8.201   1.00 4.83   ? 143 ILE H CA  1 
ATOM   9663  C  C   . ILE H  1 143 ? 42.403  -18.041 8.867   1.00 8.70   ? 143 ILE H C   1 
ATOM   9664  O  O   . ILE H  1 143 ? 42.369  -19.106 8.225   1.00 3.10   ? 143 ILE H O   1 
ATOM   9665  C  CB  . ILE H  1 143 ? 44.268  -16.335 8.421   1.00 8.70   ? 143 ILE H CB  1 
ATOM   9666  C  CG1 . ILE H  1 143 ? 44.713  -15.226 7.476   1.00 3.04   ? 143 ILE H CG1 1 
ATOM   9667  C  CG2 . ILE H  1 143 ? 45.227  -17.513 8.156   1.00 6.74   ? 143 ILE H CG2 1 
ATOM   9668  C  CD1 . ILE H  1 143 ? 46.133  -14.836 7.758   1.00 1.00   ? 143 ILE H CD1 1 
ATOM   9669  N  N   . TRP H  1 144 ? 42.113  -18.012 10.163  1.00 1.92   ? 144 TRP H N   1 
ATOM   9670  C  CA  . TRP H  1 144 ? 41.699  -19.278 10.779  1.00 2.39   ? 144 TRP H CA  1 
ATOM   9671  C  C   . TRP H  1 144 ? 40.397  -19.848 10.152  1.00 7.83   ? 144 TRP H C   1 
ATOM   9672  O  O   . TRP H  1 144 ? 40.329  -21.032 9.783   1.00 9.33   ? 144 TRP H O   1 
ATOM   9673  C  CB  . TRP H  1 144 ? 41.538  -19.066 12.289  1.00 1.26   ? 144 TRP H CB  1 
ATOM   9674  C  CG  . TRP H  1 144 ? 40.520  -20.007 12.926  1.00 5.90   ? 144 TRP H CG  1 
ATOM   9675  C  CD1 . TRP H  1 144 ? 40.556  -21.366 12.923  1.00 9.69   ? 144 TRP H CD1 1 
ATOM   9676  C  CD2 . TRP H  1 144 ? 39.346  -19.645 13.680  1.00 4.66   ? 144 TRP H CD2 1 
ATOM   9677  N  NE1 . TRP H  1 144 ? 39.495  -21.878 13.647  1.00 7.83   ? 144 TRP H NE1 1 
ATOM   9678  C  CE2 . TRP H  1 144 ? 38.755  -20.850 14.115  1.00 7.87   ? 144 TRP H CE2 1 
ATOM   9679  C  CE3 . TRP H  1 144 ? 38.756  -18.419 14.009  1.00 5.38   ? 144 TRP H CE3 1 
ATOM   9680  C  CZ2 . TRP H  1 144 ? 37.578  -20.877 14.864  1.00 7.15   ? 144 TRP H CZ2 1 
ATOM   9681  C  CZ3 . TRP H  1 144 ? 37.582  -18.446 14.764  1.00 6.49   ? 144 TRP H CZ3 1 
ATOM   9682  C  CH2 . TRP H  1 144 ? 37.018  -19.667 15.158  1.00 5.90   ? 144 TRP H CH2 1 
ATOM   9683  N  N   . MET H  1 145 ? 39.394  -18.987 9.975   1.00 3.67   ? 145 MET H N   1 
ATOM   9684  C  CA  . MET H  1 145 ? 38.128  -19.417 9.387   1.00 2.27   ? 145 MET H CA  1 
ATOM   9685  C  C   . MET H  1 145 ? 38.203  -19.890 7.946   1.00 10.47  ? 145 MET H C   1 
ATOM   9686  O  O   . MET H  1 145 ? 37.632  -20.933 7.613   1.00 7.14   ? 145 MET H O   1 
ATOM   9687  C  CB  . MET H  1 145 ? 37.038  -18.372 9.559   1.00 3.10   ? 145 MET H CB  1 
ATOM   9688  C  CG  . MET H  1 145 ? 36.794  -18.072 11.048  1.00 8.73   ? 145 MET H CG  1 
ATOM   9689  S  SD  . MET H  1 145 ? 35.450  -16.900 11.379  1.00 11.24  ? 145 MET H SD  1 
ATOM   9690  C  CE  . MET H  1 145 ? 36.072  -15.571 10.451  1.00 19.68  ? 145 MET H CE  1 
ATOM   9691  N  N   . PHE H  1 146 ? 38.878  -19.149 7.077   1.00 4.41   ? 146 PHE H N   1 
ATOM   9692  C  CA  . PHE H  1 146 ? 38.948  -19.642 5.712   1.00 6.52   ? 146 PHE H CA  1 
ATOM   9693  C  C   . PHE H  1 146 ? 39.751  -20.934 5.637   1.00 9.76   ? 146 PHE H C   1 
ATOM   9694  O  O   . PHE H  1 146 ? 39.398  -21.825 4.852   1.00 9.16   ? 146 PHE H O   1 
ATOM   9695  C  CB  . PHE H  1 146 ? 39.341  -18.565 4.708   1.00 7.32   ? 146 PHE H CB  1 
ATOM   9696  C  CG  . PHE H  1 146 ? 38.233  -17.597 4.426   1.00 9.03   ? 146 PHE H CG  1 
ATOM   9697  C  CD1 . PHE H  1 146 ? 37.222  -17.914 3.532   1.00 8.64   ? 146 PHE H CD1 1 
ATOM   9698  C  CD2 . PHE H  1 146 ? 38.140  -16.405 5.139   1.00 9.93   ? 146 PHE H CD2 1 
ATOM   9699  C  CE1 . PHE H  1 146 ? 36.144  -17.061 3.322   1.00 8.08   ? 146 PHE H CE1 1 
ATOM   9700  C  CE2 . PHE H  1 146 ? 37.081  -15.506 4.913   1.00 12.61  ? 146 PHE H CE2 1 
ATOM   9701  C  CZ  . PHE H  1 146 ? 36.064  -15.875 4.013   1.00 10.30  ? 146 PHE H CZ  1 
ATOM   9702  N  N   . LYS H  1 147 ? 40.741  -21.091 6.517   1.00 1.66   ? 147 LYS H N   1 
ATOM   9703  C  CA  . LYS H  1 147 ? 41.502  -22.321 6.519   1.00 2.82   ? 147 LYS H CA  1 
ATOM   9704  C  C   . LYS H  1 147 ? 40.642  -23.475 6.963   1.00 9.72   ? 147 LYS H C   1 
ATOM   9705  O  O   . LYS H  1 147 ? 40.658  -24.545 6.338   1.00 9.87   ? 147 LYS H O   1 
ATOM   9706  C  CB  . LYS H  1 147 ? 42.870  -22.230 7.214   1.00 5.32   ? 147 LYS H CB  1 
ATOM   9707  C  CG  . LYS H  1 147 ? 43.898  -21.518 6.323   1.00 8.11   ? 147 LYS H CG  1 
ATOM   9708  C  CD  . LYS H  1 147 ? 45.326  -22.058 6.367   1.00 26.59  ? 147 LYS H CD  1 
ATOM   9709  C  CE  . LYS H  1 147 ? 46.075  -21.608 5.117   1.00 13.08  ? 147 LYS H CE  1 
ATOM   9710  N  NZ  . LYS H  1 147 ? 47.404  -22.283 5.073   1.00 60.59  ? 147 LYS H NZ  1 
ATOM   9711  N  N   . ALA H  1 148 ? 39.847  -23.206 7.995   1.00 4.71   ? 148 ALA H N   1 
ATOM   9712  C  CA  . ALA H  1 148 ? 38.963  -24.264 8.479   1.00 4.52   ? 148 ALA H CA  1 
ATOM   9713  C  C   . ALA H  1 148 ? 37.967  -24.663 7.388   1.00 8.40   ? 148 ALA H C   1 
ATOM   9714  O  O   . ALA H  1 148 ? 37.737  -25.855 7.182   1.00 6.52   ? 148 ALA H O   1 
ATOM   9715  C  CB  . ALA H  1 148 ? 38.258  -23.858 9.763   1.00 3.15   ? 148 ALA H CB  1 
ATOM   9716  N  N   . PHE H  1 149 ? 37.484  -23.669 6.634   1.00 5.52   ? 149 PHE H N   1 
ATOM   9717  C  CA  . PHE H  1 149 ? 36.608  -23.921 5.501   1.00 3.14   ? 149 PHE H CA  1 
ATOM   9718  C  C   . PHE H  1 149 ? 37.304  -24.839 4.490   1.00 15.09  ? 149 PHE H C   1 
ATOM   9719  O  O   . PHE H  1 149 ? 36.697  -25.763 3.941   1.00 13.62  ? 149 PHE H O   1 
ATOM   9720  C  CB  . PHE H  1 149 ? 36.289  -22.621 4.804   1.00 4.24   ? 149 PHE H CB  1 
ATOM   9721  C  CG  . PHE H  1 149 ? 35.601  -22.847 3.501   1.00 7.99   ? 149 PHE H CG  1 
ATOM   9722  C  CD1 . PHE H  1 149 ? 34.262  -23.185 3.466   1.00 6.31   ? 149 PHE H CD1 1 
ATOM   9723  C  CD2 . PHE H  1 149 ? 36.295  -22.785 2.309   1.00 7.32   ? 149 PHE H CD2 1 
ATOM   9724  C  CE1 . PHE H  1 149 ? 33.637  -23.375 2.240   1.00 5.51   ? 149 PHE H CE1 1 
ATOM   9725  C  CE2 . PHE H  1 149 ? 35.700  -23.028 1.104   1.00 6.89   ? 149 PHE H CE2 1 
ATOM   9726  C  CZ  . PHE H  1 149 ? 34.375  -23.318 1.066   1.00 5.45   ? 149 PHE H CZ  1 
ATOM   9727  N  N   . LEU H  1 150 ? 38.601  -24.605 4.273   1.00 12.04  ? 150 LEU H N   1 
ATOM   9728  C  CA  . LEU H  1 150 ? 39.431  -25.407 3.374   1.00 8.26   ? 150 LEU H CA  1 
ATOM   9729  C  C   . LEU H  1 150 ? 39.913  -26.717 3.996   1.00 21.92  ? 150 LEU H C   1 
ATOM   9730  O  O   . LEU H  1 150 ? 40.639  -27.479 3.364   1.00 19.84  ? 150 LEU H O   1 
ATOM   9731  C  CB  . LEU H  1 150 ? 40.608  -24.559 2.907   1.00 3.03   ? 150 LEU H CB  1 
ATOM   9732  C  CG  . LEU H  1 150 ? 40.204  -23.427 1.975   1.00 6.93   ? 150 LEU H CG  1 
ATOM   9733  C  CD1 . LEU H  1 150 ? 41.407  -22.538 1.859   1.00 10.16  ? 150 LEU H CD1 1 
ATOM   9734  C  CD2 . LEU H  1 150 ? 39.919  -23.954 0.613   1.00 6.33   ? 150 LEU H CD2 1 
ATOM   9735  N  N   . GLY H  1 151 ? 39.540  -26.997 5.237   1.00 13.46  ? 151 GLY H N   1 
ATOM   9736  C  CA  . GLY H  1 151 ? 39.951  -28.249 5.872   1.00 9.17   ? 151 GLY H CA  1 
ATOM   9737  C  C   . GLY H  1 151 ? 41.358  -28.238 6.464   1.00 16.88  ? 151 GLY H C   1 
ATOM   9738  O  O   . GLY H  1 151 ? 41.890  -29.254 6.883   1.00 23.54  ? 151 GLY H O   1 
ATOM   9739  N  N   . LYS H  1 152 ? 41.964  -27.058 6.500   1.00 16.06  ? 152 LYS H N   1 
ATOM   9740  C  CA  . LYS H  1 152 ? 43.339  -26.909 6.973   1.00 9.72   ? 152 LYS H CA  1 
ATOM   9741  C  C   . LYS H  1 152 ? 43.464  -26.260 8.353   1.00 16.92  ? 152 LYS H C   1 
ATOM   9742  O  O   . LYS H  1 152 ? 42.529  -25.614 8.852   1.00 15.02  ? 152 LYS H O   1 
ATOM   9743  C  CB  . LYS H  1 152 ? 44.149  -26.107 5.937   1.00 14.30  ? 152 LYS H CB  1 
ATOM   9744  C  CG  . LYS H  1 152 ? 44.252  -26.750 4.552   1.00 62.53  ? 152 LYS H CG  1 
ATOM   9745  C  CD  . LYS H  1 152 ? 44.809  -28.153 4.755   1.00 99.92  ? 152 LYS H CD  1 
ATOM   9746  C  CE  . LYS H  1 152 ? 44.816  -29.008 3.503   0.00 100.00 ? 152 LYS H CE  1 
ATOM   9747  N  NZ  . LYS H  1 152 ? 45.239  -30.384 3.804   1.00 99.96  ? 152 LYS H NZ  1 
ATOM   9748  N  N   . ALA H  1 153 ? 44.630  -26.409 8.964   1.00 15.98  ? 153 ALA H N   1 
ATOM   9749  C  CA  . ALA H  1 153 ? 44.900  -25.722 10.214  1.00 10.97  ? 153 ALA H CA  1 
ATOM   9750  C  C   . ALA H  1 153 ? 45.281  -24.305 9.813   1.00 14.64  ? 153 ALA H C   1 
ATOM   9751  O  O   . ALA H  1 153 ? 45.681  -24.115 8.687   1.00 11.45  ? 153 ALA H O   1 
ATOM   9752  C  CB  . ALA H  1 153 ? 46.055  -26.356 10.936  1.00 6.54   ? 153 ALA H CB  1 
ATOM   9753  N  N   . PRO H  1 154 ? 45.124  -23.310 10.676  1.00 14.31  ? 154 PRO H N   1 
ATOM   9754  C  CA  . PRO H  1 154 ? 45.389  -21.940 10.305  1.00 9.91   ? 154 PRO H CA  1 
ATOM   9755  C  C   . PRO H  1 154 ? 46.783  -21.669 9.786   1.00 14.09  ? 154 PRO H C   1 
ATOM   9756  O  O   . PRO H  1 154 ? 46.953  -21.006 8.757   1.00 17.94  ? 154 PRO H O   1 
ATOM   9757  C  CB  . PRO H  1 154 ? 45.179  -21.184 11.627  1.00 10.93  ? 154 PRO H CB  1 
ATOM   9758  C  CG  . PRO H  1 154 ? 44.331  -22.059 12.456  1.00 12.77  ? 154 PRO H CG  1 
ATOM   9759  C  CD  . PRO H  1 154 ? 44.711  -23.437 12.080  1.00 10.53  ? 154 PRO H CD  1 
ATOM   9760  N  N   . LEU H  1 155 ? 47.780  -22.121 10.538  1.00 18.72  ? 155 LEU H N   1 
ATOM   9761  C  CA  . LEU H  1 155 ? 49.162  -21.865 10.149  1.00 19.67  ? 155 LEU H CA  1 
ATOM   9762  C  C   . LEU H  1 155 ? 49.705  -22.963 9.238   1.00 45.00  ? 155 LEU H C   1 
ATOM   9763  O  O   . LEU H  1 155 ? 50.890  -23.003 8.894   1.00 35.56  ? 155 LEU H O   1 
ATOM   9764  C  CB  . LEU H  1 155 ? 50.063  -21.590 11.347  1.00 18.26  ? 155 LEU H CB  1 
ATOM   9765  C  CG  . LEU H  1 155 ? 49.363  -20.538 12.193  1.00 27.61  ? 155 LEU H CG  1 
ATOM   9766  C  CD1 . LEU H  1 155 ? 50.241  -20.229 13.416  1.00 23.01  ? 155 LEU H CD1 1 
ATOM   9767  C  CD2 . LEU H  1 155 ? 49.081  -19.309 11.329  1.00 19.27  ? 155 LEU H CD2 1 
ATOM   9768  N  N   . GLU H  1 156 ? 48.807  -23.869 8.867   1.00 42.58  ? 156 GLU H N   1 
ATOM   9769  C  CA  . GLU H  1 156 ? 49.124  -24.950 7.944   1.00 73.01  ? 156 GLU H CA  1 
ATOM   9770  C  C   . GLU H  1 156 ? 49.366  -24.328 6.572   0.00 100.00 ? 156 GLU H C   1 
ATOM   9771  O  O   . GLU H  1 156 ? 48.556  -24.441 5.675   1.00 92.93  ? 156 GLU H O   1 
ATOM   9772  C  CB  . GLU H  1 156 ? 47.915  -25.865 7.786   1.00 49.14  ? 156 GLU H CB  1 
ATOM   9773  C  CG  . GLU H  1 156 ? 48.208  -27.203 7.142   1.00 56.80  ? 156 GLU H CG  1 
ATOM   9774  C  CD  . GLU H  1 156 ? 48.345  -28.331 8.118   0.00 100.00 ? 156 GLU H CD  1 
ATOM   9775  O  OE1 . GLU H  1 156 ? 49.194  -28.243 9.028   0.00 100.00 ? 156 GLU H OE1 1 
ATOM   9776  O  OE2 . GLU H  1 156 ? 47.538  -29.247 8.102   1.00 40.48  ? 156 GLU H OE2 1 
ATOM   9777  N  N   . VAL I  1 7   ? -7.717  -40.286 13.542  1.00 75.26  ? 7   VAL I N   1 
ATOM   9778  C  CA  . VAL I  1 7   ? -7.146  -41.556 14.039  1.00 73.21  ? 7   VAL I CA  1 
ATOM   9779  C  C   . VAL I  1 7   ? -5.748  -41.299 14.663  1.00 67.81  ? 7   VAL I C   1 
ATOM   9780  O  O   . VAL I  1 7   ? -5.565  -41.353 15.878  1.00 77.08  ? 7   VAL I O   1 
ATOM   9781  C  CB  . VAL I  1 7   ? -7.176  -42.688 13.012  1.00 76.78  ? 7   VAL I CB  1 
ATOM   9782  C  CG1 . VAL I  1 7   ? -7.192  -44.080 13.685  1.00 74.79  ? 7   VAL I CG1 1 
ATOM   9783  C  CG2 . VAL I  1 7   ? -8.428  -42.673 12.130  1.00 78.73  ? 7   VAL I CG2 1 
ATOM   9784  N  N   . ASP I  1 8   ? -4.701  -40.991 13.890  1.00 37.46  ? 8   ASP I N   1 
ATOM   9785  C  CA  . ASP I  1 8   ? -3.359  -40.782 14.538  1.00 28.63  ? 8   ASP I CA  1 
ATOM   9786  C  C   . ASP I  1 8   ? -2.795  -39.356 14.282  1.00 16.12  ? 8   ASP I C   1 
ATOM   9787  O  O   . ASP I  1 8   ? -3.152  -38.692 13.300  1.00 12.15  ? 8   ASP I O   1 
ATOM   9788  C  CB  . ASP I  1 8   ? -2.375  -41.875 14.090  1.00 27.21  ? 8   ASP I CB  1 
ATOM   9789  C  CG  . ASP I  1 8   ? -1.482  -41.492 12.911  1.00 34.76  ? 8   ASP I CG  1 
ATOM   9790  O  OD1 . ASP I  1 8   ? -1.782  -40.480 12.175  1.00 44.22  ? 8   ASP I OD1 1 
ATOM   9791  O  OD2 . ASP I  1 8   ? -0.427  -42.193 12.651  1.00 46.85  ? 8   ASP I OD2 1 
ATOM   9792  N  N   . THR I  1 9   ? -1.911  -38.938 15.209  1.00 8.28   ? 9   THR I N   1 
ATOM   9793  C  CA  . THR I  1 9   ? -1.280  -37.582 15.221  1.00 9.17   ? 9   THR I CA  1 
ATOM   9794  C  C   . THR I  1 9   ? -0.749  -37.187 13.841  1.00 11.51  ? 9   THR I C   1 
ATOM   9795  O  O   . THR I  1 9   ? -1.066  -36.115 13.314  1.00 9.38   ? 9   THR I O   1 
ATOM   9796  C  CB  . THR I  1 9   ? -0.125  -37.506 16.221  1.00 17.91  ? 9   THR I CB  1 
ATOM   9797  O  OG1 . THR I  1 9   ? -0.587  -37.837 17.522  1.00 14.95  ? 9   THR I OG1 1 
ATOM   9798  C  CG2 . THR I  1 9   ? 0.492   -36.103 16.306  1.00 16.30  ? 9   THR I CG2 1 
ATOM   9799  N  N   . LYS I  1 10  ? 0.060   -38.040 13.260  1.00 2.80   ? 10  LYS I N   1 
ATOM   9800  C  CA  . LYS I  1 10  ? 0.620   -37.757 11.936  1.00 5.34   ? 10  LYS I CA  1 
ATOM   9801  C  C   . LYS I  1 10  ? -0.508  -37.416 10.961  1.00 13.13  ? 10  LYS I C   1 
ATOM   9802  O  O   . LYS I  1 10  ? -0.480  -36.388 10.274  1.00 19.46  ? 10  LYS I O   1 
ATOM   9803  C  CB  . LYS I  1 10  ? 1.392   -38.961 11.422  1.00 3.49   ? 10  LYS I CB  1 
ATOM   9804  C  CG  . LYS I  1 10  ? 2.640   -39.245 12.250  1.00 6.05   ? 10  LYS I CG  1 
ATOM   9805  C  CD  . LYS I  1 10  ? 3.710   -40.002 11.470  1.00 11.71  ? 10  LYS I CD  1 
ATOM   9806  C  CE  . LYS I  1 10  ? 4.675   -40.761 12.379  1.00 56.19  ? 10  LYS I CE  1 
ATOM   9807  N  NZ  . LYS I  1 10  ? 5.449   -41.783 11.663  1.00 93.96  ? 10  LYS I NZ  1 
ATOM   9808  N  N   . GLU I  1 11  ? -1.492  -38.292 10.920  1.00 9.22   ? 11  GLU I N   1 
ATOM   9809  C  CA  . GLU I  1 11  ? -2.642  -38.110 10.031  1.00 12.97  ? 11  GLU I CA  1 
ATOM   9810  C  C   . GLU I  1 11  ? -3.368  -36.819 10.386  1.00 10.86  ? 11  GLU I C   1 
ATOM   9811  O  O   . GLU I  1 11  ? -3.797  -36.054 9.512   1.00 9.66   ? 11  GLU I O   1 
ATOM   9812  C  CB  . GLU I  1 11  ? -3.602  -39.292 10.146  1.00 19.59  ? 11  GLU I CB  1 
ATOM   9813  C  CG  . GLU I  1 11  ? -3.378  -40.335 9.050   1.00 72.55  ? 11  GLU I CG  1 
ATOM   9814  C  CD  . GLU I  1 11  ? -2.017  -41.021 9.160   0.00 100.00 ? 11  GLU I CD  1 
ATOM   9815  O  OE1 . GLU I  1 11  ? -0.936  -40.353 8.940   0.00 100.00 ? 11  GLU I OE1 1 
ATOM   9816  O  OE2 . GLU I  1 11  ? -1.951  -42.270 9.477   0.00 100.00 ? 11  GLU I OE2 1 
ATOM   9817  N  N   . PHE I  1 12  ? -3.504  -36.575 11.671  1.00 3.77   ? 12  PHE I N   1 
ATOM   9818  C  CA  . PHE I  1 12  ? -4.187  -35.368 12.101  1.00 3.39   ? 12  PHE I CA  1 
ATOM   9819  C  C   . PHE I  1 12  ? -3.418  -34.141 11.601  1.00 8.15   ? 12  PHE I C   1 
ATOM   9820  O  O   . PHE I  1 12  ? -3.965  -33.213 10.960  1.00 6.93   ? 12  PHE I O   1 
ATOM   9821  C  CB  . PHE I  1 12  ? -4.339  -35.290 13.609  1.00 5.92   ? 12  PHE I CB  1 
ATOM   9822  C  CG  . PHE I  1 12  ? -4.926  -33.945 14.020  1.00 11.73  ? 12  PHE I CG  1 
ATOM   9823  C  CD1 . PHE I  1 12  ? -6.314  -33.749 14.028  1.00 11.45  ? 12  PHE I CD1 1 
ATOM   9824  C  CD2 . PHE I  1 12  ? -4.070  -32.901 14.368  1.00 17.49  ? 12  PHE I CD2 1 
ATOM   9825  C  CE1 . PHE I  1 12  ? -6.839  -32.503 14.398  1.00 11.99  ? 12  PHE I CE1 1 
ATOM   9826  C  CE2 . PHE I  1 12  ? -4.594  -31.659 14.742  1.00 13.63  ? 12  PHE I CE2 1 
ATOM   9827  C  CZ  . PHE I  1 12  ? -5.978  -31.459 14.757  1.00 12.54  ? 12  PHE I CZ  1 
ATOM   9828  N  N   . LEU I  1 13  ? -2.116  -34.177 11.872  1.00 2.14   ? 13  LEU I N   1 
ATOM   9829  C  CA  . LEU I  1 13  ? -1.290  -33.056 11.479  1.00 4.19   ? 13  LEU I CA  1 
ATOM   9830  C  C   . LEU I  1 13  ? -1.343  -32.818 9.978   1.00 7.41   ? 13  LEU I C   1 
ATOM   9831  O  O   . LEU I  1 13  ? -1.572  -31.713 9.500   1.00 12.22  ? 13  LEU I O   1 
ATOM   9832  C  CB  . LEU I  1 13  ? 0.135   -33.280 11.948  1.00 2.59   ? 13  LEU I CB  1 
ATOM   9833  C  CG  . LEU I  1 13  ? 0.605   -32.520 13.178  1.00 7.70   ? 13  LEU I CG  1 
ATOM   9834  C  CD1 . LEU I  1 13  ? -0.430  -32.066 14.139  1.00 2.75   ? 13  LEU I CD1 1 
ATOM   9835  C  CD2 . LEU I  1 13  ? 1.648   -33.339 13.848  1.00 1.00   ? 13  LEU I CD2 1 
ATOM   9836  N  N   . ASN I  1 14  ? -1.229  -33.896 9.223   1.00 3.55   ? 14  ASN I N   1 
ATOM   9837  C  CA  . ASN I  1 14  ? -1.205  -33.660 7.793   1.00 6.84   ? 14  ASN I CA  1 
ATOM   9838  C  C   . ASN I  1 14  ? -2.553  -33.089 7.301   1.00 10.44  ? 14  ASN I C   1 
ATOM   9839  O  O   . ASN I  1 14  ? -2.629  -32.295 6.331   1.00 11.60  ? 14  ASN I O   1 
ATOM   9840  C  CB  . ASN I  1 14  ? -0.786  -34.954 7.084   1.00 4.92   ? 14  ASN I CB  1 
ATOM   9841  C  CG  . ASN I  1 14  ? 0.022   -34.711 5.799   1.00 21.28  ? 14  ASN I CG  1 
ATOM   9842  O  OD1 . ASN I  1 14  ? 0.455   -33.606 5.466   1.00 13.08  ? 14  ASN I OD1 1 
ATOM   9843  N  ND2 . ASN I  1 14  ? 0.277   -35.807 5.088   1.00 12.91  ? 14  ASN I ND2 1 
ATOM   9844  N  N   . HIS I  1 15  ? -3.613  -33.514 7.984   1.00 6.05   ? 15  HIS I N   1 
ATOM   9845  C  CA  . HIS I  1 15  ? -4.916  -33.054 7.546   1.00 6.93   ? 15  HIS I CA  1 
ATOM   9846  C  C   . HIS I  1 15  ? -4.982  -31.544 7.742   1.00 8.52   ? 15  HIS I C   1 
ATOM   9847  O  O   . HIS I  1 15  ? -5.554  -30.852 6.899   1.00 10.66  ? 15  HIS I O   1 
ATOM   9848  C  CB  . HIS I  1 15  ? -6.016  -33.821 8.300   1.00 10.67  ? 15  HIS I CB  1 
ATOM   9849  C  CG  . HIS I  1 15  ? -7.394  -33.382 7.923   1.00 18.60  ? 15  HIS I CG  1 
ATOM   9850  N  ND1 . HIS I  1 15  ? -8.226  -32.697 8.782   1.00 24.64  ? 15  HIS I ND1 1 
ATOM   9851  C  CD2 . HIS I  1 15  ? -8.056  -33.468 6.748   1.00 18.84  ? 15  HIS I CD2 1 
ATOM   9852  C  CE1 . HIS I  1 15  ? -9.343  -32.384 8.153   1.00 23.03  ? 15  HIS I CE1 1 
ATOM   9853  N  NE2 . HIS I  1 15  ? -9.261  -32.827 6.914   1.00 22.29  ? 15  HIS I NE2 1 
ATOM   9854  N  N   . GLN I  1 16  ? -4.366  -31.052 8.818   1.00 2.49   ? 16  GLN I N   1 
ATOM   9855  C  CA  . GLN I  1 16  ? -4.328  -29.601 9.039   1.00 2.00   ? 16  GLN I CA  1 
ATOM   9856  C  C   . GLN I  1 16  ? -3.407  -28.884 8.065   1.00 8.63   ? 16  GLN I C   1 
ATOM   9857  O  O   . GLN I  1 16  ? -3.728  -27.757 7.685   1.00 8.79   ? 16  GLN I O   1 
ATOM   9858  C  CB  . GLN I  1 16  ? -4.015  -29.186 10.474  1.00 1.00   ? 16  GLN I CB  1 
ATOM   9859  C  CG  . GLN I  1 16  ? -4.956  -29.844 11.457  1.00 6.53   ? 16  GLN I CG  1 
ATOM   9860  C  CD  . GLN I  1 16  ? -6.426  -29.572 11.102  1.00 19.37  ? 16  GLN I CD  1 
ATOM   9861  O  OE1 . GLN I  1 16  ? -6.779  -28.569 10.467  1.00 8.73   ? 16  GLN I OE1 1 
ATOM   9862  N  NE2 . GLN I  1 16  ? -7.294  -30.500 11.487  1.00 13.04  ? 16  GLN I NE2 1 
ATOM   9863  N  N   . VAL I  1 17  ? -2.347  -29.533 7.576   1.00 1.81   ? 17  VAL I N   1 
ATOM   9864  C  CA  . VAL I  1 17  ? -1.552  -28.847 6.564   1.00 1.34   ? 17  VAL I CA  1 
ATOM   9865  C  C   . VAL I  1 17  ? -2.487  -28.560 5.368   1.00 5.31   ? 17  VAL I C   1 
ATOM   9866  O  O   . VAL I  1 17  ? -2.500  -27.485 4.742   1.00 9.01   ? 17  VAL I O   1 
ATOM   9867  C  CB  . VAL I  1 17  ? -0.291  -29.681 6.095   1.00 3.12   ? 17  VAL I CB  1 
ATOM   9868  C  CG1 . VAL I  1 17  ? 0.429   -29.088 4.899   1.00 1.00   ? 17  VAL I CG1 1 
ATOM   9869  C  CG2 . VAL I  1 17  ? 0.742   -29.950 7.202   1.00 1.21   ? 17  VAL I CG2 1 
ATOM   9870  N  N   . ALA I  1 18  ? -3.321  -29.536 5.025   1.00 4.22   ? 18  ALA I N   1 
ATOM   9871  C  CA  . ALA I  1 18  ? -4.222  -29.336 3.882   1.00 4.18   ? 18  ALA I CA  1 
ATOM   9872  C  C   . ALA I  1 18  ? -5.187  -28.219 4.233   1.00 5.34   ? 18  ALA I C   1 
ATOM   9873  O  O   . ALA I  1 18  ? -5.339  -27.277 3.474   1.00 8.40   ? 18  ALA I O   1 
ATOM   9874  C  CB  . ALA I  1 18  ? -5.005  -30.619 3.569   1.00 3.99   ? 18  ALA I CB  1 
ATOM   9875  N  N   . ASN I  1 19  ? -5.887  -28.331 5.350   1.00 1.68   ? 19  ASN I N   1 
ATOM   9876  C  CA  . ASN I  1 19  ? -6.834  -27.307 5.753   1.00 2.79   ? 19  ASN I CA  1 
ATOM   9877  C  C   . ASN I  1 19  ? -6.255  -25.892 5.734   1.00 9.09   ? 19  ASN I C   1 
ATOM   9878  O  O   . ASN I  1 19  ? -6.837  -24.950 5.193   1.00 9.18   ? 19  ASN I O   1 
ATOM   9879  C  CB  . ASN I  1 19  ? -7.301  -27.575 7.182   1.00 4.75   ? 19  ASN I CB  1 
ATOM   9880  C  CG  . ASN I  1 19  ? -8.386  -28.628 7.237   1.00 14.48  ? 19  ASN I CG  1 
ATOM   9881  O  OD1 . ASN I  1 19  ? -8.986  -28.964 6.232   1.00 9.11   ? 19  ASN I OD1 1 
ATOM   9882  N  ND2 . ASN I  1 19  ? -8.714  -29.079 8.437   1.00 3.66   ? 19  ASN I ND2 1 
ATOM   9883  N  N   . LEU I  1 20  ? -5.108  -25.751 6.389   1.00 11.09  ? 20  LEU I N   1 
ATOM   9884  C  CA  . LEU I  1 20  ? -4.426  -24.466 6.502   1.00 7.25   ? 20  LEU I CA  1 
ATOM   9885  C  C   . LEU I  1 20  ? -4.136  -23.906 5.106   1.00 6.86   ? 20  LEU I C   1 
ATOM   9886  O  O   . LEU I  1 20  ? -4.365  -22.734 4.856   1.00 6.77   ? 20  LEU I O   1 
ATOM   9887  C  CB  . LEU I  1 20  ? -3.204  -24.645 7.414   1.00 4.67   ? 20  LEU I CB  1 
ATOM   9888  C  CG  . LEU I  1 20  ? -3.272  -24.170 8.867   1.00 3.86   ? 20  LEU I CG  1 
ATOM   9889  C  CD1 . LEU I  1 20  ? -4.618  -23.746 9.388   1.00 2.35   ? 20  LEU I CD1 1 
ATOM   9890  C  CD2 . LEU I  1 20  ? -2.633  -25.144 9.844   1.00 1.00   ? 20  LEU I CD2 1 
ATOM   9891  N  N   . ASN I  1 21  ? -3.733  -24.750 4.157   1.00 1.00   ? 21  ASN I N   1 
ATOM   9892  C  CA  . ASN I  1 21  ? -3.491  -24.226 2.820   1.00 1.50   ? 21  ASN I CA  1 
ATOM   9893  C  C   . ASN I  1 21  ? -4.745  -23.687 2.150   1.00 9.29   ? 21  ASN I C   1 
ATOM   9894  O  O   . ASN I  1 21  ? -4.716  -22.676 1.448   1.00 12.17  ? 21  ASN I O   1 
ATOM   9895  C  CB  . ASN I  1 21  ? -2.761  -25.228 1.940   1.00 5.84   ? 21  ASN I CB  1 
ATOM   9896  C  CG  . ASN I  1 21  ? -1.279  -25.120 2.122   1.00 21.09  ? 21  ASN I CG  1 
ATOM   9897  O  OD1 . ASN I  1 21  ? -0.645  -24.277 1.510   1.00 15.50  ? 21  ASN I OD1 1 
ATOM   9898  N  ND2 . ASN I  1 21  ? -0.755  -25.830 3.108   1.00 11.83  ? 21  ASN I ND2 1 
ATOM   9899  N  N   . VAL I  1 22  ? -5.873  -24.341 2.414   1.00 9.62   ? 22  VAL I N   1 
ATOM   9900  C  CA  . VAL I  1 22  ? -7.138  -23.890 1.818   1.00 5.52   ? 22  VAL I CA  1 
ATOM   9901  C  C   . VAL I  1 22  ? -7.570  -22.588 2.466   1.00 5.59   ? 22  VAL I C   1 
ATOM   9902  O  O   . VAL I  1 22  ? -7.980  -21.630 1.787   1.00 2.23   ? 22  VAL I O   1 
ATOM   9903  C  CB  . VAL I  1 22  ? -8.239  -24.948 1.963   1.00 5.23   ? 22  VAL I CB  1 
ATOM   9904  C  CG1 . VAL I  1 22  ? -9.532  -24.425 1.346   1.00 6.01   ? 22  VAL I CG1 1 
ATOM   9905  C  CG2 . VAL I  1 22  ? -7.826  -26.232 1.262   1.00 3.17   ? 22  VAL I CG2 1 
ATOM   9906  N  N   . PHE I  1 23  ? -7.377  -22.552 3.783   1.00 1.00   ? 23  PHE I N   1 
ATOM   9907  C  CA  . PHE I  1 23  ? -7.795  -21.377 4.541   1.00 1.00   ? 23  PHE I CA  1 
ATOM   9908  C  C   . PHE I  1 23  ? -7.033  -20.140 4.139   1.00 8.78   ? 23  PHE I C   1 
ATOM   9909  O  O   . PHE I  1 23  ? -7.493  -19.019 3.990   1.00 8.37   ? 23  PHE I O   1 
ATOM   9910  C  CB  . PHE I  1 23  ? -7.568  -21.666 6.018   1.00 2.58   ? 23  PHE I CB  1 
ATOM   9911  C  CG  . PHE I  1 23  ? -8.112  -20.591 6.931   1.00 6.63   ? 23  PHE I CG  1 
ATOM   9912  C  CD1 . PHE I  1 23  ? -9.246  -19.864 6.565   1.00 10.77  ? 23  PHE I CD1 1 
ATOM   9913  C  CD2 . PHE I  1 23  ? -7.531  -20.351 8.177   1.00 4.96   ? 23  PHE I CD2 1 
ATOM   9914  C  CE1 . PHE I  1 23  ? -9.746  -18.907 7.404   1.00 8.15   ? 23  PHE I CE1 1 
ATOM   9915  C  CE2 . PHE I  1 23  ? -8.050  -19.394 9.028   1.00 3.12   ? 23  PHE I CE2 1 
ATOM   9916  C  CZ  . PHE I  1 23  ? -9.181  -18.695 8.648   1.00 1.63   ? 23  PHE I CZ  1 
ATOM   9917  N  N   . THR I  1 24  ? -5.765  -20.393 3.930   1.00 3.40   ? 24  THR I N   1 
ATOM   9918  C  CA  . THR I  1 24  ? -4.948  -19.258 3.582   1.00 2.36   ? 24  THR I CA  1 
ATOM   9919  C  C   . THR I  1 24  ? -5.379  -18.622 2.262   1.00 9.49   ? 24  THR I C   1 
ATOM   9920  O  O   . THR I  1 24  ? -5.485  -17.399 2.120   1.00 5.31   ? 24  THR I O   1 
ATOM   9921  C  CB  . THR I  1 24  ? -3.495  -19.777 3.697   1.00 7.19   ? 24  THR I CB  1 
ATOM   9922  O  OG1 . THR I  1 24  ? -2.684  -18.796 4.378   1.00 37.21  ? 24  THR I OG1 1 
ATOM   9923  C  CG2 . THR I  1 24  ? -2.893  -20.253 2.383   1.00 1.68   ? 24  THR I CG2 1 
ATOM   9924  N  N   . VAL I  1 25  ? -5.687  -19.459 1.279   1.00 5.94   ? 25  VAL I N   1 
ATOM   9925  C  CA  . VAL I  1 25  ? -6.142  -18.932 0.008   1.00 2.67   ? 25  VAL I CA  1 
ATOM   9926  C  C   . VAL I  1 25  ? -7.494  -18.263 0.167   1.00 7.08   ? 25  VAL I C   1 
ATOM   9927  O  O   . VAL I  1 25  ? -7.796  -17.255 -0.451  1.00 4.36   ? 25  VAL I O   1 
ATOM   9928  C  CB  . VAL I  1 25  ? -6.255  -20.088 -1.013  1.00 7.53   ? 25  VAL I CB  1 
ATOM   9929  C  CG1 . VAL I  1 25  ? -6.888  -19.576 -2.324  1.00 5.59   ? 25  VAL I CG1 1 
ATOM   9930  C  CG2 . VAL I  1 25  ? -4.805  -20.603 -1.251  1.00 1.84   ? 25  VAL I CG2 1 
ATOM   9931  N  N   . LYS I  1 26  ? -8.328  -18.785 1.049   1.00 2.04   ? 26  LYS I N   1 
ATOM   9932  C  CA  . LYS I  1 26  ? -9.629  -18.170 1.313   1.00 2.20   ? 26  LYS I CA  1 
ATOM   9933  C  C   . LYS I  1 26  ? -9.459  -16.785 1.921   1.00 5.55   ? 26  LYS I C   1 
ATOM   9934  O  O   . LYS I  1 26  ? -10.162 -15.848 1.543   1.00 7.77   ? 26  LYS I O   1 
ATOM   9935  C  CB  . LYS I  1 26  ? -10.422 -19.042 2.288   1.00 2.35   ? 26  LYS I CB  1 
ATOM   9936  C  CG  . LYS I  1 26  ? -11.786 -18.470 2.557   1.00 14.83  ? 26  LYS I CG  1 
ATOM   9937  C  CD  . LYS I  1 26  ? -12.517 -19.284 3.612   1.00 30.42  ? 26  LYS I CD  1 
ATOM   9938  C  CE  . LYS I  1 26  ? -12.937 -20.702 3.190   1.00 14.00  ? 26  LYS I CE  1 
ATOM   9939  N  NZ  . LYS I  1 26  ? -14.056 -20.709 2.217   1.00 36.62  ? 26  LYS I NZ  1 
ATOM   9940  N  N   . ILE I  1 27  ? -8.473  -16.622 2.798   1.00 2.46   ? 27  ILE I N   1 
ATOM   9941  C  CA  . ILE I  1 27  ? -8.200  -15.310 3.376   1.00 1.58   ? 27  ILE I CA  1 
ATOM   9942  C  C   . ILE I  1 27  ? -7.773  -14.372 2.259   1.00 4.89   ? 27  ILE I C   1 
ATOM   9943  O  O   . ILE I  1 27  ? -8.203  -13.226 2.198   1.00 8.15   ? 27  ILE I O   1 
ATOM   9944  C  CB  . ILE I  1 27  ? -7.097  -15.403 4.463   1.00 2.93   ? 27  ILE I CB  1 
ATOM   9945  C  CG1 . ILE I  1 27  ? -7.601  -16.245 5.625   1.00 1.00   ? 27  ILE I CG1 1 
ATOM   9946  C  CG2 . ILE I  1 27  ? -6.627  -14.057 4.905   1.00 1.00   ? 27  ILE I CG2 1 
ATOM   9947  C  CD1 . ILE I  1 27  ? -6.530  -16.670 6.580   1.00 1.56   ? 27  ILE I CD1 1 
ATOM   9948  N  N   . HIS I  1 28  ? -6.920  -14.788 1.333   1.00 2.36   ? 28  HIS I N   1 
ATOM   9949  C  CA  . HIS I  1 28  ? -6.603  -13.861 0.245   1.00 1.60   ? 28  HIS I CA  1 
ATOM   9950  C  C   . HIS I  1 28  ? -7.859  -13.450 -0.573  1.00 8.74   ? 28  HIS I C   1 
ATOM   9951  O  O   . HIS I  1 28  ? -8.005  -12.304 -1.037  1.00 8.31   ? 28  HIS I O   1 
ATOM   9952  C  CB  . HIS I  1 28  ? -5.601  -14.509 -0.760  1.00 5.36   ? 28  HIS I CB  1 
ATOM   9953  C  CG  . HIS I  1 28  ? -4.158  -14.208 -0.501  1.00 11.94  ? 28  HIS I CG  1 
ATOM   9954  N  ND1 . HIS I  1 28  ? -3.746  -13.054 0.161   1.00 16.68  ? 28  HIS I ND1 1 
ATOM   9955  C  CD2 . HIS I  1 28  ? -3.030  -14.850 -0.853  1.00 11.28  ? 28  HIS I CD2 1 
ATOM   9956  C  CE1 . HIS I  1 28  ? -2.434  -13.024 0.254   1.00 16.41  ? 28  HIS I CE1 1 
ATOM   9957  N  NE2 . HIS I  1 28  ? -1.975  -14.113 -0.399  1.00 15.41  ? 28  HIS I NE2 1 
ATOM   9958  N  N   . GLN I  1 29  ? -8.735  -14.422 -0.849  1.00 6.04   ? 29  GLN I N   1 
ATOM   9959  C  CA  . GLN I  1 29  ? -9.949  -14.175 -1.605  1.00 5.65   ? 29  GLN I CA  1 
ATOM   9960  C  C   . GLN I  1 29  ? -10.705 -12.998 -0.951  1.00 6.96   ? 29  GLN I C   1 
ATOM   9961  O  O   . GLN I  1 29  ? -11.040 -11.986 -1.599  1.00 5.53   ? 29  GLN I O   1 
ATOM   9962  C  CB  . GLN I  1 29  ? -10.837 -15.435 -1.634  1.00 7.51   ? 29  GLN I CB  1 
ATOM   9963  C  CG  . GLN I  1 29  ? -12.269 -15.194 -2.115  1.00 11.01  ? 29  GLN I CG  1 
ATOM   9964  C  CD  . GLN I  1 29  ? -13.061 -16.484 -2.332  1.00 17.54  ? 29  GLN I CD  1 
ATOM   9965  O  OE1 . GLN I  1 29  ? -12.773 -17.255 -3.261  1.00 13.18  ? 29  GLN I OE1 1 
ATOM   9966  N  NE2 . GLN I  1 29  ? -14.073 -16.727 -1.485  1.00 10.97  ? 29  GLN I NE2 1 
ATOM   9967  N  N   . ILE I  1 30  ? -10.909 -13.123 0.355   1.00 3.17   ? 30  ILE I N   1 
ATOM   9968  C  CA  . ILE I  1 30  ? -11.673 -12.141 1.110   1.00 2.26   ? 30  ILE I CA  1 
ATOM   9969  C  C   . ILE I  1 30  ? -11.059 -10.794 0.966   1.00 7.17   ? 30  ILE I C   1 
ATOM   9970  O  O   . ILE I  1 30  ? -11.655 -9.775  0.760   1.00 6.33   ? 30  ILE I O   1 
ATOM   9971  C  CB  . ILE I  1 30  ? -11.737 -12.515 2.603   1.00 4.78   ? 30  ILE I CB  1 
ATOM   9972  C  CG1 . ILE I  1 30  ? -12.618 -13.747 2.777   1.00 9.80   ? 30  ILE I CG1 1 
ATOM   9973  C  CG2 . ILE I  1 30  ? -12.302 -11.389 3.387   1.00 1.85   ? 30  ILE I CG2 1 
ATOM   9974  C  CD1 . ILE I  1 30  ? -12.639 -14.268 4.179   1.00 12.90  ? 30  ILE I CD1 1 
ATOM   9975  N  N   . HIS I  1 31  ? -9.738  -10.855 1.114   1.00 3.69   ? 31  HIS I N   1 
ATOM   9976  C  CA  . HIS I  1 31  ? -8.872  -9.691  1.090   1.00 2.62   ? 31  HIS I CA  1 
ATOM   9977  C  C   . HIS I  1 31  ? -8.898  -8.952  -0.236  1.00 10.60  ? 31  HIS I C   1 
ATOM   9978  O  O   . HIS I  1 31  ? -8.856  -7.714  -0.277  1.00 3.67   ? 31  HIS I O   1 
ATOM   9979  C  CB  . HIS I  1 31  ? -7.507  -10.302 1.439   1.00 2.21   ? 31  HIS I CB  1 
ATOM   9980  C  CG  . HIS I  1 31  ? -6.320  -9.384  1.239   1.00 9.28   ? 31  HIS I CG  1 
ATOM   9981  N  ND1 . HIS I  1 31  ? -6.093  -8.294  2.064   1.00 15.16  ? 31  HIS I ND1 1 
ATOM   9982  C  CD2 . HIS I  1 31  ? -5.315  -9.410  0.332   1.00 10.42  ? 31  HIS I CD2 1 
ATOM   9983  C  CE1 . HIS I  1 31  ? -4.988  -7.703  1.656   1.00 11.36  ? 31  HIS I CE1 1 
ATOM   9984  N  NE2 . HIS I  1 31  ? -4.510  -8.356  0.623   1.00 10.48  ? 31  HIS I NE2 1 
ATOM   9985  N  N   . TRP I  1 32  ? -8.965  -9.712  -1.287  1.00 5.67   ? 32  TRP I N   1 
ATOM   9986  C  CA  . TRP I  1 32  ? -8.962  -9.159  -2.635  1.00 4.58   ? 32  TRP I CA  1 
ATOM   9987  C  C   . TRP I  1 32  ? -10.345 -8.652  -3.046  1.00 11.24  ? 32  TRP I C   1 
ATOM   9988  O  O   . TRP I  1 32  ? -10.487 -7.576  -3.634  1.00 6.55   ? 32  TRP I O   1 
ATOM   9989  C  CB  . TRP I  1 32  ? -8.563  -10.239 -3.635  1.00 2.71   ? 32  TRP I CB  1 
ATOM   9990  C  CG  . TRP I  1 32  ? -7.084  -10.589 -3.557  1.00 1.64   ? 32  TRP I CG  1 
ATOM   9991  C  CD1 . TRP I  1 32  ? -6.102  -9.793  -3.130  1.00 1.98   ? 32  TRP I CD1 1 
ATOM   9992  C  CD2 . TRP I  1 32  ? -6.517  -11.835 -3.931  1.00 2.73   ? 32  TRP I CD2 1 
ATOM   9993  N  NE1 . TRP I  1 32  ? -4.888  -10.532 -3.239  1.00 2.75   ? 32  TRP I NE1 1 
ATOM   9994  C  CE2 . TRP I  1 32  ? -5.150  -11.726 -3.716  1.00 3.92   ? 32  TRP I CE2 1 
ATOM   9995  C  CE3 . TRP I  1 32  ? -7.034  -13.038 -4.438  1.00 4.90   ? 32  TRP I CE3 1 
ATOM   9996  C  CZ2 . TRP I  1 32  ? -4.246  -12.759 -3.990  1.00 1.98   ? 32  TRP I CZ2 1 
ATOM   9997  C  CZ3 . TRP I  1 32  ? -6.115  -14.075 -4.705  1.00 6.25   ? 32  TRP I CZ3 1 
ATOM   9998  C  CH2 . TRP I  1 32  ? -4.786  -13.941 -4.492  1.00 7.13   ? 32  TRP I CH2 1 
ATOM   9999  N  N   . TYR I  1 33  ? -11.354 -9.427  -2.719  1.00 2.65   ? 33  TYR I N   1 
ATOM   10000 C  CA  . TYR I  1 33  ? -12.712 -9.148  -3.204  1.00 3.46   ? 33  TYR I CA  1 
ATOM   10001 C  C   . TYR I  1 33  ? -13.592 -8.292  -2.270  1.00 12.34  ? 33  TYR I C   1 
ATOM   10002 O  O   . TYR I  1 33  ? -14.652 -7.795  -2.663  1.00 11.89  ? 33  TYR I O   1 
ATOM   10003 C  CB  . TYR I  1 33  ? -13.431 -10.461 -3.469  1.00 3.37   ? 33  TYR I CB  1 
ATOM   10004 C  CG  . TYR I  1 33  ? -12.943 -11.119 -4.761  1.00 5.72   ? 33  TYR I CG  1 
ATOM   10005 C  CD1 . TYR I  1 33  ? -13.222 -10.521 -5.995  1.00 12.49  ? 33  TYR I CD1 1 
ATOM   10006 C  CD2 . TYR I  1 33  ? -12.210 -12.314 -4.712  1.00 1.70   ? 33  TYR I CD2 1 
ATOM   10007 C  CE1 . TYR I  1 33  ? -12.776 -11.114 -7.182  1.00 11.54  ? 33  TYR I CE1 1 
ATOM   10008 C  CE2 . TYR I  1 33  ? -11.763 -12.908 -5.901  1.00 6.09   ? 33  TYR I CE2 1 
ATOM   10009 C  CZ  . TYR I  1 33  ? -12.047 -12.307 -7.136  1.00 16.15  ? 33  TYR I CZ  1 
ATOM   10010 O  OH  . TYR I  1 33  ? -11.614 -12.882 -8.291  1.00 13.25  ? 33  TYR I OH  1 
ATOM   10011 N  N   . MET I  1 34  ? -13.210 -8.082  -1.039  1.00 7.60   ? 34  MET I N   1 
ATOM   10012 C  CA  . MET I  1 34  ? -14.066 -7.285  -0.137  1.00 3.74   ? 34  MET I CA  1 
ATOM   10013 C  C   . MET I  1 34  ? -14.255 -5.859  -0.663  1.00 3.48   ? 34  MET I C   1 
ATOM   10014 O  O   . MET I  1 34  ? -13.375 -5.263  -1.302  1.00 5.44   ? 34  MET I O   1 
ATOM   10015 C  CB  . MET I  1 34  ? -13.437 -7.205  1.250   1.00 7.25   ? 34  MET I CB  1 
ATOM   10016 C  CG  . MET I  1 34  ? -12.070 -6.529  1.234   1.00 14.04  ? 34  MET I CG  1 
ATOM   10017 S  SD  . MET I  1 34  ? -11.363 -6.348  2.853   1.00 19.82  ? 34  MET I SD  1 
ATOM   10018 C  CE  . MET I  1 34  ? -11.589 -7.856  3.766   1.00 15.94  ? 34  MET I CE  1 
ATOM   10019 N  N   . ARG I  1 35  ? -15.415 -5.300  -0.332  1.00 9.62   ? 35  ARG I N   1 
ATOM   10020 C  CA  . ARG I  1 35  ? -15.809 -3.927  -0.660  1.00 10.37  ? 35  ARG I CA  1 
ATOM   10021 C  C   . ARG I  1 35  ? -16.712 -3.487  0.461   1.00 11.85  ? 35  ARG I C   1 
ATOM   10022 O  O   . ARG I  1 35  ? -17.302 -4.333  1.142   1.00 16.23  ? 35  ARG I O   1 
ATOM   10023 C  CB  . ARG I  1 35  ? -16.625 -3.820  -1.936  1.00 7.78   ? 35  ARG I CB  1 
ATOM   10024 C  CG  . ARG I  1 35  ? -15.852 -4.252  -3.144  1.00 14.70  ? 35  ARG I CG  1 
ATOM   10025 C  CD  . ARG I  1 35  ? -16.708 -3.894  -4.302  1.00 5.01   ? 35  ARG I CD  1 
ATOM   10026 N  NE  . ARG I  1 35  ? -16.076 -4.330  -5.540  1.00 22.75  ? 35  ARG I NE  1 
ATOM   10027 C  CZ  . ARG I  1 35  ? -16.698 -4.411  -6.715  1.00 35.93  ? 35  ARG I CZ  1 
ATOM   10028 N  NH1 . ARG I  1 35  ? -17.996 -4.117  -6.786  1.00 42.95  ? 35  ARG I NH1 1 
ATOM   10029 N  NH2 . ARG I  1 35  ? -16.024 -4.807  -7.793  1.00 30.69  ? 35  ARG I NH2 1 
ATOM   10030 N  N   . GLY I  1 36  ? -16.750 -2.182  0.685   1.00 8.20   ? 36  GLY I N   1 
ATOM   10031 C  CA  . GLY I  1 36  ? -17.549 -1.663  1.792   1.00 7.63   ? 36  GLY I CA  1 
ATOM   10032 C  C   . GLY I  1 36  ? -16.750 -0.707  2.664   1.00 13.28  ? 36  GLY I C   1 
ATOM   10033 O  O   . GLY I  1 36  ? -15.535 -0.630  2.578   1.00 11.70  ? 36  GLY I O   1 
ATOM   10034 N  N   . HIS I  1 37  ? -17.469 -0.014  3.535   1.00 10.33  ? 37  HIS I N   1 
ATOM   10035 C  CA  . HIS I  1 37  ? -16.876 0.975   4.412   1.00 13.60  ? 37  HIS I CA  1 
ATOM   10036 C  C   . HIS I  1 37  ? -15.776 0.415   5.316   1.00 17.79  ? 37  HIS I C   1 
ATOM   10037 O  O   . HIS I  1 37  ? -14.873 1.139   5.776   1.00 16.35  ? 37  HIS I O   1 
ATOM   10038 C  CB  . HIS I  1 37  ? -17.986 1.684   5.201   1.00 19.26  ? 37  HIS I CB  1 
ATOM   10039 C  CG  . HIS I  1 37  ? -18.816 2.597   4.358   1.00 31.78  ? 37  HIS I CG  1 
ATOM   10040 N  ND1 . HIS I  1 37  ? -18.916 3.956   4.573   1.00 40.14  ? 37  HIS I ND1 1 
ATOM   10041 C  CD2 . HIS I  1 37  ? -19.529 2.357   3.236   1.00 48.46  ? 37  HIS I CD2 1 
ATOM   10042 C  CE1 . HIS I  1 37  ? -19.680 4.500   3.667   1.00 45.95  ? 37  HIS I CE1 1 
ATOM   10043 N  NE2 . HIS I  1 37  ? -20.061 3.552   2.817   1.00 49.21  ? 37  HIS I NE2 1 
ATOM   10044 N  N   . ASN I  1 38  ? -15.839 -0.888  5.544   1.00 12.75  ? 38  ASN I N   1 
ATOM   10045 C  CA  . ASN I  1 38  ? -14.826 -1.517  6.370   1.00 14.27  ? 38  ASN I CA  1 
ATOM   10046 C  C   . ASN I  1 38  ? -13.626 -2.017  5.580   1.00 17.71  ? 38  ASN I C   1 
ATOM   10047 O  O   . ASN I  1 38  ? -12.762 -2.711  6.130   1.00 16.52  ? 38  ASN I O   1 
ATOM   10048 C  CB  . ASN I  1 38  ? -15.436 -2.644  7.183   1.00 14.31  ? 38  ASN I CB  1 
ATOM   10049 C  CG  . ASN I  1 38  ? -16.615 -2.158  7.973   1.00 33.49  ? 38  ASN I CG  1 
ATOM   10050 O  OD1 . ASN I  1 38  ? -17.743 -2.541  7.695   1.00 37.34  ? 38  ASN I OD1 1 
ATOM   10051 N  ND2 . ASN I  1 38  ? -16.374 -1.225  8.888   1.00 16.55  ? 38  ASN I ND2 1 
ATOM   10052 N  N   . PHE I  1 39  ? -13.571 -1.635  4.311   1.00 6.85   ? 39  PHE I N   1 
ATOM   10053 C  CA  . PHE I  1 39  ? -12.469 -2.101  3.478   1.00 4.51   ? 39  PHE I CA  1 
ATOM   10054 C  C   . PHE I  1 39  ? -11.048 -1.929  4.037   1.00 7.08   ? 39  PHE I C   1 
ATOM   10055 O  O   . PHE I  1 39  ? -10.283 -2.890  4.193   1.00 6.56   ? 39  PHE I O   1 
ATOM   10056 C  CB  . PHE I  1 39  ? -12.534 -1.483  2.095   1.00 1.00   ? 39  PHE I CB  1 
ATOM   10057 C  CG  . PHE I  1 39  ? -11.389 -1.910  1.250   1.00 3.06   ? 39  PHE I CG  1 
ATOM   10058 C  CD1 . PHE I  1 39  ? -11.409 -3.150  0.616   1.00 1.71   ? 39  PHE I CD1 1 
ATOM   10059 C  CD2 . PHE I  1 39  ? -10.257 -1.099  1.158   1.00 4.70   ? 39  PHE I CD2 1 
ATOM   10060 C  CE1 . PHE I  1 39  ? -10.311 -3.559  -0.159  1.00 1.00   ? 39  PHE I CE1 1 
ATOM   10061 C  CE2 . PHE I  1 39  ? -9.135  -1.478  0.365   1.00 4.88   ? 39  PHE I CE2 1 
ATOM   10062 C  CZ  . PHE I  1 39  ? -9.154  -2.734  -0.271  1.00 2.10   ? 39  PHE I CZ  1 
ATOM   10063 N  N   . PHE I  1 40  ? -10.681 -0.692  4.335   1.00 1.40   ? 40  PHE I N   1 
ATOM   10064 C  CA  . PHE I  1 40  ? -9.318  -0.536  4.802   1.00 6.75   ? 40  PHE I CA  1 
ATOM   10065 C  C   . PHE I  1 40  ? -8.910  -1.362  5.999   1.00 17.08  ? 40  PHE I C   1 
ATOM   10066 O  O   . PHE I  1 40  ? -7.900  -2.060  6.012   1.00 12.75  ? 40  PHE I O   1 
ATOM   10067 C  CB  . PHE I  1 40  ? -9.075  0.942   5.034   1.00 4.26   ? 40  PHE I CB  1 
ATOM   10068 C  CG  . PHE I  1 40  ? -9.139  1.721   3.769   1.00 3.15   ? 40  PHE I CG  1 
ATOM   10069 C  CD1 . PHE I  1 40  ? -8.103  1.616   2.858   1.00 1.56   ? 40  PHE I CD1 1 
ATOM   10070 C  CD2 . PHE I  1 40  ? -10.239 2.525   3.511   1.00 5.43   ? 40  PHE I CD2 1 
ATOM   10071 C  CE1 . PHE I  1 40  ? -8.146  2.328   1.680   1.00 5.16   ? 40  PHE I CE1 1 
ATOM   10072 C  CE2 . PHE I  1 40  ? -10.299 3.253   2.333   1.00 7.93   ? 40  PHE I CE2 1 
ATOM   10073 C  CZ  . PHE I  1 40  ? -9.259  3.153   1.398   1.00 2.66   ? 40  PHE I CZ  1 
ATOM   10074 N  N   . THR I  1 41  ? -9.786  -1.350  6.989   1.00 13.83  ? 41  THR I N   1 
ATOM   10075 C  CA  . THR I  1 41  ? -9.475  -2.083  8.196   1.00 12.72  ? 41  THR I CA  1 
ATOM   10076 C  C   . THR I  1 41  ? -9.439  -3.596  7.971   1.00 11.85  ? 41  THR I C   1 
ATOM   10077 O  O   . THR I  1 41  ? -8.446  -4.254  8.356   1.00 11.06  ? 41  THR I O   1 
ATOM   10078 C  CB  . THR I  1 41  ? -10.328 -1.525  9.375   1.00 34.80  ? 41  THR I CB  1 
ATOM   10079 O  OG1 . THR I  1 41  ? -10.333 -2.438  10.474  1.00 53.99  ? 41  THR I OG1 1 
ATOM   10080 C  CG2 . THR I  1 41  ? -11.744 -1.118  8.940   1.00 68.09  ? 41  THR I CG2 1 
ATOM   10081 N  N   . LEU I  1 42  ? -10.496 -4.134  7.358   1.00 6.58   ? 42  LEU I N   1 
ATOM   10082 C  CA  . LEU I  1 42  ? -10.506 -5.561  7.160   1.00 4.42   ? 42  LEU I CA  1 
ATOM   10083 C  C   . LEU I  1 42  ? -9.452  -5.982  6.153   1.00 10.57  ? 42  LEU I C   1 
ATOM   10084 O  O   . LEU I  1 42  ? -8.911  -7.090  6.233   1.00 10.38  ? 42  LEU I O   1 
ATOM   10085 C  CB  . LEU I  1 42  ? -11.894 -6.037  6.751   1.00 6.46   ? 42  LEU I CB  1 
ATOM   10086 C  CG  . LEU I  1 42  ? -12.788 -6.545  7.875   1.00 12.05  ? 42  LEU I CG  1 
ATOM   10087 C  CD1 . LEU I  1 42  ? -12.267 -6.134  9.220   1.00 9.49   ? 42  LEU I CD1 1 
ATOM   10088 C  CD2 . LEU I  1 42  ? -14.150 -5.908  7.755   1.00 20.95  ? 42  LEU I CD2 1 
ATOM   10089 N  N   . HIS I  1 43  ? -9.177  -5.102  5.191   1.00 3.88   ? 43  HIS I N   1 
ATOM   10090 C  CA  . HIS I  1 43  ? -8.187  -5.460  4.176   1.00 2.96   ? 43  HIS I CA  1 
ATOM   10091 C  C   . HIS I  1 43  ? -6.853  -5.764  4.867   1.00 7.99   ? 43  HIS I C   1 
ATOM   10092 O  O   . HIS I  1 43  ? -6.216  -6.795  4.654   1.00 7.63   ? 43  HIS I O   1 
ATOM   10093 C  CB  . HIS I  1 43  ? -8.015  -4.328  3.194   1.00 2.19   ? 43  HIS I CB  1 
ATOM   10094 C  CG  . HIS I  1 43  ? -7.055  -4.658  2.093   1.00 8.78   ? 43  HIS I CG  1 
ATOM   10095 N  ND1 . HIS I  1 43  ? -7.297  -5.621  1.128   1.00 10.75  ? 43  HIS I ND1 1 
ATOM   10096 C  CD2 . HIS I  1 43  ? -5.832  -4.153  1.798   1.00 10.53  ? 43  HIS I CD2 1 
ATOM   10097 C  CE1 . HIS I  1 43  ? -6.318  -5.628  0.242   1.00 9.75   ? 43  HIS I CE1 1 
ATOM   10098 N  NE2 . HIS I  1 43  ? -5.403  -4.765  0.641   1.00 10.75  ? 43  HIS I NE2 1 
ATOM   10099 N  N   . GLU I  1 44  ? -6.485  -4.881  5.785   1.00 6.21   ? 44  GLU I N   1 
ATOM   10100 C  CA  . GLU I  1 44  ? -5.244  -5.105  6.518   1.00 6.87   ? 44  GLU I CA  1 
ATOM   10101 C  C   . GLU I  1 44  ? -5.369  -6.279  7.501   1.00 8.28   ? 44  GLU I C   1 
ATOM   10102 O  O   . GLU I  1 44  ? -4.469  -7.112  7.618   1.00 9.31   ? 44  GLU I O   1 
ATOM   10103 C  CB  . GLU I  1 44  ? -4.808  -3.806  7.212   1.00 9.22   ? 44  GLU I CB  1 
ATOM   10104 C  CG  . GLU I  1 44  ? -4.723  -2.602  6.264   1.00 78.53  ? 44  GLU I CG  1 
ATOM   10105 C  CD  . GLU I  1 44  ? -4.777  -1.248  6.956   0.00 100.00 ? 44  GLU I CD  1 
ATOM   10106 O  OE1 . GLU I  1 44  ? -4.750  -1.218  8.200   1.00 99.97  ? 44  GLU I OE1 1 
ATOM   10107 O  OE2 . GLU I  1 44  ? -4.876  -0.219  6.262   0.00 100.00 ? 44  GLU I OE2 1 
ATOM   10108 N  N   . LYS I  1 45  ? -6.502  -6.411  8.176   1.00 3.32   ? 45  LYS I N   1 
ATOM   10109 C  CA  . LYS I  1 45  ? -6.670  -7.525  9.104   1.00 2.82   ? 45  LYS I CA  1 
ATOM   10110 C  C   . LYS I  1 45  ? -6.468  -8.854  8.363   1.00 4.10   ? 45  LYS I C   1 
ATOM   10111 O  O   . LYS I  1 45  ? -5.980  -9.828  8.943   1.00 5.10   ? 45  LYS I O   1 
ATOM   10112 C  CB  . LYS I  1 45  ? -8.086  -7.508  9.697   1.00 7.14   ? 45  LYS I CB  1 
ATOM   10113 C  CG  . LYS I  1 45  ? -8.128  -8.315  10.988  1.00 28.19  ? 45  LYS I CG  1 
ATOM   10114 C  CD  . LYS I  1 45  ? -7.412  -7.529  12.074  1.00 53.16  ? 45  LYS I CD  1 
ATOM   10115 C  CE  . LYS I  1 45  ? -6.868  -8.402  13.207  1.00 91.39  ? 45  LYS I CE  1 
ATOM   10116 N  NZ  . LYS I  1 45  ? -7.844  -9.235  13.976  1.00 78.25  ? 45  LYS I NZ  1 
ATOM   10117 N  N   . MET I  1 46  ? -6.872  -8.927  7.096   1.00 2.18   ? 46  MET I N   1 
ATOM   10118 C  CA  . MET I  1 46  ? -6.709  -10.180 6.381   1.00 1.53   ? 46  MET I CA  1 
ATOM   10119 C  C   . MET I  1 46  ? -5.235  -10.446 6.142   1.00 7.12   ? 46  MET I C   1 
ATOM   10120 O  O   . MET I  1 46  ? -4.732  -11.577 6.213   1.00 13.08  ? 46  MET I O   1 
ATOM   10121 C  CB  . MET I  1 46  ? -7.504  -10.194 5.072   1.00 1.57   ? 46  MET I CB  1 
ATOM   10122 C  CG  . MET I  1 46  ? -9.027  -10.196 5.293   1.00 2.75   ? 46  MET I CG  1 
ATOM   10123 S  SD  . MET I  1 46  ? -9.628  -11.531 6.382   1.00 10.24  ? 46  MET I SD  1 
ATOM   10124 C  CE  . MET I  1 46  ? -9.785  -10.744 8.032   1.00 2.84   ? 46  MET I CE  1 
ATOM   10125 N  N   . ASP I  1 47  ? -4.523  -9.356  5.911   1.00 3.36   ? 47  ASP I N   1 
ATOM   10126 C  CA  . ASP I  1 47  ? -3.091  -9.581  5.720   1.00 9.05   ? 47  ASP I CA  1 
ATOM   10127 C  C   . ASP I  1 47  ? -2.481  -10.258 6.956   1.00 7.72   ? 47  ASP I C   1 
ATOM   10128 O  O   . ASP I  1 47  ? -1.726  -11.233 6.852   1.00 9.96   ? 47  ASP I O   1 
ATOM   10129 C  CB  . ASP I  1 47  ? -2.324  -8.320  5.296   1.00 15.78  ? 47  ASP I CB  1 
ATOM   10130 C  CG  . ASP I  1 47  ? -2.235  -8.147  3.773   1.00 77.49  ? 47  ASP I CG  1 
ATOM   10131 O  OD1 . ASP I  1 47  ? -2.380  -9.133  3.029   1.00 89.68  ? 47  ASP I OD1 1 
ATOM   10132 O  OD2 . ASP I  1 47  ? -1.939  -7.018  3.345   1.00 98.93  ? 47  ASP I OD2 1 
ATOM   10133 N  N   . ASP I  1 48  ? -2.924  -9.820  8.132   1.00 5.25   ? 48  ASP I N   1 
ATOM   10134 C  CA  . ASP I  1 48  ? -2.418  -10.328 9.399   1.00 7.67   ? 48  ASP I CA  1 
ATOM   10135 C  C   . ASP I  1 48  ? -2.840  -11.781 9.581   1.00 10.83  ? 48  ASP I C   1 
ATOM   10136 O  O   . ASP I  1 48  ? -2.029  -12.609 10.035  1.00 8.16   ? 48  ASP I O   1 
ATOM   10137 C  CB  . ASP I  1 48  ? -2.875  -9.439  10.553  1.00 13.51  ? 48  ASP I CB  1 
ATOM   10138 C  CG  . ASP I  1 48  ? -2.379  -7.999  10.434  1.00 51.63  ? 48  ASP I CG  1 
ATOM   10139 O  OD1 . ASP I  1 48  ? -1.367  -7.780  9.727   1.00 53.81  ? 48  ASP I OD1 1 
ATOM   10140 O  OD2 . ASP I  1 48  ? -3.014  -7.109  11.051  1.00 81.62  ? 48  ASP I OD2 1 
ATOM   10141 N  N   . LEU I  1 49  ? -4.082  -12.080 9.215   1.00 4.33   ? 49  LEU I N   1 
ATOM   10142 C  CA  . LEU I  1 49  ? -4.534  -13.465 9.312   1.00 5.11   ? 49  LEU I CA  1 
ATOM   10143 C  C   . LEU I  1 49  ? -3.757  -14.380 8.359   1.00 2.22   ? 49  LEU I C   1 
ATOM   10144 O  O   . LEU I  1 49  ? -3.332  -15.495 8.698   1.00 4.87   ? 49  LEU I O   1 
ATOM   10145 C  CB  . LEU I  1 49  ? -6.013  -13.538 8.976   1.00 3.02   ? 49  LEU I CB  1 
ATOM   10146 C  CG  . LEU I  1 49  ? -6.931  -13.913 10.137  1.00 7.48   ? 49  LEU I CG  1 
ATOM   10147 C  CD1 . LEU I  1 49  ? -6.601  -12.988 11.312  1.00 3.20   ? 49  LEU I CD1 1 
ATOM   10148 C  CD2 . LEU I  1 49  ? -8.304  -13.613 9.553   1.00 8.46   ? 49  LEU I CD2 1 
ATOM   10149 N  N   . TYR I  1 50  ? -3.545  -13.834 7.169   1.00 1.00   ? 50  TYR I N   1 
ATOM   10150 C  CA  . TYR I  1 50  ? -2.779  -14.566 6.171   1.00 3.23   ? 50  TYR I CA  1 
ATOM   10151 C  C   . TYR I  1 50  ? -1.389  -14.969 6.713   1.00 8.65   ? 50  TYR I C   1 
ATOM   10152 O  O   . TYR I  1 50  ? -0.940  -16.109 6.681   1.00 9.69   ? 50  TYR I O   1 
ATOM   10153 C  CB  . TYR I  1 50  ? -2.610  -13.720 4.903   1.00 3.25   ? 50  TYR I CB  1 
ATOM   10154 C  CG  . TYR I  1 50  ? -2.004  -14.533 3.780   1.00 10.84  ? 50  TYR I CG  1 
ATOM   10155 C  CD1 . TYR I  1 50  ? -0.627  -14.630 3.620   1.00 13.62  ? 50  TYR I CD1 1 
ATOM   10156 C  CD2 . TYR I  1 50  ? -2.803  -15.260 2.896   1.00 17.06  ? 50  TYR I CD2 1 
ATOM   10157 C  CE1 . TYR I  1 50  ? -0.062  -15.428 2.616   1.00 28.57  ? 50  TYR I CE1 1 
ATOM   10158 C  CE2 . TYR I  1 50  ? -2.264  -16.011 1.847   1.00 21.61  ? 50  TYR I CE2 1 
ATOM   10159 C  CZ  . TYR I  1 50  ? -0.887  -16.109 1.713   1.00 38.28  ? 50  TYR I CZ  1 
ATOM   10160 O  OH  . TYR I  1 50  ? -0.371  -16.862 0.668   1.00 33.31  ? 50  TYR I OH  1 
ATOM   10161 N  N   . SER I  1 51  ? -0.656  -14.007 7.233   1.00 4.54   ? 51  SER I N   1 
ATOM   10162 C  CA  . SER I  1 51  ? 0.642   -14.373 7.768   1.00 6.67   ? 51  SER I CA  1 
ATOM   10163 C  C   . SER I  1 51  ? 0.518   -15.305 8.960   1.00 5.39   ? 51  SER I C   1 
ATOM   10164 O  O   . SER I  1 51  ? 1.375   -16.173 9.167   1.00 6.26   ? 51  SER I O   1 
ATOM   10165 C  CB  . SER I  1 51  ? 1.348   -13.083 8.173   1.00 6.35   ? 51  SER I CB  1 
ATOM   10166 O  OG  . SER I  1 51  ? 1.498   -12.212 7.065   1.00 55.61  ? 51  SER I OG  1 
ATOM   10167 N  N   . GLU I  1 52  ? -0.476  -15.074 9.807   1.00 1.00   ? 52  GLU I N   1 
ATOM   10168 C  CA  . GLU I  1 52  ? -0.499  -15.925 10.982  1.00 1.00   ? 52  GLU I CA  1 
ATOM   10169 C  C   . GLU I  1 52  ? -0.793  -17.387 10.689  1.00 6.38   ? 52  GLU I C   1 
ATOM   10170 O  O   . GLU I  1 52  ? -0.153  -18.304 11.207  1.00 3.85   ? 52  GLU I O   1 
ATOM   10171 C  CB  . GLU I  1 52  ? -1.516  -15.368 11.971  1.00 1.63   ? 52  GLU I CB  1 
ATOM   10172 C  CG  . GLU I  1 52  ? -1.830  -16.424 13.023  1.00 17.48  ? 52  GLU I CG  1 
ATOM   10173 C  CD  . GLU I  1 52  ? -2.746  -15.886 14.091  1.00 55.13  ? 52  GLU I CD  1 
ATOM   10174 O  OE1 . GLU I  1 52  ? -3.409  -14.837 13.873  1.00 20.86  ? 52  GLU I OE1 1 
ATOM   10175 O  OE2 . GLU I  1 52  ? -2.745  -16.478 15.187  1.00 27.53  ? 52  GLU I OE2 1 
ATOM   10176 N  N   . PHE I  1 53  ? -1.796  -17.598 9.848   1.00 4.41   ? 53  PHE I N   1 
ATOM   10177 C  CA  . PHE I  1 53  ? -2.178  -18.955 9.496   1.00 1.35   ? 53  PHE I CA  1 
ATOM   10178 C  C   . PHE I  1 53  ? -1.163  -19.637 8.635   1.00 3.77   ? 53  PHE I C   1 
ATOM   10179 O  O   . PHE I  1 53  ? -0.896  -20.804 8.794   1.00 3.66   ? 53  PHE I O   1 
ATOM   10180 C  CB  . PHE I  1 53  ? -3.631  -19.080 9.073   1.00 1.00   ? 53  PHE I CB  1 
ATOM   10181 C  CG  . PHE I  1 53  ? -4.547  -18.894 10.243  1.00 2.42   ? 53  PHE I CG  1 
ATOM   10182 C  CD1 . PHE I  1 53  ? -4.871  -19.964 11.055  1.00 1.00   ? 53  PHE I CD1 1 
ATOM   10183 C  CD2 . PHE I  1 53  ? -4.967  -17.627 10.619  1.00 2.91   ? 53  PHE I CD2 1 
ATOM   10184 C  CE1 . PHE I  1 53  ? -5.650  -19.773 12.189  1.00 6.71   ? 53  PHE I CE1 1 
ATOM   10185 C  CE2 . PHE I  1 53  ? -5.735  -17.405 11.744  1.00 2.90   ? 53  PHE I CE2 1 
ATOM   10186 C  CZ  . PHE I  1 53  ? -6.077  -18.482 12.546  1.00 6.98   ? 53  PHE I CZ  1 
ATOM   10187 N  N   . GLY I  1 54  ? -0.424  -18.821 7.907   1.00 1.16   ? 54  GLY I N   1 
ATOM   10188 C  CA  . GLY I  1 54  ? 0.695   -19.301 7.097   1.00 1.00   ? 54  GLY I CA  1 
ATOM   10189 C  C   . GLY I  1 54  ? 1.801   -19.805 8.016   1.00 6.61   ? 54  GLY I C   1 
ATOM   10190 O  O   . GLY I  1 54  ? 2.431   -20.828 7.765   1.00 8.16   ? 54  GLY I O   1 
ATOM   10191 N  N   . GLU I  1 55  ? 2.007   -19.140 9.140   1.00 3.02   ? 55  GLU I N   1 
ATOM   10192 C  CA  . GLU I  1 55  ? 3.009   -19.653 10.051  1.00 6.57   ? 55  GLU I CA  1 
ATOM   10193 C  C   . GLU I  1 55  ? 2.510   -20.873 10.777  1.00 8.93   ? 55  GLU I C   1 
ATOM   10194 O  O   . GLU I  1 55  ? 3.325   -21.719 11.097  1.00 12.18  ? 55  GLU I O   1 
ATOM   10195 C  CB  . GLU I  1 55  ? 3.429   -18.627 11.125  1.00 13.19  ? 55  GLU I CB  1 
ATOM   10196 C  CG  . GLU I  1 55  ? 4.293   -17.445 10.659  1.00 68.16  ? 55  GLU I CG  1 
ATOM   10197 C  CD  . GLU I  1 55  ? 4.632   -16.509 11.807  0.00 100.00 ? 55  GLU I CD  1 
ATOM   10198 O  OE1 . GLU I  1 55  ? 4.195   -16.717 12.943  0.00 100.00 ? 55  GLU I OE1 1 
ATOM   10199 O  OE2 . GLU I  1 55  ? 5.356   -15.537 11.570  0.00 100.00 ? 55  GLU I OE2 1 
ATOM   10200 N  N   . GLN I  1 56  ? 1.218   -20.955 11.083  1.00 5.60   ? 56  GLN I N   1 
ATOM   10201 C  CA  . GLN I  1 56  ? 0.701   -22.153 11.752  1.00 3.93   ? 56  GLN I CA  1 
ATOM   10202 C  C   . GLN I  1 56  ? 0.983   -23.318 10.839  1.00 3.58   ? 56  GLN I C   1 
ATOM   10203 O  O   . GLN I  1 56  ? 1.382   -24.415 11.239  1.00 2.35   ? 56  GLN I O   1 
ATOM   10204 C  CB  . GLN I  1 56  ? -0.825  -22.133 11.928  1.00 5.27   ? 56  GLN I CB  1 
ATOM   10205 C  CG  . GLN I  1 56  ? -1.210  -21.499 13.233  1.00 18.02  ? 56  GLN I CG  1 
ATOM   10206 C  CD  . GLN I  1 56  ? -2.669  -21.615 13.611  1.00 28.34  ? 56  GLN I CD  1 
ATOM   10207 O  OE1 . GLN I  1 56  ? -3.374  -22.524 13.188  1.00 13.31  ? 56  GLN I OE1 1 
ATOM   10208 N  NE2 . GLN I  1 56  ? -3.135  -20.679 14.427  1.00 12.35  ? 56  GLN I NE2 1 
ATOM   10209 N  N   . MET I  1 57  ? 0.711   -23.033 9.586   1.00 1.00   ? 57  MET I N   1 
ATOM   10210 C  CA  . MET I  1 57  ? 0.870   -24.048 8.583   1.00 1.00   ? 57  MET I CA  1 
ATOM   10211 C  C   . MET I  1 57  ? 2.281   -24.569 8.551   1.00 4.33   ? 57  MET I C   1 
ATOM   10212 O  O   . MET I  1 57  ? 2.444   -25.779 8.686   1.00 10.98  ? 57  MET I O   1 
ATOM   10213 C  CB  . MET I  1 57  ? 0.459   -23.471 7.242   1.00 4.06   ? 57  MET I CB  1 
ATOM   10214 C  CG  . MET I  1 57  ? 0.126   -24.527 6.217   1.00 9.29   ? 57  MET I CG  1 
ATOM   10215 S  SD  . MET I  1 57  ? 1.599   -24.922 5.334   1.00 17.25  ? 57  MET I SD  1 
ATOM   10216 C  CE  . MET I  1 57  ? 1.720   -23.434 4.332   1.00 7.78   ? 57  MET I CE  1 
ATOM   10217 N  N   . ASP I  1 58  ? 3.293   -23.713 8.415   1.00 1.52   ? 58  ASP I N   1 
ATOM   10218 C  CA  . ASP I  1 58  ? 4.682   -24.171 8.380   1.00 2.04   ? 58  ASP I CA  1 
ATOM   10219 C  C   . ASP I  1 58  ? 5.078   -24.905 9.648   1.00 2.66   ? 58  ASP I C   1 
ATOM   10220 O  O   . ASP I  1 58  ? 5.803   -25.897 9.605   1.00 1.86   ? 58  ASP I O   1 
ATOM   10221 C  CB  . ASP I  1 58  ? 5.644   -23.029 8.109   1.00 5.90   ? 58  ASP I CB  1 
ATOM   10222 C  CG  . ASP I  1 58  ? 6.981   -23.514 7.615   1.00 15.54  ? 58  ASP I CG  1 
ATOM   10223 O  OD1 . ASP I  1 58  ? 7.036   -24.232 6.595   1.00 23.36  ? 58  ASP I OD1 1 
ATOM   10224 O  OD2 . ASP I  1 58  ? 8.004   -23.075 8.180   1.00 19.64  ? 58  ASP I OD2 1 
ATOM   10225 N  N   . GLU I  1 59  ? 4.539   -24.477 10.785  1.00 3.82   ? 59  GLU I N   1 
ATOM   10226 C  CA  . GLU I  1 59  ? 4.855   -25.150 12.051  1.00 4.68   ? 59  GLU I CA  1 
ATOM   10227 C  C   . GLU I  1 59  ? 4.231   -26.532 12.147  1.00 4.88   ? 59  GLU I C   1 
ATOM   10228 O  O   . GLU I  1 59  ? 4.765   -27.495 12.694  1.00 4.41   ? 59  GLU I O   1 
ATOM   10229 C  CB  . GLU I  1 59  ? 4.412   -24.330 13.289  1.00 7.95   ? 59  GLU I CB  1 
ATOM   10230 C  CG  . GLU I  1 59  ? 5.111   -22.998 13.571  1.00 47.71  ? 59  GLU I CG  1 
ATOM   10231 C  CD  . GLU I  1 59  ? 4.675   -22.326 14.829  0.00 100.00 ? 59  GLU I CD  1 
ATOM   10232 O  OE1 . GLU I  1 59  ? 4.384   -23.016 15.823  0.00 100.00 ? 59  GLU I OE1 1 
ATOM   10233 O  OE2 . GLU I  1 59  ? 4.716   -21.075 14.868  0.00 100.00 ? 59  GLU I OE2 1 
ATOM   10234 N  N   . VAL I  1 60  ? 3.001   -26.627 11.685  1.00 3.12   ? 60  VAL I N   1 
ATOM   10235 C  CA  . VAL I  1 60  ? 2.374   -27.922 11.763  1.00 1.73   ? 60  VAL I CA  1 
ATOM   10236 C  C   . VAL I  1 60  ? 3.205   -28.842 10.860  1.00 3.84   ? 60  VAL I C   1 
ATOM   10237 O  O   . VAL I  1 60  ? 3.666   -29.902 11.286  1.00 7.23   ? 60  VAL I O   1 
ATOM   10238 C  CB  . VAL I  1 60  ? 0.914   -27.758 11.276  1.00 6.38   ? 60  VAL I CB  1 
ATOM   10239 C  CG1 . VAL I  1 60  ? 0.307   -29.113 10.886  1.00 2.50   ? 60  VAL I CG1 1 
ATOM   10240 C  CG2 . VAL I  1 60  ? 0.087   -27.066 12.364  1.00 1.00   ? 60  VAL I CG2 1 
ATOM   10241 N  N   . ALA I  1 61  ? 3.488   -28.399 9.639   1.00 1.27   ? 61  ALA I N   1 
ATOM   10242 C  CA  . ALA I  1 61  ? 4.225   -29.249 8.705   1.00 1.00   ? 61  ALA I CA  1 
ATOM   10243 C  C   . ALA I  1 61  ? 5.582   -29.624 9.259   1.00 7.95   ? 61  ALA I C   1 
ATOM   10244 O  O   . ALA I  1 61  ? 5.995   -30.771 9.162   1.00 7.99   ? 61  ALA I O   1 
ATOM   10245 C  CB  . ALA I  1 61  ? 4.381   -28.557 7.382   1.00 1.00   ? 61  ALA I CB  1 
ATOM   10246 N  N   . GLU I  1 62  ? 6.240   -28.662 9.904   1.00 4.23   ? 62  GLU I N   1 
ATOM   10247 C  CA  . GLU I  1 62  ? 7.560   -28.933 10.502  1.00 2.98   ? 62  GLU I CA  1 
ATOM   10248 C  C   . GLU I  1 62  ? 7.480   -29.844 11.743  1.00 8.94   ? 62  GLU I C   1 
ATOM   10249 O  O   . GLU I  1 62  ? 8.379   -30.657 11.985  1.00 6.96   ? 62  GLU I O   1 
ATOM   10250 C  CB  . GLU I  1 62  ? 8.418   -27.670 10.646  1.00 2.73   ? 62  GLU I CB  1 
ATOM   10251 C  CG  . GLU I  1 62  ? 8.775   -27.071 9.270   1.00 9.44   ? 62  GLU I CG  1 
ATOM   10252 C  CD  . GLU I  1 62  ? 9.547   -25.762 9.299   1.00 10.64  ? 62  GLU I CD  1 
ATOM   10253 O  OE1 . GLU I  1 62  ? 9.799   -25.245 10.406  1.00 42.27  ? 62  GLU I OE1 1 
ATOM   10254 O  OE2 . GLU I  1 62  ? 9.880   -25.257 8.204   1.00 21.73  ? 62  GLU I OE2 1 
ATOM   10255 N  N   . ARG I  1 63  ? 6.368   -29.767 12.472  1.00 3.71   ? 63  ARG I N   1 
ATOM   10256 C  CA  . ARG I  1 63  ? 6.189   -30.622 13.630  1.00 3.73   ? 63  ARG I CA  1 
ATOM   10257 C  C   . ARG I  1 63  ? 5.987   -32.040 13.145  1.00 7.83   ? 63  ARG I C   1 
ATOM   10258 O  O   . ARG I  1 63  ? 6.471   -32.981 13.762  1.00 5.98   ? 63  ARG I O   1 
ATOM   10259 C  CB  . ARG I  1 63  ? 4.985   -30.196 14.461  1.00 1.00   ? 63  ARG I CB  1 
ATOM   10260 C  CG  . ARG I  1 63  ? 4.719   -31.093 15.640  1.00 1.00   ? 63  ARG I CG  1 
ATOM   10261 C  CD  . ARG I  1 63  ? 5.942   -31.368 16.490  1.00 3.07   ? 63  ARG I CD  1 
ATOM   10262 N  NE  . ARG I  1 63  ? 5.704   -32.294 17.591  1.00 5.27   ? 63  ARG I NE  1 
ATOM   10263 C  CZ  . ARG I  1 63  ? 6.627   -32.913 18.325  1.00 7.30   ? 63  ARG I CZ  1 
ATOM   10264 N  NH1 . ARG I  1 63  ? 7.918   -32.682 18.086  1.00 2.60   ? 63  ARG I NH1 1 
ATOM   10265 N  NH2 . ARG I  1 63  ? 6.305   -33.785 19.280  1.00 1.57   ? 63  ARG I NH2 1 
ATOM   10266 N  N   . LEU I  1 64  ? 5.321   -32.149 11.993  1.00 1.32   ? 64  LEU I N   1 
ATOM   10267 C  CA  . LEU I  1 64  ? 5.020   -33.442 11.384  1.00 4.05   ? 64  LEU I CA  1 
ATOM   10268 C  C   . LEU I  1 64  ? 6.317   -34.125 10.941  1.00 12.39  ? 64  LEU I C   1 
ATOM   10269 O  O   . LEU I  1 64  ? 6.591   -35.308 11.195  1.00 10.89  ? 64  LEU I O   1 
ATOM   10270 C  CB  . LEU I  1 64  ? 4.102   -33.244 10.171  1.00 1.05   ? 64  LEU I CB  1 
ATOM   10271 C  CG  . LEU I  1 64  ? 3.779   -34.518 9.392   1.00 8.98   ? 64  LEU I CG  1 
ATOM   10272 C  CD1 . LEU I  1 64  ? 3.175   -35.628 10.250  1.00 5.53   ? 64  LEU I CD1 1 
ATOM   10273 C  CD2 . LEU I  1 64  ? 2.831   -34.168 8.281   1.00 2.66   ? 64  LEU I CD2 1 
ATOM   10274 N  N   . LEU I  1 65  ? 7.117   -33.319 10.254  1.00 4.45   ? 65  LEU I N   1 
ATOM   10275 C  CA  . LEU I  1 65  ? 8.378   -33.795 9.718   1.00 3.00   ? 65  LEU I CA  1 
ATOM   10276 C  C   . LEU I  1 65  ? 9.208   -34.263 10.907  1.00 8.09   ? 65  LEU I C   1 
ATOM   10277 O  O   . LEU I  1 65  ? 9.807   -35.331 10.908  1.00 7.11   ? 65  LEU I O   1 
ATOM   10278 C  CB  . LEU I  1 65  ? 8.937   -32.503 9.183   1.00 3.60   ? 65  LEU I CB  1 
ATOM   10279 C  CG  . LEU I  1 65  ? 9.589   -32.346 7.830   1.00 10.04  ? 65  LEU I CG  1 
ATOM   10280 C  CD1 . LEU I  1 65  ? 9.010   -33.293 6.854   1.00 2.32   ? 65  LEU I CD1 1 
ATOM   10281 C  CD2 . LEU I  1 65  ? 9.246   -31.008 7.332   1.00 1.19   ? 65  LEU I CD2 1 
ATOM   10282 N  N   . ALA I  1 66  ? 9.174   -33.484 11.985  1.00 6.25   ? 66  ALA I N   1 
ATOM   10283 C  CA  . ALA I  1 66  ? 9.936   -33.800 13.187  1.00 5.06   ? 66  ALA I CA  1 
ATOM   10284 C  C   . ALA I  1 66  ? 9.474   -35.040 13.940  1.00 12.15  ? 66  ALA I C   1 
ATOM   10285 O  O   . ALA I  1 66  ? 10.224  -35.603 14.738  1.00 6.26   ? 66  ALA I O   1 
ATOM   10286 C  CB  . ALA I  1 66  ? 9.990   -32.581 14.102  1.00 4.85   ? 66  ALA I CB  1 
ATOM   10287 N  N   . ILE I  1 67  ? 8.234   -35.474 13.758  1.00 10.79  ? 67  ILE I N   1 
ATOM   10288 C  CA  . ILE I  1 67  ? 7.831   -36.687 14.474  1.00 7.55   ? 67  ILE I CA  1 
ATOM   10289 C  C   . ILE I  1 67  ? 7.926   -37.835 13.492  1.00 17.12  ? 67  ILE I C   1 
ATOM   10290 O  O   . ILE I  1 67  ? 7.364   -38.893 13.712  1.00 14.73  ? 67  ILE I O   1 
ATOM   10291 C  CB  . ILE I  1 67  ? 6.428   -36.659 15.099  1.00 6.98   ? 67  ILE I CB  1 
ATOM   10292 C  CG1 . ILE I  1 67  ? 5.339   -36.398 14.050  1.00 6.42   ? 67  ILE I CG1 1 
ATOM   10293 C  CG2 . ILE I  1 67  ? 6.395   -35.724 16.299  1.00 4.07   ? 67  ILE I CG2 1 
ATOM   10294 C  CD1 . ILE I  1 67  ? 3.963   -36.360 14.626  1.00 28.59  ? 67  ILE I CD1 1 
ATOM   10295 N  N   . GLY I  1 68  ? 8.616   -37.606 12.386  1.00 6.47   ? 68  GLY I N   1 
ATOM   10296 C  CA  . GLY I  1 68  ? 8.848   -38.600 11.353  1.00 1.19   ? 68  GLY I CA  1 
ATOM   10297 C  C   . GLY I  1 68  ? 7.817   -38.657 10.237  1.00 12.69  ? 68  GLY I C   1 
ATOM   10298 O  O   . GLY I  1 68  ? 7.771   -39.633 9.490   1.00 20.14  ? 68  GLY I O   1 
ATOM   10299 N  N   . GLY I  1 69  ? 6.993   -37.629 10.089  1.00 7.27   ? 69  GLY I N   1 
ATOM   10300 C  CA  . GLY I  1 69  ? 5.936   -37.689 9.093   1.00 1.00   ? 69  GLY I CA  1 
ATOM   10301 C  C   . GLY I  1 69  ? 6.377   -37.059 7.787   1.00 5.88   ? 69  GLY I C   1 
ATOM   10302 O  O   . GLY I  1 69  ? 7.532   -36.637 7.674   1.00 7.66   ? 69  GLY I O   1 
ATOM   10303 N  N   . SER I  1 70  ? 5.443   -36.941 6.843   1.00 4.57   ? 70  SER I N   1 
ATOM   10304 C  CA  . SER I  1 70  ? 5.711   -36.388 5.515   1.00 8.44   ? 70  SER I CA  1 
ATOM   10305 C  C   . SER I  1 70  ? 4.507   -35.557 5.074   1.00 16.72  ? 70  SER I C   1 
ATOM   10306 O  O   . SER I  1 70  ? 3.469   -36.062 4.668   1.00 21.50  ? 70  SER I O   1 
ATOM   10307 C  CB  . SER I  1 70  ? 5.932   -37.530 4.507   1.00 12.36  ? 70  SER I CB  1 
ATOM   10308 O  OG  . SER I  1 70  ? 6.947   -38.416 4.927   1.00 33.13  ? 70  SER I OG  1 
ATOM   10309 N  N   . PRO I  1 71  ? 4.645   -34.245 5.120   1.00 13.97  ? 71  PRO I N   1 
ATOM   10310 C  CA  . PRO I  1 71  ? 3.519   -33.392 4.824   1.00 10.00  ? 71  PRO I CA  1 
ATOM   10311 C  C   . PRO I  1 71  ? 3.095   -33.440 3.394   1.00 8.99   ? 71  PRO I C   1 
ATOM   10312 O  O   . PRO I  1 71  ? 3.917   -33.519 2.496   1.00 5.41   ? 71  PRO I O   1 
ATOM   10313 C  CB  . PRO I  1 71  ? 4.078   -31.990 5.060   1.00 9.57   ? 71  PRO I CB  1 
ATOM   10314 C  CG  . PRO I  1 71  ? 5.520   -32.110 4.907   1.00 13.70  ? 71  PRO I CG  1 
ATOM   10315 C  CD  . PRO I  1 71  ? 5.867   -33.487 5.425   1.00 6.77   ? 71  PRO I CD  1 
ATOM   10316 N  N   . PHE I  1 72  ? 1.796   -33.211 3.210   1.00 7.89   ? 72  PHE I N   1 
ATOM   10317 C  CA  . PHE I  1 72  ? 1.316   -33.047 1.860   1.00 4.50   ? 72  PHE I CA  1 
ATOM   10318 C  C   . PHE I  1 72  ? 2.048   -31.811 1.392   1.00 13.01  ? 72  PHE I C   1 
ATOM   10319 O  O   . PHE I  1 72  ? 2.269   -30.881 2.134   1.00 9.71   ? 72  PHE I O   1 
ATOM   10320 C  CB  . PHE I  1 72  ? -0.177  -32.726 1.845   1.00 5.52   ? 72  PHE I CB  1 
ATOM   10321 C  CG  . PHE I  1 72  ? -1.039  -33.839 2.333   1.00 8.58   ? 72  PHE I CG  1 
ATOM   10322 C  CD1 . PHE I  1 72  ? -0.899  -35.108 1.822   1.00 13.68  ? 72  PHE I CD1 1 
ATOM   10323 C  CD2 . PHE I  1 72  ? -1.946  -33.615 3.367   1.00 10.03  ? 72  PHE I CD2 1 
ATOM   10324 C  CE1 . PHE I  1 72  ? -1.702  -36.120 2.300   1.00 18.82  ? 72  PHE I CE1 1 
ATOM   10325 C  CE2 . PHE I  1 72  ? -2.733  -34.621 3.887   1.00 12.07  ? 72  PHE I CE2 1 
ATOM   10326 C  CZ  . PHE I  1 72  ? -2.601  -35.891 3.355   1.00 13.69  ? 72  PHE I CZ  1 
ATOM   10327 N  N   . SER I  1 73  ? 2.305   -31.723 0.106   1.00 6.25   ? 73  SER I N   1 
ATOM   10328 C  CA  . SER I  1 73  ? 2.978   -30.554 -0.430  1.00 1.99   ? 73  SER I CA  1 
ATOM   10329 C  C   . SER I  1 73  ? 2.672   -30.172 -1.895  1.00 7.43   ? 73  SER I C   1 
ATOM   10330 O  O   . SER I  1 73  ? 3.517   -29.689 -2.640  1.00 5.95   ? 73  SER I O   1 
ATOM   10331 C  CB  . SER I  1 73  ? 4.469   -30.763 -0.194  1.00 7.12   ? 73  SER I CB  1 
ATOM   10332 O  OG  . SER I  1 73  ? 4.941   -31.943 -0.832  1.00 12.71  ? 73  SER I OG  1 
ATOM   10333 N  N   . THR I  1 74  ? 1.420   -30.299 -2.312  1.00 3.84   ? 74  THR I N   1 
ATOM   10334 C  CA  . THR I  1 74  ? 0.958   -29.910 -3.644  1.00 4.36   ? 74  THR I CA  1 
ATOM   10335 C  C   . THR I  1 74  ? -0.514  -29.500 -3.452  1.00 6.96   ? 74  THR I C   1 
ATOM   10336 O  O   . THR I  1 74  ? -1.214  -30.087 -2.604  1.00 9.57   ? 74  THR I O   1 
ATOM   10337 C  CB  . THR I  1 74  ? 0.918   -31.159 -4.572  1.00 10.24  ? 74  THR I CB  1 
ATOM   10338 O  OG1 . THR I  1 74  ? 0.129   -32.175 -3.935  1.00 13.08  ? 74  THR I OG1 1 
ATOM   10339 C  CG2 . THR I  1 74  ? 2.328   -31.684 -4.821  1.00 5.49   ? 74  THR I CG2 1 
ATOM   10340 N  N   . LEU I  1 75  ? -0.965  -28.540 -4.256  1.00 3.70   ? 75  LEU I N   1 
ATOM   10341 C  CA  . LEU I  1 75  ? -2.367  -28.123 -4.177  1.00 6.90   ? 75  LEU I CA  1 
ATOM   10342 C  C   . LEU I  1 75  ? -3.290  -29.335 -4.331  1.00 11.75  ? 75  LEU I C   1 
ATOM   10343 O  O   . LEU I  1 75  ? -4.320  -29.465 -3.663  1.00 14.83  ? 75  LEU I O   1 
ATOM   10344 C  CB  . LEU I  1 75  ? -2.704  -27.121 -5.273  1.00 7.58   ? 75  LEU I CB  1 
ATOM   10345 C  CG  . LEU I  1 75  ? -2.108  -25.736 -5.068  1.00 13.59  ? 75  LEU I CG  1 
ATOM   10346 C  CD1 . LEU I  1 75  ? -0.632  -25.892 -5.201  1.00 17.01  ? 75  LEU I CD1 1 
ATOM   10347 C  CD2 . LEU I  1 75  ? -2.564  -24.801 -6.152  1.00 9.57   ? 75  LEU I CD2 1 
ATOM   10348 N  N   . LYS I  1 76  ? -2.895  -30.247 -5.206  1.00 9.98   ? 76  LYS I N   1 
ATOM   10349 C  CA  . LYS I  1 76  ? -3.747  -31.394 -5.440  1.00 10.98  ? 76  LYS I CA  1 
ATOM   10350 C  C   . LYS I  1 76  ? -3.891  -32.157 -4.163  1.00 9.42   ? 76  LYS I C   1 
ATOM   10351 O  O   . LYS I  1 76  ? -4.991  -32.474 -3.744  1.00 10.13  ? 76  LYS I O   1 
ATOM   10352 C  CB  . LYS I  1 76  ? -3.118  -32.288 -6.503  1.00 15.78  ? 76  LYS I CB  1 
ATOM   10353 C  CG  . LYS I  1 76  ? -3.921  -33.573 -6.754  1.00 50.55  ? 76  LYS I CG  1 
ATOM   10354 C  CD  . LYS I  1 76  ? -3.467  -34.233 -8.049  1.00 99.56  ? 76  LYS I CD  1 
ATOM   10355 C  CE  . LYS I  1 76  ? -4.181  -35.538 -8.353  1.00 99.97  ? 76  LYS I CE  1 
ATOM   10356 N  NZ  . LYS I  1 76  ? -3.755  -36.591 -7.391  0.00 100.00 ? 76  LYS I NZ  1 
ATOM   10357 N  N   . GLU I  1 77  ? -2.787  -32.410 -3.486  1.00 7.94   ? 77  GLU I N   1 
ATOM   10358 C  CA  . GLU I  1 77  ? -2.974  -33.113 -2.224  1.00 6.98   ? 77  GLU I CA  1 
ATOM   10359 C  C   . GLU I  1 77  ? -3.821  -32.370 -1.195  1.00 11.11  ? 77  GLU I C   1 
ATOM   10360 O  O   . GLU I  1 77  ? -4.616  -33.015 -0.478  1.00 10.66  ? 77  GLU I O   1 
ATOM   10361 C  CB  . GLU I  1 77  ? -1.621  -33.400 -1.591  1.00 8.75   ? 77  GLU I CB  1 
ATOM   10362 C  CG  . GLU I  1 77  ? -0.806  -34.427 -2.345  1.00 11.40  ? 77  GLU I CG  1 
ATOM   10363 C  CD  . GLU I  1 77  ? 0.652   -34.485 -1.888  1.00 34.78  ? 77  GLU I CD  1 
ATOM   10364 O  OE1 . GLU I  1 77  ? 1.336   -33.464 -2.137  1.00 28.11  ? 77  GLU I OE1 1 
ATOM   10365 O  OE2 . GLU I  1 77  ? 1.074   -35.488 -1.247  1.00 30.68  ? 77  GLU I OE2 1 
ATOM   10366 N  N   . PHE I  1 78  ? -3.606  -31.051 -1.124  1.00 7.72   ? 78  PHE I N   1 
ATOM   10367 C  CA  . PHE I  1 78  ? -4.343  -30.199 -0.197  1.00 7.35   ? 78  PHE I CA  1 
ATOM   10368 C  C   . PHE I  1 78  ? -5.823  -30.321 -0.524  1.00 11.91  ? 78  PHE I C   1 
ATOM   10369 O  O   . PHE I  1 78  ? -6.601  -30.623 0.372   1.00 12.33  ? 78  PHE I O   1 
ATOM   10370 C  CB  . PHE I  1 78  ? -3.921  -28.728 -0.257  1.00 6.23   ? 78  PHE I CB  1 
ATOM   10371 C  CG  . PHE I  1 78  ? -2.464  -28.468 0.059   1.00 4.35   ? 78  PHE I CG  1 
ATOM   10372 C  CD1 . PHE I  1 78  ? -1.744  -29.332 0.843   1.00 3.67   ? 78  PHE I CD1 1 
ATOM   10373 C  CD2 . PHE I  1 78  ? -1.813  -27.379 -0.496  1.00 4.23   ? 78  PHE I CD2 1 
ATOM   10374 C  CE1 . PHE I  1 78  ? -0.405  -29.074 1.134   1.00 7.31   ? 78  PHE I CE1 1 
ATOM   10375 C  CE2 . PHE I  1 78  ? -0.485  -27.140 -0.218  1.00 1.69   ? 78  PHE I CE2 1 
ATOM   10376 C  CZ  . PHE I  1 78  ? 0.224   -27.991 0.605   1.00 3.78   ? 78  PHE I CZ  1 
ATOM   10377 N  N   . LEU I  1 79  ? -6.179  -30.116 -1.794  1.00 7.99   ? 79  LEU I N   1 
ATOM   10378 C  CA  . LEU I  1 79  ? -7.565  -30.258 -2.248  1.00 13.28  ? 79  LEU I CA  1 
ATOM   10379 C  C   . LEU I  1 79  ? -8.164  -31.608 -1.903  1.00 21.75  ? 79  LEU I C   1 
ATOM   10380 O  O   . LEU I  1 79  ? -9.257  -31.740 -1.354  1.00 18.03  ? 79  LEU I O   1 
ATOM   10381 C  CB  . LEU I  1 79  ? -7.670  -30.103 -3.745  1.00 15.57  ? 79  LEU I CB  1 
ATOM   10382 C  CG  . LEU I  1 79  ? -7.804  -28.613 -3.990  1.00 25.19  ? 79  LEU I CG  1 
ATOM   10383 C  CD1 . LEU I  1 79  ? -7.965  -28.308 -5.457  1.00 19.43  ? 79  LEU I CD1 1 
ATOM   10384 C  CD2 . LEU I  1 79  ? -9.052  -28.209 -3.247  1.00 27.59  ? 79  LEU I CD2 1 
ATOM   10385 N  N   . GLU I  1 80  ? -7.389  -32.651 -2.138  1.00 16.61  ? 80  GLU I N   1 
ATOM   10386 C  CA  . GLU I  1 80  ? -7.891  -33.961 -1.813  1.00 17.03  ? 80  GLU I CA  1 
ATOM   10387 C  C   . GLU I  1 80  ? -8.089  -34.162 -0.357  1.00 24.97  ? 80  GLU I C   1 
ATOM   10388 O  O   . GLU I  1 80  ? -8.896  -34.998 0.038   1.00 38.75  ? 80  GLU I O   1 
ATOM   10389 C  CB  . GLU I  1 80  ? -6.937  -35.043 -2.341  1.00 18.24  ? 80  GLU I CB  1 
ATOM   10390 C  CG  . GLU I  1 80  ? -6.788  -34.933 -3.853  1.00 63.07  ? 80  GLU I CG  1 
ATOM   10391 C  CD  . GLU I  1 80  ? -5.879  -35.946 -4.456  0.00 100.00 ? 80  GLU I CD  1 
ATOM   10392 O  OE1 . GLU I  1 80  ? -5.067  -36.511 -3.706  0.00 100.00 ? 80  GLU I OE1 1 
ATOM   10393 O  OE2 . GLU I  1 80  ? -5.961  -36.179 -5.677  0.00 100.00 ? 80  GLU I OE2 1 
ATOM   10394 N  N   . ASN I  1 81  ? -7.302  -33.526 0.493   1.00 12.30  ? 81  ASN I N   1 
ATOM   10395 C  CA  . ASN I  1 81  ? -7.514  -33.876 1.898   1.00 11.65  ? 81  ASN I CA  1 
ATOM   10396 C  C   . ASN I  1 81  ? -8.187  -32.880 2.809   1.00 14.04  ? 81  ASN I C   1 
ATOM   10397 O  O   . ASN I  1 81  ? -8.461  -33.198 3.968   1.00 18.41  ? 81  ASN I O   1 
ATOM   10398 C  CB  . ASN I  1 81  ? -6.202  -34.321 2.542   1.00 14.44  ? 81  ASN I CB  1 
ATOM   10399 C  CG  . ASN I  1 81  ? -5.575  -35.446 1.772   1.00 14.99  ? 81  ASN I CG  1 
ATOM   10400 O  OD1 . ASN I  1 81  ? -4.956  -35.245 0.709   1.00 20.68  ? 81  ASN I OD1 1 
ATOM   10401 N  ND2 . ASN I  1 81  ? -5.758  -36.652 2.307   1.00 15.10  ? 81  ASN I ND2 1 
ATOM   10402 N  N   . ALA I  1 82  ? -8.367  -31.663 2.324   1.00 13.15  ? 82  ALA I N   1 
ATOM   10403 C  CA  . ALA I  1 82  ? -8.919  -30.660 3.222   1.00 13.33  ? 82  ALA I CA  1 
ATOM   10404 C  C   . ALA I  1 82  ? -10.359 -30.879 3.642   1.00 16.80  ? 82  ALA I C   1 
ATOM   10405 O  O   . ALA I  1 82  ? -11.159 -31.267 2.812   1.00 19.24  ? 82  ALA I O   1 
ATOM   10406 C  CB  . ALA I  1 82  ? -8.764  -29.287 2.584   1.00 12.73  ? 82  ALA I CB  1 
ATOM   10407 N  N   . SER I  1 83  ? -10.680 -30.586 4.900   1.00 8.25   ? 83  SER I N   1 
ATOM   10408 C  CA  . SER I  1 83  ? -12.069 -30.543 5.365   1.00 5.64   ? 83  SER I CA  1 
ATOM   10409 C  C   . SER I  1 83  ? -12.593 -29.114 5.186   1.00 13.74  ? 83  SER I C   1 
ATOM   10410 O  O   . SER I  1 83  ? -13.785 -28.896 5.100   1.00 16.52  ? 83  SER I O   1 
ATOM   10411 C  CB  . SER I  1 83  ? -12.220 -31.030 6.818   1.00 4.38   ? 83  SER I CB  1 
ATOM   10412 O  OG  . SER I  1 83  ? -11.351 -30.353 7.703   1.00 25.49  ? 83  SER I OG  1 
ATOM   10413 N  N   . VAL I  1 84  ? -11.710 -28.128 5.086   1.00 13.48  ? 84  VAL I N   1 
ATOM   10414 C  CA  . VAL I  1 84  ? -12.089 -26.737 4.857   1.00 9.11   ? 84  VAL I CA  1 
ATOM   10415 C  C   . VAL I  1 84  ? -12.616 -26.615 3.432   1.00 13.18  ? 84  VAL I C   1 
ATOM   10416 O  O   . VAL I  1 84  ? -12.031 -27.144 2.503   1.00 12.52  ? 84  VAL I O   1 
ATOM   10417 C  CB  . VAL I  1 84  ? -10.900 -25.789 5.067   1.00 6.18   ? 84  VAL I CB  1 
ATOM   10418 C  CG1 . VAL I  1 84  ? -11.247 -24.407 4.554   1.00 5.10   ? 84  VAL I CG1 1 
ATOM   10419 C  CG2 . VAL I  1 84  ? -10.479 -25.810 6.550   1.00 4.02   ? 84  VAL I CG2 1 
ATOM   10420 N  N   . GLU I  1 85  ? -13.740 -25.939 3.254   1.00 20.96  ? 85  GLU I N   1 
ATOM   10421 C  CA  . GLU I  1 85  ? -14.324 -25.784 1.931   1.00 21.34  ? 85  GLU I CA  1 
ATOM   10422 C  C   . GLU I  1 85  ? -13.968 -24.460 1.302   1.00 17.85  ? 85  GLU I C   1 
ATOM   10423 O  O   . GLU I  1 85  ? -13.907 -23.427 1.958   1.00 21.92  ? 85  GLU I O   1 
ATOM   10424 C  CB  . GLU I  1 85  ? -15.841 -25.798 2.054   1.00 27.33  ? 85  GLU I CB  1 
ATOM   10425 C  CG  . GLU I  1 85  ? -16.477 -27.145 2.329   1.00 73.61  ? 85  GLU I CG  1 
ATOM   10426 C  CD  . GLU I  1 85  ? -16.160 -28.167 1.281   0.00 100.00 ? 85  GLU I CD  1 
ATOM   10427 O  OE1 . GLU I  1 85  ? -15.661 -27.779 0.211   0.00 100.00 ? 85  GLU I OE1 1 
ATOM   10428 O  OE2 . GLU I  1 85  ? -16.343 -29.372 1.542   0.00 100.00 ? 85  GLU I OE2 1 
ATOM   10429 N  N   . GLU I  1 86  ? -13.872 -24.463 -0.015  1.00 13.46  ? 86  GLU I N   1 
ATOM   10430 C  CA  . GLU I  1 86  ? -13.599 -23.215 -0.726  1.00 16.10  ? 86  GLU I CA  1 
ATOM   10431 C  C   . GLU I  1 86  ? -14.550 -23.124 -1.917  1.00 19.81  ? 86  GLU I C   1 
ATOM   10432 O  O   . GLU I  1 86  ? -15.118 -24.097 -2.422  1.00 20.76  ? 86  GLU I O   1 
ATOM   10433 C  CB  . GLU I  1 86  ? -12.149 -23.205 -1.255  1.00 18.13  ? 86  GLU I CB  1 
ATOM   10434 C  CG  . GLU I  1 86  ? -11.765 -24.341 -2.254  1.00 40.24  ? 86  GLU I CG  1 
ATOM   10435 C  CD  . GLU I  1 86  ? -10.502 -24.157 -3.126  1.00 49.68  ? 86  GLU I CD  1 
ATOM   10436 O  OE1 . GLU I  1 86  ? -9.578  -23.385 -2.766  1.00 28.75  ? 86  GLU I OE1 1 
ATOM   10437 O  OE2 . GLU I  1 86  ? -10.400 -24.852 -4.175  1.00 25.05  ? 86  GLU I OE2 1 
ATOM   10438 N  N   . ALA I  1 87  ? -14.641 -21.912 -2.440  1.00 16.80  ? 87  ALA I N   1 
ATOM   10439 C  CA  . ALA I  1 87  ? -15.471 -21.670 -3.608  1.00 16.89  ? 87  ALA I CA  1 
ATOM   10440 C  C   . ALA I  1 87  ? -15.074 -20.393 -4.312  1.00 19.65  ? 87  ALA I C   1 
ATOM   10441 O  O   . ALA I  1 87  ? -14.875 -19.342 -3.723  1.00 25.32  ? 87  ALA I O   1 
ATOM   10442 C  CB  . ALA I  1 87  ? -16.956 -21.592 -3.225  1.00 18.39  ? 87  ALA I CB  1 
ATOM   10443 N  N   . PRO I  1 88  ? -15.059 -20.498 -5.626  1.00 17.04  ? 88  PRO I N   1 
ATOM   10444 C  CA  . PRO I  1 88  ? -14.745 -19.381 -6.486  1.00 20.47  ? 88  PRO I CA  1 
ATOM   10445 C  C   . PRO I  1 88  ? -15.667 -18.246 -6.161  1.00 18.48  ? 88  PRO I C   1 
ATOM   10446 O  O   . PRO I  1 88  ? -16.789 -18.417 -5.711  1.00 17.63  ? 88  PRO I O   1 
ATOM   10447 C  CB  . PRO I  1 88  ? -15.026 -19.894 -7.896  1.00 23.37  ? 88  PRO I CB  1 
ATOM   10448 C  CG  . PRO I  1 88  ? -16.011 -20.966 -7.676  1.00 27.44  ? 88  PRO I CG  1 
ATOM   10449 C  CD  . PRO I  1 88  ? -15.692 -21.608 -6.351  1.00 18.51  ? 88  PRO I CD  1 
ATOM   10450 N  N   . TYR I  1 89  ? -15.141 -17.054 -6.358  1.00 15.33  ? 89  TYR I N   1 
ATOM   10451 C  CA  . TYR I  1 89  ? -15.939 -15.890 -6.044  1.00 14.54  ? 89  TYR I CA  1 
ATOM   10452 C  C   . TYR I  1 89  ? -16.551 -15.486 -7.373  1.00 30.87  ? 89  TYR I C   1 
ATOM   10453 O  O   . TYR I  1 89  ? -15.878 -14.984 -8.291  1.00 35.51  ? 89  TYR I O   1 
ATOM   10454 C  CB  . TYR I  1 89  ? -15.021 -14.808 -5.499  1.00 8.28   ? 89  TYR I CB  1 
ATOM   10455 C  CG  . TYR I  1 89  ? -15.786 -13.601 -5.060  1.00 10.56  ? 89  TYR I CG  1 
ATOM   10456 C  CD1 . TYR I  1 89  ? -16.044 -12.560 -5.948  1.00 13.98  ? 89  TYR I CD1 1 
ATOM   10457 C  CD2 . TYR I  1 89  ? -16.208 -13.485 -3.742  1.00 9.05   ? 89  TYR I CD2 1 
ATOM   10458 C  CE1 . TYR I  1 89  ? -16.694 -11.416 -5.523  1.00 18.88  ? 89  TYR I CE1 1 
ATOM   10459 C  CE2 . TYR I  1 89  ? -16.868 -12.342 -3.308  1.00 9.11   ? 89  TYR I CE2 1 
ATOM   10460 C  CZ  . TYR I  1 89  ? -17.124 -11.314 -4.201  1.00 19.99  ? 89  TYR I CZ  1 
ATOM   10461 O  OH  . TYR I  1 89  ? -17.788 -10.171 -3.798  1.00 30.85  ? 89  TYR I OH  1 
ATOM   10462 N  N   . THR I  1 90  ? -17.858 -15.711 -7.447  1.00 35.80  ? 90  THR I N   1 
ATOM   10463 C  CA  . THR I  1 90  ? -18.627 -15.366 -8.645  1.00 39.17  ? 90  THR I CA  1 
ATOM   10464 C  C   . THR I  1 90  ? -19.526 -14.174 -8.331  1.00 47.68  ? 90  THR I C   1 
ATOM   10465 O  O   . THR I  1 90  ? -19.369 -13.046 -8.828  1.00 48.28  ? 90  THR I O   1 
ATOM   10466 C  CB  . THR I  1 90  ? -19.426 -16.613 -9.010  1.00 51.02  ? 90  THR I CB  1 
ATOM   10467 O  OG1 . THR I  1 90  ? -20.027 -17.113 -7.808  1.00 57.16  ? 90  THR I OG1 1 
ATOM   10468 C  CG2 . THR I  1 90  ? -18.457 -17.683 -9.484  1.00 51.82  ? 90  THR I CG2 1 
ATOM   10469 N  N   . LYS I  1 91  ? -20.458 -14.471 -7.431  1.00 43.28  ? 91  LYS I N   1 
ATOM   10470 C  CA  . LYS I  1 91  ? -21.361 -13.439 -6.978  1.00 39.70  ? 91  LYS I CA  1 
ATOM   10471 C  C   . LYS I  1 91  ? -20.516 -12.671 -6.009  1.00 55.03  ? 91  LYS I C   1 
ATOM   10472 O  O   . LYS I  1 91  ? -19.559 -13.171 -5.377  1.00 32.85  ? 91  LYS I O   1 
ATOM   10473 C  CB  . LYS I  1 91  ? -22.569 -14.010 -6.233  1.00 39.41  ? 91  LYS I CB  1 
ATOM   10474 C  CG  . LYS I  1 91  ? -23.543 -12.896 -5.889  0.00 100.00 ? 91  LYS I CG  1 
ATOM   10475 C  CD  . LYS I  1 91  ? -24.248 -13.000 -4.561  0.00 100.00 ? 91  LYS I CD  1 
ATOM   10476 C  CE  . LYS I  1 91  ? -25.474 -13.895 -4.560  0.00 100.00 ? 91  LYS I CE  1 
ATOM   10477 N  NZ  . LYS I  1 91  ? -26.176 -13.909 -3.249  0.00 100.00 ? 91  LYS I NZ  1 
ATOM   10478 N  N   . PRO I  1 92  ? -20.859 -11.414 -5.930  1.00 45.27  ? 92  PRO I N   1 
ATOM   10479 C  CA  . PRO I  1 92  ? -20.258 -10.420 -5.098  1.00 70.48  ? 92  PRO I CA  1 
ATOM   10480 C  C   . PRO I  1 92  ? -21.066 -10.655 -3.840  1.00 68.97  ? 92  PRO I C   1 
ATOM   10481 O  O   . PRO I  1 92  ? -22.298 -10.780 -3.869  1.00 56.29  ? 92  PRO I O   1 
ATOM   10482 C  CB  . PRO I  1 92  ? -20.647 -9.095  -5.720  1.00 63.45  ? 92  PRO I CB  1 
ATOM   10483 C  CG  . PRO I  1 92  ? -21.183 -9.452  -7.118  1.00 23.87  ? 92  PRO I CG  1 
ATOM   10484 C  CD  . PRO I  1 92  ? -21.819 -10.817 -6.941  1.00 1.69   ? 92  PRO I CD  1 
ATOM   10485 N  N   . LYS I  1 93  ? -20.307 -10.820 -2.778  1.00 21.20  ? 93  LYS I N   1 
ATOM   10486 C  CA  . LYS I  1 93  ? -20.802 -11.085 -1.433  1.00 1.00   ? 93  LYS I CA  1 
ATOM   10487 C  C   . LYS I  1 93  ? -20.656 -9.807  -0.559  1.00 12.25  ? 93  LYS I C   1 
ATOM   10488 O  O   . LYS I  1 93  ? -20.050 -8.811  -0.976  1.00 17.54  ? 93  LYS I O   1 
ATOM   10489 C  CB  . LYS I  1 93  ? -20.031 -12.337 -1.001  1.00 18.60  ? 93  LYS I CB  1 
ATOM   10490 C  CG  . LYS I  1 93  ? -20.540 -13.606 -1.701  1.00 13.83  ? 93  LYS I CG  1 
ATOM   10491 C  CD  . LYS I  1 93  ? -19.439 -14.399 -2.417  1.00 83.67  ? 93  LYS I CD  1 
ATOM   10492 C  CE  . LYS I  1 93  ? -18.805 -15.474 -1.530  0.00 100.00 ? 93  LYS I CE  1 
ATOM   10493 N  NZ  . LYS I  1 93  ? -17.868 -16.357 -2.260  0.00 100.00 ? 93  LYS I NZ  1 
ATOM   10494 N  N   . THR I  1 94  ? -21.259 -9.860  0.632   1.00 40.35  ? 94  THR I N   1 
ATOM   10495 C  CA  . THR I  1 94  ? -21.248 -8.745  1.627   1.00 37.31  ? 94  THR I CA  1 
ATOM   10496 C  C   . THR I  1 94  ? -20.036 -8.875  2.537   1.00 46.26  ? 94  THR I C   1 
ATOM   10497 O  O   . THR I  1 94  ? -19.583 -10.004 2.795   1.00 38.61  ? 94  THR I O   1 
ATOM   10498 C  CB  . THR I  1 94  ? -22.467 -8.856  2.540   1.00 17.22  ? 94  THR I CB  1 
ATOM   10499 O  OG1 . THR I  1 94  ? -23.650 -8.581  1.815   1.00 76.37  ? 94  THR I OG1 1 
ATOM   10500 C  CG2 . THR I  1 94  ? -22.402 -7.898  3.728   1.00 75.73  ? 94  THR I CG2 1 
ATOM   10501 N  N   . MET I  1 95  ? -19.534 -7.764  3.114   1.00 16.38  ? 95  MET I N   1 
ATOM   10502 C  CA  . MET I  1 95  ? -18.445 -7.819  4.085   1.00 21.53  ? 95  MET I CA  1 
ATOM   10503 C  C   . MET I  1 95  ? -18.775 -8.878  5.158   1.00 23.06  ? 95  MET I C   1 
ATOM   10504 O  O   . MET I  1 95  ? -18.017 -9.838  5.426   1.00 22.87  ? 95  MET I O   1 
ATOM   10505 C  CB  . MET I  1 95  ? -18.215 -6.476  4.781   1.00 24.73  ? 95  MET I CB  1 
ATOM   10506 C  CG  . MET I  1 95  ? -16.944 -6.534  5.628   1.00 30.64  ? 95  MET I CG  1 
ATOM   10507 S  SD  . MET I  1 95  ? -15.337 -6.777  4.676   1.00 33.17  ? 95  MET I SD  1 
ATOM   10508 C  CE  . MET I  1 95  ? -15.184 -5.101  3.839   1.00 25.97  ? 95  MET I CE  1 
ATOM   10509 N  N   . ASP I  1 96  ? -20.003 -8.726  5.658   1.00 20.65  ? 96  ASP I N   1 
ATOM   10510 C  CA  . ASP I  1 96  ? -20.574 -9.647  6.624   1.00 23.70  ? 96  ASP I CA  1 
ATOM   10511 C  C   . ASP I  1 96  ? -20.651 -11.050 6.084   1.00 15.72  ? 96  ASP I C   1 
ATOM   10512 O  O   . ASP I  1 96  ? -20.348 -12.008 6.790   1.00 18.01  ? 96  ASP I O   1 
ATOM   10513 C  CB  . ASP I  1 96  ? -21.960 -9.191  7.048   1.00 29.22  ? 96  ASP I CB  1 
ATOM   10514 C  CG  . ASP I  1 96  ? -21.883 -8.027  8.013   1.00 57.19  ? 96  ASP I CG  1 
ATOM   10515 O  OD1 . ASP I  1 96  ? -20.767 -7.458  8.120   1.00 66.01  ? 96  ASP I OD1 1 
ATOM   10516 O  OD2 . ASP I  1 96  ? -22.869 -7.792  8.758   1.00 59.66  ? 96  ASP I OD2 1 
ATOM   10517 N  N   . GLN I  1 97  ? -21.029 -11.180 4.823   1.00 9.31   ? 97  GLN I N   1 
ATOM   10518 C  CA  . GLN I  1 97  ? -21.058 -12.539 4.292   1.00 14.73  ? 97  GLN I CA  1 
ATOM   10519 C  C   . GLN I  1 97  ? -19.653 -13.136 4.295   1.00 19.68  ? 97  GLN I C   1 
ATOM   10520 O  O   . GLN I  1 97  ? -19.467 -14.295 4.652   1.00 14.61  ? 97  GLN I O   1 
ATOM   10521 C  CB  . GLN I  1 97  ? -21.596 -12.522 2.866   1.00 22.50  ? 97  GLN I CB  1 
ATOM   10522 C  CG  . GLN I  1 97  ? -23.004 -11.978 2.680   1.00 41.58  ? 97  GLN I CG  1 
ATOM   10523 C  CD  . GLN I  1 97  ? -23.449 -12.096 1.240   1.00 61.12  ? 97  GLN I CD  1 
ATOM   10524 O  OE1 . GLN I  1 97  ? -23.993 -11.147 0.681   1.00 73.47  ? 97  GLN I OE1 1 
ATOM   10525 N  NE2 . GLN I  1 97  ? -23.221 -13.251 0.634   1.00 91.49  ? 97  GLN I NE2 1 
ATOM   10526 N  N   . LEU I  1 98  ? -18.668 -12.328 3.904   1.00 13.86  ? 98  LEU I N   1 
ATOM   10527 C  CA  . LEU I  1 98  ? -17.254 -12.729 3.860   1.00 12.87  ? 98  LEU I CA  1 
ATOM   10528 C  C   . LEU I  1 98  ? -16.750 -13.061 5.282   1.00 11.31  ? 98  LEU I C   1 
ATOM   10529 O  O   . LEU I  1 98  ? -16.177 -14.139 5.547   1.00 8.18   ? 98  LEU I O   1 
ATOM   10530 C  CB  . LEU I  1 98  ? -16.462 -11.593 3.229   1.00 11.24  ? 98  LEU I CB  1 
ATOM   10531 C  CG  . LEU I  1 98  ? -16.823 -11.397 1.753   1.00 11.15  ? 98  LEU I CG  1 
ATOM   10532 C  CD1 . LEU I  1 98  ? -16.051 -10.310 0.990   1.00 9.51   ? 98  LEU I CD1 1 
ATOM   10533 C  CD2 . LEU I  1 98  ? -16.646 -12.677 1.013   1.00 2.42   ? 98  LEU I CD2 1 
ATOM   10534 N  N   . MET I  1 99  ? -17.055 -12.171 6.222   1.00 4.80   ? 99  MET I N   1 
ATOM   10535 C  CA  . MET I  1 99  ? -16.650 -12.430 7.590   1.00 1.07   ? 99  MET I CA  1 
ATOM   10536 C  C   . MET I  1 99  ? -17.310 -13.677 8.097   1.00 9.78   ? 99  MET I C   1 
ATOM   10537 O  O   . MET I  1 99  ? -16.676 -14.445 8.809   1.00 12.74  ? 99  MET I O   1 
ATOM   10538 C  CB  . MET I  1 99  ? -16.997 -11.228 8.453   1.00 5.07   ? 99  MET I CB  1 
ATOM   10539 C  CG  . MET I  1 99  ? -16.090 -10.030 8.098   1.00 12.08  ? 99  MET I CG  1 
ATOM   10540 S  SD  . MET I  1 99  ? -14.264 -10.422 8.004   1.00 14.67  ? 99  MET I SD  1 
ATOM   10541 C  CE  . MET I  1 99  ? -14.106 -10.784 6.355   1.00 11.27  ? 99  MET I CE  1 
ATOM   10542 N  N   . GLU I  1 100 ? -18.557 -13.910 7.715   1.00 11.53  ? 100 GLU I N   1 
ATOM   10543 C  CA  . GLU I  1 100 ? -19.217 -15.132 8.169   1.00 11.85  ? 100 GLU I CA  1 
ATOM   10544 C  C   . GLU I  1 100 ? -18.581 -16.402 7.616   1.00 11.76  ? 100 GLU I C   1 
ATOM   10545 O  O   . GLU I  1 100 ? -18.471 -17.431 8.302   1.00 12.40  ? 100 GLU I O   1 
ATOM   10546 C  CB  . GLU I  1 100 ? -20.712 -15.082 7.864   1.00 15.11  ? 100 GLU I CB  1 
ATOM   10547 C  CG  . GLU I  1 100 ? -21.482 -14.189 8.836   1.00 37.04  ? 100 GLU I CG  1 
ATOM   10548 C  CD  . GLU I  1 100 ? -22.837 -13.746 8.335   0.00 100.00 ? 100 GLU I CD  1 
ATOM   10549 O  OE1 . GLU I  1 100 ? -23.140 -13.858 7.140   1.00 98.10  ? 100 GLU I OE1 1 
ATOM   10550 O  OE2 . GLU I  1 100 ? -23.599 -13.204 9.156   0.00 100.00 ? 100 GLU I OE2 1 
ATOM   10551 N  N   . ASP I  1 101 ? -18.068 -16.312 6.394   1.00 12.08  ? 101 ASP I N   1 
ATOM   10552 C  CA  . ASP I  1 101 ? -17.358 -17.479 5.873   1.00 17.54  ? 101 ASP I CA  1 
ATOM   10553 C  C   . ASP I  1 101 ? -16.067 -17.654 6.701   1.00 16.09  ? 101 ASP I C   1 
ATOM   10554 O  O   . ASP I  1 101 ? -15.736 -18.731 7.188   1.00 13.20  ? 101 ASP I O   1 
ATOM   10555 C  CB  . ASP I  1 101 ? -17.080 -17.169 4.383   1.00 26.08  ? 101 ASP I CB  1 
ATOM   10556 C  CG  . ASP I  1 101 ? -16.441 -18.336 3.624   1.00 70.64  ? 101 ASP I CG  1 
ATOM   10557 O  OD1 . ASP I  1 101 ? -16.322 -19.463 4.187   1.00 74.91  ? 101 ASP I OD1 1 
ATOM   10558 O  OD2 . ASP I  1 101 ? -16.031 -18.112 2.456   1.00 79.42  ? 101 ASP I OD2 1 
ATOM   10559 N  N   . LEU I  1 102 ? -15.318 -16.575 6.889   1.00 8.76   ? 102 LEU I N   1 
ATOM   10560 C  CA  . LEU I  1 102 ? -14.095 -16.600 7.677   1.00 5.71   ? 102 LEU I CA  1 
ATOM   10561 C  C   . LEU I  1 102 ? -14.342 -17.212 9.042   1.00 7.80   ? 102 LEU I C   1 
ATOM   10562 O  O   . LEU I  1 102 ? -13.705 -18.192 9.413   1.00 8.57   ? 102 LEU I O   1 
ATOM   10563 C  CB  . LEU I  1 102 ? -13.725 -15.133 7.905   1.00 6.91   ? 102 LEU I CB  1 
ATOM   10564 C  CG  . LEU I  1 102 ? -12.244 -14.806 8.035   1.00 14.67  ? 102 LEU I CG  1 
ATOM   10565 C  CD1 . LEU I  1 102 ? -12.129 -13.730 9.095   1.00 8.71   ? 102 LEU I CD1 1 
ATOM   10566 C  CD2 . LEU I  1 102 ? -11.533 -16.104 8.362   1.00 24.65  ? 102 LEU I CD2 1 
ATOM   10567 N  N   . VAL I  1 103 ? -15.328 -16.699 9.756   1.00 1.27   ? 103 VAL I N   1 
ATOM   10568 C  CA  . VAL I  1 103 ? -15.604 -17.239 11.078  1.00 3.15   ? 103 VAL I CA  1 
ATOM   10569 C  C   . VAL I  1 103 ? -15.976 -18.707 11.062  1.00 12.38  ? 103 VAL I C   1 
ATOM   10570 O  O   . VAL I  1 103 ? -15.681 -19.454 12.003  1.00 6.92   ? 103 VAL I O   1 
ATOM   10571 C  CB  . VAL I  1 103 ? -16.764 -16.477 11.721  1.00 13.65  ? 103 VAL I CB  1 
ATOM   10572 C  CG1 . VAL I  1 103 ? -17.299 -17.256 12.898  1.00 13.79  ? 103 VAL I CG1 1 
ATOM   10573 C  CG2 . VAL I  1 103 ? -16.288 -15.114 12.163  1.00 14.24  ? 103 VAL I CG2 1 
ATOM   10574 N  N   . GLY I  1 104 ? -16.684 -19.092 10.005  1.00 6.78   ? 104 GLY I N   1 
ATOM   10575 C  CA  . GLY I  1 104 ? -17.167 -20.469 9.941   1.00 3.19   ? 104 GLY I CA  1 
ATOM   10576 C  C   . GLY I  1 104 ? -15.970 -21.375 9.868   1.00 7.86   ? 104 GLY I C   1 
ATOM   10577 O  O   . GLY I  1 104 ? -15.873 -22.387 10.558  1.00 11.85  ? 104 GLY I O   1 
ATOM   10578 N  N   . THR I  1 105 ? -15.038 -20.930 9.046   1.00 5.21   ? 105 THR I N   1 
ATOM   10579 C  CA  . THR I  1 105 ? -13.833 -21.718 8.893   1.00 5.02   ? 105 THR I CA  1 
ATOM   10580 C  C   . THR I  1 105 ? -13.030 -21.750 10.193  1.00 4.72   ? 105 THR I C   1 
ATOM   10581 O  O   . THR I  1 105 ? -12.435 -22.768 10.560  1.00 7.46   ? 105 THR I O   1 
ATOM   10582 C  CB  . THR I  1 105 ? -12.995 -21.182 7.728   1.00 12.40  ? 105 THR I CB  1 
ATOM   10583 O  OG1 . THR I  1 105 ? -13.733 -21.245 6.497   1.00 17.84  ? 105 THR I OG1 1 
ATOM   10584 C  CG2 . THR I  1 105 ? -11.729 -21.989 7.596   1.00 7.47   ? 105 THR I CG2 1 
ATOM   10585 N  N   . LEU I  1 106 ? -13.042 -20.634 10.918  1.00 3.32   ? 106 LEU I N   1 
ATOM   10586 C  CA  . LEU I  1 106 ? -12.283 -20.605 12.157  1.00 2.61   ? 106 LEU I CA  1 
ATOM   10587 C  C   . LEU I  1 106 ? -12.953 -21.610 13.076  1.00 11.43  ? 106 LEU I C   1 
ATOM   10588 O  O   . LEU I  1 106 ? -12.301 -22.423 13.755  1.00 9.21   ? 106 LEU I O   1 
ATOM   10589 C  CB  . LEU I  1 106 ? -12.273 -19.192 12.739  1.00 1.21   ? 106 LEU I CB  1 
ATOM   10590 C  CG  . LEU I  1 106 ? -11.423 -18.153 12.005  1.00 4.92   ? 106 LEU I CG  1 
ATOM   10591 C  CD1 . LEU I  1 106 ? -11.725 -16.744 12.491  1.00 1.71   ? 106 LEU I CD1 1 
ATOM   10592 C  CD2 . LEU I  1 106 ? -9.972  -18.449 12.243  1.00 1.59   ? 106 LEU I CD2 1 
ATOM   10593 N  N   . GLU I  1 107 ? -14.276 -21.577 13.087  1.00 4.97   ? 107 GLU I N   1 
ATOM   10594 C  CA  . GLU I  1 107 ? -14.946 -22.537 13.955  1.00 5.72   ? 107 GLU I CA  1 
ATOM   10595 C  C   . GLU I  1 107 ? -14.632 -23.971 13.586  1.00 10.63  ? 107 GLU I C   1 
ATOM   10596 O  O   . GLU I  1 107 ? -14.398 -24.840 14.412  1.00 7.71   ? 107 GLU I O   1 
ATOM   10597 C  CB  . GLU I  1 107 ? -16.444 -22.306 13.932  1.00 5.10   ? 107 GLU I CB  1 
ATOM   10598 C  CG  . GLU I  1 107 ? -16.813 -21.057 14.757  1.00 16.67  ? 107 GLU I CG  1 
ATOM   10599 C  CD  . GLU I  1 107 ? -18.268 -20.562 14.599  1.00 28.53  ? 107 GLU I CD  1 
ATOM   10600 O  OE1 . GLU I  1 107 ? -18.769 -20.711 13.459  1.00 40.37  ? 107 GLU I OE1 1 
ATOM   10601 O  OE2 . GLU I  1 107 ? -18.879 -20.039 15.577  1.00 29.95  ? 107 GLU I OE2 1 
ATOM   10602 N  N   . LEU I  1 108 ? -14.521 -24.221 12.295  1.00 6.35   ? 108 LEU I N   1 
ATOM   10603 C  CA  . LEU I  1 108 ? -14.134 -25.576 11.911  1.00 7.07   ? 108 LEU I CA  1 
ATOM   10604 C  C   . LEU I  1 108 ? -12.734 -25.990 12.406  1.00 11.00  ? 108 LEU I C   1 
ATOM   10605 O  O   . LEU I  1 108 ? -12.510 -27.101 12.915  1.00 11.76  ? 108 LEU I O   1 
ATOM   10606 C  CB  . LEU I  1 108 ? -14.203 -25.671 10.389  1.00 9.03   ? 108 LEU I CB  1 
ATOM   10607 C  CG  . LEU I  1 108 ? -13.735 -26.987 9.756   1.00 18.64  ? 108 LEU I CG  1 
ATOM   10608 C  CD1 . LEU I  1 108 ? -14.244 -27.143 8.344   1.00 15.09  ? 108 LEU I CD1 1 
ATOM   10609 C  CD2 . LEU I  1 108 ? -12.219 -27.222 9.759   1.00 24.84  ? 108 LEU I CD2 1 
ATOM   10610 N  N   . LEU I  1 109 ? -11.786 -25.066 12.247  1.00 6.37   ? 109 LEU I N   1 
ATOM   10611 C  CA  . LEU I  1 109 ? -10.433 -25.333 12.710  1.00 6.33   ? 109 LEU I CA  1 
ATOM   10612 C  C   . LEU I  1 109 ? -10.410 -25.533 14.221  1.00 6.21   ? 109 LEU I C   1 
ATOM   10613 O  O   . LEU I  1 109 ? -9.823  -26.486 14.739  1.00 10.12  ? 109 LEU I O   1 
ATOM   10614 C  CB  . LEU I  1 109 ? -9.505  -24.196 12.282  1.00 6.10   ? 109 LEU I CB  1 
ATOM   10615 C  CG  . LEU I  1 109 ? -9.303  -24.188 10.767  1.00 10.28  ? 109 LEU I CG  1 
ATOM   10616 C  CD1 . LEU I  1 109 ? -8.611  -22.901 10.347  1.00 11.37  ? 109 LEU I CD1 1 
ATOM   10617 C  CD2 . LEU I  1 109 ? -8.474  -25.413 10.432  1.00 7.18   ? 109 LEU I CD2 1 
ATOM   10618 N  N   . ARG I  1 110 ? -11.159 -24.666 14.890  1.00 3.12   ? 110 ARG I N   1 
ATOM   10619 C  CA  . ARG I  1 110 ? -11.211 -24.754 16.332  1.00 4.76   ? 110 ARG I CA  1 
ATOM   10620 C  C   . ARG I  1 110 ? -11.614 -26.172 16.697  1.00 10.60  ? 110 ARG I C   1 
ATOM   10621 O  O   . ARG I  1 110 ? -10.962 -26.931 17.421  1.00 8.92   ? 110 ARG I O   1 
ATOM   10622 C  CB  . ARG I  1 110 ? -12.235 -23.746 16.871  1.00 2.62   ? 110 ARG I CB  1 
ATOM   10623 C  CG  . ARG I  1 110 ? -12.289 -23.770 18.409  1.00 6.11   ? 110 ARG I CG  1 
ATOM   10624 C  CD  . ARG I  1 110 ? -13.520 -23.068 19.018  1.00 6.03   ? 110 ARG I CD  1 
ATOM   10625 N  NE  . ARG I  1 110 ? -14.726 -23.595 18.374  1.00 10.52  ? 110 ARG I NE  1 
ATOM   10626 C  CZ  . ARG I  1 110 ? -15.873 -22.949 18.270  1.00 18.40  ? 110 ARG I CZ  1 
ATOM   10627 N  NH1 . ARG I  1 110 ? -16.063 -21.746 18.802  1.00 6.96   ? 110 ARG I NH1 1 
ATOM   10628 N  NH2 . ARG I  1 110 ? -16.827 -23.553 17.613  1.00 14.70  ? 110 ARG I NH2 1 
ATOM   10629 N  N   . ASP I  1 111 ? -12.720 -26.566 16.104  1.00 7.46   ? 111 ASP I N   1 
ATOM   10630 C  CA  . ASP I  1 111 ? -13.273 -27.854 16.475  1.00 11.07  ? 111 ASP I CA  1 
ATOM   10631 C  C   . ASP I  1 111 ? -12.340 -29.006 16.151  1.00 9.32   ? 111 ASP I C   1 
ATOM   10632 O  O   . ASP I  1 111 ? -12.161 -29.915 16.968  1.00 10.09  ? 111 ASP I O   1 
ATOM   10633 C  CB  . ASP I  1 111 ? -14.700 -27.975 15.927  1.00 20.16  ? 111 ASP I CB  1 
ATOM   10634 C  CG  . ASP I  1 111 ? -15.663 -26.924 16.506  1.00 33.66  ? 111 ASP I CG  1 
ATOM   10635 O  OD1 . ASP I  1 111 ? -15.486 -26.467 17.664  1.00 24.33  ? 111 ASP I OD1 1 
ATOM   10636 O  OD2 . ASP I  1 111 ? -16.618 -26.590 15.768  1.00 58.87  ? 111 ASP I OD2 1 
ATOM   10637 N  N   . GLU I  1 112 ? -11.719 -28.938 14.976  1.00 4.38   ? 112 GLU I N   1 
ATOM   10638 C  CA  . GLU I  1 112 ? -10.815 -30.023 14.647  1.00 2.70   ? 112 GLU I CA  1 
ATOM   10639 C  C   . GLU I  1 112 ? -9.584  -29.991 15.540  1.00 11.68  ? 112 GLU I C   1 
ATOM   10640 O  O   . GLU I  1 112 ? -9.137  -31.045 16.003  1.00 12.37  ? 112 GLU I O   1 
ATOM   10641 C  CB  . GLU I  1 112 ? -10.438 -29.977 13.180  1.00 5.11   ? 112 GLU I CB  1 
ATOM   10642 C  CG  . GLU I  1 112 ? -11.640 -30.122 12.256  1.00 23.45  ? 112 GLU I CG  1 
ATOM   10643 C  CD  . GLU I  1 112 ? -11.276 -30.470 10.796  1.00 36.56  ? 112 GLU I CD  1 
ATOM   10644 O  OE1 . GLU I  1 112 ? -10.061 -30.640 10.503  1.00 17.99  ? 112 GLU I OE1 1 
ATOM   10645 O  OE2 . GLU I  1 112 ? -12.190 -30.547 9.923   1.00 23.63  ? 112 GLU I OE2 1 
ATOM   10646 N  N   . TYR I  1 113 ? -9.082  -28.800 15.856  1.00 6.63   ? 113 TYR I N   1 
ATOM   10647 C  CA  . TYR I  1 113 ? -7.935  -28.791 16.750  1.00 5.55   ? 113 TYR I CA  1 
ATOM   10648 C  C   . TYR I  1 113 ? -8.274  -29.447 18.067  1.00 8.93   ? 113 TYR I C   1 
ATOM   10649 O  O   . TYR I  1 113 ? -7.478  -30.196 18.647  1.00 7.20   ? 113 TYR I O   1 
ATOM   10650 C  CB  . TYR I  1 113 ? -7.461  -27.364 17.007  1.00 3.64   ? 113 TYR I CB  1 
ATOM   10651 C  CG  . TYR I  1 113 ? -6.623  -26.837 15.874  1.00 9.94   ? 113 TYR I CG  1 
ATOM   10652 C  CD1 . TYR I  1 113 ? -6.774  -27.325 14.589  1.00 12.52  ? 113 TYR I CD1 1 
ATOM   10653 C  CD2 . TYR I  1 113 ? -5.764  -25.795 16.071  1.00 14.53  ? 113 TYR I CD2 1 
ATOM   10654 C  CE1 . TYR I  1 113 ? -6.066  -26.793 13.547  1.00 17.92  ? 113 TYR I CE1 1 
ATOM   10655 C  CE2 . TYR I  1 113 ? -5.070  -25.263 15.029  1.00 20.64  ? 113 TYR I CE2 1 
ATOM   10656 C  CZ  . TYR I  1 113 ? -5.217  -25.742 13.766  1.00 17.54  ? 113 TYR I CZ  1 
ATOM   10657 O  OH  . TYR I  1 113 ? -4.487  -25.190 12.738  1.00 17.84  ? 113 TYR I OH  1 
ATOM   10658 N  N   . LYS I  1 114 ? -9.478  -29.162 18.546  1.00 8.75   ? 114 LYS I N   1 
ATOM   10659 C  CA  . LYS I  1 114 ? -9.927  -29.762 19.795  1.00 10.83  ? 114 LYS I CA  1 
ATOM   10660 C  C   . LYS I  1 114 ? -9.786  -31.295 19.717  1.00 12.45  ? 114 LYS I C   1 
ATOM   10661 O  O   . LYS I  1 114 ? -9.266  -31.959 20.634  1.00 12.39  ? 114 LYS I O   1 
ATOM   10662 C  CB  . LYS I  1 114 ? -11.370 -29.329 20.061  1.00 13.66  ? 114 LYS I CB  1 
ATOM   10663 C  CG  . LYS I  1 114 ? -11.912 -29.866 21.372  1.00 47.40  ? 114 LYS I CG  1 
ATOM   10664 C  CD  . LYS I  1 114 ? -10.790 -29.919 22.414  1.00 65.78  ? 114 LYS I CD  1 
ATOM   10665 C  CE  . LYS I  1 114 ? -11.225 -30.478 23.778  1.00 72.14  ? 114 LYS I CE  1 
ATOM   10666 N  NZ  . LYS I  1 114 ? -10.108 -30.556 24.761  1.00 81.01  ? 114 LYS I NZ  1 
ATOM   10667 N  N   . GLN I  1 115 ? -10.157 -31.865 18.562  1.00 8.18   ? 115 GLN I N   1 
ATOM   10668 C  CA  . GLN I  1 115 ? -10.003 -33.314 18.399  1.00 10.56  ? 115 GLN I CA  1 
ATOM   10669 C  C   . GLN I  1 115 ? -8.532  -33.671 18.471  1.00 9.92   ? 115 GLN I C   1 
ATOM   10670 O  O   . GLN I  1 115 ? -8.118  -34.668 19.082  1.00 14.24  ? 115 GLN I O   1 
ATOM   10671 C  CB  . GLN I  1 115 ? -10.473 -33.857 17.044  1.00 12.82  ? 115 GLN I CB  1 
ATOM   10672 C  CG  . GLN I  1 115 ? -11.747 -33.300 16.413  1.00 65.53  ? 115 GLN I CG  1 
ATOM   10673 C  CD  . GLN I  1 115 ? -12.908 -33.200 17.371  0.00 100.00 ? 115 GLN I CD  1 
ATOM   10674 O  OE1 . GLN I  1 115 ? -12.953 -33.879 18.387  0.00 100.00 ? 115 GLN I OE1 1 
ATOM   10675 N  NE2 . GLN I  1 115 ? -13.833 -32.307 17.074  0.00 100.00 ? 115 GLN I NE2 1 
ATOM   10676 N  N   . GLY I  1 116 ? -7.728  -32.919 17.730  1.00 6.56   ? 116 GLY I N   1 
ATOM   10677 C  CA  . GLY I  1 116 ? -6.299  -33.229 17.724  1.00 3.00   ? 116 GLY I CA  1 
ATOM   10678 C  C   . GLY I  1 116 ? -5.728  -33.104 19.146  1.00 4.66   ? 116 GLY I C   1 
ATOM   10679 O  O   . GLY I  1 116 ? -4.859  -33.891 19.557  1.00 7.42   ? 116 GLY I O   1 
ATOM   10680 N  N   . ILE I  1 117 ? -6.224  -32.121 19.898  1.00 1.00   ? 117 ILE I N   1 
ATOM   10681 C  CA  . ILE I  1 117 ? -5.659  -31.945 21.225  1.00 1.00   ? 117 ILE I CA  1 
ATOM   10682 C  C   . ILE I  1 117 ? -5.804  -33.224 21.996  1.00 11.60  ? 117 ILE I C   1 
ATOM   10683 O  O   . ILE I  1 117 ? -4.860  -33.895 22.436  1.00 22.10  ? 117 ILE I O   1 
ATOM   10684 C  CB  . ILE I  1 117 ? -6.265  -30.724 21.946  1.00 1.00   ? 117 ILE I CB  1 
ATOM   10685 C  CG1 . ILE I  1 117 ? -5.727  -29.493 21.213  1.00 5.49   ? 117 ILE I CG1 1 
ATOM   10686 C  CG2 . ILE I  1 117 ? -5.979  -30.746 23.464  1.00 1.00   ? 117 ILE I CG2 1 
ATOM   10687 C  CD1 . ILE I  1 117 ? -6.256  -28.149 21.657  1.00 1.00   ? 117 ILE I CD1 1 
ATOM   10688 N  N   . GLU I  1 118 ? -7.068  -33.606 21.989  1.00 22.10  ? 118 GLU I N   1 
ATOM   10689 C  CA  . GLU I  1 118 ? -7.459  -34.786 22.707  1.00 23.63  ? 118 GLU I CA  1 
ATOM   10690 C  C   . GLU I  1 118 ? -6.678  -36.051 22.367  1.00 17.78  ? 118 GLU I C   1 
ATOM   10691 O  O   . GLU I  1 118 ? -6.155  -36.723 23.247  1.00 19.28  ? 118 GLU I O   1 
ATOM   10692 C  CB  . GLU I  1 118 ? -8.985  -34.829 22.777  1.00 29.78  ? 118 GLU I CB  1 
ATOM   10693 C  CG  . GLU I  1 118 ? -9.421  -33.796 23.755  1.00 70.09  ? 118 GLU I CG  1 
ATOM   10694 C  CD  . GLU I  1 118 ? -10.901 -33.673 23.975  0.00 100.00 ? 118 GLU I CD  1 
ATOM   10695 O  OE1 . GLU I  1 118 ? -11.654 -33.758 22.977  0.00 100.00 ? 118 GLU I OE1 1 
ATOM   10696 O  OE2 . GLU I  1 118 ? -11.277 -33.619 25.140  0.00 100.00 ? 118 GLU I OE2 1 
ATOM   10697 N  N   . LEU I  1 119 ? -6.468  -36.245 21.074  1.00 7.51   ? 119 LEU I N   1 
ATOM   10698 C  CA  . LEU I  1 119 ? -5.780  -37.379 20.441  1.00 7.75   ? 119 LEU I CA  1 
ATOM   10699 C  C   . LEU I  1 119 ? -4.340  -37.521 20.896  1.00 18.03  ? 119 LEU I C   1 
ATOM   10700 O  O   . LEU I  1 119 ? -3.868  -38.543 21.428  1.00 7.17   ? 119 LEU I O   1 
ATOM   10701 C  CB  . LEU I  1 119 ? -5.814  -37.076 18.938  1.00 4.25   ? 119 LEU I CB  1 
ATOM   10702 C  CG  . LEU I  1 119 ? -4.936  -38.042 18.169  1.00 15.67  ? 119 LEU I CG  1 
ATOM   10703 C  CD1 . LEU I  1 119 ? -5.475  -39.381 18.535  1.00 13.59  ? 119 LEU I CD1 1 
ATOM   10704 C  CD2 . LEU I  1 119 ? -4.939  -37.796 16.669  1.00 5.57   ? 119 LEU I CD2 1 
ATOM   10705 N  N   . THR I  1 120 ? -3.708  -36.381 20.668  1.00 16.52  ? 120 THR I N   1 
ATOM   10706 C  CA  . THR I  1 120 ? -2.317  -36.125 20.988  1.00 12.48  ? 120 THR I CA  1 
ATOM   10707 C  C   . THR I  1 120 ? -2.177  -36.346 22.473  1.00 8.90   ? 120 THR I C   1 
ATOM   10708 O  O   . THR I  1 120 ? -1.180  -36.841 22.996  1.00 5.29   ? 120 THR I O   1 
ATOM   10709 C  CB  . THR I  1 120 ? -2.259  -34.652 20.745  1.00 17.18  ? 120 THR I CB  1 
ATOM   10710 O  OG1 . THR I  1 120 ? -1.609  -34.388 19.506  1.00 13.72  ? 120 THR I OG1 1 
ATOM   10711 C  CG2 . THR I  1 120 ? -1.735  -33.931 21.890  1.00 16.07  ? 120 THR I CG2 1 
ATOM   10712 N  N   . ASP I  1 121 ? -3.236  -35.993 23.174  1.00 3.99   ? 121 ASP I N   1 
ATOM   10713 C  CA  . ASP I  1 121 ? -3.173  -36.193 24.603  1.00 17.57  ? 121 ASP I CA  1 
ATOM   10714 C  C   . ASP I  1 121 ? -3.264  -37.681 24.888  1.00 14.87  ? 121 ASP I C   1 
ATOM   10715 O  O   . ASP I  1 121 ? -2.469  -38.226 25.649  1.00 14.78  ? 121 ASP I O   1 
ATOM   10716 C  CB  . ASP I  1 121 ? -4.325  -35.454 25.227  1.00 17.54  ? 121 ASP I CB  1 
ATOM   10717 C  CG  . ASP I  1 121 ? -4.152  -35.304 26.717  1.00 16.08  ? 121 ASP I CG  1 
ATOM   10718 O  OD1 . ASP I  1 121 ? -3.849  -36.356 27.361  1.00 28.89  ? 121 ASP I OD1 1 
ATOM   10719 O  OD2 . ASP I  1 121 ? -4.297  -34.174 27.230  1.00 83.14  ? 121 ASP I OD2 1 
ATOM   10720 N  N   . LYS I  1 122 ? -4.222  -38.356 24.289  1.00 22.28  ? 122 LYS I N   1 
ATOM   10721 C  CA  . LYS I  1 122 ? -4.270  -39.782 24.572  1.00 16.68  ? 122 LYS I CA  1 
ATOM   10722 C  C   . LYS I  1 122 ? -2.990  -40.403 24.049  1.00 30.74  ? 122 LYS I C   1 
ATOM   10723 O  O   . LYS I  1 122 ? -2.460  -41.285 24.711  1.00 36.12  ? 122 LYS I O   1 
ATOM   10724 C  CB  . LYS I  1 122 ? -5.397  -40.499 23.824  1.00 24.69  ? 122 LYS I CB  1 
ATOM   10725 C  CG  . LYS I  1 122 ? -6.616  -40.902 24.648  1.00 46.27  ? 122 LYS I CG  1 
ATOM   10726 C  CD  . LYS I  1 122 ? -7.525  -41.729 23.797  0.00 100.00 ? 122 LYS I CD  1 
ATOM   10727 C  CE  . LYS I  1 122 ? -8.454  -42.540 24.620  0.00 100.00 ? 122 LYS I CE  1 
ATOM   10728 N  NZ  . LYS I  1 122 ? -7.794  -43.702 25.336  0.00 100.00 ? 122 LYS I NZ  1 
ATOM   10729 N  N   . GLU I  1 123 ? -2.528  -40.014 22.863  1.00 11.00  ? 123 GLU I N   1 
ATOM   10730 C  CA  . GLU I  1 123 ? -1.284  -40.617 22.378  1.00 16.55  ? 123 GLU I CA  1 
ATOM   10731 C  C   . GLU I  1 123 ? 0.048   -40.297 23.079  1.00 29.47  ? 123 GLU I C   1 
ATOM   10732 O  O   . GLU I  1 123 ? 1.100   -40.875 22.708  1.00 39.73  ? 123 GLU I O   1 
ATOM   10733 C  CB  . GLU I  1 123 ? -1.150  -40.560 20.861  1.00 11.81  ? 123 GLU I CB  1 
ATOM   10734 C  CG  . GLU I  1 123 ? -2.324  -41.252 20.194  1.00 22.16  ? 123 GLU I CG  1 
ATOM   10735 C  CD  . GLU I  1 123 ? -2.168  -41.394 18.682  1.00 54.69  ? 123 GLU I CD  1 
ATOM   10736 O  OE1 . GLU I  1 123 ? -1.378  -40.680 18.016  1.00 25.92  ? 123 GLU I OE1 1 
ATOM   10737 O  OE2 . GLU I  1 123 ? -2.869  -42.296 18.149  1.00 72.58  ? 123 GLU I OE2 1 
ATOM   10738 N  N   . GLY I  1 124 ? 0.046   -39.425 24.046  1.00 25.88  ? 124 GLY I N   1 
ATOM   10739 C  CA  . GLY I  1 124 ? 1.310   -39.056 24.708  1.00 36.60  ? 124 GLY I CA  1 
ATOM   10740 C  C   . GLY I  1 124 ? 2.217   -38.015 24.032  1.00 53.24  ? 124 GLY I C   1 
ATOM   10741 O  O   . GLY I  1 124 ? 3.325   -37.747 24.511  1.00 47.83  ? 124 GLY I O   1 
ATOM   10742 N  N   . ASP I  1 125 ? 1.787   -37.423 22.922  1.00 22.99  ? 125 ASP I N   1 
ATOM   10743 C  CA  . ASP I  1 125 ? 2.648   -36.456 22.240  1.00 12.51  ? 125 ASP I CA  1 
ATOM   10744 C  C   . ASP I  1 125 ? 2.445   -35.089 22.852  1.00 10.64  ? 125 ASP I C   1 
ATOM   10745 O  O   . ASP I  1 125 ? 1.677   -34.309 22.335  1.00 11.71  ? 125 ASP I O   1 
ATOM   10746 C  CB  . ASP I  1 125 ? 2.326   -36.410 20.746  1.00 2.76   ? 125 ASP I CB  1 
ATOM   10747 C  CG  . ASP I  1 125 ? 3.322   -35.559 19.958  1.00 21.67  ? 125 ASP I CG  1 
ATOM   10748 O  OD1 . ASP I  1 125 ? 4.055   -34.763 20.608  1.00 21.10  ? 125 ASP I OD1 1 
ATOM   10749 O  OD2 . ASP I  1 125 ? 3.362   -35.723 18.712  1.00 13.11  ? 125 ASP I OD2 1 
ATOM   10750 N  N   . ASP I  1 126 ? 3.118   -34.822 23.954  1.00 5.96   ? 126 ASP I N   1 
ATOM   10751 C  CA  . ASP I  1 126 ? 2.984   -33.568 24.675  1.00 9.61   ? 126 ASP I CA  1 
ATOM   10752 C  C   . ASP I  1 126 ? 3.339   -32.367 23.835  1.00 6.42   ? 126 ASP I C   1 
ATOM   10753 O  O   . ASP I  1 126 ? 2.638   -31.363 23.843  1.00 7.39   ? 126 ASP I O   1 
ATOM   10754 C  CB  . ASP I  1 126 ? 3.962   -33.572 25.834  1.00 17.25  ? 126 ASP I CB  1 
ATOM   10755 C  CG  . ASP I  1 126 ? 3.931   -34.885 26.569  1.00 39.47  ? 126 ASP I CG  1 
ATOM   10756 O  OD1 . ASP I  1 126 ? 2.917   -35.060 27.282  1.00 40.29  ? 126 ASP I OD1 1 
ATOM   10757 O  OD2 . ASP I  1 126 ? 4.844   -35.720 26.321  1.00 51.17  ? 126 ASP I OD2 1 
ATOM   10758 N  N   . VAL I  1 127 ? 4.406   -32.481 23.065  1.00 2.68   ? 127 VAL I N   1 
ATOM   10759 C  CA  . VAL I  1 127 ? 4.773   -31.336 22.264  1.00 2.31   ? 127 VAL I CA  1 
ATOM   10760 C  C   . VAL I  1 127 ? 3.643   -31.013 21.297  1.00 9.28   ? 127 VAL I C   1 
ATOM   10761 O  O   . VAL I  1 127 ? 3.168   -29.870 21.308  1.00 12.21  ? 127 VAL I O   1 
ATOM   10762 C  CB  . VAL I  1 127 ? 6.164   -31.511 21.590  1.00 4.23   ? 127 VAL I CB  1 
ATOM   10763 C  CG1 . VAL I  1 127 ? 6.346   -30.506 20.461  1.00 1.51   ? 127 VAL I CG1 1 
ATOM   10764 C  CG2 . VAL I  1 127 ? 7.319   -31.395 22.614  1.00 1.00   ? 127 VAL I CG2 1 
ATOM   10765 N  N   . THR I  1 128 ? 3.196   -31.973 20.481  1.00 2.35   ? 128 THR I N   1 
ATOM   10766 C  CA  . THR I  1 128 ? 2.156   -31.619 19.518  1.00 1.00   ? 128 THR I CA  1 
ATOM   10767 C  C   . THR I  1 128 ? 0.900   -31.094 20.205  1.00 6.67   ? 128 THR I C   1 
ATOM   10768 O  O   . THR I  1 128 ? 0.263   -30.135 19.756  1.00 8.17   ? 128 THR I O   1 
ATOM   10769 C  CB  . THR I  1 128 ? 1.791   -32.756 18.587  1.00 1.23   ? 128 THR I CB  1 
ATOM   10770 O  OG1 . THR I  1 128 ? 2.964   -33.287 17.978  1.00 5.35   ? 128 THR I OG1 1 
ATOM   10771 C  CG2 . THR I  1 128 ? 0.881   -32.304 17.439  1.00 1.00   ? 128 THR I CG2 1 
ATOM   10772 N  N   . ASN I  1 129 ? 0.609   -31.648 21.372  1.00 2.26   ? 129 ASN I N   1 
ATOM   10773 C  CA  . ASN I  1 129 ? -0.530  -31.243 22.196  1.00 1.98   ? 129 ASN I CA  1 
ATOM   10774 C  C   . ASN I  1 129 ? -0.428  -29.753 22.513  1.00 2.61   ? 129 ASN I C   1 
ATOM   10775 O  O   . ASN I  1 129 ? -1.337  -28.973 22.228  1.00 4.75   ? 129 ASN I O   1 
ATOM   10776 C  CB  . ASN I  1 129 ? -0.464  -32.055 23.487  1.00 1.00   ? 129 ASN I CB  1 
ATOM   10777 C  CG  . ASN I  1 129 ? -1.623  -31.792 24.381  1.00 8.33   ? 129 ASN I CG  1 
ATOM   10778 O  OD1 . ASN I  1 129 ? -1.452  -31.198 25.447  1.00 27.80  ? 129 ASN I OD1 1 
ATOM   10779 N  ND2 . ASN I  1 129 ? -2.808  -32.244 23.967  1.00 3.34   ? 129 ASN I ND2 1 
ATOM   10780 N  N   . ASP I  1 130 ? 0.700   -29.338 23.071  1.00 1.00   ? 130 ASP I N   1 
ATOM   10781 C  CA  . ASP I  1 130 ? 0.874   -27.908 23.341  1.00 5.70   ? 130 ASP I CA  1 
ATOM   10782 C  C   . ASP I  1 130 ? 0.798   -26.992 22.118  1.00 7.30   ? 130 ASP I C   1 
ATOM   10783 O  O   . ASP I  1 130 ? 0.240   -25.924 22.232  1.00 10.25  ? 130 ASP I O   1 
ATOM   10784 C  CB  . ASP I  1 130 ? 2.122   -27.531 24.155  1.00 10.19  ? 130 ASP I CB  1 
ATOM   10785 C  CG  . ASP I  1 130 ? 1.886   -27.425 25.660  1.00 57.54  ? 130 ASP I CG  1 
ATOM   10786 O  OD1 . ASP I  1 130 ? 0.887   -27.911 26.197  1.00 57.24  ? 130 ASP I OD1 1 
ATOM   10787 O  OD2 . ASP I  1 130 ? 2.775   -26.787 26.305  1.00 94.44  ? 130 ASP I OD2 1 
ATOM   10788 N  N   . MET I  1 131 ? 1.331   -27.377 20.964  1.00 2.83   ? 131 MET I N   1 
ATOM   10789 C  CA  . MET I  1 131 ? 1.258   -26.497 19.804  1.00 6.10   ? 131 MET I CA  1 
ATOM   10790 C  C   . MET I  1 131 ? -0.203  -26.192 19.497  1.00 5.20   ? 131 MET I C   1 
ATOM   10791 O  O   . MET I  1 131 ? -0.585  -25.061 19.190  1.00 4.52   ? 131 MET I O   1 
ATOM   10792 C  CB  . MET I  1 131 ? 1.637   -27.261 18.545  1.00 12.71  ? 131 MET I CB  1 
ATOM   10793 C  CG  . MET I  1 131 ? 3.018   -27.337 17.960  1.00 17.79  ? 131 MET I CG  1 
ATOM   10794 S  SD  . MET I  1 131 ? 2.814   -27.484 16.104  1.00 15.89  ? 131 MET I SD  1 
ATOM   10795 C  CE  . MET I  1 131 ? 1.573   -28.737 15.831  1.00 13.23  ? 131 MET I CE  1 
ATOM   10796 N  N   . LEU I  1 132 ? -0.965  -27.286 19.432  1.00 2.57   ? 132 LEU I N   1 
ATOM   10797 C  CA  . LEU I  1 132 ? -2.363  -27.203 19.055  1.00 4.81   ? 132 LEU I CA  1 
ATOM   10798 C  C   . LEU I  1 132 ? -3.103  -26.319 20.049  1.00 6.26   ? 132 LEU I C   1 
ATOM   10799 O  O   . LEU I  1 132 ? -3.919  -25.474 19.698  1.00 6.34   ? 132 LEU I O   1 
ATOM   10800 C  CB  . LEU I  1 132 ? -2.896  -28.630 19.029  1.00 5.65   ? 132 LEU I CB  1 
ATOM   10801 C  CG  . LEU I  1 132 ? -2.973  -29.413 17.723  1.00 10.09  ? 132 LEU I CG  1 
ATOM   10802 C  CD1 . LEU I  1 132 ? -2.181  -28.809 16.576  1.00 7.32   ? 132 LEU I CD1 1 
ATOM   10803 C  CD2 . LEU I  1 132 ? -2.673  -30.890 17.991  1.00 5.37   ? 132 LEU I CD2 1 
ATOM   10804 N  N   . ILE I  1 133 ? -2.794  -26.497 21.325  1.00 4.03   ? 133 ILE I N   1 
ATOM   10805 C  CA  . ILE I  1 133 ? -3.486  -25.669 22.299  1.00 4.31   ? 133 ILE I CA  1 
ATOM   10806 C  C   . ILE I  1 133 ? -3.249  -24.190 22.045  1.00 8.63   ? 133 ILE I C   1 
ATOM   10807 O  O   . ILE I  1 133 ? -4.175  -23.377 21.994  1.00 7.03   ? 133 ILE I O   1 
ATOM   10808 C  CB  . ILE I  1 133 ? -3.065  -26.079 23.693  1.00 5.36   ? 133 ILE I CB  1 
ATOM   10809 C  CG1 . ILE I  1 133 ? -3.552  -27.498 23.905  1.00 7.23   ? 133 ILE I CG1 1 
ATOM   10810 C  CG2 . ILE I  1 133 ? -3.762  -25.227 24.735  1.00 1.85   ? 133 ILE I CG2 1 
ATOM   10811 C  CD1 . ILE I  1 133 ? -3.250  -27.996 25.304  1.00 1.26   ? 133 ILE I CD1 1 
ATOM   10812 N  N   . ALA I  1 134 ? -1.993  -23.855 21.795  1.00 4.00   ? 134 ALA I N   1 
ATOM   10813 C  CA  . ALA I  1 134 ? -1.697  -22.463 21.540  1.00 3.42   ? 134 ALA I CA  1 
ATOM   10814 C  C   . ALA I  1 134 ? -2.373  -21.996 20.277  1.00 5.49   ? 134 ALA I C   1 
ATOM   10815 O  O   . ALA I  1 134 ? -2.883  -20.894 20.257  1.00 9.85   ? 134 ALA I O   1 
ATOM   10816 C  CB  . ALA I  1 134 ? -0.209  -22.279 21.426  1.00 1.00   ? 134 ALA I CB  1 
ATOM   10817 N  N   . PHE I  1 135 ? -2.378  -22.789 19.216  1.00 1.00   ? 135 PHE I N   1 
ATOM   10818 C  CA  . PHE I  1 135 ? -3.080  -22.287 18.044  1.00 2.88   ? 135 PHE I CA  1 
ATOM   10819 C  C   . PHE I  1 135 ? -4.572  -22.092 18.415  1.00 5.12   ? 135 PHE I C   1 
ATOM   10820 O  O   . PHE I  1 135 ? -5.281  -21.152 18.012  1.00 6.42   ? 135 PHE I O   1 
ATOM   10821 C  CB  . PHE I  1 135 ? -3.003  -23.337 16.935  1.00 8.95   ? 135 PHE I CB  1 
ATOM   10822 C  CG  . PHE I  1 135 ? -1.626  -23.598 16.389  1.00 19.09  ? 135 PHE I CG  1 
ATOM   10823 C  CD1 . PHE I  1 135 ? -0.587  -22.721 16.613  1.00 22.62  ? 135 PHE I CD1 1 
ATOM   10824 C  CD2 . PHE I  1 135 ? -1.399  -24.699 15.579  1.00 22.12  ? 135 PHE I CD2 1 
ATOM   10825 C  CE1 . PHE I  1 135 ? 0.660   -22.959 16.053  1.00 21.27  ? 135 PHE I CE1 1 
ATOM   10826 C  CE2 . PHE I  1 135 ? -0.182  -24.926 15.007  1.00 17.84  ? 135 PHE I CE2 1 
ATOM   10827 C  CZ  . PHE I  1 135 ? 0.867   -24.071 15.262  1.00 13.04  ? 135 PHE I CZ  1 
ATOM   10828 N  N   . LYS I  1 136 ? -5.071  -23.012 19.224  1.00 3.00   ? 136 LYS I N   1 
ATOM   10829 C  CA  . LYS I  1 136 ? -6.468  -22.893 19.549  1.00 3.93   ? 136 LYS I CA  1 
ATOM   10830 C  C   . LYS I  1 136 ? -6.715  -21.567 20.272  1.00 3.50   ? 136 LYS I C   1 
ATOM   10831 O  O   . LYS I  1 136 ? -7.680  -20.845 19.997  1.00 4.22   ? 136 LYS I O   1 
ATOM   10832 C  CB  . LYS I  1 136 ? -6.987  -24.115 20.316  1.00 2.34   ? 136 LYS I CB  1 
ATOM   10833 C  CG  . LYS I  1 136 ? -8.526  -24.072 20.385  1.00 9.77   ? 136 LYS I CG  1 
ATOM   10834 C  CD  . LYS I  1 136 ? -9.212  -25.310 20.985  1.00 6.00   ? 136 LYS I CD  1 
ATOM   10835 C  CE  . LYS I  1 136 ? -9.604  -25.113 22.428  1.00 42.42  ? 136 LYS I CE  1 
ATOM   10836 N  NZ  . LYS I  1 136 ? -10.795 -24.246 22.587  1.00 16.48  ? 136 LYS I NZ  1 
ATOM   10837 N  N   . ALA I  1 137 ? -5.836  -21.269 21.207  1.00 1.00   ? 137 ALA I N   1 
ATOM   10838 C  CA  . ALA I  1 137 ? -6.048  -20.053 21.971  1.00 2.00   ? 137 ALA I CA  1 
ATOM   10839 C  C   . ALA I  1 137 ? -6.253  -18.880 21.043  1.00 6.85   ? 137 ALA I C   1 
ATOM   10840 O  O   . ALA I  1 137 ? -7.153  -18.057 21.195  1.00 7.94   ? 137 ALA I O   1 
ATOM   10841 C  CB  . ALA I  1 137 ? -4.828  -19.830 22.835  1.00 1.06   ? 137 ALA I CB  1 
ATOM   10842 N  N   . SER I  1 138 ? -5.433  -18.808 20.018  1.00 1.00   ? 138 SER I N   1 
ATOM   10843 C  CA  . SER I  1 138 ? -5.528  -17.689 19.086  1.00 1.27   ? 138 SER I CA  1 
ATOM   10844 C  C   . SER I  1 138 ? -6.832  -17.696 18.239  1.00 6.38   ? 138 SER I C   1 
ATOM   10845 O  O   . SER I  1 138 ? -7.487  -16.665 17.980  1.00 2.84   ? 138 SER I O   1 
ATOM   10846 C  CB  . SER I  1 138 ? -4.281  -17.732 18.196  1.00 1.00   ? 138 SER I CB  1 
ATOM   10847 O  OG  . SER I  1 138 ? -4.450  -16.859 17.097  1.00 35.89  ? 138 SER I OG  1 
ATOM   10848 N  N   . ILE I  1 139 ? -7.192  -18.899 17.789  1.00 2.88   ? 139 ILE I N   1 
ATOM   10849 C  CA  . ILE I  1 139 ? -8.406  -19.048 17.000  1.00 2.39   ? 139 ILE I CA  1 
ATOM   10850 C  C   . ILE I  1 139 ? -9.615  -18.597 17.827  1.00 5.71   ? 139 ILE I C   1 
ATOM   10851 O  O   . ILE I  1 139 ? -10.488 -17.873 17.342  1.00 4.43   ? 139 ILE I O   1 
ATOM   10852 C  CB  . ILE I  1 139 ? -8.605  -20.507 16.579  1.00 5.53   ? 139 ILE I CB  1 
ATOM   10853 C  CG1 . ILE I  1 139 ? -7.576  -20.827 15.503  1.00 4.79   ? 139 ILE I CG1 1 
ATOM   10854 C  CG2 . ILE I  1 139 ? -10.023 -20.734 16.056  1.00 1.76   ? 139 ILE I CG2 1 
ATOM   10855 C  CD1 . ILE I  1 139 ? -7.381  -22.291 15.380  1.00 5.40   ? 139 ILE I CD1 1 
ATOM   10856 N  N   . ASP I  1 140 ? -9.615  -18.998 19.090  1.00 2.06   ? 140 ASP I N   1 
ATOM   10857 C  CA  . ASP I  1 140 ? -10.700 -18.574 19.945  1.00 3.21   ? 140 ASP I CA  1 
ATOM   10858 C  C   . ASP I  1 140 ? -10.786 -17.066 20.065  1.00 7.32   ? 140 ASP I C   1 
ATOM   10859 O  O   . ASP I  1 140 ? -11.890 -16.500 20.082  1.00 10.01  ? 140 ASP I O   1 
ATOM   10860 C  CB  . ASP I  1 140 ? -10.582 -19.154 21.345  1.00 9.41   ? 140 ASP I CB  1 
ATOM   10861 C  CG  . ASP I  1 140 ? -10.908 -20.627 21.384  1.00 21.11  ? 140 ASP I CG  1 
ATOM   10862 O  OD1 . ASP I  1 140 ? -11.567 -21.139 20.452  1.00 11.92  ? 140 ASP I OD1 1 
ATOM   10863 O  OD2 . ASP I  1 140 ? -10.470 -21.287 22.347  1.00 13.95  ? 140 ASP I OD2 1 
ATOM   10864 N  N   . LYS I  1 141 ? -9.633  -16.411 20.127  1.00 4.66   ? 141 LYS I N   1 
ATOM   10865 C  CA  . LYS I  1 141 ? -9.654  -14.967 20.262  1.00 3.03   ? 141 LYS I CA  1 
ATOM   10866 C  C   . LYS I  1 141 ? -10.209 -14.346 18.993  1.00 3.23   ? 141 LYS I C   1 
ATOM   10867 O  O   . LYS I  1 141 ? -11.078 -13.457 19.030  1.00 7.56   ? 141 LYS I O   1 
ATOM   10868 C  CB  . LYS I  1 141 ? -8.253  -14.460 20.593  1.00 5.02   ? 141 LYS I CB  1 
ATOM   10869 C  CG  . LYS I  1 141 ? -8.130  -12.966 20.858  1.00 46.16  ? 141 LYS I CG  1 
ATOM   10870 C  CD  . LYS I  1 141 ? -6.659  -12.630 20.908  1.00 84.12  ? 141 LYS I CD  1 
ATOM   10871 C  CE  . LYS I  1 141 ? -6.377  -11.142 20.966  0.00 100.00 ? 141 LYS I CE  1 
ATOM   10872 N  NZ  . LYS I  1 141 ? -6.672  -10.546 22.297  0.00 100.00 ? 141 LYS I NZ  1 
ATOM   10873 N  N   . HIS I  1 142 ? -9.731  -14.864 17.867  1.00 2.54   ? 142 HIS I N   1 
ATOM   10874 C  CA  . HIS I  1 142 ? -10.210 -14.318 16.605  1.00 2.75   ? 142 HIS I CA  1 
ATOM   10875 C  C   . HIS I  1 142 ? -11.706 -14.519 16.501  1.00 6.18   ? 142 HIS I C   1 
ATOM   10876 O  O   . HIS I  1 142 ? -12.406 -13.678 15.966  1.00 5.79   ? 142 HIS I O   1 
ATOM   10877 C  CB  . HIS I  1 142 ? -9.611  -15.079 15.442  1.00 2.87   ? 142 HIS I CB  1 
ATOM   10878 C  CG  . HIS I  1 142 ? -8.168  -14.765 15.228  1.00 7.75   ? 142 HIS I CG  1 
ATOM   10879 N  ND1 . HIS I  1 142 ? -7.723  -13.467 15.106  1.00 8.84   ? 142 HIS I ND1 1 
ATOM   10880 C  CD2 . HIS I  1 142 ? -7.086  -15.566 15.092  1.00 7.27   ? 142 HIS I CD2 1 
ATOM   10881 C  CE1 . HIS I  1 142 ? -6.421  -13.481 14.886  1.00 5.66   ? 142 HIS I CE1 1 
ATOM   10882 N  NE2 . HIS I  1 142 ? -6.006  -14.735 14.909  1.00 6.62   ? 142 HIS I NE2 1 
ATOM   10883 N  N   . ILE I  1 143 ? -12.159 -15.682 16.952  1.00 2.54   ? 143 ILE I N   1 
ATOM   10884 C  CA  . ILE I  1 143 ? -13.574 -15.983 16.835  1.00 4.97   ? 143 ILE I CA  1 
ATOM   10885 C  C   . ILE I  1 143 ? -14.346 -14.967 17.648  1.00 8.42   ? 143 ILE I C   1 
ATOM   10886 O  O   . ILE I  1 143 ? -15.323 -14.436 17.147  1.00 2.57   ? 143 ILE I O   1 
ATOM   10887 C  CB  . ILE I  1 143 ? -13.905 -17.403 17.236  1.00 8.95   ? 143 ILE I CB  1 
ATOM   10888 C  CG1 . ILE I  1 143 ? -13.397 -18.373 16.168  1.00 2.87   ? 143 ILE I CG1 1 
ATOM   10889 C  CG2 . ILE I  1 143 ? -15.400 -17.523 17.509  1.00 7.47   ? 143 ILE I CG2 1 
ATOM   10890 C  CD1 . ILE I  1 143 ? -13.469 -19.811 16.644  1.00 1.32   ? 143 ILE I CD1 1 
ATOM   10891 N  N   . TRP I  1 144 ? -13.841 -14.611 18.827  1.00 3.18   ? 144 TRP I N   1 
ATOM   10892 C  CA  . TRP I  1 144 ? -14.503 -13.605 19.617  1.00 1.00   ? 144 TRP I CA  1 
ATOM   10893 C  C   . TRP I  1 144 ? -14.534 -12.277 18.884  1.00 7.66   ? 144 TRP I C   1 
ATOM   10894 O  O   . TRP I  1 144 ? -15.575 -11.607 18.773  1.00 10.34  ? 144 TRP I O   1 
ATOM   10895 C  CB  . TRP I  1 144 ? -13.907 -13.477 21.012  1.00 2.12   ? 144 TRP I CB  1 
ATOM   10896 C  CG  . TRP I  1 144 ? -14.054 -12.095 21.582  1.00 5.87   ? 144 TRP I CG  1 
ATOM   10897 C  CD1 . TRP I  1 144 ? -15.210 -11.447 21.819  1.00 10.69  ? 144 TRP I CD1 1 
ATOM   10898 C  CD2 . TRP I  1 144 ? -13.007 -11.175 21.937  1.00 4.53   ? 144 TRP I CD2 1 
ATOM   10899 N  NE1 . TRP I  1 144 ? -14.975 -10.210 22.358  1.00 7.95   ? 144 TRP I NE1 1 
ATOM   10900 C  CE2 . TRP I  1 144 ? -13.627 -9.994  22.400  1.00 8.27   ? 144 TRP I CE2 1 
ATOM   10901 C  CE3 . TRP I  1 144 ? -11.612 -11.261 21.989  1.00 5.73   ? 144 TRP I CE3 1 
ATOM   10902 C  CZ2 . TRP I  1 144 ? -12.887 -8.885  22.859  1.00 7.18   ? 144 TRP I CZ2 1 
ATOM   10903 C  CZ3 . TRP I  1 144 ? -10.890 -10.152 22.416  1.00 6.37   ? 144 TRP I CZ3 1 
ATOM   10904 C  CH2 . TRP I  1 144 ? -11.524 -8.984  22.832  1.00 6.32   ? 144 TRP I CH2 1 
ATOM   10905 N  N   . MET I  1 145 ? -13.395 -11.920 18.311  1.00 4.08   ? 145 MET I N   1 
ATOM   10906 C  CA  . MET I  1 145 ? -13.339 -10.627 17.632  1.00 2.93   ? 145 MET I CA  1 
ATOM   10907 C  C   . MET I  1 145 ? -14.166 -10.510 16.367  1.00 10.05  ? 145 MET I C   1 
ATOM   10908 O  O   . MET I  1 145 ? -14.794 -9.482  16.129  1.00 7.10   ? 145 MET I O   1 
ATOM   10909 C  CB  . MET I  1 145 ? -11.887 -10.191 17.429  1.00 2.26   ? 145 MET I CB  1 
ATOM   10910 C  CG  . MET I  1 145 ? -11.153 -10.081 18.766  1.00 8.23   ? 145 MET I CG  1 
ATOM   10911 S  SD  . MET I  1 145 ? -9.483  -9.466  18.586  1.00 13.35  ? 145 MET I SD  1 
ATOM   10912 C  CE  . MET I  1 145 ? -8.801  -10.707 17.592  1.00 20.12  ? 145 MET I CE  1 
ATOM   10913 N  N   . PHE I  1 146 ? -14.130 -11.525 15.516  1.00 3.95   ? 146 PHE I N   1 
ATOM   10914 C  CA  . PHE I  1 146 ? -14.915 -11.425 14.284  1.00 6.64   ? 146 PHE I CA  1 
ATOM   10915 C  C   . PHE I  1 146 ? -16.420 -11.471 14.590  1.00 9.36   ? 146 PHE I C   1 
ATOM   10916 O  O   . PHE I  1 146 ? -17.202 -10.716 14.013  1.00 8.07   ? 146 PHE I O   1 
ATOM   10917 C  CB  . PHE I  1 146 ? -14.415 -12.379 13.184  1.00 7.68   ? 146 PHE I CB  1 
ATOM   10918 C  CG  . PHE I  1 146 ? -13.144 -11.920 12.538  1.00 9.25   ? 146 PHE I CG  1 
ATOM   10919 C  CD1 . PHE I  1 146 ? -13.161 -10.920 11.577  1.00 9.03   ? 146 PHE I CD1 1 
ATOM   10920 C  CD2 . PHE I  1 146 ? -11.918 -12.413 12.960  1.00 9.66   ? 146 PHE I CD2 1 
ATOM   10921 C  CE1 . PHE I  1 146 ? -11.985 -10.454 10.979  1.00 8.35   ? 146 PHE I CE1 1 
ATOM   10922 C  CE2 . PHE I  1 146 ? -10.741 -11.963 12.354  1.00 12.61  ? 146 PHE I CE2 1 
ATOM   10923 C  CZ  . PHE I  1 146 ? -10.767 -10.965 11.374  1.00 10.83  ? 146 PHE I CZ  1 
ATOM   10924 N  N   . LYS I  1 147 ? -16.826 -12.266 15.581  1.00 1.78   ? 147 LYS I N   1 
ATOM   10925 C  CA  . LYS I  1 147 ? -18.215 -12.266 16.010  1.00 2.55   ? 147 LYS I CA  1 
ATOM   10926 C  C   . LYS I  1 147 ? -18.622 -10.907 16.553  1.00 9.71   ? 147 LYS I C   1 
ATOM   10927 O  O   . LYS I  1 147 ? -19.687 -10.404 16.209  1.00 9.66   ? 147 LYS I O   1 
ATOM   10928 C  CB  . LYS I  1 147 ? -18.541 -13.418 16.956  1.00 4.92   ? 147 LYS I CB  1 
ATOM   10929 C  CG  . LYS I  1 147 ? -18.578 -14.723 16.212  1.00 6.75   ? 147 LYS I CG  1 
ATOM   10930 C  CD  . LYS I  1 147 ? -19.730 -15.603 16.630  1.00 26.78  ? 147 LYS I CD  1 
ATOM   10931 C  CE  . LYS I  1 147 ? -19.994 -16.655 15.548  1.00 13.81  ? 147 LYS I CE  1 
ATOM   10932 N  NZ  . LYS I  1 147 ? -21.228 -17.475 15.818  1.00 60.68  ? 147 LYS I NZ  1 
ATOM   10933 N  N   . ALA I  1 148 ? -17.750 -10.251 17.317  1.00 5.15   ? 148 ALA I N   1 
ATOM   10934 C  CA  . ALA I  1 148 ? -18.113 -8.917  17.811  1.00 4.21   ? 148 ALA I CA  1 
ATOM   10935 C  C   . ALA I  1 148 ? -18.304 -7.988  16.639  1.00 7.56   ? 148 ALA I C   1 
ATOM   10936 O  O   . ALA I  1 148 ? -19.221 -7.158  16.594  1.00 6.94   ? 148 ALA I O   1 
ATOM   10937 C  CB  . ALA I  1 148 ? -17.035 -8.370  18.734  1.00 3.02   ? 148 ALA I CB  1 
ATOM   10938 N  N   . PHE I  1 149 ? -17.472 -8.176  15.633  1.00 4.91   ? 149 PHE I N   1 
ATOM   10939 C  CA  . PHE I  1 149 ? -17.552 -7.304  14.464  1.00 3.66   ? 149 PHE I CA  1 
ATOM   10940 C  C   . PHE I  1 149 ? -18.889 -7.455  13.785  1.00 14.66  ? 149 PHE I C   1 
ATOM   10941 O  O   . PHE I  1 149 ? -19.478 -6.486  13.300  1.00 13.58  ? 149 PHE I O   1 
ATOM   10942 C  CB  . PHE I  1 149 ? -16.486 -7.683  13.454  1.00 4.71   ? 149 PHE I CB  1 
ATOM   10943 C  CG  . PHE I  1 149 ? -16.694 -7.088  12.095  1.00 7.59   ? 149 PHE I CG  1 
ATOM   10944 C  CD1 . PHE I  1 149 ? -16.243 -5.813  11.800  1.00 7.48   ? 149 PHE I CD1 1 
ATOM   10945 C  CD2 . PHE I  1 149 ? -17.250 -7.818  11.077  1.00 6.86   ? 149 PHE I CD2 1 
ATOM   10946 C  CE1 . PHE I  1 149 ? -16.406 -5.271  10.525  1.00 6.08   ? 149 PHE I CE1 1 
ATOM   10947 C  CE2 . PHE I  1 149 ? -17.434 -7.257  9.844   1.00 6.67   ? 149 PHE I CE2 1 
ATOM   10948 C  CZ  . PHE I  1 149 ? -16.999 -5.994  9.543   1.00 5.35   ? 149 PHE I CZ  1 
ATOM   10949 N  N   . LEU I  1 150 ? -19.328 -8.704  13.757  1.00 11.14  ? 150 LEU I N   1 
ATOM   10950 C  CA  . LEU I  1 150 ? -20.609 -9.063  13.172  1.00 9.36   ? 150 LEU I CA  1 
ATOM   10951 C  C   . LEU I  1 150 ? -21.776 -8.768  14.127  1.00 22.21  ? 150 LEU I C   1 
ATOM   10952 O  O   . LEU I  1 150 ? -22.924 -9.071  13.815  1.00 20.00  ? 150 LEU I O   1 
ATOM   10953 C  CB  . LEU I  1 150 ? -20.580 -10.568 12.852  1.00 4.44   ? 150 LEU I CB  1 
ATOM   10954 C  CG  . LEU I  1 150 ? -19.698 -10.926 11.680  1.00 7.12   ? 150 LEU I CG  1 
ATOM   10955 C  CD1 . LEU I  1 150 ? -19.644 -12.432 11.554  1.00 9.39   ? 150 LEU I CD1 1 
ATOM   10956 C  CD2 . LEU I  1 150 ? -20.384 -10.336 10.471  1.00 6.89   ? 150 LEU I CD2 1 
ATOM   10957 N  N   . GLY I  1 151 ? -21.499 -8.233  15.312  1.00 13.80  ? 151 GLY I N   1 
ATOM   10958 C  CA  . GLY I  1 151 ? -22.559 -7.955  16.269  1.00 9.99   ? 151 GLY I CA  1 
ATOM   10959 C  C   . GLY I  1 151 ? -23.080 -9.159  17.052  1.00 17.62  ? 151 GLY I C   1 
ATOM   10960 O  O   . GLY I  1 151 ? -24.134 -9.080  17.708  1.00 23.94  ? 151 GLY I O   1 
ATOM   10961 N  N   . LYS I  1 152 ? -22.342 -10.266 16.987  1.00 15.74  ? 152 LYS I N   1 
ATOM   10962 C  CA  . LYS I  1 152 ? -22.716 -11.464 17.721