data_1QI9
# 
_entry.id   1QI9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QI9         
RCSB  RCSB001172   
WWPDB D_1000001172 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QI9 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Weyand, M.'    1 
'Hecht, H.-J.'  2 
'Kiess, M.'     3 
'Liaud, M.F.'   4 
'Vilter, H.'    5 
'Schomburg, D.' 6 
# 
_citation.id                        primary 
_citation.title                     
'X-ray structure determination of a vanadium-dependent haloperoxidase from Ascophyllum nodosum at 2.0 A resolution.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            293 
_citation.page_first                595 
_citation.page_last                 611 
_citation.year                      1999 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10543953 
_citation.pdbx_database_id_DOI      10.1006/jmbi.1999.3179 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Weyand, M.'    1 ? 
primary 'Hecht, H.'     2 ? 
primary 'Kiess, M.'     3 ? 
primary 'Liaud, M.'     4 ? 
primary 'Vilter, H.'    5 ? 
primary 'Schomburg, D.' 6 ? 
# 
_cell.entry_id           1QI9 
_cell.length_a           113.190 
_cell.length_b           113.190 
_cell.length_c           272.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QI9 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (VANADIUM BROMOPEROXIDASE)' 60284.016 2    1.11.1.10 ? ? ? 
2 non-polymer syn 'VANADATE ION'                       114.939   2    ?         ? ? ? 
3 non-polymer syn 'IODIDE ION'                         126.904   5    ?         ? ? ? 
4 water       nat water                                18.015    1759 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(PCA)TCSTSDDADDPTPPNERDDEAFASRVAAAKRELEGTGTVCQINNGETDLAAKFHKSLPHDDLGQVDADAFAALED
CILNGDLSICEDVPVGNSEGDPVGRLVNPTAAFAIDISGPAFSATTIPPVPTLPSPELAAQLAEVYWMALARDVPFMQYG
TDDITVTAAANLAGMEGFPNLDAVSIGSDGTVDPLSQLFRATFVGVETGPFISQLLVNSFTIDSITVEPKQETFAPDVNY
MVDFDEWLNIQNGGPPAGPELLDDELRFVRNARDLARVTFTDNINTEAYRGALILLGLDAFNRAGVNGPFIDIDRQAGFV
NFGISHYFRLIGAAELAQRSSWYQKWQVHRFARPEALGGTLHLTIKGELNADFDLSLLENAELLKRVAAINAAQNPNNEV
TYLLPQAIQEGSPTHPSYPSGHATQNGAFATVLKALIGLDRGGDCYPDPVYPDDDGLKLIDFRGSCLTFEGEINKLAVNV
AFGRQMLGIHYRFDGIQGLLLGETITVRTLHQELMTFAEESTFEFRLFTGEVIKLFQDGTFTIDGFKCPGLVYTGVENCV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QTCSTSDDADDPTPPNERDDEAFASRVAAAKRELEGTGTVCQINNGETDLAAKFHKSLPHDDLGQVDADAFAALEDCILN
GDLSICEDVPVGNSEGDPVGRLVNPTAAFAIDISGPAFSATTIPPVPTLPSPELAAQLAEVYWMALARDVPFMQYGTDDI
TVTAAANLAGMEGFPNLDAVSIGSDGTVDPLSQLFRATFVGVETGPFISQLLVNSFTIDSITVEPKQETFAPDVNYMVDF
DEWLNIQNGGPPAGPELLDDELRFVRNARDLARVTFTDNINTEAYRGALILLGLDAFNRAGVNGPFIDIDRQAGFVNFGI
SHYFRLIGAAELAQRSSWYQKWQVHRFARPEALGGTLHLTIKGELNADFDLSLLENAELLKRVAAINAAQNPNNEVTYLL
PQAIQEGSPTHPSYPSGHATQNGAFATVLKALIGLDRGGDCYPDPVYPDDDGLKLIDFRGSCLTFEGEINKLAVNVAFGR
QMLGIHYRFDGIQGLLLGETITVRTLHQELMTFAEESTFEFRLFTGEVIKLFQDGTFTIDGFKCPGLVYTGVENCV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PCA n 
1 2   THR n 
1 3   CYS n 
1 4   SER n 
1 5   THR n 
1 6   SER n 
1 7   ASP n 
1 8   ASP n 
1 9   ALA n 
1 10  ASP n 
1 11  ASP n 
1 12  PRO n 
1 13  THR n 
1 14  PRO n 
1 15  PRO n 
1 16  ASN n 
1 17  GLU n 
1 18  ARG n 
1 19  ASP n 
1 20  ASP n 
1 21  GLU n 
1 22  ALA n 
1 23  PHE n 
1 24  ALA n 
1 25  SER n 
1 26  ARG n 
1 27  VAL n 
1 28  ALA n 
1 29  ALA n 
1 30  ALA n 
1 31  LYS n 
1 32  ARG n 
1 33  GLU n 
1 34  LEU n 
1 35  GLU n 
1 36  GLY n 
1 37  THR n 
1 38  GLY n 
1 39  THR n 
1 40  VAL n 
1 41  CYS n 
1 42  GLN n 
1 43  ILE n 
1 44  ASN n 
1 45  ASN n 
1 46  GLY n 
1 47  GLU n 
1 48  THR n 
1 49  ASP n 
1 50  LEU n 
1 51  ALA n 
1 52  ALA n 
1 53  LYS n 
1 54  PHE n 
1 55  HIS n 
1 56  LYS n 
1 57  SER n 
1 58  LEU n 
1 59  PRO n 
1 60  HIS n 
1 61  ASP n 
1 62  ASP n 
1 63  LEU n 
1 64  GLY n 
1 65  GLN n 
1 66  VAL n 
1 67  ASP n 
1 68  ALA n 
1 69  ASP n 
1 70  ALA n 
1 71  PHE n 
1 72  ALA n 
1 73  ALA n 
1 74  LEU n 
1 75  GLU n 
1 76  ASP n 
1 77  CYS n 
1 78  ILE n 
1 79  LEU n 
1 80  ASN n 
1 81  GLY n 
1 82  ASP n 
1 83  LEU n 
1 84  SER n 
1 85  ILE n 
1 86  CYS n 
1 87  GLU n 
1 88  ASP n 
1 89  VAL n 
1 90  PRO n 
1 91  VAL n 
1 92  GLY n 
1 93  ASN n 
1 94  SER n 
1 95  GLU n 
1 96  GLY n 
1 97  ASP n 
1 98  PRO n 
1 99  VAL n 
1 100 GLY n 
1 101 ARG n 
1 102 LEU n 
1 103 VAL n 
1 104 ASN n 
1 105 PRO n 
1 106 THR n 
1 107 ALA n 
1 108 ALA n 
1 109 PHE n 
1 110 ALA n 
1 111 ILE n 
1 112 ASP n 
1 113 ILE n 
1 114 SER n 
1 115 GLY n 
1 116 PRO n 
1 117 ALA n 
1 118 PHE n 
1 119 SER n 
1 120 ALA n 
1 121 THR n 
1 122 THR n 
1 123 ILE n 
1 124 PRO n 
1 125 PRO n 
1 126 VAL n 
1 127 PRO n 
1 128 THR n 
1 129 LEU n 
1 130 PRO n 
1 131 SER n 
1 132 PRO n 
1 133 GLU n 
1 134 LEU n 
1 135 ALA n 
1 136 ALA n 
1 137 GLN n 
1 138 LEU n 
1 139 ALA n 
1 140 GLU n 
1 141 VAL n 
1 142 TYR n 
1 143 TRP n 
1 144 MET n 
1 145 ALA n 
1 146 LEU n 
1 147 ALA n 
1 148 ARG n 
1 149 ASP n 
1 150 VAL n 
1 151 PRO n 
1 152 PHE n 
1 153 MET n 
1 154 GLN n 
1 155 TYR n 
1 156 GLY n 
1 157 THR n 
1 158 ASP n 
1 159 ASP n 
1 160 ILE n 
1 161 THR n 
1 162 VAL n 
1 163 THR n 
1 164 ALA n 
1 165 ALA n 
1 166 ALA n 
1 167 ASN n 
1 168 LEU n 
1 169 ALA n 
1 170 GLY n 
1 171 MET n 
1 172 GLU n 
1 173 GLY n 
1 174 PHE n 
1 175 PRO n 
1 176 ASN n 
1 177 LEU n 
1 178 ASP n 
1 179 ALA n 
1 180 VAL n 
1 181 SER n 
1 182 ILE n 
1 183 GLY n 
1 184 SER n 
1 185 ASP n 
1 186 GLY n 
1 187 THR n 
1 188 VAL n 
1 189 ASP n 
1 190 PRO n 
1 191 LEU n 
1 192 SER n 
1 193 GLN n 
1 194 LEU n 
1 195 PHE n 
1 196 ARG n 
1 197 ALA n 
1 198 THR n 
1 199 PHE n 
1 200 VAL n 
1 201 GLY n 
1 202 VAL n 
1 203 GLU n 
1 204 THR n 
1 205 GLY n 
1 206 PRO n 
1 207 PHE n 
1 208 ILE n 
1 209 SER n 
1 210 GLN n 
1 211 LEU n 
1 212 LEU n 
1 213 VAL n 
1 214 ASN n 
1 215 SER n 
1 216 PHE n 
1 217 THR n 
1 218 ILE n 
1 219 ASP n 
1 220 SER n 
1 221 ILE n 
1 222 THR n 
1 223 VAL n 
1 224 GLU n 
1 225 PRO n 
1 226 LYS n 
1 227 GLN n 
1 228 GLU n 
1 229 THR n 
1 230 PHE n 
1 231 ALA n 
1 232 PRO n 
1 233 ASP n 
1 234 VAL n 
1 235 ASN n 
1 236 TYR n 
1 237 MET n 
1 238 VAL n 
1 239 ASP n 
1 240 PHE n 
1 241 ASP n 
1 242 GLU n 
1 243 TRP n 
1 244 LEU n 
1 245 ASN n 
1 246 ILE n 
1 247 GLN n 
1 248 ASN n 
1 249 GLY n 
1 250 GLY n 
1 251 PRO n 
1 252 PRO n 
1 253 ALA n 
1 254 GLY n 
1 255 PRO n 
1 256 GLU n 
1 257 LEU n 
1 258 LEU n 
1 259 ASP n 
1 260 ASP n 
1 261 GLU n 
1 262 LEU n 
1 263 ARG n 
1 264 PHE n 
1 265 VAL n 
1 266 ARG n 
1 267 ASN n 
1 268 ALA n 
1 269 ARG n 
1 270 ASP n 
1 271 LEU n 
1 272 ALA n 
1 273 ARG n 
1 274 VAL n 
1 275 THR n 
1 276 PHE n 
1 277 THR n 
1 278 ASP n 
1 279 ASN n 
1 280 ILE n 
1 281 ASN n 
1 282 THR n 
1 283 GLU n 
1 284 ALA n 
1 285 TYR n 
1 286 ARG n 
1 287 GLY n 
1 288 ALA n 
1 289 LEU n 
1 290 ILE n 
1 291 LEU n 
1 292 LEU n 
1 293 GLY n 
1 294 LEU n 
1 295 ASP n 
1 296 ALA n 
1 297 PHE n 
1 298 ASN n 
1 299 ARG n 
1 300 ALA n 
1 301 GLY n 
1 302 VAL n 
1 303 ASN n 
1 304 GLY n 
1 305 PRO n 
1 306 PHE n 
1 307 ILE n 
1 308 ASP n 
1 309 ILE n 
1 310 ASP n 
1 311 ARG n 
1 312 GLN n 
1 313 ALA n 
1 314 GLY n 
1 315 PHE n 
1 316 VAL n 
1 317 ASN n 
1 318 PHE n 
1 319 GLY n 
1 320 ILE n 
1 321 SER n 
1 322 HIS n 
1 323 TYR n 
1 324 PHE n 
1 325 ARG n 
1 326 LEU n 
1 327 ILE n 
1 328 GLY n 
1 329 ALA n 
1 330 ALA n 
1 331 GLU n 
1 332 LEU n 
1 333 ALA n 
1 334 GLN n 
1 335 ARG n 
1 336 SER n 
1 337 SER n 
1 338 TRP n 
1 339 TYR n 
1 340 GLN n 
1 341 LYS n 
1 342 TRP n 
1 343 GLN n 
1 344 VAL n 
1 345 HIS n 
1 346 ARG n 
1 347 PHE n 
1 348 ALA n 
1 349 ARG n 
1 350 PRO n 
1 351 GLU n 
1 352 ALA n 
1 353 LEU n 
1 354 GLY n 
1 355 GLY n 
1 356 THR n 
1 357 LEU n 
1 358 HIS n 
1 359 LEU n 
1 360 THR n 
1 361 ILE n 
1 362 LYS n 
1 363 GLY n 
1 364 GLU n 
1 365 LEU n 
1 366 ASN n 
1 367 ALA n 
1 368 ASP n 
1 369 PHE n 
1 370 ASP n 
1 371 LEU n 
1 372 SER n 
1 373 LEU n 
1 374 LEU n 
1 375 GLU n 
1 376 ASN n 
1 377 ALA n 
1 378 GLU n 
1 379 LEU n 
1 380 LEU n 
1 381 LYS n 
1 382 ARG n 
1 383 VAL n 
1 384 ALA n 
1 385 ALA n 
1 386 ILE n 
1 387 ASN n 
1 388 ALA n 
1 389 ALA n 
1 390 GLN n 
1 391 ASN n 
1 392 PRO n 
1 393 ASN n 
1 394 ASN n 
1 395 GLU n 
1 396 VAL n 
1 397 THR n 
1 398 TYR n 
1 399 LEU n 
1 400 LEU n 
1 401 PRO n 
1 402 GLN n 
1 403 ALA n 
1 404 ILE n 
1 405 GLN n 
1 406 GLU n 
1 407 GLY n 
1 408 SER n 
1 409 PRO n 
1 410 THR n 
1 411 HIS n 
1 412 PRO n 
1 413 SER n 
1 414 TYR n 
1 415 PRO n 
1 416 SER n 
1 417 GLY n 
1 418 HIS n 
1 419 ALA n 
1 420 THR n 
1 421 GLN n 
1 422 ASN n 
1 423 GLY n 
1 424 ALA n 
1 425 PHE n 
1 426 ALA n 
1 427 THR n 
1 428 VAL n 
1 429 LEU n 
1 430 LYS n 
1 431 ALA n 
1 432 LEU n 
1 433 ILE n 
1 434 GLY n 
1 435 LEU n 
1 436 ASP n 
1 437 ARG n 
1 438 GLY n 
1 439 GLY n 
1 440 ASP n 
1 441 CYS n 
1 442 TYR n 
1 443 PRO n 
1 444 ASP n 
1 445 PRO n 
1 446 VAL n 
1 447 TYR n 
1 448 PRO n 
1 449 ASP n 
1 450 ASP n 
1 451 ASP n 
1 452 GLY n 
1 453 LEU n 
1 454 LYS n 
1 455 LEU n 
1 456 ILE n 
1 457 ASP n 
1 458 PHE n 
1 459 ARG n 
1 460 GLY n 
1 461 SER n 
1 462 CYS n 
1 463 LEU n 
1 464 THR n 
1 465 PHE n 
1 466 GLU n 
1 467 GLY n 
1 468 GLU n 
1 469 ILE n 
1 470 ASN n 
1 471 LYS n 
1 472 LEU n 
1 473 ALA n 
1 474 VAL n 
1 475 ASN n 
1 476 VAL n 
1 477 ALA n 
1 478 PHE n 
1 479 GLY n 
1 480 ARG n 
1 481 GLN n 
1 482 MET n 
1 483 LEU n 
1 484 GLY n 
1 485 ILE n 
1 486 HIS n 
1 487 TYR n 
1 488 ARG n 
1 489 PHE n 
1 490 ASP n 
1 491 GLY n 
1 492 ILE n 
1 493 GLN n 
1 494 GLY n 
1 495 LEU n 
1 496 LEU n 
1 497 LEU n 
1 498 GLY n 
1 499 GLU n 
1 500 THR n 
1 501 ILE n 
1 502 THR n 
1 503 VAL n 
1 504 ARG n 
1 505 THR n 
1 506 LEU n 
1 507 HIS n 
1 508 GLN n 
1 509 GLU n 
1 510 LEU n 
1 511 MET n 
1 512 THR n 
1 513 PHE n 
1 514 ALA n 
1 515 GLU n 
1 516 GLU n 
1 517 SER n 
1 518 THR n 
1 519 PHE n 
1 520 GLU n 
1 521 PHE n 
1 522 ARG n 
1 523 LEU n 
1 524 PHE n 
1 525 THR n 
1 526 GLY n 
1 527 GLU n 
1 528 VAL n 
1 529 ILE n 
1 530 LYS n 
1 531 LEU n 
1 532 PHE n 
1 533 GLN n 
1 534 ASP n 
1 535 GLY n 
1 536 THR n 
1 537 PHE n 
1 538 THR n 
1 539 ILE n 
1 540 ASP n 
1 541 GLY n 
1 542 PHE n 
1 543 LYS n 
1 544 CYS n 
1 545 PRO n 
1 546 GLY n 
1 547 LEU n 
1 548 VAL n 
1 549 TYR n 
1 550 THR n 
1 551 GLY n 
1 552 VAL n 
1 553 GLU n 
1 554 ASN n 
1 555 CYS n 
1 556 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Ascophyllum nodosum' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      52969 
_entity_src_nat.genus                      Ascophyllum 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRXV_ASCNO 
_struct_ref.pdbx_db_accession          P81701 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1QI9 A 1 ? 556 ? P81701 1 ? 556 ? 1 556 
2 1 1QI9 B 1 ? 556 ? P81701 1 ? 556 ? 1 556 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'        ? 'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ? 'C5 H11 N O2 S'  149.211 
PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3'     129.114 
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
VO4 non-polymer         . 'VANADATE ION'      ? 'O4 V -3'        114.939 
# 
_exptl.entry_id          1QI9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.9 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '2.0 M AMMONIUM SULPHATE 50 MM TRIS/HCL, PH 8.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           130 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS-NICOLET X100' 
_diffrn_detector.pdbx_collection_date   1997-03-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1QI9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             31.6 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   105540 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.0 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   85.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QI9 
_refine.ls_number_reflns_obs                     100219 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.0 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    95 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.165 
_refine.ls_R_factor_R_free                       0.219 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  5320 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               9.56 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.146 
_refine.pdbx_overall_ESU_R_Free                  0.149 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8490 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             1759 
_refine_hist.number_atoms_total               10264 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        31.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.014 0.02  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.032 0.04  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.034 0.05  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.286 2.000 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        1.735 3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         1.628 2.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        2.255 3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.13  0.15  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.172 0.3   ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.249 0.3   ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.117 0.3   ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        3.9   7.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     14.6  15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    30.8  20.0  ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1QI9 
_struct.title                     
'X-RAY SIRAS STRUCTURE DETERMINATION OF A VANADIUM-DEPENDENT HALOPEROXIDASE FROM ASCOPHYLLUM NODOSUM AT 2.0 A RESOLUTION' 
_struct.pdbx_descriptor           'VANADIUM BROMOPEROXIDASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QI9 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'BROMOPEROXIDASE, VANADIUM, HALOPEROXIDASE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 15  ? THR A 37  ? PRO A 15  THR A 37  1 ? 23 
HELX_P HELX_P2  2  ASP A 67  ? ASN A 80  ? ASP A 67  ASN A 80  1 ? 14 
HELX_P HELX_P3  3  LEU A 83  ? GLU A 87  ? LEU A 83  GLU A 87  1 ? 5  
HELX_P HELX_P4  4  PRO A 132 ? ALA A 147 ? PRO A 132 ALA A 147 1 ? 16 
HELX_P HELX_P5  5  ASP A 159 ? GLY A 170 ? ASP A 159 GLY A 170 1 ? 12 
HELX_P HELX_P6  6  PRO A 190 ? GLN A 193 ? PRO A 190 GLN A 193 1 ? 4  
HELX_P HELX_P7  7  GLN A 210 ? VAL A 213 ? GLN A 210 VAL A 213 1 ? 4  
HELX_P HELX_P8  8  PHE A 240 ? GLN A 247 ? PHE A 240 GLN A 247 1 ? 8  
HELX_P HELX_P9  9  ALA A 268 ? THR A 277 ? ALA A 268 THR A 277 1 ? 10 
HELX_P HELX_P10 10 THR A 282 ? GLY A 293 ? THR A 282 GLY A 293 1 ? 12 
HELX_P HELX_P11 11 ILE A 320 ? TRP A 342 ? ILE A 320 TRP A 342 1 ? 23 
HELX_P HELX_P12 12 PRO A 350 ? LYS A 362 ? PRO A 350 LYS A 362 1 ? 13 
HELX_P HELX_P13 13 LEU A 371 ? LEU A 374 ? LEU A 371 LEU A 374 1 ? 4  
HELX_P HELX_P14 14 ALA A 377 ? GLN A 390 ? ALA A 377 GLN A 390 1 ? 14 
HELX_P HELX_P15 15 GLY A 417 ? ILE A 433 ? GLY A 417 ILE A 433 1 ? 17 
HELX_P HELX_P16 16 LEU A 435 ? GLY A 438 ? LEU A 435 GLY A 438 1 ? 4  
HELX_P HELX_P17 17 PHE A 465 ? LEU A 483 ? PHE A 465 LEU A 483 1 ? 19 
HELX_P HELX_P18 18 ARG A 488 ? THR A 512 ? ARG A 488 THR A 512 1 ? 25 
HELX_P HELX_P19 1  PRO B 15  ? THR B 37  ? PRO B 15  THR B 37  1 ? 23 
HELX_P HELX_P20 2  ASP B 67  ? ASN B 80  ? ASP B 67  ASN B 80  1 ? 14 
HELX_P HELX_P21 3  LEU B 83  ? GLU B 87  ? LEU B 83  GLU B 87  1 ? 5  
HELX_P HELX_P22 4  PRO B 132 ? ALA B 147 ? PRO B 132 ALA B 147 1 ? 16 
HELX_P HELX_P23 5  ASP B 159 ? GLY B 170 ? ASP B 159 GLY B 170 1 ? 12 
HELX_P HELX_P24 6  PRO B 190 ? GLN B 193 ? PRO B 190 GLN B 193 1 ? 4  
HELX_P HELX_P25 7  GLN B 210 ? VAL B 213 ? GLN B 210 VAL B 213 1 ? 4  
HELX_P HELX_P26 8  PHE B 240 ? GLN B 247 ? PHE B 240 GLN B 247 1 ? 8  
HELX_P HELX_P27 9  ALA B 268 ? THR B 277 ? ALA B 268 THR B 277 1 ? 10 
HELX_P HELX_P28 10 THR B 282 ? GLY B 293 ? THR B 282 GLY B 293 1 ? 12 
HELX_P HELX_P29 11 ILE B 320 ? TRP B 342 ? ILE B 320 TRP B 342 1 ? 23 
HELX_P HELX_P30 12 PRO B 350 ? LYS B 362 ? PRO B 350 LYS B 362 1 ? 13 
HELX_P HELX_P31 13 LEU B 371 ? LEU B 374 ? LEU B 371 LEU B 374 1 ? 4  
HELX_P HELX_P32 14 ALA B 377 ? GLN B 390 ? ALA B 377 GLN B 390 1 ? 14 
HELX_P HELX_P33 15 GLY B 417 ? ILE B 433 ? GLY B 417 ILE B 433 1 ? 17 
HELX_P HELX_P34 16 LEU B 435 ? GLY B 438 ? LEU B 435 GLY B 438 1 ? 4  
HELX_P HELX_P35 17 PHE B 465 ? LEU B 483 ? PHE B 465 LEU B 483 1 ? 19 
HELX_P HELX_P36 18 ARG B 488 ? THR B 512 ? ARG B 488 THR B 512 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? A CYS 3   SG ? ? ? 1_555 B CYS 41  SG  ? ? A CYS 3   B CYS 41  1_555 ? ? ? ? ? ? ? 2.004 ? 
disulf2 disulf ?    ? A CYS 41  SG ? ? ? 1_555 B CYS 3   SG  ? ? A CYS 41  B CYS 3   1_555 ? ? ? ? ? ? ? 1.919 ? 
disulf3 disulf ?    ? A CYS 77  SG ? ? ? 1_555 A CYS 86  SG  ? ? A CYS 77  A CYS 86  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf4 disulf ?    ? A CYS 441 SG ? ? ? 1_555 A CYS 462 SG  ? ? A CYS 441 A CYS 462 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf5 disulf ?    ? A CYS 544 SG ? ? ? 1_555 A CYS 555 SG  ? ? A CYS 544 A CYS 555 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf6 disulf ?    ? B CYS 77  SG ? ? ? 1_555 B CYS 86  SG  ? ? B CYS 77  B CYS 86  1_555 ? ? ? ? ? ? ? 2.084 ? 
disulf7 disulf ?    ? B CYS 441 SG ? ? ? 1_555 B CYS 462 SG  ? ? B CYS 441 B CYS 462 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf8 disulf ?    ? B CYS 544 SG ? ? ? 1_555 B CYS 555 SG  ? ? B CYS 544 B CYS 555 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc1 metalc ?    ? C VO4 .   V  ? ? ? 1_555 A HIS 486 NE2 ? ? A VO4 600 A HIS 486 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc2 metalc ?    ? G VO4 .   V  ? ? ? 1_555 B HIS 486 NE2 ? ? B VO4 600 B HIS 486 1_555 ? ? ? ? ? ? ? 2.111 ? 
covale1 covale one  ? D IOD .   I  ? ? ? 1_555 A TYR 398 CE1 ? ? A IOD 601 A TYR 398 1_555 ? ? ? ? ? ? ? 2.089 ? 
covale2 covale one  ? E IOD .   I  ? ? ? 1_555 A TYR 447 CE1 ? ? A IOD 602 A TYR 447 1_555 ? ? ? ? ? ? ? 2.080 ? 
covale3 covale one  ? F IOD .   I  ? ? ? 1_555 A TYR 447 CE2 ? ? A IOD 603 A TYR 447 1_555 ? ? ? ? ? ? ? 2.060 ? 
covale4 covale one  ? H IOD .   I  ? ? ? 1_555 B TYR 447 CE1 ? ? B IOD 601 B TYR 447 1_555 ? ? ? ? ? ? ? 2.064 ? 
covale5 covale one  ? I IOD .   I  ? ? ? 1_555 B TYR 447 CE2 ? ? B IOD 602 B TYR 447 1_555 ? ? ? ? ? ? ? 2.053 ? 
covale6 covale both ? B PCA 1   C  ? ? ? 1_555 B THR 2   N   ? ? B PCA 1   B THR 2   1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 414 A . ? TYR 414 A PRO 415 A ? PRO 415 A 1 -5.75 
2 TYR 414 B . ? TYR 414 B PRO 415 B ? PRO 415 B 1 -2.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 2 ? 
S2 ? 2 ? 
S3 ? 4 ? 
S4 ? 2 ? 
S5 ? 2 ? 
S6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S2 1 2 ? anti-parallel 
S3 1 2 ? anti-parallel 
S3 2 3 ? anti-parallel 
S3 3 4 ? anti-parallel 
S4 1 2 ? anti-parallel 
S5 1 2 ? anti-parallel 
S6 1 2 ? anti-parallel 
S6 2 3 ? anti-parallel 
S6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 PHE A 216 ? ILE A 218 ? PHE A 216 ILE A 218 
S1 2 ILE A 221 ? VAL A 223 ? ILE A 221 VAL A 223 
S2 1 PRO A 445 ? ASP A 449 ? PRO A 445 ASP A 449 
S2 2 LYS A 454 ? PHE A 458 ? LYS A 454 PHE A 458 
S3 1 SER A 517 ? ARG A 522 ? SER A 517 ARG A 522 
S3 2 GLU A 527 ? GLN A 533 ? GLU A 527 GLN A 533 
S3 3 PHE A 537 ? ILE A 539 ? PHE A 537 ILE A 539 
S3 4 PHE A 542 ? LYS A 543 ? PHE A 542 LYS A 543 
S4 1 PHE B 216 ? ILE B 218 ? PHE B 216 ILE B 218 
S4 2 ILE B 221 ? VAL B 223 ? ILE B 221 VAL B 223 
S5 1 VAL B 446 ? PRO B 448 ? VAL B 446 PRO B 448 
S5 2 LEU B 455 ? ASP B 457 ? LEU B 455 ASP B 457 
S6 1 THR B 518 ? ARG B 522 ? THR B 518 ARG B 522 
S6 2 VAL B 528 ? PHE B 532 ? VAL B 528 PHE B 532 
S6 3 PHE B 537 ? ILE B 539 ? PHE B 537 ILE B 539 
S6 4 PHE B 542 ? LYS B 543 ? PHE B 542 LYS B 543 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE VO4 A 600' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IOD A 601' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IOD A 602' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE IOD A 603' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE VO4 B 600' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE IOD B 601' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE IOD B 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 LYS A 341 ? LYS A 341  . ? 1_555 ? 
2  AC1 10 ARG A 349 ? ARG A 349  . ? 1_555 ? 
3  AC1 10 PRO A 409 ? PRO A 409  . ? 1_555 ? 
4  AC1 10 HIS A 411 ? HIS A 411  . ? 1_555 ? 
5  AC1 10 SER A 416 ? SER A 416  . ? 1_555 ? 
6  AC1 10 GLY A 417 ? GLY A 417  . ? 1_555 ? 
7  AC1 10 HIS A 418 ? HIS A 418  . ? 1_555 ? 
8  AC1 10 ARG A 480 ? ARG A 480  . ? 1_555 ? 
9  AC1 10 HIS A 486 ? HIS A 486  . ? 1_555 ? 
10 AC1 10 HOH J .   ? HOH A 1350 . ? 1_555 ? 
11 AC2 2  LYS A 362 ? LYS A 362  . ? 1_555 ? 
12 AC2 2  TYR A 398 ? TYR A 398  . ? 1_555 ? 
13 AC3 2  MET A 153 ? MET A 153  . ? 1_555 ? 
14 AC3 2  TYR A 447 ? TYR A 447  . ? 1_555 ? 
15 AC4 4  TYR A 447 ? TYR A 447  . ? 1_555 ? 
16 AC4 4  ASP A 457 ? ASP A 457  . ? 1_555 ? 
17 AC4 4  PHE A 458 ? PHE A 458  . ? 1_555 ? 
18 AC4 4  HOH J .   ? HOH A 995  . ? 1_555 ? 
19 AC5 10 LYS B 341 ? LYS B 341  . ? 1_555 ? 
20 AC5 10 ARG B 349 ? ARG B 349  . ? 1_555 ? 
21 AC5 10 PRO B 409 ? PRO B 409  . ? 1_555 ? 
22 AC5 10 HIS B 411 ? HIS B 411  . ? 1_555 ? 
23 AC5 10 SER B 416 ? SER B 416  . ? 1_555 ? 
24 AC5 10 GLY B 417 ? GLY B 417  . ? 1_555 ? 
25 AC5 10 HIS B 418 ? HIS B 418  . ? 1_555 ? 
26 AC5 10 ARG B 480 ? ARG B 480  . ? 1_555 ? 
27 AC5 10 HIS B 486 ? HIS B 486  . ? 1_555 ? 
28 AC5 10 HOH K .   ? HOH B 1387 . ? 1_555 ? 
29 AC6 2  MET B 153 ? MET B 153  . ? 1_555 ? 
30 AC6 2  TYR B 447 ? TYR B 447  . ? 1_555 ? 
31 AC7 3  TYR B 447 ? TYR B 447  . ? 1_555 ? 
32 AC7 3  ASP B 457 ? ASP B 457  . ? 1_555 ? 
33 AC7 3  HOH K .   ? HOH B 878  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QI9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QI9 
_atom_sites.fract_transf_matrix[1][1]   0.008835 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008835 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003672 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
V 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . THR A 1 2   ? 85.149  -15.673 29.970  1.00 37.00 ? 2    THR A N   1 
ATOM   2     C CA  . THR A 1 2   ? 85.998  -14.439 29.880  1.00 35.32 ? 2    THR A CA  1 
ATOM   3     C C   . THR A 1 2   ? 87.363  -14.813 29.325  1.00 32.11 ? 2    THR A C   1 
ATOM   4     O O   . THR A 1 2   ? 88.070  -15.670 29.865  1.00 33.00 ? 2    THR A O   1 
ATOM   5     C CB  . THR A 1 2   ? 86.081  -13.749 31.249  1.00 37.13 ? 2    THR A CB  1 
ATOM   6     O OG1 . THR A 1 2   ? 84.791  -13.133 31.478  1.00 38.75 ? 2    THR A OG1 1 
ATOM   7     C CG2 . THR A 1 2   ? 87.181  -12.713 31.361  1.00 37.23 ? 2    THR A CG2 1 
ATOM   8     N N   . CYS A 1 3   ? 87.754  -14.178 28.234  1.00 27.17 ? 3    CYS A N   1 
ATOM   9     C CA  . CYS A 1 3   ? 88.995  -14.421 27.546  1.00 21.82 ? 3    CYS A CA  1 
ATOM   10    C C   . CYS A 1 3   ? 90.229  -14.122 28.402  1.00 22.85 ? 3    CYS A C   1 
ATOM   11    O O   . CYS A 1 3   ? 90.172  -13.612 29.529  1.00 22.73 ? 3    CYS A O   1 
ATOM   12    C CB  . CYS A 1 3   ? 89.070  -13.575 26.262  1.00 18.91 ? 3    CYS A CB  1 
ATOM   13    S SG  . CYS A 1 3   ? 89.712  -11.903 26.611  1.00 12.17 ? 3    CYS A SG  1 
ATOM   14    N N   . SER A 1 4   ? 91.375  -14.478 27.815  1.00 22.06 ? 4    SER A N   1 
ATOM   15    C CA  . SER A 1 4   ? 92.650  -14.248 28.484  1.00 22.31 ? 4    SER A CA  1 
ATOM   16    C C   . SER A 1 4   ? 93.745  -14.197 27.428  1.00 21.89 ? 4    SER A C   1 
ATOM   17    O O   . SER A 1 4   ? 94.299  -13.113 27.180  1.00 20.77 ? 4    SER A O   1 
ATOM   18    C CB  . SER A 1 4   ? 92.873  -15.296 29.568  1.00 24.01 ? 4    SER A CB  1 
ATOM   19    O OG  . SER A 1 4   ? 93.009  -16.602 28.998  1.00 24.63 ? 4    SER A OG  1 
ATOM   20    N N   . THR A 1 5   ? 93.987  -15.311 26.728  1.00 19.59 ? 5    THR A N   1 
ATOM   21    C CA  . THR A 1 5   ? 95.056  -15.295 25.732  1.00 19.76 ? 5    THR A CA  1 
ATOM   22    C C   . THR A 1 5   ? 94.584  -15.144 24.306  1.00 17.88 ? 5    THR A C   1 
ATOM   23    O O   . THR A 1 5   ? 95.374  -14.954 23.364  1.00 17.10 ? 5    THR A O   1 
ATOM   24    C CB  . THR A 1 5   ? 95.978  -16.531 25.851  1.00 22.84 ? 5    THR A CB  1 
ATOM   25    O OG1 . THR A 1 5   ? 95.273  -17.723 25.442  1.00 24.93 ? 5    THR A OG1 1 
ATOM   26    C CG2 . THR A 1 5   ? 96.476  -16.677 27.281  1.00 23.55 ? 5    THR A CG2 1 
ATOM   27    N N   . SER A 1 6   ? 93.268  -15.180 24.120  1.00 17.70 ? 6    SER A N   1 
ATOM   28    C CA  . SER A 1 6   ? 92.703  -15.015 22.778  1.00 18.30 ? 6    SER A CA  1 
ATOM   29    C C   . SER A 1 6   ? 91.367  -14.280 22.780  1.00 15.52 ? 6    SER A C   1 
ATOM   30    O O   . SER A 1 6   ? 90.674  -14.273 23.790  1.00 14.89 ? 6    SER A O   1 
ATOM   31    C CB  . SER A 1 6   ? 92.501  -16.409 22.128  1.00 20.45 ? 6    SER A CB  1 
ATOM   32    O OG  . SER A 1 6   ? 92.418  -16.151 20.707  1.00 23.76 ? 6    SER A OG  1 
ATOM   33    N N   . ASP A 1 7   ? 91.016  -13.671 21.647  1.00 14.81 ? 7    ASP A N   1 
ATOM   34    C CA  . ASP A 1 7   ? 89.695  -13.011 21.538  1.00 12.60 ? 7    ASP A CA  1 
ATOM   35    C C   . ASP A 1 7   ? 89.406  -12.866 20.055  1.00 12.54 ? 7    ASP A C   1 
ATOM   36    O O   . ASP A 1 7   ? 90.149  -13.427 19.238  1.00 10.33 ? 7    ASP A O   1 
ATOM   37    C CB  . ASP A 1 7   ? 89.542  -11.711 22.298  1.00 10.82 ? 7    ASP A CB  1 
ATOM   38    C CG  . ASP A 1 7   ? 90.346  -10.523 21.832  1.00 10.06 ? 7    ASP A CG  1 
ATOM   39    O OD1 . ASP A 1 7   ? 91.106  -10.563 20.842  1.00 8.37  ? 7    ASP A OD1 1 
ATOM   40    O OD2 . ASP A 1 7   ? 90.216  -9.462  22.501  1.00 10.38 ? 7    ASP A OD2 1 
ATOM   41    N N   . ASP A 1 8   ? 88.444  -12.023 19.660  1.00 10.52 ? 8    ASP A N   1 
ATOM   42    C CA  . ASP A 1 8   ? 88.125  -11.939 18.245  1.00 11.80 ? 8    ASP A CA  1 
ATOM   43    C C   . ASP A 1 8   ? 88.926  -10.900 17.496  1.00 13.76 ? 8    ASP A C   1 
ATOM   44    O O   . ASP A 1 8   ? 88.710  -10.767 16.289  1.00 15.17 ? 8    ASP A O   1 
ATOM   45    C CB  . ASP A 1 8   ? 86.615  -11.645 18.083  1.00 13.24 ? 8    ASP A CB  1 
ATOM   46    C CG  . ASP A 1 8   ? 85.743  -12.761 18.647  1.00 13.55 ? 8    ASP A CG  1 
ATOM   47    O OD1 . ASP A 1 8   ? 86.222  -13.918 18.519  1.00 13.29 ? 8    ASP A OD1 1 
ATOM   48    O OD2 . ASP A 1 8   ? 84.650  -12.565 19.208  1.00 10.93 ? 8    ASP A OD2 1 
ATOM   49    N N   . ALA A 1 9   ? 89.798  -10.136 18.185  1.00 14.06 ? 9    ALA A N   1 
ATOM   50    C CA  . ALA A 1 9   ? 90.515  -9.100  17.453  1.00 12.69 ? 9    ALA A CA  1 
ATOM   51    C C   . ALA A 1 9   ? 91.637  -9.670  16.599  1.00 13.91 ? 9    ALA A C   1 
ATOM   52    O O   . ALA A 1 9   ? 92.330  -10.605 16.979  1.00 14.32 ? 9    ALA A O   1 
ATOM   53    C CB  . ALA A 1 9   ? 91.072  -8.086  18.444  1.00 13.06 ? 9    ALA A CB  1 
ATOM   54    N N   . ASP A 1 10  ? 91.902  -9.047  15.469  1.00 13.88 ? 10   ASP A N   1 
ATOM   55    C CA  . ASP A 1 10  ? 93.015  -9.271  14.578  1.00 14.15 ? 10   ASP A CA  1 
ATOM   56    C C   . ASP A 1 10  ? 94.146  -8.388  15.142  1.00 13.39 ? 10   ASP A C   1 
ATOM   57    O O   . ASP A 1 10  ? 94.524  -7.359  14.579  1.00 13.22 ? 10   ASP A O   1 
ATOM   58    C CB  . ASP A 1 10  ? 92.750  -8.856  13.150  1.00 17.27 ? 10   ASP A CB  1 
ATOM   59    C CG  . ASP A 1 10  ? 92.142  -9.873  12.221  1.00 21.80 ? 10   ASP A CG  1 
ATOM   60    O OD1 . ASP A 1 10  ? 92.315  -11.095 12.520  1.00 23.93 ? 10   ASP A OD1 1 
ATOM   61    O OD2 . ASP A 1 10  ? 91.547  -9.501  11.156  1.00 21.96 ? 10   ASP A OD2 1 
ATOM   62    N N   . ASP A 1 11  ? 94.680  -8.808  16.264  1.00 11.64 ? 11   ASP A N   1 
ATOM   63    C CA  . ASP A 1 11  ? 95.709  -8.170  17.041  1.00 12.84 ? 11   ASP A CA  1 
ATOM   64    C C   . ASP A 1 11  ? 96.727  -9.197  17.525  1.00 12.92 ? 11   ASP A C   1 
ATOM   65    O O   . ASP A 1 11  ? 96.358  -10.034 18.341  1.00 11.33 ? 11   ASP A O   1 
ATOM   66    C CB  . ASP A 1 11  ? 95.020  -7.577  18.300  1.00 10.47 ? 11   ASP A CB  1 
ATOM   67    C CG  . ASP A 1 11  ? 95.924  -6.631  19.053  1.00 12.52 ? 11   ASP A CG  1 
ATOM   68    O OD1 . ASP A 1 11  ? 97.155  -6.812  18.969  1.00 10.08 ? 11   ASP A OD1 1 
ATOM   69    O OD2 . ASP A 1 11  ? 95.425  -5.693  19.737  1.00 12.91 ? 11   ASP A OD2 1 
ATOM   70    N N   . PRO A 1 12  ? 97.988  -9.083  17.152  1.00 15.61 ? 12   PRO A N   1 
ATOM   71    C CA  . PRO A 1 12  ? 99.028  -10.010 17.599  1.00 15.33 ? 12   PRO A CA  1 
ATOM   72    C C   . PRO A 1 12  ? 99.171  -10.114 19.090  1.00 14.68 ? 12   PRO A C   1 
ATOM   73    O O   . PRO A 1 12  ? 99.527  -11.187 19.614  1.00 15.58 ? 12   PRO A O   1 
ATOM   74    C CB  . PRO A 1 12  ? 100.309 -9.515  16.927  1.00 15.12 ? 12   PRO A CB  1 
ATOM   75    C CG  . PRO A 1 12  ? 99.845  -8.689  15.783  1.00 17.52 ? 12   PRO A CG  1 
ATOM   76    C CD  . PRO A 1 12  ? 98.524  -8.068  16.207  1.00 16.47 ? 12   PRO A CD  1 
ATOM   77    N N   . THR A 1 13  ? 98.917  -9.039  19.862  1.00 12.47 ? 13   THR A N   1 
ATOM   78    C CA  . THR A 1 13  ? 99.036  -9.117  21.314  1.00 9.97  ? 13   THR A CA  1 
ATOM   79    C C   . THR A 1 13  ? 97.803  -9.753  21.938  1.00 12.30 ? 13   THR A C   1 
ATOM   80    O O   . THR A 1 13  ? 96.659  -9.372  21.668  1.00 11.65 ? 13   THR A O   1 
ATOM   81    C CB  . THR A 1 13  ? 99.214  -7.676  21.866  1.00 9.79  ? 13   THR A CB  1 
ATOM   82    O OG1 . THR A 1 13  ? 100.256 -6.990  21.133  1.00 9.25  ? 13   THR A OG1 1 
ATOM   83    C CG2 . THR A 1 13  ? 99.579  -7.642  23.325  1.00 6.28  ? 13   THR A CG2 1 
ATOM   84    N N   . PRO A 1 14  ? 97.971  -10.733 22.832  1.00 13.14 ? 14   PRO A N   1 
ATOM   85    C CA  . PRO A 1 14  ? 96.897  -11.359 23.544  1.00 12.70 ? 14   PRO A CA  1 
ATOM   86    C C   . PRO A 1 14  ? 96.233  -10.327 24.459  1.00 13.92 ? 14   PRO A C   1 
ATOM   87    O O   . PRO A 1 14  ? 96.902  -9.493  25.096  1.00 14.58 ? 14   PRO A O   1 
ATOM   88    C CB  . PRO A 1 14  ? 97.573  -12.400 24.438  1.00 12.98 ? 14   PRO A CB  1 
ATOM   89    C CG  . PRO A 1 14  ? 98.943  -12.605 23.886  1.00 13.39 ? 14   PRO A CG  1 
ATOM   90    C CD  . PRO A 1 14  ? 99.300  -11.330 23.184  1.00 13.93 ? 14   PRO A CD  1 
ATOM   91    N N   . PRO A 1 15  ? 94.934  -10.496 24.687  1.00 11.89 ? 15   PRO A N   1 
ATOM   92    C CA  . PRO A 1 15  ? 94.168  -9.669  25.582  1.00 11.03 ? 15   PRO A CA  1 
ATOM   93    C C   . PRO A 1 15  ? 94.832  -9.401  26.913  1.00 11.46 ? 15   PRO A C   1 
ATOM   94    O O   . PRO A 1 15  ? 94.922  -8.263  27.427  1.00 10.78 ? 15   PRO A O   1 
ATOM   95    C CB  . PRO A 1 15  ? 92.906  -10.524 25.801  1.00 11.69 ? 15   PRO A CB  1 
ATOM   96    C CG  . PRO A 1 15  ? 92.703  -11.107 24.447  1.00 11.68 ? 15   PRO A CG  1 
ATOM   97    C CD  . PRO A 1 15  ? 94.093  -11.541 24.021  1.00 12.35 ? 15   PRO A CD  1 
ATOM   98    N N   . ASN A 1 16  ? 95.314  -10.452 27.574  1.00 8.55  ? 16   ASN A N   1 
ATOM   99    C CA  . ASN A 1 16  ? 95.931  -10.292 28.872  1.00 10.06 ? 16   ASN A CA  1 
ATOM   100   C C   . ASN A 1 16  ? 97.338  -9.702  28.811  1.00 8.28  ? 16   ASN A C   1 
ATOM   101   O O   . ASN A 1 16  ? 97.945  -9.578  29.867  1.00 10.13 ? 16   ASN A O   1 
ATOM   102   C CB  . ASN A 1 16  ? 95.849  -11.575 29.684  1.00 10.62 ? 16   ASN A CB  1 
ATOM   103   C CG  . ASN A 1 16  ? 96.735  -12.661 29.113  1.00 12.95 ? 16   ASN A CG  1 
ATOM   104   O OD1 . ASN A 1 16  ? 97.296  -12.531 28.034  1.00 12.85 ? 16   ASN A OD1 1 
ATOM   105   N ND2 . ASN A 1 16  ? 96.790  -13.744 29.911  1.00 15.09 ? 16   ASN A ND2 1 
ATOM   106   N N   . GLU A 1 17  ? 97.869  -9.297  27.680  1.00 8.28  ? 17   GLU A N   1 
ATOM   107   C CA  . GLU A 1 17  ? 99.113  -8.557  27.584  1.00 10.55 ? 17   GLU A CA  1 
ATOM   108   C C   . GLU A 1 17  ? 98.913  -7.125  27.043  1.00 10.32 ? 17   GLU A C   1 
ATOM   109   O O   . GLU A 1 17  ? 99.860  -6.329  27.021  1.00 8.03  ? 17   GLU A O   1 
ATOM   110   C CB  . GLU A 1 17  ? 100.093 -9.304  26.644  1.00 10.70 ? 17   GLU A CB  1 
ATOM   111   C CG  . GLU A 1 17  ? 100.486 -10.622 27.327  1.00 13.72 ? 17   GLU A CG  1 
ATOM   112   C CD  . GLU A 1 17  ? 101.364 -11.505 26.469  1.00 14.76 ? 17   GLU A CD  1 
ATOM   113   O OE1 . GLU A 1 17  ? 101.991 -11.060 25.496  1.00 14.36 ? 17   GLU A OE1 1 
ATOM   114   O OE2 . GLU A 1 17  ? 101.382 -12.700 26.833  1.00 17.55 ? 17   GLU A OE2 1 
ATOM   115   N N   . ARG A 1 18  ? 97.713  -6.761  26.580  1.00 8.11  ? 18   ARG A N   1 
ATOM   116   C CA  . ARG A 1 18  ? 97.504  -5.450  25.968  1.00 9.72  ? 18   ARG A CA  1 
ATOM   117   C C   . ARG A 1 18  ? 97.676  -4.312  26.982  1.00 8.44  ? 18   ARG A C   1 
ATOM   118   O O   . ARG A 1 18  ? 98.167  -3.231  26.602  1.00 7.73  ? 18   ARG A O   1 
ATOM   119   C CB  . ARG A 1 18  ? 96.171  -5.328  25.214  1.00 7.47  ? 18   ARG A CB  1 
ATOM   120   C CG  . ARG A 1 18  ? 96.105  -6.317  24.076  1.00 8.66  ? 18   ARG A CG  1 
ATOM   121   C CD  . ARG A 1 18  ? 94.799  -6.288  23.265  1.00 8.48  ? 18   ARG A CD  1 
ATOM   122   N NE  . ARG A 1 18  ? 94.693  -7.511  22.451  1.00 7.50  ? 18   ARG A NE  1 
ATOM   123   C CZ  . ARG A 1 18  ? 93.570  -8.144  22.142  1.00 7.80  ? 18   ARG A CZ  1 
ATOM   124   N NH1 . ARG A 1 18  ? 92.393  -7.661  22.567  1.00 6.29  ? 18   ARG A NH1 1 
ATOM   125   N NH2 . ARG A 1 18  ? 93.556  -9.264  21.400  1.00 7.27  ? 18   ARG A NH2 1 
ATOM   126   N N   . ASP A 1 19  ? 97.269  -4.588  28.197  1.00 7.79  ? 19   ASP A N   1 
ATOM   127   C CA  . ASP A 1 19  ? 97.389  -3.660  29.302  1.00 9.93  ? 19   ASP A CA  1 
ATOM   128   C C   . ASP A 1 19  ? 98.871  -3.447  29.670  1.00 12.53 ? 19   ASP A C   1 
ATOM   129   O O   . ASP A 1 19  ? 99.321  -2.277  29.814  1.00 10.50 ? 19   ASP A O   1 
ATOM   130   C CB  . ASP A 1 19  ? 96.555  -4.150  30.476  1.00 8.13  ? 19   ASP A CB  1 
ATOM   131   C CG  . ASP A 1 19  ? 96.923  -5.493  31.060  1.00 9.40  ? 19   ASP A CG  1 
ATOM   132   O OD1 . ASP A 1 19  ? 97.539  -6.334  30.383  1.00 10.20 ? 19   ASP A OD1 1 
ATOM   133   O OD2 . ASP A 1 19  ? 96.614  -5.762  32.235  1.00 9.00  ? 19   ASP A OD2 1 
ATOM   134   N N   . ASP A 1 20  ? 99.641  -4.551  29.778  1.00 11.05 ? 20   ASP A N   1 
ATOM   135   C CA  . ASP A 1 20  ? 101.056 -4.417  30.084  1.00 12.02 ? 20   ASP A CA  1 
ATOM   136   C C   . ASP A 1 20  ? 101.806 -3.710  28.970  1.00 9.92  ? 20   ASP A C   1 
ATOM   137   O O   . ASP A 1 20  ? 102.702 -2.926  29.288  1.00 10.58 ? 20   ASP A O   1 
ATOM   138   C CB  . ASP A 1 20  ? 101.784 -5.747  30.344  1.00 15.19 ? 20   ASP A CB  1 
ATOM   139   C CG  . ASP A 1 20  ? 101.178 -6.547  31.473  1.00 16.45 ? 20   ASP A CG  1 
ATOM   140   O OD1 . ASP A 1 20  ? 100.905 -6.067  32.584  1.00 18.31 ? 20   ASP A OD1 1 
ATOM   141   O OD2 . ASP A 1 20  ? 100.974 -7.748  31.235  1.00 18.60 ? 20   ASP A OD2 1 
ATOM   142   N N   . GLU A 1 21  ? 101.536 -3.964  27.708  1.00 9.87  ? 21   GLU A N   1 
ATOM   143   C CA  . GLU A 1 21  ? 102.237 -3.323  26.619  1.00 9.53  ? 21   GLU A CA  1 
ATOM   144   C C   . GLU A 1 21  ? 101.943 -1.810  26.578  1.00 11.56 ? 21   GLU A C   1 
ATOM   145   O O   . GLU A 1 21  ? 102.857 -1.059  26.209  1.00 9.26  ? 21   GLU A O   1 
ATOM   146   C CB  . GLU A 1 21  ? 101.893 -3.926  25.269  1.00 11.97 ? 21   GLU A CB  1 
ATOM   147   C CG  . GLU A 1 21  ? 102.363 -5.381  25.162  1.00 13.32 ? 21   GLU A CG  1 
ATOM   148   C CD  . GLU A 1 21  ? 102.343 -5.837  23.736  1.00 16.09 ? 21   GLU A CD  1 
ATOM   149   O OE1 . GLU A 1 21  ? 101.656 -5.268  22.834  1.00 16.30 ? 21   GLU A OE1 1 
ATOM   150   O OE2 . GLU A 1 21  ? 103.051 -6.843  23.454  1.00 18.66 ? 21   GLU A OE2 1 
ATOM   151   N N   . ALA A 1 22  ? 100.711 -1.396  26.943  1.00 9.52  ? 22   ALA A N   1 
ATOM   152   C CA  . ALA A 1 22  ? 100.397 0.042   26.939  1.00 8.55  ? 22   ALA A CA  1 
ATOM   153   C C   . ALA A 1 22  ? 101.169 0.699   28.074  1.00 8.62  ? 22   ALA A C   1 
ATOM   154   O O   . ALA A 1 22  ? 101.804 1.731   27.852  1.00 8.79  ? 22   ALA A O   1 
ATOM   155   C CB  . ALA A 1 22  ? 98.920  0.335   27.077  1.00 8.14  ? 22   ALA A CB  1 
ATOM   156   N N   . PHE A 1 23  ? 101.208 0.090   29.257  1.00 9.73  ? 23   PHE A N   1 
ATOM   157   C CA  . PHE A 1 23  ? 101.979 0.628   30.365  1.00 10.98 ? 23   PHE A CA  1 
ATOM   158   C C   . PHE A 1 23  ? 103.455 0.747   29.986  1.00 10.99 ? 23   PHE A C   1 
ATOM   159   O O   . PHE A 1 23  ? 104.077 1.812   30.150  1.00 9.31  ? 23   PHE A O   1 
ATOM   160   C CB  . PHE A 1 23  ? 101.785 -0.174  31.642  1.00 11.04 ? 23   PHE A CB  1 
ATOM   161   C CG  . PHE A 1 23  ? 102.566 0.229   32.858  1.00 11.96 ? 23   PHE A CG  1 
ATOM   162   C CD1 . PHE A 1 23  ? 102.177 1.299   33.637  1.00 11.57 ? 23   PHE A CD1 1 
ATOM   163   C CD2 . PHE A 1 23  ? 103.710 -0.477  33.250  1.00 11.19 ? 23   PHE A CD2 1 
ATOM   164   C CE1 . PHE A 1 23  ? 102.870 1.679   34.770  1.00 12.18 ? 23   PHE A CE1 1 
ATOM   165   C CE2 . PHE A 1 23  ? 104.410 -0.105  34.373  1.00 11.66 ? 23   PHE A CE2 1 
ATOM   166   C CZ  . PHE A 1 23  ? 104.000 0.960   35.151  1.00 12.43 ? 23   PHE A CZ  1 
ATOM   167   N N   . ALA A 1 24  ? 104.017 -0.332  29.433  1.00 11.27 ? 24   ALA A N   1 
ATOM   168   C CA  . ALA A 1 24  ? 105.452 -0.331  29.112  1.00 10.29 ? 24   ALA A CA  1 
ATOM   169   C C   . ALA A 1 24  ? 105.799 0.804   28.163  1.00 9.23  ? 24   ALA A C   1 
ATOM   170   O O   . ALA A 1 24  ? 106.808 1.471   28.341  1.00 9.11  ? 24   ALA A O   1 
ATOM   171   C CB  . ALA A 1 24  ? 105.950 -1.658  28.528  1.00 7.87  ? 24   ALA A CB  1 
ATOM   172   N N   . SER A 1 25  ? 105.006 0.996   27.138  1.00 6.85  ? 25   SER A N   1 
ATOM   173   C CA  . SER A 1 25  ? 105.195 2.026   26.138  1.00 8.36  ? 25   SER A CA  1 
ATOM   174   C C   . SER A 1 25  ? 105.199 3.445   26.727  1.00 8.25  ? 25   SER A C   1 
ATOM   175   O O   . SER A 1 25  ? 106.024 4.281   26.336  1.00 7.93  ? 25   SER A O   1 
ATOM   176   C CB  . SER A 1 25  ? 104.090 1.939   25.067  1.00 6.56  ? 25   SER A CB  1 
ATOM   177   O OG  . SER A 1 25  ? 104.271 3.025   24.176  1.00 6.36  ? 25   SER A OG  1 
ATOM   178   N N   . ARG A 1 26  ? 104.306 3.686   27.659  1.00 8.36  ? 26   ARG A N   1 
ATOM   179   C CA  . ARG A 1 26  ? 104.117 4.955   28.339  1.00 8.39  ? 26   ARG A CA  1 
ATOM   180   C C   . ARG A 1 26  ? 105.242 5.224   29.345  1.00 9.16  ? 26   ARG A C   1 
ATOM   181   O O   . ARG A 1 26  ? 105.768 6.349   29.404  1.00 10.56 ? 26   ARG A O   1 
ATOM   182   C CB  . ARG A 1 26  ? 102.754 4.954   29.075  1.00 5.99  ? 26   ARG A CB  1 
ATOM   183   C CG  . ARG A 1 26  ? 101.611 4.968   28.050  1.00 5.08  ? 26   ARG A CG  1 
ATOM   184   C CD  . ARG A 1 26  ? 100.227 4.938   28.674  1.00 4.87  ? 26   ARG A CD  1 
ATOM   185   N NE  . ARG A 1 26  ? 99.203  5.035   27.627  1.00 4.54  ? 26   ARG A NE  1 
ATOM   186   C CZ  . ARG A 1 26  ? 97.936  4.625   27.760  1.00 5.46  ? 26   ARG A CZ  1 
ATOM   187   N NH1 . ARG A 1 26  ? 97.509  4.044   28.871  1.00 2.34  ? 26   ARG A NH1 1 
ATOM   188   N NH2 . ARG A 1 26  ? 97.052  4.771   26.757  1.00 3.59  ? 26   ARG A NH2 1 
ATOM   189   N N   . VAL A 1 27  ? 105.678 4.196   30.065  1.00 7.44  ? 27   VAL A N   1 
ATOM   190   C CA  . VAL A 1 27  ? 106.822 4.334   30.966  1.00 6.78  ? 27   VAL A CA  1 
ATOM   191   C C   . VAL A 1 27  ? 108.041 4.695   30.122  1.00 7.38  ? 27   VAL A C   1 
ATOM   192   O O   . VAL A 1 27  ? 108.767 5.651   30.384  1.00 8.79  ? 27   VAL A O   1 
ATOM   193   C CB  . VAL A 1 27  ? 107.048 3.039   31.761  1.00 6.46  ? 27   VAL A CB  1 
ATOM   194   C CG1 . VAL A 1 27  ? 108.407 3.012   32.465  1.00 5.00  ? 27   VAL A CG1 1 
ATOM   195   C CG2 . VAL A 1 27  ? 105.920 2.871   32.778  1.00 4.37  ? 27   VAL A CG2 1 
ATOM   196   N N   . ALA A 1 28  ? 108.303 3.982   29.032  1.00 6.78  ? 28   ALA A N   1 
ATOM   197   C CA  . ALA A 1 28  ? 109.432 4.304   28.180  1.00 6.49  ? 28   ALA A CA  1 
ATOM   198   C C   . ALA A 1 28  ? 109.346 5.752   27.675  1.00 7.32  ? 28   ALA A C   1 
ATOM   199   O O   . ALA A 1 28  ? 110.369 6.442   27.628  1.00 7.05  ? 28   ALA A O   1 
ATOM   200   C CB  . ALA A 1 28  ? 109.507 3.391   26.966  1.00 7.02  ? 28   ALA A CB  1 
ATOM   201   N N   . ALA A 1 29  ? 108.170 6.219   27.240  1.00 3.67  ? 29   ALA A N   1 
ATOM   202   C CA  . ALA A 1 29  ? 108.015 7.554   26.690  1.00 4.35  ? 29   ALA A CA  1 
ATOM   203   C C   . ALA A 1 29  ? 108.378 8.617   27.724  1.00 4.30  ? 29   ALA A C   1 
ATOM   204   O O   . ALA A 1 29  ? 109.091 9.584   27.441  1.00 5.57  ? 29   ALA A O   1 
ATOM   205   C CB  . ALA A 1 29  ? 106.554 7.722   26.232  1.00 3.50  ? 29   ALA A CB  1 
ATOM   206   N N   . ALA A 1 30  ? 107.892 8.459   28.937  1.00 4.69  ? 30   ALA A N   1 
ATOM   207   C CA  . ALA A 1 30  ? 108.107 9.251   30.099  1.00 6.42  ? 30   ALA A CA  1 
ATOM   208   C C   . ALA A 1 30  ? 109.585 9.193   30.516  1.00 8.92  ? 30   ALA A C   1 
ATOM   209   O O   . ALA A 1 30  ? 110.133 10.196  30.960  1.00 6.01  ? 30   ALA A O   1 
ATOM   210   C CB  . ALA A 1 30  ? 107.233 8.820   31.279  1.00 7.07  ? 30   ALA A CB  1 
ATOM   211   N N   . LYS A 1 31  ? 110.219 8.023   30.360  1.00 10.79 ? 31   LYS A N   1 
ATOM   212   C CA  . LYS A 1 31  ? 111.641 7.873   30.672  1.00 11.24 ? 31   LYS A CA  1 
ATOM   213   C C   . LYS A 1 31  ? 112.483 8.691   29.718  1.00 7.87  ? 31   LYS A C   1 
ATOM   214   O O   . LYS A 1 31  ? 113.505 9.289   30.105  1.00 8.94  ? 31   LYS A O   1 
ATOM   215   C CB  . LYS A 1 31  ? 112.086 6.412   30.666  1.00 13.72 ? 31   LYS A CB  1 
ATOM   216   C CG  . LYS A 1 31  ? 113.552 6.180   31.056  1.00 18.40 ? 31   LYS A CG  1 
ATOM   217   C CD  . LYS A 1 31  ? 113.672 4.790   31.697  1.00 21.96 ? 31   LYS A CD  1 
ATOM   218   C CE  . LYS A 1 31  ? 115.115 4.350   31.898  1.00 24.30 ? 31   LYS A CE  1 
ATOM   219   N NZ  . LYS A 1 31  ? 115.813 4.129   30.598  1.00 25.73 ? 31   LYS A NZ  1 
ATOM   220   N N   . ARG A 1 32  ? 112.101 8.748   28.467  1.00 6.60  ? 32   ARG A N   1 
ATOM   221   C CA  . ARG A 1 32  ? 112.730 9.523   27.452  1.00 6.40  ? 32   ARG A CA  1 
ATOM   222   C C   . ARG A 1 32  ? 112.594 11.031  27.788  1.00 9.65  ? 32   ARG A C   1 
ATOM   223   O O   . ARG A 1 32  ? 113.579 11.763  27.615  1.00 7.77  ? 32   ARG A O   1 
ATOM   224   C CB  . ARG A 1 32  ? 112.208 9.246   26.064  1.00 8.13  ? 32   ARG A CB  1 
ATOM   225   C CG  . ARG A 1 32  ? 112.922 10.007  24.959  1.00 8.85  ? 32   ARG A CG  1 
ATOM   226   C CD  . ARG A 1 32  ? 112.320 9.651   23.584  1.00 13.99 ? 32   ARG A CD  1 
ATOM   227   N NE  . ARG A 1 32  ? 113.332 10.016  22.571  1.00 16.17 ? 32   ARG A NE  1 
ATOM   228   C CZ  . ARG A 1 32  ? 114.345 9.202   22.272  1.00 19.42 ? 32   ARG A CZ  1 
ATOM   229   N NH1 . ARG A 1 32  ? 114.485 7.990   22.818  1.00 18.15 ? 32   ARG A NH1 1 
ATOM   230   N NH2 . ARG A 1 32  ? 115.253 9.627   21.390  1.00 20.55 ? 32   ARG A NH2 1 
ATOM   231   N N   . GLU A 1 33  ? 111.426 11.456  28.322  1.00 8.25  ? 33   GLU A N   1 
ATOM   232   C CA  . GLU A 1 33  ? 111.318 12.858  28.716  1.00 7.07  ? 33   GLU A CA  1 
ATOM   233   C C   . GLU A 1 33  ? 112.173 13.069  29.969  1.00 5.98  ? 33   GLU A C   1 
ATOM   234   O O   . GLU A 1 33  ? 112.845 14.107  30.074  1.00 3.39  ? 33   GLU A O   1 
ATOM   235   C CB  . GLU A 1 33  ? 109.884 13.357  28.995  1.00 5.61  ? 33   GLU A CB  1 
ATOM   236   C CG  . GLU A 1 33  ? 109.139 13.646  27.665  1.00 2.91  ? 33   GLU A CG  1 
ATOM   237   C CD  . GLU A 1 33  ? 109.676 14.933  27.053  1.00 5.47  ? 33   GLU A CD  1 
ATOM   238   O OE1 . GLU A 1 33  ? 109.883 15.884  27.863  1.00 6.58  ? 33   GLU A OE1 1 
ATOM   239   O OE2 . GLU A 1 33  ? 109.891 14.987  25.829  1.00 5.12  ? 33   GLU A OE2 1 
ATOM   240   N N   . LEU A 1 34  ? 112.176 12.112  30.894  1.00 4.17  ? 34   LEU A N   1 
ATOM   241   C CA  . LEU A 1 34  ? 113.015 12.246  32.087  1.00 7.47  ? 34   LEU A CA  1 
ATOM   242   C C   . LEU A 1 34  ? 114.473 12.513  31.720  1.00 9.43  ? 34   LEU A C   1 
ATOM   243   O O   . LEU A 1 34  ? 115.111 13.479  32.163  1.00 10.10 ? 34   LEU A O   1 
ATOM   244   C CB  . LEU A 1 34  ? 112.933 10.986  32.949  1.00 9.77  ? 34   LEU A CB  1 
ATOM   245   C CG  . LEU A 1 34  ? 113.901 10.861  34.148  1.00 11.06 ? 34   LEU A CG  1 
ATOM   246   C CD1 . LEU A 1 34  ? 113.639 11.926  35.208  1.00 10.79 ? 34   LEU A CD1 1 
ATOM   247   C CD2 . LEU A 1 34  ? 113.799 9.439   34.686  1.00 10.31 ? 34   LEU A CD2 1 
ATOM   248   N N   . GLU A 1 35  ? 115.050 11.566  30.982  1.00 9.43  ? 35   GLU A N   1 
ATOM   249   C CA  . GLU A 1 35  ? 116.445 11.634  30.585  1.00 11.01 ? 35   GLU A CA  1 
ATOM   250   C C   . GLU A 1 35  ? 116.761 12.785  29.645  1.00 10.44 ? 35   GLU A C   1 
ATOM   251   O O   . GLU A 1 35  ? 117.829 13.371  29.765  1.00 10.67 ? 35   GLU A O   1 
ATOM   252   C CB  . GLU A 1 35  ? 116.841 10.278  29.930  1.00 12.85 ? 35   GLU A CB  1 
ATOM   253   C CG  . GLU A 1 35  ? 116.577 9.179   30.977  1.00 14.63 ? 35   GLU A CG  1 
ATOM   254   C CD  . GLU A 1 35  ? 116.940 7.787   30.491  1.00 17.92 ? 35   GLU A CD  1 
ATOM   255   O OE1 . GLU A 1 35  ? 116.958 7.544   29.280  1.00 17.84 ? 35   GLU A OE1 1 
ATOM   256   O OE2 . GLU A 1 35  ? 117.184 6.914   31.357  1.00 20.51 ? 35   GLU A OE2 1 
ATOM   257   N N   . GLY A 1 36  ? 115.876 13.142  28.727  1.00 8.29  ? 36   GLY A N   1 
ATOM   258   C CA  . GLY A 1 36  ? 116.122 14.200  27.763  1.00 7.36  ? 36   GLY A CA  1 
ATOM   259   C C   . GLY A 1 36  ? 116.038 15.593  28.410  1.00 6.79  ? 36   GLY A C   1 
ATOM   260   O O   . GLY A 1 36  ? 116.593 16.542  27.829  1.00 8.13  ? 36   GLY A O   1 
ATOM   261   N N   . THR A 1 37  ? 115.313 15.694  29.494  1.00 5.29  ? 37   THR A N   1 
ATOM   262   C CA  . THR A 1 37  ? 115.069 16.941  30.194  1.00 7.00  ? 37   THR A CA  1 
ATOM   263   C C   . THR A 1 37  ? 116.228 17.294  31.156  1.00 7.78  ? 37   THR A C   1 
ATOM   264   O O   . THR A 1 37  ? 116.855 18.337  30.950  1.00 7.73  ? 37   THR A O   1 
ATOM   265   C CB  . THR A 1 37  ? 113.747 16.956  30.999  1.00 4.41  ? 37   THR A CB  1 
ATOM   266   O OG1 . THR A 1 37  ? 112.613 16.857  30.123  1.00 3.80  ? 37   THR A OG1 1 
ATOM   267   C CG2 . THR A 1 37  ? 113.609 18.246  31.806  1.00 2.27  ? 37   THR A CG2 1 
ATOM   268   N N   . GLY A 1 38  ? 116.434 16.424  32.123  1.00 7.32  ? 38   GLY A N   1 
ATOM   269   C CA  . GLY A 1 38  ? 117.449 16.611  33.147  1.00 6.67  ? 38   GLY A CA  1 
ATOM   270   C C   . GLY A 1 38  ? 117.080 17.873  33.962  1.00 8.36  ? 38   GLY A C   1 
ATOM   271   O O   . GLY A 1 38  ? 115.904 18.090  34.236  1.00 5.59  ? 38   GLY A O   1 
ATOM   272   N N   . THR A 1 39  ? 118.076 18.641  34.377  1.00 6.32  ? 39   THR A N   1 
ATOM   273   C CA  . THR A 1 39  ? 117.928 19.826  35.188  1.00 6.71  ? 39   THR A CA  1 
ATOM   274   C C   . THR A 1 39  ? 117.821 21.021  34.248  1.00 7.85  ? 39   THR A C   1 
ATOM   275   O O   . THR A 1 39  ? 118.667 21.248  33.358  1.00 8.31  ? 39   THR A O   1 
ATOM   276   C CB  . THR A 1 39  ? 119.105 20.063  36.150  1.00 7.47  ? 39   THR A CB  1 
ATOM   277   O OG1 . THR A 1 39  ? 119.190 18.907  36.984  1.00 6.56  ? 39   THR A OG1 1 
ATOM   278   C CG2 . THR A 1 39  ? 118.857 21.286  37.050  1.00 7.01  ? 39   THR A CG2 1 
ATOM   279   N N   . VAL A 1 40  ? 116.645 21.678  34.364  1.00 6.13  ? 40   VAL A N   1 
ATOM   280   C CA  . VAL A 1 40  ? 116.393 22.853  33.534  1.00 4.23  ? 40   VAL A CA  1 
ATOM   281   C C   . VAL A 1 40  ? 116.326 24.071  34.443  1.00 4.79  ? 40   VAL A C   1 
ATOM   282   O O   . VAL A 1 40  ? 115.644 24.036  35.470  1.00 3.85  ? 40   VAL A O   1 
ATOM   283   C CB  . VAL A 1 40  ? 115.126 22.640  32.677  1.00 5.08  ? 40   VAL A CB  1 
ATOM   284   C CG1 . VAL A 1 40  ? 114.760 23.888  31.889  1.00 2.08  ? 40   VAL A CG1 1 
ATOM   285   C CG2 . VAL A 1 40  ? 115.396 21.502  31.687  1.00 3.46  ? 40   VAL A CG2 1 
ATOM   286   N N   . CYS A 1 41  ? 117.113 25.101  34.125  1.00 4.34  ? 41   CYS A N   1 
ATOM   287   C CA  . CYS A 1 41  ? 117.261 26.286  34.984  1.00 6.16  ? 41   CYS A CA  1 
ATOM   288   C C   . CYS A 1 41  ? 116.487 27.506  34.507  1.00 4.93  ? 41   CYS A C   1 
ATOM   289   O O   . CYS A 1 41  ? 116.746 27.987  33.418  1.00 4.48  ? 41   CYS A O   1 
ATOM   290   C CB  . CYS A 1 41  ? 118.759 26.652  35.113  1.00 6.38  ? 41   CYS A CB  1 
ATOM   291   S SG  . CYS A 1 41  ? 119.697 25.259  35.842  1.00 4.40  ? 41   CYS A SG  1 
ATOM   292   N N   . GLN A 1 42  ? 115.467 27.895  35.286  1.00 4.94  ? 42   GLN A N   1 
ATOM   293   C CA  . GLN A 1 42  ? 114.664 29.068  34.856  1.00 4.71  ? 42   GLN A CA  1 
ATOM   294   C C   . GLN A 1 42  ? 115.366 30.348  35.313  1.00 4.15  ? 42   GLN A C   1 
ATOM   295   O O   . GLN A 1 42  ? 115.683 30.459  36.488  1.00 3.94  ? 42   GLN A O   1 
ATOM   296   C CB  . GLN A 1 42  ? 113.287 28.992  35.535  1.00 5.08  ? 42   GLN A CB  1 
ATOM   297   C CG  . GLN A 1 42  ? 112.471 27.735  35.209  1.00 3.80  ? 42   GLN A CG  1 
ATOM   298   C CD  . GLN A 1 42  ? 112.174 27.560  33.763  1.00 3.30  ? 42   GLN A CD  1 
ATOM   299   O OE1 . GLN A 1 42  ? 112.064 28.536  33.016  1.00 3.69  ? 42   GLN A OE1 1 
ATOM   300   N NE2 . GLN A 1 42  ? 111.997 26.328  33.208  1.00 3.54  ? 42   GLN A NE2 1 
ATOM   301   N N   . ILE A 1 43  ? 115.690 31.251  34.383  1.00 5.63  ? 43   ILE A N   1 
ATOM   302   C CA  . ILE A 1 43  ? 116.474 32.444  34.730  1.00 5.82  ? 43   ILE A CA  1 
ATOM   303   C C   . ILE A 1 43  ? 115.750 33.730  34.304  1.00 4.26  ? 43   ILE A C   1 
ATOM   304   O O   . ILE A 1 43  ? 115.357 33.896  33.145  1.00 3.51  ? 43   ILE A O   1 
ATOM   305   C CB  . ILE A 1 43  ? 117.842 32.368  33.972  1.00 3.78  ? 43   ILE A CB  1 
ATOM   306   C CG1 . ILE A 1 43  ? 118.572 31.030  34.207  1.00 2.63  ? 43   ILE A CG1 1 
ATOM   307   C CG2 . ILE A 1 43  ? 118.698 33.571  34.353  1.00 4.18  ? 43   ILE A CG2 1 
ATOM   308   C CD1 . ILE A 1 43  ? 119.112 30.872  35.631  1.00 2.92  ? 43   ILE A CD1 1 
ATOM   309   N N   . ASN A 1 44  ? 115.557 34.649  35.231  1.00 3.37  ? 44   ASN A N   1 
ATOM   310   C CA  . ASN A 1 44  ? 114.930 35.933  34.779  1.00 3.02  ? 44   ASN A CA  1 
ATOM   311   C C   . ASN A 1 44  ? 116.001 37.009  34.796  1.00 2.08  ? 44   ASN A C   1 
ATOM   312   O O   . ASN A 1 44  ? 117.155 36.664  35.065  1.00 2.49  ? 44   ASN A O   1 
ATOM   313   C CB  . ASN A 1 44  ? 113.745 36.243  35.655  1.00 4.06  ? 44   ASN A CB  1 
ATOM   314   C CG  . ASN A 1 44  ? 113.920 36.428  37.113  1.00 5.04  ? 44   ASN A CG  1 
ATOM   315   O OD1 . ASN A 1 44  ? 114.945 36.817  37.675  1.00 4.65  ? 44   ASN A OD1 1 
ATOM   316   N ND2 . ASN A 1 44  ? 112.846 36.111  37.850  1.00 5.39  ? 44   ASN A ND2 1 
ATOM   317   N N   . ASN A 1 45  ? 115.663 38.277  34.522  1.00 3.54  ? 45   ASN A N   1 
ATOM   318   C CA  . ASN A 1 45  ? 116.682 39.325  34.442  1.00 2.96  ? 45   ASN A CA  1 
ATOM   319   C C   . ASN A 1 45  ? 117.266 39.833  35.748  1.00 4.44  ? 45   ASN A C   1 
ATOM   320   O O   . ASN A 1 45  ? 118.147 40.722  35.732  1.00 3.01  ? 45   ASN A O   1 
ATOM   321   C CB  . ASN A 1 45  ? 116.108 40.465  33.570  1.00 3.65  ? 45   ASN A CB  1 
ATOM   322   C CG  . ASN A 1 45  ? 115.033 41.306  34.201  1.00 3.36  ? 45   ASN A CG  1 
ATOM   323   O OD1 . ASN A 1 45  ? 114.870 41.349  35.417  1.00 2.47  ? 45   ASN A OD1 1 
ATOM   324   N ND2 . ASN A 1 45  ? 114.262 41.990  33.356  1.00 2.79  ? 45   ASN A ND2 1 
ATOM   325   N N   . GLY A 1 46  ? 116.810 39.358  36.888  1.00 3.12  ? 46   GLY A N   1 
ATOM   326   C CA  . GLY A 1 46  ? 117.220 39.705  38.211  1.00 4.60  ? 46   GLY A CA  1 
ATOM   327   C C   . GLY A 1 46  ? 116.903 41.070  38.815  1.00 4.66  ? 46   GLY A C   1 
ATOM   328   O O   . GLY A 1 46  ? 117.230 41.307  39.996  1.00 2.46  ? 46   GLY A O   1 
ATOM   329   N N   . GLU A 1 47  ? 116.198 41.941  38.076  1.00 3.95  ? 47   GLU A N   1 
ATOM   330   C CA  . GLU A 1 47  ? 115.900 43.268  38.640  1.00 3.91  ? 47   GLU A CA  1 
ATOM   331   C C   . GLU A 1 47  ? 114.888 43.152  39.744  1.00 4.92  ? 47   GLU A C   1 
ATOM   332   O O   . GLU A 1 47  ? 113.980 42.314  39.683  1.00 4.10  ? 47   GLU A O   1 
ATOM   333   C CB  . GLU A 1 47  ? 115.459 44.217  37.516  1.00 4.82  ? 47   GLU A CB  1 
ATOM   334   C CG  . GLU A 1 47  ? 114.026 43.887  37.000  1.00 4.78  ? 47   GLU A CG  1 
ATOM   335   C CD  . GLU A 1 47  ? 113.721 44.665  35.745  1.00 4.67  ? 47   GLU A CD  1 
ATOM   336   O OE1 . GLU A 1 47  ? 114.225 45.799  35.493  1.00 4.11  ? 47   GLU A OE1 1 
ATOM   337   O OE2 . GLU A 1 47  ? 112.946 44.121  34.942  1.00 3.15  ? 47   GLU A OE2 1 
ATOM   338   N N   . THR A 1 48  ? 115.048 43.978  40.798  1.00 4.71  ? 48   THR A N   1 
ATOM   339   C CA  . THR A 1 48  ? 114.096 43.836  41.901  1.00 5.57  ? 48   THR A CA  1 
ATOM   340   C C   . THR A 1 48  ? 112.967 44.868  41.888  1.00 5.99  ? 48   THR A C   1 
ATOM   341   O O   . THR A 1 48  ? 112.038 44.686  42.670  1.00 6.02  ? 48   THR A O   1 
ATOM   342   C CB  . THR A 1 48  ? 114.872 44.001  43.226  1.00 6.94  ? 48   THR A CB  1 
ATOM   343   O OG1 . THR A 1 48  ? 115.431 45.323  43.223  1.00 5.66  ? 48   THR A OG1 1 
ATOM   344   C CG2 . THR A 1 48  ? 115.978 42.950  43.359  1.00 6.03  ? 48   THR A CG2 1 
ATOM   345   N N   . ASP A 1 49  ? 113.048 45.918  41.089  1.00 5.17  ? 49   ASP A N   1 
ATOM   346   C CA  . ASP A 1 49  ? 112.109 47.031  41.111  1.00 5.65  ? 49   ASP A CA  1 
ATOM   347   C C   . ASP A 1 49  ? 110.669 46.532  40.923  1.00 3.17  ? 49   ASP A C   1 
ATOM   348   O O   . ASP A 1 49  ? 110.390 45.920  39.882  1.00 4.28  ? 49   ASP A O   1 
ATOM   349   C CB  . ASP A 1 49  ? 112.427 48.022  39.994  1.00 6.17  ? 49   ASP A CB  1 
ATOM   350   C CG  . ASP A 1 49  ? 111.611 49.313  39.969  1.00 7.01  ? 49   ASP A CG  1 
ATOM   351   O OD1 . ASP A 1 49  ? 110.885 49.652  40.907  1.00 3.64  ? 49   ASP A OD1 1 
ATOM   352   O OD2 . ASP A 1 49  ? 111.699 50.037  38.944  1.00 6.02  ? 49   ASP A OD2 1 
ATOM   353   N N   . LEU A 1 50  ? 109.768 46.872  41.830  1.00 4.47  ? 50   LEU A N   1 
ATOM   354   C CA  . LEU A 1 50  ? 108.382 46.409  41.666  1.00 5.05  ? 50   LEU A CA  1 
ATOM   355   C C   . LEU A 1 50  ? 107.704 47.109  40.499  1.00 6.41  ? 50   LEU A C   1 
ATOM   356   O O   . LEU A 1 50  ? 106.691 46.582  39.982  1.00 6.23  ? 50   LEU A O   1 
ATOM   357   C CB  . LEU A 1 50  ? 107.583 46.583  42.962  1.00 4.69  ? 50   LEU A CB  1 
ATOM   358   C CG  . LEU A 1 50  ? 108.099 45.706  44.111  1.00 6.34  ? 50   LEU A CG  1 
ATOM   359   C CD1 . LEU A 1 50  ? 107.091 45.711  45.258  1.00 5.89  ? 50   LEU A CD1 1 
ATOM   360   C CD2 . LEU A 1 50  ? 108.381 44.272  43.690  1.00 5.04  ? 50   LEU A CD2 1 
ATOM   361   N N   . ALA A 1 51  ? 108.252 48.245  40.056  1.00 4.63  ? 51   ALA A N   1 
ATOM   362   C CA  . ALA A 1 51  ? 107.688 48.930  38.900  1.00 5.75  ? 51   ALA A CA  1 
ATOM   363   C C   . ALA A 1 51  ? 107.811 48.094  37.641  1.00 4.54  ? 51   ALA A C   1 
ATOM   364   O O   . ALA A 1 51  ? 107.060 48.272  36.686  1.00 4.55  ? 51   ALA A O   1 
ATOM   365   C CB  . ALA A 1 51  ? 108.340 50.296  38.678  1.00 5.39  ? 51   ALA A CB  1 
ATOM   366   N N   . ALA A 1 52  ? 108.809 47.194  37.574  1.00 2.79  ? 52   ALA A N   1 
ATOM   367   C CA  . ALA A 1 52  ? 108.980 46.368  36.392  1.00 3.31  ? 52   ALA A CA  1 
ATOM   368   C C   . ALA A 1 52  ? 108.268 45.019  36.549  1.00 2.89  ? 52   ALA A C   1 
ATOM   369   O O   . ALA A 1 52  ? 108.554 44.090  35.761  1.00 2.30  ? 52   ALA A O   1 
ATOM   370   C CB  . ALA A 1 52  ? 110.503 46.069  36.277  1.00 2.08  ? 52   ALA A CB  1 
ATOM   371   N N   . LYS A 1 53  ? 107.429 44.811  37.515  1.00 3.40  ? 53   LYS A N   1 
ATOM   372   C CA  . LYS A 1 53  ? 106.749 43.551  37.761  1.00 2.08  ? 53   LYS A CA  1 
ATOM   373   C C   . LYS A 1 53  ? 105.233 43.662  37.492  1.00 4.01  ? 53   LYS A C   1 
ATOM   374   O O   . LYS A 1 53  ? 104.613 44.718  37.580  1.00 3.89  ? 53   LYS A O   1 
ATOM   375   C CB  . LYS A 1 53  ? 106.896 43.137  39.235  1.00 2.35  ? 53   LYS A CB  1 
ATOM   376   C CG  . LYS A 1 53  ? 108.298 43.007  39.787  1.00 2.31  ? 53   LYS A CG  1 
ATOM   377   C CD  . LYS A 1 53  ? 109.168 42.035  38.984  1.00 2.44  ? 53   LYS A CD  1 
ATOM   378   C CE  . LYS A 1 53  ? 110.626 42.161  39.505  1.00 3.75  ? 53   LYS A CE  1 
ATOM   379   N NZ  . LYS A 1 53  ? 111.536 41.589  38.434  1.00 2.41  ? 53   LYS A NZ  1 
ATOM   380   N N   . PHE A 1 54  ? 104.602 42.513  37.232  1.00 2.68  ? 54   PHE A N   1 
ATOM   381   C CA  . PHE A 1 54  ? 103.163 42.475  37.021  1.00 3.35  ? 54   PHE A CA  1 
ATOM   382   C C   . PHE A 1 54  ? 102.429 42.539  38.367  1.00 3.38  ? 54   PHE A C   1 
ATOM   383   O O   . PHE A 1 54  ? 102.681 41.803  39.316  1.00 2.08  ? 54   PHE A O   1 
ATOM   384   C CB  . PHE A 1 54  ? 102.714 41.181  36.298  1.00 2.97  ? 54   PHE A CB  1 
ATOM   385   C CG  . PHE A 1 54  ? 101.205 41.036  36.280  1.00 2.21  ? 54   PHE A CG  1 
ATOM   386   C CD1 . PHE A 1 54  ? 100.479 41.686  35.311  1.00 3.33  ? 54   PHE A CD1 1 
ATOM   387   C CD2 . PHE A 1 54  ? 100.559 40.309  37.273  1.00 3.81  ? 54   PHE A CD2 1 
ATOM   388   C CE1 . PHE A 1 54  ? 99.089  41.604  35.266  1.00 2.38  ? 54   PHE A CE1 1 
ATOM   389   C CE2 . PHE A 1 54  ? 99.160  40.225  37.249  1.00 4.65  ? 54   PHE A CE2 1 
ATOM   390   C CZ  . PHE A 1 54  ? 98.454  40.891  36.264  1.00 3.23  ? 54   PHE A CZ  1 
ATOM   391   N N   . HIS A 1 55  ? 101.484 43.497  38.433  1.00 2.08  ? 55   HIS A N   1 
ATOM   392   C CA  . HIS A 1 55  ? 100.593 43.548  39.593  1.00 2.24  ? 55   HIS A CA  1 
ATOM   393   C C   . HIS A 1 55  ? 99.230  44.237  39.258  1.00 3.07  ? 55   HIS A C   1 
ATOM   394   O O   . HIS A 1 55  ? 98.643  44.830  40.131  1.00 3.50  ? 55   HIS A O   1 
ATOM   395   C CB  . HIS A 1 55  ? 101.218 44.155  40.842  1.00 2.09  ? 55   HIS A CB  1 
ATOM   396   C CG  . HIS A 1 55  ? 102.114 45.312  40.535  1.00 4.31  ? 55   HIS A CG  1 
ATOM   397   N ND1 . HIS A 1 55  ? 101.651 46.559  40.154  1.00 3.42  ? 55   HIS A ND1 1 
ATOM   398   C CD2 . HIS A 1 55  ? 103.475 45.401  40.553  1.00 4.14  ? 55   HIS A CD2 1 
ATOM   399   C CE1 . HIS A 1 55  ? 102.676 47.382  39.951  1.00 4.80  ? 55   HIS A CE1 1 
ATOM   400   N NE2 . HIS A 1 55  ? 103.801 46.695  40.192  1.00 3.12  ? 55   HIS A NE2 1 
ATOM   401   N N   . LYS A 1 56  ? 98.832  44.111  38.001  1.00 3.63  ? 56   LYS A N   1 
ATOM   402   C CA  . LYS A 1 56  ? 97.505  44.669  37.653  1.00 4.37  ? 56   LYS A CA  1 
ATOM   403   C C   . LYS A 1 56  ? 96.394  44.039  38.491  1.00 5.13  ? 56   LYS A C   1 
ATOM   404   O O   . LYS A 1 56  ? 96.400  42.830  38.783  1.00 3.02  ? 56   LYS A O   1 
ATOM   405   C CB  . LYS A 1 56  ? 97.151  44.406  36.207  1.00 5.23  ? 56   LYS A CB  1 
ATOM   406   C CG  . LYS A 1 56  ? 95.883  45.124  35.740  1.00 4.99  ? 56   LYS A CG  1 
ATOM   407   C CD  . LYS A 1 56  ? 95.680  44.952  34.252  1.00 4.55  ? 56   LYS A CD  1 
ATOM   408   C CE  . LYS A 1 56  ? 94.415  45.654  33.770  1.00 3.01  ? 56   LYS A CE  1 
ATOM   409   N NZ  . LYS A 1 56  ? 94.371  45.888  32.303  1.00 2.82  ? 56   LYS A NZ  1 
ATOM   410   N N   . SER A 1 57  ? 95.506  44.884  39.028  1.00 4.00  ? 57   SER A N   1 
ATOM   411   C CA  . SER A 1 57  ? 94.365  44.506  39.815  1.00 3.79  ? 57   SER A CA  1 
ATOM   412   C C   . SER A 1 57  ? 94.604  44.499  41.300  1.00 3.98  ? 57   SER A C   1 
ATOM   413   O O   . SER A 1 57  ? 93.674  44.315  42.098  1.00 4.09  ? 57   SER A O   1 
ATOM   414   C CB  . SER A 1 57  ? 93.724  43.178  39.367  1.00 3.07  ? 57   SER A CB  1 
ATOM   415   O OG  . SER A 1 57  ? 94.275  42.066  40.040  1.00 2.20  ? 57   SER A OG  1 
ATOM   416   N N   . LEU A 1 58  ? 95.868  44.631  41.749  1.00 3.11  ? 58   LEU A N   1 
ATOM   417   C CA  . LEU A 1 58  ? 96.108  44.751  43.181  1.00 3.71  ? 58   LEU A CA  1 
ATOM   418   C C   . LEU A 1 58  ? 95.876  46.239  43.533  1.00 3.57  ? 58   LEU A C   1 
ATOM   419   O O   . LEU A 1 58  ? 95.718  47.087  42.647  1.00 4.75  ? 58   LEU A O   1 
ATOM   420   C CB  . LEU A 1 58  ? 97.552  44.383  43.506  1.00 4.63  ? 58   LEU A CB  1 
ATOM   421   C CG  . LEU A 1 58  ? 97.866  42.914  43.825  1.00 5.81  ? 58   LEU A CG  1 
ATOM   422   C CD1 . LEU A 1 58  ? 97.589  42.001  42.633  1.00 2.08  ? 58   LEU A CD1 1 
ATOM   423   C CD2 . LEU A 1 58  ? 99.339  42.779  44.259  1.00 4.59  ? 58   LEU A CD2 1 
ATOM   424   N N   . PRO A 1 59  ? 95.876  46.568  44.801  1.00 4.06  ? 59   PRO A N   1 
ATOM   425   C CA  . PRO A 1 59  ? 95.783  47.930  45.305  1.00 6.32  ? 59   PRO A CA  1 
ATOM   426   C C   . PRO A 1 59  ? 97.072  48.692  44.982  1.00 7.94  ? 59   PRO A C   1 
ATOM   427   O O   . PRO A 1 59  ? 98.162  48.126  45.113  1.00 5.94  ? 59   PRO A O   1 
ATOM   428   C CB  . PRO A 1 59  ? 95.626  47.808  46.812  1.00 5.80  ? 59   PRO A CB  1 
ATOM   429   C CG  . PRO A 1 59  ? 95.357  46.339  47.081  1.00 4.28  ? 59   PRO A CG  1 
ATOM   430   C CD  . PRO A 1 59  ? 96.028  45.621  45.931  1.00 4.40  ? 59   PRO A CD  1 
ATOM   431   N N   . HIS A 1 60  ? 96.916  49.903  44.432  1.00 8.21  ? 60   HIS A N   1 
ATOM   432   C CA  . HIS A 1 60  ? 98.074  50.740  44.145  1.00 8.03  ? 60   HIS A CA  1 
ATOM   433   C C   . HIS A 1 60  ? 97.858  52.104  44.831  1.00 9.50  ? 60   HIS A C   1 
ATOM   434   O O   . HIS A 1 60  ? 96.702  52.467  45.080  1.00 8.77  ? 60   HIS A O   1 
ATOM   435   C CB  . HIS A 1 60  ? 98.307  50.949  42.652  1.00 7.36  ? 60   HIS A CB  1 
ATOM   436   C CG  . HIS A 1 60  ? 98.549  49.698  41.843  1.00 7.17  ? 60   HIS A CG  1 
ATOM   437   N ND1 . HIS A 1 60  ? 97.540  48.916  41.312  1.00 5.88  ? 60   HIS A ND1 1 
ATOM   438   C CD2 . HIS A 1 60  ? 99.710  49.096  41.491  1.00 5.52  ? 60   HIS A CD2 1 
ATOM   439   C CE1 . HIS A 1 60  ? 98.087  47.891  40.662  1.00 6.39  ? 60   HIS A CE1 1 
ATOM   440   N NE2 . HIS A 1 60  ? 99.410  47.951  40.769  1.00 4.50  ? 60   HIS A NE2 1 
ATOM   441   N N   . ASP A 1 61  ? 98.952  52.842  45.039  1.00 8.11  ? 61   ASP A N   1 
ATOM   442   C CA  . ASP A 1 61  ? 98.795  54.199  45.579  1.00 7.49  ? 61   ASP A CA  1 
ATOM   443   C C   . ASP A 1 61  ? 98.331  55.011  44.382  1.00 7.13  ? 61   ASP A C   1 
ATOM   444   O O   . ASP A 1 61  ? 98.198  54.464  43.262  1.00 4.54  ? 61   ASP A O   1 
ATOM   445   C CB  . ASP A 1 61  ? 100.097 54.661  46.215  1.00 6.81  ? 61   ASP A CB  1 
ATOM   446   C CG  . ASP A 1 61  ? 101.264 54.899  45.292  1.00 5.98  ? 61   ASP A CG  1 
ATOM   447   O OD1 . ASP A 1 61  ? 101.188 54.829  44.048  1.00 4.65  ? 61   ASP A OD1 1 
ATOM   448   O OD2 . ASP A 1 61  ? 102.371 55.199  45.786  1.00 6.94  ? 61   ASP A OD2 1 
ATOM   449   N N   . ASP A 1 62  ? 98.241  56.333  44.535  1.00 8.15  ? 62   ASP A N   1 
ATOM   450   C CA  . ASP A 1 62  ? 97.797  57.169  43.418  1.00 9.50  ? 62   ASP A CA  1 
ATOM   451   C C   . ASP A 1 62  ? 98.861  57.417  42.381  1.00 8.03  ? 62   ASP A C   1 
ATOM   452   O O   . ASP A 1 62  ? 98.542  57.950  41.320  1.00 5.15  ? 62   ASP A O   1 
ATOM   453   C CB  . ASP A 1 62  ? 97.143  58.447  43.968  1.00 15.79 ? 62   ASP A CB  1 
ATOM   454   C CG  . ASP A 1 62  ? 95.807  58.051  44.622  1.00 20.56 ? 62   ASP A CG  1 
ATOM   455   O OD1 . ASP A 1 62  ? 95.115  57.103  44.153  1.00 21.35 ? 62   ASP A OD1 1 
ATOM   456   O OD2 . ASP A 1 62  ? 95.424  58.656  45.648  1.00 23.36 ? 62   ASP A OD2 1 
ATOM   457   N N   . LEU A 1 63  ? 100.084 56.917  42.528  1.00 6.08  ? 63   LEU A N   1 
ATOM   458   C CA  . LEU A 1 63  ? 101.123 57.022  41.515  1.00 6.56  ? 63   LEU A CA  1 
ATOM   459   C C   . LEU A 1 63  ? 101.254 55.650  40.811  1.00 9.62  ? 63   LEU A C   1 
ATOM   460   O O   . LEU A 1 63  ? 102.206 55.368  40.071  1.00 6.61  ? 63   LEU A O   1 
ATOM   461   C CB  . LEU A 1 63  ? 102.480 57.414  42.129  1.00 6.29  ? 63   LEU A CB  1 
ATOM   462   C CG  . LEU A 1 63  ? 102.493 58.843  42.728  1.00 8.42  ? 63   LEU A CG  1 
ATOM   463   C CD1 . LEU A 1 63  ? 103.776 59.159  43.465  1.00 6.52  ? 63   LEU A CD1 1 
ATOM   464   C CD2 . LEU A 1 63  ? 102.270 59.871  41.610  1.00 8.02  ? 63   LEU A CD2 1 
ATOM   465   N N   . GLY A 1 64  ? 100.256 54.772  41.026  1.00 8.11  ? 64   GLY A N   1 
ATOM   466   C CA  . GLY A 1 64  ? 100.246 53.450  40.407  1.00 6.01  ? 64   GLY A CA  1 
ATOM   467   C C   . GLY A 1 64  ? 101.304 52.485  40.965  1.00 6.56  ? 64   GLY A C   1 
ATOM   468   O O   . GLY A 1 64  ? 101.582 51.440  40.351  1.00 6.53  ? 64   GLY A O   1 
ATOM   469   N N   . GLN A 1 65  ? 101.857 52.757  42.121  1.00 6.05  ? 65   GLN A N   1 
ATOM   470   C CA  . GLN A 1 65  ? 102.877 51.970  42.775  1.00 6.95  ? 65   GLN A CA  1 
ATOM   471   C C   . GLN A 1 65  ? 102.204 50.939  43.667  1.00 7.77  ? 65   GLN A C   1 
ATOM   472   O O   . GLN A 1 65  ? 101.348 51.309  44.469  1.00 4.63  ? 65   GLN A O   1 
ATOM   473   C CB  . GLN A 1 65  ? 103.841 52.883  43.534  1.00 7.44  ? 65   GLN A CB  1 
ATOM   474   C CG  . GLN A 1 65  ? 104.589 53.850  42.603  1.00 7.02  ? 65   GLN A CG  1 
ATOM   475   C CD  . GLN A 1 65  ? 105.543 54.739  43.424  1.00 8.21  ? 65   GLN A CD  1 
ATOM   476   O OE1 . GLN A 1 65  ? 106.738 54.803  43.079  1.00 7.08  ? 65   GLN A OE1 1 
ATOM   477   N NE2 . GLN A 1 65  ? 105.007 55.405  44.444  1.00 6.19  ? 65   GLN A NE2 1 
ATOM   478   N N   . VAL A 1 66  ? 102.557 49.654  43.480  1.00 7.59  ? 66   VAL A N   1 
ATOM   479   C CA  . VAL A 1 66  ? 101.864 48.588  44.192  1.00 6.42  ? 66   VAL A CA  1 
ATOM   480   C C   . VAL A 1 66  ? 101.961 48.634  45.692  1.00 7.27  ? 66   VAL A C   1 
ATOM   481   O O   . VAL A 1 66  ? 103.016 48.957  46.234  1.00 7.26  ? 66   VAL A O   1 
ATOM   482   C CB  . VAL A 1 66  ? 102.324 47.189  43.678  1.00 6.08  ? 66   VAL A CB  1 
ATOM   483   C CG1 . VAL A 1 66  ? 103.702 46.818  44.291  1.00 4.83  ? 66   VAL A CG1 1 
ATOM   484   C CG2 . VAL A 1 66  ? 101.300 46.106  44.005  1.00 5.36  ? 66   VAL A CG2 1 
ATOM   485   N N   . ASP A 1 67  ? 100.914 48.174  46.403  1.00 6.13  ? 67   ASP A N   1 
ATOM   486   C CA  . ASP A 1 67  ? 100.989 48.002  47.841  1.00 5.95  ? 67   ASP A CA  1 
ATOM   487   C C   . ASP A 1 67  ? 101.875 46.783  48.169  1.00 7.20  ? 67   ASP A C   1 
ATOM   488   O O   . ASP A 1 67  ? 101.737 45.681  47.628  1.00 5.06  ? 67   ASP A O   1 
ATOM   489   C CB  . ASP A 1 67  ? 99.590  47.842  48.423  1.00 6.99  ? 67   ASP A CB  1 
ATOM   490   C CG  . ASP A 1 67  ? 99.603  47.488  49.876  1.00 7.46  ? 67   ASP A CG  1 
ATOM   491   O OD1 . ASP A 1 67  ? 99.845  48.372  50.721  1.00 12.52 ? 67   ASP A OD1 1 
ATOM   492   O OD2 . ASP A 1 67  ? 99.426  46.314  50.255  1.00 9.61  ? 67   ASP A OD2 1 
ATOM   493   N N   . ALA A 1 68  ? 102.838 46.976  49.042  1.00 6.38  ? 68   ALA A N   1 
ATOM   494   C CA  . ALA A 1 68  ? 103.845 46.025  49.435  1.00 8.96  ? 68   ALA A CA  1 
ATOM   495   C C   . ALA A 1 68  ? 103.246 44.728  49.966  1.00 8.42  ? 68   ALA A C   1 
ATOM   496   O O   . ALA A 1 68  ? 103.627 43.663  49.463  1.00 7.80  ? 68   ALA A O   1 
ATOM   497   C CB  . ALA A 1 68  ? 104.823 46.587  50.479  1.00 8.75  ? 68   ALA A CB  1 
ATOM   498   N N   . ASP A 1 69  ? 102.371 44.822  50.953  1.00 9.22  ? 69   ASP A N   1 
ATOM   499   C CA  . ASP A 1 69  ? 101.741 43.644  51.520  1.00 10.27 ? 69   ASP A CA  1 
ATOM   500   C C   . ASP A 1 69  ? 101.001 42.859  50.432  1.00 9.55  ? 69   ASP A C   1 
ATOM   501   O O   . ASP A 1 69  ? 101.155 41.649  50.364  1.00 9.10  ? 69   ASP A O   1 
ATOM   502   C CB  . ASP A 1 69  ? 100.748 43.984  52.628  1.00 12.96 ? 69   ASP A CB  1 
ATOM   503   C CG  . ASP A 1 69  ? 101.377 44.500  53.904  1.00 15.13 ? 69   ASP A CG  1 
ATOM   504   O OD1 . ASP A 1 69  ? 102.612 44.410  54.032  1.00 14.81 ? 69   ASP A OD1 1 
ATOM   505   O OD2 . ASP A 1 69  ? 100.581 44.996  54.737  1.00 15.29 ? 69   ASP A OD2 1 
ATOM   506   N N   . ALA A 1 70  ? 100.231 43.571  49.600  1.00 8.15  ? 70   ALA A N   1 
ATOM   507   C CA  . ALA A 1 70  ? 99.518  42.874  48.530  1.00 8.45  ? 70   ALA A CA  1 
ATOM   508   C C   . ALA A 1 70  ? 100.464 42.150  47.568  1.00 7.11  ? 70   ALA A C   1 
ATOM   509   O O   . ALA A 1 70  ? 100.132 41.050  47.115  1.00 4.83  ? 70   ALA A O   1 
ATOM   510   C CB  . ALA A 1 70  ? 98.634  43.831  47.714  1.00 8.15  ? 70   ALA A CB  1 
ATOM   511   N N   . PHE A 1 71  ? 101.565 42.781  47.146  1.00 6.32  ? 71   PHE A N   1 
ATOM   512   C CA  . PHE A 1 71  ? 102.473 42.133  46.197  1.00 5.72  ? 71   PHE A CA  1 
ATOM   513   C C   . PHE A 1 71  ? 103.072 40.857  46.810  1.00 6.49  ? 71   PHE A C   1 
ATOM   514   O O   . PHE A 1 71  ? 103.200 39.828  46.136  1.00 8.04  ? 71   PHE A O   1 
ATOM   515   C CB  . PHE A 1 71  ? 103.584 43.099  45.756  1.00 4.25  ? 71   PHE A CB  1 
ATOM   516   C CG  . PHE A 1 71  ? 104.379 42.491  44.628  1.00 4.58  ? 71   PHE A CG  1 
ATOM   517   C CD1 . PHE A 1 71  ? 103.872 42.516  43.332  1.00 3.07  ? 71   PHE A CD1 1 
ATOM   518   C CD2 . PHE A 1 71  ? 105.572 41.820  44.880  1.00 4.76  ? 71   PHE A CD2 1 
ATOM   519   C CE1 . PHE A 1 71  ? 104.560 41.960  42.248  1.00 3.42  ? 71   PHE A CE1 1 
ATOM   520   C CE2 . PHE A 1 71  ? 106.286 41.272  43.798  1.00 2.49  ? 71   PHE A CE2 1 
ATOM   521   C CZ  . PHE A 1 71  ? 105.755 41.306  42.542  1.00 4.81  ? 71   PHE A CZ  1 
ATOM   522   N N   . ALA A 1 72  ? 103.411 40.868  48.090  1.00 5.49  ? 72   ALA A N   1 
ATOM   523   C CA  . ALA A 1 72  ? 103.927 39.705  48.810  1.00 6.62  ? 72   ALA A CA  1 
ATOM   524   C C   . ALA A 1 72  ? 102.843 38.617  48.889  1.00 6.24  ? 72   ALA A C   1 
ATOM   525   O O   . ALA A 1 72  ? 103.146 37.411  48.777  1.00 6.74  ? 72   ALA A O   1 
ATOM   526   C CB  . ALA A 1 72  ? 104.339 40.050  50.229  1.00 4.58  ? 72   ALA A CB  1 
ATOM   527   N N   . ALA A 1 73  ? 101.568 39.007  48.987  1.00 5.62  ? 73   ALA A N   1 
ATOM   528   C CA  . ALA A 1 73  ? 100.493 37.994  48.969  1.00 5.10  ? 73   ALA A CA  1 
ATOM   529   C C   . ALA A 1 73  ? 100.382 37.435  47.553  1.00 5.10  ? 73   ALA A C   1 
ATOM   530   O O   . ALA A 1 73  ? 100.072 36.236  47.386  1.00 6.62  ? 73   ALA A O   1 
ATOM   531   C CB  . ALA A 1 73  ? 99.152  38.592  49.399  1.00 4.07  ? 73   ALA A CB  1 
ATOM   532   N N   . LEU A 1 74  ? 100.685 38.226  46.524  1.00 3.38  ? 74   LEU A N   1 
ATOM   533   C CA  . LEU A 1 74  ? 100.628 37.717  45.149  1.00 4.95  ? 74   LEU A CA  1 
ATOM   534   C C   . LEU A 1 74  ? 101.741 36.684  44.935  1.00 4.65  ? 74   LEU A C   1 
ATOM   535   O O   . LEU A 1 74  ? 101.499 35.622  44.331  1.00 3.70  ? 74   LEU A O   1 
ATOM   536   C CB  . LEU A 1 74  ? 100.673 38.824  44.104  1.00 2.08  ? 74   LEU A CB  1 
ATOM   537   C CG  . LEU A 1 74  ? 100.749 38.391  42.641  1.00 4.63  ? 74   LEU A CG  1 
ATOM   538   C CD1 . LEU A 1 74  ? 99.457  37.628  42.262  1.00 5.35  ? 74   LEU A CD1 1 
ATOM   539   C CD2 . LEU A 1 74  ? 100.875 39.617  41.706  1.00 4.30  ? 74   LEU A CD2 1 
ATOM   540   N N   . GLU A 1 75  ? 102.941 36.959  45.462  1.00 6.01  ? 75   GLU A N   1 
ATOM   541   C CA  . GLU A 1 75  ? 104.062 36.009  45.337  1.00 5.81  ? 75   GLU A CA  1 
ATOM   542   C C   . GLU A 1 75  ? 103.701 34.710  46.067  1.00 7.88  ? 75   GLU A C   1 
ATOM   543   O O   . GLU A 1 75  ? 104.015 33.629  45.590  1.00 6.43  ? 75   GLU A O   1 
ATOM   544   C CB  . GLU A 1 75  ? 105.355 36.593  45.905  1.00 6.78  ? 75   GLU A CB  1 
ATOM   545   C CG  . GLU A 1 75  ? 105.852 37.798  45.084  1.00 7.82  ? 75   GLU A CG  1 
ATOM   546   C CD  . GLU A 1 75  ? 107.067 38.426  45.770  1.00 11.02 ? 75   GLU A CD  1 
ATOM   547   O OE1 . GLU A 1 75  ? 106.991 38.655  46.992  1.00 10.59 ? 75   GLU A OE1 1 
ATOM   548   O OE2 . GLU A 1 75  ? 108.071 38.670  45.060  1.00 12.43 ? 75   GLU A OE2 1 
ATOM   549   N N   . ASP A 1 76  ? 103.023 34.771  47.198  1.00 8.65  ? 76   ASP A N   1 
ATOM   550   C CA  . ASP A 1 76  ? 102.526 33.628  47.934  1.00 10.70 ? 76   ASP A CA  1 
ATOM   551   C C   . ASP A 1 76  ? 101.618 32.720  47.091  1.00 9.32  ? 76   ASP A C   1 
ATOM   552   O O   . ASP A 1 76  ? 101.732 31.477  47.020  1.00 8.17  ? 76   ASP A O   1 
ATOM   553   C CB  . ASP A 1 76  ? 101.575 34.174  49.003  1.00 16.31 ? 76   ASP A CB  1 
ATOM   554   C CG  . ASP A 1 76  ? 102.036 33.723  50.371  1.00 21.87 ? 76   ASP A CG  1 
ATOM   555   O OD1 . ASP A 1 76  ? 103.020 34.442  50.700  1.00 24.04 ? 76   ASP A OD1 1 
ATOM   556   O OD2 . ASP A 1 76  ? 101.429 32.764  50.914  1.00 22.44 ? 76   ASP A OD2 1 
ATOM   557   N N   . CYS A 1 77  ? 100.678 33.395  46.444  1.00 6.61  ? 77   CYS A N   1 
ATOM   558   C CA  . CYS A 1 77  ? 99.706  32.807  45.537  1.00 5.17  ? 77   CYS A CA  1 
ATOM   559   C C   . CYS A 1 77  ? 100.421 32.150  44.375  1.00 5.96  ? 77   CYS A C   1 
ATOM   560   O O   . CYS A 1 77  ? 100.119 31.009  44.027  1.00 5.65  ? 77   CYS A O   1 
ATOM   561   C CB  . CYS A 1 77  ? 98.696  33.857  45.035  1.00 4.00  ? 77   CYS A CB  1 
ATOM   562   S SG  . CYS A 1 77  ? 97.874  33.464  43.438  1.00 3.82  ? 77   CYS A SG  1 
ATOM   563   N N   . ILE A 1 78  ? 101.381 32.852  43.728  1.00 5.29  ? 78   ILE A N   1 
ATOM   564   C CA  . ILE A 1 78  ? 102.063 32.281  42.573  1.00 5.24  ? 78   ILE A CA  1 
ATOM   565   C C   . ILE A 1 78  ? 102.820 30.992  42.898  1.00 6.57  ? 78   ILE A C   1 
ATOM   566   O O   . ILE A 1 78  ? 102.883 30.044  42.109  1.00 8.11  ? 78   ILE A O   1 
ATOM   567   C CB  . ILE A 1 78  ? 103.020 33.364  42.014  1.00 4.31  ? 78   ILE A CB  1 
ATOM   568   C CG1 . ILE A 1 78  ? 102.184 34.487  41.364  1.00 3.69  ? 78   ILE A CG1 1 
ATOM   569   C CG2 . ILE A 1 78  ? 104.009 32.830  41.007  1.00 3.51  ? 78   ILE A CG2 1 
ATOM   570   C CD1 . ILE A 1 78  ? 103.032 35.639  40.823  1.00 2.66  ? 78   ILE A CD1 1 
ATOM   571   N N   . LEU A 1 79  ? 103.493 30.980  44.028  1.00 7.16  ? 79   LEU A N   1 
ATOM   572   C CA  . LEU A 1 79  ? 104.313 29.894  44.502  1.00 7.77  ? 79   LEU A CA  1 
ATOM   573   C C   . LEU A 1 79  ? 103.593 28.600  44.866  1.00 9.15  ? 79   LEU A C   1 
ATOM   574   O O   . LEU A 1 79  ? 104.106 27.520  44.562  1.00 9.10  ? 79   LEU A O   1 
ATOM   575   C CB  . LEU A 1 79  ? 104.994 30.342  45.816  1.00 6.64  ? 79   LEU A CB  1 
ATOM   576   C CG  . LEU A 1 79  ? 105.791 29.261  46.574  1.00 8.24  ? 79   LEU A CG  1 
ATOM   577   C CD1 . LEU A 1 79  ? 106.885 28.661  45.713  1.00 7.42  ? 79   LEU A CD1 1 
ATOM   578   C CD2 . LEU A 1 79  ? 106.392 29.870  47.846  1.00 7.85  ? 79   LEU A CD2 1 
ATOM   579   N N   . ASN A 1 80  ? 102.506 28.707  45.586  1.00 7.33  ? 80   ASN A N   1 
ATOM   580   C CA  . ASN A 1 80  ? 101.843 27.595  46.214  1.00 10.70 ? 80   ASN A CA  1 
ATOM   581   C C   . ASN A 1 80  ? 100.805 26.794  45.470  1.00 9.69  ? 80   ASN A C   1 
ATOM   582   O O   . ASN A 1 80  ? 100.324 25.835  46.063  1.00 11.46 ? 80   ASN A O   1 
ATOM   583   C CB  . ASN A 1 80  ? 101.281 28.101  47.565  1.00 12.01 ? 80   ASN A CB  1 
ATOM   584   C CG  . ASN A 1 80  ? 102.463 28.327  48.505  1.00 15.25 ? 80   ASN A CG  1 
ATOM   585   O OD1 . ASN A 1 80  ? 103.094 27.336  48.863  1.00 15.82 ? 80   ASN A OD1 1 
ATOM   586   N ND2 . ASN A 1 80  ? 102.769 29.554  48.896  1.00 15.05 ? 80   ASN A ND2 1 
ATOM   587   N N   . GLY A 1 81  ? 100.376 27.098  44.264  1.00 9.94  ? 81   GLY A N   1 
ATOM   588   C CA  . GLY A 1 81  ? 99.409  26.292  43.514  1.00 8.76  ? 81   GLY A CA  1 
ATOM   589   C C   . GLY A 1 81  ? 98.205  25.915  44.360  1.00 8.34  ? 81   GLY A C   1 
ATOM   590   O O   . GLY A 1 81  ? 97.688  24.808  44.340  1.00 8.62  ? 81   GLY A O   1 
ATOM   591   N N   . ASP A 1 82  ? 97.695  26.877  45.117  1.00 7.69  ? 82   ASP A N   1 
ATOM   592   C CA  . ASP A 1 82  ? 96.586  26.711  46.017  1.00 8.66  ? 82   ASP A CA  1 
ATOM   593   C C   . ASP A 1 82  ? 95.509  27.768  45.749  1.00 9.11  ? 82   ASP A C   1 
ATOM   594   O O   . ASP A 1 82  ? 95.773  28.973  45.917  1.00 7.66  ? 82   ASP A O   1 
ATOM   595   C CB  . ASP A 1 82  ? 97.147  26.886  47.444  1.00 8.87  ? 82   ASP A CB  1 
ATOM   596   C CG  . ASP A 1 82  ? 96.053  26.574  48.456  1.00 11.59 ? 82   ASP A CG  1 
ATOM   597   O OD1 . ASP A 1 82  ? 95.185  27.414  48.744  1.00 12.56 ? 82   ASP A OD1 1 
ATOM   598   O OD2 . ASP A 1 82  ? 96.066  25.469  49.001  1.00 12.68 ? 82   ASP A OD2 1 
ATOM   599   N N   . LEU A 1 83  ? 94.292  27.337  45.420  1.00 9.31  ? 83   LEU A N   1 
ATOM   600   C CA  . LEU A 1 83  ? 93.220  28.269  45.164  1.00 10.70 ? 83   LEU A CA  1 
ATOM   601   C C   . LEU A 1 83  ? 92.969  29.199  46.358  1.00 9.07  ? 83   LEU A C   1 
ATOM   602   O O   . LEU A 1 83  ? 92.774  30.397  46.175  1.00 8.06  ? 83   LEU A O   1 
ATOM   603   C CB  . LEU A 1 83  ? 91.853  27.633  44.905  1.00 11.52 ? 83   LEU A CB  1 
ATOM   604   C CG  . LEU A 1 83  ? 91.473  27.240  43.509  1.00 12.80 ? 83   LEU A CG  1 
ATOM   605   C CD1 . LEU A 1 83  ? 90.075  26.603  43.575  1.00 13.54 ? 83   LEU A CD1 1 
ATOM   606   C CD2 . LEU A 1 83  ? 91.500  28.404  42.520  1.00 10.03 ? 83   LEU A CD2 1 
ATOM   607   N N   . SER A 1 84  ? 92.894  28.577  47.526  1.00 7.35  ? 84   SER A N   1 
ATOM   608   C CA  . SER A 1 84  ? 92.575  29.363  48.702  1.00 9.02  ? 84   SER A CA  1 
ATOM   609   C C   . SER A 1 84  ? 93.567  30.487  48.990  1.00 9.74  ? 84   SER A C   1 
ATOM   610   O O   . SER A 1 84  ? 93.123  31.610  49.275  1.00 8.27  ? 84   SER A O   1 
ATOM   611   C CB  . SER A 1 84  ? 92.436  28.457  49.932  1.00 9.56  ? 84   SER A CB  1 
ATOM   612   O OG  . SER A 1 84  ? 91.909  29.343  50.928  1.00 13.58 ? 84   SER A OG  1 
ATOM   613   N N   . ILE A 1 85  ? 94.866  30.211  48.820  1.00 7.21  ? 85   ILE A N   1 
ATOM   614   C CA  . ILE A 1 85  ? 95.859  31.278  49.063  1.00 6.56  ? 85   ILE A CA  1 
ATOM   615   C C   . ILE A 1 85  ? 95.690  32.361  48.011  1.00 6.24  ? 85   ILE A C   1 
ATOM   616   O O   . ILE A 1 85  ? 95.739  33.557  48.305  1.00 6.36  ? 85   ILE A O   1 
ATOM   617   C CB  . ILE A 1 85  ? 97.267  30.674  49.114  1.00 7.54  ? 85   ILE A CB  1 
ATOM   618   C CG1 . ILE A 1 85  ? 97.472  29.799  50.378  1.00 7.18  ? 85   ILE A CG1 1 
ATOM   619   C CG2 . ILE A 1 85  ? 98.348  31.745  49.052  1.00 7.38  ? 85   ILE A CG2 1 
ATOM   620   C CD1 . ILE A 1 85  ? 98.809  29.059  50.301  1.00 11.08 ? 85   ILE A CD1 1 
ATOM   621   N N   . CYS A 1 86  ? 95.407  32.020  46.766  1.00 5.21  ? 86   CYS A N   1 
ATOM   622   C CA  . CYS A 1 86  ? 95.199  32.965  45.682  1.00 6.14  ? 86   CYS A CA  1 
ATOM   623   C C   . CYS A 1 86  ? 93.973  33.852  45.895  1.00 6.61  ? 86   CYS A C   1 
ATOM   624   O O   . CYS A 1 86  ? 93.993  35.018  45.482  1.00 4.83  ? 86   CYS A O   1 
ATOM   625   C CB  . CYS A 1 86  ? 95.215  32.270  44.322  1.00 5.70  ? 86   CYS A CB  1 
ATOM   626   S SG  . CYS A 1 86  ? 96.904  31.727  43.884  1.00 3.88  ? 86   CYS A SG  1 
ATOM   627   N N   . GLU A 1 87  ? 92.969  33.369  46.613  1.00 6.25  ? 87   GLU A N   1 
ATOM   628   C CA  . GLU A 1 87  ? 91.800  34.159  46.964  1.00 7.57  ? 87   GLU A CA  1 
ATOM   629   C C   . GLU A 1 87  ? 92.139  35.202  48.027  1.00 7.85  ? 87   GLU A C   1 
ATOM   630   O O   . GLU A 1 87  ? 91.343  36.115  48.234  1.00 7.83  ? 87   GLU A O   1 
ATOM   631   C CB  . GLU A 1 87  ? 90.652  33.275  47.497  1.00 7.40  ? 87   GLU A CB  1 
ATOM   632   C CG  . GLU A 1 87  ? 89.935  32.512  46.379  1.00 7.17  ? 87   GLU A CG  1 
ATOM   633   C CD  . GLU A 1 87  ? 89.438  33.443  45.281  1.00 6.48  ? 87   GLU A CD  1 
ATOM   634   O OE1 . GLU A 1 87  ? 88.556  34.287  45.555  1.00 8.15  ? 87   GLU A OE1 1 
ATOM   635   O OE2 . GLU A 1 87  ? 89.872  33.352  44.121  1.00 5.81  ? 87   GLU A OE2 1 
ATOM   636   N N   . ASP A 1 88  ? 93.297  35.101  48.682  1.00 8.27  ? 88   ASP A N   1 
ATOM   637   C CA  . ASP A 1 88  ? 93.728  36.015  49.700  1.00 10.77 ? 88   ASP A CA  1 
ATOM   638   C C   . ASP A 1 88  ? 94.488  37.219  49.119  1.00 9.48  ? 88   ASP A C   1 
ATOM   639   O O   . ASP A 1 88  ? 94.821  38.113  49.900  1.00 8.97  ? 88   ASP A O   1 
ATOM   640   C CB  . ASP A 1 88  ? 94.604  35.360  50.787  1.00 12.29 ? 88   ASP A CB  1 
ATOM   641   C CG  . ASP A 1 88  ? 93.791  34.419  51.671  1.00 16.51 ? 88   ASP A CG  1 
ATOM   642   O OD1 . ASP A 1 88  ? 92.576  34.644  51.844  1.00 14.54 ? 88   ASP A OD1 1 
ATOM   643   O OD2 . ASP A 1 88  ? 94.368  33.424  52.209  1.00 18.71 ? 88   ASP A OD2 1 
ATOM   644   N N   . VAL A 1 89  ? 94.755  37.247  47.840  1.00 7.84  ? 89   VAL A N   1 
ATOM   645   C CA  . VAL A 1 89  ? 95.471  38.394  47.256  1.00 6.15  ? 89   VAL A CA  1 
ATOM   646   C C   . VAL A 1 89  ? 94.494  39.571  47.216  1.00 5.40  ? 89   VAL A C   1 
ATOM   647   O O   . VAL A 1 89  ? 93.472  39.488  46.543  1.00 4.95  ? 89   VAL A O   1 
ATOM   648   C CB  . VAL A 1 89  ? 95.935  38.062  45.835  1.00 4.55  ? 89   VAL A CB  1 
ATOM   649   C CG1 . VAL A 1 89  ? 96.670  39.221  45.179  1.00 3.73  ? 89   VAL A CG1 1 
ATOM   650   C CG2 . VAL A 1 89  ? 96.805  36.790  45.830  1.00 3.62  ? 89   VAL A CG2 1 
ATOM   651   N N   . PRO A 1 90  ? 94.856  40.703  47.801  1.00 6.19  ? 90   PRO A N   1 
ATOM   652   C CA  . PRO A 1 90  ? 94.015  41.893  47.796  1.00 3.51  ? 90   PRO A CA  1 
ATOM   653   C C   . PRO A 1 90  ? 93.704  42.357  46.401  1.00 4.27  ? 90   PRO A C   1 
ATOM   654   O O   . PRO A 1 90  ? 94.450  42.201  45.427  1.00 3.56  ? 90   PRO A O   1 
ATOM   655   C CB  . PRO A 1 90  ? 94.827  42.925  48.581  1.00 3.74  ? 90   PRO A CB  1 
ATOM   656   C CG  . PRO A 1 90  ? 95.748  42.133  49.451  1.00 3.76  ? 90   PRO A CG  1 
ATOM   657   C CD  . PRO A 1 90  ? 96.101  40.928  48.578  1.00 4.79  ? 90   PRO A CD  1 
ATOM   658   N N   . VAL A 1 91  ? 92.517  42.955  46.247  1.00 3.16  ? 91   VAL A N   1 
ATOM   659   C CA  . VAL A 1 91  ? 92.104  43.507  44.942  1.00 4.24  ? 91   VAL A CA  1 
ATOM   660   C C   . VAL A 1 91  ? 92.038  45.028  45.127  1.00 4.70  ? 91   VAL A C   1 
ATOM   661   O O   . VAL A 1 91  ? 91.741  45.495  46.235  1.00 5.54  ? 91   VAL A O   1 
ATOM   662   C CB  . VAL A 1 91  ? 90.791  42.877  44.470  1.00 5.96  ? 91   VAL A CB  1 
ATOM   663   C CG1 . VAL A 1 91  ? 89.629  43.210  45.405  1.00 4.96  ? 91   VAL A CG1 1 
ATOM   664   C CG2 . VAL A 1 91  ? 90.393  43.340  43.048  1.00 6.58  ? 91   VAL A CG2 1 
ATOM   665   N N   . GLY A 1 92  ? 92.373  45.844  44.132  1.00 4.97  ? 92   GLY A N   1 
ATOM   666   C CA  . GLY A 1 92  ? 92.432  47.266  44.323  1.00 5.16  ? 92   GLY A CA  1 
ATOM   667   C C   . GLY A 1 92  ? 91.128  48.031  44.104  1.00 8.27  ? 92   GLY A C   1 
ATOM   668   O O   . GLY A 1 92  ? 91.160  49.261  44.100  1.00 6.40  ? 92   GLY A O   1 
ATOM   669   N N   . ASN A 1 93  ? 90.083  47.329  43.694  1.00 7.31  ? 93   ASN A N   1 
ATOM   670   C CA  . ASN A 1 93  ? 88.785  47.907  43.385  1.00 7.78  ? 93   ASN A CA  1 
ATOM   671   C C   . ASN A 1 93  ? 87.768  46.853  43.818  1.00 9.06  ? 93   ASN A C   1 
ATOM   672   O O   . ASN A 1 93  ? 87.966  45.657  43.501  1.00 8.51  ? 93   ASN A O   1 
ATOM   673   C CB  . ASN A 1 93  ? 88.620  48.284  41.938  1.00 4.59  ? 93   ASN A CB  1 
ATOM   674   C CG  . ASN A 1 93  ? 87.163  48.657  41.587  1.00 7.16  ? 93   ASN A CG  1 
ATOM   675   O OD1 . ASN A 1 93  ? 86.305  47.791  41.468  1.00 5.68  ? 93   ASN A OD1 1 
ATOM   676   N ND2 . ASN A 1 93  ? 86.925  49.949  41.404  1.00 4.81  ? 93   ASN A ND2 1 
ATOM   677   N N   . SER A 1 94  ? 86.785  47.244  44.598  1.00 9.14  ? 94   SER A N   1 
ATOM   678   C CA  . SER A 1 94  ? 85.864  46.240  45.136  1.00 11.68 ? 94   SER A CA  1 
ATOM   679   C C   . SER A 1 94  ? 84.573  46.081  44.349  1.00 13.34 ? 94   SER A C   1 
ATOM   680   O O   . SER A 1 94  ? 83.641  45.488  44.924  1.00 13.12 ? 94   SER A O   1 
ATOM   681   C CB  . SER A 1 94  ? 85.518  46.556  46.606  1.00 12.51 ? 94   SER A CB  1 
ATOM   682   O OG  . SER A 1 94  ? 84.821  47.802  46.696  1.00 13.66 ? 94   SER A OG  1 
ATOM   683   N N   . GLU A 1 95  ? 84.487  46.494  43.095  1.00 11.49 ? 95   GLU A N   1 
ATOM   684   C CA  . GLU A 1 95  ? 83.235  46.383  42.374  1.00 13.50 ? 95   GLU A CA  1 
ATOM   685   C C   . GLU A 1 95  ? 82.956  44.986  41.854  1.00 14.53 ? 95   GLU A C   1 
ATOM   686   O O   . GLU A 1 95  ? 81.876  44.792  41.273  1.00 14.09 ? 95   GLU A O   1 
ATOM   687   C CB  . GLU A 1 95  ? 83.139  47.423  41.239  1.00 14.93 ? 95   GLU A CB  1 
ATOM   688   C CG  . GLU A 1 95  ? 83.106  48.853  41.811  1.00 16.64 ? 95   GLU A CG  1 
ATOM   689   C CD  . GLU A 1 95  ? 83.324  49.917  40.751  1.00 18.80 ? 95   GLU A CD  1 
ATOM   690   O OE1 . GLU A 1 95  ? 82.566  49.967  39.771  1.00 19.40 ? 95   GLU A OE1 1 
ATOM   691   O OE2 . GLU A 1 95  ? 84.266  50.735  40.820  1.00 18.70 ? 95   GLU A OE2 1 
ATOM   692   N N   . GLY A 1 96  ? 83.863  44.012  41.991  1.00 12.62 ? 96   GLY A N   1 
ATOM   693   C CA  . GLY A 1 96  ? 83.600  42.659  41.533  1.00 9.36  ? 96   GLY A CA  1 
ATOM   694   C C   . GLY A 1 96  ? 83.527  42.456  40.044  1.00 9.80  ? 96   GLY A C   1 
ATOM   695   O O   . GLY A 1 96  ? 83.014  41.414  39.582  1.00 8.46  ? 96   GLY A O   1 
ATOM   696   N N   . ASP A 1 97  ? 84.066  43.357  39.207  1.00 7.48  ? 97   ASP A N   1 
ATOM   697   C CA  . ASP A 1 97  ? 83.998  43.140  37.773  1.00 8.18  ? 97   ASP A CA  1 
ATOM   698   C C   . ASP A 1 97  ? 84.957  42.004  37.429  1.00 9.91  ? 97   ASP A C   1 
ATOM   699   O O   . ASP A 1 97  ? 86.017  41.880  38.066  1.00 8.87  ? 97   ASP A O   1 
ATOM   700   C CB  . ASP A 1 97  ? 84.367  44.436  37.040  1.00 9.59  ? 97   ASP A CB  1 
ATOM   701   C CG  . ASP A 1 97  ? 84.220  44.361  35.558  1.00 10.18 ? 97   ASP A CG  1 
ATOM   702   O OD1 . ASP A 1 97  ? 84.919  43.603  34.846  1.00 11.70 ? 97   ASP A OD1 1 
ATOM   703   O OD2 . ASP A 1 97  ? 83.352  45.020  34.963  1.00 14.23 ? 97   ASP A OD2 1 
ATOM   704   N N   . PRO A 1 98  ? 84.581  41.156  36.465  1.00 8.96  ? 98   PRO A N   1 
ATOM   705   C CA  . PRO A 1 98  ? 85.411  40.051  36.055  1.00 8.15  ? 98   PRO A CA  1 
ATOM   706   C C   . PRO A 1 98  ? 86.755  40.492  35.466  1.00 6.53  ? 98   PRO A C   1 
ATOM   707   O O   . PRO A 1 98  ? 87.651  39.662  35.545  1.00 3.54  ? 98   PRO A O   1 
ATOM   708   C CB  . PRO A 1 98  ? 84.645  39.331  34.946  1.00 10.39 ? 98   PRO A CB  1 
ATOM   709   C CG  . PRO A 1 98  ? 83.288  39.960  34.910  1.00 11.59 ? 98   PRO A CG  1 
ATOM   710   C CD  . PRO A 1 98  ? 83.301  41.214  35.745  1.00 9.47  ? 98   PRO A CD  1 
ATOM   711   N N   . VAL A 1 99  ? 86.935  41.704  34.919  1.00 4.20  ? 99   VAL A N   1 
ATOM   712   C CA  . VAL A 1 99  ? 88.244  42.075  34.403  1.00 3.99  ? 99   VAL A CA  1 
ATOM   713   C C   . VAL A 1 99  ? 89.262  42.191  35.525  1.00 3.74  ? 99   VAL A C   1 
ATOM   714   O O   . VAL A 1 99  ? 90.446  42.042  35.227  1.00 3.80  ? 99   VAL A O   1 
ATOM   715   C CB  . VAL A 1 99  ? 88.235  43.343  33.528  1.00 4.60  ? 99   VAL A CB  1 
ATOM   716   C CG1 . VAL A 1 99  ? 87.254  43.177  32.368  1.00 3.94  ? 99   VAL A CG1 1 
ATOM   717   C CG2 . VAL A 1 99  ? 87.961  44.577  34.366  1.00 2.12  ? 99   VAL A CG2 1 
ATOM   718   N N   . GLY A 1 100 ? 88.875  42.374  36.768  1.00 2.33  ? 100  GLY A N   1 
ATOM   719   C CA  . GLY A 1 100 ? 89.724  42.438  37.936  1.00 2.91  ? 100  GLY A CA  1 
ATOM   720   C C   . GLY A 1 100 ? 90.270  41.085  38.439  1.00 2.18  ? 100  GLY A C   1 
ATOM   721   O O   . GLY A 1 100 ? 91.178  41.082  39.299  1.00 3.42  ? 100  GLY A O   1 
ATOM   722   N N   . ARG A 1 101 ? 89.728  39.966  37.974  1.00 3.21  ? 101  ARG A N   1 
ATOM   723   C CA  . ARG A 1 101 ? 90.218  38.690  38.488  1.00 3.06  ? 101  ARG A CA  1 
ATOM   724   C C   . ARG A 1 101 ? 91.611  38.301  37.937  1.00 2.08  ? 101  ARG A C   1 
ATOM   725   O O   . ARG A 1 101 ? 91.878  38.385  36.741  1.00 3.00  ? 101  ARG A O   1 
ATOM   726   C CB  . ARG A 1 101 ? 89.235  37.569  38.084  1.00 4.02  ? 101  ARG A CB  1 
ATOM   727   C CG  . ARG A 1 101 ? 87.836  37.665  38.713  1.00 4.04  ? 101  ARG A CG  1 
ATOM   728   C CD  . ARG A 1 101 ? 86.765  36.866  37.940  1.00 3.20  ? 101  ARG A CD  1 
ATOM   729   N NE  . ARG A 1 101 ? 85.507  36.783  38.691  1.00 2.56  ? 101  ARG A NE  1 
ATOM   730   C CZ  . ARG A 1 101 ? 84.992  35.922  39.541  1.00 5.11  ? 101  ARG A CZ  1 
ATOM   731   N NH1 . ARG A 1 101 ? 85.576  34.766  39.861  1.00 4.05  ? 101  ARG A NH1 1 
ATOM   732   N NH2 . ARG A 1 101 ? 83.769  36.135  40.096  1.00 3.77  ? 101  ARG A NH2 1 
ATOM   733   N N   . LEU A 1 102 ? 92.392  37.726  38.835  1.00 2.10  ? 102  LEU A N   1 
ATOM   734   C CA  . LEU A 1 102 ? 93.704  37.164  38.415  1.00 4.28  ? 102  LEU A CA  1 
ATOM   735   C C   . LEU A 1 102 ? 93.467  36.014  37.434  1.00 4.20  ? 102  LEU A C   1 
ATOM   736   O O   . LEU A 1 102 ? 92.598  35.187  37.799  1.00 6.04  ? 102  LEU A O   1 
ATOM   737   C CB  . LEU A 1 102 ? 94.371  36.681  39.694  1.00 2.08  ? 102  LEU A CB  1 
ATOM   738   C CG  . LEU A 1 102 ? 94.748  37.804  40.676  1.00 4.64  ? 102  LEU A CG  1 
ATOM   739   C CD1 . LEU A 1 102 ? 95.318  37.180  41.946  1.00 4.36  ? 102  LEU A CD1 1 
ATOM   740   C CD2 . LEU A 1 102 ? 95.725  38.778  40.026  1.00 2.68  ? 102  LEU A CD2 1 
ATOM   741   N N   . VAL A 1 103 ? 94.044  35.970  36.262  1.00 3.74  ? 103  VAL A N   1 
ATOM   742   C CA  . VAL A 1 103 ? 93.760  34.902  35.333  1.00 3.27  ? 103  VAL A CA  1 
ATOM   743   C C   . VAL A 1 103 ? 94.571  33.623  35.570  1.00 3.82  ? 103  VAL A C   1 
ATOM   744   O O   . VAL A 1 103 ? 95.699  33.456  35.148  1.00 2.53  ? 103  VAL A O   1 
ATOM   745   C CB  . VAL A 1 103 ? 93.854  35.320  33.866  1.00 3.06  ? 103  VAL A CB  1 
ATOM   746   C CG1 . VAL A 1 103 ? 93.469  34.225  32.876  1.00 3.63  ? 103  VAL A CG1 1 
ATOM   747   C CG2 . VAL A 1 103 ? 92.955  36.531  33.612  1.00 3.54  ? 103  VAL A CG2 1 
ATOM   748   N N   . ASN A 1 104 ? 93.977  32.752  36.360  1.00 3.86  ? 104  ASN A N   1 
ATOM   749   C CA  . ASN A 1 104 ? 94.423  31.397  36.649  1.00 3.66  ? 104  ASN A CA  1 
ATOM   750   C C   . ASN A 1 104 ? 95.892  31.254  37.001  1.00 3.64  ? 104  ASN A C   1 
ATOM   751   O O   . ASN A 1 104 ? 96.580  30.468  36.380  1.00 2.83  ? 104  ASN A O   1 
ATOM   752   C CB  . ASN A 1 104 ? 94.103  30.566  35.390  1.00 4.00  ? 104  ASN A CB  1 
ATOM   753   C CG  . ASN A 1 104 ? 94.017  29.065  35.531  1.00 3.55  ? 104  ASN A CG  1 
ATOM   754   O OD1 . ASN A 1 104 ? 93.845  28.446  34.481  1.00 3.04  ? 104  ASN A OD1 1 
ATOM   755   N ND2 . ASN A 1 104 ? 94.148  28.420  36.675  1.00 2.08  ? 104  ASN A ND2 1 
ATOM   756   N N   . PRO A 1 105 ? 96.355  31.927  38.036  1.00 3.89  ? 105  PRO A N   1 
ATOM   757   C CA  . PRO A 1 105 ? 97.745  31.908  38.436  1.00 4.23  ? 105  PRO A CA  1 
ATOM   758   C C   . PRO A 1 105 ? 98.280  30.535  38.815  1.00 5.40  ? 105  PRO A C   1 
ATOM   759   O O   . PRO A 1 105 ? 99.492  30.295  38.717  1.00 5.92  ? 105  PRO A O   1 
ATOM   760   C CB  . PRO A 1 105 ? 97.784  32.826  39.666  1.00 4.27  ? 105  PRO A CB  1 
ATOM   761   C CG  . PRO A 1 105 ? 96.369  32.891  40.134  1.00 3.38  ? 105  PRO A CG  1 
ATOM   762   C CD  . PRO A 1 105 ? 95.536  32.888  38.868  1.00 2.08  ? 105  PRO A CD  1 
ATOM   763   N N   . THR A 1 106 ? 97.401  29.607  39.224  1.00 4.64  ? 106  THR A N   1 
ATOM   764   C CA  . THR A 1 106 ? 97.878  28.295  39.640  1.00 4.01  ? 106  THR A CA  1 
ATOM   765   C C   . THR A 1 106 ? 97.946  27.349  38.468  1.00 4.02  ? 106  THR A C   1 
ATOM   766   O O   . THR A 1 106 ? 98.235  26.171  38.684  1.00 4.44  ? 106  THR A O   1 
ATOM   767   C CB  . THR A 1 106 ? 96.943  27.648  40.693  1.00 5.11  ? 106  THR A CB  1 
ATOM   768   O OG1 . THR A 1 106 ? 95.655  27.371  40.075  1.00 4.51  ? 106  THR A OG1 1 
ATOM   769   C CG2 . THR A 1 106 ? 96.724  28.530  41.902  1.00 4.47  ? 106  THR A CG2 1 
ATOM   770   N N   . ALA A 1 107 ? 97.613  27.780  37.251  1.00 3.51  ? 107  ALA A N   1 
ATOM   771   C CA  . ALA A 1 107 ? 97.501  26.825  36.151  1.00 5.08  ? 107  ALA A CA  1 
ATOM   772   C C   . ALA A 1 107 ? 98.741  25.989  35.877  1.00 6.42  ? 107  ALA A C   1 
ATOM   773   O O   . ALA A 1 107 ? 98.639  24.814  35.459  1.00 3.76  ? 107  ALA A O   1 
ATOM   774   C CB  . ALA A 1 107 ? 97.069  27.524  34.855  1.00 4.96  ? 107  ALA A CB  1 
ATOM   775   N N   . ALA A 1 108 ? 99.929  26.639  35.966  1.00 5.35  ? 108  ALA A N   1 
ATOM   776   C CA  . ALA A 1 108 ? 101.159 25.973  35.594  1.00 5.41  ? 108  ALA A CA  1 
ATOM   777   C C   . ALA A 1 108 ? 101.387 24.641  36.303  1.00 4.36  ? 108  ALA A C   1 
ATOM   778   O O   . ALA A 1 108 ? 101.975 23.754  35.680  1.00 5.47  ? 108  ALA A O   1 
ATOM   779   C CB  . ALA A 1 108 ? 102.410 26.834  35.906  1.00 4.48  ? 108  ALA A CB  1 
ATOM   780   N N   . PHE A 1 109 ? 101.000 24.513  37.548  1.00 4.66  ? 109  PHE A N   1 
ATOM   781   C CA  . PHE A 1 109 ? 101.271 23.373  38.381  1.00 4.52  ? 109  PHE A CA  1 
ATOM   782   C C   . PHE A 1 109 ? 100.398 22.161  38.112  1.00 4.37  ? 109  PHE A C   1 
ATOM   783   O O   . PHE A 1 109 ? 99.556  21.703  38.883  1.00 5.46  ? 109  PHE A O   1 
ATOM   784   C CB  . PHE A 1 109 ? 101.221 23.803  39.849  1.00 5.75  ? 109  PHE A CB  1 
ATOM   785   C CG  . PHE A 1 109 ? 102.318 24.781  40.242  1.00 7.91  ? 109  PHE A CG  1 
ATOM   786   C CD1 . PHE A 1 109 ? 103.655 24.434  40.089  1.00 7.62  ? 109  PHE A CD1 1 
ATOM   787   C CD2 . PHE A 1 109 ? 101.998 26.021  40.781  1.00 6.62  ? 109  PHE A CD2 1 
ATOM   788   C CE1 . PHE A 1 109 ? 104.650 25.336  40.445  1.00 8.80  ? 109  PHE A CE1 1 
ATOM   789   C CE2 . PHE A 1 109 ? 102.992 26.905  41.146  1.00 7.71  ? 109  PHE A CE2 1 
ATOM   790   C CZ  . PHE A 1 109 ? 104.328 26.580  40.989  1.00 6.18  ? 109  PHE A CZ  1 
ATOM   791   N N   . ALA A 1 110 ? 100.522 21.638  36.906  1.00 4.57  ? 110  ALA A N   1 
ATOM   792   C CA  . ALA A 1 110 ? 99.822  20.428  36.480  1.00 3.42  ? 110  ALA A CA  1 
ATOM   793   C C   . ALA A 1 110 ? 100.778 19.671  35.576  1.00 3.09  ? 110  ALA A C   1 
ATOM   794   O O   . ALA A 1 110 ? 101.148 20.182  34.514  1.00 3.53  ? 110  ALA A O   1 
ATOM   795   C CB  . ALA A 1 110 ? 98.552  20.784  35.707  1.00 2.08  ? 110  ALA A CB  1 
ATOM   796   N N   . ILE A 1 111 ? 101.137 18.437  35.941  1.00 3.34  ? 111  ILE A N   1 
ATOM   797   C CA  . ILE A 1 111 ? 102.006 17.634  35.060  1.00 3.62  ? 111  ILE A CA  1 
ATOM   798   C C   . ILE A 1 111 ? 101.150 16.940  34.015  1.00 5.26  ? 111  ILE A C   1 
ATOM   799   O O   . ILE A 1 111 ? 100.472 15.930  34.364  1.00 4.93  ? 111  ILE A O   1 
ATOM   800   C CB  . ILE A 1 111 ? 102.833 16.627  35.905  1.00 3.98  ? 111  ILE A CB  1 
ATOM   801   C CG1 . ILE A 1 111 ? 103.702 17.416  36.880  1.00 3.66  ? 111  ILE A CG1 1 
ATOM   802   C CG2 . ILE A 1 111 ? 103.675 15.741  34.974  1.00 3.55  ? 111  ILE A CG2 1 
ATOM   803   C CD1 . ILE A 1 111 ? 104.247 16.612  38.049  1.00 3.88  ? 111  ILE A CD1 1 
ATOM   804   N N   . ASP A 1 112 ? 101.135 17.422  32.751  1.00 4.68  ? 112  ASP A N   1 
ATOM   805   C CA  . ASP A 1 112 ? 100.311 16.769  31.740  1.00 3.68  ? 112  ASP A CA  1 
ATOM   806   C C   . ASP A 1 112 ? 101.028 15.464  31.367  1.00 5.63  ? 112  ASP A C   1 
ATOM   807   O O   . ASP A 1 112 ? 102.268 15.409  31.284  1.00 2.70  ? 112  ASP A O   1 
ATOM   808   C CB  . ASP A 1 112 ? 100.140 17.642  30.491  1.00 3.66  ? 112  ASP A CB  1 
ATOM   809   C CG  . ASP A 1 112 ? 99.386  18.937  30.850  1.00 6.46  ? 112  ASP A CG  1 
ATOM   810   O OD1 . ASP A 1 112 ? 98.149  18.860  31.031  1.00 2.55  ? 112  ASP A OD1 1 
ATOM   811   O OD2 . ASP A 1 112 ? 100.035 20.028  30.899  1.00 5.04  ? 112  ASP A OD2 1 
ATOM   812   N N   . ILE A 1 113 ? 100.289 14.393  31.074  1.00 4.52  ? 113  ILE A N   1 
ATOM   813   C CA  . ILE A 1 113 ? 100.950 13.128  30.801  1.00 4.33  ? 113  ILE A CA  1 
ATOM   814   C C   . ILE A 1 113 ? 101.669 13.170  29.460  1.00 4.86  ? 113  ILE A C   1 
ATOM   815   O O   . ILE A 1 113 ? 102.749 12.556  29.302  1.00 3.38  ? 113  ILE A O   1 
ATOM   816   C CB  . ILE A 1 113 ? 99.996  11.919  30.894  1.00 6.19  ? 113  ILE A CB  1 
ATOM   817   C CG1 . ILE A 1 113 ? 100.831 10.622  31.032  1.00 4.55  ? 113  ILE A CG1 1 
ATOM   818   C CG2 . ILE A 1 113 ? 99.095  11.839  29.666  1.00 4.78  ? 113  ILE A CG2 1 
ATOM   819   C CD1 . ILE A 1 113 ? 99.958  9.393   31.233  1.00 5.24  ? 113  ILE A CD1 1 
ATOM   820   N N   . SER A 1 114 ? 101.088 13.907  28.524  1.00 3.48  ? 114  SER A N   1 
ATOM   821   C CA  . SER A 1 114 ? 101.715 14.043  27.213  1.00 4.03  ? 114  SER A CA  1 
ATOM   822   C C   . SER A 1 114 ? 102.621 15.299  27.107  1.00 4.26  ? 114  SER A C   1 
ATOM   823   O O   . SER A 1 114 ? 102.410 16.263  27.845  1.00 2.84  ? 114  SER A O   1 
ATOM   824   C CB  . SER A 1 114 ? 100.645 14.111  26.135  1.00 4.48  ? 114  SER A CB  1 
ATOM   825   O OG  . SER A 1 114 ? 99.974  15.375  26.017  1.00 6.23  ? 114  SER A OG  1 
ATOM   826   N N   . GLY A 1 115 ? 103.467 15.336  26.105  1.00 4.35  ? 115  GLY A N   1 
ATOM   827   C CA  . GLY A 1 115 ? 104.363 16.432  25.775  1.00 5.18  ? 115  GLY A CA  1 
ATOM   828   C C   . GLY A 1 115 ? 105.405 16.751  26.847  1.00 4.99  ? 115  GLY A C   1 
ATOM   829   O O   . GLY A 1 115 ? 105.496 16.072  27.875  1.00 6.17  ? 115  GLY A O   1 
ATOM   830   N N   . PRO A 1 116 ? 106.140 17.837  26.670  1.00 5.28  ? 116  PRO A N   1 
ATOM   831   C CA  . PRO A 1 116 ? 107.173 18.255  27.628  1.00 5.82  ? 116  PRO A CA  1 
ATOM   832   C C   . PRO A 1 116 ? 106.569 18.841  28.877  1.00 3.53  ? 116  PRO A C   1 
ATOM   833   O O   . PRO A 1 116 ? 105.554 19.548  28.768  1.00 3.63  ? 116  PRO A O   1 
ATOM   834   C CB  . PRO A 1 116 ? 108.030 19.239  26.811  1.00 4.29  ? 116  PRO A CB  1 
ATOM   835   C CG  . PRO A 1 116 ? 107.030 19.852  25.883  1.00 4.24  ? 116  PRO A CG  1 
ATOM   836   C CD  . PRO A 1 116 ? 106.073 18.754  25.505  1.00 3.78  ? 116  PRO A CD  1 
ATOM   837   N N   . ALA A 1 117 ? 107.052 18.527  30.074  1.00 3.83  ? 117  ALA A N   1 
ATOM   838   C CA  . ALA A 1 117 ? 106.425 19.089  31.260  1.00 2.97  ? 117  ALA A CA  1 
ATOM   839   C C   . ALA A 1 117 ? 106.571 20.637  31.230  1.00 3.71  ? 117  ALA A C   1 
ATOM   840   O O   . ALA A 1 117 ? 107.384 21.254  30.498  1.00 2.83  ? 117  ALA A O   1 
ATOM   841   C CB  . ALA A 1 117 ? 106.984 18.445  32.514  1.00 2.08  ? 117  ALA A CB  1 
ATOM   842   N N   . PHE A 1 118 ? 105.750 21.285  32.036  1.00 3.56  ? 118  PHE A N   1 
ATOM   843   C CA  . PHE A 1 118 ? 105.695 22.755  32.067  1.00 5.71  ? 118  PHE A CA  1 
ATOM   844   C C   . PHE A 1 118 ? 107.009 23.448  32.387  1.00 5.52  ? 118  PHE A C   1 
ATOM   845   O O   . PHE A 1 118 ? 107.201 24.581  31.923  1.00 5.58  ? 118  PHE A O   1 
ATOM   846   C CB  . PHE A 1 118 ? 104.612 23.264  33.038  1.00 4.02  ? 118  PHE A CB  1 
ATOM   847   C CG  . PHE A 1 118 ? 104.832 22.920  34.476  1.00 3.69  ? 118  PHE A CG  1 
ATOM   848   C CD1 . PHE A 1 118 ? 105.538 23.737  35.368  1.00 3.70  ? 118  PHE A CD1 1 
ATOM   849   C CD2 . PHE A 1 118 ? 104.241 21.785  34.986  1.00 2.69  ? 118  PHE A CD2 1 
ATOM   850   C CE1 . PHE A 1 118 ? 105.691 23.397  36.691  1.00 2.51  ? 118  PHE A CE1 1 
ATOM   851   C CE2 . PHE A 1 118 ? 104.358 21.432  36.300  1.00 2.08  ? 118  PHE A CE2 1 
ATOM   852   C CZ  . PHE A 1 118 ? 105.122 22.209  37.167  1.00 2.08  ? 118  PHE A CZ  1 
ATOM   853   N N   . SER A 1 119 ? 107.840 22.837  33.234  1.00 6.24  ? 119  SER A N   1 
ATOM   854   C CA  . SER A 1 119 ? 109.122 23.483  33.568  1.00 8.20  ? 119  SER A CA  1 
ATOM   855   C C   . SER A 1 119 ? 110.285 22.942  32.745  1.00 7.72  ? 119  SER A C   1 
ATOM   856   O O   . SER A 1 119 ? 111.442 23.255  33.078  1.00 7.46  ? 119  SER A O   1 
ATOM   857   C CB  . SER A 1 119 ? 109.483 23.250  35.032  1.00 6.14  ? 119  SER A CB  1 
ATOM   858   O OG  . SER A 1 119 ? 109.794 21.870  35.187  1.00 7.90  ? 119  SER A OG  1 
ATOM   859   N N   . ALA A 1 120 ? 110.021 22.216  31.661  1.00 6.02  ? 120  ALA A N   1 
ATOM   860   C CA  . ALA A 1 120 ? 111.075 21.635  30.847  1.00 4.70  ? 120  ALA A CA  1 
ATOM   861   C C   . ALA A 1 120 ? 111.654 22.535  29.770  1.00 6.44  ? 120  ALA A C   1 
ATOM   862   O O   . ALA A 1 120 ? 112.684 22.211  29.152  1.00 4.52  ? 120  ALA A O   1 
ATOM   863   C CB  . ALA A 1 120 ? 110.614 20.328  30.227  1.00 4.90  ? 120  ALA A CB  1 
ATOM   864   N N   . THR A 1 121 ? 111.023 23.699  29.544  1.00 3.91  ? 121  THR A N   1 
ATOM   865   C CA  . THR A 1 121 ? 111.449 24.639  28.536  1.00 3.29  ? 121  THR A CA  1 
ATOM   866   C C   . THR A 1 121 ? 111.674 25.999  29.224  1.00 2.08  ? 121  THR A C   1 
ATOM   867   O O   . THR A 1 121 ? 111.416 26.121  30.421  1.00 2.15  ? 121  THR A O   1 
ATOM   868   C CB  . THR A 1 121 ? 110.418 24.821  27.397  1.00 4.60  ? 121  THR A CB  1 
ATOM   869   O OG1 . THR A 1 121 ? 109.138 24.988  28.017  1.00 4.40  ? 121  THR A OG1 1 
ATOM   870   C CG2 . THR A 1 121 ? 110.393 23.609  26.481  1.00 4.74  ? 121  THR A CG2 1 
ATOM   871   N N   . THR A 1 122 ? 112.398 26.848  28.517  1.00 3.63  ? 122  THR A N   1 
ATOM   872   C CA  . THR A 1 122 ? 112.756 28.134  29.085  1.00 3.20  ? 122  THR A CA  1 
ATOM   873   C C   . THR A 1 122 ? 112.616 29.153  27.972  1.00 3.56  ? 122  THR A C   1 
ATOM   874   O O   . THR A 1 122 ? 112.575 28.836  26.789  1.00 2.54  ? 122  THR A O   1 
ATOM   875   C CB  . THR A 1 122 ? 114.223 28.248  29.565  1.00 3.49  ? 122  THR A CB  1 
ATOM   876   O OG1 . THR A 1 122 ? 115.128 28.127  28.445  1.00 3.24  ? 122  THR A OG1 1 
ATOM   877   C CG2 . THR A 1 122 ? 114.592 27.204  30.567  1.00 3.51  ? 122  THR A CG2 1 
ATOM   878   N N   . ILE A 1 123 ? 112.529 30.410  28.422  1.00 3.97  ? 123  ILE A N   1 
ATOM   879   C CA  . ILE A 1 123 ? 112.542 31.554  27.492  1.00 3.05  ? 123  ILE A CA  1 
ATOM   880   C C   . ILE A 1 123 ? 113.539 32.558  28.157  1.00 2.85  ? 123  ILE A C   1 
ATOM   881   O O   . ILE A 1 123 ? 113.779 32.539  29.358  1.00 2.08  ? 123  ILE A O   1 
ATOM   882   C CB  . ILE A 1 123 ? 111.144 32.126  27.231  1.00 3.23  ? 123  ILE A CB  1 
ATOM   883   C CG1 . ILE A 1 123 ? 110.556 32.741  28.512  1.00 3.37  ? 123  ILE A CG1 1 
ATOM   884   C CG2 . ILE A 1 123 ? 110.180 31.062  26.663  1.00 2.08  ? 123  ILE A CG2 1 
ATOM   885   C CD1 . ILE A 1 123 ? 109.183 33.363  28.290  1.00 3.24  ? 123  ILE A CD1 1 
ATOM   886   N N   . PRO A 1 124 ? 114.167 33.410  27.357  1.00 3.19  ? 124  PRO A N   1 
ATOM   887   C CA  . PRO A 1 124 ? 115.190 34.298  27.833  1.00 3.88  ? 124  PRO A CA  1 
ATOM   888   C C   . PRO A 1 124 ? 114.721 35.355  28.817  1.00 5.50  ? 124  PRO A C   1 
ATOM   889   O O   . PRO A 1 124 ? 113.548 35.738  28.810  1.00 5.90  ? 124  PRO A O   1 
ATOM   890   C CB  . PRO A 1 124 ? 115.666 35.024  26.561  1.00 3.13  ? 124  PRO A CB  1 
ATOM   891   C CG  . PRO A 1 124 ? 115.224 34.177  25.439  1.00 4.10  ? 124  PRO A CG  1 
ATOM   892   C CD  . PRO A 1 124 ? 113.935 33.516  25.894  1.00 3.14  ? 124  PRO A CD  1 
ATOM   893   N N   . PRO A 1 125 ? 115.651 35.867  29.621  1.00 5.03  ? 125  PRO A N   1 
ATOM   894   C CA  . PRO A 1 125 ? 115.356 36.951  30.530  1.00 4.27  ? 125  PRO A CA  1 
ATOM   895   C C   . PRO A 1 125 ? 114.866 38.119  29.678  1.00 3.47  ? 125  PRO A C   1 
ATOM   896   O O   . PRO A 1 125 ? 115.233 38.295  28.501  1.00 2.82  ? 125  PRO A O   1 
ATOM   897   C CB  . PRO A 1 125 ? 116.706 37.297  31.143  1.00 5.03  ? 125  PRO A CB  1 
ATOM   898   C CG  . PRO A 1 125 ? 117.499 36.010  31.039  1.00 6.10  ? 125  PRO A CG  1 
ATOM   899   C CD  . PRO A 1 125 ? 117.061 35.428  29.719  1.00 6.19  ? 125  PRO A CD  1 
ATOM   900   N N   . VAL A 1 126 ? 114.022 38.934  30.293  1.00 3.32  ? 126  VAL A N   1 
ATOM   901   C CA  . VAL A 1 126 ? 113.551 40.137  29.645  1.00 3.80  ? 126  VAL A CA  1 
ATOM   902   C C   . VAL A 1 126 ? 114.595 41.261  29.827  1.00 2.08  ? 126  VAL A C   1 
ATOM   903   O O   . VAL A 1 126 ? 115.130 41.340  30.933  1.00 3.93  ? 126  VAL A O   1 
ATOM   904   C CB  . VAL A 1 126 ? 112.239 40.573  30.380  1.00 5.15  ? 126  VAL A CB  1 
ATOM   905   C CG1 . VAL A 1 126 ? 111.546 41.738  29.661  1.00 4.65  ? 126  VAL A CG1 1 
ATOM   906   C CG2 . VAL A 1 126 ? 111.199 39.440  30.494  1.00 2.49  ? 126  VAL A CG2 1 
ATOM   907   N N   . PRO A 1 127 ? 114.672 42.176  28.894  1.00 4.02  ? 127  PRO A N   1 
ATOM   908   C CA  . PRO A 1 127 ? 115.494 43.383  29.062  1.00 4.46  ? 127  PRO A CA  1 
ATOM   909   C C   . PRO A 1 127 ? 115.064 44.124  30.313  1.00 6.27  ? 127  PRO A C   1 
ATOM   910   O O   . PRO A 1 127 ? 113.835 44.197  30.599  1.00 6.29  ? 127  PRO A O   1 
ATOM   911   C CB  . PRO A 1 127 ? 115.165 44.172  27.806  1.00 3.88  ? 127  PRO A CB  1 
ATOM   912   C CG  . PRO A 1 127 ? 114.899 43.117  26.793  1.00 5.95  ? 127  PRO A CG  1 
ATOM   913   C CD  . PRO A 1 127 ? 114.055 42.082  27.542  1.00 4.28  ? 127  PRO A CD  1 
ATOM   914   N N   . THR A 1 128 ? 115.949 44.611  31.174  1.00 4.02  ? 128  THR A N   1 
ATOM   915   C CA  . THR A 1 128 ? 115.541 45.267  32.397  1.00 3.84  ? 128  THR A CA  1 
ATOM   916   C C   . THR A 1 128 ? 114.916 46.625  32.060  1.00 2.92  ? 128  THR A C   1 
ATOM   917   O O   . THR A 1 128 ? 115.170 47.197  30.996  1.00 3.20  ? 128  THR A O   1 
ATOM   918   C CB  . THR A 1 128 ? 116.759 45.490  33.319  1.00 4.67  ? 128  THR A CB  1 
ATOM   919   O OG1 . THR A 1 128 ? 117.760 46.169  32.519  1.00 5.52  ? 128  THR A OG1 1 
ATOM   920   C CG2 . THR A 1 128 ? 117.228 44.145  33.839  1.00 5.65  ? 128  THR A CG2 1 
ATOM   921   N N   . LEU A 1 129 ? 114.270 47.233  33.027  1.00 3.09  ? 129  LEU A N   1 
ATOM   922   C CA  . LEU A 1 129 ? 113.641 48.540  32.822  1.00 4.44  ? 129  LEU A CA  1 
ATOM   923   C C   . LEU A 1 129 ? 114.571 49.660  32.380  1.00 3.61  ? 129  LEU A C   1 
ATOM   924   O O   . LEU A 1 129 ? 114.266 50.366  31.410  1.00 5.25  ? 129  LEU A O   1 
ATOM   925   C CB  . LEU A 1 129 ? 112.838 48.854  34.084  1.00 2.86  ? 129  LEU A CB  1 
ATOM   926   C CG  . LEU A 1 129 ? 111.963 50.129  33.929  1.00 5.27  ? 129  LEU A CG  1 
ATOM   927   C CD1 . LEU A 1 129 ? 110.841 50.086  34.942  1.00 4.74  ? 129  LEU A CD1 1 
ATOM   928   C CD2 . LEU A 1 129 ? 112.844 51.373  34.214  1.00 3.98  ? 129  LEU A CD2 1 
ATOM   929   N N   . PRO A 1 130 ? 115.787 49.754  32.908  1.00 5.88  ? 130  PRO A N   1 
ATOM   930   C CA  . PRO A 1 130 ? 116.725 50.806  32.518  1.00 6.33  ? 130  PRO A CA  1 
ATOM   931   C C   . PRO A 1 130 ? 117.449 50.590  31.208  1.00 6.89  ? 130  PRO A C   1 
ATOM   932   O O   . PRO A 1 130 ? 118.180 51.471  30.732  1.00 5.39  ? 130  PRO A O   1 
ATOM   933   C CB  . PRO A 1 130 ? 117.714 50.855  33.691  1.00 7.09  ? 130  PRO A CB  1 
ATOM   934   C CG  . PRO A 1 130 ? 116.966 50.197  34.824  1.00 6.68  ? 130  PRO A CG  1 
ATOM   935   C CD  . PRO A 1 130 ? 116.269 49.027  34.114  1.00 4.61  ? 130  PRO A CD  1 
ATOM   936   N N   . SER A 1 131 ? 117.316 49.427  30.554  1.00 5.17  ? 131  SER A N   1 
ATOM   937   C CA  . SER A 1 131 ? 118.072 49.091  29.395  1.00 4.97  ? 131  SER A CA  1 
ATOM   938   C C   . SER A 1 131 ? 117.620 49.808  28.145  1.00 4.08  ? 131  SER A C   1 
ATOM   939   O O   . SER A 1 131 ? 116.457 50.128  27.923  1.00 4.13  ? 131  SER A O   1 
ATOM   940   C CB  . SER A 1 131 ? 118.068 47.563  29.115  1.00 6.08  ? 131  SER A CB  1 
ATOM   941   O OG  . SER A 1 131 ? 116.740 47.109  28.706  1.00 5.07  ? 131  SER A OG  1 
ATOM   942   N N   . PRO A 1 132 ? 118.564 49.961  27.218  1.00 5.59  ? 132  PRO A N   1 
ATOM   943   C CA  . PRO A 1 132 ? 118.256 50.524  25.915  1.00 4.87  ? 132  PRO A CA  1 
ATOM   944   C C   . PRO A 1 132 ? 117.276 49.624  25.156  1.00 4.75  ? 132  PRO A C   1 
ATOM   945   O O   . PRO A 1 132 ? 116.491 50.073  24.305  1.00 3.93  ? 132  PRO A O   1 
ATOM   946   C CB  . PRO A 1 132 ? 119.584 50.628  25.181  1.00 5.57  ? 132  PRO A CB  1 
ATOM   947   C CG  . PRO A 1 132 ? 120.570 49.902  26.014  1.00 6.88  ? 132  PRO A CG  1 
ATOM   948   C CD  . PRO A 1 132 ? 119.997 49.632  27.370  1.00 5.83  ? 132  PRO A CD  1 
ATOM   949   N N   . GLU A 1 133 ? 117.388 48.296  25.343  1.00 3.48  ? 133  GLU A N   1 
ATOM   950   C CA  . GLU A 1 133 ? 116.502 47.389  24.640  1.00 4.37  ? 133  GLU A CA  1 
ATOM   951   C C   . GLU A 1 133 ? 115.050 47.575  25.108  1.00 2.96  ? 133  GLU A C   1 
ATOM   952   O O   . GLU A 1 133 ? 114.177 47.607  24.260  1.00 2.08  ? 133  GLU A O   1 
ATOM   953   C CB  . GLU A 1 133 ? 116.917 45.926  24.823  1.00 6.08  ? 133  GLU A CB  1 
ATOM   954   C CG  . GLU A 1 133 ? 118.185 45.490  24.117  1.00 7.53  ? 133  GLU A CG  1 
ATOM   955   C CD  . GLU A 1 133 ? 119.430 46.084  24.757  1.00 8.21  ? 133  GLU A CD  1 
ATOM   956   O OE1 . GLU A 1 133 ? 119.538 46.360  25.947  1.00 10.02 ? 133  GLU A OE1 1 
ATOM   957   O OE2 . GLU A 1 133 ? 120.369 46.272  23.981  1.00 11.25 ? 133  GLU A OE2 1 
ATOM   958   N N   . LEU A 1 134 ? 114.798 47.599  26.408  1.00 3.61  ? 134  LEU A N   1 
ATOM   959   C CA  . LEU A 1 134 ? 113.453 47.789  26.946  1.00 3.22  ? 134  LEU A CA  1 
ATOM   960   C C   . LEU A 1 134 ? 112.910 49.113  26.387  1.00 2.21  ? 134  LEU A C   1 
ATOM   961   O O   . LEU A 1 134 ? 111.751 49.167  25.909  1.00 2.08  ? 134  LEU A O   1 
ATOM   962   C CB  . LEU A 1 134 ? 113.260 47.780  28.472  1.00 3.02  ? 134  LEU A CB  1 
ATOM   963   C CG  . LEU A 1 134 ? 111.751 48.128  28.671  1.00 7.89  ? 134  LEU A CG  1 
ATOM   964   C CD1 . LEU A 1 134 ? 110.932 46.855  28.777  1.00 4.68  ? 134  LEU A CD1 1 
ATOM   965   C CD2 . LEU A 1 134 ? 111.457 49.232  29.628  1.00 5.77  ? 134  LEU A CD2 1 
ATOM   966   N N   . ALA A 1 135 ? 113.715 50.179  26.337  1.00 2.46  ? 135  ALA A N   1 
ATOM   967   C CA  . ALA A 1 135 ? 113.276 51.444  25.773  1.00 2.46  ? 135  ALA A CA  1 
ATOM   968   C C   . ALA A 1 135 ? 112.779 51.341  24.354  1.00 4.68  ? 135  ALA A C   1 
ATOM   969   O O   . ALA A 1 135 ? 111.727 51.939  24.058  1.00 3.10  ? 135  ALA A O   1 
ATOM   970   C CB  . ALA A 1 135 ? 114.450 52.445  25.804  1.00 3.49  ? 135  ALA A CB  1 
ATOM   971   N N   . ALA A 1 136 ? 113.537 50.665  23.494  1.00 3.72  ? 136  ALA A N   1 
ATOM   972   C CA  . ALA A 1 136 ? 113.128 50.554  22.101  1.00 4.02  ? 136  ALA A CA  1 
ATOM   973   C C   . ALA A 1 136 ? 111.898 49.637  21.954  1.00 4.53  ? 136  ALA A C   1 
ATOM   974   O O   . ALA A 1 136 ? 111.128 49.783  21.017  1.00 2.35  ? 136  ALA A O   1 
ATOM   975   C CB  . ALA A 1 136 ? 114.278 49.971  21.269  1.00 3.55  ? 136  ALA A CB  1 
ATOM   976   N N   . GLN A 1 137 ? 111.836 48.603  22.762  1.00 5.24  ? 137  GLN A N   1 
ATOM   977   C CA  . GLN A 1 137 ? 110.694 47.658  22.772  1.00 6.02  ? 137  GLN A CA  1 
ATOM   978   C C   . GLN A 1 137 ? 109.437 48.449  23.170  1.00 4.26  ? 137  GLN A C   1 
ATOM   979   O O   . GLN A 1 137 ? 108.445 48.429  22.433  1.00 5.08  ? 137  GLN A O   1 
ATOM   980   C CB  . GLN A 1 137 ? 110.966 46.574  23.803  1.00 3.25  ? 137  GLN A CB  1 
ATOM   981   C CG  . GLN A 1 137 ? 112.037 45.552  23.492  1.00 4.44  ? 137  GLN A CG  1 
ATOM   982   C CD  . GLN A 1 137 ? 111.522 44.321  22.775  1.00 5.82  ? 137  GLN A CD  1 
ATOM   983   O OE1 . GLN A 1 137 ? 110.311 44.084  22.610  1.00 4.12  ? 137  GLN A OE1 1 
ATOM   984   N NE2 . GLN A 1 137 ? 112.451 43.502  22.313  1.00 6.59  ? 137  GLN A NE2 1 
ATOM   985   N N   . LEU A 1 138 ? 109.475 49.219  24.231  1.00 4.87  ? 138  LEU A N   1 
ATOM   986   C CA  . LEU A 1 138 ? 108.382 50.087  24.681  1.00 3.86  ? 138  LEU A CA  1 
ATOM   987   C C   . LEU A 1 138 ? 108.084 51.135  23.661  1.00 4.97  ? 138  LEU A C   1 
ATOM   988   O O   . LEU A 1 138 ? 106.895 51.261  23.236  1.00 3.72  ? 138  LEU A O   1 
ATOM   989   C CB  . LEU A 1 138 ? 108.568 50.650  26.083  1.00 3.32  ? 138  LEU A CB  1 
ATOM   990   C CG  . LEU A 1 138 ? 107.453 51.496  26.709  1.00 4.33  ? 138  LEU A CG  1 
ATOM   991   C CD1 . LEU A 1 138 ? 106.113 50.746  26.676  1.00 4.36  ? 138  LEU A CD1 1 
ATOM   992   C CD2 . LEU A 1 138 ? 107.778 51.818  28.161  1.00 3.79  ? 138  LEU A CD2 1 
ATOM   993   N N   . ALA A 1 139 ? 109.059 51.839  23.061  1.00 2.42  ? 139  ALA A N   1 
ATOM   994   C CA  . ALA A 1 139 ? 108.758 52.805  22.016  1.00 4.05  ? 139  ALA A CA  1 
ATOM   995   C C   . ALA A 1 139 ? 108.025 52.148  20.861  1.00 4.89  ? 139  ALA A C   1 
ATOM   996   O O   . ALA A 1 139 ? 107.133 52.781  20.239  1.00 4.26  ? 139  ALA A O   1 
ATOM   997   C CB  . ALA A 1 139 ? 110.039 53.457  21.452  1.00 2.82  ? 139  ALA A CB  1 
ATOM   998   N N   . GLU A 1 140 ? 108.431 50.929  20.476  1.00 2.79  ? 140  GLU A N   1 
ATOM   999   C CA  . GLU A 1 140 ? 107.773 50.263  19.340  1.00 3.47  ? 140  GLU A CA  1 
ATOM   1000  C C   . GLU A 1 140 ? 106.272 50.049  19.620  1.00 4.00  ? 140  GLU A C   1 
ATOM   1001  O O   . GLU A 1 140 ? 105.438 50.227  18.737  1.00 2.50  ? 140  GLU A O   1 
ATOM   1002  C CB  . GLU A 1 140 ? 108.463 48.932  18.959  1.00 3.06  ? 140  GLU A CB  1 
ATOM   1003  C CG  . GLU A 1 140 ? 107.822 48.346  17.698  1.00 3.82  ? 140  GLU A CG  1 
ATOM   1004  C CD  . GLU A 1 140 ? 108.448 47.036  17.242  1.00 3.67  ? 140  GLU A CD  1 
ATOM   1005  O OE1 . GLU A 1 140 ? 108.857 46.228  18.100  1.00 4.08  ? 140  GLU A OE1 1 
ATOM   1006  O OE2 . GLU A 1 140 ? 108.560 46.807  16.039  1.00 5.98  ? 140  GLU A OE2 1 
ATOM   1007  N N   . VAL A 1 141 ? 105.875 49.694  20.830  1.00 5.58  ? 141  VAL A N   1 
ATOM   1008  C CA  . VAL A 1 141 ? 104.467 49.558  21.226  1.00 5.79  ? 141  VAL A CA  1 
ATOM   1009  C C   . VAL A 1 141 ? 103.781 50.953  21.132  1.00 6.85  ? 141  VAL A C   1 
ATOM   1010  O O   . VAL A 1 141 ? 102.674 51.099  20.607  1.00 4.28  ? 141  VAL A O   1 
ATOM   1011  C CB  . VAL A 1 141 ? 104.359 48.978  22.632  1.00 6.63  ? 141  VAL A CB  1 
ATOM   1012  C CG1 . VAL A 1 141 ? 102.891 48.727  23.033  1.00 7.87  ? 141  VAL A CG1 1 
ATOM   1013  C CG2 . VAL A 1 141 ? 105.087 47.623  22.785  1.00 5.25  ? 141  VAL A CG2 1 
ATOM   1014  N N   . TYR A 1 142 ? 104.479 52.024  21.578  1.00 4.12  ? 142  TYR A N   1 
ATOM   1015  C CA  . TYR A 1 142 ? 103.913 53.365  21.406  1.00 2.08  ? 142  TYR A CA  1 
ATOM   1016  C C   . TYR A 1 142 ? 103.735 53.700  19.958  1.00 3.40  ? 142  TYR A C   1 
ATOM   1017  O O   . TYR A 1 142 ? 102.673 54.207  19.538  1.00 6.14  ? 142  TYR A O   1 
ATOM   1018  C CB  . TYR A 1 142 ? 104.772 54.450  22.085  1.00 2.27  ? 142  TYR A CB  1 
ATOM   1019  C CG  . TYR A 1 142 ? 104.504 54.723  23.527  1.00 3.21  ? 142  TYR A CG  1 
ATOM   1020  C CD1 . TYR A 1 142 ? 103.548 55.667  23.892  1.00 2.65  ? 142  TYR A CD1 1 
ATOM   1021  C CD2 . TYR A 1 142 ? 105.200 54.085  24.532  1.00 3.14  ? 142  TYR A CD2 1 
ATOM   1022  C CE1 . TYR A 1 142 ? 103.281 55.968  25.220  1.00 2.61  ? 142  TYR A CE1 1 
ATOM   1023  C CE2 . TYR A 1 142 ? 104.964 54.356  25.867  1.00 3.72  ? 142  TYR A CE2 1 
ATOM   1024  C CZ  . TYR A 1 142 ? 103.998 55.315  26.174  1.00 3.51  ? 142  TYR A CZ  1 
ATOM   1025  O OH  . TYR A 1 142 ? 103.778 55.531  27.497  1.00 2.54  ? 142  TYR A OH  1 
ATOM   1026  N N   . TRP A 1 143 ? 104.693 53.462  19.049  1.00 3.96  ? 143  TRP A N   1 
ATOM   1027  C CA  . TRP A 1 143 ? 104.557 53.815  17.660  1.00 4.68  ? 143  TRP A CA  1 
ATOM   1028  C C   . TRP A 1 143 ? 103.454 52.980  17.004  1.00 5.96  ? 143  TRP A C   1 
ATOM   1029  O O   . TRP A 1 143 ? 102.790 53.464  16.080  1.00 4.68  ? 143  TRP A O   1 
ATOM   1030  C CB  . TRP A 1 143 ? 105.857 53.609  16.849  1.00 5.42  ? 143  TRP A CB  1 
ATOM   1031  C CG  . TRP A 1 143 ? 106.849 54.740  17.020  1.00 5.71  ? 143  TRP A CG  1 
ATOM   1032  C CD1 . TRP A 1 143 ? 108.010 54.726  17.734  1.00 5.82  ? 143  TRP A CD1 1 
ATOM   1033  C CD2 . TRP A 1 143 ? 106.705 56.050  16.469  1.00 6.09  ? 143  TRP A CD2 1 
ATOM   1034  N NE1 . TRP A 1 143 ? 108.612 55.973  17.635  1.00 7.21  ? 143  TRP A NE1 1 
ATOM   1035  C CE2 . TRP A 1 143 ? 107.830 56.788  16.853  1.00 6.87  ? 143  TRP A CE2 1 
ATOM   1036  C CE3 . TRP A 1 143 ? 105.695 56.672  15.709  1.00 5.87  ? 143  TRP A CE3 1 
ATOM   1037  C CZ2 . TRP A 1 143 ? 107.992 58.132  16.488  1.00 6.69  ? 143  TRP A CZ2 1 
ATOM   1038  C CZ3 . TRP A 1 143 ? 105.862 58.001  15.332  1.00 6.43  ? 143  TRP A CZ3 1 
ATOM   1039  C CH2 . TRP A 1 143 ? 107.010 58.707  15.726  1.00 6.03  ? 143  TRP A CH2 1 
ATOM   1040  N N   . MET A 1 144 ? 103.271 51.722  17.432  1.00 2.85  ? 144  MET A N   1 
ATOM   1041  C CA  . MET A 1 144 ? 102.178 50.912  16.846  1.00 4.68  ? 144  MET A CA  1 
ATOM   1042  C C   . MET A 1 144 ? 100.830 51.598  17.148  1.00 4.30  ? 144  MET A C   1 
ATOM   1043  O O   . MET A 1 144 ? 99.968  51.675  16.269  1.00 4.08  ? 144  MET A O   1 
ATOM   1044  C CB  . MET A 1 144 ? 102.133 49.483  17.379  1.00 3.72  ? 144  MET A CB  1 
ATOM   1045  C CG  . MET A 1 144 ? 103.130 48.519  16.724  1.00 3.71  ? 144  MET A CG  1 
ATOM   1046  S SD  . MET A 1 144 ? 103.179 46.959  17.669  1.00 3.04  ? 144  MET A SD  1 
ATOM   1047  C CE  . MET A 1 144 ? 103.996 45.946  16.414  1.00 4.15  ? 144  MET A CE  1 
ATOM   1048  N N   . ALA A 1 145 ? 100.684 52.076  18.358  1.00 3.82  ? 145  ALA A N   1 
ATOM   1049  C CA  . ALA A 1 145 ? 99.491  52.767  18.793  1.00 4.42  ? 145  ALA A CA  1 
ATOM   1050  C C   . ALA A 1 145 ? 99.250  54.042  17.971  1.00 3.36  ? 145  ALA A C   1 
ATOM   1051  O O   . ALA A 1 145 ? 98.196  54.223  17.412  1.00 3.79  ? 145  ALA A O   1 
ATOM   1052  C CB  . ALA A 1 145 ? 99.563  53.137  20.253  1.00 2.53  ? 145  ALA A CB  1 
ATOM   1053  N N   . LEU A 1 146 ? 100.318 54.851  17.786  1.00 4.48  ? 146  LEU A N   1 
ATOM   1054  C CA  . LEU A 1 146 ? 100.198 56.011  16.911  1.00 4.85  ? 146  LEU A CA  1 
ATOM   1055  C C   . LEU A 1 146 ? 99.921  55.597  15.487  1.00 3.90  ? 146  LEU A C   1 
ATOM   1056  O O   . LEU A 1 146 ? 99.285  56.377  14.778  1.00 5.09  ? 146  LEU A O   1 
ATOM   1057  C CB  . LEU A 1 146 ? 101.478 56.877  16.911  1.00 5.25  ? 146  LEU A CB  1 
ATOM   1058  C CG  . LEU A 1 146 ? 101.839 57.455  18.271  1.00 7.74  ? 146  LEU A CG  1 
ATOM   1059  C CD1 . LEU A 1 146 ? 103.146 58.257  18.231  1.00 8.09  ? 146  LEU A CD1 1 
ATOM   1060  C CD2 . LEU A 1 146 ? 100.683 58.320  18.765  1.00 7.44  ? 146  LEU A CD2 1 
ATOM   1061  N N   . ALA A 1 147 ? 100.390 54.442  15.007  1.00 4.26  ? 147  ALA A N   1 
ATOM   1062  C CA  . ALA A 1 147 ? 100.142 54.104  13.601  1.00 4.80  ? 147  ALA A CA  1 
ATOM   1063  C C   . ALA A 1 147 ? 98.903  53.255  13.333  1.00 4.69  ? 147  ALA A C   1 
ATOM   1064  O O   . ALA A 1 147 ? 98.668  52.832  12.198  1.00 3.02  ? 147  ALA A O   1 
ATOM   1065  C CB  . ALA A 1 147 ? 101.361 53.352  13.044  1.00 4.71  ? 147  ALA A CB  1 
ATOM   1066  N N   . ARG A 1 148 ? 98.092  52.968  14.332  1.00 3.58  ? 148  ARG A N   1 
ATOM   1067  C CA  . ARG A 1 148 ? 96.920  52.125  14.217  1.00 4.52  ? 148  ARG A CA  1 
ATOM   1068  C C   . ARG A 1 148 ? 96.009  52.367  13.038  1.00 5.70  ? 148  ARG A C   1 
ATOM   1069  O O   . ARG A 1 148 ? 95.534  51.399  12.420  1.00 4.49  ? 148  ARG A O   1 
ATOM   1070  C CB  . ARG A 1 148 ? 96.060  52.278  15.509  1.00 2.82  ? 148  ARG A CB  1 
ATOM   1071  C CG  . ARG A 1 148 ? 96.673  51.429  16.620  1.00 3.43  ? 148  ARG A CG  1 
ATOM   1072  C CD  . ARG A 1 148 ? 95.913  51.579  17.934  1.00 3.62  ? 148  ARG A CD  1 
ATOM   1073  N NE  . ARG A 1 148 ? 96.587  50.946  19.039  1.00 2.98  ? 148  ARG A NE  1 
ATOM   1074  C CZ  . ARG A 1 148 ? 96.655  51.286  20.312  1.00 3.85  ? 148  ARG A CZ  1 
ATOM   1075  N NH1 . ARG A 1 148 ? 96.017  52.376  20.729  1.00 3.78  ? 148  ARG A NH1 1 
ATOM   1076  N NH2 . ARG A 1 148 ? 97.376  50.583  21.163  1.00 3.75  ? 148  ARG A NH2 1 
ATOM   1077  N N   . ASP A 1 149 ? 95.747  53.633  12.676  1.00 5.67  ? 149  ASP A N   1 
ATOM   1078  C CA  . ASP A 1 149 ? 94.837  53.910  11.583  1.00 6.35  ? 149  ASP A CA  1 
ATOM   1079  C C   . ASP A 1 149 ? 95.531  54.183  10.263  1.00 6.74  ? 149  ASP A C   1 
ATOM   1080  O O   . ASP A 1 149 ? 94.859  54.594  9.313   1.00 5.78  ? 149  ASP A O   1 
ATOM   1081  C CB  . ASP A 1 149 ? 93.876  55.059  11.970  1.00 6.57  ? 149  ASP A CB  1 
ATOM   1082  C CG  . ASP A 1 149 ? 93.198  54.709  13.276  1.00 7.19  ? 149  ASP A CG  1 
ATOM   1083  O OD1 . ASP A 1 149 ? 92.549  53.624  13.278  1.00 6.80  ? 149  ASP A OD1 1 
ATOM   1084  O OD2 . ASP A 1 149 ? 93.313  55.416  14.301  1.00 7.22  ? 149  ASP A OD2 1 
ATOM   1085  N N   . VAL A 1 150 ? 96.813  53.864  10.135  1.00 4.65  ? 150  VAL A N   1 
ATOM   1086  C CA  . VAL A 1 150 ? 97.430  53.974  8.816   1.00 3.51  ? 150  VAL A CA  1 
ATOM   1087  C C   . VAL A 1 150 ? 97.249  52.658  8.069   1.00 5.87  ? 150  VAL A C   1 
ATOM   1088  O O   . VAL A 1 150 ? 97.750  51.618  8.515   1.00 6.42  ? 150  VAL A O   1 
ATOM   1089  C CB  . VAL A 1 150 ? 98.949  54.241  8.969   1.00 4.70  ? 150  VAL A CB  1 
ATOM   1090  C CG1 . VAL A 1 150 ? 99.553  54.351  7.579   1.00 3.59  ? 150  VAL A CG1 1 
ATOM   1091  C CG2 . VAL A 1 150 ? 99.174  55.496  9.821   1.00 3.34  ? 150  VAL A CG2 1 
ATOM   1092  N N   . PRO A 1 151 ? 96.690  52.664  6.869   1.00 6.77  ? 151  PRO A N   1 
ATOM   1093  C CA  . PRO A 1 151 ? 96.524  51.463  6.069   1.00 7.15  ? 151  PRO A CA  1 
ATOM   1094  C C   . PRO A 1 151 ? 97.880  50.859  5.718   1.00 8.79  ? 151  PRO A C   1 
ATOM   1095  O O   . PRO A 1 151 ? 98.806  51.603  5.336   1.00 7.57  ? 151  PRO A O   1 
ATOM   1096  C CB  . PRO A 1 151 ? 95.786  51.941  4.829   1.00 7.29  ? 151  PRO A CB  1 
ATOM   1097  C CG  . PRO A 1 151 ? 95.171  53.252  5.182   1.00 7.92  ? 151  PRO A CG  1 
ATOM   1098  C CD  . PRO A 1 151 ? 96.095  53.866  6.224   1.00 6.54  ? 151  PRO A CD  1 
ATOM   1099  N N   . PHE A 1 152 ? 98.050  49.532  5.794   1.00 6.26  ? 152  PHE A N   1 
ATOM   1100  C CA  . PHE A 1 152 ? 99.345  48.931  5.541   1.00 7.54  ? 152  PHE A CA  1 
ATOM   1101  C C   . PHE A 1 152 ? 100.033 49.317  4.243   1.00 7.81  ? 152  PHE A C   1 
ATOM   1102  O O   . PHE A 1 152 ? 101.260 49.516  4.205   1.00 8.88  ? 152  PHE A O   1 
ATOM   1103  C CB  . PHE A 1 152 ? 99.287  47.392  5.596   1.00 6.48  ? 152  PHE A CB  1 
ATOM   1104  C CG  . PHE A 1 152 ? 98.980  46.904  6.985   1.00 6.99  ? 152  PHE A CG  1 
ATOM   1105  C CD1 . PHE A 1 152 ? 99.835  47.173  8.034   1.00 4.47  ? 152  PHE A CD1 1 
ATOM   1106  C CD2 . PHE A 1 152 ? 97.828  46.131  7.219   1.00 6.08  ? 152  PHE A CD2 1 
ATOM   1107  C CE1 . PHE A 1 152 ? 99.598  46.727  9.315   1.00 6.47  ? 152  PHE A CE1 1 
ATOM   1108  C CE2 . PHE A 1 152 ? 97.596  45.676  8.494   1.00 5.93  ? 152  PHE A CE2 1 
ATOM   1109  C CZ  . PHE A 1 152 ? 98.467  45.946  9.545   1.00 6.45  ? 152  PHE A CZ  1 
ATOM   1110  N N   . MET A 1 153 ? 99.321  49.506  3.160   1.00 8.78  ? 153  MET A N   1 
ATOM   1111  C CA  . MET A 1 153 ? 99.866  49.887  1.890   1.00 11.65 ? 153  MET A CA  1 
ATOM   1112  C C   . MET A 1 153 ? 100.270 51.363  1.837   1.00 10.44 ? 153  MET A C   1 
ATOM   1113  O O   . MET A 1 153 ? 100.851 51.764  0.844   1.00 9.99  ? 153  MET A O   1 
ATOM   1114  C CB  . MET A 1 153 ? 98.896  49.615  0.728   1.00 12.92 ? 153  MET A CB  1 
ATOM   1115  C CG  . MET A 1 153 ? 98.595  48.138  0.652   1.00 15.06 ? 153  MET A CG  1 
ATOM   1116  S SD  . MET A 1 153 ? 100.094 47.171  0.375   1.00 22.73 ? 153  MET A SD  1 
ATOM   1117  C CE  . MET A 1 153 ? 100.940 47.810  -0.913  1.00 9.84  ? 153  MET A CE  1 
ATOM   1118  N N   . GLN A 1 154 ? 99.974  52.117  2.875   1.00 9.06  ? 154  GLN A N   1 
ATOM   1119  C CA  . GLN A 1 154 ? 100.376 53.525  2.915   1.00 10.35 ? 154  GLN A CA  1 
ATOM   1120  C C   . GLN A 1 154 ? 101.541 53.695  3.878   1.00 8.82  ? 154  GLN A C   1 
ATOM   1121  O O   . GLN A 1 154 ? 101.897 54.841  4.163   1.00 7.23  ? 154  GLN A O   1 
ATOM   1122  C CB  . GLN A 1 154 ? 99.180  54.384  3.328   1.00 10.02 ? 154  GLN A CB  1 
ATOM   1123  C CG  . GLN A 1 154 ? 98.249  54.742  2.165   1.00 12.92 ? 154  GLN A CG  1 
ATOM   1124  C CD  . GLN A 1 154 ? 96.939  55.325  2.668   1.00 14.36 ? 154  GLN A CD  1 
ATOM   1125  O OE1 . GLN A 1 154 ? 96.912  56.034  3.672   1.00 15.06 ? 154  GLN A OE1 1 
ATOM   1126  N NE2 . GLN A 1 154 ? 95.795  55.035  2.026   1.00 15.35 ? 154  GLN A NE2 1 
ATOM   1127  N N   . TYR A 1 155 ? 102.137 52.578  4.343   1.00 7.08  ? 155  TYR A N   1 
ATOM   1128  C CA  . TYR A 1 155 ? 103.198 52.697  5.337   1.00 8.69  ? 155  TYR A CA  1 
ATOM   1129  C C   . TYR A 1 155 ? 104.386 53.510  4.814   1.00 8.19  ? 155  TYR A C   1 
ATOM   1130  O O   . TYR A 1 155 ? 104.955 54.283  5.597   1.00 9.55  ? 155  TYR A O   1 
ATOM   1131  C CB  . TYR A 1 155 ? 103.702 51.336  5.862   1.00 6.06  ? 155  TYR A CB  1 
ATOM   1132  C CG  . TYR A 1 155 ? 102.979 50.839  7.104   1.00 4.82  ? 155  TYR A CG  1 
ATOM   1133  C CD1 . TYR A 1 155 ? 101.652 51.158  7.371   1.00 5.16  ? 155  TYR A CD1 1 
ATOM   1134  C CD2 . TYR A 1 155 ? 103.631 50.023  8.009   1.00 5.14  ? 155  TYR A CD2 1 
ATOM   1135  C CE1 . TYR A 1 155 ? 101.023 50.727  8.532   1.00 4.66  ? 155  TYR A CE1 1 
ATOM   1136  C CE2 . TYR A 1 155 ? 103.038 49.566  9.171   1.00 5.04  ? 155  TYR A CE2 1 
ATOM   1137  C CZ  . TYR A 1 155 ? 101.722 49.917  9.412   1.00 4.44  ? 155  TYR A CZ  1 
ATOM   1138  O OH  . TYR A 1 155 ? 101.116 49.484  10.557  1.00 5.48  ? 155  TYR A OH  1 
ATOM   1139  N N   . GLY A 1 156 ? 104.688 53.351  3.537   1.00 9.87  ? 156  GLY A N   1 
ATOM   1140  C CA  . GLY A 1 156 ? 105.823 54.069  2.956   1.00 10.95 ? 156  GLY A CA  1 
ATOM   1141  C C   . GLY A 1 156 ? 105.563 55.546  2.745   1.00 10.97 ? 156  GLY A C   1 
ATOM   1142  O O   . GLY A 1 156 ? 106.535 56.308  2.496   1.00 12.30 ? 156  GLY A O   1 
ATOM   1143  N N   . THR A 1 157 ? 104.309 56.011  2.811   1.00 9.59  ? 157  THR A N   1 
ATOM   1144  C CA  . THR A 1 157 ? 104.094 57.425  2.518   1.00 10.89 ? 157  THR A CA  1 
ATOM   1145  C C   . THR A 1 157 ? 103.454 58.201  3.633   1.00 10.97 ? 157  THR A C   1 
ATOM   1146  O O   . THR A 1 157 ? 103.420 59.442  3.544   1.00 13.21 ? 157  THR A O   1 
ATOM   1147  C CB  . THR A 1 157 ? 103.275 57.610  1.221   1.00 11.35 ? 157  THR A CB  1 
ATOM   1148  O OG1 . THR A 1 157 ? 101.973 57.034  1.453   1.00 11.36 ? 157  THR A OG1 1 
ATOM   1149  C CG2 . THR A 1 157 ? 103.912 56.941  0.031   1.00 9.79  ? 157  THR A CG2 1 
ATOM   1150  N N   . ASP A 1 158 ? 102.902 57.541  4.649   1.00 9.79  ? 158  ASP A N   1 
ATOM   1151  C CA  . ASP A 1 158 ? 102.257 58.272  5.740   1.00 7.66  ? 158  ASP A CA  1 
ATOM   1152  C C   . ASP A 1 158 ? 103.329 58.798  6.691   1.00 8.30  ? 158  ASP A C   1 
ATOM   1153  O O   . ASP A 1 158 ? 104.246 58.100  7.129   1.00 6.31  ? 158  ASP A O   1 
ATOM   1154  C CB  . ASP A 1 158 ? 101.308 57.372  6.507   1.00 9.17  ? 158  ASP A CB  1 
ATOM   1155  C CG  . ASP A 1 158 ? 100.354 58.082  7.427   1.00 8.09  ? 158  ASP A CG  1 
ATOM   1156  O OD1 . ASP A 1 158 ? 100.731 58.550  8.517   1.00 8.29  ? 158  ASP A OD1 1 
ATOM   1157  O OD2 . ASP A 1 158 ? 99.177  58.173  7.006   1.00 8.84  ? 158  ASP A OD2 1 
ATOM   1158  N N   . ASP A 1 159 ? 103.130 60.025  7.135   1.00 6.81  ? 159  ASP A N   1 
ATOM   1159  C CA  . ASP A 1 159 ? 104.052 60.704  8.034   1.00 7.64  ? 159  ASP A CA  1 
ATOM   1160  C C   . ASP A 1 159 ? 104.352 59.897  9.279   1.00 7.38  ? 159  ASP A C   1 
ATOM   1161  O O   . ASP A 1 159 ? 105.485 59.896  9.735   1.00 6.03  ? 159  ASP A O   1 
ATOM   1162  C CB  . ASP A 1 159 ? 103.443 62.059  8.447   1.00 8.30  ? 159  ASP A CB  1 
ATOM   1163  C CG  . ASP A 1 159 ? 104.249 62.738  9.543   1.00 10.42 ? 159  ASP A CG  1 
ATOM   1164  O OD1 . ASP A 1 159 ? 105.479 62.927  9.390   1.00 9.82  ? 159  ASP A OD1 1 
ATOM   1165  O OD2 . ASP A 1 159 ? 103.656 63.069  10.594  1.00 12.02 ? 159  ASP A OD2 1 
ATOM   1166  N N   . ILE A 1 160 ? 103.322 59.308  9.893   1.00 7.36  ? 160  ILE A N   1 
ATOM   1167  C CA  . ILE A 1 160 ? 103.489 58.568  11.136  1.00 5.93  ? 160  ILE A CA  1 
ATOM   1168  C C   . ILE A 1 160 ? 104.400 57.363  11.021  1.00 6.46  ? 160  ILE A C   1 
ATOM   1169  O O   . ILE A 1 160 ? 105.216 57.118  11.908  1.00 6.07  ? 160  ILE A O   1 
ATOM   1170  C CB  . ILE A 1 160 ? 102.112 58.082  11.644  1.00 7.69  ? 160  ILE A CB  1 
ATOM   1171  C CG1 . ILE A 1 160 ? 101.164 59.255  11.961  1.00 4.58  ? 160  ILE A CG1 1 
ATOM   1172  C CG2 . ILE A 1 160 ? 102.241 57.184  12.867  1.00 5.21  ? 160  ILE A CG2 1 
ATOM   1173  C CD1 . ILE A 1 160 ? 99.714  58.819  11.643  1.00 8.38  ? 160  ILE A CD1 1 
ATOM   1174  N N   . THR A 1 161 ? 104.245 56.545  9.983   1.00 6.07  ? 161  THR A N   1 
ATOM   1175  C CA  . THR A 1 161 ? 105.083 55.374  9.821   1.00 5.42  ? 161  THR A CA  1 
ATOM   1176  C C   . THR A 1 161 ? 106.437 55.694  9.180   1.00 6.88  ? 161  THR A C   1 
ATOM   1177  O O   . THR A 1 161 ? 107.442 55.040  9.482   1.00 5.30  ? 161  THR A O   1 
ATOM   1178  C CB  . THR A 1 161 ? 104.318 54.324  8.998   1.00 4.94  ? 161  THR A CB  1 
ATOM   1179  O OG1 . THR A 1 161 ? 103.834 54.923  7.797   1.00 2.97  ? 161  THR A OG1 1 
ATOM   1180  C CG2 . THR A 1 161 ? 103.153 53.744  9.800   1.00 4.71  ? 161  THR A CG2 1 
ATOM   1181  N N   . VAL A 1 162 ? 106.501 56.720  8.314   1.00 7.91  ? 162  VAL A N   1 
ATOM   1182  C CA  . VAL A 1 162 ? 107.830 57.126  7.779   1.00 7.34  ? 162  VAL A CA  1 
ATOM   1183  C C   . VAL A 1 162 ? 108.625 57.633  8.978   1.00 7.16  ? 162  VAL A C   1 
ATOM   1184  O O   . VAL A 1 162 ? 109.783 57.238  9.144   1.00 7.51  ? 162  VAL A O   1 
ATOM   1185  C CB  . VAL A 1 162 ? 107.670 58.141  6.656   1.00 8.75  ? 162  VAL A CB  1 
ATOM   1186  C CG1 . VAL A 1 162 ? 108.955 58.864  6.296   1.00 9.42  ? 162  VAL A CG1 1 
ATOM   1187  C CG2 . VAL A 1 162 ? 107.099 57.458  5.401   1.00 7.28  ? 162  VAL A CG2 1 
ATOM   1188  N N   . THR A 1 163 ? 108.008 58.369  9.905   1.00 7.34  ? 163  THR A N   1 
ATOM   1189  C CA  . THR A 1 163 ? 108.684 58.850  11.098  1.00 6.31  ? 163  THR A CA  1 
ATOM   1190  C C   . THR A 1 163 ? 109.029 57.741  12.081  1.00 6.79  ? 163  THR A C   1 
ATOM   1191  O O   . THR A 1 163 ? 110.137 57.659  12.649  1.00 3.86  ? 163  THR A O   1 
ATOM   1192  C CB  . THR A 1 163 ? 107.910 59.989  11.794  1.00 7.96  ? 163  THR A CB  1 
ATOM   1193  O OG1 . THR A 1 163 ? 107.766 61.087  10.850  1.00 7.24  ? 163  THR A OG1 1 
ATOM   1194  C CG2 . THR A 1 163 ? 108.637 60.469  13.033  1.00 5.18  ? 163  THR A CG2 1 
ATOM   1195  N N   . ALA A 1 164 ? 108.070 56.823  12.321  1.00 3.67  ? 164  ALA A N   1 
ATOM   1196  C CA  . ALA A 1 164 ? 108.314 55.708  13.206  1.00 4.86  ? 164  ALA A CA  1 
ATOM   1197  C C   . ALA A 1 164 ? 109.572 54.934  12.798  1.00 4.28  ? 164  ALA A C   1 
ATOM   1198  O O   . ALA A 1 164 ? 110.398 54.627  13.654  1.00 4.89  ? 164  ALA A O   1 
ATOM   1199  C CB  . ALA A 1 164 ? 107.102 54.764  13.175  1.00 4.97  ? 164  ALA A CB  1 
ATOM   1200  N N   . ALA A 1 165 ? 109.756 54.712  11.503  1.00 4.85  ? 165  ALA A N   1 
ATOM   1201  C CA  . ALA A 1 165 ? 110.895 53.963  11.005  1.00 5.29  ? 165  ALA A CA  1 
ATOM   1202  C C   . ALA A 1 165 ? 112.220 54.698  11.236  1.00 6.72  ? 165  ALA A C   1 
ATOM   1203  O O   . ALA A 1 165 ? 113.161 54.070  11.699  1.00 5.44  ? 165  ALA A O   1 
ATOM   1204  C CB  . ALA A 1 165 ? 110.602 53.669  9.549   1.00 4.95  ? 165  ALA A CB  1 
ATOM   1205  N N   . ALA A 1 166 ? 112.286 56.007  11.013  1.00 6.04  ? 166  ALA A N   1 
ATOM   1206  C CA  . ALA A 1 166 ? 113.472 56.810  11.302  1.00 6.36  ? 166  ALA A CA  1 
ATOM   1207  C C   . ALA A 1 166 ? 113.729 56.919  12.789  1.00 6.04  ? 166  ALA A C   1 
ATOM   1208  O O   . ALA A 1 166 ? 114.847 56.763  13.299  1.00 7.34  ? 166  ALA A O   1 
ATOM   1209  C CB  . ALA A 1 166 ? 113.261 58.247  10.781  1.00 6.07  ? 166  ALA A CB  1 
ATOM   1210  N N   . ASN A 1 167 ? 112.658 57.097  13.592  1.00 5.16  ? 167  ASN A N   1 
ATOM   1211  C CA  . ASN A 1 167 ? 112.854 57.270  15.021  1.00 4.19  ? 167  ASN A CA  1 
ATOM   1212  C C   . ASN A 1 167 ? 113.273 56.010  15.751  1.00 5.74  ? 167  ASN A C   1 
ATOM   1213  O O   . ASN A 1 167 ? 114.135 56.005  16.659  1.00 2.78  ? 167  ASN A O   1 
ATOM   1214  C CB  . ASN A 1 167 ? 111.587 57.890  15.570  1.00 5.76  ? 167  ASN A CB  1 
ATOM   1215  C CG  . ASN A 1 167 ? 111.606 58.178  17.033  1.00 5.65  ? 167  ASN A CG  1 
ATOM   1216  O OD1 . ASN A 1 167 ? 111.184 57.365  17.865  1.00 7.25  ? 167  ASN A OD1 1 
ATOM   1217  N ND2 . ASN A 1 167 ? 112.102 59.371  17.392  1.00 5.96  ? 167  ASN A ND2 1 
ATOM   1218  N N   . LEU A 1 168 ? 112.677 54.867  15.348  1.00 4.67  ? 168  LEU A N   1 
ATOM   1219  C CA  . LEU A 1 168 ? 113.021 53.602  16.001  1.00 4.63  ? 168  LEU A CA  1 
ATOM   1220  C C   . LEU A 1 168 ? 114.450 53.198  15.598  1.00 4.32  ? 168  LEU A C   1 
ATOM   1221  O O   . LEU A 1 168 ? 115.189 52.804  16.480  1.00 3.78  ? 168  LEU A O   1 
ATOM   1222  C CB  . LEU A 1 168 ? 112.052 52.481  15.604  1.00 2.70  ? 168  LEU A CB  1 
ATOM   1223  C CG  . LEU A 1 168 ? 110.731 52.445  16.391  1.00 2.19  ? 168  LEU A CG  1 
ATOM   1224  C CD1 . LEU A 1 168 ? 109.660 51.648  15.647  1.00 3.41  ? 168  LEU A CD1 1 
ATOM   1225  C CD2 . LEU A 1 168 ? 110.936 51.932  17.788  1.00 3.24  ? 168  LEU A CD2 1 
ATOM   1226  N N   . ALA A 1 169 ? 114.781 53.360  14.326  1.00 3.54  ? 169  ALA A N   1 
ATOM   1227  C CA  . ALA A 1 169 ? 116.122 52.986  13.860  1.00 6.12  ? 169  ALA A CA  1 
ATOM   1228  C C   . ALA A 1 169 ? 117.230 53.781  14.531  1.00 6.75  ? 169  ALA A C   1 
ATOM   1229  O O   . ALA A 1 169 ? 118.334 53.232  14.696  1.00 7.86  ? 169  ALA A O   1 
ATOM   1230  C CB  . ALA A 1 169 ? 116.236 53.067  12.357  1.00 7.00  ? 169  ALA A CB  1 
ATOM   1231  N N   . GLY A 1 170 ? 116.949 54.978  15.005  1.00 6.29  ? 170  GLY A N   1 
ATOM   1232  C CA  . GLY A 1 170 ? 117.868 55.832  15.722  1.00 5.25  ? 170  GLY A CA  1 
ATOM   1233  C C   . GLY A 1 170 ? 117.987 55.486  17.173  1.00 6.51  ? 170  GLY A C   1 
ATOM   1234  O O   . GLY A 1 170 ? 118.928 55.977  17.810  1.00 9.76  ? 170  GLY A O   1 
ATOM   1235  N N   . MET A 1 171 ? 117.134 54.620  17.731  1.00 6.59  ? 171  MET A N   1 
ATOM   1236  C CA  . MET A 1 171 ? 117.277 54.264  19.149  1.00 7.06  ? 171  MET A CA  1 
ATOM   1237  C C   . MET A 1 171 ? 118.417 53.266  19.354  1.00 6.89  ? 171  MET A C   1 
ATOM   1238  O O   . MET A 1 171 ? 118.488 52.223  18.677  1.00 5.95  ? 171  MET A O   1 
ATOM   1239  C CB  . MET A 1 171 ? 115.919 53.767  19.686  1.00 7.20  ? 171  MET A CB  1 
ATOM   1240  C CG  . MET A 1 171 ? 114.845 54.861  19.736  1.00 7.80  ? 171  MET A CG  1 
ATOM   1241  S SD  . MET A 1 171 ? 113.256 54.305  20.462  1.00 3.74  ? 171  MET A SD  1 
ATOM   1242  C CE  . MET A 1 171 ? 113.774 54.013  22.101  1.00 2.31  ? 171  MET A CE  1 
ATOM   1243  N N   . GLU A 1 172 ? 119.262 53.486  20.357  1.00 4.93  ? 172  GLU A N   1 
ATOM   1244  C CA  . GLU A 1 172 ? 120.393 52.610  20.618  1.00 8.37  ? 172  GLU A CA  1 
ATOM   1245  C C   . GLU A 1 172 ? 120.025 51.116  20.640  1.00 7.91  ? 172  GLU A C   1 
ATOM   1246  O O   . GLU A 1 172 ? 120.676 50.286  19.989  1.00 6.72  ? 172  GLU A O   1 
ATOM   1247  C CB  . GLU A 1 172 ? 121.053 53.025  21.939  1.00 7.97  ? 172  GLU A CB  1 
ATOM   1248  C CG  . GLU A 1 172 ? 122.332 52.243  22.235  1.00 11.16 ? 172  GLU A CG  1 
ATOM   1249  C CD  . GLU A 1 172 ? 122.897 52.481  23.610  1.00 11.59 ? 172  GLU A CD  1 
ATOM   1250  O OE1 . GLU A 1 172 ? 122.426 53.351  24.361  1.00 12.90 ? 172  GLU A OE1 1 
ATOM   1251  O OE2 . GLU A 1 172 ? 123.857 51.798  24.044  1.00 13.63 ? 172  GLU A OE2 1 
ATOM   1252  N N   . GLY A 1 173 ? 118.971 50.734  21.374  1.00 6.92  ? 173  GLY A N   1 
ATOM   1253  C CA  . GLY A 1 173 ? 118.570 49.352  21.531  1.00 6.15  ? 173  GLY A CA  1 
ATOM   1254  C C   . GLY A 1 173 ? 117.876 48.687  20.374  1.00 7.25  ? 173  GLY A C   1 
ATOM   1255  O O   . GLY A 1 173 ? 117.736 47.460  20.350  1.00 7.14  ? 173  GLY A O   1 
ATOM   1256  N N   . PHE A 1 174 ? 117.459 49.408  19.344  1.00 7.23  ? 174  PHE A N   1 
ATOM   1257  C CA  . PHE A 1 174 ? 116.672 48.892  18.235  1.00 8.14  ? 174  PHE A CA  1 
ATOM   1258  C C   . PHE A 1 174 ? 117.206 47.716  17.457  1.00 9.50  ? 174  PHE A C   1 
ATOM   1259  O O   . PHE A 1 174 ? 116.444 46.739  17.265  1.00 10.84 ? 174  PHE A O   1 
ATOM   1260  C CB  . PHE A 1 174 ? 116.140 50.005  17.319  1.00 6.01  ? 174  PHE A CB  1 
ATOM   1261  C CG  . PHE A 1 174 ? 115.212 49.484  16.237  1.00 7.63  ? 174  PHE A CG  1 
ATOM   1262  C CD1 . PHE A 1 174 ? 113.867 49.297  16.501  1.00 6.94  ? 174  PHE A CD1 1 
ATOM   1263  C CD2 . PHE A 1 174 ? 115.687 49.180  14.959  1.00 7.27  ? 174  PHE A CD2 1 
ATOM   1264  C CE1 . PHE A 1 174 ? 112.987 48.832  15.539  1.00 6.47  ? 174  PHE A CE1 1 
ATOM   1265  C CE2 . PHE A 1 174 ? 114.824 48.716  13.998  1.00 8.53  ? 174  PHE A CE2 1 
ATOM   1266  C CZ  . PHE A 1 174 ? 113.464 48.536  14.277  1.00 7.48  ? 174  PHE A CZ  1 
ATOM   1267  N N   . PRO A 1 175 ? 118.461 47.660  17.026  1.00 9.41  ? 175  PRO A N   1 
ATOM   1268  C CA  . PRO A 1 175 ? 118.988 46.517  16.309  1.00 8.23  ? 175  PRO A CA  1 
ATOM   1269  C C   . PRO A 1 175 ? 118.992 45.285  17.198  1.00 7.11  ? 175  PRO A C   1 
ATOM   1270  O O   . PRO A 1 175 ? 119.091 44.178  16.663  1.00 6.42  ? 175  PRO A O   1 
ATOM   1271  C CB  . PRO A 1 175 ? 120.365 46.951  15.820  1.00 9.19  ? 175  PRO A CB  1 
ATOM   1272  C CG  . PRO A 1 175 ? 120.332 48.460  15.925  1.00 10.31 ? 175  PRO A CG  1 
ATOM   1273  C CD  . PRO A 1 175 ? 119.457 48.755  17.131  1.00 9.43  ? 175  PRO A CD  1 
ATOM   1274  N N   . ASN A 1 176 ? 118.888 45.350  18.514  1.00 6.52  ? 176  ASN A N   1 
ATOM   1275  C CA  . ASN A 1 176 ? 118.825 44.191  19.379  1.00 7.60  ? 176  ASN A CA  1 
ATOM   1276  C C   . ASN A 1 176 ? 117.395 43.705  19.637  1.00 7.53  ? 176  ASN A C   1 
ATOM   1277  O O   . ASN A 1 176 ? 117.163 42.876  20.519  1.00 7.07  ? 176  ASN A O   1 
ATOM   1278  C CB  . ASN A 1 176 ? 119.488 44.477  20.738  1.00 9.98  ? 176  ASN A CB  1 
ATOM   1279  C CG  . ASN A 1 176 ? 121.007 44.610  20.595  1.00 12.09 ? 176  ASN A CG  1 
ATOM   1280  O OD1 . ASN A 1 176 ? 121.516 44.341  19.520  1.00 13.68 ? 176  ASN A OD1 1 
ATOM   1281  N ND2 . ASN A 1 176 ? 121.713 45.042  21.627  1.00 12.65 ? 176  ASN A ND2 1 
ATOM   1282  N N   . LEU A 1 177 ? 116.393 44.250  18.940  1.00 6.64  ? 177  LEU A N   1 
ATOM   1283  C CA  . LEU A 1 177 ? 115.025 43.746  19.197  1.00 5.87  ? 177  LEU A CA  1 
ATOM   1284  C C   . LEU A 1 177 ? 114.876 42.355  18.559  1.00 3.82  ? 177  LEU A C   1 
ATOM   1285  O O   . LEU A 1 177 ? 115.438 42.040  17.513  1.00 2.59  ? 177  LEU A O   1 
ATOM   1286  C CB  . LEU A 1 177 ? 113.975 44.682  18.658  1.00 5.82  ? 177  LEU A CB  1 
ATOM   1287  C CG  . LEU A 1 177 ? 113.860 46.080  19.284  1.00 8.27  ? 177  LEU A CG  1 
ATOM   1288  C CD1 . LEU A 1 177 ? 112.445 46.586  19.012  1.00 7.62  ? 177  LEU A CD1 1 
ATOM   1289  C CD2 . LEU A 1 177 ? 114.303 46.246  20.715  1.00 5.69  ? 177  LEU A CD2 1 
ATOM   1290  N N   . ASP A 1 178 ? 114.112 41.476  19.190  1.00 4.77  ? 178  ASP A N   1 
ATOM   1291  C CA  . ASP A 1 178 ? 113.931 40.102  18.739  1.00 4.28  ? 178  ASP A CA  1 
ATOM   1292  C C   . ASP A 1 178 ? 113.554 39.970  17.277  1.00 4.44  ? 178  ASP A C   1 
ATOM   1293  O O   . ASP A 1 178 ? 112.481 40.481  16.856  1.00 5.63  ? 178  ASP A O   1 
ATOM   1294  C CB  . ASP A 1 178 ? 112.823 39.426  19.569  1.00 4.05  ? 178  ASP A CB  1 
ATOM   1295  C CG  . ASP A 1 178 ? 112.908 39.713  21.044  1.00 4.40  ? 178  ASP A CG  1 
ATOM   1296  O OD1 . ASP A 1 178 ? 112.982 40.914  21.402  1.00 5.81  ? 178  ASP A OD1 1 
ATOM   1297  O OD2 . ASP A 1 178 ? 112.909 38.788  21.891  1.00 4.56  ? 178  ASP A OD2 1 
ATOM   1298  N N   . ALA A 1 179 ? 114.333 39.290  16.467  1.00 2.08  ? 179  ALA A N   1 
ATOM   1299  C CA  . ALA A 1 179 ? 114.074 39.073  15.061  1.00 4.71  ? 179  ALA A CA  1 
ATOM   1300  C C   . ALA A 1 179 ? 113.622 40.347  14.344  1.00 5.46  ? 179  ALA A C   1 
ATOM   1301  O O   . ALA A 1 179 ? 112.811 40.283  13.393  1.00 4.06  ? 179  ALA A O   1 
ATOM   1302  C CB  . ALA A 1 179 ? 112.968 37.991  14.905  1.00 5.52  ? 179  ALA A CB  1 
ATOM   1303  N N   . VAL A 1 180 ? 114.232 41.494  14.685  1.00 5.33  ? 180  VAL A N   1 
ATOM   1304  C CA  . VAL A 1 180 ? 113.853 42.762  14.084  1.00 4.65  ? 180  VAL A CA  1 
ATOM   1305  C C   . VAL A 1 180 ? 114.122 42.854  12.604  1.00 4.92  ? 180  VAL A C   1 
ATOM   1306  O O   . VAL A 1 180 ? 115.185 42.509  12.045  1.00 5.96  ? 180  VAL A O   1 
ATOM   1307  C CB  . VAL A 1 180 ? 114.532 43.890  14.909  1.00 5.55  ? 180  VAL A CB  1 
ATOM   1308  C CG1 . VAL A 1 180 ? 116.018 43.961  14.650  1.00 3.83  ? 180  VAL A CG1 1 
ATOM   1309  C CG2 . VAL A 1 180 ? 113.884 45.240  14.566  1.00 4.58  ? 180  VAL A CG2 1 
ATOM   1310  N N   . SER A 1 181 ? 113.142 43.330  11.822  1.00 2.15  ? 181  SER A N   1 
ATOM   1311  C CA  . SER A 1 181 ? 113.298 43.486  10.391  1.00 3.59  ? 181  SER A CA  1 
ATOM   1312  C C   . SER A 1 181 ? 114.115 44.774  10.201  1.00 5.36  ? 181  SER A C   1 
ATOM   1313  O O   . SER A 1 181 ? 113.682 45.788  10.752  1.00 6.52  ? 181  SER A O   1 
ATOM   1314  C CB  . SER A 1 181 ? 111.964 43.511  9.680   1.00 2.50  ? 181  SER A CB  1 
ATOM   1315  O OG  . SER A 1 181 ? 112.100 43.607  8.298   1.00 7.11  ? 181  SER A OG  1 
ATOM   1316  N N   . ILE A 1 182 ? 115.229 44.701  9.498   1.00 6.31  ? 182  ILE A N   1 
ATOM   1317  C CA  . ILE A 1 182 ? 116.150 45.849  9.470   1.00 7.12  ? 182  ILE A CA  1 
ATOM   1318  C C   . ILE A 1 182 ? 117.154 45.687  8.352   1.00 8.43  ? 182  ILE A C   1 
ATOM   1319  O O   . ILE A 1 182 ? 117.524 44.558  7.945   1.00 9.74  ? 182  ILE A O   1 
ATOM   1320  C CB  . ILE A 1 182 ? 116.825 45.994  10.857  1.00 6.52  ? 182  ILE A CB  1 
ATOM   1321  C CG1 . ILE A 1 182 ? 117.573 47.327  11.036  1.00 8.34  ? 182  ILE A CG1 1 
ATOM   1322  C CG2 . ILE A 1 182 ? 117.734 44.798  11.144  1.00 7.80  ? 182  ILE A CG2 1 
ATOM   1323  C CD1 . ILE A 1 182 ? 118.353 47.505  12.331  1.00 7.38  ? 182  ILE A CD1 1 
ATOM   1324  N N   . GLY A 1 183 ? 117.517 46.833  7.769   1.00 9.39  ? 183  GLY A N   1 
ATOM   1325  C CA  . GLY A 1 183 ? 118.497 46.762  6.661   1.00 9.64  ? 183  GLY A CA  1 
ATOM   1326  C C   . GLY A 1 183 ? 119.852 46.444  7.310   1.00 10.44 ? 183  GLY A C   1 
ATOM   1327  O O   . GLY A 1 183 ? 120.088 46.668  8.499   1.00 7.55  ? 183  GLY A O   1 
ATOM   1328  N N   . SER A 1 184 ? 120.792 46.031  6.457   1.00 13.22 ? 184  SER A N   1 
ATOM   1329  C CA  . SER A 1 184 ? 122.167 45.774  6.878   1.00 15.30 ? 184  SER A CA  1 
ATOM   1330  C C   . SER A 1 184 ? 122.822 47.095  7.277   1.00 14.79 ? 184  SER A C   1 
ATOM   1331  O O   . SER A 1 184 ? 123.609 47.117  8.224   1.00 15.05 ? 184  SER A O   1 
ATOM   1332  C CB  . SER A 1 184 ? 122.925 45.008  5.795   1.00 17.21 ? 184  SER A CB  1 
ATOM   1333  O OG  . SER A 1 184 ? 123.000 45.717  4.560   1.00 19.70 ? 184  SER A OG  1 
ATOM   1334  N N   . ASP A 1 185 ? 122.386 48.223  6.717   1.00 15.10 ? 185  ASP A N   1 
ATOM   1335  C CA  . ASP A 1 185 ? 122.841 49.536  7.120   1.00 16.19 ? 185  ASP A CA  1 
ATOM   1336  C C   . ASP A 1 185 ? 122.095 50.055  8.341   1.00 16.00 ? 185  ASP A C   1 
ATOM   1337  O O   . ASP A 1 185 ? 122.276 51.206  8.740   1.00 15.36 ? 185  ASP A O   1 
ATOM   1338  C CB  . ASP A 1 185 ? 122.705 50.600  6.038   1.00 18.40 ? 185  ASP A CB  1 
ATOM   1339  C CG  . ASP A 1 185 ? 121.284 50.835  5.560   1.00 18.95 ? 185  ASP A CG  1 
ATOM   1340  O OD1 . ASP A 1 185 ? 120.281 50.371  6.163   1.00 19.55 ? 185  ASP A OD1 1 
ATOM   1341  O OD2 . ASP A 1 185 ? 121.186 51.488  4.499   1.00 17.09 ? 185  ASP A OD2 1 
ATOM   1342  N N   . GLY A 1 186 ? 121.204 49.277  8.951   1.00 14.28 ? 186  GLY A N   1 
ATOM   1343  C CA  . GLY A 1 186 ? 120.503 49.653  10.143  1.00 10.12 ? 186  GLY A CA  1 
ATOM   1344  C C   . GLY A 1 186 ? 119.263 50.502  9.916   1.00 9.22  ? 186  GLY A C   1 
ATOM   1345  O O   . GLY A 1 186 ? 118.643 50.876  10.924  1.00 7.93  ? 186  GLY A O   1 
ATOM   1346  N N   . THR A 1 187 ? 118.871 50.689  8.664   1.00 8.73  ? 187  THR A N   1 
ATOM   1347  C CA  . THR A 1 187 ? 117.692 51.517  8.401   1.00 9.57  ? 187  THR A CA  1 
ATOM   1348  C C   . THR A 1 187 ? 116.417 50.667  8.402   1.00 8.20  ? 187  THR A C   1 
ATOM   1349  O O   . THR A 1 187 ? 116.484 49.451  8.228   1.00 7.15  ? 187  THR A O   1 
ATOM   1350  C CB  . THR A 1 187 ? 117.778 52.257  7.056   1.00 9.38  ? 187  THR A CB  1 
ATOM   1351  O OG1 . THR A 1 187 ? 117.771 51.299  5.979   1.00 8.94  ? 187  THR A OG1 1 
ATOM   1352  C CG2 . THR A 1 187 ? 119.026 53.119  6.914   1.00 9.92  ? 187  THR A CG2 1 
ATOM   1353  N N   . VAL A 1 188 ? 115.254 51.309  8.513   1.00 7.67  ? 188  VAL A N   1 
ATOM   1354  C CA  . VAL A 1 188 ? 113.999 50.515  8.536   1.00 7.40  ? 188  VAL A CA  1 
ATOM   1355  C C   . VAL A 1 188 ? 113.129 51.033  7.400   1.00 8.48  ? 188  VAL A C   1 
ATOM   1356  O O   . VAL A 1 188 ? 112.853 52.237  7.350   1.00 6.09  ? 188  VAL A O   1 
ATOM   1357  C CB  . VAL A 1 188 ? 113.315 50.567  9.902   1.00 7.41  ? 188  VAL A CB  1 
ATOM   1358  C CG1 . VAL A 1 188 ? 111.838 50.137  9.868   1.00 6.34  ? 188  VAL A CG1 1 
ATOM   1359  C CG2 . VAL A 1 188 ? 114.054 49.719  10.939  1.00 5.04  ? 188  VAL A CG2 1 
ATOM   1360  N N   . ASP A 1 189 ? 112.795 50.127  6.464   1.00 7.11  ? 189  ASP A N   1 
ATOM   1361  C CA  . ASP A 1 189 ? 111.898 50.510  5.374   1.00 7.55  ? 189  ASP A CA  1 
ATOM   1362  C C   . ASP A 1 189 ? 110.451 50.389  5.876   1.00 7.69  ? 189  ASP A C   1 
ATOM   1363  O O   . ASP A 1 189 ? 110.019 49.321  6.319   1.00 6.91  ? 189  ASP A O   1 
ATOM   1364  C CB  . ASP A 1 189 ? 112.085 49.601  4.162   1.00 8.73  ? 189  ASP A CB  1 
ATOM   1365  C CG  . ASP A 1 189 ? 111.118 49.985  3.054   1.00 12.22 ? 189  ASP A CG  1 
ATOM   1366  O OD1 . ASP A 1 189 ? 111.191 51.149  2.594   1.00 11.99 ? 189  ASP A OD1 1 
ATOM   1367  O OD2 . ASP A 1 189 ? 110.292 49.144  2.622   1.00 11.88 ? 189  ASP A OD2 1 
ATOM   1368  N N   . PRO A 1 190 ? 109.698 51.473  5.908   1.00 6.76  ? 190  PRO A N   1 
ATOM   1369  C CA  . PRO A 1 190 ? 108.339 51.434  6.432   1.00 7.15  ? 190  PRO A CA  1 
ATOM   1370  C C   . PRO A 1 190 ? 107.469 50.394  5.742   1.00 7.36  ? 190  PRO A C   1 
ATOM   1371  O O   . PRO A 1 190 ? 106.875 49.580  6.484   1.00 8.05  ? 190  PRO A O   1 
ATOM   1372  C CB  . PRO A 1 190 ? 107.808 52.860  6.274   1.00 7.67  ? 190  PRO A CB  1 
ATOM   1373  C CG  . PRO A 1 190 ? 109.021 53.711  6.096   1.00 6.79  ? 190  PRO A CG  1 
ATOM   1374  C CD  . PRO A 1 190 ? 110.095 52.827  5.470   1.00 5.39  ? 190  PRO A CD  1 
ATOM   1375  N N   . LEU A 1 191 ? 107.384 50.355  4.416   1.00 6.61  ? 191  LEU A N   1 
ATOM   1376  C CA  . LEU A 1 191 ? 106.473 49.405  3.763   1.00 8.77  ? 191  LEU A CA  1 
ATOM   1377  C C   . LEU A 1 191 ? 106.801 47.933  4.041   1.00 9.09  ? 191  LEU A C   1 
ATOM   1378  O O   . LEU A 1 191 ? 105.867 47.199  4.406   1.00 7.60  ? 191  LEU A O   1 
ATOM   1379  C CB  . LEU A 1 191 ? 106.401 49.638  2.266   1.00 8.78  ? 191  LEU A CB  1 
ATOM   1380  C CG  . LEU A 1 191 ? 105.332 48.908  1.452   1.00 12.93 ? 191  LEU A CG  1 
ATOM   1381  C CD1 . LEU A 1 191 ? 103.909 49.264  1.899   1.00 11.51 ? 191  LEU A CD1 1 
ATOM   1382  C CD2 . LEU A 1 191 ? 105.485 49.316  -0.025  1.00 12.52 ? 191  LEU A CD2 1 
ATOM   1383  N N   . SER A 1 192 ? 108.064 47.529  3.958   1.00 6.38  ? 192  SER A N   1 
ATOM   1384  C CA  . SER A 1 192 ? 108.409 46.128  4.099   1.00 7.06  ? 192  SER A CA  1 
ATOM   1385  C C   . SER A 1 192 ? 109.075 45.692  5.375   1.00 7.25  ? 192  SER A C   1 
ATOM   1386  O O   . SER A 1 192 ? 109.426 44.488  5.509   1.00 7.49  ? 192  SER A O   1 
ATOM   1387  C CB  . SER A 1 192 ? 109.312 45.802  2.867   1.00 8.24  ? 192  SER A CB  1 
ATOM   1388  O OG  . SER A 1 192 ? 110.603 46.400  3.064   1.00 7.93  ? 192  SER A OG  1 
ATOM   1389  N N   . GLN A 1 193 ? 109.364 46.558  6.337   1.00 4.94  ? 193  GLN A N   1 
ATOM   1390  C CA  . GLN A 1 193 ? 110.127 46.159  7.509   1.00 5.10  ? 193  GLN A CA  1 
ATOM   1391  C C   . GLN A 1 193 ? 109.540 46.633  8.819   1.00 5.17  ? 193  GLN A C   1 
ATOM   1392  O O   . GLN A 1 193 ? 109.719 45.992  9.874   1.00 5.27  ? 193  GLN A O   1 
ATOM   1393  C CB  . GLN A 1 193 ? 111.600 46.673  7.379   1.00 4.49  ? 193  GLN A CB  1 
ATOM   1394  C CG  . GLN A 1 193 ? 112.346 45.943  6.242   1.00 6.03  ? 193  GLN A CG  1 
ATOM   1395  C CD  . GLN A 1 193 ? 113.791 46.404  6.067   1.00 7.19  ? 193  GLN A CD  1 
ATOM   1396  O OE1 . GLN A 1 193 ? 114.115 47.549  6.421   1.00 6.91  ? 193  GLN A OE1 1 
ATOM   1397  N NE2 . GLN A 1 193 ? 114.619 45.492  5.584   1.00 5.67  ? 193  GLN A NE2 1 
ATOM   1398  N N   . LEU A 1 194 ? 108.906 47.806  8.798   1.00 4.48  ? 194  LEU A N   1 
ATOM   1399  C CA  . LEU A 1 194 ? 108.373 48.325  10.072  1.00 3.28  ? 194  LEU A CA  1 
ATOM   1400  C C   . LEU A 1 194 ? 107.327 47.342  10.636  1.00 4.22  ? 194  LEU A C   1 
ATOM   1401  O O   . LEU A 1 194 ? 106.431 46.934  9.883   1.00 4.44  ? 194  LEU A O   1 
ATOM   1402  C CB  . LEU A 1 194 ? 107.705 49.658  9.846   1.00 4.25  ? 194  LEU A CB  1 
ATOM   1403  C CG  . LEU A 1 194 ? 107.128 50.393  11.050  1.00 3.52  ? 194  LEU A CG  1 
ATOM   1404  C CD1 . LEU A 1 194 ? 108.178 50.780  12.046  1.00 5.33  ? 194  LEU A CD1 1 
ATOM   1405  C CD2 . LEU A 1 194 ? 106.373 51.620  10.515  1.00 4.02  ? 194  LEU A CD2 1 
ATOM   1406  N N   . PHE A 1 195 ? 107.427 47.082  11.921  1.00 3.21  ? 195  PHE A N   1 
ATOM   1407  C CA  . PHE A 1 195 ? 106.553 46.150  12.623  1.00 6.73  ? 195  PHE A CA  1 
ATOM   1408  C C   . PHE A 1 195 ? 106.606 44.762  12.002  1.00 6.61  ? 195  PHE A C   1 
ATOM   1409  O O   . PHE A 1 195 ? 105.608 44.031  12.059  1.00 6.24  ? 195  PHE A O   1 
ATOM   1410  C CB  . PHE A 1 195 ? 105.096 46.637  12.777  1.00 5.94  ? 195  PHE A CB  1 
ATOM   1411  C CG  . PHE A 1 195 ? 104.939 48.052  13.278  1.00 5.88  ? 195  PHE A CG  1 
ATOM   1412  C CD1 . PHE A 1 195 ? 105.792 48.603  14.220  1.00 3.24  ? 195  PHE A CD1 1 
ATOM   1413  C CD2 . PHE A 1 195 ? 103.940 48.859  12.735  1.00 5.37  ? 195  PHE A CD2 1 
ATOM   1414  C CE1 . PHE A 1 195 ? 105.637 49.906  14.668  1.00 4.23  ? 195  PHE A CE1 1 
ATOM   1415  C CE2 . PHE A 1 195 ? 103.786 50.182  13.147  1.00 4.16  ? 195  PHE A CE2 1 
ATOM   1416  C CZ  . PHE A 1 195 ? 104.633 50.681  14.129  1.00 3.83  ? 195  PHE A CZ  1 
ATOM   1417  N N   . ARG A 1 196 ? 107.748 44.347  11.439  1.00 5.32  ? 196  ARG A N   1 
ATOM   1418  C CA  . ARG A 1 196 ? 107.877 43.004  10.872  1.00 3.10  ? 196  ARG A CA  1 
ATOM   1419  C C   . ARG A 1 196 ? 108.966 42.227  11.598  1.00 4.90  ? 196  ARG A C   1 
ATOM   1420  O O   . ARG A 1 196 ? 109.566 42.716  12.566  1.00 6.14  ? 196  ARG A O   1 
ATOM   1421  C CB  . ARG A 1 196 ? 108.088 43.024  9.360   1.00 3.63  ? 196  ARG A CB  1 
ATOM   1422  C CG  . ARG A 1 196 ? 106.961 43.592  8.540   1.00 2.42  ? 196  ARG A CG  1 
ATOM   1423  C CD  . ARG A 1 196 ? 106.898 42.990  7.146   1.00 3.62  ? 196  ARG A CD  1 
ATOM   1424  N NE  . ARG A 1 196 ? 106.101 43.822  6.261   1.00 3.84  ? 196  ARG A NE  1 
ATOM   1425  C CZ  . ARG A 1 196 ? 105.475 43.425  5.173   1.00 2.08  ? 196  ARG A CZ  1 
ATOM   1426  N NH1 . ARG A 1 196 ? 105.522 42.150  4.761   1.00 3.24  ? 196  ARG A NH1 1 
ATOM   1427  N NH2 . ARG A 1 196 ? 104.824 44.290  4.409   1.00 2.74  ? 196  ARG A NH2 1 
ATOM   1428  N N   . ALA A 1 197 ? 109.176 40.962  11.208  1.00 4.20  ? 197  ALA A N   1 
ATOM   1429  C CA  . ALA A 1 197 ? 110.162 40.104  11.866  1.00 4.10  ? 197  ALA A CA  1 
ATOM   1430  C C   . ALA A 1 197 ? 110.835 39.247  10.784  1.00 3.26  ? 197  ALA A C   1 
ATOM   1431  O O   . ALA A 1 197 ? 110.365 39.164  9.663   1.00 3.63  ? 197  ALA A O   1 
ATOM   1432  C CB  . ALA A 1 197 ? 109.598 39.323  13.024  1.00 3.44  ? 197  ALA A CB  1 
ATOM   1433  N N   . THR A 1 198 ? 111.984 38.678  11.103  1.00 4.12  ? 198  THR A N   1 
ATOM   1434  C CA  . THR A 1 198 ? 112.770 37.968  10.098  1.00 4.57  ? 198  THR A CA  1 
ATOM   1435  C C   . THR A 1 198 ? 112.385 36.501  9.979   1.00 5.54  ? 198  THR A C   1 
ATOM   1436  O O   . THR A 1 198 ? 113.024 35.804  9.197   1.00 4.37  ? 198  THR A O   1 
ATOM   1437  C CB  . THR A 1 198 ? 114.276 38.128  10.362  1.00 4.37  ? 198  THR A CB  1 
ATOM   1438  O OG1 . THR A 1 198 ? 114.554 37.688  11.694  1.00 3.49  ? 198  THR A OG1 1 
ATOM   1439  C CG2 . THR A 1 198 ? 114.682 39.604  10.173  1.00 6.86  ? 198  THR A CG2 1 
ATOM   1440  N N   . PHE A 1 199 ? 111.414 35.997  10.741  1.00 5.44  ? 199  PHE A N   1 
ATOM   1441  C CA  . PHE A 1 199 ? 110.965 34.616  10.529  1.00 5.23  ? 199  PHE A CA  1 
ATOM   1442  C C   . PHE A 1 199 ? 110.594 34.476  9.067   1.00 3.63  ? 199  PHE A C   1 
ATOM   1443  O O   . PHE A 1 199 ? 110.152 35.398  8.391   1.00 4.07  ? 199  PHE A O   1 
ATOM   1444  C CB  . PHE A 1 199 ? 109.813 34.251  11.463  1.00 5.13  ? 199  PHE A CB  1 
ATOM   1445  C CG  . PHE A 1 199 ? 110.165 34.167  12.922  1.00 5.28  ? 199  PHE A CG  1 
ATOM   1446  C CD1 . PHE A 1 199 ? 111.475 34.231  13.374  1.00 5.22  ? 199  PHE A CD1 1 
ATOM   1447  C CD2 . PHE A 1 199 ? 109.153 33.972  13.863  1.00 5.81  ? 199  PHE A CD2 1 
ATOM   1448  C CE1 . PHE A 1 199 ? 111.777 34.102  14.714  1.00 3.39  ? 199  PHE A CE1 1 
ATOM   1449  C CE2 . PHE A 1 199 ? 109.455 33.847  15.192  1.00 5.12  ? 199  PHE A CE2 1 
ATOM   1450  C CZ  . PHE A 1 199 ? 110.771 33.921  15.624  1.00 5.69  ? 199  PHE A CZ  1 
ATOM   1451  N N   . VAL A 1 200 ? 110.756 33.254  8.558   1.00 5.33  ? 200  VAL A N   1 
ATOM   1452  C CA  . VAL A 1 200 ? 110.556 32.947  7.163   1.00 4.56  ? 200  VAL A CA  1 
ATOM   1453  C C   . VAL A 1 200 ? 109.252 33.442  6.568   1.00 5.07  ? 200  VAL A C   1 
ATOM   1454  O O   . VAL A 1 200 ? 108.184 33.101  7.066   1.00 5.14  ? 200  VAL A O   1 
ATOM   1455  C CB  . VAL A 1 200 ? 110.701 31.430  6.876   1.00 4.79  ? 200  VAL A CB  1 
ATOM   1456  C CG1 . VAL A 1 200 ? 110.387 31.112  5.417   1.00 5.33  ? 200  VAL A CG1 1 
ATOM   1457  C CG2 . VAL A 1 200 ? 112.132 31.011  7.199   1.00 5.75  ? 200  VAL A CG2 1 
ATOM   1458  N N   . GLY A 1 201 ? 109.348 34.203  5.480   1.00 4.16  ? 201  GLY A N   1 
ATOM   1459  C CA  . GLY A 1 201 ? 108.214 34.714  4.777   1.00 4.27  ? 201  GLY A CA  1 
ATOM   1460  C C   . GLY A 1 201 ? 107.487 35.920  5.361   1.00 3.83  ? 201  GLY A C   1 
ATOM   1461  O O   . GLY A 1 201 ? 106.658 36.488  4.635   1.00 4.69  ? 201  GLY A O   1 
ATOM   1462  N N   . VAL A 1 202 ? 107.796 36.354  6.572   1.00 4.76  ? 202  VAL A N   1 
ATOM   1463  C CA  . VAL A 1 202 ? 107.083 37.494  7.150   1.00 5.46  ? 202  VAL A CA  1 
ATOM   1464  C C   . VAL A 1 202 ? 107.410 38.783  6.411   1.00 6.92  ? 202  VAL A C   1 
ATOM   1465  O O   . VAL A 1 202 ? 106.525 39.631  6.249   1.00 4.40  ? 202  VAL A O   1 
ATOM   1466  C CB  . VAL A 1 202 ? 107.416 37.575  8.651   1.00 5.44  ? 202  VAL A CB  1 
ATOM   1467  C CG1 . VAL A 1 202 ? 106.775 38.744  9.384   1.00 2.94  ? 202  VAL A CG1 1 
ATOM   1468  C CG2 . VAL A 1 202 ? 106.969 36.263  9.325   1.00 5.85  ? 202  VAL A CG2 1 
ATOM   1469  N N   . GLU A 1 203 ? 108.653 38.931  5.892   1.00 6.53  ? 203  GLU A N   1 
ATOM   1470  C CA  . GLU A 1 203 ? 108.996 40.195  5.221   1.00 6.76  ? 203  GLU A CA  1 
ATOM   1471  C C   . GLU A 1 203 ? 108.620 40.209  3.757   1.00 7.64  ? 203  GLU A C   1 
ATOM   1472  O O   . GLU A 1 203 ? 108.679 41.225  3.069   1.00 6.77  ? 203  GLU A O   1 
ATOM   1473  C CB  . GLU A 1 203 ? 110.514 40.432  5.394   1.00 7.61  ? 203  GLU A CB  1 
ATOM   1474  C CG  . GLU A 1 203 ? 110.898 40.700  6.857   1.00 6.53  ? 203  GLU A CG  1 
ATOM   1475  C CD  . GLU A 1 203 ? 112.399 40.442  7.019   1.00 8.67  ? 203  GLU A CD  1 
ATOM   1476  O OE1 . GLU A 1 203 ? 112.860 39.289  6.789   1.00 8.67  ? 203  GLU A OE1 1 
ATOM   1477  O OE2 . GLU A 1 203 ? 113.135 41.394  7.353   1.00 6.88  ? 203  GLU A OE2 1 
ATOM   1478  N N   . THR A 1 204 ? 108.204 39.058  3.204   1.00 7.92  ? 204  THR A N   1 
ATOM   1479  C CA  . THR A 1 204 ? 107.839 39.017  1.788   1.00 7.83  ? 204  THR A CA  1 
ATOM   1480  C C   . THR A 1 204 ? 106.393 39.446  1.524   1.00 8.49  ? 204  THR A C   1 
ATOM   1481  O O   . THR A 1 204 ? 105.447 38.936  2.130   1.00 8.98  ? 204  THR A O   1 
ATOM   1482  C CB  . THR A 1 204 ? 108.008 37.570  1.287   1.00 7.83  ? 204  THR A CB  1 
ATOM   1483  O OG1 . THR A 1 204 ? 109.286 37.073  1.730   1.00 9.35  ? 204  THR A OG1 1 
ATOM   1484  C CG2 . THR A 1 204 ? 107.905 37.441  -0.222  1.00 6.72  ? 204  THR A CG2 1 
ATOM   1485  N N   . GLY A 1 205 ? 106.154 40.302  0.535   1.00 6.76  ? 205  GLY A N   1 
ATOM   1486  C CA  . GLY A 1 205 ? 104.799 40.639  0.164   1.00 6.89  ? 205  GLY A CA  1 
ATOM   1487  C C   . GLY A 1 205 ? 104.029 41.432  1.221   1.00 5.40  ? 205  GLY A C   1 
ATOM   1488  O O   . GLY A 1 205 ? 104.598 42.091  2.092   1.00 3.71  ? 205  GLY A O   1 
ATOM   1489  N N   . PRO A 1 206 ? 102.704 41.391  1.089   1.00 4.69  ? 206  PRO A N   1 
ATOM   1490  C CA  . PRO A 1 206 ? 101.795 42.141  1.946   1.00 4.09  ? 206  PRO A CA  1 
ATOM   1491  C C   . PRO A 1 206 ? 101.967 41.848  3.396   1.00 3.15  ? 206  PRO A C   1 
ATOM   1492  O O   . PRO A 1 206 ? 102.289 40.706  3.776   1.00 2.27  ? 206  PRO A O   1 
ATOM   1493  C CB  . PRO A 1 206 ? 100.404 41.668  1.483   1.00 4.95  ? 206  PRO A CB  1 
ATOM   1494  C CG  . PRO A 1 206 ? 100.605 41.377  0.038   1.00 5.00  ? 206  PRO A CG  1 
ATOM   1495  C CD  . PRO A 1 206 ? 101.944 40.619  0.067   1.00 4.93  ? 206  PRO A CD  1 
ATOM   1496  N N   . PHE A 1 207 ? 101.685 42.841  4.253   1.00 2.08  ? 207  PHE A N   1 
ATOM   1497  C CA  . PHE A 1 207 ? 101.824 42.689  5.687   1.00 4.41  ? 207  PHE A CA  1 
ATOM   1498  C C   . PHE A 1 207 ? 100.952 41.548  6.267   1.00 4.44  ? 207  PHE A C   1 
ATOM   1499  O O   . PHE A 1 207 ? 101.376 40.797  7.163   1.00 3.57  ? 207  PHE A O   1 
ATOM   1500  C CB  . PHE A 1 207 ? 101.404 44.008  6.372   1.00 2.74  ? 207  PHE A CB  1 
ATOM   1501  C CG  . PHE A 1 207 ? 101.788 44.080  7.822   1.00 3.32  ? 207  PHE A CG  1 
ATOM   1502  C CD1 . PHE A 1 207 ? 100.975 43.507  8.783   1.00 3.42  ? 207  PHE A CD1 1 
ATOM   1503  C CD2 . PHE A 1 207 ? 102.956 44.733  8.238   1.00 3.61  ? 207  PHE A CD2 1 
ATOM   1504  C CE1 . PHE A 1 207 ? 101.306 43.538  10.131  1.00 2.33  ? 207  PHE A CE1 1 
ATOM   1505  C CE2 . PHE A 1 207 ? 103.297 44.771  9.567   1.00 2.09  ? 207  PHE A CE2 1 
ATOM   1506  C CZ  . PHE A 1 207 ? 102.477 44.179  10.515  1.00 2.08  ? 207  PHE A CZ  1 
ATOM   1507  N N   . ILE A 1 208 ? 99.697  41.482  5.818   1.00 4.80  ? 208  ILE A N   1 
ATOM   1508  C CA  . ILE A 1 208 ? 98.782  40.492  6.410   1.00 5.17  ? 208  ILE A CA  1 
ATOM   1509  C C   . ILE A 1 208 ? 98.797  39.170  5.646   1.00 4.72  ? 208  ILE A C   1 
ATOM   1510  O O   . ILE A 1 208 ? 98.708  39.111  4.431   1.00 4.26  ? 208  ILE A O   1 
ATOM   1511  C CB  . ILE A 1 208 ? 97.345  41.071  6.483   1.00 4.99  ? 208  ILE A CB  1 
ATOM   1512  C CG1 . ILE A 1 208 ? 97.286  42.308  7.401   1.00 2.67  ? 208  ILE A CG1 1 
ATOM   1513  C CG2 . ILE A 1 208 ? 96.361  39.990  6.948   1.00 4.05  ? 208  ILE A CG2 1 
ATOM   1514  C CD1 . ILE A 1 208 ? 97.525  42.006  8.877   1.00 2.27  ? 208  ILE A CD1 1 
ATOM   1515  N N   . SER A 1 209 ? 98.843  38.075  6.400   1.00 4.96  ? 209  SER A N   1 
ATOM   1516  C CA  . SER A 1 209 ? 98.835  36.743  5.807   1.00 3.86  ? 209  SER A CA  1 
ATOM   1517  C C   . SER A 1 209 ? 97.676  36.542  4.867   1.00 5.20  ? 209  SER A C   1 
ATOM   1518  O O   . SER A 1 209 ? 96.511  36.921  5.129   1.00 3.42  ? 209  SER A O   1 
ATOM   1519  C CB  . SER A 1 209 ? 98.774  35.704  6.943   1.00 5.23  ? 209  SER A CB  1 
ATOM   1520  O OG  . SER A 1 209 ? 98.587  34.388  6.408   1.00 5.15  ? 209  SER A OG  1 
ATOM   1521  N N   . GLN A 1 210 ? 97.890  35.825  3.773   1.00 5.08  ? 210  GLN A N   1 
ATOM   1522  C CA  . GLN A 1 210 ? 96.865  35.413  2.836   1.00 4.94  ? 210  GLN A CA  1 
ATOM   1523  C C   . GLN A 1 210 ? 95.759  34.648  3.570   1.00 4.71  ? 210  GLN A C   1 
ATOM   1524  O O   . GLN A 1 210 ? 94.607  34.656  3.106   1.00 8.08  ? 210  GLN A O   1 
ATOM   1525  C CB  . GLN A 1 210 ? 97.355  34.433  1.767   1.00 5.42  ? 210  GLN A CB  1 
ATOM   1526  C CG  . GLN A 1 210 ? 98.166  35.007  0.609   1.00 6.65  ? 210  GLN A CG  1 
ATOM   1527  C CD  . GLN A 1 210 ? 97.568  36.272  0.028   1.00 5.62  ? 210  GLN A CD  1 
ATOM   1528  O OE1 . GLN A 1 210 ? 96.489  36.296  -0.570  1.00 5.00  ? 210  GLN A OE1 1 
ATOM   1529  N NE2 . GLN A 1 210 ? 98.290  37.382  0.237   1.00 5.72  ? 210  GLN A NE2 1 
ATOM   1530  N N   . LEU A 1 211 ? 96.047  33.988  4.669   1.00 3.70  ? 211  LEU A N   1 
ATOM   1531  C CA  . LEU A 1 211 ? 95.085  33.162  5.386   1.00 2.77  ? 211  LEU A CA  1 
ATOM   1532  C C   . LEU A 1 211 ? 94.068  33.986  6.177   1.00 4.01  ? 211  LEU A C   1 
ATOM   1533  O O   . LEU A 1 211 ? 93.081  33.427  6.663   1.00 3.50  ? 211  LEU A O   1 
ATOM   1534  C CB  . LEU A 1 211 ? 95.877  32.249  6.328   1.00 2.08  ? 211  LEU A CB  1 
ATOM   1535  C CG  . LEU A 1 211 ? 96.840  31.280  5.604   1.00 3.16  ? 211  LEU A CG  1 
ATOM   1536  C CD1 . LEU A 1 211 ? 97.649  30.528  6.636   1.00 3.68  ? 211  LEU A CD1 1 
ATOM   1537  C CD2 . LEU A 1 211 ? 96.069  30.294  4.725   1.00 2.84  ? 211  LEU A CD2 1 
ATOM   1538  N N   . LEU A 1 212 ? 94.321  35.297  6.337   1.00 3.56  ? 212  LEU A N   1 
ATOM   1539  C CA  . LEU A 1 212 ? 93.427  36.177  7.066   1.00 3.24  ? 212  LEU A CA  1 
ATOM   1540  C C   . LEU A 1 212 ? 92.541  37.003  6.144   1.00 3.99  ? 212  LEU A C   1 
ATOM   1541  O O   . LEU A 1 212 ? 91.552  37.559  6.613   1.00 3.74  ? 212  LEU A O   1 
ATOM   1542  C CB  . LEU A 1 212 ? 94.279  37.103  7.923   1.00 3.27  ? 212  LEU A CB  1 
ATOM   1543  C CG  . LEU A 1 212 ? 94.386  37.086  9.416   1.00 8.49  ? 212  LEU A CG  1 
ATOM   1544  C CD1 . LEU A 1 212 ? 93.834  35.835  10.084  1.00 7.15  ? 212  LEU A CD1 1 
ATOM   1545  C CD2 . LEU A 1 212 ? 95.802  37.433  9.850   1.00 7.82  ? 212  LEU A CD2 1 
ATOM   1546  N N   . VAL A 1 213 ? 92.844  37.094  4.857   1.00 2.30  ? 213  VAL A N   1 
ATOM   1547  C CA  . VAL A 1 213 ? 92.035  37.909  3.965   1.00 4.40  ? 213  VAL A CA  1 
ATOM   1548  C C   . VAL A 1 213 ? 91.323  37.116  2.880   1.00 4.04  ? 213  VAL A C   1 
ATOM   1549  O O   . VAL A 1 213 ? 90.328  37.591  2.287   1.00 3.61  ? 213  VAL A O   1 
ATOM   1550  C CB  . VAL A 1 213 ? 92.920  39.035  3.386   1.00 5.00  ? 213  VAL A CB  1 
ATOM   1551  C CG1 . VAL A 1 213 ? 93.373  39.990  4.500   1.00 4.92  ? 213  VAL A CG1 1 
ATOM   1552  C CG2 . VAL A 1 213 ? 94.156  38.495  2.670   1.00 6.91  ? 213  VAL A CG2 1 
ATOM   1553  N N   . ASN A 1 214 ? 91.671  35.822  2.702   1.00 2.90  ? 214  ASN A N   1 
ATOM   1554  C CA  . ASN A 1 214 ? 90.975  35.043  1.676   1.00 3.90  ? 214  ASN A CA  1 
ATOM   1555  C C   . ASN A 1 214 ? 89.754  34.302  2.256   1.00 3.62  ? 214  ASN A C   1 
ATOM   1556  O O   . ASN A 1 214 ? 89.689  34.135  3.451   1.00 2.67  ? 214  ASN A O   1 
ATOM   1557  C CB  . ASN A 1 214 ? 91.881  34.024  0.997   1.00 3.23  ? 214  ASN A CB  1 
ATOM   1558  C CG  . ASN A 1 214 ? 92.769  34.635  -0.063  1.00 5.50  ? 214  ASN A CG  1 
ATOM   1559  O OD1 . ASN A 1 214 ? 92.328  34.848  -1.171  1.00 5.03  ? 214  ASN A OD1 1 
ATOM   1560  N ND2 . ASN A 1 214 ? 94.030  34.917  0.296   1.00 5.34  ? 214  ASN A ND2 1 
ATOM   1561  N N   . SER A 1 215 ? 88.795  33.974  1.389   1.00 3.75  ? 215  SER A N   1 
ATOM   1562  C CA  . SER A 1 215 ? 87.600  33.266  1.891   1.00 4.15  ? 215  SER A CA  1 
ATOM   1563  C C   . SER A 1 215 ? 87.915  31.854  2.360   1.00 4.87  ? 215  SER A C   1 
ATOM   1564  O O   . SER A 1 215 ? 88.827  31.189  1.886   1.00 4.54  ? 215  SER A O   1 
ATOM   1565  C CB  . SER A 1 215 ? 86.564  33.227  0.757   1.00 4.55  ? 215  SER A CB  1 
ATOM   1566  O OG  . SER A 1 215 ? 86.094  34.555  0.530   1.00 5.89  ? 215  SER A OG  1 
ATOM   1567  N N   . PHE A 1 216 ? 87.110  31.360  3.277   1.00 6.29  ? 216  PHE A N   1 
ATOM   1568  C CA  . PHE A 1 216 ? 87.184  30.016  3.806   1.00 6.03  ? 216  PHE A CA  1 
ATOM   1569  C C   . PHE A 1 216 ? 85.778  29.377  3.756   1.00 7.57  ? 216  PHE A C   1 
ATOM   1570  O O   . PHE A 1 216 ? 84.765  30.064  3.974   1.00 5.35  ? 216  PHE A O   1 
ATOM   1571  C CB  . PHE A 1 216 ? 87.671  29.895  5.239   1.00 4.72  ? 216  PHE A CB  1 
ATOM   1572  C CG  . PHE A 1 216 ? 86.909  30.601  6.319   1.00 6.60  ? 216  PHE A CG  1 
ATOM   1573  C CD1 . PHE A 1 216 ? 87.075  31.963  6.539   1.00 5.15  ? 216  PHE A CD1 1 
ATOM   1574  C CD2 . PHE A 1 216 ? 86.047  29.883  7.145   1.00 4.61  ? 216  PHE A CD2 1 
ATOM   1575  C CE1 . PHE A 1 216 ? 86.342  32.602  7.530   1.00 7.00  ? 216  PHE A CE1 1 
ATOM   1576  C CE2 . PHE A 1 216 ? 85.335  30.505  8.164   1.00 5.35  ? 216  PHE A CE2 1 
ATOM   1577  C CZ  . PHE A 1 216 ? 85.488  31.871  8.352   1.00 7.30  ? 216  PHE A CZ  1 
ATOM   1578  N N   . THR A 1 217 ? 85.793  28.059  3.560   1.00 5.98  ? 217  THR A N   1 
ATOM   1579  C CA  . THR A 1 217 ? 84.494  27.362  3.594   1.00 4.93  ? 217  THR A CA  1 
ATOM   1580  C C   . THR A 1 217 ? 84.424  26.477  4.813   1.00 4.53  ? 217  THR A C   1 
ATOM   1581  O O   . THR A 1 217 ? 85.386  25.723  5.001   1.00 4.46  ? 217  THR A O   1 
ATOM   1582  C CB  . THR A 1 217 ? 84.275  26.534  2.317   1.00 5.33  ? 217  THR A CB  1 
ATOM   1583  O OG1 . THR A 1 217 ? 84.296  27.455  1.235   1.00 6.66  ? 217  THR A OG1 1 
ATOM   1584  C CG2 . THR A 1 217 ? 82.912  25.819  2.357   1.00 3.50  ? 217  THR A CG2 1 
ATOM   1585  N N   . ILE A 1 218 ? 83.334  26.487  5.565   1.00 4.22  ? 218  ILE A N   1 
ATOM   1586  C CA  . ILE A 1 218 ? 83.194  25.625  6.725   1.00 3.77  ? 218  ILE A CA  1 
ATOM   1587  C C   . ILE A 1 218 ? 81.797  24.980  6.603   1.00 5.80  ? 218  ILE A C   1 
ATOM   1588  O O   . ILE A 1 218 ? 80.770  25.653  6.512   1.00 2.45  ? 218  ILE A O   1 
ATOM   1589  C CB  . ILE A 1 218 ? 83.317  26.367  8.065   1.00 4.37  ? 218  ILE A CB  1 
ATOM   1590  C CG1 . ILE A 1 218 ? 83.141  25.347  9.223   1.00 3.88  ? 218  ILE A CG1 1 
ATOM   1591  C CG2 . ILE A 1 218 ? 82.352  27.537  8.193   1.00 3.91  ? 218  ILE A CG2 1 
ATOM   1592  C CD1 . ILE A 1 218 ? 83.387  25.915  10.603  1.00 2.46  ? 218  ILE A CD1 1 
ATOM   1593  N N   . ASP A 1 219 ? 81.756  23.661  6.440   1.00 4.89  ? 219  ASP A N   1 
ATOM   1594  C CA  . ASP A 1 219 ? 80.512  22.917  6.302   1.00 4.76  ? 219  ASP A CA  1 
ATOM   1595  C C   . ASP A 1 219 ? 79.681  23.452  5.156   1.00 5.46  ? 219  ASP A C   1 
ATOM   1596  O O   . ASP A 1 219 ? 78.498  23.718  5.359   1.00 4.14  ? 219  ASP A O   1 
ATOM   1597  C CB  . ASP A 1 219 ? 79.720  23.038  7.618   1.00 4.10  ? 219  ASP A CB  1 
ATOM   1598  C CG  . ASP A 1 219 ? 80.373  22.382  8.782   1.00 4.23  ? 219  ASP A CG  1 
ATOM   1599  O OD1 . ASP A 1 219 ? 81.289  21.538  8.577   1.00 5.58  ? 219  ASP A OD1 1 
ATOM   1600  O OD2 . ASP A 1 219 ? 80.015  22.648  9.943   1.00 5.09  ? 219  ASP A OD2 1 
ATOM   1601  N N   . SER A 1 220 ? 80.217  23.677  3.957   1.00 3.69  ? 220  SER A N   1 
ATOM   1602  C CA  . SER A 1 220 ? 79.548  24.211  2.805   1.00 3.78  ? 220  SER A CA  1 
ATOM   1603  C C   . SER A 1 220 ? 79.068  25.661  2.915   1.00 4.09  ? 220  SER A C   1 
ATOM   1604  O O   . SER A 1 220 ? 78.242  26.113  2.099   1.00 2.33  ? 220  SER A O   1 
ATOM   1605  C CB  . SER A 1 220 ? 78.323  23.347  2.407   1.00 5.73  ? 220  SER A CB  1 
ATOM   1606  O OG  . SER A 1 220 ? 78.773  22.080  1.943   1.00 6.76  ? 220  SER A OG  1 
ATOM   1607  N N   . ILE A 1 221 ? 79.518  26.392  3.904   1.00 4.07  ? 221  ILE A N   1 
ATOM   1608  C CA  . ILE A 1 221 ? 79.215  27.812  4.111   1.00 4.74  ? 221  ILE A CA  1 
ATOM   1609  C C   . ILE A 1 221 ? 80.490  28.616  3.756   1.00 5.40  ? 221  ILE A C   1 
ATOM   1610  O O   . ILE A 1 221 ? 81.535  28.531  4.409   1.00 4.43  ? 221  ILE A O   1 
ATOM   1611  C CB  . ILE A 1 221 ? 78.756  28.135  5.540   1.00 5.01  ? 221  ILE A CB  1 
ATOM   1612  C CG1 . ILE A 1 221 ? 77.599  27.185  5.951   1.00 4.02  ? 221  ILE A CG1 1 
ATOM   1613  C CG2 . ILE A 1 221 ? 78.278  29.609  5.592   1.00 4.54  ? 221  ILE A CG2 1 
ATOM   1614  C CD1 . ILE A 1 221 ? 77.429  27.058  7.454   1.00 3.12  ? 221  ILE A CD1 1 
ATOM   1615  N N   . THR A 1 222 ? 80.360  29.419  2.699   1.00 4.16  ? 222  THR A N   1 
ATOM   1616  C CA  . THR A 1 222 ? 81.553  30.159  2.243   1.00 5.52  ? 222  THR A CA  1 
ATOM   1617  C C   . THR A 1 222 ? 81.594  31.508  2.928   1.00 7.38  ? 222  THR A C   1 
ATOM   1618  O O   . THR A 1 222 ? 80.568  32.176  2.933   1.00 7.34  ? 222  THR A O   1 
ATOM   1619  C CB  . THR A 1 222 ? 81.544  30.271  0.730   1.00 5.32  ? 222  THR A CB  1 
ATOM   1620  O OG1 . THR A 1 222 ? 81.786  28.948  0.241   1.00 5.58  ? 222  THR A OG1 1 
ATOM   1621  C CG2 . THR A 1 222 ? 82.682  31.198  0.250   1.00 2.08  ? 222  THR A CG2 1 
ATOM   1622  N N   . VAL A 1 223 ? 82.722  31.802  3.580   1.00 5.34  ? 223  VAL A N   1 
ATOM   1623  C CA  . VAL A 1 223 ? 82.799  33.015  4.380   1.00 5.09  ? 223  VAL A CA  1 
ATOM   1624  C C   . VAL A 1 223 ? 83.872  33.988  3.883   1.00 7.73  ? 223  VAL A C   1 
ATOM   1625  O O   . VAL A 1 223 ? 85.045  33.617  3.910   1.00 7.70  ? 223  VAL A O   1 
ATOM   1626  C CB  . VAL A 1 223 ? 83.093  32.640  5.845   1.00 4.36  ? 223  VAL A CB  1 
ATOM   1627  C CG1 . VAL A 1 223 ? 83.065  33.904  6.713   1.00 5.13  ? 223  VAL A CG1 1 
ATOM   1628  C CG2 . VAL A 1 223 ? 82.084  31.618  6.419   1.00 3.70  ? 223  VAL A CG2 1 
ATOM   1629  N N   . GLU A 1 224 ? 83.487  35.201  3.503   1.00 5.35  ? 224  GLU A N   1 
ATOM   1630  C CA  . GLU A 1 224 ? 84.407  36.281  3.157   1.00 4.56  ? 224  GLU A CA  1 
ATOM   1631  C C   . GLU A 1 224 ? 84.736  36.999  4.471   1.00 4.24  ? 224  GLU A C   1 
ATOM   1632  O O   . GLU A 1 224 ? 83.876  37.541  5.182   1.00 2.80  ? 224  GLU A O   1 
ATOM   1633  C CB  . GLU A 1 224 ? 83.723  37.270  2.193   1.00 5.88  ? 224  GLU A CB  1 
ATOM   1634  C CG  . GLU A 1 224 ? 84.626  38.458  1.805   1.00 7.59  ? 224  GLU A CG  1 
ATOM   1635  C CD  . GLU A 1 224 ? 83.911  39.410  0.847   1.00 10.09 ? 224  GLU A CD  1 
ATOM   1636  O OE1 . GLU A 1 224 ? 82.871  39.935  1.294   1.00 8.38  ? 224  GLU A OE1 1 
ATOM   1637  O OE2 . GLU A 1 224 ? 84.325  39.633  -0.310  1.00 10.82 ? 224  GLU A OE2 1 
ATOM   1638  N N   . PRO A 1 225 ? 86.027  37.151  4.800   1.00 3.70  ? 225  PRO A N   1 
ATOM   1639  C CA  . PRO A 1 225 ? 86.452  37.722  6.046   1.00 2.14  ? 225  PRO A CA  1 
ATOM   1640  C C   . PRO A 1 225 ? 86.422  39.210  6.260   1.00 4.15  ? 225  PRO A C   1 
ATOM   1641  O O   . PRO A 1 225 ? 87.406  39.858  6.668   1.00 3.73  ? 225  PRO A O   1 
ATOM   1642  C CB  . PRO A 1 225 ? 87.850  37.129  6.289   1.00 3.20  ? 225  PRO A CB  1 
ATOM   1643  C CG  . PRO A 1 225 ? 88.357  36.915  4.905   1.00 4.88  ? 225  PRO A CG  1 
ATOM   1644  C CD  . PRO A 1 225 ? 87.153  36.554  4.034   1.00 4.60  ? 225  PRO A CD  1 
ATOM   1645  N N   . LYS A 1 226 ? 85.281  39.841  5.992   1.00 5.45  ? 226  LYS A N   1 
ATOM   1646  C CA  . LYS A 1 226 ? 85.091  41.264  6.316   1.00 4.13  ? 226  LYS A CA  1 
ATOM   1647  C C   . LYS A 1 226 ? 84.577  41.231  7.741   1.00 6.16  ? 226  LYS A C   1 
ATOM   1648  O O   . LYS A 1 226 ? 83.566  40.554  7.972   1.00 6.12  ? 226  LYS A O   1 
ATOM   1649  C CB  . LYS A 1 226 ? 84.126  41.964  5.379   1.00 5.72  ? 226  LYS A CB  1 
ATOM   1650  C CG  . LYS A 1 226 ? 84.696  42.093  3.975   1.00 6.22  ? 226  LYS A CG  1 
ATOM   1651  C CD  . LYS A 1 226 ? 83.773  43.027  3.174   1.00 9.23  ? 226  LYS A CD  1 
ATOM   1652  C CE  . LYS A 1 226 ? 84.417  43.359  1.841   1.00 10.02 ? 226  LYS A CE  1 
ATOM   1653  N NZ  . LYS A 1 226 ? 83.531  44.249  1.037   1.00 11.51 ? 226  LYS A NZ  1 
ATOM   1654  N N   . GLN A 1 227 ? 85.271  41.892  8.670   1.00 4.42  ? 227  GLN A N   1 
ATOM   1655  C CA  . GLN A 1 227 ? 84.836  41.840  10.039  1.00 4.94  ? 227  GLN A CA  1 
ATOM   1656  C C   . GLN A 1 227 ? 84.236  43.158  10.516  1.00 4.39  ? 227  GLN A C   1 
ATOM   1657  O O   . GLN A 1 227 ? 84.449  44.215  9.911   1.00 3.77  ? 227  GLN A O   1 
ATOM   1658  C CB  . GLN A 1 227 ? 86.074  41.552  10.950  1.00 4.28  ? 227  GLN A CB  1 
ATOM   1659  C CG  . GLN A 1 227 ? 87.118  42.657  10.807  1.00 4.25  ? 227  GLN A CG  1 
ATOM   1660  C CD  . GLN A 1 227 ? 88.270  42.568  11.774  1.00 4.05  ? 227  GLN A CD  1 
ATOM   1661  O OE1 . GLN A 1 227 ? 88.378  41.641  12.592  1.00 3.65  ? 227  GLN A OE1 1 
ATOM   1662  N NE2 . GLN A 1 227 ? 89.152  43.582  11.731  1.00 4.89  ? 227  GLN A NE2 1 
ATOM   1663  N N   . GLU A 1 228 ? 83.628  43.059  11.687  1.00 3.49  ? 228  GLU A N   1 
ATOM   1664  C CA  . GLU A 1 228 ? 83.198  44.262  12.390  1.00 3.67  ? 228  GLU A CA  1 
ATOM   1665  C C   . GLU A 1 228 ? 84.452  44.741  13.147  1.00 4.39  ? 228  GLU A C   1 
ATOM   1666  O O   . GLU A 1 228 ? 84.969  44.010  14.006  1.00 3.30  ? 228  GLU A O   1 
ATOM   1667  C CB  . GLU A 1 228 ? 82.123  43.943  13.426  1.00 3.25  ? 228  GLU A CB  1 
ATOM   1668  C CG  . GLU A 1 228 ? 81.639  45.182  14.147  1.00 4.46  ? 228  GLU A CG  1 
ATOM   1669  C CD  . GLU A 1 228 ? 80.384  45.026  14.986  1.00 6.73  ? 228  GLU A CD  1 
ATOM   1670  O OE1 . GLU A 1 228 ? 80.272  44.039  15.732  1.00 6.30  ? 228  GLU A OE1 1 
ATOM   1671  O OE2 . GLU A 1 228 ? 79.499  45.920  14.955  1.00 9.34  ? 228  GLU A OE2 1 
ATOM   1672  N N   . THR A 1 229 ? 84.908  45.939  12.829  1.00 5.54  ? 229  THR A N   1 
ATOM   1673  C CA  . THR A 1 229 ? 86.161  46.441  13.391  1.00 7.05  ? 229  THR A CA  1 
ATOM   1674  C C   . THR A 1 229 ? 85.993  47.662  14.270  1.00 7.47  ? 229  THR A C   1 
ATOM   1675  O O   . THR A 1 229 ? 84.919  48.247  14.356  1.00 6.48  ? 229  THR A O   1 
ATOM   1676  C CB  . THR A 1 229 ? 87.152  46.704  12.224  1.00 8.00  ? 229  THR A CB  1 
ATOM   1677  O OG1 . THR A 1 229 ? 88.443  46.957  12.781  1.00 6.85  ? 229  THR A OG1 1 
ATOM   1678  C CG2 . THR A 1 229 ? 86.765  47.878  11.319  1.00 6.04  ? 229  THR A CG2 1 
ATOM   1679  N N   . PHE A 1 230 ? 87.070  48.070  14.932  1.00 7.09  ? 230  PHE A N   1 
ATOM   1680  C CA  . PHE A 1 230 ? 87.085  49.272  15.737  1.00 5.68  ? 230  PHE A CA  1 
ATOM   1681  C C   . PHE A 1 230 ? 86.975  50.539  14.876  1.00 5.86  ? 230  PHE A C   1 
ATOM   1682  O O   . PHE A 1 230 ? 87.445  50.579  13.757  1.00 3.49  ? 230  PHE A O   1 
ATOM   1683  C CB  . PHE A 1 230 ? 88.351  49.371  16.574  1.00 4.62  ? 230  PHE A CB  1 
ATOM   1684  C CG  . PHE A 1 230 ? 88.596  48.322  17.622  1.00 5.93  ? 230  PHE A CG  1 
ATOM   1685  C CD1 . PHE A 1 230 ? 87.689  48.093  18.640  1.00 3.14  ? 230  PHE A CD1 1 
ATOM   1686  C CD2 . PHE A 1 230 ? 89.786  47.580  17.611  1.00 5.41  ? 230  PHE A CD2 1 
ATOM   1687  C CE1 . PHE A 1 230 ? 87.936  47.107  19.587  1.00 5.10  ? 230  PHE A CE1 1 
ATOM   1688  C CE2 . PHE A 1 230 ? 90.050  46.636  18.578  1.00 2.08  ? 230  PHE A CE2 1 
ATOM   1689  C CZ  . PHE A 1 230 ? 89.125  46.390  19.582  1.00 3.88  ? 230  PHE A CZ  1 
ATOM   1690  N N   . ALA A 1 231 ? 86.398  51.609  15.449  1.00 7.12  ? 231  ALA A N   1 
ATOM   1691  C CA  . ALA A 1 231 ? 86.357  52.906  14.776  1.00 8.07  ? 231  ALA A CA  1 
ATOM   1692  C C   . ALA A 1 231 ? 87.770  53.493  14.851  1.00 8.50  ? 231  ALA A C   1 
ATOM   1693  O O   . ALA A 1 231 ? 88.518  53.205  15.787  1.00 8.77  ? 231  ALA A O   1 
ATOM   1694  C CB  . ALA A 1 231 ? 85.354  53.817  15.518  1.00 7.54  ? 231  ALA A CB  1 
ATOM   1695  N N   . PRO A 1 232 ? 88.163  54.298  13.883  1.00 9.14  ? 232  PRO A N   1 
ATOM   1696  C CA  . PRO A 1 232 ? 89.477  54.902  13.869  1.00 10.90 ? 232  PRO A CA  1 
ATOM   1697  C C   . PRO A 1 232 ? 89.582  55.997  14.907  1.00 11.97 ? 232  PRO A C   1 
ATOM   1698  O O   . PRO A 1 232 ? 88.608  56.513  15.456  1.00 8.64  ? 232  PRO A O   1 
ATOM   1699  C CB  . PRO A 1 232 ? 89.628  55.532  12.490  1.00 10.49 ? 232  PRO A CB  1 
ATOM   1700  C CG  . PRO A 1 232 ? 88.214  55.707  12.014  1.00 11.03 ? 232  PRO A CG  1 
ATOM   1701  C CD  . PRO A 1 232 ? 87.370  54.675  12.701  1.00 9.20  ? 232  PRO A CD  1 
ATOM   1702  N N   . ASP A 1 233 ? 90.842  56.385  15.132  1.00 12.26 ? 233  ASP A N   1 
ATOM   1703  C CA  . ASP A 1 233 ? 91.195  57.529  15.937  1.00 12.35 ? 233  ASP A CA  1 
ATOM   1704  C C   . ASP A 1 233 ? 90.828  57.628  17.378  1.00 13.21 ? 233  ASP A C   1 
ATOM   1705  O O   . ASP A 1 233 ? 91.195  58.692  17.929  1.00 19.07 ? 233  ASP A O   1 
ATOM   1706  C CB  . ASP A 1 233 ? 90.579  58.814  15.296  1.00 11.61 ? 233  ASP A CB  1 
ATOM   1707  C CG  . ASP A 1 233 ? 91.048  58.947  13.875  1.00 11.86 ? 233  ASP A CG  1 
ATOM   1708  O OD1 . ASP A 1 233 ? 92.227  58.722  13.564  1.00 13.83 ? 233  ASP A OD1 1 
ATOM   1709  O OD2 . ASP A 1 233 ? 90.224  59.257  12.994  1.00 14.72 ? 233  ASP A OD2 1 
ATOM   1710  N N   . VAL A 1 234 ? 90.093  56.757  18.014  1.00 9.72  ? 234  VAL A N   1 
ATOM   1711  C CA  . VAL A 1 234 ? 89.807  56.919  19.426  1.00 7.24  ? 234  VAL A CA  1 
ATOM   1712  C C   . VAL A 1 234 ? 90.644  55.879  20.163  1.00 5.96  ? 234  VAL A C   1 
ATOM   1713  O O   . VAL A 1 234 ? 90.676  54.731  19.693  1.00 5.83  ? 234  VAL A O   1 
ATOM   1714  C CB  . VAL A 1 234 ? 88.310  56.718  19.709  1.00 8.95  ? 234  VAL A CB  1 
ATOM   1715  C CG1 . VAL A 1 234 ? 87.992  56.878  21.181  1.00 7.92  ? 234  VAL A CG1 1 
ATOM   1716  C CG2 . VAL A 1 234 ? 87.462  57.727  18.908  1.00 10.13 ? 234  VAL A CG2 1 
ATOM   1717  N N   . ASN A 1 235 ? 91.318  56.232  21.233  1.00 5.54  ? 235  ASN A N   1 
ATOM   1718  C CA  . ASN A 1 235 ? 92.057  55.242  22.029  1.00 5.32  ? 235  ASN A CA  1 
ATOM   1719  C C   . ASN A 1 235 ? 91.523  55.359  23.437  1.00 5.83  ? 235  ASN A C   1 
ATOM   1720  O O   . ASN A 1 235 ? 90.669  56.228  23.717  1.00 5.95  ? 235  ASN A O   1 
ATOM   1721  C CB  . ASN A 1 235 ? 93.563  55.499  22.070  1.00 4.95  ? 235  ASN A CB  1 
ATOM   1722  C CG  . ASN A 1 235 ? 94.124  55.379  20.667  1.00 5.22  ? 235  ASN A CG  1 
ATOM   1723  O OD1 . ASN A 1 235 ? 93.919  54.344  20.030  1.00 5.75  ? 235  ASN A OD1 1 
ATOM   1724  N ND2 . ASN A 1 235 ? 94.775  56.429  20.176  1.00 3.85  ? 235  ASN A ND2 1 
ATOM   1725  N N   . TYR A 1 236 ? 91.883  54.452  24.329  1.00 3.33  ? 236  TYR A N   1 
ATOM   1726  C CA  . TYR A 1 236 ? 91.374  54.404  25.689  1.00 3.76  ? 236  TYR A CA  1 
ATOM   1727  C C   . TYR A 1 236 ? 92.479  54.398  26.701  1.00 3.14  ? 236  TYR A C   1 
ATOM   1728  O O   . TYR A 1 236 ? 93.652  54.181  26.288  1.00 2.32  ? 236  TYR A O   1 
ATOM   1729  C CB  . TYR A 1 236 ? 90.479  53.130  25.923  1.00 3.68  ? 236  TYR A CB  1 
ATOM   1730  C CG  . TYR A 1 236 ? 89.471  53.112  24.775  1.00 4.90  ? 236  TYR A CG  1 
ATOM   1731  C CD1 . TYR A 1 236 ? 88.345  53.938  24.766  1.00 4.39  ? 236  TYR A CD1 1 
ATOM   1732  C CD2 . TYR A 1 236 ? 89.771  52.357  23.642  1.00 4.35  ? 236  TYR A CD2 1 
ATOM   1733  C CE1 . TYR A 1 236 ? 87.489  53.921  23.661  1.00 5.91  ? 236  TYR A CE1 1 
ATOM   1734  C CE2 . TYR A 1 236 ? 88.938  52.360  22.557  1.00 6.18  ? 236  TYR A CE2 1 
ATOM   1735  C CZ  . TYR A 1 236 ? 87.781  53.132  22.575  1.00 6.32  ? 236  TYR A CZ  1 
ATOM   1736  O OH  . TYR A 1 236 ? 86.978  53.098  21.455  1.00 7.26  ? 236  TYR A OH  1 
ATOM   1737  N N   . MET A 1 237 ? 92.200  54.569  27.952  1.00 2.08  ? 237  MET A N   1 
ATOM   1738  C CA  . MET A 1 237 ? 93.097  54.621  29.080  1.00 5.25  ? 237  MET A CA  1 
ATOM   1739  C C   . MET A 1 237 ? 94.174  55.707  29.008  1.00 5.57  ? 237  MET A C   1 
ATOM   1740  O O   . MET A 1 237 ? 95.316  55.448  29.432  1.00 3.41  ? 237  MET A O   1 
ATOM   1741  C CB  . MET A 1 237 ? 93.761  53.219  29.258  1.00 5.10  ? 237  MET A CB  1 
ATOM   1742  C CG  . MET A 1 237 ? 92.762  52.218  29.868  1.00 6.37  ? 237  MET A CG  1 
ATOM   1743  S SD  . MET A 1 237 ? 93.331  50.501  29.841  1.00 2.58  ? 237  MET A SD  1 
ATOM   1744  C CE  . MET A 1 237 ? 94.757  50.669  30.890  1.00 3.79  ? 237  MET A CE  1 
ATOM   1745  N N   . VAL A 1 238 ? 93.857  56.865  28.423  1.00 4.84  ? 238  VAL A N   1 
ATOM   1746  C CA  . VAL A 1 238 ? 94.823  57.955  28.265  1.00 6.04  ? 238  VAL A CA  1 
ATOM   1747  C C   . VAL A 1 238 ? 94.488  59.119  29.194  1.00 7.48  ? 238  VAL A C   1 
ATOM   1748  O O   . VAL A 1 238 ? 95.230  60.072  29.379  1.00 6.19  ? 238  VAL A O   1 
ATOM   1749  C CB  . VAL A 1 238 ? 94.965  58.440  26.829  1.00 6.46  ? 238  VAL A CB  1 
ATOM   1750  C CG1 . VAL A 1 238 ? 95.587  57.302  25.995  1.00 5.81  ? 238  VAL A CG1 1 
ATOM   1751  C CG2 . VAL A 1 238 ? 93.638  58.873  26.214  1.00 5.23  ? 238  VAL A CG2 1 
ATOM   1752  N N   . ASP A 1 239 ? 93.344  59.004  29.856  1.00 6.88  ? 239  ASP A N   1 
ATOM   1753  C CA  . ASP A 1 239 ? 92.928  59.879  30.942  1.00 7.24  ? 239  ASP A CA  1 
ATOM   1754  C C   . ASP A 1 239 ? 93.514  59.177  32.158  1.00 6.97  ? 239  ASP A C   1 
ATOM   1755  O O   . ASP A 1 239 ? 93.335  57.956  32.339  1.00 6.70  ? 239  ASP A O   1 
ATOM   1756  C CB  . ASP A 1 239 ? 91.394  59.971  31.022  1.00 7.65  ? 239  ASP A CB  1 
ATOM   1757  C CG  . ASP A 1 239 ? 90.946  60.511  32.359  1.00 8.71  ? 239  ASP A CG  1 
ATOM   1758  O OD1 . ASP A 1 239 ? 90.758  59.749  33.309  1.00 7.48  ? 239  ASP A OD1 1 
ATOM   1759  O OD2 . ASP A 1 239 ? 90.781  61.754  32.437  1.00 12.64 ? 239  ASP A OD2 1 
ATOM   1760  N N   . PHE A 1 240 ? 94.270  59.866  32.979  1.00 7.03  ? 240  PHE A N   1 
ATOM   1761  C CA  . PHE A 1 240 ? 94.965  59.300  34.112  1.00 5.80  ? 240  PHE A CA  1 
ATOM   1762  C C   . PHE A 1 240 ? 94.070  58.533  35.070  1.00 6.74  ? 240  PHE A C   1 
ATOM   1763  O O   . PHE A 1 240 ? 94.438  57.406  35.484  1.00 5.70  ? 240  PHE A O   1 
ATOM   1764  C CB  . PHE A 1 240 ? 95.727  60.399  34.905  1.00 7.23  ? 240  PHE A CB  1 
ATOM   1765  C CG  . PHE A 1 240 ? 96.591  59.707  35.957  1.00 6.53  ? 240  PHE A CG  1 
ATOM   1766  C CD1 . PHE A 1 240 ? 97.803  59.154  35.579  1.00 5.98  ? 240  PHE A CD1 1 
ATOM   1767  C CD2 . PHE A 1 240 ? 96.179  59.625  37.255  1.00 6.16  ? 240  PHE A CD2 1 
ATOM   1768  C CE1 . PHE A 1 240 ? 98.591  58.507  36.516  1.00 6.19  ? 240  PHE A CE1 1 
ATOM   1769  C CE2 . PHE A 1 240 ? 96.967  58.975  38.192  1.00 7.33  ? 240  PHE A CE2 1 
ATOM   1770  C CZ  . PHE A 1 240 ? 98.178  58.407  37.826  1.00 7.16  ? 240  PHE A CZ  1 
ATOM   1771  N N   . ASP A 1 241 ? 92.958  59.120  35.536  1.00 4.08  ? 241  ASP A N   1 
ATOM   1772  C CA  . ASP A 1 241 ? 92.119  58.388  36.482  1.00 5.13  ? 241  ASP A CA  1 
ATOM   1773  C C   . ASP A 1 241 ? 91.602  57.084  35.831  1.00 2.38  ? 241  ASP A C   1 
ATOM   1774  O O   . ASP A 1 241 ? 91.484  56.097  36.585  1.00 2.72  ? 241  ASP A O   1 
ATOM   1775  C CB  . ASP A 1 241 ? 90.958  59.197  37.044  1.00 8.36  ? 241  ASP A CB  1 
ATOM   1776  C CG  . ASP A 1 241 ? 91.369  60.388  37.916  1.00 12.87 ? 241  ASP A CG  1 
ATOM   1777  O OD1 . ASP A 1 241 ? 92.424  60.446  38.607  1.00 13.48 ? 241  ASP A OD1 1 
ATOM   1778  O OD2 . ASP A 1 241 ? 90.587  61.363  37.924  1.00 13.52 ? 241  ASP A OD2 1 
ATOM   1779  N N   . GLU A 1 242 ? 91.229  57.059  34.589  1.00 4.37  ? 242  GLU A N   1 
ATOM   1780  C CA  . GLU A 1 242 ? 90.734  55.863  33.901  1.00 4.73  ? 242  GLU A CA  1 
ATOM   1781  C C   . GLU A 1 242 ? 91.848  54.792  33.877  1.00 6.55  ? 242  GLU A C   1 
ATOM   1782  O O   . GLU A 1 242 ? 91.612  53.638  34.240  1.00 4.79  ? 242  GLU A O   1 
ATOM   1783  C CB  . GLU A 1 242 ? 90.268  56.175  32.484  1.00 5.46  ? 242  GLU A CB  1 
ATOM   1784  C CG  . GLU A 1 242 ? 88.943  56.929  32.415  1.00 8.96  ? 242  GLU A CG  1 
ATOM   1785  C CD  . GLU A 1 242 ? 88.475  57.220  31.016  1.00 10.57 ? 242  GLU A CD  1 
ATOM   1786  O OE1 . GLU A 1 242 ? 89.001  56.761  29.981  1.00 11.80 ? 242  GLU A OE1 1 
ATOM   1787  O OE2 . GLU A 1 242 ? 87.527  58.029  30.867  1.00 14.17 ? 242  GLU A OE2 1 
ATOM   1788  N N   . TRP A 1 243 ? 93.059  55.231  33.531  1.00 6.38  ? 243  TRP A N   1 
ATOM   1789  C CA  . TRP A 1 243 ? 94.241  54.363  33.580  1.00 6.03  ? 243  TRP A CA  1 
ATOM   1790  C C   . TRP A 1 243 ? 94.409  53.793  34.967  1.00 4.53  ? 243  TRP A C   1 
ATOM   1791  O O   . TRP A 1 243 ? 94.538  52.554  35.087  1.00 7.18  ? 243  TRP A O   1 
ATOM   1792  C CB  . TRP A 1 243 ? 95.515  55.125  33.111  1.00 4.43  ? 243  TRP A CB  1 
ATOM   1793  C CG  . TRP A 1 243 ? 96.765  54.324  33.373  1.00 3.23  ? 243  TRP A CG  1 
ATOM   1794  C CD1 . TRP A 1 243 ? 97.260  53.363  32.532  1.00 2.40  ? 243  TRP A CD1 1 
ATOM   1795  C CD2 . TRP A 1 243 ? 97.579  54.315  34.544  1.00 3.81  ? 243  TRP A CD2 1 
ATOM   1796  N NE1 . TRP A 1 243 ? 98.346  52.765  33.132  1.00 3.73  ? 243  TRP A NE1 1 
ATOM   1797  C CE2 . TRP A 1 243 ? 98.573  53.352  34.352  1.00 2.55  ? 243  TRP A CE2 1 
ATOM   1798  C CE3 . TRP A 1 243 ? 97.602  55.070  35.721  1.00 2.48  ? 243  TRP A CE3 1 
ATOM   1799  C CZ2 . TRP A 1 243 ? 99.585  53.089  35.271  1.00 3.13  ? 243  TRP A CZ2 1 
ATOM   1800  C CZ3 . TRP A 1 243 ? 98.605  54.816  36.647  1.00 4.52  ? 243  TRP A CZ3 1 
ATOM   1801  C CH2 . TRP A 1 243 ? 99.572  53.813  36.435  1.00 4.33  ? 243  TRP A CH2 1 
ATOM   1802  N N   . LEU A 1 244 ? 94.443  54.551  36.047  1.00 2.92  ? 244  LEU A N   1 
ATOM   1803  C CA  . LEU A 1 244 ? 94.662  54.070  37.396  1.00 5.03  ? 244  LEU A CA  1 
ATOM   1804  C C   . LEU A 1 244 ? 93.581  53.084  37.840  1.00 4.80  ? 244  LEU A C   1 
ATOM   1805  O O   . LEU A 1 244 ? 93.835  52.053  38.487  1.00 3.54  ? 244  LEU A O   1 
ATOM   1806  C CB  . LEU A 1 244 ? 94.654  55.169  38.449  1.00 6.22  ? 244  LEU A CB  1 
ATOM   1807  C CG  . LEU A 1 244 ? 95.625  55.308  39.581  1.00 9.71  ? 244  LEU A CG  1 
ATOM   1808  C CD1 . LEU A 1 244 ? 95.003  56.049  40.769  1.00 8.82  ? 244  LEU A CD1 1 
ATOM   1809  C CD2 . LEU A 1 244 ? 96.383  54.057  39.993  1.00 8.09  ? 244  LEU A CD2 1 
ATOM   1810  N N   . ASN A 1 245 ? 92.334  53.470  37.577  1.00 4.32  ? 245  ASN A N   1 
ATOM   1811  C CA  . ASN A 1 245 ? 91.197  52.585  37.864  1.00 5.37  ? 245  ASN A CA  1 
ATOM   1812  C C   . ASN A 1 245 ? 91.418  51.194  37.217  1.00 5.46  ? 245  ASN A C   1 
ATOM   1813  O O   . ASN A 1 245 ? 91.092  50.174  37.855  1.00 3.79  ? 245  ASN A O   1 
ATOM   1814  C CB  . ASN A 1 245 ? 89.900  53.256  37.381  1.00 4.35  ? 245  ASN A CB  1 
ATOM   1815  C CG  . ASN A 1 245 ? 88.757  52.240  37.367  1.00 4.63  ? 245  ASN A CG  1 
ATOM   1816  O OD1 . ASN A 1 245 ? 88.253  51.861  38.422  1.00 5.02  ? 245  ASN A OD1 1 
ATOM   1817  N ND2 . ASN A 1 245 ? 88.420  51.758  36.190  1.00 5.75  ? 245  ASN A ND2 1 
ATOM   1818  N N   . ILE A 1 246 ? 91.850  51.121  35.975  1.00 4.00  ? 246  ILE A N   1 
ATOM   1819  C CA  . ILE A 1 246 ? 92.133  49.825  35.319  1.00 5.04  ? 246  ILE A CA  1 
ATOM   1820  C C   . ILE A 1 246 ? 93.291  49.097  35.992  1.00 5.64  ? 246  ILE A C   1 
ATOM   1821  O O   . ILE A 1 246 ? 93.176  47.906  36.270  1.00 5.32  ? 246  ILE A O   1 
ATOM   1822  C CB  . ILE A 1 246 ? 92.422  50.023  33.824  1.00 4.49  ? 246  ILE A CB  1 
ATOM   1823  C CG1 . ILE A 1 246 ? 91.135  50.401  33.081  1.00 3.46  ? 246  ILE A CG1 1 
ATOM   1824  C CG2 . ILE A 1 246 ? 93.067  48.812  33.140  1.00 2.94  ? 246  ILE A CG2 1 
ATOM   1825  C CD1 . ILE A 1 246 ? 90.061  49.313  33.103  1.00 6.28  ? 246  ILE A CD1 1 
ATOM   1826  N N   . GLN A 1 247 ? 94.359  49.780  36.445  1.00 2.50  ? 247  GLN A N   1 
ATOM   1827  C CA  . GLN A 1 247 ? 95.456  49.096  37.149  1.00 3.88  ? 247  GLN A CA  1 
ATOM   1828  C C   . GLN A 1 247 ? 95.019  48.565  38.490  1.00 3.10  ? 247  GLN A C   1 
ATOM   1829  O O   . GLN A 1 247 ? 95.510  47.533  38.954  1.00 2.49  ? 247  GLN A O   1 
ATOM   1830  C CB  . GLN A 1 247 ? 96.698  49.998  37.338  1.00 3.63  ? 247  GLN A CB  1 
ATOM   1831  C CG  . GLN A 1 247 ? 97.152  50.664  36.059  1.00 3.50  ? 247  GLN A CG  1 
ATOM   1832  C CD  . GLN A 1 247 ? 97.291  49.623  34.958  1.00 4.37  ? 247  GLN A CD  1 
ATOM   1833  O OE1 . GLN A 1 247 ? 98.022  48.648  35.158  1.00 4.86  ? 247  GLN A OE1 1 
ATOM   1834  N NE2 . GLN A 1 247 ? 96.614  49.754  33.823  1.00 4.29  ? 247  GLN A NE2 1 
ATOM   1835  N N   . ASN A 1 248 ? 94.101  49.232  39.160  1.00 3.07  ? 248  ASN A N   1 
ATOM   1836  C CA  . ASN A 1 248 ? 93.543  48.820  40.421  1.00 2.49  ? 248  ASN A CA  1 
ATOM   1837  C C   . ASN A 1 248 ? 92.472  47.745  40.247  1.00 3.42  ? 248  ASN A C   1 
ATOM   1838  O O   . ASN A 1 248 ? 91.822  47.354  41.226  1.00 3.28  ? 248  ASN A O   1 
ATOM   1839  C CB  . ASN A 1 248 ? 93.007  50.076  41.145  1.00 3.87  ? 248  ASN A CB  1 
ATOM   1840  C CG  . ASN A 1 248 ? 94.075  50.945  41.766  1.00 2.08  ? 248  ASN A CG  1 
ATOM   1841  O OD1 . ASN A 1 248 ? 95.136  50.437  42.188  1.00 2.94  ? 248  ASN A OD1 1 
ATOM   1842  N ND2 . ASN A 1 248 ? 93.824  52.267  41.840  1.00 2.08  ? 248  ASN A ND2 1 
ATOM   1843  N N   . GLY A 1 249 ? 92.160  47.215  39.066  1.00 3.26  ? 249  GLY A N   1 
ATOM   1844  C CA  . GLY A 1 249 ? 91.190  46.122  38.970  1.00 6.54  ? 249  GLY A CA  1 
ATOM   1845  C C   . GLY A 1 249 ? 89.731  46.511  38.726  1.00 8.31  ? 249  GLY A C   1 
ATOM   1846  O O   . GLY A 1 249 ? 88.821  45.664  38.816  1.00 7.70  ? 249  GLY A O   1 
ATOM   1847  N N   . GLY A 1 250 ? 89.467  47.782  38.498  1.00 7.09  ? 250  GLY A N   1 
ATOM   1848  C CA  . GLY A 1 250 ? 88.133  48.326  38.281  1.00 6.50  ? 250  GLY A CA  1 
ATOM   1849  C C   . GLY A 1 250 ? 87.647  48.089  36.855  1.00 6.88  ? 250  GLY A C   1 
ATOM   1850  O O   . GLY A 1 250 ? 88.378  47.705  35.920  1.00 3.62  ? 250  GLY A O   1 
ATOM   1851  N N   . PRO A 1 251 ? 86.338  48.299  36.680  1.00 7.14  ? 251  PRO A N   1 
ATOM   1852  C CA  . PRO A 1 251 ? 85.690  48.085  35.395  1.00 5.98  ? 251  PRO A CA  1 
ATOM   1853  C C   . PRO A 1 251 ? 86.117  49.069  34.335  1.00 5.03  ? 251  PRO A C   1 
ATOM   1854  O O   . PRO A 1 251 ? 86.484  50.207  34.605  1.00 5.65  ? 251  PRO A O   1 
ATOM   1855  C CB  . PRO A 1 251 ? 84.181  48.225  35.687  1.00 6.73  ? 251  PRO A CB  1 
ATOM   1856  C CG  . PRO A 1 251 ? 84.173  49.153  36.856  1.00 8.07  ? 251  PRO A CG  1 
ATOM   1857  C CD  . PRO A 1 251 ? 85.368  48.739  37.695  1.00 7.20  ? 251  PRO A CD  1 
ATOM   1858  N N   . PRO A 1 252 ? 86.031  48.650  33.079  1.00 3.18  ? 252  PRO A N   1 
ATOM   1859  C CA  . PRO A 1 252 ? 86.348  49.499  31.945  1.00 3.97  ? 252  PRO A CA  1 
ATOM   1860  C C   . PRO A 1 252 ? 85.427  50.722  31.950  1.00 7.09  ? 252  PRO A C   1 
ATOM   1861  O O   . PRO A 1 252 ? 84.316  50.623  32.481  1.00 3.60  ? 252  PRO A O   1 
ATOM   1862  C CB  . PRO A 1 252 ? 86.041  48.624  30.748  1.00 2.68  ? 252  PRO A CB  1 
ATOM   1863  C CG  . PRO A 1 252 ? 86.108  47.217  31.270  1.00 3.40  ? 252  PRO A CG  1 
ATOM   1864  C CD  . PRO A 1 252 ? 85.566  47.303  32.666  1.00 4.01  ? 252  PRO A CD  1 
ATOM   1865  N N   . ALA A 1 253 ? 85.859  51.797  31.307  1.00 6.08  ? 253  ALA A N   1 
ATOM   1866  C CA  . ALA A 1 253 ? 85.098  53.040  31.298  1.00 8.68  ? 253  ALA A CA  1 
ATOM   1867  C C   . ALA A 1 253 ? 83.855  52.936  30.429  1.00 8.46  ? 253  ALA A C   1 
ATOM   1868  O O   . ALA A 1 253 ? 82.908  53.703  30.586  1.00 7.63  ? 253  ALA A O   1 
ATOM   1869  C CB  . ALA A 1 253 ? 86.043  54.144  30.784  1.00 8.61  ? 253  ALA A CB  1 
ATOM   1870  N N   . GLY A 1 254 ? 83.818  51.944  29.532  1.00 6.28  ? 254  GLY A N   1 
ATOM   1871  C CA  . GLY A 1 254 ? 82.684  51.783  28.619  1.00 3.80  ? 254  GLY A CA  1 
ATOM   1872  C C   . GLY A 1 254 ? 83.126  50.823  27.525  1.00 8.77  ? 254  GLY A C   1 
ATOM   1873  O O   . GLY A 1 254 ? 84.222  50.209  27.629  1.00 7.63  ? 254  GLY A O   1 
ATOM   1874  N N   . PRO A 1 255 ? 82.355  50.703  26.462  1.00 9.85  ? 255  PRO A N   1 
ATOM   1875  C CA  . PRO A 1 255 ? 82.683  49.815  25.359  1.00 8.95  ? 255  PRO A CA  1 
ATOM   1876  C C   . PRO A 1 255 ? 83.556  50.552  24.366  1.00 8.45  ? 255  PRO A C   1 
ATOM   1877  O O   . PRO A 1 255 ? 83.652  51.793  24.478  1.00 6.96  ? 255  PRO A O   1 
ATOM   1878  C CB  . PRO A 1 255 ? 81.319  49.613  24.667  1.00 11.22 ? 255  PRO A CB  1 
ATOM   1879  C CG  . PRO A 1 255 ? 80.704  50.984  24.806  1.00 10.40 ? 255  PRO A CG  1 
ATOM   1880  C CD  . PRO A 1 255 ? 81.030  51.347  26.242  1.00 11.11 ? 255  PRO A CD  1 
ATOM   1881  N N   . GLU A 1 256 ? 84.110  49.795  23.412  1.00 6.82  ? 256  GLU A N   1 
ATOM   1882  C CA  . GLU A 1 256 ? 84.898  50.485  22.393  1.00 5.93  ? 256  GLU A CA  1 
ATOM   1883  C C   . GLU A 1 256 ? 83.928  50.892  21.278  1.00 7.60  ? 256  GLU A C   1 
ATOM   1884  O O   . GLU A 1 256 ? 82.995  50.155  20.977  1.00 6.55  ? 256  GLU A O   1 
ATOM   1885  C CB  . GLU A 1 256 ? 85.998  49.619  21.787  1.00 3.15  ? 256  GLU A CB  1 
ATOM   1886  C CG  . GLU A 1 256 ? 87.097  49.107  22.733  1.00 3.76  ? 256  GLU A CG  1 
ATOM   1887  C CD  . GLU A 1 256 ? 86.699  48.062  23.730  1.00 4.76  ? 256  GLU A CD  1 
ATOM   1888  O OE1 . GLU A 1 256 ? 85.820  47.216  23.378  1.00 7.04  ? 256  GLU A OE1 1 
ATOM   1889  O OE2 . GLU A 1 256 ? 87.191  47.947  24.898  1.00 3.93  ? 256  GLU A OE2 1 
ATOM   1890  N N   . LEU A 1 257 ? 84.210  52.035  20.660  1.00 8.11  ? 257  LEU A N   1 
ATOM   1891  C CA  . LEU A 1 257 ? 83.559  52.541  19.495  1.00 9.17  ? 257  LEU A CA  1 
ATOM   1892  C C   . LEU A 1 257 ? 83.848  51.618  18.310  1.00 7.92  ? 257  LEU A C   1 
ATOM   1893  O O   . LEU A 1 257 ? 85.009  51.342  18.024  1.00 5.75  ? 257  LEU A O   1 
ATOM   1894  C CB  . LEU A 1 257 ? 84.155  53.888  19.087  1.00 13.64 ? 257  LEU A CB  1 
ATOM   1895  C CG  . LEU A 1 257 ? 83.285  55.130  19.170  1.00 19.36 ? 257  LEU A CG  1 
ATOM   1896  C CD1 . LEU A 1 257 ? 82.345  55.155  17.965  1.00 20.47 ? 257  LEU A CD1 1 
ATOM   1897  C CD2 . LEU A 1 257 ? 82.509  55.169  20.486  1.00 21.04 ? 257  LEU A CD2 1 
ATOM   1898  N N   . LEU A 1 258 ? 82.826  51.256  17.538  1.00 5.99  ? 258  LEU A N   1 
ATOM   1899  C CA  . LEU A 1 258 ? 83.009  50.348  16.424  1.00 8.03  ? 258  LEU A CA  1 
ATOM   1900  C C   . LEU A 1 258 ? 82.680  51.023  15.112  1.00 8.96  ? 258  LEU A C   1 
ATOM   1901  O O   . LEU A 1 258 ? 81.887  51.965  15.069  1.00 7.13  ? 258  LEU A O   1 
ATOM   1902  C CB  . LEU A 1 258 ? 82.151  49.067  16.592  1.00 8.87  ? 258  LEU A CB  1 
ATOM   1903  C CG  . LEU A 1 258 ? 82.393  48.171  17.803  1.00 9.10  ? 258  LEU A CG  1 
ATOM   1904  C CD1 . LEU A 1 258 ? 81.450  46.950  17.885  1.00 7.65  ? 258  LEU A CD1 1 
ATOM   1905  C CD2 . LEU A 1 258 ? 83.814  47.625  17.851  1.00 9.01  ? 258  LEU A CD2 1 
ATOM   1906  N N   . ASP A 1 259 ? 83.266  50.528  14.029  1.00 8.98  ? 259  ASP A N   1 
ATOM   1907  C CA  . ASP A 1 259 ? 82.987  51.087  12.717  1.00 10.44 ? 259  ASP A CA  1 
ATOM   1908  C C   . ASP A 1 259 ? 81.669  50.489  12.203  1.00 11.21 ? 259  ASP A C   1 
ATOM   1909  O O   . ASP A 1 259 ? 81.475  49.267  12.266  1.00 9.96  ? 259  ASP A O   1 
ATOM   1910  C CB  . ASP A 1 259 ? 84.134  50.742  11.788  1.00 10.33 ? 259  ASP A CB  1 
ATOM   1911  C CG  . ASP A 1 259 ? 84.153  51.367  10.421  1.00 11.70 ? 259  ASP A CG  1 
ATOM   1912  O OD1 . ASP A 1 259 ? 83.114  51.694  9.829   1.00 11.23 ? 259  ASP A OD1 1 
ATOM   1913  O OD2 . ASP A 1 259 ? 85.254  51.547  9.839   1.00 13.67 ? 259  ASP A OD2 1 
ATOM   1914  N N   . ASP A 1 260 ? 80.840  51.300  11.564  1.00 11.83 ? 260  ASP A N   1 
ATOM   1915  C CA  . ASP A 1 260 ? 79.622  50.828  10.934  1.00 14.58 ? 260  ASP A CA  1 
ATOM   1916  C C   . ASP A 1 260 ? 79.877  49.973  9.698   1.00 12.89 ? 260  ASP A C   1 
ATOM   1917  O O   . ASP A 1 260 ? 78.937  49.253  9.332   1.00 12.52 ? 260  ASP A O   1 
ATOM   1918  C CB  . ASP A 1 260 ? 78.705  51.963  10.458  1.00 19.72 ? 260  ASP A CB  1 
ATOM   1919  C CG  . ASP A 1 260 ? 78.007  52.739  11.551  1.00 24.21 ? 260  ASP A CG  1 
ATOM   1920  O OD1 . ASP A 1 260 ? 77.730  52.188  12.648  1.00 26.19 ? 260  ASP A OD1 1 
ATOM   1921  O OD2 . ASP A 1 260 ? 77.755  53.950  11.317  1.00 26.27 ? 260  ASP A OD2 1 
ATOM   1922  N N   . GLU A 1 261 ? 80.999  50.050  9.013   1.00 11.75 ? 261  GLU A N   1 
ATOM   1923  C CA  . GLU A 1 261 ? 81.236  49.271  7.821   1.00 12.59 ? 261  GLU A CA  1 
ATOM   1924  C C   . GLU A 1 261 ? 82.145  48.073  8.099   1.00 12.20 ? 261  GLU A C   1 
ATOM   1925  O O   . GLU A 1 261 ? 83.198  48.196  8.719   1.00 11.08 ? 261  GLU A O   1 
ATOM   1926  C CB  . GLU A 1 261 ? 81.863  50.083  6.693   1.00 16.50 ? 261  GLU A CB  1 
ATOM   1927  C CG  . GLU A 1 261 ? 80.868  51.042  6.038   1.00 22.78 ? 261  GLU A CG  1 
ATOM   1928  C CD  . GLU A 1 261 ? 81.577  51.985  5.075   1.00 26.56 ? 261  GLU A CD  1 
ATOM   1929  O OE1 . GLU A 1 261 ? 81.854  51.571  3.921   1.00 28.53 ? 261  GLU A OE1 1 
ATOM   1930  O OE2 . GLU A 1 261 ? 81.860  53.138  5.497   1.00 28.01 ? 261  GLU A OE2 1 
ATOM   1931  N N   . LEU A 1 262 ? 81.694  46.921  7.618   1.00 10.42 ? 262  LEU A N   1 
ATOM   1932  C CA  . LEU A 1 262 ? 82.453  45.667  7.707   1.00 9.62  ? 262  LEU A CA  1 
ATOM   1933  C C   . LEU A 1 262 ? 83.654  45.757  6.790   1.00 8.30  ? 262  LEU A C   1 
ATOM   1934  O O   . LEU A 1 262 ? 83.525  46.216  5.658   1.00 6.76  ? 262  LEU A O   1 
ATOM   1935  C CB  . LEU A 1 262 ? 81.552  44.505  7.266   1.00 9.31  ? 262  LEU A CB  1 
ATOM   1936  C CG  . LEU A 1 262 ? 80.785  43.778  8.369   1.00 10.49 ? 262  LEU A CG  1 
ATOM   1937  C CD1 . LEU A 1 262 ? 80.552  44.490  9.686   1.00 8.39  ? 262  LEU A CD1 1 
ATOM   1938  C CD2 . LEU A 1 262 ? 79.483  43.194  7.856   1.00 11.04 ? 262  LEU A CD2 1 
ATOM   1939  N N   . ARG A 1 263 ? 84.857  45.396  7.264   1.00 6.27  ? 263  ARG A N   1 
ATOM   1940  C CA  . ARG A 1 263 ? 86.023  45.573  6.405   1.00 5.82  ? 263  ARG A CA  1 
ATOM   1941  C C   . ARG A 1 263 ? 87.002  44.409  6.529   1.00 3.09  ? 263  ARG A C   1 
ATOM   1942  O O   . ARG A 1 263 ? 87.112  43.797  7.610   1.00 5.04  ? 263  ARG A O   1 
ATOM   1943  C CB  . ARG A 1 263 ? 86.744  46.868  6.874   1.00 4.63  ? 263  ARG A CB  1 
ATOM   1944  C CG  . ARG A 1 263 ? 86.013  48.191  6.626   1.00 6.11  ? 263  ARG A CG  1 
ATOM   1945  C CD  . ARG A 1 263 ? 86.815  49.381  7.168   1.00 6.70  ? 263  ARG A CD  1 
ATOM   1946  N NE  . ARG A 1 263 ? 85.989  50.566  7.324   1.00 7.62  ? 263  ARG A NE  1 
ATOM   1947  C CZ  . ARG A 1 263 ? 85.665  51.384  6.327   1.00 7.13  ? 263  ARG A CZ  1 
ATOM   1948  N NH1 . ARG A 1 263 ? 86.051  51.187  5.081   1.00 7.37  ? 263  ARG A NH1 1 
ATOM   1949  N NH2 . ARG A 1 263 ? 84.880  52.419  6.605   1.00 9.77  ? 263  ARG A NH2 1 
ATOM   1950  N N   . PHE A 1 264 ? 87.771  44.183  5.491   1.00 5.24  ? 264  PHE A N   1 
ATOM   1951  C CA  . PHE A 1 264 ? 88.900  43.249  5.584   1.00 5.41  ? 264  PHE A CA  1 
ATOM   1952  C C   . PHE A 1 264 ? 89.942  43.959  6.484   1.00 6.82  ? 264  PHE A C   1 
ATOM   1953  O O   . PHE A 1 264 ? 89.851  45.195  6.721   1.00 4.80  ? 264  PHE A O   1 
ATOM   1954  C CB  . PHE A 1 264 ? 89.486  43.025  4.216   1.00 4.64  ? 264  PHE A CB  1 
ATOM   1955  C CG  . PHE A 1 264 ? 88.744  42.255  3.184   1.00 6.40  ? 264  PHE A CG  1 
ATOM   1956  C CD1 . PHE A 1 264 ? 88.480  40.898  3.356   1.00 5.67  ? 264  PHE A CD1 1 
ATOM   1957  C CD2 . PHE A 1 264 ? 88.308  42.835  2.011   1.00 6.77  ? 264  PHE A CD2 1 
ATOM   1958  C CE1 . PHE A 1 264 ? 87.802  40.172  2.401   1.00 5.54  ? 264  PHE A CE1 1 
ATOM   1959  C CE2 . PHE A 1 264 ? 87.642  42.128  1.031   1.00 7.43  ? 264  PHE A CE2 1 
ATOM   1960  C CZ  . PHE A 1 264 ? 87.403  40.769  1.228   1.00 7.37  ? 264  PHE A CZ  1 
ATOM   1961  N N   . VAL A 1 265 ? 90.859  43.158  7.034   1.00 4.96  ? 265  VAL A N   1 
ATOM   1962  C CA  . VAL A 1 265 ? 91.932  43.664  7.878   1.00 3.67  ? 265  VAL A CA  1 
ATOM   1963  C C   . VAL A 1 265 ? 92.915  44.474  7.005   1.00 3.46  ? 265  VAL A C   1 
ATOM   1964  O O   . VAL A 1 265 ? 93.526  43.969  6.042   1.00 3.08  ? 265  VAL A O   1 
ATOM   1965  C CB  . VAL A 1 265 ? 92.686  42.518  8.584   1.00 3.95  ? 265  VAL A CB  1 
ATOM   1966  C CG1 . VAL A 1 265 ? 93.898  43.027  9.369   1.00 4.04  ? 265  VAL A CG1 1 
ATOM   1967  C CG2 . VAL A 1 265 ? 91.790  41.751  9.568   1.00 2.26  ? 265  VAL A CG2 1 
ATOM   1968  N N   . ARG A 1 266 ? 92.987  45.793  7.302   1.00 3.63  ? 266  ARG A N   1 
ATOM   1969  C CA  . ARG A 1 266 ? 93.815  46.645  6.453   1.00 3.34  ? 266  ARG A CA  1 
ATOM   1970  C C   . ARG A 1 266 ? 94.682  47.668  7.175   1.00 5.44  ? 266  ARG A C   1 
ATOM   1971  O O   . ARG A 1 266 ? 95.342  48.428  6.469   1.00 4.63  ? 266  ARG A O   1 
ATOM   1972  C CB  . ARG A 1 266 ? 92.982  47.246  5.338   1.00 2.86  ? 266  ARG A CB  1 
ATOM   1973  C CG  . ARG A 1 266 ? 91.834  48.178  5.646   1.00 5.61  ? 266  ARG A CG  1 
ATOM   1974  C CD  . ARG A 1 266 ? 92.145  49.369  6.537   1.00 7.55  ? 266  ARG A CD  1 
ATOM   1975  N NE  . ARG A 1 266 ? 91.102  50.385  6.533   1.00 7.43  ? 266  ARG A NE  1 
ATOM   1976  C CZ  . ARG A 1 266 ? 90.158  50.558  7.454   1.00 7.38  ? 266  ARG A CZ  1 
ATOM   1977  N NH1 . ARG A 1 266 ? 90.093  49.776  8.529   1.00 5.12  ? 266  ARG A NH1 1 
ATOM   1978  N NH2 . ARG A 1 266 ? 89.267  51.541  7.305   1.00 4.96  ? 266  ARG A NH2 1 
ATOM   1979  N N   . ASN A 1 267 ? 94.790  47.614  8.500   1.00 6.05  ? 267  ASN A N   1 
ATOM   1980  C CA  . ASN A 1 267 ? 95.669  48.493  9.249   1.00 6.82  ? 267  ASN A CA  1 
ATOM   1981  C C   . ASN A 1 267 ? 95.921  47.860  10.611  1.00 6.77  ? 267  ASN A C   1 
ATOM   1982  O O   . ASN A 1 267 ? 95.302  46.789  10.862  1.00 7.83  ? 267  ASN A O   1 
ATOM   1983  C CB  . ASN A 1 267 ? 95.076  49.883  9.474   1.00 6.08  ? 267  ASN A CB  1 
ATOM   1984  C CG  . ASN A 1 267 ? 93.775  49.994  10.234  1.00 6.49  ? 267  ASN A CG  1 
ATOM   1985  O OD1 . ASN A 1 267 ? 93.485  49.300  11.215  1.00 5.92  ? 267  ASN A OD1 1 
ATOM   1986  N ND2 . ASN A 1 267 ? 92.986  51.005  9.823   1.00 5.42  ? 267  ASN A ND2 1 
ATOM   1987  N N   . ALA A 1 268 ? 96.745  48.435  11.456  1.00 5.20  ? 268  ALA A N   1 
ATOM   1988  C CA  . ALA A 1 268 ? 97.020  47.804  12.733  1.00 4.85  ? 268  ALA A CA  1 
ATOM   1989  C C   . ALA A 1 268 ? 95.829  47.762  13.688  1.00 4.93  ? 268  ALA A C   1 
ATOM   1990  O O   . ALA A 1 268 ? 95.757  46.797  14.494  1.00 2.90  ? 268  ALA A O   1 
ATOM   1991  C CB  . ALA A 1 268 ? 98.255  48.409  13.403  1.00 4.38  ? 268  ALA A CB  1 
ATOM   1992  N N   . ARG A 1 269 ? 94.947  48.761  13.678  1.00 2.32  ? 269  ARG A N   1 
ATOM   1993  C CA  . ARG A 1 269 ? 93.781  48.734  14.565  1.00 3.65  ? 269  ARG A CA  1 
ATOM   1994  C C   . ARG A 1 269 ? 92.932  47.502  14.212  1.00 3.89  ? 269  ARG A C   1 
ATOM   1995  O O   . ARG A 1 269 ? 92.455  46.834  15.116  1.00 4.14  ? 269  ARG A O   1 
ATOM   1996  C CB  . ARG A 1 269 ? 92.916  50.025  14.489  1.00 3.29  ? 269  ARG A CB  1 
ATOM   1997  C CG  . ARG A 1 269 ? 92.025  50.176  15.728  1.00 3.91  ? 269  ARG A CG  1 
ATOM   1998  C CD  . ARG A 1 269 ? 91.200  51.473  15.688  1.00 3.03  ? 269  ARG A CD  1 
ATOM   1999  N NE  . ARG A 1 269 ? 92.038  52.690  15.759  1.00 3.83  ? 269  ARG A NE  1 
ATOM   2000  C CZ  . ARG A 1 269 ? 92.477  53.125  16.945  1.00 3.05  ? 269  ARG A CZ  1 
ATOM   2001  N NH1 . ARG A 1 269 ? 92.192  52.574  18.114  1.00 3.69  ? 269  ARG A NH1 1 
ATOM   2002  N NH2 . ARG A 1 269 ? 93.263  54.207  16.981  1.00 3.52  ? 269  ARG A NH2 1 
ATOM   2003  N N   . ASP A 1 270 ? 92.742  47.226  12.946  1.00 3.77  ? 270  ASP A N   1 
ATOM   2004  C CA  . ASP A 1 270 ? 91.989  46.095  12.410  1.00 3.47  ? 270  ASP A CA  1 
ATOM   2005  C C   . ASP A 1 270 ? 92.602  44.759  12.832  1.00 5.96  ? 270  ASP A C   1 
ATOM   2006  O O   . ASP A 1 270 ? 91.906  43.852  13.271  1.00 5.91  ? 270  ASP A O   1 
ATOM   2007  C CB  . ASP A 1 270 ? 91.917  46.132  10.895  1.00 3.23  ? 270  ASP A CB  1 
ATOM   2008  C CG  . ASP A 1 270 ? 91.009  47.182  10.295  1.00 2.59  ? 270  ASP A CG  1 
ATOM   2009  O OD1 . ASP A 1 270 ? 90.228  47.781  11.065  1.00 2.08  ? 270  ASP A OD1 1 
ATOM   2010  O OD2 . ASP A 1 270 ? 91.108  47.375  9.094   1.00 2.91  ? 270  ASP A OD2 1 
ATOM   2011  N N   . LEU A 1 271 ? 93.941  44.649  12.741  1.00 5.39  ? 271  LEU A N   1 
ATOM   2012  C CA  . LEU A 1 271 ? 94.660  43.433  13.122  1.00 3.42  ? 271  LEU A CA  1 
ATOM   2013  C C   . LEU A 1 271 ? 94.546  43.204  14.611  1.00 4.25  ? 271  LEU A C   1 
ATOM   2014  O O   . LEU A 1 271 ? 94.269  42.113  15.112  1.00 3.27  ? 271  LEU A O   1 
ATOM   2015  C CB  . LEU A 1 271 ? 96.097  43.418  12.609  1.00 3.55  ? 271  LEU A CB  1 
ATOM   2016  C CG  . LEU A 1 271 ? 96.969  42.225  13.056  1.00 2.95  ? 271  LEU A CG  1 
ATOM   2017  C CD1 . LEU A 1 271 ? 96.306  40.925  12.621  1.00 2.68  ? 271  LEU A CD1 1 
ATOM   2018  C CD2 . LEU A 1 271 ? 98.386  42.303  12.464  1.00 3.17  ? 271  LEU A CD2 1 
ATOM   2019  N N   . ALA A 1 272 ? 94.671  44.265  15.392  1.00 4.04  ? 272  ALA A N   1 
ATOM   2020  C CA  . ALA A 1 272 ? 94.478  44.286  16.817  1.00 4.35  ? 272  ALA A CA  1 
ATOM   2021  C C   . ALA A 1 272 ? 93.021  43.820  17.102  1.00 3.64  ? 272  ALA A C   1 
ATOM   2022  O O   . ALA A 1 272 ? 92.847  42.989  18.005  1.00 2.08  ? 272  ALA A O   1 
ATOM   2023  C CB  . ALA A 1 272 ? 94.740  45.641  17.451  1.00 3.55  ? 272  ALA A CB  1 
ATOM   2024  N N   . ARG A 1 273 ? 92.037  44.317  16.384  1.00 3.31  ? 273  ARG A N   1 
ATOM   2025  C CA  . ARG A 1 273 ? 90.638  43.873  16.579  1.00 4.57  ? 273  ARG A CA  1 
ATOM   2026  C C   . ARG A 1 273 ? 90.469  42.346  16.451  1.00 4.05  ? 273  ARG A C   1 
ATOM   2027  O O   . ARG A 1 273 ? 89.823  41.701  17.288  1.00 4.67  ? 273  ARG A O   1 
ATOM   2028  C CB  . ARG A 1 273 ? 89.703  44.568  15.588  1.00 2.10  ? 273  ARG A CB  1 
ATOM   2029  C CG  . ARG A 1 273 ? 88.247  44.134  15.555  1.00 2.24  ? 273  ARG A CG  1 
ATOM   2030  C CD  . ARG A 1 273 ? 87.455  44.549  16.786  1.00 2.45  ? 273  ARG A CD  1 
ATOM   2031  N NE  . ARG A 1 273 ? 86.032  44.178  16.574  1.00 2.33  ? 273  ARG A NE  1 
ATOM   2032  C CZ  . ARG A 1 273 ? 85.156  44.224  17.563  1.00 3.30  ? 273  ARG A CZ  1 
ATOM   2033  N NH1 . ARG A 1 273 ? 85.476  44.700  18.765  1.00 4.35  ? 273  ARG A NH1 1 
ATOM   2034  N NH2 . ARG A 1 273 ? 83.899  43.825  17.331  1.00 4.40  ? 273  ARG A NH2 1 
ATOM   2035  N N   . VAL A 1 274 ? 91.052  41.749  15.428  1.00 4.05  ? 274  VAL A N   1 
ATOM   2036  C CA  . VAL A 1 274 ? 91.064  40.285  15.267  1.00 5.38  ? 274  VAL A CA  1 
ATOM   2037  C C   . VAL A 1 274 ? 91.511  39.595  16.541  1.00 5.59  ? 274  VAL A C   1 
ATOM   2038  O O   . VAL A 1 274 ? 90.826  38.723  17.115  1.00 5.37  ? 274  VAL A O   1 
ATOM   2039  C CB  . VAL A 1 274 ? 92.000  39.834  14.133  1.00 4.35  ? 274  VAL A CB  1 
ATOM   2040  C CG1 . VAL A 1 274 ? 92.078  38.314  13.995  1.00 4.26  ? 274  VAL A CG1 1 
ATOM   2041  C CG2 . VAL A 1 274 ? 91.546  40.381  12.777  1.00 3.06  ? 274  VAL A CG2 1 
ATOM   2042  N N   . THR A 1 275 ? 92.671  40.028  17.088  1.00 5.28  ? 275  THR A N   1 
ATOM   2043  C CA  . THR A 1 275 ? 93.230  39.386  18.253  1.00 2.08  ? 275  THR A CA  1 
ATOM   2044  C C   . THR A 1 275 ? 92.450  39.704  19.529  1.00 4.31  ? 275  THR A C   1 
ATOM   2045  O O   . THR A 1 275 ? 92.612  39.071  20.587  1.00 3.51  ? 275  THR A O   1 
ATOM   2046  C CB  . THR A 1 275 ? 94.700  39.737  18.466  1.00 4.79  ? 275  THR A CB  1 
ATOM   2047  O OG1 . THR A 1 275 ? 94.851  41.045  19.020  1.00 2.23  ? 275  THR A OG1 1 
ATOM   2048  C CG2 . THR A 1 275 ? 95.468  39.557  17.150  1.00 3.37  ? 275  THR A CG2 1 
ATOM   2049  N N   . PHE A 1 276 ? 91.595  40.745  19.556  1.00 3.43  ? 276  PHE A N   1 
ATOM   2050  C CA  . PHE A 1 276 ? 90.784  41.030  20.739  1.00 3.49  ? 276  PHE A CA  1 
ATOM   2051  C C   . PHE A 1 276 ? 89.514  40.144  20.741  1.00 2.66  ? 276  PHE A C   1 
ATOM   2052  O O   . PHE A 1 276 ? 88.845  39.954  21.741  1.00 3.08  ? 276  PHE A O   1 
ATOM   2053  C CB  . PHE A 1 276 ? 90.331  42.494  20.803  1.00 2.32  ? 276  PHE A CB  1 
ATOM   2054  C CG  . PHE A 1 276 ? 89.550  42.915  22.019  1.00 2.35  ? 276  PHE A CG  1 
ATOM   2055  C CD1 . PHE A 1 276 ? 90.040  42.748  23.295  1.00 3.00  ? 276  PHE A CD1 1 
ATOM   2056  C CD2 . PHE A 1 276 ? 88.280  43.485  21.851  1.00 2.82  ? 276  PHE A CD2 1 
ATOM   2057  C CE1 . PHE A 1 276 ? 89.325  43.145  24.391  1.00 3.60  ? 276  PHE A CE1 1 
ATOM   2058  C CE2 . PHE A 1 276 ? 87.554  43.894  22.969  1.00 2.69  ? 276  PHE A CE2 1 
ATOM   2059  C CZ  . PHE A 1 276 ? 88.061  43.718  24.228  1.00 3.56  ? 276  PHE A CZ  1 
ATOM   2060  N N   . THR A 1 277 ? 89.104  39.677  19.570  1.00 2.08  ? 277  THR A N   1 
ATOM   2061  C CA  . THR A 1 277 ? 87.873  38.883  19.417  1.00 3.03  ? 277  THR A CA  1 
ATOM   2062  C C   . THR A 1 277 ? 88.047  37.456  18.907  1.00 2.08  ? 277  THR A C   1 
ATOM   2063  O O   . THR A 1 277 ? 87.103  36.786  18.411  1.00 2.15  ? 277  THR A O   1 
ATOM   2064  C CB  . THR A 1 277 ? 86.936  39.705  18.510  1.00 2.08  ? 277  THR A CB  1 
ATOM   2065  O OG1 . THR A 1 277 ? 87.488  39.712  17.174  1.00 2.32  ? 277  THR A OG1 1 
ATOM   2066  C CG2 . THR A 1 277 ? 86.724  41.147  18.957  1.00 3.93  ? 277  THR A CG2 1 
ATOM   2067  N N   . ASP A 1 278 ? 89.277  36.921  18.975  1.00 3.48  ? 278  ASP A N   1 
ATOM   2068  C CA  . ASP A 1 278 ? 89.575  35.581  18.528  1.00 2.08  ? 278  ASP A CA  1 
ATOM   2069  C C   . ASP A 1 278 ? 89.370  34.657  19.709  1.00 2.16  ? 278  ASP A C   1 
ATOM   2070  O O   . ASP A 1 278 ? 89.188  35.132  20.879  1.00 3.16  ? 278  ASP A O   1 
ATOM   2071  C CB  . ASP A 1 278 ? 90.979  35.431  17.926  1.00 4.00  ? 278  ASP A CB  1 
ATOM   2072  C CG  . ASP A 1 278 ? 92.136  35.789  18.837  1.00 3.81  ? 278  ASP A CG  1 
ATOM   2073  O OD1 . ASP A 1 278 ? 91.916  35.899  20.057  1.00 4.01  ? 278  ASP A OD1 1 
ATOM   2074  O OD2 . ASP A 1 278 ? 93.278  35.935  18.321  1.00 3.25  ? 278  ASP A OD2 1 
ATOM   2075  N N   . ASN A 1 279 ? 89.268  33.356  19.496  1.00 3.49  ? 279  ASN A N   1 
ATOM   2076  C CA  . ASN A 1 279 ? 89.169  32.411  20.595  1.00 3.35  ? 279  ASN A CA  1 
ATOM   2077  C C   . ASN A 1 279 ? 90.146  31.242  20.419  1.00 3.34  ? 279  ASN A C   1 
ATOM   2078  O O   . ASN A 1 279 ? 89.820  30.257  19.754  1.00 2.47  ? 279  ASN A O   1 
ATOM   2079  C CB  . ASN A 1 279 ? 87.737  31.879  20.759  1.00 3.26  ? 279  ASN A CB  1 
ATOM   2080  C CG  . ASN A 1 279 ? 86.799  32.928  21.343  1.00 2.82  ? 279  ASN A CG  1 
ATOM   2081  O OD1 . ASN A 1 279 ? 86.914  33.226  22.517  1.00 2.98  ? 279  ASN A OD1 1 
ATOM   2082  N ND2 . ASN A 1 279 ? 85.920  33.454  20.488  1.00 3.35  ? 279  ASN A ND2 1 
ATOM   2083  N N   . ILE A 1 280 ? 91.333  31.368  20.955  1.00 2.39  ? 280  ILE A N   1 
ATOM   2084  C CA  . ILE A 1 280 ? 92.407  30.373  20.974  1.00 3.37  ? 280  ILE A CA  1 
ATOM   2085  C C   . ILE A 1 280 ? 93.040  30.030  19.645  1.00 2.65  ? 280  ILE A C   1 
ATOM   2086  O O   . ILE A 1 280 ? 94.174  30.465  19.391  1.00 2.96  ? 280  ILE A O   1 
ATOM   2087  C CB  . ILE A 1 280 ? 91.979  29.074  21.704  1.00 3.04  ? 280  ILE A CB  1 
ATOM   2088  C CG1 . ILE A 1 280 ? 91.464  29.385  23.122  1.00 3.46  ? 280  ILE A CG1 1 
ATOM   2089  C CG2 . ILE A 1 280 ? 93.136  28.031  21.762  1.00 2.52  ? 280  ILE A CG2 1 
ATOM   2090  C CD1 . ILE A 1 280 ? 92.500  30.195  23.944  1.00 2.91  ? 280  ILE A CD1 1 
ATOM   2091  N N   . ASN A 1 281 ? 92.331  29.311  18.771  1.00 2.08  ? 281  ASN A N   1 
ATOM   2092  C CA  . ASN A 1 281 ? 92.868  28.893  17.493  1.00 2.08  ? 281  ASN A CA  1 
ATOM   2093  C C   . ASN A 1 281 ? 91.956  29.295  16.363  1.00 2.43  ? 281  ASN A C   1 
ATOM   2094  O O   . ASN A 1 281 ? 92.067  28.761  15.248  1.00 2.74  ? 281  ASN A O   1 
ATOM   2095  C CB  . ASN A 1 281 ? 93.148  27.373  17.460  1.00 2.09  ? 281  ASN A CB  1 
ATOM   2096  C CG  . ASN A 1 281 ? 91.925  26.548  17.868  1.00 2.19  ? 281  ASN A CG  1 
ATOM   2097  O OD1 . ASN A 1 281 ? 90.812  27.067  17.983  1.00 2.84  ? 281  ASN A OD1 1 
ATOM   2098  N ND2 . ASN A 1 281 ? 92.077  25.246  18.036  1.00 2.82  ? 281  ASN A ND2 1 
ATOM   2099  N N   . THR A 1 282 ? 91.045  30.257  16.565  1.00 2.79  ? 282  THR A N   1 
ATOM   2100  C CA  . THR A 1 282 ? 90.156  30.598  15.441  1.00 2.08  ? 282  THR A CA  1 
ATOM   2101  C C   . THR A 1 282 ? 90.892  31.031  14.204  1.00 2.48  ? 282  THR A C   1 
ATOM   2102  O O   . THR A 1 282 ? 90.481  30.701  13.074  1.00 3.43  ? 282  THR A O   1 
ATOM   2103  C CB  . THR A 1 282 ? 89.167  31.725  15.886  1.00 2.42  ? 282  THR A CB  1 
ATOM   2104  O OG1 . THR A 1 282 ? 89.886  32.692  16.636  1.00 3.69  ? 282  THR A OG1 1 
ATOM   2105  C CG2 . THR A 1 282 ? 88.087  31.082  16.751  1.00 2.89  ? 282  THR A CG2 1 
ATOM   2106  N N   . GLU A 1 283 ? 91.946  31.862  14.277  1.00 3.22  ? 283  GLU A N   1 
ATOM   2107  C CA  . GLU A 1 283 ? 92.630  32.321  13.043  1.00 3.55  ? 283  GLU A CA  1 
ATOM   2108  C C   . GLU A 1 283 ? 93.310  31.123  12.375  1.00 2.80  ? 283  GLU A C   1 
ATOM   2109  O O   . GLU A 1 283 ? 93.200  30.920  11.178  1.00 2.34  ? 283  GLU A O   1 
ATOM   2110  C CB  . GLU A 1 283 ? 93.668  33.402  13.320  1.00 3.57  ? 283  GLU A CB  1 
ATOM   2111  C CG  . GLU A 1 283 ? 93.169  34.670  14.036  1.00 3.97  ? 283  GLU A CG  1 
ATOM   2112  C CD  . GLU A 1 283 ? 93.276  34.684  15.507  1.00 2.08  ? 283  GLU A CD  1 
ATOM   2113  O OE1 . GLU A 1 283 ? 93.297  33.618  16.188  1.00 2.31  ? 283  GLU A OE1 1 
ATOM   2114  O OE2 . GLU A 1 283 ? 93.373  35.817  16.079  1.00 3.80  ? 283  GLU A OE2 1 
ATOM   2115  N N   . ALA A 1 284 ? 93.969  30.284  13.205  1.00 2.45  ? 284  ALA A N   1 
ATOM   2116  C CA  . ALA A 1 284 ? 94.676  29.119  12.656  1.00 4.13  ? 284  ALA A CA  1 
ATOM   2117  C C   . ALA A 1 284 ? 93.706  28.073  12.091  1.00 4.69  ? 284  ALA A C   1 
ATOM   2118  O O   . ALA A 1 284 ? 93.973  27.435  11.074  1.00 4.65  ? 284  ALA A O   1 
ATOM   2119  C CB  . ALA A 1 284 ? 95.614  28.561  13.728  1.00 3.91  ? 284  ALA A CB  1 
ATOM   2120  N N   . TYR A 1 285 ? 92.486  27.997  12.638  1.00 4.65  ? 285  TYR A N   1 
ATOM   2121  C CA  . TYR A 1 285 ? 91.461  27.058  12.137  1.00 4.67  ? 285  TYR A CA  1 
ATOM   2122  C C   . TYR A 1 285 ? 91.008  27.458  10.760  1.00 3.92  ? 285  TYR A C   1 
ATOM   2123  O O   . TYR A 1 285 ? 90.877  26.730  9.769   1.00 2.88  ? 285  TYR A O   1 
ATOM   2124  C CB  . TYR A 1 285 ? 90.318  26.997  13.151  1.00 5.25  ? 285  TYR A CB  1 
ATOM   2125  C CG  . TYR A 1 285 ? 89.348  25.856  13.093  1.00 5.87  ? 285  TYR A CG  1 
ATOM   2126  C CD1 . TYR A 1 285 ? 88.182  25.955  12.355  1.00 7.15  ? 285  TYR A CD1 1 
ATOM   2127  C CD2 . TYR A 1 285 ? 89.581  24.669  13.787  1.00 6.64  ? 285  TYR A CD2 1 
ATOM   2128  C CE1 . TYR A 1 285 ? 87.266  24.902  12.314  1.00 7.71  ? 285  TYR A CE1 1 
ATOM   2129  C CE2 . TYR A 1 285 ? 88.682  23.616  13.778  1.00 5.31  ? 285  TYR A CE2 1 
ATOM   2130  C CZ  . TYR A 1 285 ? 87.535  23.746  13.022  1.00 6.20  ? 285  TYR A CZ  1 
ATOM   2131  O OH  . TYR A 1 285 ? 86.607  22.726  13.006  1.00 4.95  ? 285  TYR A OH  1 
ATOM   2132  N N   . ARG A 1 286 ? 90.801  28.814  10.633  1.00 3.25  ? 286  ARG A N   1 
ATOM   2133  C CA  . ARG A 1 286 ? 90.493  29.352  9.336   1.00 3.83  ? 286  ARG A CA  1 
ATOM   2134  C C   . ARG A 1 286 ? 91.658  29.036  8.383   1.00 3.43  ? 286  ARG A C   1 
ATOM   2135  O O   . ARG A 1 286 ? 91.374  28.687  7.276   1.00 3.10  ? 286  ARG A O   1 
ATOM   2136  C CB  . ARG A 1 286 ? 90.342  30.869  9.233   1.00 3.77  ? 286  ARG A CB  1 
ATOM   2137  C CG  . ARG A 1 286 ? 89.020  31.323  9.917   1.00 6.50  ? 286  ARG A CG  1 
ATOM   2138  C CD  . ARG A 1 286 ? 88.993  32.767  9.351   1.00 9.45  ? 286  ARG A CD  1 
ATOM   2139  N NE  . ARG A 1 286 ? 89.402  33.726  10.278  1.00 8.66  ? 286  ARG A NE  1 
ATOM   2140  C CZ  . ARG A 1 286 ? 89.801  34.975  10.034  1.00 7.63  ? 286  ARG A CZ  1 
ATOM   2141  N NH1 . ARG A 1 286 ? 89.919  35.517  8.845   1.00 8.22  ? 286  ARG A NH1 1 
ATOM   2142  N NH2 . ARG A 1 286 ? 90.068  35.607  11.155  1.00 6.73  ? 286  ARG A NH2 1 
ATOM   2143  N N   . GLY A 1 287 ? 92.882  29.275  8.858   1.00 2.18  ? 287  GLY A N   1 
ATOM   2144  C CA  . GLY A 1 287 ? 93.982  29.001  7.904   1.00 4.32  ? 287  GLY A CA  1 
ATOM   2145  C C   . GLY A 1 287 ? 94.020  27.525  7.489   1.00 3.47  ? 287  GLY A C   1 
ATOM   2146  O O   . GLY A 1 287 ? 94.239  27.229  6.336   1.00 3.75  ? 287  GLY A O   1 
ATOM   2147  N N   . ALA A 1 288 ? 93.746  26.612  8.386   1.00 4.54  ? 288  ALA A N   1 
ATOM   2148  C CA  . ALA A 1 288 ? 93.727  25.171  8.234   1.00 2.74  ? 288  ALA A CA  1 
ATOM   2149  C C   . ALA A 1 288 ? 92.707  24.772  7.180   1.00 3.13  ? 288  ALA A C   1 
ATOM   2150  O O   . ALA A 1 288 ? 93.006  23.950  6.302   1.00 2.95  ? 288  ALA A O   1 
ATOM   2151  C CB  . ALA A 1 288 ? 93.457  24.495  9.564   1.00 2.61  ? 288  ALA A CB  1 
ATOM   2152  N N   . LEU A 1 289 ? 91.507  25.351  7.266   1.00 3.85  ? 289  LEU A N   1 
ATOM   2153  C CA  . LEU A 1 289 ? 90.483  25.088  6.258   1.00 3.34  ? 289  LEU A CA  1 
ATOM   2154  C C   . LEU A 1 289 ? 90.872  25.597  4.889   1.00 3.94  ? 289  LEU A C   1 
ATOM   2155  O O   . LEU A 1 289 ? 90.616  25.003  3.841   1.00 2.09  ? 289  LEU A O   1 
ATOM   2156  C CB  . LEU A 1 289 ? 89.145  25.713  6.686   1.00 3.56  ? 289  LEU A CB  1 
ATOM   2157  C CG  . LEU A 1 289 ? 88.415  25.061  7.863   1.00 3.94  ? 289  LEU A CG  1 
ATOM   2158  C CD1 . LEU A 1 289 ? 87.308  25.970  8.389   1.00 3.78  ? 289  LEU A CD1 1 
ATOM   2159  C CD2 . LEU A 1 289 ? 87.901  23.682  7.411   1.00 3.43  ? 289  LEU A CD2 1 
ATOM   2160  N N   . ILE A 1 290 ? 91.486  26.804  4.822   1.00 4.88  ? 290  ILE A N   1 
ATOM   2161  C CA  . ILE A 1 290 ? 91.864  27.340  3.520   1.00 3.47  ? 290  ILE A CA  1 
ATOM   2162  C C   . ILE A 1 290 ? 92.963  26.467  2.908   1.00 4.33  ? 290  ILE A C   1 
ATOM   2163  O O   . ILE A 1 290 ? 92.974  26.091  1.731   1.00 4.46  ? 290  ILE A O   1 
ATOM   2164  C CB  . ILE A 1 290 ? 92.356  28.790  3.695   1.00 3.89  ? 290  ILE A CB  1 
ATOM   2165  C CG1 . ILE A 1 290 ? 91.161  29.740  3.990   1.00 3.32  ? 290  ILE A CG1 1 
ATOM   2166  C CG2 . ILE A 1 290 ? 93.050  29.254  2.444   1.00 3.88  ? 290  ILE A CG2 1 
ATOM   2167  C CD1 . ILE A 1 290 ? 91.525  31.064  4.596   1.00 4.24  ? 290  ILE A CD1 1 
ATOM   2168  N N   . LEU A 1 291 ? 93.974  26.115  3.710   1.00 4.57  ? 291  LEU A N   1 
ATOM   2169  C CA  . LEU A 1 291 ? 95.104  25.294  3.203   1.00 4.45  ? 291  LEU A CA  1 
ATOM   2170  C C   . LEU A 1 291 ? 94.593  23.964  2.690   1.00 5.04  ? 291  LEU A C   1 
ATOM   2171  O O   . LEU A 1 291 ? 95.009  23.463  1.645   1.00 5.83  ? 291  LEU A O   1 
ATOM   2172  C CB  . LEU A 1 291 ? 96.109  25.157  4.349   1.00 2.91  ? 291  LEU A CB  1 
ATOM   2173  C CG  . LEU A 1 291 ? 96.888  26.421  4.715   1.00 3.48  ? 291  LEU A CG  1 
ATOM   2174  C CD1 . LEU A 1 291 ? 97.489  26.284  6.106   1.00 3.33  ? 291  LEU A CD1 1 
ATOM   2175  C CD2 . LEU A 1 291 ? 97.947  26.686  3.645   1.00 3.91  ? 291  LEU A CD2 1 
ATOM   2176  N N   . LEU A 1 292 ? 93.622  23.370  3.403   1.00 5.68  ? 292  LEU A N   1 
ATOM   2177  C CA  . LEU A 1 292 ? 92.980  22.114  2.988   1.00 4.47  ? 292  LEU A CA  1 
ATOM   2178  C C   . LEU A 1 292 ? 92.281  22.280  1.652   1.00 4.30  ? 292  LEU A C   1 
ATOM   2179  O O   . LEU A 1 292 ? 92.480  21.558  0.660   1.00 3.20  ? 292  LEU A O   1 
ATOM   2180  C CB  . LEU A 1 292 ? 92.004  21.688  4.089   1.00 4.21  ? 292  LEU A CB  1 
ATOM   2181  C CG  . LEU A 1 292 ? 91.286  20.343  3.937   1.00 3.63  ? 292  LEU A CG  1 
ATOM   2182  C CD1 . LEU A 1 292 ? 92.269  19.185  4.073   1.00 3.49  ? 292  LEU A CD1 1 
ATOM   2183  C CD2 . LEU A 1 292 ? 90.189  20.201  4.991   1.00 3.77  ? 292  LEU A CD2 1 
ATOM   2184  N N   . GLY A 1 293 ? 91.524  23.372  1.510   1.00 3.97  ? 293  GLY A N   1 
ATOM   2185  C CA  . GLY A 1 293 ? 90.854  23.704  0.254   1.00 4.16  ? 293  GLY A CA  1 
ATOM   2186  C C   . GLY A 1 293 ? 91.793  23.940  -0.920  1.00 5.64  ? 293  GLY A C   1 
ATOM   2187  O O   . GLY A 1 293 ? 91.443  23.624  -2.088  1.00 3.42  ? 293  GLY A O   1 
ATOM   2188  N N   . LEU A 1 294 ? 92.997  24.464  -0.662  1.00 4.06  ? 294  LEU A N   1 
ATOM   2189  C CA  . LEU A 1 294 ? 93.982  24.707  -1.687  1.00 4.15  ? 294  LEU A CA  1 
ATOM   2190  C C   . LEU A 1 294 ? 94.861  23.477  -1.897  1.00 4.85  ? 294  LEU A C   1 
ATOM   2191  O O   . LEU A 1 294 ? 95.756  23.464  -2.739  1.00 3.62  ? 294  LEU A O   1 
ATOM   2192  C CB  . LEU A 1 294 ? 94.857  25.925  -1.315  1.00 4.44  ? 294  LEU A CB  1 
ATOM   2193  C CG  . LEU A 1 294 ? 94.150  27.279  -1.329  1.00 4.42  ? 294  LEU A CG  1 
ATOM   2194  C CD1 . LEU A 1 294 ? 95.108  28.400  -0.886  1.00 5.91  ? 294  LEU A CD1 1 
ATOM   2195  C CD2 . LEU A 1 294 ? 93.567  27.578  -2.691  1.00 4.33  ? 294  LEU A CD2 1 
ATOM   2196  N N   . ASP A 1 295 ? 94.636  22.402  -1.140  1.00 6.47  ? 295  ASP A N   1 
ATOM   2197  C CA  . ASP A 1 295 ? 95.394  21.172  -1.311  1.00 7.07  ? 295  ASP A CA  1 
ATOM   2198  C C   . ASP A 1 295 ? 96.859  21.294  -0.897  1.00 8.20  ? 295  ASP A C   1 
ATOM   2199  O O   . ASP A 1 295 ? 97.715  20.479  -1.266  1.00 6.55  ? 295  ASP A O   1 
ATOM   2200  C CB  . ASP A 1 295 ? 95.231  20.673  -2.759  1.00 8.42  ? 295  ASP A CB  1 
ATOM   2201  C CG  . ASP A 1 295 ? 95.573  19.184  -2.848  1.00 10.82 ? 295  ASP A CG  1 
ATOM   2202  O OD1 . ASP A 1 295 ? 95.387  18.449  -1.865  1.00 9.67  ? 295  ASP A OD1 1 
ATOM   2203  O OD2 . ASP A 1 295 ? 96.049  18.749  -3.901  1.00 13.17 ? 295  ASP A OD2 1 
ATOM   2204  N N   . ALA A 1 296 ? 97.181  22.160  0.070   1.00 5.93  ? 296  ALA A N   1 
ATOM   2205  C CA  . ALA A 1 296 ? 98.497  22.239  0.670   1.00 6.33  ? 296  ALA A CA  1 
ATOM   2206  C C   . ALA A 1 296 ? 98.511  21.024  1.604   1.00 6.70  ? 296  ALA A C   1 
ATOM   2207  O O   . ALA A 1 296 ? 99.535  20.394  1.817   1.00 4.93  ? 296  ALA A O   1 
ATOM   2208  C CB  . ALA A 1 296 ? 98.791  23.479  1.496   1.00 5.40  ? 296  ALA A CB  1 
ATOM   2209  N N   . PHE A 1 297 ? 97.340  20.748  2.194   1.00 6.10  ? 297  PHE A N   1 
ATOM   2210  C CA  . PHE A 1 297 ? 97.128  19.507  2.962   1.00 5.67  ? 297  PHE A CA  1 
ATOM   2211  C C   . PHE A 1 297 ? 96.035  18.744  2.178   1.00 6.48  ? 297  PHE A C   1 
ATOM   2212  O O   . PHE A 1 297 ? 95.108  19.414  1.688   1.00 4.95  ? 297  PHE A O   1 
ATOM   2213  C CB  . PHE A 1 297 ? 96.760  19.686  4.393   1.00 5.02  ? 297  PHE A CB  1 
ATOM   2214  C CG  . PHE A 1 297 ? 96.810  18.426  5.210   1.00 5.98  ? 297  PHE A CG  1 
ATOM   2215  C CD1 . PHE A 1 297 ? 98.023  17.816  5.502   1.00 6.45  ? 297  PHE A CD1 1 
ATOM   2216  C CD2 . PHE A 1 297 ? 95.647  17.896  5.738   1.00 5.25  ? 297  PHE A CD2 1 
ATOM   2217  C CE1 . PHE A 1 297 ? 98.086  16.651  6.231   1.00 6.85  ? 297  PHE A CE1 1 
ATOM   2218  C CE2 . PHE A 1 297 ? 95.700  16.727  6.482   1.00 6.87  ? 297  PHE A CE2 1 
ATOM   2219  C CZ  . PHE A 1 297 ? 96.910  16.119  6.750   1.00 6.45  ? 297  PHE A CZ  1 
ATOM   2220  N N   . ASN A 1 298 ? 96.164  17.427  1.996   1.00 5.01  ? 298  ASN A N   1 
ATOM   2221  C CA  . ASN A 1 298 ? 95.216  16.722  1.128   1.00 5.17  ? 298  ASN A CA  1 
ATOM   2222  C C   . ASN A 1 298 ? 94.052  16.132  1.904   1.00 4.92  ? 298  ASN A C   1 
ATOM   2223  O O   . ASN A 1 298 ? 94.291  15.273  2.746   1.00 5.50  ? 298  ASN A O   1 
ATOM   2224  C CB  . ASN A 1 298 ? 95.930  15.633  0.315   1.00 5.24  ? 298  ASN A CB  1 
ATOM   2225  C CG  . ASN A 1 298 ? 95.023  14.931  -0.683  1.00 6.60  ? 298  ASN A CG  1 
ATOM   2226  O OD1 . ASN A 1 298 ? 94.558  13.815  -0.435  1.00 7.37  ? 298  ASN A OD1 1 
ATOM   2227  N ND2 . ASN A 1 298 ? 94.761  15.568  -1.813  1.00 4.30  ? 298  ASN A ND2 1 
ATOM   2228  N N   . ARG A 1 299 ? 92.820  16.529  1.648   1.00 4.59  ? 299  ARG A N   1 
ATOM   2229  C CA  . ARG A 1 299 ? 91.657  16.047  2.400   1.00 4.96  ? 299  ARG A CA  1 
ATOM   2230  C C   . ARG A 1 299 ? 91.406  14.555  2.296   1.00 5.13  ? 299  ARG A C   1 
ATOM   2231  O O   . ARG A 1 299 ? 91.076  13.937  3.316   1.00 8.48  ? 299  ARG A O   1 
ATOM   2232  C CB  . ARG A 1 299 ? 90.380  16.805  1.999   1.00 5.47  ? 299  ARG A CB  1 
ATOM   2233  C CG  . ARG A 1 299 ? 89.180  16.582  2.916   1.00 5.28  ? 299  ARG A CG  1 
ATOM   2234  C CD  . ARG A 1 299 ? 88.113  17.657  2.671   1.00 6.29  ? 299  ARG A CD  1 
ATOM   2235  N NE  . ARG A 1 299 ? 86.942  17.447  3.526   1.00 9.58  ? 299  ARG A NE  1 
ATOM   2236  C CZ  . ARG A 1 299 ? 85.841  16.773  3.176   1.00 9.59  ? 299  ARG A CZ  1 
ATOM   2237  N NH1 . ARG A 1 299 ? 85.731  16.236  1.981   1.00 9.43  ? 299  ARG A NH1 1 
ATOM   2238  N NH2 . ARG A 1 299 ? 84.820  16.639  4.026   1.00 12.10 ? 299  ARG A NH2 1 
ATOM   2239  N N   . ALA A 1 300 ? 91.701  13.921  1.190   1.00 5.60  ? 300  ALA A N   1 
ATOM   2240  C CA  . ALA A 1 300 ? 91.555  12.501  0.939   1.00 6.16  ? 300  ALA A CA  1 
ATOM   2241  C C   . ALA A 1 300 ? 92.651  11.686  1.623   1.00 7.12  ? 300  ALA A C   1 
ATOM   2242  O O   . ALA A 1 300 ? 92.562  10.468  1.817   1.00 7.52  ? 300  ALA A O   1 
ATOM   2243  C CB  . ALA A 1 300 ? 91.472  12.285  -0.567  1.00 5.36  ? 300  ALA A CB  1 
ATOM   2244  N N   . GLY A 1 301 ? 93.655  12.335  2.224   1.00 5.77  ? 301  GLY A N   1 
ATOM   2245  C CA  . GLY A 1 301 ? 94.623  11.644  3.036   1.00 5.24  ? 301  GLY A CA  1 
ATOM   2246  C C   . GLY A 1 301 ? 95.925  11.320  2.303   1.00 3.95  ? 301  GLY A C   1 
ATOM   2247  O O   . GLY A 1 301 ? 96.706  10.583  2.933   1.00 6.21  ? 301  GLY A O   1 
ATOM   2248  N N   . VAL A 1 302 ? 96.152  11.852  1.116   1.00 4.71  ? 302  VAL A N   1 
ATOM   2249  C CA  . VAL A 1 302 ? 97.470  11.542  0.503   1.00 6.17  ? 302  VAL A CA  1 
ATOM   2250  C C   . VAL A 1 302 ? 98.538  12.521  0.986   1.00 5.55  ? 302  VAL A C   1 
ATOM   2251  O O   . VAL A 1 302 ? 98.814  13.535  0.326   1.00 6.16  ? 302  VAL A O   1 
ATOM   2252  C CB  . VAL A 1 302 ? 97.328  11.557  -1.018  1.00 6.62  ? 302  VAL A CB  1 
ATOM   2253  C CG1 . VAL A 1 302 ? 98.648  11.260  -1.724  1.00 5.50  ? 302  VAL A CG1 1 
ATOM   2254  C CG2 . VAL A 1 302 ? 96.279  10.512  -1.446  1.00 7.62  ? 302  VAL A CG2 1 
ATOM   2255  N N   . ASN A 1 303 ? 98.982  12.396  2.219   1.00 3.55  ? 303  ASN A N   1 
ATOM   2256  C CA  . ASN A 1 303 ? 99.969  13.153  2.942   1.00 5.80  ? 303  ASN A CA  1 
ATOM   2257  C C   . ASN A 1 303 ? 101.001 12.228  3.611   1.00 6.23  ? 303  ASN A C   1 
ATOM   2258  O O   . ASN A 1 303 ? 100.812 11.008  3.707   1.00 4.56  ? 303  ASN A O   1 
ATOM   2259  C CB  . ASN A 1 303 ? 99.278  13.920  4.082   1.00 5.58  ? 303  ASN A CB  1 
ATOM   2260  C CG  . ASN A 1 303 ? 98.040  14.658  3.578   1.00 6.09  ? 303  ASN A CG  1 
ATOM   2261  O OD1 . ASN A 1 303 ? 98.185  15.614  2.826   1.00 5.25  ? 303  ASN A OD1 1 
ATOM   2262  N ND2 . ASN A 1 303 ? 96.835  14.176  3.924   1.00 3.61  ? 303  ASN A ND2 1 
ATOM   2263  N N   . GLY A 1 304 ? 102.088 12.774  4.139   1.00 6.05  ? 304  GLY A N   1 
ATOM   2264  C CA  . GLY A 1 304 ? 103.059 11.972  4.878   1.00 7.76  ? 304  GLY A CA  1 
ATOM   2265  C C   . GLY A 1 304 ? 103.593 10.789  4.079   1.00 5.46  ? 304  GLY A C   1 
ATOM   2266  O O   . GLY A 1 304 ? 103.817 10.887  2.877   1.00 3.37  ? 304  GLY A O   1 
ATOM   2267  N N   . PRO A 1 305 ? 103.564 9.603   4.683   1.00 6.56  ? 305  PRO A N   1 
ATOM   2268  C CA  . PRO A 1 305 ? 104.089 8.392   4.046   1.00 8.66  ? 305  PRO A CA  1 
ATOM   2269  C C   . PRO A 1 305 ? 103.195 7.908   2.930   1.00 9.80  ? 305  PRO A C   1 
ATOM   2270  O O   . PRO A 1 305 ? 103.596 7.068   2.133   1.00 11.20 ? 305  PRO A O   1 
ATOM   2271  C CB  . PRO A 1 305 ? 104.204 7.387   5.201   1.00 7.65  ? 305  PRO A CB  1 
ATOM   2272  C CG  . PRO A 1 305 ? 103.108 7.851   6.140   1.00 6.26  ? 305  PRO A CG  1 
ATOM   2273  C CD  . PRO A 1 305 ? 103.196 9.359   6.096   1.00 4.91  ? 305  PRO A CD  1 
ATOM   2274  N N   . PHE A 1 306 ? 101.973 8.433   2.805   1.00 8.48  ? 306  PHE A N   1 
ATOM   2275  C CA  . PHE A 1 306 ? 101.037 8.008   1.783   1.00 7.93  ? 306  PHE A CA  1 
ATOM   2276  C C   . PHE A 1 306 ? 101.293 8.680   0.464   1.00 7.78  ? 306  PHE A C   1 
ATOM   2277  O O   . PHE A 1 306 ? 100.826 8.253   -0.596  1.00 6.34  ? 306  PHE A O   1 
ATOM   2278  C CB  . PHE A 1 306 ? 99.573  8.214   2.277   1.00 6.70  ? 306  PHE A CB  1 
ATOM   2279  C CG  . PHE A 1 306 ? 99.379  7.487   3.580   1.00 5.28  ? 306  PHE A CG  1 
ATOM   2280  C CD1 . PHE A 1 306 ? 99.147  6.119   3.588   1.00 6.14  ? 306  PHE A CD1 1 
ATOM   2281  C CD2 . PHE A 1 306 ? 99.484  8.123   4.789   1.00 4.79  ? 306  PHE A CD2 1 
ATOM   2282  C CE1 . PHE A 1 306 ? 99.008  5.432   4.780   1.00 3.62  ? 306  PHE A CE1 1 
ATOM   2283  C CE2 . PHE A 1 306 ? 99.345  7.469   5.985   1.00 4.81  ? 306  PHE A CE2 1 
ATOM   2284  C CZ  . PHE A 1 306 ? 99.091  6.095   5.981   1.00 5.70  ? 306  PHE A CZ  1 
ATOM   2285  N N   . ILE A 1 307 ? 102.079 9.765   0.448   1.00 8.71  ? 307  ILE A N   1 
ATOM   2286  C CA  . ILE A 1 307 ? 102.380 10.406  -0.845  1.00 10.56 ? 307  ILE A CA  1 
ATOM   2287  C C   . ILE A 1 307 ? 103.179 9.481   -1.766  1.00 12.24 ? 307  ILE A C   1 
ATOM   2288  O O   . ILE A 1 307 ? 103.046 9.566   -2.995  1.00 13.08 ? 307  ILE A O   1 
ATOM   2289  C CB  . ILE A 1 307 ? 103.127 11.717  -0.532  1.00 11.93 ? 307  ILE A CB  1 
ATOM   2290  C CG1 . ILE A 1 307 ? 102.125 12.772  -0.048  1.00 11.04 ? 307  ILE A CG1 1 
ATOM   2291  C CG2 . ILE A 1 307 ? 103.901 12.242  -1.741  1.00 11.24 ? 307  ILE A CG2 1 
ATOM   2292  C CD1 . ILE A 1 307 ? 102.815 14.030  0.471   1.00 14.09 ? 307  ILE A CD1 1 
ATOM   2293  N N   . ASP A 1 308 ? 104.009 8.610   -1.215  1.00 13.03 ? 308  ASP A N   1 
ATOM   2294  C CA  . ASP A 1 308 ? 104.859 7.722   -1.986  1.00 17.52 ? 308  ASP A CA  1 
ATOM   2295  C C   . ASP A 1 308 ? 104.275 6.328   -2.213  1.00 18.71 ? 308  ASP A C   1 
ATOM   2296  O O   . ASP A 1 308 ? 104.984 5.466   -2.759  1.00 20.04 ? 308  ASP A O   1 
ATOM   2297  C CB  . ASP A 1 308 ? 106.213 7.555   -1.281  1.00 17.69 ? 308  ASP A CB  1 
ATOM   2298  C CG  . ASP A 1 308 ? 106.983 8.868   -1.194  1.00 19.77 ? 308  ASP A CG  1 
ATOM   2299  O OD1 . ASP A 1 308 ? 106.971 9.710   -2.120  1.00 18.71 ? 308  ASP A OD1 1 
ATOM   2300  O OD2 . ASP A 1 308 ? 107.610 9.005   -0.124  1.00 21.62 ? 308  ASP A OD2 1 
ATOM   2301  N N   . ILE A 1 309 ? 103.047 6.045   -1.776  1.00 16.43 ? 309  ILE A N   1 
ATOM   2302  C CA  . ILE A 1 309 ? 102.500 4.700   -1.983  1.00 15.50 ? 309  ILE A CA  1 
ATOM   2303  C C   . ILE A 1 309 ? 101.126 4.806   -2.617  1.00 15.95 ? 309  ILE A C   1 
ATOM   2304  O O   . ILE A 1 309 ? 100.619 5.930   -2.786  1.00 15.55 ? 309  ILE A O   1 
ATOM   2305  C CB  . ILE A 1 309 ? 102.520 3.857   -0.716  1.00 14.52 ? 309  ILE A CB  1 
ATOM   2306  C CG1 . ILE A 1 309 ? 101.822 4.642   0.418   1.00 12.07 ? 309  ILE A CG1 1 
ATOM   2307  C CG2 . ILE A 1 309 ? 103.931 3.447   -0.287  1.00 13.07 ? 309  ILE A CG2 1 
ATOM   2308  C CD1 . ILE A 1 309 ? 101.741 3.862   1.714   1.00 9.83  ? 309  ILE A CD1 1 
ATOM   2309  N N   . ASP A 1 310 ? 100.523 3.704   -3.082  1.00 14.77 ? 310  ASP A N   1 
ATOM   2310  C CA  . ASP A 1 310 ? 99.271  3.878   -3.829  1.00 14.87 ? 310  ASP A CA  1 
ATOM   2311  C C   . ASP A 1 310 ? 97.986  3.307   -3.255  1.00 12.22 ? 310  ASP A C   1 
ATOM   2312  O O   . ASP A 1 310 ? 96.904  3.691   -3.750  1.00 11.63 ? 310  ASP A O   1 
ATOM   2313  C CB  . ASP A 1 310 ? 99.407  3.184   -5.203  1.00 19.07 ? 310  ASP A CB  1 
ATOM   2314  C CG  . ASP A 1 310 ? 100.305 3.911   -6.184  1.00 23.09 ? 310  ASP A CG  1 
ATOM   2315  O OD1 . ASP A 1 310 ? 100.070 5.088   -6.518  1.00 24.36 ? 310  ASP A OD1 1 
ATOM   2316  O OD2 . ASP A 1 310 ? 101.279 3.252   -6.631  1.00 26.66 ? 310  ASP A OD2 1 
ATOM   2317  N N   . ARG A 1 311 ? 98.094  2.369   -2.350  1.00 9.91  ? 311  ARG A N   1 
ATOM   2318  C CA  . ARG A 1 311 ? 96.959  1.625   -1.858  1.00 9.18  ? 311  ARG A CA  1 
ATOM   2319  C C   . ARG A 1 311 ? 96.217  2.217   -0.673  1.00 9.22  ? 311  ARG A C   1 
ATOM   2320  O O   . ARG A 1 311 ? 95.065  1.800   -0.408  1.00 8.49  ? 311  ARG A O   1 
ATOM   2321  C CB  . ARG A 1 311 ? 97.453  0.205   -1.444  1.00 8.72  ? 311  ARG A CB  1 
ATOM   2322  C CG  . ARG A 1 311 ? 96.322  -0.813  -1.301  1.00 8.48  ? 311  ARG A CG  1 
ATOM   2323  C CD  . ARG A 1 311 ? 95.625  -1.049  -2.649  1.00 8.41  ? 311  ARG A CD  1 
ATOM   2324  N NE  . ARG A 1 311 ? 94.465  -1.960  -2.447  1.00 9.32  ? 311  ARG A NE  1 
ATOM   2325  C CZ  . ARG A 1 311 ? 93.246  -1.502  -2.178  1.00 7.42  ? 311  ARG A CZ  1 
ATOM   2326  N NH1 . ARG A 1 311 ? 93.029  -0.166  -2.133  1.00 7.28  ? 311  ARG A NH1 1 
ATOM   2327  N NH2 . ARG A 1 311 ? 92.275  -2.360  -1.992  1.00 4.84  ? 311  ARG A NH2 1 
ATOM   2328  N N   . GLN A 1 312 ? 96.929  3.003   0.134   1.00 6.70  ? 312  GLN A N   1 
ATOM   2329  C CA  . GLN A 1 312 ? 96.426  3.537   1.382   1.00 6.42  ? 312  GLN A CA  1 
ATOM   2330  C C   . GLN A 1 312 ? 96.387  5.068   1.417   1.00 6.03  ? 312  GLN A C   1 
ATOM   2331  O O   . GLN A 1 312 ? 97.133  5.757   0.700   1.00 3.44  ? 312  GLN A O   1 
ATOM   2332  C CB  . GLN A 1 312 ? 97.350  3.094   2.526   1.00 7.71  ? 312  GLN A CB  1 
ATOM   2333  C CG  . GLN A 1 312 ? 97.330  1.604   2.822   1.00 7.62  ? 312  GLN A CG  1 
ATOM   2334  C CD  . GLN A 1 312 ? 98.435  1.190   3.760   1.00 6.52  ? 312  GLN A CD  1 
ATOM   2335  O OE1 . GLN A 1 312 ? 98.286  1.120   4.980   1.00 6.00  ? 312  GLN A OE1 1 
ATOM   2336  N NE2 . GLN A 1 312 ? 99.586  0.879   3.152   1.00 9.90  ? 312  GLN A NE2 1 
ATOM   2337  N N   . ALA A 1 313 ? 95.497  5.560   2.291   1.00 6.03  ? 313  ALA A N   1 
ATOM   2338  C CA  . ALA A 1 313 ? 95.394  7.015   2.495   1.00 4.87  ? 313  ALA A CA  1 
ATOM   2339  C C   . ALA A 1 313 ? 95.518  7.265   3.985   1.00 4.57  ? 313  ALA A C   1 
ATOM   2340  O O   . ALA A 1 313 ? 95.178  6.342   4.751   1.00 4.01  ? 313  ALA A O   1 
ATOM   2341  C CB  . ALA A 1 313 ? 94.078  7.583   1.971   1.00 4.92  ? 313  ALA A CB  1 
ATOM   2342  N N   . GLY A 1 314 ? 96.051  8.421   4.429   1.00 4.61  ? 314  GLY A N   1 
ATOM   2343  C CA  . GLY A 1 314 ? 96.087  8.552   5.902   1.00 3.82  ? 314  GLY A CA  1 
ATOM   2344  C C   . GLY A 1 314 ? 94.720  9.067   6.419   1.00 4.63  ? 314  GLY A C   1 
ATOM   2345  O O   . GLY A 1 314 ? 93.892  9.594   5.678   1.00 3.16  ? 314  GLY A O   1 
ATOM   2346  N N   . PHE A 1 315 ? 94.499  9.008   7.718   1.00 3.77  ? 315  PHE A N   1 
ATOM   2347  C CA  . PHE A 1 315 ? 93.320  9.622   8.328   1.00 5.45  ? 315  PHE A CA  1 
ATOM   2348  C C   . PHE A 1 315 ? 93.676  9.963   9.765   1.00 4.07  ? 315  PHE A C   1 
ATOM   2349  O O   . PHE A 1 315 ? 94.041  11.130  10.079  1.00 5.93  ? 315  PHE A O   1 
ATOM   2350  C CB  . PHE A 1 315 ? 92.008  8.847   8.223   1.00 4.12  ? 315  PHE A CB  1 
ATOM   2351  C CG  . PHE A 1 315 ? 90.831  9.552   8.877   1.00 2.88  ? 315  PHE A CG  1 
ATOM   2352  C CD1 . PHE A 1 315 ? 90.358  10.747  8.335   1.00 2.80  ? 315  PHE A CD1 1 
ATOM   2353  C CD2 . PHE A 1 315 ? 90.204  9.032   9.963   1.00 4.04  ? 315  PHE A CD2 1 
ATOM   2354  C CE1 . PHE A 1 315 ? 89.272  11.410  8.896   1.00 3.08  ? 315  PHE A CE1 1 
ATOM   2355  C CE2 . PHE A 1 315 ? 89.124  9.678   10.558  1.00 4.09  ? 315  PHE A CE2 1 
ATOM   2356  C CZ  . PHE A 1 315 ? 88.674  10.866  10.019  1.00 3.00  ? 315  PHE A CZ  1 
ATOM   2357  N N   . VAL A 1 316 ? 93.662  8.985   10.647  1.00 3.74  ? 316  VAL A N   1 
ATOM   2358  C CA  . VAL A 1 316 ? 93.998  9.200   12.067  1.00 4.36  ? 316  VAL A CA  1 
ATOM   2359  C C   . VAL A 1 316 ? 95.444  9.707   12.150  1.00 6.39  ? 316  VAL A C   1 
ATOM   2360  O O   . VAL A 1 316 ? 95.777  10.538  13.018  1.00 5.59  ? 316  VAL A O   1 
ATOM   2361  C CB  . VAL A 1 316 ? 93.815  7.910   12.874  1.00 4.72  ? 316  VAL A CB  1 
ATOM   2362  C CG1 . VAL A 1 316 ? 94.088  8.038   14.360  1.00 3.58  ? 316  VAL A CG1 1 
ATOM   2363  C CG2 . VAL A 1 316 ? 92.380  7.383   12.669  1.00 4.86  ? 316  VAL A CG2 1 
ATOM   2364  N N   . ASN A 1 317 ? 96.291  9.119   11.304  1.00 4.46  ? 317  ASN A N   1 
ATOM   2365  C CA  . ASN A 1 317 ? 97.663  9.596   11.169  1.00 5.58  ? 317  ASN A CA  1 
ATOM   2366  C C   . ASN A 1 317 ? 97.771  10.094  9.746   1.00 5.10  ? 317  ASN A C   1 
ATOM   2367  O O   . ASN A 1 317 ? 97.349  9.476   8.749   1.00 4.27  ? 317  ASN A O   1 
ATOM   2368  C CB  . ASN A 1 317 ? 98.754  8.560   11.420  1.00 5.21  ? 317  ASN A CB  1 
ATOM   2369  C CG  . ASN A 1 317 ? 98.608  7.758   12.662  1.00 4.71  ? 317  ASN A CG  1 
ATOM   2370  O OD1 . ASN A 1 317 ? 98.278  8.231   13.757  1.00 5.15  ? 317  ASN A OD1 1 
ATOM   2371  N ND2 . ASN A 1 317 ? 98.900  6.451   12.530  1.00 4.66  ? 317  ASN A ND2 1 
ATOM   2372  N N   . PHE A 1 318 ? 98.356  11.289  9.597   1.00 4.42  ? 318  PHE A N   1 
ATOM   2373  C CA  . PHE A 1 318 ? 98.611  11.865  8.292   1.00 4.68  ? 318  PHE A CA  1 
ATOM   2374  C C   . PHE A 1 318 ? 97.391  12.149  7.430   1.00 5.95  ? 318  PHE A C   1 
ATOM   2375  O O   . PHE A 1 318 ? 97.483  12.252  6.191   1.00 3.70  ? 318  PHE A O   1 
ATOM   2376  C CB  . PHE A 1 318 ? 99.681  11.030  7.557   1.00 5.05  ? 318  PHE A CB  1 
ATOM   2377  C CG  . PHE A 1 318 ? 100.915 10.795  8.400   1.00 6.67  ? 318  PHE A CG  1 
ATOM   2378  C CD1 . PHE A 1 318 ? 101.803 11.811  8.702   1.00 7.04  ? 318  PHE A CD1 1 
ATOM   2379  C CD2 . PHE A 1 318 ? 101.161 9.538   8.942   1.00 7.57  ? 318  PHE A CD2 1 
ATOM   2380  C CE1 . PHE A 1 318 ? 102.907 11.601  9.514   1.00 7.63  ? 318  PHE A CE1 1 
ATOM   2381  C CE2 . PHE A 1 318 ? 102.265 9.293   9.739   1.00 7.80  ? 318  PHE A CE2 1 
ATOM   2382  C CZ  . PHE A 1 318 ? 103.134 10.331  10.026  1.00 8.95  ? 318  PHE A CZ  1 
ATOM   2383  N N   . GLY A 1 319 ? 96.244  12.425  8.090   1.00 6.22  ? 319  GLY A N   1 
ATOM   2384  C CA  . GLY A 1 319 ? 95.026  12.873  7.420   1.00 4.44  ? 319  GLY A CA  1 
ATOM   2385  C C   . GLY A 1 319 ? 94.286  13.928  8.273   1.00 3.92  ? 319  GLY A C   1 
ATOM   2386  O O   . GLY A 1 319 ? 94.762  14.338  9.329   1.00 3.32  ? 319  GLY A O   1 
ATOM   2387  N N   . ILE A 1 320 ? 93.075  14.338  7.820   1.00 4.94  ? 320  ILE A N   1 
ATOM   2388  C CA  . ILE A 1 320 ? 92.365  15.420  8.532   1.00 5.20  ? 320  ILE A CA  1 
ATOM   2389  C C   . ILE A 1 320 ? 92.089  15.157  9.990   1.00 4.97  ? 320  ILE A C   1 
ATOM   2390  O O   . ILE A 1 320 ? 92.024  16.097  10.802  1.00 4.61  ? 320  ILE A O   1 
ATOM   2391  C CB  . ILE A 1 320 ? 91.092  15.894  7.794   1.00 4.74  ? 320  ILE A CB  1 
ATOM   2392  C CG1 . ILE A 1 320 ? 90.102  14.722  7.616   1.00 5.90  ? 320  ILE A CG1 1 
ATOM   2393  C CG2 . ILE A 1 320 ? 91.472  16.457  6.442   1.00 4.17  ? 320  ILE A CG2 1 
ATOM   2394  C CD1 . ILE A 1 320 ? 88.736  15.159  7.092   1.00 3.97  ? 320  ILE A CD1 1 
ATOM   2395  N N   . SER A 1 321 ? 91.941  13.897  10.413  1.00 4.15  ? 321  SER A N   1 
ATOM   2396  C CA  . SER A 1 321 ? 91.769  13.606  11.817  1.00 2.08  ? 321  SER A CA  1 
ATOM   2397  C C   . SER A 1 321 ? 92.998  14.106  12.571  1.00 2.99  ? 321  SER A C   1 
ATOM   2398  O O   . SER A 1 321 ? 92.915  14.763  13.599  1.00 5.10  ? 321  SER A O   1 
ATOM   2399  C CB  . SER A 1 321 ? 91.586  12.103  12.084  1.00 2.08  ? 321  SER A CB  1 
ATOM   2400  O OG  . SER A 1 321 ? 91.562  11.844  13.465  1.00 3.35  ? 321  SER A OG  1 
ATOM   2401  N N   . HIS A 1 322 ? 94.201  13.760  12.041  1.00 3.32  ? 322  HIS A N   1 
ATOM   2402  C CA  . HIS A 1 322 ? 95.458  14.126  12.676  1.00 2.08  ? 322  HIS A CA  1 
ATOM   2403  C C   . HIS A 1 322 ? 95.583  15.645  12.741  1.00 2.79  ? 322  HIS A C   1 
ATOM   2404  O O   . HIS A 1 322 ? 95.978  16.206  13.753  1.00 2.08  ? 322  HIS A O   1 
ATOM   2405  C CB  . HIS A 1 322 ? 96.639  13.586  11.842  1.00 4.33  ? 322  HIS A CB  1 
ATOM   2406  C CG  . HIS A 1 322 ? 97.984  13.537  12.484  1.00 4.96  ? 322  HIS A CG  1 
ATOM   2407  N ND1 . HIS A 1 322 ? 99.028  12.890  11.874  1.00 4.74  ? 322  HIS A ND1 1 
ATOM   2408  C CD2 . HIS A 1 322 ? 98.479  14.034  13.649  1.00 5.19  ? 322  HIS A CD2 1 
ATOM   2409  C CE1 . HIS A 1 322 ? 100.119 12.956  12.624  1.00 7.09  ? 322  HIS A CE1 1 
ATOM   2410  N NE2 . HIS A 1 322 ? 99.807  13.655  13.723  1.00 6.95  ? 322  HIS A NE2 1 
ATOM   2411  N N   . TYR A 1 323 ? 95.311  16.291  11.562  1.00 4.93  ? 323  TYR A N   1 
ATOM   2412  C CA  . TYR A 1 323 ? 95.455  17.751  11.489  1.00 3.31  ? 323  TYR A CA  1 
ATOM   2413  C C   . TYR A 1 323 ? 94.586  18.524  12.449  1.00 3.23  ? 323  TYR A C   1 
ATOM   2414  O O   . TYR A 1 323 ? 95.046  19.353  13.242  1.00 2.23  ? 323  TYR A O   1 
ATOM   2415  C CB  . TYR A 1 323 ? 95.103  17.996  10.060  1.00 3.02  ? 323  TYR A CB  1 
ATOM   2416  C CG  . TYR A 1 323 ? 95.166  19.234  9.226   1.00 2.89  ? 323  TYR A CG  1 
ATOM   2417  C CD1 . TYR A 1 323 ? 96.374  19.768  8.772   1.00 2.57  ? 323  TYR A CD1 1 
ATOM   2418  C CD2 . TYR A 1 323 ? 93.990  19.900  8.853   1.00 2.08  ? 323  TYR A CD2 1 
ATOM   2419  C CE1 . TYR A 1 323 ? 96.408  20.836  7.909   1.00 3.86  ? 323  TYR A CE1 1 
ATOM   2420  C CE2 . TYR A 1 323 ? 94.016  20.979  7.983   1.00 2.08  ? 323  TYR A CE2 1 
ATOM   2421  C CZ  . TYR A 1 323 ? 95.212  21.484  7.549   1.00 3.34  ? 323  TYR A CZ  1 
ATOM   2422  O OH  . TYR A 1 323 ? 95.290  22.579  6.722   1.00 2.08  ? 323  TYR A OH  1 
ATOM   2423  N N   . PHE A 1 324 ? 93.245  18.366  12.407  1.00 3.32  ? 324  PHE A N   1 
ATOM   2424  C CA  . PHE A 1 324 ? 92.314  19.075  13.271  1.00 2.16  ? 324  PHE A CA  1 
ATOM   2425  C C   . PHE A 1 324 ? 92.490  18.661  14.707  1.00 4.05  ? 324  PHE A C   1 
ATOM   2426  O O   . PHE A 1 324 ? 92.324  19.496  15.636  1.00 2.90  ? 324  PHE A O   1 
ATOM   2427  C CB  . PHE A 1 324 ? 90.836  19.009  12.813  1.00 2.08  ? 324  PHE A CB  1 
ATOM   2428  C CG  . PHE A 1 324 ? 90.621  19.801  11.553  1.00 2.47  ? 324  PHE A CG  1 
ATOM   2429  C CD1 . PHE A 1 324 ? 90.467  21.175  11.581  1.00 4.64  ? 324  PHE A CD1 1 
ATOM   2430  C CD2 . PHE A 1 324 ? 90.592  19.157  10.331  1.00 3.65  ? 324  PHE A CD2 1 
ATOM   2431  C CE1 . PHE A 1 324 ? 90.272  21.890  10.422  1.00 4.49  ? 324  PHE A CE1 1 
ATOM   2432  C CE2 . PHE A 1 324 ? 90.394  19.886  9.170   1.00 4.38  ? 324  PHE A CE2 1 
ATOM   2433  C CZ  . PHE A 1 324 ? 90.225  21.249  9.200   1.00 3.94  ? 324  PHE A CZ  1 
ATOM   2434  N N   . ARG A 1 325 ? 92.929  17.423  14.997  1.00 2.88  ? 325  ARG A N   1 
ATOM   2435  C CA  . ARG A 1 325 ? 93.189  17.073  16.401  1.00 2.73  ? 325  ARG A CA  1 
ATOM   2436  C C   . ARG A 1 325 ? 94.263  17.950  17.044  1.00 4.24  ? 325  ARG A C   1 
ATOM   2437  O O   . ARG A 1 325 ? 94.075  18.459  18.174  1.00 4.44  ? 325  ARG A O   1 
ATOM   2438  C CB  . ARG A 1 325 ? 93.614  15.597  16.509  1.00 2.92  ? 325  ARG A CB  1 
ATOM   2439  C CG  . ARG A 1 325 ? 93.808  15.128  17.949  1.00 2.08  ? 325  ARG A CG  1 
ATOM   2440  C CD  . ARG A 1 325 ? 94.140  13.629  18.019  1.00 2.55  ? 325  ARG A CD  1 
ATOM   2441  N NE  . ARG A 1 325 ? 95.310  13.223  17.253  1.00 2.71  ? 325  ARG A NE  1 
ATOM   2442  C CZ  . ARG A 1 325 ? 96.543  13.333  17.773  1.00 3.87  ? 325  ARG A CZ  1 
ATOM   2443  N NH1 . ARG A 1 325 ? 96.752  13.811  18.985  1.00 3.82  ? 325  ARG A NH1 1 
ATOM   2444  N NH2 . ARG A 1 325 ? 97.554  12.953  17.000  1.00 2.60  ? 325  ARG A NH2 1 
ATOM   2445  N N   . LEU A 1 326 ? 95.404  18.067  16.342  1.00 3.53  ? 326  LEU A N   1 
ATOM   2446  C CA  . LEU A 1 326 ? 96.536  18.846  16.894  1.00 3.14  ? 326  LEU A CA  1 
ATOM   2447  C C   . LEU A 1 326 ? 96.324  20.358  16.866  1.00 2.70  ? 326  LEU A C   1 
ATOM   2448  O O   . LEU A 1 326 ? 96.804  21.056  17.799  1.00 3.19  ? 326  LEU A O   1 
ATOM   2449  C CB  . LEU A 1 326 ? 97.840  18.466  16.184  1.00 3.74  ? 326  LEU A CB  1 
ATOM   2450  C CG  . LEU A 1 326 ? 98.352  17.034  16.446  1.00 3.83  ? 326  LEU A CG  1 
ATOM   2451  C CD1 . LEU A 1 326 ? 99.588  16.768  15.584  1.00 3.70  ? 326  LEU A CD1 1 
ATOM   2452  C CD2 . LEU A 1 326 ? 98.629  16.910  17.942  1.00 3.54  ? 326  LEU A CD2 1 
ATOM   2453  N N   . ILE A 1 327 ? 95.480  20.840  15.976  1.00 2.90  ? 327  ILE A N   1 
ATOM   2454  C CA  . ILE A 1 327 ? 95.110  22.258  15.884  1.00 4.80  ? 327  ILE A CA  1 
ATOM   2455  C C   . ILE A 1 327 ? 94.492  22.704  17.189  1.00 4.58  ? 327  ILE A C   1 
ATOM   2456  O O   . ILE A 1 327 ? 94.711  23.839  17.638  1.00 5.39  ? 327  ILE A O   1 
ATOM   2457  C CB  . ILE A 1 327 ? 94.248  22.554  14.659  1.00 7.22  ? 327  ILE A CB  1 
ATOM   2458  C CG1 . ILE A 1 327 ? 95.065  22.554  13.364  1.00 7.51  ? 327  ILE A CG1 1 
ATOM   2459  C CG2 . ILE A 1 327 ? 93.501  23.881  14.812  1.00 9.03  ? 327  ILE A CG2 1 
ATOM   2460  C CD1 . ILE A 1 327 ? 96.209  23.590  13.402  1.00 12.07 ? 327  ILE A CD1 1 
ATOM   2461  N N   . GLY A 1 328 ? 93.771  21.796  17.864  1.00 3.88  ? 328  GLY A N   1 
ATOM   2462  C CA  . GLY A 1 328 ? 93.328  22.037  19.233  1.00 3.67  ? 328  GLY A CA  1 
ATOM   2463  C C   . GLY A 1 328 ? 94.317  21.540  20.307  1.00 2.08  ? 328  GLY A C   1 
ATOM   2464  O O   . GLY A 1 328 ? 94.606  22.244  21.291  1.00 3.15  ? 328  GLY A O   1 
ATOM   2465  N N   . ALA A 1 329 ? 94.844  20.342  20.140  1.00 2.08  ? 329  ALA A N   1 
ATOM   2466  C CA  . ALA A 1 329 ? 95.662  19.747  21.182  1.00 3.57  ? 329  ALA A CA  1 
ATOM   2467  C C   . ALA A 1 329 ? 96.982  20.488  21.428  1.00 3.32  ? 329  ALA A C   1 
ATOM   2468  O O   . ALA A 1 329 ? 97.431  20.509  22.592  1.00 4.19  ? 329  ALA A O   1 
ATOM   2469  C CB  . ALA A 1 329 ? 96.045  18.294  20.859  1.00 5.20  ? 329  ALA A CB  1 
ATOM   2470  N N   . ALA A 1 330 ? 97.530  21.068  20.359  1.00 2.08  ? 330  ALA A N   1 
ATOM   2471  C CA  . ALA A 1 330 ? 98.766  21.842  20.568  1.00 3.80  ? 330  ALA A CA  1 
ATOM   2472  C C   . ALA A 1 330 ? 98.581  23.055  21.453  1.00 5.87  ? 330  ALA A C   1 
ATOM   2473  O O   . ALA A 1 330 ? 99.589  23.528  22.007  1.00 2.37  ? 330  ALA A O   1 
ATOM   2474  C CB  . ALA A 1 330 ? 99.439  22.163  19.225  1.00 2.11  ? 330  ALA A CB  1 
ATOM   2475  N N   . GLU A 1 331 ? 97.354  23.484  21.823  1.00 3.78  ? 331  GLU A N   1 
ATOM   2476  C CA  . GLU A 1 331 ? 97.127  24.536  22.815  1.00 2.86  ? 331  GLU A CA  1 
ATOM   2477  C C   . GLU A 1 331 ? 97.660  24.138  24.155  1.00 3.01  ? 331  GLU A C   1 
ATOM   2478  O O   . GLU A 1 331 ? 97.848  24.999  25.051  1.00 3.06  ? 331  GLU A O   1 
ATOM   2479  C CB  . GLU A 1 331 ? 95.632  24.932  22.848  1.00 3.24  ? 331  GLU A CB  1 
ATOM   2480  C CG  . GLU A 1 331 ? 95.140  25.772  23.993  1.00 2.50  ? 331  GLU A CG  1 
ATOM   2481  C CD  . GLU A 1 331 ? 95.736  27.194  23.955  1.00 2.08  ? 331  GLU A CD  1 
ATOM   2482  O OE1 . GLU A 1 331 ? 96.254  27.576  22.894  1.00 2.67  ? 331  GLU A OE1 1 
ATOM   2483  O OE2 . GLU A 1 331 ? 95.573  27.829  25.028  1.00 2.08  ? 331  GLU A OE2 1 
ATOM   2484  N N   . LEU A 1 332 ? 98.042  22.875  24.426  1.00 3.29  ? 332  LEU A N   1 
ATOM   2485  C CA  . LEU A 1 332 ? 98.656  22.474  25.682  1.00 3.20  ? 332  LEU A CA  1 
ATOM   2486  C C   . LEU A 1 332 ? 99.953  23.249  26.004  1.00 2.35  ? 332  LEU A C   1 
ATOM   2487  O O   . LEU A 1 332 ? 100.204 23.342  27.195  1.00 2.34  ? 332  LEU A O   1 
ATOM   2488  C CB  . LEU A 1 332 ? 98.983  20.977  25.680  1.00 2.80  ? 332  LEU A CB  1 
ATOM   2489  C CG  . LEU A 1 332 ? 99.311  20.295  27.003  1.00 2.96  ? 332  LEU A CG  1 
ATOM   2490  C CD1 . LEU A 1 332 ? 98.148  20.368  27.981  1.00 4.68  ? 332  LEU A CD1 1 
ATOM   2491  C CD2 . LEU A 1 332 ? 99.565  18.793  26.727  1.00 4.42  ? 332  LEU A CD2 1 
ATOM   2492  N N   . ALA A 1 333 ? 100.640 23.836  25.040  1.00 2.08  ? 333  ALA A N   1 
ATOM   2493  C CA  . ALA A 1 333 ? 101.827 24.666  25.326  1.00 2.82  ? 333  ALA A CA  1 
ATOM   2494  C C   . ALA A 1 333 ? 101.487 25.881  26.177  1.00 2.08  ? 333  ALA A C   1 
ATOM   2495  O O   . ALA A 1 333 ? 102.353 26.446  26.833  1.00 3.69  ? 333  ALA A O   1 
ATOM   2496  C CB  . ALA A 1 333 ? 102.345 25.212  23.983  1.00 2.08  ? 333  ALA A CB  1 
ATOM   2497  N N   . GLN A 1 334 ? 100.181 26.262  26.248  1.00 2.08  ? 334  GLN A N   1 
ATOM   2498  C CA  . GLN A 1 334 ? 99.770  27.365  27.122  1.00 3.23  ? 334  GLN A CA  1 
ATOM   2499  C C   . GLN A 1 334 ? 100.101 27.117  28.571  1.00 2.88  ? 334  GLN A C   1 
ATOM   2500  O O   . GLN A 1 334 ? 100.208 28.023  29.416  1.00 3.97  ? 334  GLN A O   1 
ATOM   2501  C CB  . GLN A 1 334 ? 98.236  27.625  27.033  1.00 3.05  ? 334  GLN A CB  1 
ATOM   2502  C CG  . GLN A 1 334 ? 97.850  29.038  27.478  1.00 3.93  ? 334  GLN A CG  1 
ATOM   2503  C CD  . GLN A 1 334 ? 98.368  30.018  26.447  1.00 3.26  ? 334  GLN A CD  1 
ATOM   2504  O OE1 . GLN A 1 334 ? 99.349  30.727  26.758  1.00 2.75  ? 334  GLN A OE1 1 
ATOM   2505  N NE2 . GLN A 1 334 ? 97.760  30.065  25.269  1.00 4.19  ? 334  GLN A NE2 1 
ATOM   2506  N N   . ARG A 1 335 ? 100.197 25.827  28.992  1.00 2.76  ? 335  ARG A N   1 
ATOM   2507  C CA  . ARG A 1 335 ? 100.542 25.615  30.406  1.00 3.75  ? 335  ARG A CA  1 
ATOM   2508  C C   . ARG A 1 335 ? 101.999 26.103  30.701  1.00 2.21  ? 335  ARG A C   1 
ATOM   2509  O O   . ARG A 1 335 ? 102.244 26.576  31.794  1.00 2.89  ? 335  ARG A O   1 
ATOM   2510  C CB  . ARG A 1 335 ? 100.401 24.152  30.867  1.00 3.46  ? 335  ARG A CB  1 
ATOM   2511  C CG  . ARG A 1 335 ? 100.228 24.145  32.373  1.00 4.40  ? 335  ARG A CG  1 
ATOM   2512  C CD  . ARG A 1 335 ? 99.915  22.839  33.050  1.00 5.38  ? 335  ARG A CD  1 
ATOM   2513  N NE  . ARG A 1 335 ? 98.866  22.076  32.346  1.00 3.90  ? 335  ARG A NE  1 
ATOM   2514  C CZ  . ARG A 1 335 ? 97.564  22.260  32.542  1.00 4.57  ? 335  ARG A CZ  1 
ATOM   2515  N NH1 . ARG A 1 335 ? 97.086  23.152  33.410  1.00 2.50  ? 335  ARG A NH1 1 
ATOM   2516  N NH2 . ARG A 1 335 ? 96.713  21.487  31.880  1.00 4.55  ? 335  ARG A NH2 1 
ATOM   2517  N N   . SER A 1 336 ? 102.868 25.905  29.741  1.00 2.69  ? 336  SER A N   1 
ATOM   2518  C CA  . SER A 1 336 ? 104.279 26.313  29.904  1.00 5.86  ? 336  SER A CA  1 
ATOM   2519  C C   . SER A 1 336 ? 104.342 27.857  29.822  1.00 5.05  ? 336  SER A C   1 
ATOM   2520  O O   . SER A 1 336 ? 104.953 28.463  30.678  1.00 4.71  ? 336  SER A O   1 
ATOM   2521  C CB  . SER A 1 336 ? 105.222 25.714  28.865  1.00 3.78  ? 336  SER A CB  1 
ATOM   2522  O OG  . SER A 1 336 ? 105.199 24.301  28.819  1.00 2.75  ? 336  SER A OG  1 
ATOM   2523  N N   . SER A 1 337 ? 103.594 28.407  28.864  1.00 3.54  ? 337  SER A N   1 
ATOM   2524  C CA  . SER A 1 337 ? 103.406 29.846  28.782  1.00 4.75  ? 337  SER A CA  1 
ATOM   2525  C C   . SER A 1 337 ? 102.987 30.419  30.131  1.00 4.83  ? 337  SER A C   1 
ATOM   2526  O O   . SER A 1 337 ? 103.531 31.430  30.602  1.00 3.56  ? 337  SER A O   1 
ATOM   2527  C CB  . SER A 1 337 ? 102.335 30.171  27.722  1.00 4.56  ? 337  SER A CB  1 
ATOM   2528  O OG  . SER A 1 337 ? 101.905 31.535  27.952  1.00 7.68  ? 337  SER A OG  1 
ATOM   2529  N N   . TRP A 1 338 ? 102.041 29.780  30.855  1.00 3.47  ? 338  TRP A N   1 
ATOM   2530  C CA  . TRP A 1 338 ? 101.626 30.280  32.161  1.00 2.81  ? 338  TRP A CA  1 
ATOM   2531  C C   . TRP A 1 338 ? 102.692 30.237  33.268  1.00 3.63  ? 338  TRP A C   1 
ATOM   2532  O O   . TRP A 1 338 ? 102.892 31.186  34.067  1.00 2.99  ? 338  TRP A O   1 
ATOM   2533  C CB  . TRP A 1 338 ? 100.354 29.535  32.642  1.00 3.95  ? 338  TRP A CB  1 
ATOM   2534  C CG  . TRP A 1 338 ? 99.205  30.481  32.814  1.00 2.28  ? 338  TRP A CG  1 
ATOM   2535  C CD1 . TRP A 1 338 ? 98.541  30.810  33.950  1.00 3.96  ? 338  TRP A CD1 1 
ATOM   2536  C CD2 . TRP A 1 338 ? 98.625  31.313  31.780  1.00 2.08  ? 338  TRP A CD2 1 
ATOM   2537  N NE1 . TRP A 1 338 ? 97.579  31.769  33.682  1.00 3.05  ? 338  TRP A NE1 1 
ATOM   2538  C CE2 . TRP A 1 338 ? 97.636  32.096  32.359  1.00 2.65  ? 338  TRP A CE2 1 
ATOM   2539  C CE3 . TRP A 1 338 ? 98.899  31.411  30.402  1.00 2.27  ? 338  TRP A CE3 1 
ATOM   2540  C CZ2 . TRP A 1 338 ? 96.888  32.988  31.578  1.00 2.08  ? 338  TRP A CZ2 1 
ATOM   2541  C CZ3 . TRP A 1 338 ? 98.152  32.305  29.635  1.00 2.84  ? 338  TRP A CZ3 1 
ATOM   2542  C CH2 . TRP A 1 338 ? 97.167  33.103  30.256  1.00 2.60  ? 338  TRP A CH2 1 
ATOM   2543  N N   . TYR A 1 339 ? 103.489 29.184  33.333  1.00 3.53  ? 339  TYR A N   1 
ATOM   2544  C CA  . TYR A 1 339 ? 104.616 29.044  34.246  1.00 3.92  ? 339  TYR A CA  1 
ATOM   2545  C C   . TYR A 1 339 ? 105.659 30.184  34.052  1.00 2.63  ? 339  TYR A C   1 
ATOM   2546  O O   . TYR A 1 339 ? 106.085 30.714  35.031  1.00 3.66  ? 339  TYR A O   1 
ATOM   2547  C CB  . TYR A 1 339 ? 105.289 27.705  33.964  1.00 2.08  ? 339  TYR A CB  1 
ATOM   2548  C CG  . TYR A 1 339 ? 106.383 27.280  34.897  1.00 2.80  ? 339  TYR A CG  1 
ATOM   2549  C CD1 . TYR A 1 339 ? 106.114 27.034  36.238  1.00 3.33  ? 339  TYR A CD1 1 
ATOM   2550  C CD2 . TYR A 1 339 ? 107.686 27.090  34.419  1.00 3.64  ? 339  TYR A CD2 1 
ATOM   2551  C CE1 . TYR A 1 339 ? 107.120 26.594  37.087  1.00 2.62  ? 339  TYR A CE1 1 
ATOM   2552  C CE2 . TYR A 1 339 ? 108.672 26.644  35.298  1.00 3.44  ? 339  TYR A CE2 1 
ATOM   2553  C CZ  . TYR A 1 339 ? 108.415 26.394  36.606  1.00 3.84  ? 339  TYR A CZ  1 
ATOM   2554  O OH  . TYR A 1 339 ? 109.408 25.918  37.471  1.00 3.87  ? 339  TYR A OH  1 
ATOM   2555  N N   . GLN A 1 340 ? 105.921 30.450  32.807  1.00 2.08  ? 340  GLN A N   1 
ATOM   2556  C CA  . GLN A 1 340 ? 106.848 31.519  32.384  1.00 4.33  ? 340  GLN A CA  1 
ATOM   2557  C C   . GLN A 1 340 ? 106.308 32.888  32.804  1.00 4.72  ? 340  GLN A C   1 
ATOM   2558  O O   . GLN A 1 340 ? 106.998 33.716  33.416  1.00 2.55  ? 340  GLN A O   1 
ATOM   2559  C CB  . GLN A 1 340 ? 107.078 31.429  30.878  1.00 2.08  ? 340  GLN A CB  1 
ATOM   2560  C CG  . GLN A 1 340 ? 107.981 30.255  30.413  1.00 2.92  ? 340  GLN A CG  1 
ATOM   2561  C CD  . GLN A 1 340 ? 109.255 30.094  31.190  1.00 2.08  ? 340  GLN A CD  1 
ATOM   2562  O OE1 . GLN A 1 340 ? 109.927 31.047  31.606  1.00 2.64  ? 340  GLN A OE1 1 
ATOM   2563  N NE2 . GLN A 1 340 ? 109.659 28.834  31.512  1.00 3.44  ? 340  GLN A NE2 1 
ATOM   2564  N N   . LYS A 1 341 ? 105.017 33.136  32.498  1.00 4.80  ? 341  LYS A N   1 
ATOM   2565  C CA  . LYS A 1 341 ? 104.351 34.369  32.899  1.00 3.50  ? 341  LYS A CA  1 
ATOM   2566  C C   . LYS A 1 341 ? 104.398 34.617  34.391  1.00 2.65  ? 341  LYS A C   1 
ATOM   2567  O O   . LYS A 1 341 ? 104.792 35.710  34.841  1.00 2.52  ? 341  LYS A O   1 
ATOM   2568  C CB  . LYS A 1 341 ? 102.816 34.328  32.587  1.00 3.15  ? 341  LYS A CB  1 
ATOM   2569  C CG  . LYS A 1 341 ? 102.585 34.645  31.108  1.00 2.19  ? 341  LYS A CG  1 
ATOM   2570  C CD  . LYS A 1 341 ? 101.106 34.477  30.743  1.00 3.52  ? 341  LYS A CD  1 
ATOM   2571  C CE  . LYS A 1 341 ? 100.707 34.852  29.326  1.00 2.48  ? 341  LYS A CE  1 
ATOM   2572  N NZ  . LYS A 1 341 ? 100.815 36.322  29.090  1.00 3.86  ? 341  LYS A NZ  1 
ATOM   2573  N N   . TRP A 1 342 ? 103.912 33.656  35.191  1.00 2.93  ? 342  TRP A N   1 
ATOM   2574  C CA  . TRP A 1 342 ? 103.777 33.909  36.599  1.00 3.25  ? 342  TRP A CA  1 
ATOM   2575  C C   . TRP A 1 342 ? 104.916 33.390  37.480  1.00 4.15  ? 342  TRP A C   1 
ATOM   2576  O O   . TRP A 1 342 ? 105.380 34.156  38.320  1.00 4.25  ? 342  TRP A O   1 
ATOM   2577  C CB  . TRP A 1 342 ? 102.495 33.288  37.173  1.00 3.66  ? 342  TRP A CB  1 
ATOM   2578  C CG  . TRP A 1 342 ? 101.172 33.664  36.611  1.00 3.79  ? 342  TRP A CG  1 
ATOM   2579  C CD1 . TRP A 1 342 ? 100.461 33.099  35.599  1.00 3.80  ? 342  TRP A CD1 1 
ATOM   2580  C CD2 . TRP A 1 342 ? 100.327 34.727  37.106  1.00 3.26  ? 342  TRP A CD2 1 
ATOM   2581  N NE1 . TRP A 1 342 ? 99.243  33.739  35.419  1.00 2.83  ? 342  TRP A NE1 1 
ATOM   2582  C CE2 . TRP A 1 342 ? 99.137  34.734  36.340  1.00 2.31  ? 342  TRP A CE2 1 
ATOM   2583  C CE3 . TRP A 1 342 ? 100.513 35.668  38.116  1.00 2.37  ? 342  TRP A CE3 1 
ATOM   2584  C CZ2 . TRP A 1 342 ? 98.127  35.675  36.579  1.00 2.08  ? 342  TRP A CZ2 1 
ATOM   2585  C CZ3 . TRP A 1 342 ? 99.491  36.585  38.369  1.00 4.27  ? 342  TRP A CZ3 1 
ATOM   2586  C CH2 . TRP A 1 342 ? 98.347  36.599  37.586  1.00 2.08  ? 342  TRP A CH2 1 
ATOM   2587  N N   . GLN A 1 343 ? 105.262 32.117  37.402  1.00 3.04  ? 343  GLN A N   1 
ATOM   2588  C CA  . GLN A 1 343 ? 106.249 31.571  38.327  1.00 3.92  ? 343  GLN A CA  1 
ATOM   2589  C C   . GLN A 1 343 ? 107.668 32.074  38.059  1.00 3.84  ? 343  GLN A C   1 
ATOM   2590  O O   . GLN A 1 343 ? 108.510 32.094  38.967  1.00 3.66  ? 343  GLN A O   1 
ATOM   2591  C CB  . GLN A 1 343 ? 106.132 30.026  38.271  1.00 3.12  ? 343  GLN A CB  1 
ATOM   2592  C CG  . GLN A 1 343 ? 104.954 29.487  39.109  1.00 3.69  ? 343  GLN A CG  1 
ATOM   2593  C CD  . GLN A 1 343 ? 103.615 29.760  38.436  1.00 4.91  ? 343  GLN A CD  1 
ATOM   2594  O OE1 . GLN A 1 343 ? 103.433 29.769  37.199  1.00 3.53  ? 343  GLN A OE1 1 
ATOM   2595  N NE2 . GLN A 1 343 ? 102.596 30.018  39.255  1.00 3.69  ? 343  GLN A NE2 1 
ATOM   2596  N N   . VAL A 1 344 ? 107.991 32.425  36.829  1.00 2.87  ? 344  VAL A N   1 
ATOM   2597  C CA  . VAL A 1 344 ? 109.333 32.853  36.444  1.00 2.58  ? 344  VAL A CA  1 
ATOM   2598  C C   . VAL A 1 344 ? 109.577 34.338  36.218  1.00 2.08  ? 344  VAL A C   1 
ATOM   2599  O O   . VAL A 1 344 ? 110.389 34.920  36.970  1.00 2.96  ? 344  VAL A O   1 
ATOM   2600  C CB  . VAL A 1 344 ? 109.836 32.025  35.237  1.00 3.85  ? 344  VAL A CB  1 
ATOM   2601  C CG1 . VAL A 1 344 ? 111.287 32.405  34.920  1.00 3.83  ? 344  VAL A CG1 1 
ATOM   2602  C CG2 . VAL A 1 344 ? 109.695 30.522  35.463  1.00 3.29  ? 344  VAL A CG2 1 
ATOM   2603  N N   . HIS A 1 345 ? 109.052 34.936  35.182  1.00 2.17  ? 345  HIS A N   1 
ATOM   2604  C CA  . HIS A 1 345 ? 109.329 36.305  34.829  1.00 4.12  ? 345  HIS A CA  1 
ATOM   2605  C C   . HIS A 1 345 ? 108.430 37.345  35.452  1.00 4.90  ? 345  HIS A C   1 
ATOM   2606  O O   . HIS A 1 345 ? 109.000 38.389  35.791  1.00 4.72  ? 345  HIS A O   1 
ATOM   2607  C CB  . HIS A 1 345 ? 109.288 36.418  33.290  1.00 4.96  ? 345  HIS A CB  1 
ATOM   2608  C CG  . HIS A 1 345 ? 110.341 35.540  32.684  1.00 7.39  ? 345  HIS A CG  1 
ATOM   2609  N ND1 . HIS A 1 345 ? 111.677 35.869  32.685  1.00 7.45  ? 345  HIS A ND1 1 
ATOM   2610  C CD2 . HIS A 1 345 ? 110.253 34.295  32.109  1.00 6.83  ? 345  HIS A CD2 1 
ATOM   2611  C CE1 . HIS A 1 345 ? 112.375 34.931  32.107  1.00 7.02  ? 345  HIS A CE1 1 
ATOM   2612  N NE2 . HIS A 1 345 ? 111.538 33.964  31.737  1.00 7.89  ? 345  HIS A NE2 1 
ATOM   2613  N N   . ARG A 1 346 ? 107.100 37.222  35.484  1.00 4.30  ? 346  ARG A N   1 
ATOM   2614  C CA  . ARG A 1 346 ? 106.241 38.211  36.115  1.00 3.95  ? 346  ARG A CA  1 
ATOM   2615  C C   . ARG A 1 346 ? 106.469 39.671  35.670  1.00 2.08  ? 346  ARG A C   1 
ATOM   2616  O O   . ARG A 1 346 ? 106.523 40.589  36.503  1.00 3.24  ? 346  ARG A O   1 
ATOM   2617  C CB  . ARG A 1 346 ? 106.466 38.241  37.628  1.00 7.29  ? 346  ARG A CB  1 
ATOM   2618  C CG  . ARG A 1 346 ? 106.273 37.065  38.494  1.00 11.98 ? 346  ARG A CG  1 
ATOM   2619  C CD  . ARG A 1 346 ? 106.336 37.257  39.971  1.00 11.67 ? 346  ARG A CD  1 
ATOM   2620  N NE  . ARG A 1 346 ? 107.611 37.109  40.636  1.00 10.70 ? 346  ARG A NE  1 
ATOM   2621  C CZ  . ARG A 1 346 ? 108.482 36.105  40.494  1.00 10.66 ? 346  ARG A CZ  1 
ATOM   2622  N NH1 . ARG A 1 346 ? 108.254 35.088  39.681  1.00 10.03 ? 346  ARG A NH1 1 
ATOM   2623  N NH2 . ARG A 1 346 ? 109.597 36.142  41.217  1.00 8.48  ? 346  ARG A NH2 1 
ATOM   2624  N N   . PHE A 1 347 ? 106.699 39.876  34.408  1.00 2.70  ? 347  PHE A N   1 
ATOM   2625  C CA  . PHE A 1 347 ? 106.995 41.180  33.851  1.00 3.66  ? 347  PHE A CA  1 
ATOM   2626  C C   . PHE A 1 347 ? 105.784 42.120  33.684  1.00 4.30  ? 347  PHE A C   1 
ATOM   2627  O O   . PHE A 1 347 ? 104.708 41.666  33.278  1.00 3.55  ? 347  PHE A O   1 
ATOM   2628  C CB  . PHE A 1 347 ? 107.627 40.995  32.454  1.00 2.08  ? 347  PHE A CB  1 
ATOM   2629  C CG  . PHE A 1 347 ? 108.430 42.244  32.098  1.00 4.30  ? 347  PHE A CG  1 
ATOM   2630  C CD1 . PHE A 1 347 ? 109.629 42.516  32.726  1.00 3.36  ? 347  PHE A CD1 1 
ATOM   2631  C CD2 . PHE A 1 347 ? 107.981 43.130  31.126  1.00 4.33  ? 347  PHE A CD2 1 
ATOM   2632  C CE1 . PHE A 1 347 ? 110.382 43.649  32.439  1.00 3.66  ? 347  PHE A CE1 1 
ATOM   2633  C CE2 . PHE A 1 347 ? 108.697 44.277  30.824  1.00 6.28  ? 347  PHE A CE2 1 
ATOM   2634  C CZ  . PHE A 1 347 ? 109.912 44.534  31.476  1.00 6.84  ? 347  PHE A CZ  1 
ATOM   2635  N N   . ALA A 1 348 ? 105.998 43.416  33.897  1.00 2.44  ? 348  ALA A N   1 
ATOM   2636  C CA  . ALA A 1 348 ? 105.007 44.455  33.782  1.00 3.29  ? 348  ALA A CA  1 
ATOM   2637  C C   . ALA A 1 348 ? 104.481 44.610  32.375  1.00 2.08  ? 348  ALA A C   1 
ATOM   2638  O O   . ALA A 1 348 ? 105.273 44.718  31.421  1.00 3.15  ? 348  ALA A O   1 
ATOM   2639  C CB  . ALA A 1 348 ? 105.641 45.843  34.168  1.00 3.84  ? 348  ALA A CB  1 
ATOM   2640  N N   . ARG A 1 349 ? 103.182 44.755  32.205  1.00 3.16  ? 349  ARG A N   1 
ATOM   2641  C CA  . ARG A 1 349 ? 102.601 45.053  30.910  1.00 2.08  ? 349  ARG A CA  1 
ATOM   2642  C C   . ARG A 1 349 ? 103.019 46.431  30.414  1.00 2.64  ? 349  ARG A C   1 
ATOM   2643  O O   . ARG A 1 349 ? 103.262 47.365  31.181  1.00 2.80  ? 349  ARG A O   1 
ATOM   2644  C CB  . ARG A 1 349 ? 101.036 45.000  31.002  1.00 3.28  ? 349  ARG A CB  1 
ATOM   2645  C CG  . ARG A 1 349 ? 100.509 43.583  31.286  1.00 2.08  ? 349  ARG A CG  1 
ATOM   2646  C CD  . ARG A 1 349 ? 100.370 42.848  29.937  1.00 3.37  ? 349  ARG A CD  1 
ATOM   2647  N NE  . ARG A 1 349 ? 99.853  41.492  30.145  1.00 3.26  ? 349  ARG A NE  1 
ATOM   2648  C CZ  . ARG A 1 349 ? 99.234  40.789  29.196  1.00 2.08  ? 349  ARG A CZ  1 
ATOM   2649  N NH1 . ARG A 1 349 ? 99.089  41.240  27.959  1.00 2.90  ? 349  ARG A NH1 1 
ATOM   2650  N NH2 . ARG A 1 349 ? 98.807  39.544  29.469  1.00 2.97  ? 349  ARG A NH2 1 
ATOM   2651  N N   . PRO A 1 350 ? 102.950 46.666  29.110  1.00 2.69  ? 350  PRO A N   1 
ATOM   2652  C CA  . PRO A 1 350 ? 103.259 47.944  28.488  1.00 3.34  ? 350  PRO A CA  1 
ATOM   2653  C C   . PRO A 1 350 ? 102.439 49.093  29.051  1.00 4.49  ? 350  PRO A C   1 
ATOM   2654  O O   . PRO A 1 350 ? 103.037 50.159  29.328  1.00 4.58  ? 350  PRO A O   1 
ATOM   2655  C CB  . PRO A 1 350 ? 103.066 47.701  27.010  1.00 2.26  ? 350  PRO A CB  1 
ATOM   2656  C CG  . PRO A 1 350 ? 103.218 46.207  26.831  1.00 2.08  ? 350  PRO A CG  1 
ATOM   2657  C CD  . PRO A 1 350 ? 102.639 45.630  28.095  1.00 2.08  ? 350  PRO A CD  1 
ATOM   2658  N N   . GLU A 1 351 ? 101.161 48.862  29.423  1.00 2.17  ? 351  GLU A N   1 
ATOM   2659  C CA  . GLU A 1 351 ? 100.409 50.005  30.012  1.00 4.41  ? 351  GLU A CA  1 
ATOM   2660  C C   . GLU A 1 351 ? 100.928 50.417  31.359  1.00 4.06  ? 351  GLU A C   1 
ATOM   2661  O O   . GLU A 1 351 ? 100.811 51.586  31.759  1.00 7.62  ? 351  GLU A O   1 
ATOM   2662  C CB  . GLU A 1 351 ? 98.911  49.700  30.059  1.00 2.90  ? 351  GLU A CB  1 
ATOM   2663  C CG  . GLU A 1 351 ? 98.530  48.656  31.102  1.00 2.24  ? 351  GLU A CG  1 
ATOM   2664  C CD  . GLU A 1 351 ? 97.273  47.831  30.941  1.00 2.68  ? 351  GLU A CD  1 
ATOM   2665  O OE1 . GLU A 1 351 ? 96.967  47.269  29.887  1.00 2.45  ? 351  GLU A OE1 1 
ATOM   2666  O OE2 . GLU A 1 351 ? 96.538  47.615  31.918  1.00 4.11  ? 351  GLU A OE2 1 
ATOM   2667  N N   . ALA A 1 352 ? 101.409 49.502  32.175  1.00 4.49  ? 352  ALA A N   1 
ATOM   2668  C CA  . ALA A 1 352 ? 101.955 49.795  33.480  1.00 3.20  ? 352  ALA A CA  1 
ATOM   2669  C C   . ALA A 1 352 ? 103.274 50.584  33.365  1.00 4.46  ? 352  ALA A C   1 
ATOM   2670  O O   . ALA A 1 352 ? 103.426 51.593  34.064  1.00 5.16  ? 352  ALA A O   1 
ATOM   2671  C CB  . ALA A 1 352 ? 102.183 48.511  34.233  1.00 3.11  ? 352  ALA A CB  1 
ATOM   2672  N N   . LEU A 1 353 ? 104.136 50.168  32.461  1.00 4.20  ? 353  LEU A N   1 
ATOM   2673  C CA  . LEU A 1 353 ? 105.376 50.940  32.208  1.00 5.66  ? 353  LEU A CA  1 
ATOM   2674  C C   . LEU A 1 353 ? 105.009 52.293  31.626  1.00 5.69  ? 353  LEU A C   1 
ATOM   2675  O O   . LEU A 1 353 ? 105.678 53.282  31.906  1.00 6.98  ? 353  LEU A O   1 
ATOM   2676  C CB  . LEU A 1 353 ? 106.340 50.180  31.276  1.00 4.54  ? 353  LEU A CB  1 
ATOM   2677  C CG  . LEU A 1 353 ? 106.988 48.931  31.896  1.00 3.09  ? 353  LEU A CG  1 
ATOM   2678  C CD1 . LEU A 1 353 ? 108.223 48.481  31.119  1.00 4.49  ? 353  LEU A CD1 1 
ATOM   2679  C CD2 . LEU A 1 353 ? 107.351 49.136  33.356  1.00 5.80  ? 353  LEU A CD2 1 
ATOM   2680  N N   . GLY A 1 354 ? 103.939 52.364  30.827  1.00 5.51  ? 354  GLY A N   1 
ATOM   2681  C CA  . GLY A 1 354 ? 103.458 53.633  30.275  1.00 4.61  ? 354  GLY A CA  1 
ATOM   2682  C C   . GLY A 1 354 ? 103.076 54.586  31.407  1.00 3.64  ? 354  GLY A C   1 
ATOM   2683  O O   . GLY A 1 354 ? 103.288 55.786  31.298  1.00 4.97  ? 354  GLY A O   1 
ATOM   2684  N N   . GLY A 1 355 ? 102.498 54.137  32.495  1.00 4.46  ? 355  GLY A N   1 
ATOM   2685  C CA  . GLY A 1 355 ? 102.153 54.912  33.651  1.00 4.06  ? 355  GLY A CA  1 
ATOM   2686  C C   . GLY A 1 355 ? 103.446 55.440  34.331  1.00 6.18  ? 355  GLY A C   1 
ATOM   2687  O O   . GLY A 1 355 ? 103.541 56.630  34.643  1.00 4.99  ? 355  GLY A O   1 
ATOM   2688  N N   . THR A 1 356 ? 104.418 54.557  34.538  1.00 3.61  ? 356  THR A N   1 
ATOM   2689  C CA  . THR A 1 356 ? 105.675 54.903  35.142  1.00 4.26  ? 356  THR A CA  1 
ATOM   2690  C C   . THR A 1 356 ? 106.361 55.995  34.307  1.00 2.84  ? 356  THR A C   1 
ATOM   2691  O O   . THR A 1 356 ? 106.819 56.955  34.893  1.00 3.09  ? 356  THR A O   1 
ATOM   2692  C CB  . THR A 1 356 ? 106.597 53.654  35.213  1.00 3.14  ? 356  THR A CB  1 
ATOM   2693  O OG1 . THR A 1 356 ? 105.857 52.673  35.959  1.00 3.13  ? 356  THR A OG1 1 
ATOM   2694  C CG2 . THR A 1 356 ? 107.849 54.004  36.007  1.00 2.08  ? 356  THR A CG2 1 
ATOM   2695  N N   . LEU A 1 357 ? 106.409 55.801  33.015  1.00 3.82  ? 357  LEU A N   1 
ATOM   2696  C CA  . LEU A 1 357 ? 106.976 56.766  32.088  1.00 4.45  ? 357  LEU A CA  1 
ATOM   2697  C C   . LEU A 1 357 ? 106.251 58.109  32.208  1.00 6.30  ? 357  LEU A C   1 
ATOM   2698  O O   . LEU A 1 357 ? 106.832 59.134  32.570  1.00 4.90  ? 357  LEU A O   1 
ATOM   2699  C CB  . LEU A 1 357 ? 106.901 56.166  30.696  1.00 2.08  ? 357  LEU A CB  1 
ATOM   2700  C CG  . LEU A 1 357 ? 107.379 57.032  29.524  1.00 4.05  ? 357  LEU A CG  1 
ATOM   2701  C CD1 . LEU A 1 357 ? 108.893 57.321  29.668  1.00 3.27  ? 357  LEU A CD1 1 
ATOM   2702  C CD2 . LEU A 1 357 ? 107.201 56.466  28.112  1.00 3.99  ? 357  LEU A CD2 1 
ATOM   2703  N N   . HIS A 1 358 ? 104.931 58.112  31.993  1.00 8.26  ? 358  HIS A N   1 
ATOM   2704  C CA  . HIS A 1 358 ? 104.171 59.370  32.101  1.00 8.55  ? 358  HIS A CA  1 
ATOM   2705  C C   . HIS A 1 358 ? 104.455 60.114  33.393  1.00 8.94  ? 358  HIS A C   1 
ATOM   2706  O O   . HIS A 1 358 ? 104.672 61.343  33.408  1.00 10.43 ? 358  HIS A O   1 
ATOM   2707  C CB  . HIS A 1 358 ? 102.672 59.020  32.021  1.00 9.26  ? 358  HIS A CB  1 
ATOM   2708  C CG  . HIS A 1 358 ? 101.822 60.147  32.544  1.00 8.00  ? 358  HIS A CG  1 
ATOM   2709  N ND1 . HIS A 1 358 ? 101.517 61.223  31.755  1.00 7.57  ? 358  HIS A ND1 1 
ATOM   2710  C CD2 . HIS A 1 358 ? 101.220 60.350  33.726  1.00 9.81  ? 358  HIS A CD2 1 
ATOM   2711  C CE1 . HIS A 1 358 ? 100.731 62.058  32.449  1.00 9.06  ? 358  HIS A CE1 1 
ATOM   2712  N NE2 . HIS A 1 358 ? 100.534 61.536  33.647  1.00 9.64  ? 358  HIS A NE2 1 
ATOM   2713  N N   . LEU A 1 359 ? 104.455 59.434  34.537  1.00 7.98  ? 359  LEU A N   1 
ATOM   2714  C CA  . LEU A 1 359 ? 104.719 60.093  35.811  1.00 8.37  ? 359  LEU A CA  1 
ATOM   2715  C C   . LEU A 1 359 ? 106.151 60.604  35.936  1.00 8.75  ? 359  LEU A C   1 
ATOM   2716  O O   . LEU A 1 359 ? 106.403 61.705  36.481  1.00 6.95  ? 359  LEU A O   1 
ATOM   2717  C CB  . LEU A 1 359 ? 104.273 59.217  36.977  1.00 8.24  ? 359  LEU A CB  1 
ATOM   2718  C CG  . LEU A 1 359 ? 102.753 59.010  37.003  1.00 8.70  ? 359  LEU A CG  1 
ATOM   2719  C CD1 . LEU A 1 359 ? 102.365 57.880  37.952  1.00 8.75  ? 359  LEU A CD1 1 
ATOM   2720  C CD2 . LEU A 1 359 ? 102.065 60.309  37.429  1.00 8.89  ? 359  LEU A CD2 1 
ATOM   2721  N N   . THR A 1 360 ? 107.093 59.840  35.381  1.00 7.02  ? 360  THR A N   1 
ATOM   2722  C CA  . THR A 1 360 ? 108.487 60.270  35.379  1.00 7.94  ? 360  THR A CA  1 
ATOM   2723  C C   . THR A 1 360 ? 108.614 61.550  34.537  1.00 7.88  ? 360  THR A C   1 
ATOM   2724  O O   . THR A 1 360 ? 109.244 62.517  34.964  1.00 9.06  ? 360  THR A O   1 
ATOM   2725  C CB  . THR A 1 360 ? 109.421 59.176  34.817  1.00 5.99  ? 360  THR A CB  1 
ATOM   2726  O OG1 . THR A 1 360 ? 109.346 58.095  35.762  1.00 6.80  ? 360  THR A OG1 1 
ATOM   2727  C CG2 . THR A 1 360 ? 110.862 59.680  34.741  1.00 6.22  ? 360  THR A CG2 1 
ATOM   2728  N N   . ILE A 1 361 ? 107.955 61.591  33.393  1.00 7.54  ? 361  ILE A N   1 
ATOM   2729  C CA  . ILE A 1 361 ? 107.999 62.779  32.544  1.00 11.13 ? 361  ILE A CA  1 
ATOM   2730  C C   . ILE A 1 361 ? 107.367 63.971  33.257  1.00 13.24 ? 361  ILE A C   1 
ATOM   2731  O O   . ILE A 1 361 ? 107.830 65.097  33.107  1.00 13.28 ? 361  ILE A O   1 
ATOM   2732  C CB  . ILE A 1 361 ? 107.371 62.590  31.170  1.00 9.58  ? 361  ILE A CB  1 
ATOM   2733  C CG1 . ILE A 1 361 ? 108.255 61.595  30.374  1.00 10.03 ? 361  ILE A CG1 1 
ATOM   2734  C CG2 . ILE A 1 361 ? 107.280 63.853  30.319  1.00 9.04  ? 361  ILE A CG2 1 
ATOM   2735  C CD1 . ILE A 1 361 ? 107.432 61.031  29.208  1.00 11.31 ? 361  ILE A CD1 1 
ATOM   2736  N N   . LYS A 1 362 ? 106.343 63.727  34.060  1.00 14.01 ? 362  LYS A N   1 
ATOM   2737  C CA  . LYS A 1 362 ? 105.686 64.798  34.799  1.00 15.78 ? 362  LYS A CA  1 
ATOM   2738  C C   . LYS A 1 362 ? 106.503 65.162  36.030  1.00 15.18 ? 362  LYS A C   1 
ATOM   2739  O O   . LYS A 1 362 ? 106.130 66.152  36.674  1.00 14.60 ? 362  LYS A O   1 
ATOM   2740  C CB  . LYS A 1 362 ? 104.252 64.407  35.189  1.00 17.85 ? 362  LYS A CB  1 
ATOM   2741  C CG  . LYS A 1 362 ? 103.255 64.536  34.016  1.00 22.07 ? 362  LYS A CG  1 
ATOM   2742  C CD  . LYS A 1 362 ? 102.546 65.887  34.206  1.00 27.24 ? 362  LYS A CD  1 
ATOM   2743  C CE  . LYS A 1 362 ? 101.159 65.954  33.610  1.00 28.65 ? 362  LYS A CE  1 
ATOM   2744  N NZ  . LYS A 1 362 ? 101.206 65.958  32.102  1.00 30.38 ? 362  LYS A NZ  1 
ATOM   2745  N N   . GLY A 1 363 ? 107.518 64.382  36.420  1.00 11.82 ? 363  GLY A N   1 
ATOM   2746  C CA  . GLY A 1 363 ? 108.324 64.746  37.572  1.00 8.59  ? 363  GLY A CA  1 
ATOM   2747  C C   . GLY A 1 363 ? 107.739 64.244  38.875  1.00 8.81  ? 363  GLY A C   1 
ATOM   2748  O O   . GLY A 1 363 ? 108.237 64.604  39.946  1.00 6.94  ? 363  GLY A O   1 
ATOM   2749  N N   . GLU A 1 364 ? 106.742 63.355  38.811  1.00 7.24  ? 364  GLU A N   1 
ATOM   2750  C CA  . GLU A 1 364 ? 106.191 62.781  40.035  1.00 7.31  ? 364  GLU A CA  1 
ATOM   2751  C C   . GLU A 1 364 ? 106.845 61.449  40.402  1.00 5.78  ? 364  GLU A C   1 
ATOM   2752  O O   . GLU A 1 364 ? 106.707 60.982  41.521  1.00 7.59  ? 364  GLU A O   1 
ATOM   2753  C CB  . GLU A 1 364 ? 104.679 62.605  39.900  1.00 10.98 ? 364  GLU A CB  1 
ATOM   2754  C CG  . GLU A 1 364 ? 104.038 63.989  39.614  1.00 15.30 ? 364  GLU A CG  1 
ATOM   2755  C CD  . GLU A 1 364 ? 102.538 63.785  39.751  1.00 20.59 ? 364  GLU A CD  1 
ATOM   2756  O OE1 . GLU A 1 364 ? 102.059 63.750  40.914  1.00 23.98 ? 364  GLU A OE1 1 
ATOM   2757  O OE2 . GLU A 1 364 ? 101.882 63.619  38.724  1.00 21.94 ? 364  GLU A OE2 1 
ATOM   2758  N N   . LEU A 1 365 ? 107.526 60.828  39.461  1.00 2.68  ? 365  LEU A N   1 
ATOM   2759  C CA  . LEU A 1 365 ? 108.320 59.619  39.687  1.00 5.20  ? 365  LEU A CA  1 
ATOM   2760  C C   . LEU A 1 365 ? 109.705 59.876  39.064  1.00 5.66  ? 365  LEU A C   1 
ATOM   2761  O O   . LEU A 1 365 ? 109.850 60.881  38.352  1.00 5.49  ? 365  LEU A O   1 
ATOM   2762  C CB  . LEU A 1 365 ? 107.675 58.388  39.042  1.00 4.10  ? 365  LEU A CB  1 
ATOM   2763  C CG  . LEU A 1 365 ? 106.375 57.910  39.730  1.00 3.16  ? 365  LEU A CG  1 
ATOM   2764  C CD1 . LEU A 1 365 ? 105.919 56.574  39.080  1.00 3.49  ? 365  LEU A CD1 1 
ATOM   2765  C CD2 . LEU A 1 365 ? 106.567 57.648  41.207  1.00 3.30  ? 365  LEU A CD2 1 
ATOM   2766  N N   . ASN A 1 366 ? 110.678 59.030  39.366  1.00 8.12  ? 366  ASN A N   1 
ATOM   2767  C CA  . ASN A 1 366 ? 112.010 59.234  38.770  1.00 9.06  ? 366  ASN A CA  1 
ATOM   2768  C C   . ASN A 1 366 ? 112.532 57.909  38.231  1.00 8.91  ? 366  ASN A C   1 
ATOM   2769  O O   . ASN A 1 366 ? 113.652 57.485  38.513  1.00 6.17  ? 366  ASN A O   1 
ATOM   2770  C CB  . ASN A 1 366 ? 112.901 59.914  39.814  1.00 11.45 ? 366  ASN A CB  1 
ATOM   2771  C CG  . ASN A 1 366 ? 114.303 60.205  39.294  1.00 15.19 ? 366  ASN A CG  1 
ATOM   2772  O OD1 . ASN A 1 366 ? 115.285 60.011  40.052  1.00 17.01 ? 366  ASN A OD1 1 
ATOM   2773  N ND2 . ASN A 1 366 ? 114.441 60.587  38.024  1.00 14.46 ? 366  ASN A ND2 1 
ATOM   2774  N N   . ALA A 1 367 ? 111.730 57.210  37.413  1.00 6.83  ? 367  ALA A N   1 
ATOM   2775  C CA  . ALA A 1 367 ? 112.170 55.899  36.902  1.00 5.89  ? 367  ALA A CA  1 
ATOM   2776  C C   . ALA A 1 367 ? 113.390 56.078  35.981  1.00 7.06  ? 367  ALA A C   1 
ATOM   2777  O O   . ALA A 1 367 ? 113.458 56.943  35.084  1.00 3.44  ? 367  ALA A O   1 
ATOM   2778  C CB  . ALA A 1 367 ? 111.054 55.237  36.102  1.00 3.68  ? 367  ALA A CB  1 
ATOM   2779  N N   . ASP A 1 368 ? 114.307 55.113  36.147  1.00 7.94  ? 368  ASP A N   1 
ATOM   2780  C CA  . ASP A 1 368 ? 115.553 55.148  35.371  1.00 8.94  ? 368  ASP A CA  1 
ATOM   2781  C C   . ASP A 1 368 ? 115.428 54.685  33.949  1.00 8.67  ? 368  ASP A C   1 
ATOM   2782  O O   . ASP A 1 368 ? 116.282 53.934  33.458  1.00 10.25 ? 368  ASP A O   1 
ATOM   2783  C CB  . ASP A 1 368 ? 116.618 54.445  36.213  1.00 8.76  ? 368  ASP A CB  1 
ATOM   2784  C CG  . ASP A 1 368 ? 118.033 54.523  35.670  1.00 9.32  ? 368  ASP A CG  1 
ATOM   2785  O OD1 . ASP A 1 368 ? 118.349 55.478  34.917  1.00 9.71  ? 368  ASP A OD1 1 
ATOM   2786  O OD2 . ASP A 1 368 ? 118.785 53.574  35.983  1.00 8.02  ? 368  ASP A OD2 1 
ATOM   2787  N N   . PHE A 1 369 ? 114.459 55.157  33.139  1.00 7.32  ? 369  PHE A N   1 
ATOM   2788  C CA  . PHE A 1 369 ? 114.411 54.660  31.771  1.00 6.28  ? 369  PHE A CA  1 
ATOM   2789  C C   . PHE A 1 369 ? 115.652 55.147  31.005  1.00 8.01  ? 369  PHE A C   1 
ATOM   2790  O O   . PHE A 1 369 ? 116.114 56.249  31.288  1.00 9.55  ? 369  PHE A O   1 
ATOM   2791  C CB  . PHE A 1 369 ? 113.167 55.112  31.002  1.00 3.42  ? 369  PHE A CB  1 
ATOM   2792  C CG  . PHE A 1 369 ? 111.891 54.472  31.476  1.00 5.98  ? 369  PHE A CG  1 
ATOM   2793  C CD1 . PHE A 1 369 ? 111.596 53.171  31.046  1.00 5.00  ? 369  PHE A CD1 1 
ATOM   2794  C CD2 . PHE A 1 369 ? 110.992 55.143  32.289  1.00 4.68  ? 369  PHE A CD2 1 
ATOM   2795  C CE1 . PHE A 1 369 ? 110.409 52.570  31.440  1.00 5.79  ? 369  PHE A CE1 1 
ATOM   2796  C CE2 . PHE A 1 369 ? 109.795 54.540  32.690  1.00 5.93  ? 369  PHE A CE2 1 
ATOM   2797  C CZ  . PHE A 1 369 ? 109.513 53.243  32.259  1.00 6.72  ? 369  PHE A CZ  1 
ATOM   2798  N N   . ASP A 1 370 ? 116.065 54.394  29.978  1.00 5.76  ? 370  ASP A N   1 
ATOM   2799  C CA  . ASP A 1 370 ? 117.159 54.866  29.145  1.00 5.75  ? 370  ASP A CA  1 
ATOM   2800  C C   . ASP A 1 370 ? 116.793 56.178  28.453  1.00 7.46  ? 370  ASP A C   1 
ATOM   2801  O O   . ASP A 1 370 ? 115.708 56.299  27.835  1.00 6.32  ? 370  ASP A O   1 
ATOM   2802  C CB  . ASP A 1 370 ? 117.437 53.861  28.064  1.00 2.08  ? 370  ASP A CB  1 
ATOM   2803  C CG  . ASP A 1 370 ? 118.716 54.087  27.263  1.00 4.22  ? 370  ASP A CG  1 
ATOM   2804  O OD1 . ASP A 1 370 ? 119.769 53.648  27.783  1.00 4.17  ? 370  ASP A OD1 1 
ATOM   2805  O OD2 . ASP A 1 370 ? 118.682 54.639  26.157  1.00 5.50  ? 370  ASP A OD2 1 
ATOM   2806  N N   . LEU A 1 371 ? 117.792 57.083  28.338  1.00 8.53  ? 371  LEU A N   1 
ATOM   2807  C CA  . LEU A 1 371 ? 117.520 58.387  27.727  1.00 9.68  ? 371  LEU A CA  1 
ATOM   2808  C C   . LEU A 1 371 ? 117.040 58.316  26.312  1.00 8.70  ? 371  LEU A C   1 
ATOM   2809  O O   . LEU A 1 371 ? 116.335 59.237  25.866  1.00 8.76  ? 371  LEU A O   1 
ATOM   2810  C CB  . LEU A 1 371 ? 118.743 59.335  27.863  1.00 12.50 ? 371  LEU A CB  1 
ATOM   2811  C CG  . LEU A 1 371 ? 119.157 59.622  29.309  1.00 12.92 ? 371  LEU A CG  1 
ATOM   2812  C CD1 . LEU A 1 371 ? 120.400 60.517  29.406  1.00 14.68 ? 371  LEU A CD1 1 
ATOM   2813  C CD2 . LEU A 1 371 ? 118.002 60.258  30.058  1.00 14.63 ? 371  LEU A CD2 1 
ATOM   2814  N N   . SER A 1 372 ? 117.253 57.234  25.551  1.00 7.85  ? 372  SER A N   1 
ATOM   2815  C CA  . SER A 1 372 ? 116.742 57.111  24.197  1.00 7.03  ? 372  SER A CA  1 
ATOM   2816  C C   . SER A 1 372 ? 115.200 57.080  24.197  1.00 7.82  ? 372  SER A C   1 
ATOM   2817  O O   . SER A 1 372 ? 114.600 57.361  23.157  1.00 7.20  ? 372  SER A O   1 
ATOM   2818  C CB  . SER A 1 372 ? 117.228 55.844  23.505  1.00 7.30  ? 372  SER A CB  1 
ATOM   2819  O OG  . SER A 1 372 ? 116.814 54.699  24.283  1.00 6.11  ? 372  SER A OG  1 
ATOM   2820  N N   . LEU A 1 373 ? 114.561 56.798  25.329  1.00 8.21  ? 373  LEU A N   1 
ATOM   2821  C CA  . LEU A 1 373 ? 113.087 56.857  25.360  1.00 8.88  ? 373  LEU A CA  1 
ATOM   2822  C C   . LEU A 1 373 ? 112.642 58.149  26.074  1.00 10.47 ? 373  LEU A C   1 
ATOM   2823  O O   . LEU A 1 373 ? 111.799 58.909  25.600  1.00 10.16 ? 373  LEU A O   1 
ATOM   2824  C CB  . LEU A 1 373 ? 112.534 55.636  26.102  1.00 7.54  ? 373  LEU A CB  1 
ATOM   2825  C CG  . LEU A 1 373 ? 111.037 55.729  26.463  1.00 8.72  ? 373  LEU A CG  1 
ATOM   2826  C CD1 . LEU A 1 373 ? 110.157 55.797  25.250  1.00 6.83  ? 373  LEU A CD1 1 
ATOM   2827  C CD2 . LEU A 1 373 ? 110.654 54.554  27.377  1.00 10.41 ? 373  LEU A CD2 1 
ATOM   2828  N N   . LEU A 1 374 ? 113.261 58.403  27.214  1.00 10.06 ? 374  LEU A N   1 
ATOM   2829  C CA  . LEU A 1 374 ? 112.987 59.511  28.113  1.00 13.37 ? 374  LEU A CA  1 
ATOM   2830  C C   . LEU A 1 374 ? 113.230 60.847  27.430  1.00 14.39 ? 374  LEU A C   1 
ATOM   2831  O O   . LEU A 1 374 ? 112.469 61.784  27.657  1.00 15.12 ? 374  LEU A O   1 
ATOM   2832  C CB  . LEU A 1 374 ? 113.825 59.312  29.373  1.00 13.74 ? 374  LEU A CB  1 
ATOM   2833  C CG  . LEU A 1 374 ? 113.381 59.862  30.713  1.00 16.04 ? 374  LEU A CG  1 
ATOM   2834  C CD1 . LEU A 1 374 ? 111.980 59.380  31.099  1.00 16.16 ? 374  LEU A CD1 1 
ATOM   2835  C CD2 . LEU A 1 374 ? 114.392 59.557  31.811  1.00 14.37 ? 374  LEU A CD2 1 
ATOM   2836  N N   . GLU A 1 375 ? 114.169 60.931  26.502  1.00 14.57 ? 375  GLU A N   1 
ATOM   2837  C CA  . GLU A 1 375 ? 114.451 62.128  25.745  1.00 15.75 ? 375  GLU A CA  1 
ATOM   2838  C C   . GLU A 1 375 ? 113.986 62.027  24.313  1.00 14.11 ? 375  GLU A C   1 
ATOM   2839  O O   . GLU A 1 375 ? 114.446 62.777  23.459  1.00 12.40 ? 375  GLU A O   1 
ATOM   2840  C CB  . GLU A 1 375 ? 115.987 62.380  25.773  1.00 20.36 ? 375  GLU A CB  1 
ATOM   2841  C CG  . GLU A 1 375 ? 116.272 63.420  26.855  1.00 24.32 ? 375  GLU A CG  1 
ATOM   2842  C CD  . GLU A 1 375 ? 117.675 63.390  27.443  1.00 26.43 ? 375  GLU A CD  1 
ATOM   2843  O OE1 . GLU A 1 375 ? 118.596 62.943  26.703  1.00 25.87 ? 375  GLU A OE1 1 
ATOM   2844  O OE2 . GLU A 1 375 ? 117.735 63.798  28.647  1.00 26.06 ? 375  GLU A OE2 1 
ATOM   2845  N N   . ASN A 1 376 ? 113.052 61.114  24.014  1.00 11.36 ? 376  ASN A N   1 
ATOM   2846  C CA  . ASN A 1 376 ? 112.601 60.907  22.643  1.00 9.37  ? 376  ASN A CA  1 
ATOM   2847  C C   . ASN A 1 376 ? 111.494 61.907  22.350  1.00 11.24 ? 376  ASN A C   1 
ATOM   2848  O O   . ASN A 1 376 ? 110.300 61.557  22.396  1.00 10.20 ? 376  ASN A O   1 
ATOM   2849  C CB  . ASN A 1 376 ? 112.068 59.458  22.507  1.00 8.51  ? 376  ASN A CB  1 
ATOM   2850  C CG  . ASN A 1 376 ? 111.842 59.097  21.071  1.00 7.32  ? 376  ASN A CG  1 
ATOM   2851  O OD1 . ASN A 1 376 ? 111.461 59.936  20.238  1.00 7.61  ? 376  ASN A OD1 1 
ATOM   2852  N ND2 . ASN A 1 376 ? 112.074 57.810  20.744  1.00 8.16  ? 376  ASN A ND2 1 
ATOM   2853  N N   . ALA A 1 377 ? 111.899 63.137  22.024  1.00 10.95 ? 377  ALA A N   1 
ATOM   2854  C CA  . ALA A 1 377 ? 110.956 64.211  21.785  1.00 10.59 ? 377  ALA A CA  1 
ATOM   2855  C C   . ALA A 1 377 ? 109.969 63.922  20.673  1.00 8.42  ? 377  ALA A C   1 
ATOM   2856  O O   . ALA A 1 377 ? 108.799 64.287  20.813  1.00 8.05  ? 377  ALA A O   1 
ATOM   2857  C CB  . ALA A 1 377 ? 111.703 65.522  21.442  1.00 10.88 ? 377  ALA A CB  1 
ATOM   2858  N N   . GLU A 1 378 ? 110.426 63.409  19.549  1.00 7.11  ? 378  GLU A N   1 
ATOM   2859  C CA  . GLU A 1 378 ? 109.586 63.150  18.409  1.00 8.84  ? 378  GLU A CA  1 
ATOM   2860  C C   . GLU A 1 378 ? 108.402 62.228  18.753  1.00 8.75  ? 378  GLU A C   1 
ATOM   2861  O O   . GLU A 1 378 ? 107.276 62.435  18.298  1.00 7.87  ? 378  GLU A O   1 
ATOM   2862  C CB  . GLU A 1 378 ? 110.398 62.570  17.252  1.00 8.59  ? 378  GLU A CB  1 
ATOM   2863  C CG  . GLU A 1 378 ? 109.633 62.180  16.017  1.00 11.09 ? 378  GLU A CG  1 
ATOM   2864  C CD  . GLU A 1 378 ? 109.061 63.329  15.206  1.00 14.08 ? 378  GLU A CD  1 
ATOM   2865  O OE1 . GLU A 1 378 ? 109.810 64.278  14.924  1.00 11.31 ? 378  GLU A OE1 1 
ATOM   2866  O OE2 . GLU A 1 378 ? 107.852 63.333  14.821  1.00 14.31 ? 378  GLU A OE2 1 
ATOM   2867  N N   . LEU A 1 379 ? 108.670 61.189  19.522  1.00 8.91  ? 379  LEU A N   1 
ATOM   2868  C CA  . LEU A 1 379 ? 107.652 60.234  19.942  1.00 9.19  ? 379  LEU A CA  1 
ATOM   2869  C C   . LEU A 1 379 ? 106.790 60.845  21.053  1.00 8.37  ? 379  LEU A C   1 
ATOM   2870  O O   . LEU A 1 379 ? 105.587 60.815  20.916  1.00 8.09  ? 379  LEU A O   1 
ATOM   2871  C CB  . LEU A 1 379 ? 108.301 58.941  20.480  1.00 7.65  ? 379  LEU A CB  1 
ATOM   2872  C CG  . LEU A 1 379 ? 107.345 57.962  21.191  1.00 8.55  ? 379  LEU A CG  1 
ATOM   2873  C CD1 . LEU A 1 379 ? 106.341 57.403  20.197  1.00 5.45  ? 379  LEU A CD1 1 
ATOM   2874  C CD2 . LEU A 1 379 ? 108.160 56.857  21.885  1.00 7.11  ? 379  LEU A CD2 1 
ATOM   2875  N N   . LEU A 1 380 ? 107.378 61.443  22.087  1.00 6.76  ? 380  LEU A N   1 
ATOM   2876  C CA  . LEU A 1 380 ? 106.593 61.938  23.203  1.00 8.67  ? 380  LEU A CA  1 
ATOM   2877  C C   . LEU A 1 380 ? 105.697 63.115  22.856  1.00 9.64  ? 380  LEU A C   1 
ATOM   2878  O O   . LEU A 1 380 ? 104.570 63.203  23.385  1.00 9.22  ? 380  LEU A O   1 
ATOM   2879  C CB  . LEU A 1 380 ? 107.471 62.120  24.437  1.00 9.97  ? 380  LEU A CB  1 
ATOM   2880  C CG  . LEU A 1 380 ? 108.087 60.782  24.939  1.00 10.55 ? 380  LEU A CG  1 
ATOM   2881  C CD1 . LEU A 1 380 ? 109.174 61.074  25.967  1.00 10.35 ? 380  LEU A CD1 1 
ATOM   2882  C CD2 . LEU A 1 380 ? 107.045 59.854  25.551  1.00 10.71 ? 380  LEU A CD2 1 
ATOM   2883  N N   . LYS A 1 381 ? 106.130 63.973  21.931  1.00 8.50  ? 381  LYS A N   1 
ATOM   2884  C CA  . LYS A 1 381 ? 105.251 65.069  21.532  1.00 10.70 ? 381  LYS A CA  1 
ATOM   2885  C C   . LYS A 1 381 ? 104.015 64.515  20.818  1.00 10.07 ? 381  LYS A C   1 
ATOM   2886  O O   . LYS A 1 381 ? 102.939 65.088  20.961  1.00 8.71  ? 381  LYS A O   1 
ATOM   2887  C CB  . LYS A 1 381 ? 106.026 66.018  20.611  1.00 12.43 ? 381  LYS A CB  1 
ATOM   2888  C CG  . LYS A 1 381 ? 107.048 66.824  21.448  1.00 18.72 ? 381  LYS A CG  1 
ATOM   2889  C CD  . LYS A 1 381 ? 107.825 67.729  20.475  1.00 23.50 ? 381  LYS A CD  1 
ATOM   2890  C CE  . LYS A 1 381 ? 108.634 68.780  21.238  1.00 27.68 ? 381  LYS A CE  1 
ATOM   2891  N NZ  . LYS A 1 381 ? 109.839 69.227  20.434  1.00 31.71 ? 381  LYS A NZ  1 
ATOM   2892  N N   . ARG A 1 382 ? 104.182 63.491  19.960  1.00 7.52  ? 382  ARG A N   1 
ATOM   2893  C CA  . ARG A 1 382 ? 103.041 62.925  19.249  1.00 9.85  ? 382  ARG A CA  1 
ATOM   2894  C C   . ARG A 1 382 ? 102.100 62.256  20.246  1.00 8.76  ? 382  ARG A C   1 
ATOM   2895  O O   . ARG A 1 382 ? 100.896 62.332  20.053  1.00 10.24 ? 382  ARG A O   1 
ATOM   2896  C CB  . ARG A 1 382 ? 103.422 61.893  18.171  1.00 9.70  ? 382  ARG A CB  1 
ATOM   2897  C CG  . ARG A 1 382 ? 104.043 62.571  16.945  1.00 10.86 ? 382  ARG A CG  1 
ATOM   2898  C CD  . ARG A 1 382 ? 104.737 61.542  16.075  1.00 11.00 ? 382  ARG A CD  1 
ATOM   2899  N NE  . ARG A 1 382 ? 105.295 62.124  14.870  1.00 10.43 ? 382  ARG A NE  1 
ATOM   2900  C CZ  . ARG A 1 382 ? 104.704 62.228  13.696  1.00 11.18 ? 382  ARG A CZ  1 
ATOM   2901  N NH1 . ARG A 1 382 ? 103.476 61.748  13.527  1.00 10.56 ? 382  ARG A NH1 1 
ATOM   2902  N NH2 . ARG A 1 382 ? 105.320 62.815  12.682  1.00 10.84 ? 382  ARG A NH2 1 
ATOM   2903  N N   . VAL A 1 383 ? 102.630 61.599  21.275  1.00 7.48  ? 383  VAL A N   1 
ATOM   2904  C CA  . VAL A 1 383 ? 101.769 60.968  22.281  1.00 6.61  ? 383  VAL A CA  1 
ATOM   2905  C C   . VAL A 1 383 ? 100.998 62.036  23.039  1.00 7.71  ? 383  VAL A C   1 
ATOM   2906  O O   . VAL A 1 383 ? 99.757  61.987  23.137  1.00 7.90  ? 383  VAL A O   1 
ATOM   2907  C CB  . VAL A 1 383 ? 102.547 60.059  23.255  1.00 4.25  ? 383  VAL A CB  1 
ATOM   2908  C CG1 . VAL A 1 383 ? 101.632 59.583  24.368  1.00 3.24  ? 383  VAL A CG1 1 
ATOM   2909  C CG2 . VAL A 1 383 ? 103.148 58.857  22.490  1.00 2.12  ? 383  VAL A CG2 1 
ATOM   2910  N N   . ALA A 1 384 ? 101.711 63.056  23.549  1.00 8.15  ? 384  ALA A N   1 
ATOM   2911  C CA  . ALA A 1 384 ? 101.049 64.177  24.221  1.00 7.09  ? 384  ALA A CA  1 
ATOM   2912  C C   . ALA A 1 384 ? 99.890  64.729  23.386  1.00 6.44  ? 384  ALA A C   1 
ATOM   2913  O O   . ALA A 1 384 ? 98.801  65.008  23.898  1.00 5.79  ? 384  ALA A O   1 
ATOM   2914  C CB  . ALA A 1 384 ? 102.047 65.353  24.406  1.00 6.61  ? 384  ALA A CB  1 
ATOM   2915  N N   . ALA A 1 385 ? 100.156 64.972  22.105  1.00 5.46  ? 385  ALA A N   1 
ATOM   2916  C CA  . ALA A 1 385 ? 99.147  65.531  21.223  1.00 8.57  ? 385  ALA A CA  1 
ATOM   2917  C C   . ALA A 1 385 ? 97.924  64.645  20.969  1.00 8.82  ? 385  ALA A C   1 
ATOM   2918  O O   . ALA A 1 385 ? 96.805  65.172  20.857  1.00 8.10  ? 385  ALA A O   1 
ATOM   2919  C CB  . ALA A 1 385 ? 99.719  65.853  19.845  1.00 6.37  ? 385  ALA A CB  1 
ATOM   2920  N N   . ILE A 1 386 ? 98.117  63.328  20.793  1.00 7.43  ? 386  ILE A N   1 
ATOM   2921  C CA  . ILE A 1 386 ? 96.968  62.476  20.480  1.00 6.98  ? 386  ILE A CA  1 
ATOM   2922  C C   . ILE A 1 386 ? 96.132  62.297  21.736  1.00 8.04  ? 386  ILE A C   1 
ATOM   2923  O O   . ILE A 1 386 ? 94.894  62.326  21.680  1.00 9.38  ? 386  ILE A O   1 
ATOM   2924  C CB  . ILE A 1 386 ? 97.418  61.162  19.821  1.00 6.72  ? 386  ILE A CB  1 
ATOM   2925  C CG1 . ILE A 1 386 ? 96.230  60.533  19.076  1.00 6.87  ? 386  ILE A CG1 1 
ATOM   2926  C CG2 . ILE A 1 386 ? 98.071  60.264  20.856  1.00 2.72  ? 386  ILE A CG2 1 
ATOM   2927  C CD1 . ILE A 1 386 ? 96.598  59.262  18.308  1.00 7.64  ? 386  ILE A CD1 1 
ATOM   2928  N N   . ASN A 1 387 ? 96.764  62.308  22.899  1.00 6.55  ? 387  ASN A N   1 
ATOM   2929  C CA  . ASN A 1 387 ? 96.046  62.154  24.160  1.00 7.84  ? 387  ASN A CA  1 
ATOM   2930  C C   . ASN A 1 387 ? 95.275  63.422  24.500  1.00 10.80 ? 387  ASN A C   1 
ATOM   2931  O O   . ASN A 1 387 ? 94.079  63.391  24.839  1.00 9.15  ? 387  ASN A O   1 
ATOM   2932  C CB  . ASN A 1 387 ? 97.023  61.716  25.256  1.00 5.78  ? 387  ASN A CB  1 
ATOM   2933  C CG  . ASN A 1 387 ? 97.458  60.259  25.025  1.00 5.25  ? 387  ASN A CG  1 
ATOM   2934  O OD1 . ASN A 1 387 ? 96.995  59.627  24.072  1.00 6.86  ? 387  ASN A OD1 1 
ATOM   2935  N ND2 . ASN A 1 387 ? 98.259  59.721  25.925  1.00 3.17  ? 387  ASN A ND2 1 
ATOM   2936  N N   . ALA A 1 388 ? 95.943  64.584  24.404  1.00 10.99 ? 388  ALA A N   1 
ATOM   2937  C CA  . ALA A 1 388 ? 95.285  65.856  24.691  1.00 10.44 ? 388  ALA A CA  1 
ATOM   2938  C C   . ALA A 1 388 ? 94.068  66.035  23.777  1.00 9.77  ? 388  ALA A C   1 
ATOM   2939  O O   . ALA A 1 388 ? 93.061  66.579  24.221  1.00 10.46 ? 388  ALA A O   1 
ATOM   2940  C CB  . ALA A 1 388 ? 96.274  67.020  24.464  1.00 9.49  ? 388  ALA A CB  1 
ATOM   2941  N N   . ALA A 1 389 ? 94.117  65.667  22.511  1.00 10.62 ? 389  ALA A N   1 
ATOM   2942  C CA  . ALA A 1 389 ? 93.012  65.786  21.593  1.00 14.15 ? 389  ALA A CA  1 
ATOM   2943  C C   . ALA A 1 389 ? 91.784  64.986  22.054  1.00 16.09 ? 389  ALA A C   1 
ATOM   2944  O O   . ALA A 1 389 ? 90.656  65.407  21.836  1.00 16.02 ? 389  ALA A O   1 
ATOM   2945  C CB  . ALA A 1 389 ? 93.338  65.322  20.189  1.00 13.10 ? 389  ALA A CB  1 
ATOM   2946  N N   . GLN A 1 390 ? 92.006  63.870  22.695  1.00 16.09 ? 390  GLN A N   1 
ATOM   2947  C CA  . GLN A 1 390 ? 91.067  62.906  23.237  1.00 17.08 ? 390  GLN A CA  1 
ATOM   2948  C C   . GLN A 1 390 ? 90.562  63.274  24.626  1.00 15.62 ? 390  GLN A C   1 
ATOM   2949  O O   . GLN A 1 390 ? 89.416  62.975  24.984  1.00 14.64 ? 390  GLN A O   1 
ATOM   2950  C CB  . GLN A 1 390 ? 91.898  61.622  23.400  1.00 17.09 ? 390  GLN A CB  1 
ATOM   2951  C CG  . GLN A 1 390 ? 91.492  60.265  23.874  1.00 19.91 ? 390  GLN A CG  1 
ATOM   2952  C CD  . GLN A 1 390 ? 91.289  59.413  22.650  1.00 21.59 ? 390  GLN A CD  1 
ATOM   2953  O OE1 . GLN A 1 390 ? 92.212  58.901  22.022  1.00 23.05 ? 390  GLN A OE1 1 
ATOM   2954  N NE2 . GLN A 1 390 ? 90.023  59.392  22.238  1.00 24.04 ? 390  GLN A NE2 1 
ATOM   2955  N N   . ASN A 1 391 ? 91.418  63.801  25.496  1.00 13.97 ? 391  ASN A N   1 
ATOM   2956  C CA  . ASN A 1 391 ? 91.089  63.972  26.898  1.00 14.54 ? 391  ASN A CA  1 
ATOM   2957  C C   . ASN A 1 391 ? 90.237  65.193  27.247  1.00 15.87 ? 391  ASN A C   1 
ATOM   2958  O O   . ASN A 1 391 ? 90.325  66.215  26.594  1.00 13.74 ? 391  ASN A O   1 
ATOM   2959  C CB  . ASN A 1 391 ? 92.376  64.060  27.721  1.00 13.85 ? 391  ASN A CB  1 
ATOM   2960  C CG  . ASN A 1 391 ? 93.015  62.723  28.090  1.00 15.85 ? 391  ASN A CG  1 
ATOM   2961  O OD1 . ASN A 1 391 ? 92.326  61.701  28.115  1.00 11.93 ? 391  ASN A OD1 1 
ATOM   2962  N ND2 . ASN A 1 391 ? 94.316  62.757  28.381  1.00 11.98 ? 391  ASN A ND2 1 
ATOM   2963  N N   . PRO A 1 392 ? 89.509  65.089  28.356  1.00 18.62 ? 392  PRO A N   1 
ATOM   2964  C CA  . PRO A 1 392 ? 88.722  66.198  28.898  1.00 20.51 ? 392  PRO A CA  1 
ATOM   2965  C C   . PRO A 1 392 ? 89.627  67.360  29.261  1.00 22.36 ? 392  PRO A C   1 
ATOM   2966  O O   . PRO A 1 392 ? 90.646  67.226  29.955  1.00 22.67 ? 392  PRO A O   1 
ATOM   2967  C CB  . PRO A 1 392 ? 88.090  65.653  30.177  1.00 20.55 ? 392  PRO A CB  1 
ATOM   2968  C CG  . PRO A 1 392 ? 88.809  64.390  30.506  1.00 20.04 ? 392  PRO A CG  1 
ATOM   2969  C CD  . PRO A 1 392 ? 89.400  63.889  29.217  1.00 18.63 ? 392  PRO A CD  1 
ATOM   2970  N N   . ASN A 1 393 ? 89.283  68.548  28.802  1.00 23.77 ? 393  ASN A N   1 
ATOM   2971  C CA  . ASN A 1 393 ? 90.039  69.777  28.994  1.00 25.56 ? 393  ASN A CA  1 
ATOM   2972  C C   . ASN A 1 393 ? 91.346  69.734  28.209  1.00 24.70 ? 393  ASN A C   1 
ATOM   2973  O O   . ASN A 1 393 ? 92.293  70.446  28.548  1.00 23.99 ? 393  ASN A O   1 
ATOM   2974  C CB  . ASN A 1 393 ? 90.397  70.008  30.461  1.00 29.03 ? 393  ASN A CB  1 
ATOM   2975  C CG  . ASN A 1 393 ? 89.217  70.041  31.409  1.00 32.62 ? 393  ASN A CG  1 
ATOM   2976  O OD1 . ASN A 1 393 ? 89.418  69.638  32.566  1.00 34.78 ? 393  ASN A OD1 1 
ATOM   2977  N ND2 . ASN A 1 393 ? 88.056  70.479  30.919  1.00 32.94 ? 393  ASN A ND2 1 
ATOM   2978  N N   . ASN A 1 394 ? 91.473  68.838  27.231  1.00 23.16 ? 394  ASN A N   1 
ATOM   2979  C CA  . ASN A 1 394 ? 92.694  68.629  26.479  1.00 21.33 ? 394  ASN A CA  1 
ATOM   2980  C C   . ASN A 1 394 ? 93.889  68.375  27.385  1.00 17.39 ? 394  ASN A C   1 
ATOM   2981  O O   . ASN A 1 394 ? 94.980  68.852  27.121  1.00 15.82 ? 394  ASN A O   1 
ATOM   2982  C CB  . ASN A 1 394 ? 92.964  69.841  25.579  1.00 24.06 ? 394  ASN A CB  1 
ATOM   2983  C CG  . ASN A 1 394 ? 91.866  70.029  24.558  1.00 26.29 ? 394  ASN A CG  1 
ATOM   2984  O OD1 . ASN A 1 394 ? 90.966  70.854  24.765  1.00 27.88 ? 394  ASN A OD1 1 
ATOM   2985  N ND2 . ASN A 1 394 ? 91.923  69.267  23.478  1.00 27.29 ? 394  ASN A ND2 1 
ATOM   2986  N N   . GLU A 1 395 ? 93.736  67.672  28.495  1.00 17.19 ? 395  GLU A N   1 
ATOM   2987  C CA  . GLU A 1 395 ? 94.857  67.441  29.389  1.00 17.95 ? 395  GLU A CA  1 
ATOM   2988  C C   . GLU A 1 395 ? 95.886  66.524  28.712  1.00 15.01 ? 395  GLU A C   1 
ATOM   2989  O O   . GLU A 1 395 ? 95.512  65.546  28.090  1.00 13.12 ? 395  GLU A O   1 
ATOM   2990  C CB  . GLU A 1 395 ? 94.423  66.822  30.716  1.00 21.32 ? 395  GLU A CB  1 
ATOM   2991  C CG  . GLU A 1 395 ? 95.660  66.564  31.588  1.00 26.30 ? 395  GLU A CG  1 
ATOM   2992  C CD  . GLU A 1 395 ? 95.316  65.845  32.874  1.00 29.56 ? 395  GLU A CD  1 
ATOM   2993  O OE1 . GLU A 1 395 ? 94.271  66.264  33.436  1.00 31.42 ? 395  GLU A OE1 1 
ATOM   2994  O OE2 . GLU A 1 395 ? 96.056  64.914  33.293  1.00 30.58 ? 395  GLU A OE2 1 
ATOM   2995  N N   . VAL A 1 396 ? 97.141  66.903  28.774  1.00 13.24 ? 396  VAL A N   1 
ATOM   2996  C CA  . VAL A 1 396 ? 98.227  66.127  28.216  1.00 13.14 ? 396  VAL A CA  1 
ATOM   2997  C C   . VAL A 1 396 ? 98.605  64.969  29.137  1.00 11.44 ? 396  VAL A C   1 
ATOM   2998  O O   . VAL A 1 396 ? 98.751  65.123  30.350  1.00 11.05 ? 396  VAL A O   1 
ATOM   2999  C CB  . VAL A 1 396 ? 99.478  66.998  27.962  1.00 13.14 ? 396  VAL A CB  1 
ATOM   3000  C CG1 . VAL A 1 396 ? 100.724 66.142  27.751  1.00 13.52 ? 396  VAL A CG1 1 
ATOM   3001  C CG2 . VAL A 1 396 ? 99.224  67.865  26.741  1.00 12.97 ? 396  VAL A CG2 1 
ATOM   3002  N N   . THR A 1 397 ? 98.714  63.762  28.554  1.00 9.54  ? 397  THR A N   1 
ATOM   3003  C CA  . THR A 1 397 ? 99.278  62.631  29.296  1.00 6.76  ? 397  THR A CA  1 
ATOM   3004  C C   . THR A 1 397 ? 100.250 61.931  28.325  1.00 5.46  ? 397  THR A C   1 
ATOM   3005  O O   . THR A 1 397 ? 100.071 62.031  27.110  1.00 3.30  ? 397  THR A O   1 
ATOM   3006  C CB  . THR A 1 397 ? 98.329  61.537  29.820  1.00 6.68  ? 397  THR A CB  1 
ATOM   3007  O OG1 . THR A 1 397 ? 97.810  60.832  28.683  1.00 5.40  ? 397  THR A OG1 1 
ATOM   3008  C CG2 . THR A 1 397 ? 97.201  62.114  30.658  1.00 8.09  ? 397  THR A CG2 1 
ATOM   3009  N N   . TYR A 1 398 ? 101.187 61.125  28.822  1.00 3.98  ? 398  TYR A N   1 
ATOM   3010  C CA  . TYR A 1 398 ? 102.055 60.368  27.930  1.00 5.19  ? 398  TYR A CA  1 
ATOM   3011  C C   . TYR A 1 398 ? 101.745 58.879  28.134  1.00 6.96  ? 398  TYR A C   1 
ATOM   3012  O O   . TYR A 1 398 ? 102.592 58.017  27.840  1.00 6.05  ? 398  TYR A O   1 
ATOM   3013  C CB  . TYR A 1 398 ? 103.544 60.603  28.259  1.00 7.65  ? 398  TYR A CB  1 
ATOM   3014  C CG  . TYR A 1 398 ? 103.892 62.057  28.031  1.00 7.63  ? 398  TYR A CG  1 
ATOM   3015  C CD1 . TYR A 1 398 ? 103.668 62.907  29.093  1.00 10.64 ? 398  TYR A CD1 1 
ATOM   3016  C CD2 . TYR A 1 398 ? 104.398 62.550  26.871  1.00 9.80  ? 398  TYR A CD2 1 
ATOM   3017  C CE1 . TYR A 1 398 ? 103.931 64.265  28.953  1.00 11.63 ? 398  TYR A CE1 1 
ATOM   3018  C CE2 . TYR A 1 398 ? 104.685 63.913  26.691  1.00 10.79 ? 398  TYR A CE2 1 
ATOM   3019  C CZ  . TYR A 1 398 ? 104.441 64.742  27.769  1.00 11.74 ? 398  TYR A CZ  1 
ATOM   3020  O OH  . TYR A 1 398 ? 104.716 66.087  27.636  1.00 12.90 ? 398  TYR A OH  1 
ATOM   3021  N N   . LEU A 1 399 ? 100.526 58.581  28.600  1.00 4.85  ? 399  LEU A N   1 
ATOM   3022  C CA  . LEU A 1 399 ? 100.168 57.180  28.830  1.00 3.41  ? 399  LEU A CA  1 
ATOM   3023  C C   . LEU A 1 399 ? 100.137 56.462  27.495  1.00 3.54  ? 399  LEU A C   1 
ATOM   3024  O O   . LEU A 1 399 ? 99.864  57.100  26.469  1.00 3.39  ? 399  LEU A O   1 
ATOM   3025  C CB  . LEU A 1 399 ? 98.790  57.065  29.533  1.00 4.65  ? 399  LEU A CB  1 
ATOM   3026  C CG  . LEU A 1 399 ? 98.847  57.604  30.975  1.00 5.06  ? 399  LEU A CG  1 
ATOM   3027  C CD1 . LEU A 1 399 ? 97.464  57.932  31.529  1.00 4.67  ? 399  LEU A CD1 1 
ATOM   3028  C CD2 . LEU A 1 399 ? 99.580  56.557  31.827  1.00 5.49  ? 399  LEU A CD2 1 
ATOM   3029  N N   . LEU A 1 400 ? 100.380 55.137  27.534  1.00 3.13  ? 400  LEU A N   1 
ATOM   3030  C CA  . LEU A 1 400 ? 100.315 54.396  26.271  1.00 4.12  ? 400  LEU A CA  1 
ATOM   3031  C C   . LEU A 1 400 ? 98.868  54.166  25.859  1.00 4.14  ? 400  LEU A C   1 
ATOM   3032  O O   . LEU A 1 400 ? 98.085  53.541  26.573  1.00 3.38  ? 400  LEU A O   1 
ATOM   3033  C CB  . LEU A 1 400 ? 101.059 53.068  26.481  1.00 4.96  ? 400  LEU A CB  1 
ATOM   3034  C CG  . LEU A 1 400 ? 100.941 51.975  25.433  1.00 7.59  ? 400  LEU A CG  1 
ATOM   3035  C CD1 . LEU A 1 400 ? 101.338 52.382  24.043  1.00 5.46  ? 400  LEU A CD1 1 
ATOM   3036  C CD2 . LEU A 1 400 ? 101.772 50.725  25.838  1.00 6.83  ? 400  LEU A CD2 1 
ATOM   3037  N N   . PRO A 1 401 ? 98.449  54.718  24.740  1.00 3.65  ? 401  PRO A N   1 
ATOM   3038  C CA  . PRO A 1 401 ? 97.076  54.627  24.274  1.00 4.37  ? 401  PRO A CA  1 
ATOM   3039  C C   . PRO A 1 401 ? 96.680  53.183  24.008  1.00 4.34  ? 401  PRO A C   1 
ATOM   3040  O O   . PRO A 1 401 ? 97.338  52.555  23.175  1.00 3.59  ? 401  PRO A O   1 
ATOM   3041  C CB  . PRO A 1 401 ? 96.992  55.450  22.997  1.00 3.64  ? 401  PRO A CB  1 
ATOM   3042  C CG  . PRO A 1 401 ? 98.181  56.367  23.120  1.00 4.25  ? 401  PRO A CG  1 
ATOM   3043  C CD  . PRO A 1 401 ? 99.238  55.514  23.777  1.00 3.61  ? 401  PRO A CD  1 
ATOM   3044  N N   . GLN A 1 402 ? 95.601  52.738  24.645  1.00 3.74  ? 402  GLN A N   1 
ATOM   3045  C CA  . GLN A 1 402 ? 95.147  51.345  24.450  1.00 2.86  ? 402  GLN A CA  1 
ATOM   3046  C C   . GLN A 1 402 ? 94.046  51.293  23.416  1.00 5.25  ? 402  GLN A C   1 
ATOM   3047  O O   . GLN A 1 402 ? 93.214  52.223  23.256  1.00 4.13  ? 402  GLN A O   1 
ATOM   3048  C CB  . GLN A 1 402 ? 94.771  50.846  25.862  1.00 2.08  ? 402  GLN A CB  1 
ATOM   3049  C CG  . GLN A 1 402 ? 95.832  50.874  26.928  1.00 3.62  ? 402  GLN A CG  1 
ATOM   3050  C CD  . GLN A 1 402 ? 96.887  49.805  26.597  1.00 6.52  ? 402  GLN A CD  1 
ATOM   3051  O OE1 . GLN A 1 402 ? 96.544  48.624  26.471  1.00 4.93  ? 402  GLN A OE1 1 
ATOM   3052  N NE2 . GLN A 1 402 ? 98.115  50.249  26.431  1.00 5.41  ? 402  GLN A NE2 1 
ATOM   3053  N N   . ALA A 1 403 ? 93.940  50.258  22.561  1.00 3.29  ? 403  ALA A N   1 
ATOM   3054  C CA  . ALA A 1 403 ? 92.892  50.138  21.574  1.00 4.19  ? 403  ALA A CA  1 
ATOM   3055  C C   . ALA A 1 403 ? 91.622  49.544  22.227  1.00 3.86  ? 403  ALA A C   1 
ATOM   3056  O O   . ALA A 1 403 ? 90.608  49.392  21.517  1.00 5.13  ? 403  ALA A O   1 
ATOM   3057  C CB  . ALA A 1 403 ? 93.290  49.277  20.400  1.00 2.08  ? 403  ALA A CB  1 
ATOM   3058  N N   . ILE A 1 404 ? 91.687  49.209  23.487  1.00 2.08  ? 404  ILE A N   1 
ATOM   3059  C CA  . ILE A 1 404 ? 90.611  48.638  24.271  1.00 3.63  ? 404  ILE A CA  1 
ATOM   3060  C C   . ILE A 1 404 ? 90.549  49.275  25.658  1.00 2.48  ? 404  ILE A C   1 
ATOM   3061  O O   . ILE A 1 404 ? 91.553  49.493  26.385  1.00 2.92  ? 404  ILE A O   1 
ATOM   3062  C CB  . ILE A 1 404 ? 90.742  47.101  24.466  1.00 4.19  ? 404  ILE A CB  1 
ATOM   3063  C CG1 . ILE A 1 404 ? 92.215  46.706  24.721  1.00 2.41  ? 404  ILE A CG1 1 
ATOM   3064  C CG2 . ILE A 1 404 ? 90.226  46.438  23.191  1.00 4.31  ? 404  ILE A CG2 1 
ATOM   3065  C CD1 . ILE A 1 404 ? 92.379  45.203  24.832  1.00 2.91  ? 404  ILE A CD1 1 
ATOM   3066  N N   . GLN A 1 405 ? 89.317  49.514  26.080  1.00 3.50  ? 405  GLN A N   1 
ATOM   3067  C CA  . GLN A 1 405 ? 89.039  50.136  27.369  1.00 3.31  ? 405  GLN A CA  1 
ATOM   3068  C C   . GLN A 1 405 ? 89.557  49.376  28.555  1.00 3.51  ? 405  GLN A C   1 
ATOM   3069  O O   . GLN A 1 405 ? 89.921  49.955  29.597  1.00 3.13  ? 405  GLN A O   1 
ATOM   3070  C CB  . GLN A 1 405 ? 87.500  50.341  27.559  1.00 2.08  ? 405  GLN A CB  1 
ATOM   3071  C CG  . GLN A 1 405 ? 86.906  51.252  26.448  1.00 3.66  ? 405  GLN A CG  1 
ATOM   3072  C CD  . GLN A 1 405 ? 86.484  52.618  26.979  1.00 5.80  ? 405  GLN A CD  1 
ATOM   3073  O OE1 . GLN A 1 405 ? 87.104  53.183  27.885  1.00 5.72  ? 405  GLN A OE1 1 
ATOM   3074  N NE2 . GLN A 1 405 ? 85.438  53.186  26.382  1.00 4.50  ? 405  GLN A NE2 1 
ATOM   3075  N N   . GLU A 1 406 ? 89.577  48.042  28.487  1.00 3.03  ? 406  GLU A N   1 
ATOM   3076  C CA  . GLU A 1 406 ? 90.035  47.240  29.612  1.00 3.56  ? 406  GLU A CA  1 
ATOM   3077  C C   . GLU A 1 406 ? 91.561  47.076  29.715  1.00 2.39  ? 406  GLU A C   1 
ATOM   3078  O O   . GLU A 1 406 ? 92.022  46.546  30.742  1.00 3.08  ? 406  GLU A O   1 
ATOM   3079  C CB  . GLU A 1 406 ? 89.431  45.830  29.508  1.00 4.11  ? 406  GLU A CB  1 
ATOM   3080  C CG  . GLU A 1 406 ? 90.039  45.019  28.354  1.00 2.08  ? 406  GLU A CG  1 
ATOM   3081  C CD  . GLU A 1 406 ? 89.053  43.841  28.118  1.00 7.03  ? 406  GLU A CD  1 
ATOM   3082  O OE1 . GLU A 1 406 ? 87.894  44.137  27.755  1.00 6.08  ? 406  GLU A OE1 1 
ATOM   3083  O OE2 . GLU A 1 406 ? 89.418  42.648  28.243  1.00 6.13  ? 406  GLU A OE2 1 
ATOM   3084  N N   . GLY A 1 407 ? 92.253  47.415  28.644  1.00 2.12  ? 407  GLY A N   1 
ATOM   3085  C CA  . GLY A 1 407 ? 93.738  47.314  28.687  1.00 2.08  ? 407  GLY A CA  1 
ATOM   3086  C C   . GLY A 1 407 ? 94.085  45.821  28.589  1.00 2.08  ? 407  GLY A C   1 
ATOM   3087  O O   . GLY A 1 407 ? 93.336  44.941  28.059  1.00 3.22  ? 407  GLY A O   1 
ATOM   3088  N N   . SER A 1 408 ? 95.177  45.415  29.211  1.00 2.62  ? 408  SER A N   1 
ATOM   3089  C CA  . SER A 1 408 ? 95.596  44.016  29.109  1.00 3.12  ? 408  SER A CA  1 
ATOM   3090  C C   . SER A 1 408 ? 94.769  43.060  29.943  1.00 2.86  ? 408  SER A C   1 
ATOM   3091  O O   . SER A 1 408 ? 94.285  43.455  31.006  1.00 2.08  ? 408  SER A O   1 
ATOM   3092  C CB  . SER A 1 408 ? 97.032  43.965  29.734  1.00 2.08  ? 408  SER A CB  1 
ATOM   3093  O OG  . SER A 1 408 ? 97.011  44.012  31.122  1.00 2.08  ? 408  SER A OG  1 
ATOM   3094  N N   . PRO A 1 409 ? 94.793  41.771  29.626  1.00 3.54  ? 409  PRO A N   1 
ATOM   3095  C CA  . PRO A 1 409 ? 94.284  40.761  30.557  1.00 3.85  ? 409  PRO A CA  1 
ATOM   3096  C C   . PRO A 1 409 ? 95.014  40.839  31.884  1.00 3.18  ? 409  PRO A C   1 
ATOM   3097  O O   . PRO A 1 409 ? 96.166  41.353  32.024  1.00 3.54  ? 409  PRO A O   1 
ATOM   3098  C CB  . PRO A 1 409 ? 94.583  39.457  29.805  1.00 4.26  ? 409  PRO A CB  1 
ATOM   3099  C CG  . PRO A 1 409 ? 94.466  39.877  28.370  1.00 2.79  ? 409  PRO A CG  1 
ATOM   3100  C CD  . PRO A 1 409 ? 95.291  41.167  28.371  1.00 4.02  ? 409  PRO A CD  1 
ATOM   3101  N N   . THR A 1 410 ? 94.393  40.340  32.957  1.00 2.08  ? 410  THR A N   1 
ATOM   3102  C CA  . THR A 1 410 ? 94.996  40.326  34.280  1.00 2.66  ? 410  THR A CA  1 
ATOM   3103  C C   . THR A 1 410 ? 95.941  39.130  34.468  1.00 3.24  ? 410  THR A C   1 
ATOM   3104  O O   . THR A 1 410 ? 95.706  38.259  35.306  1.00 3.04  ? 410  THR A O   1 
ATOM   3105  C CB  . THR A 1 410 ? 93.914  40.416  35.380  1.00 2.99  ? 410  THR A CB  1 
ATOM   3106  O OG1 . THR A 1 410 ? 93.037  41.496  34.978  1.00 4.80  ? 410  THR A OG1 1 
ATOM   3107  C CG2 . THR A 1 410 ? 94.435  40.752  36.761  1.00 2.08  ? 410  THR A CG2 1 
ATOM   3108  N N   . HIS A 1 411 ? 97.036  39.158  33.705  1.00 2.08  ? 411  HIS A N   1 
ATOM   3109  C CA  . HIS A 1 411 ? 98.148  38.175  33.836  1.00 4.20  ? 411  HIS A CA  1 
ATOM   3110  C C   . HIS A 1 411 ? 99.402  38.835  33.228  1.00 3.22  ? 411  HIS A C   1 
ATOM   3111  O O   . HIS A 1 411 ? 99.306  39.820  32.507  1.00 2.75  ? 411  HIS A O   1 
ATOM   3112  C CB  . HIS A 1 411 ? 97.954  36.809  33.202  1.00 2.50  ? 411  HIS A CB  1 
ATOM   3113  C CG  . HIS A 1 411 ? 97.411  36.753  31.830  1.00 2.08  ? 411  HIS A CG  1 
ATOM   3114  N ND1 . HIS A 1 411 ? 98.279  36.733  30.744  1.00 2.35  ? 411  HIS A ND1 1 
ATOM   3115  C CD2 . HIS A 1 411 ? 96.120  36.654  31.347  1.00 2.08  ? 411  HIS A CD2 1 
ATOM   3116  C CE1 . HIS A 1 411 ? 97.536  36.665  29.642  1.00 2.51  ? 411  HIS A CE1 1 
ATOM   3117  N NE2 . HIS A 1 411 ? 96.240  36.616  29.963  1.00 2.69  ? 411  HIS A NE2 1 
ATOM   3118  N N   . PRO A 1 412 ? 100.574 38.418  33.658  1.00 4.43  ? 412  PRO A N   1 
ATOM   3119  C CA  . PRO A 1 412 ? 101.838 39.050  33.271  1.00 4.29  ? 412  PRO A CA  1 
ATOM   3120  C C   . PRO A 1 412 ? 102.071 39.082  31.785  1.00 3.87  ? 412  PRO A C   1 
ATOM   3121  O O   . PRO A 1 412 ? 101.590 38.326  30.933  1.00 2.08  ? 412  PRO A O   1 
ATOM   3122  C CB  . PRO A 1 412 ? 102.892 38.259  34.049  1.00 4.78  ? 412  PRO A CB  1 
ATOM   3123  C CG  . PRO A 1 412 ? 102.096 37.737  35.215  1.00 5.53  ? 412  PRO A CG  1 
ATOM   3124  C CD  . PRO A 1 412 ? 100.768 37.274  34.600  1.00 2.08  ? 412  PRO A CD  1 
ATOM   3125  N N   . SER A 1 413 ? 102.915 40.036  31.363  1.00 3.39  ? 413  SER A N   1 
ATOM   3126  C CA  . SER A 1 413 ? 103.175 40.264  29.974  1.00 2.66  ? 413  SER A CA  1 
ATOM   3127  C C   . SER A 1 413 ? 103.874 39.160  29.190  1.00 2.08  ? 413  SER A C   1 
ATOM   3128  O O   . SER A 1 413 ? 103.660 38.991  27.995  1.00 3.10  ? 413  SER A O   1 
ATOM   3129  C CB  . SER A 1 413 ? 104.091 41.513  29.814  1.00 2.08  ? 413  SER A CB  1 
ATOM   3130  O OG  . SER A 1 413 ? 103.746 42.122  28.563  1.00 2.80  ? 413  SER A OG  1 
ATOM   3131  N N   . TYR A 1 414 ? 104.904 38.565  29.784  1.00 2.08  ? 414  TYR A N   1 
ATOM   3132  C CA  . TYR A 1 414 ? 105.851 37.698  29.076  1.00 2.63  ? 414  TYR A CA  1 
ATOM   3133  C C   . TYR A 1 414 ? 105.844 36.215  29.383  1.00 2.08  ? 414  TYR A C   1 
ATOM   3134  O O   . TYR A 1 414 ? 105.969 35.816  30.542  1.00 3.26  ? 414  TYR A O   1 
ATOM   3135  C CB  . TYR A 1 414 ? 107.256 38.237  29.472  1.00 2.32  ? 414  TYR A CB  1 
ATOM   3136  C CG  . TYR A 1 414 ? 108.481 37.560  28.909  1.00 2.08  ? 414  TYR A CG  1 
ATOM   3137  C CD1 . TYR A 1 414 ? 108.631 37.797  27.547  1.00 2.08  ? 414  TYR A CD1 1 
ATOM   3138  C CD2 . TYR A 1 414 ? 109.431 36.778  29.587  1.00 2.08  ? 414  TYR A CD2 1 
ATOM   3139  C CE1 . TYR A 1 414 ? 109.740 37.314  26.857  1.00 3.04  ? 414  TYR A CE1 1 
ATOM   3140  C CE2 . TYR A 1 414 ? 110.504 36.250  28.880  1.00 2.08  ? 414  TYR A CE2 1 
ATOM   3141  C CZ  . TYR A 1 414 ? 110.651 36.531  27.544  1.00 2.99  ? 414  TYR A CZ  1 
ATOM   3142  O OH  . TYR A 1 414 ? 111.757 36.010  26.952  1.00 2.83  ? 414  TYR A OH  1 
ATOM   3143  N N   . PRO A 1 415 ? 105.709 35.372  28.383  1.00 2.97  ? 415  PRO A N   1 
ATOM   3144  C CA  . PRO A 1 415 ? 105.452 35.754  27.041  1.00 2.08  ? 415  PRO A CA  1 
ATOM   3145  C C   . PRO A 1 415 ? 103.940 35.951  26.737  1.00 3.00  ? 415  PRO A C   1 
ATOM   3146  O O   . PRO A 1 415 ? 103.155 35.841  27.649  1.00 2.08  ? 415  PRO A O   1 
ATOM   3147  C CB  . PRO A 1 415 ? 105.898 34.517  26.274  1.00 2.08  ? 415  PRO A CB  1 
ATOM   3148  C CG  . PRO A 1 415 ? 105.449 33.407  27.173  1.00 2.37  ? 415  PRO A CG  1 
ATOM   3149  C CD  . PRO A 1 415 ? 105.681 33.873  28.581  1.00 3.55  ? 415  PRO A CD  1 
ATOM   3150  N N   . SER A 1 416 ? 103.661 36.243  25.514  1.00 2.74  ? 416  SER A N   1 
ATOM   3151  C CA  . SER A 1 416 ? 102.275 36.353  25.064  1.00 5.15  ? 416  SER A CA  1 
ATOM   3152  C C   . SER A 1 416 ? 101.730 34.922  24.865  1.00 4.53  ? 416  SER A C   1 
ATOM   3153  O O   . SER A 1 416 ? 102.376 34.051  24.297  1.00 2.89  ? 416  SER A O   1 
ATOM   3154  C CB  . SER A 1 416 ? 102.264 37.101  23.731  1.00 3.90  ? 416  SER A CB  1 
ATOM   3155  O OG  . SER A 1 416 ? 101.035 36.857  23.088  1.00 3.34  ? 416  SER A OG  1 
ATOM   3156  N N   . GLY A 1 417 ? 100.556 34.672  25.419  1.00 3.55  ? 417  GLY A N   1 
ATOM   3157  C CA  . GLY A 1 417 ? 99.859  33.382  25.273  1.00 4.17  ? 417  GLY A CA  1 
ATOM   3158  C C   . GLY A 1 417 ? 99.352  33.202  23.862  1.00 2.93  ? 417  GLY A C   1 
ATOM   3159  O O   . GLY A 1 417 ? 99.311  32.112  23.262  1.00 4.40  ? 417  GLY A O   1 
ATOM   3160  N N   . HIS A 1 418 ? 98.909  34.316  23.218  1.00 3.95  ? 418  HIS A N   1 
ATOM   3161  C CA  . HIS A 1 418 ? 98.533  34.278  21.811  1.00 2.08  ? 418  HIS A CA  1 
ATOM   3162  C C   . HIS A 1 418 ? 99.735  33.870  20.945  1.00 3.72  ? 418  HIS A C   1 
ATOM   3163  O O   . HIS A 1 418 ? 99.633  33.154  19.945  1.00 2.95  ? 418  HIS A O   1 
ATOM   3164  C CB  . HIS A 1 418 ? 98.000  35.665  21.382  1.00 4.11  ? 418  HIS A CB  1 
ATOM   3165  C CG  . HIS A 1 418 ? 96.538  35.928  21.661  1.00 3.19  ? 418  HIS A CG  1 
ATOM   3166  N ND1 . HIS A 1 418 ? 95.991  36.048  22.913  1.00 3.83  ? 418  HIS A ND1 1 
ATOM   3167  C CD2 . HIS A 1 418 ? 95.530  36.061  20.756  1.00 3.62  ? 418  HIS A CD2 1 
ATOM   3168  C CE1 . HIS A 1 418 ? 94.678  36.247  22.794  1.00 5.41  ? 418  HIS A CE1 1 
ATOM   3169  N NE2 . HIS A 1 418 ? 94.371  36.263  21.502  1.00 3.44  ? 418  HIS A NE2 1 
ATOM   3170  N N   . ALA A 1 419 ? 100.935 34.406  21.242  1.00 2.82  ? 419  ALA A N   1 
ATOM   3171  C CA  . ALA A 1 419 ? 102.141 34.061  20.471  1.00 3.31  ? 419  ALA A CA  1 
ATOM   3172  C C   . ALA A 1 419 ? 102.579 32.590  20.743  1.00 2.08  ? 419  ALA A C   1 
ATOM   3173  O O   . ALA A 1 419 ? 102.836 31.918  19.772  1.00 4.35  ? 419  ALA A O   1 
ATOM   3174  C CB  . ALA A 1 419 ? 103.261 35.022  20.865  1.00 4.43  ? 419  ALA A CB  1 
ATOM   3175  N N   . THR A 1 420 ? 102.522 32.181  21.996  1.00 4.17  ? 420  THR A N   1 
ATOM   3176  C CA  . THR A 1 420 ? 102.869 30.777  22.258  1.00 5.13  ? 420  THR A CA  1 
ATOM   3177  C C   . THR A 1 420 ? 101.926 29.818  21.523  1.00 4.34  ? 420  THR A C   1 
ATOM   3178  O O   . THR A 1 420 ? 102.386 28.920  20.817  1.00 2.75  ? 420  THR A O   1 
ATOM   3179  C CB  . THR A 1 420 ? 102.817 30.467  23.749  1.00 4.76  ? 420  THR A CB  1 
ATOM   3180  O OG1 . THR A 1 420 ? 103.731 31.392  24.363  1.00 3.79  ? 420  THR A OG1 1 
ATOM   3181  C CG2 . THR A 1 420 ? 103.221 29.016  24.065  1.00 2.52  ? 420  THR A CG2 1 
ATOM   3182  N N   . GLN A 1 421 ? 100.603 30.044  21.587  1.00 3.68  ? 421  GLN A N   1 
ATOM   3183  C CA  . GLN A 1 421 ? 99.672  29.096  20.939  1.00 3.57  ? 421  GLN A CA  1 
ATOM   3184  C C   . GLN A 1 421 ? 99.751  29.248  19.455  1.00 3.23  ? 421  GLN A C   1 
ATOM   3185  O O   . GLN A 1 421 ? 99.751  28.257  18.702  1.00 2.08  ? 421  GLN A O   1 
ATOM   3186  C CB  . GLN A 1 421 ? 98.250  29.270  21.535  1.00 4.37  ? 421  GLN A CB  1 
ATOM   3187  C CG  . GLN A 1 421 ? 97.496  30.489  20.965  1.00 2.43  ? 421  GLN A CG  1 
ATOM   3188  C CD  . GLN A 1 421 ? 96.423  31.059  21.856  1.00 2.08  ? 421  GLN A CD  1 
ATOM   3189  O OE1 . GLN A 1 421 ? 96.058  32.228  21.729  1.00 2.77  ? 421  GLN A OE1 1 
ATOM   3190  N NE2 . GLN A 1 421 ? 95.887  30.306  22.827  1.00 3.50  ? 421  GLN A NE2 1 
ATOM   3191  N N   . ASN A 1 422 ? 100.008 30.453  18.907  1.00 2.23  ? 422  ASN A N   1 
ATOM   3192  C CA  . ASN A 1 422 ? 100.104 30.572  17.439  1.00 2.68  ? 422  ASN A CA  1 
ATOM   3193  C C   . ASN A 1 422 ? 101.410 29.972  16.877  1.00 2.86  ? 422  ASN A C   1 
ATOM   3194  O O   . ASN A 1 422 ? 101.414 29.431  15.757  1.00 3.38  ? 422  ASN A O   1 
ATOM   3195  C CB  . ASN A 1 422 ? 99.798  31.984  16.945  1.00 3.48  ? 422  ASN A CB  1 
ATOM   3196  C CG  . ASN A 1 422 ? 98.231  32.163  16.908  1.00 3.58  ? 422  ASN A CG  1 
ATOM   3197  O OD1 . ASN A 1 422 ? 97.665  31.813  15.869  1.00 4.21  ? 422  ASN A OD1 1 
ATOM   3198  N ND2 . ASN A 1 422 ? 97.595  32.566  17.986  1.00 2.08  ? 422  ASN A ND2 1 
ATOM   3199  N N   . GLY A 1 423 ? 102.461 29.956  17.705  1.00 3.04  ? 423  GLY A N   1 
ATOM   3200  C CA  . GLY A 1 423 ? 103.718 29.331  17.255  1.00 2.08  ? 423  GLY A CA  1 
ATOM   3201  C C   . GLY A 1 423 ? 103.423 27.822  17.195  1.00 2.08  ? 423  GLY A C   1 
ATOM   3202  O O   . GLY A 1 423 ? 103.848 27.165  16.306  1.00 2.08  ? 423  GLY A O   1 
ATOM   3203  N N   . ALA A 1 424 ? 102.687 27.302  18.218  1.00 3.58  ? 424  ALA A N   1 
ATOM   3204  C CA  . ALA A 1 424 ? 102.335 25.872  18.210  1.00 3.32  ? 424  ALA A CA  1 
ATOM   3205  C C   . ALA A 1 424 ? 101.455 25.531  17.019  1.00 4.57  ? 424  ALA A C   1 
ATOM   3206  O O   . ALA A 1 424 ? 101.782 24.563  16.289  1.00 2.98  ? 424  ALA A O   1 
ATOM   3207  C CB  . ALA A 1 424 ? 101.626 25.611  19.532  1.00 2.08  ? 424  ALA A CB  1 
ATOM   3208  N N   . PHE A 1 425 ? 100.456 26.376  16.675  1.00 3.66  ? 425  PHE A N   1 
ATOM   3209  C CA  . PHE A 1 425 ? 99.571  26.001  15.582  1.00 4.06  ? 425  PHE A CA  1 
ATOM   3210  C C   . PHE A 1 425 ? 100.296 26.090  14.247  1.00 3.52  ? 425  PHE A C   1 
ATOM   3211  O O   . PHE A 1 425 ? 100.099 25.213  13.382  1.00 2.08  ? 425  PHE A O   1 
ATOM   3212  C CB  . PHE A 1 425 ? 98.178  26.691  15.487  1.00 2.08  ? 425  PHE A CB  1 
ATOM   3213  C CG  . PHE A 1 425 ? 97.520  26.788  16.848  1.00 2.08  ? 425  PHE A CG  1 
ATOM   3214  C CD1 . PHE A 1 425 ? 97.403  25.700  17.690  1.00 3.19  ? 425  PHE A CD1 1 
ATOM   3215  C CD2 . PHE A 1 425 ? 96.970  28.011  17.220  1.00 3.26  ? 425  PHE A CD2 1 
ATOM   3216  C CE1 . PHE A 1 425 ? 96.778  25.823  18.917  1.00 3.58  ? 425  PHE A CE1 1 
ATOM   3217  C CE2 . PHE A 1 425 ? 96.346  28.149  18.435  1.00 3.29  ? 425  PHE A CE2 1 
ATOM   3218  C CZ  . PHE A 1 425 ? 96.274  27.058  19.277  1.00 3.28  ? 425  PHE A CZ  1 
ATOM   3219  N N   . ALA A 1 426 ? 101.151 27.090  14.055  1.00 2.94  ? 426  ALA A N   1 
ATOM   3220  C CA  . ALA A 1 426 ? 101.893 27.179  12.793  1.00 2.08  ? 426  ALA A CA  1 
ATOM   3221  C C   . ALA A 1 426 ? 102.792 25.931  12.628  1.00 3.40  ? 426  ALA A C   1 
ATOM   3222  O O   . ALA A 1 426 ? 103.023 25.477  11.528  1.00 3.86  ? 426  ALA A O   1 
ATOM   3223  C CB  . ALA A 1 426 ? 102.784 28.414  12.843  1.00 4.42  ? 426  ALA A CB  1 
ATOM   3224  N N   . THR A 1 427 ? 103.362 25.452  13.705  1.00 3.48  ? 427  THR A N   1 
ATOM   3225  C CA  . THR A 1 427 ? 104.262 24.280  13.670  1.00 4.70  ? 427  THR A CA  1 
ATOM   3226  C C   . THR A 1 427 ? 103.487 23.015  13.295  1.00 4.67  ? 427  THR A C   1 
ATOM   3227  O O   . THR A 1 427 ? 103.873 22.295  12.366  1.00 2.98  ? 427  THR A O   1 
ATOM   3228  C CB  . THR A 1 427 ? 104.949 24.188  15.044  1.00 4.17  ? 427  THR A CB  1 
ATOM   3229  O OG1 . THR A 1 427 ? 105.675 25.411  15.266  1.00 4.05  ? 427  THR A OG1 1 
ATOM   3230  C CG2 . THR A 1 427 ? 105.906 23.006  15.169  1.00 2.32  ? 427  THR A CG2 1 
ATOM   3231  N N   . VAL A 1 428 ? 102.329 22.794  13.916  1.00 3.75  ? 428  VAL A N   1 
ATOM   3232  C CA  . VAL A 1 428 ? 101.431 21.695  13.538  1.00 3.95  ? 428  VAL A CA  1 
ATOM   3233  C C   . VAL A 1 428 ? 101.117 21.800  12.078  1.00 2.41  ? 428  VAL A C   1 
ATOM   3234  O O   . VAL A 1 428 ? 101.355 20.816  11.330  1.00 4.81  ? 428  VAL A O   1 
ATOM   3235  C CB  . VAL A 1 428 ? 100.116 21.770  14.357  1.00 3.19  ? 428  VAL A CB  1 
ATOM   3236  C CG1 . VAL A 1 428 ? 99.067  20.860  13.688  1.00 2.67  ? 428  VAL A CG1 1 
ATOM   3237  C CG2 . VAL A 1 428 ? 100.225 21.502  15.849  1.00 2.08  ? 428  VAL A CG2 1 
ATOM   3238  N N   . LEU A 1 429 ? 100.652 22.924  11.495  1.00 2.74  ? 429  LEU A N   1 
ATOM   3239  C CA  . LEU A 1 429 ? 100.352 23.002  10.083  1.00 3.48  ? 429  LEU A CA  1 
ATOM   3240  C C   . LEU A 1 429 ? 101.550 22.693  9.201   1.00 4.13  ? 429  LEU A C   1 
ATOM   3241  O O   . LEU A 1 429 ? 101.444 21.911  8.264   1.00 4.42  ? 429  LEU A O   1 
ATOM   3242  C CB  . LEU A 1 429 ? 99.712  24.347  9.685   1.00 3.43  ? 429  LEU A CB  1 
ATOM   3243  C CG  . LEU A 1 429 ? 98.372  24.647  10.392  1.00 3.54  ? 429  LEU A CG  1 
ATOM   3244  C CD1 . LEU A 1 429 ? 98.062  26.131  10.249  1.00 3.17  ? 429  LEU A CD1 1 
ATOM   3245  C CD2 . LEU A 1 429 ? 97.240  23.836  9.764   1.00 4.37  ? 429  LEU A CD2 1 
ATOM   3246  N N   . LYS A 1 430 ? 102.691 23.347  9.399   1.00 4.69  ? 430  LYS A N   1 
ATOM   3247  C CA  . LYS A 1 430 ? 103.871 23.074  8.581   1.00 6.46  ? 430  LYS A CA  1 
ATOM   3248  C C   . LYS A 1 430 ? 104.292 21.601  8.640   1.00 4.54  ? 430  LYS A C   1 
ATOM   3249  O O   . LYS A 1 430 ? 104.639 21.012  7.606   1.00 4.24  ? 430  LYS A O   1 
ATOM   3250  C CB  . LYS A 1 430 ? 105.054 23.957  9.057   1.00 5.87  ? 430  LYS A CB  1 
ATOM   3251  C CG  . LYS A 1 430 ? 104.918 25.394  8.539   1.00 7.57  ? 430  LYS A CG  1 
ATOM   3252  C CD  . LYS A 1 430 ? 106.125 26.270  8.926   1.00 4.52  ? 430  LYS A CD  1 
ATOM   3253  C CE  . LYS A 1 430 ? 106.230 26.353  10.426  1.00 4.94  ? 430  LYS A CE  1 
ATOM   3254  N NZ  . LYS A 1 430 ? 107.366 27.247  10.852  1.00 5.70  ? 430  LYS A NZ  1 
ATOM   3255  N N   . ALA A 1 431 ? 104.265 20.970  9.787   1.00 2.35  ? 431  ALA A N   1 
ATOM   3256  C CA  . ALA A 1 431 ? 104.694 19.586  9.935   1.00 5.52  ? 431  ALA A CA  1 
ATOM   3257  C C   . ALA A 1 431 ? 103.786 18.625  9.160   1.00 7.24  ? 431  ALA A C   1 
ATOM   3258  O O   . ALA A 1 431 ? 104.301 17.760  8.420   1.00 6.14  ? 431  ALA A O   1 
ATOM   3259  C CB  . ALA A 1 431 ? 104.800 19.191  11.400  1.00 3.80  ? 431  ALA A CB  1 
ATOM   3260  N N   . LEU A 1 432 ? 102.468 18.880  9.187   1.00 5.99  ? 432  LEU A N   1 
ATOM   3261  C CA  . LEU A 1 432 ? 101.568 17.990  8.443   1.00 7.41  ? 432  LEU A CA  1 
ATOM   3262  C C   . LEU A 1 432 ? 101.608 18.253  6.955   1.00 7.65  ? 432  LEU A C   1 
ATOM   3263  O O   . LEU A 1 432 ? 101.470 17.336  6.153   1.00 6.99  ? 432  LEU A O   1 
ATOM   3264  C CB  . LEU A 1 432 ? 100.121 18.125  8.966   1.00 7.72  ? 432  LEU A CB  1 
ATOM   3265  C CG  . LEU A 1 432 ? 99.962  17.256  10.231  1.00 9.32  ? 432  LEU A CG  1 
ATOM   3266  C CD1 . LEU A 1 432 ? 98.749  17.657  11.004  1.00 10.98 ? 432  LEU A CD1 1 
ATOM   3267  C CD2 . LEU A 1 432 ? 99.861  15.783  9.816   1.00 10.66 ? 432  LEU A CD2 1 
ATOM   3268  N N   . ILE A 1 433 ? 101.783 19.508  6.560   1.00 6.44  ? 433  ILE A N   1 
ATOM   3269  C CA  . ILE A 1 433 ? 101.891 19.809  5.128   1.00 4.97  ? 433  ILE A CA  1 
ATOM   3270  C C   . ILE A 1 433 ? 103.233 19.327  4.574   1.00 5.67  ? 433  ILE A C   1 
ATOM   3271  O O   . ILE A 1 433 ? 103.281 18.879  3.419   1.00 3.04  ? 433  ILE A O   1 
ATOM   3272  C CB  . ILE A 1 433 ? 101.677 21.320  4.958   1.00 6.28  ? 433  ILE A CB  1 
ATOM   3273  C CG1 . ILE A 1 433 ? 100.151 21.587  5.096   1.00 4.00  ? 433  ILE A CG1 1 
ATOM   3274  C CG2 . ILE A 1 433 ? 102.212 21.869  3.651   1.00 2.74  ? 433  ILE A CG2 1 
ATOM   3275  C CD1 . ILE A 1 433 ? 99.822  23.029  5.475   1.00 6.51  ? 433  ILE A CD1 1 
ATOM   3276  N N   . GLY A 1 434 ? 104.301 19.351  5.382   1.00 4.68  ? 434  GLY A N   1 
ATOM   3277  C CA  . GLY A 1 434 ? 105.596 18.869  4.905   1.00 6.64  ? 434  GLY A CA  1 
ATOM   3278  C C   . GLY A 1 434 ? 106.373 19.956  4.142   1.00 7.94  ? 434  GLY A C   1 
ATOM   3279  O O   . GLY A 1 434 ? 105.792 20.901  3.597   1.00 4.99  ? 434  GLY A O   1 
ATOM   3280  N N   . LEU A 1 435 ? 107.698 19.780  4.122   1.00 8.67  ? 435  LEU A N   1 
ATOM   3281  C CA  . LEU A 1 435 ? 108.617 20.709  3.475   1.00 9.86  ? 435  LEU A CA  1 
ATOM   3282  C C   . LEU A 1 435 ? 108.368 21.001  2.022   1.00 9.28  ? 435  LEU A C   1 
ATOM   3283  O O   . LEU A 1 435 ? 108.335 22.174  1.578   1.00 8.68  ? 435  LEU A O   1 
ATOM   3284  C CB  . LEU A 1 435 ? 110.059 20.140  3.657   1.00 11.13 ? 435  LEU A CB  1 
ATOM   3285  C CG  . LEU A 1 435 ? 111.190 21.097  3.236   1.00 12.05 ? 435  LEU A CG  1 
ATOM   3286  C CD1 . LEU A 1 435 ? 111.241 22.277  4.204   1.00 8.15  ? 435  LEU A CD1 1 
ATOM   3287  C CD2 . LEU A 1 435 ? 112.524 20.326  3.211   1.00 9.66  ? 435  LEU A CD2 1 
ATOM   3288  N N   . ASP A 1 436 ? 108.148 19.969  1.219   1.00 9.31  ? 436  ASP A N   1 
ATOM   3289  C CA  . ASP A 1 436 ? 107.909 20.173  -0.213  1.00 11.50 ? 436  ASP A CA  1 
ATOM   3290  C C   . ASP A 1 436 ? 106.720 21.079  -0.503  1.00 10.75 ? 436  ASP A C   1 
ATOM   3291  O O   . ASP A 1 436 ? 106.758 22.114  -1.214  1.00 10.05 ? 436  ASP A O   1 
ATOM   3292  C CB  . ASP A 1 436 ? 107.682 18.796  -0.862  1.00 14.23 ? 436  ASP A CB  1 
ATOM   3293  C CG  . ASP A 1 436 ? 107.308 18.927  -2.321  1.00 19.22 ? 436  ASP A CG  1 
ATOM   3294  O OD1 . ASP A 1 436 ? 108.082 19.530  -3.114  1.00 20.21 ? 436  ASP A OD1 1 
ATOM   3295  O OD2 . ASP A 1 436 ? 106.192 18.482  -2.722  1.00 20.74 ? 436  ASP A OD2 1 
ATOM   3296  N N   . ARG A 1 437 ? 105.561 20.683  0.048   1.00 7.53  ? 437  ARG A N   1 
ATOM   3297  C CA  . ARG A 1 437 ? 104.354 21.499  -0.193  1.00 6.98  ? 437  ARG A CA  1 
ATOM   3298  C C   . ARG A 1 437 ? 104.492 22.831  0.513   1.00 6.04  ? 437  ARG A C   1 
ATOM   3299  O O   . ARG A 1 437 ? 103.988 23.869  0.034   1.00 7.56  ? 437  ARG A O   1 
ATOM   3300  C CB  . ARG A 1 437 ? 103.090 20.737  0.242   1.00 7.36  ? 437  ARG A CB  1 
ATOM   3301  C CG  . ARG A 1 437 ? 102.732 19.673  -0.814  1.00 7.40  ? 437  ARG A CG  1 
ATOM   3302  C CD  . ARG A 1 437 ? 101.506 18.876  -0.435  1.00 4.16  ? 437  ARG A CD  1 
ATOM   3303  N NE  . ARG A 1 437 ? 101.594 18.270  0.888   1.00 4.74  ? 437  ARG A NE  1 
ATOM   3304  C CZ  . ARG A 1 437 ? 100.650 17.442  1.359   1.00 5.23  ? 437  ARG A CZ  1 
ATOM   3305  N NH1 . ARG A 1 437 ? 99.589  17.164  0.583   1.00 5.22  ? 437  ARG A NH1 1 
ATOM   3306  N NH2 . ARG A 1 437 ? 100.726 16.931  2.574   1.00 3.39  ? 437  ARG A NH2 1 
ATOM   3307  N N   . GLY A 1 438 ? 105.231 22.878  1.605   1.00 5.97  ? 438  GLY A N   1 
ATOM   3308  C CA  . GLY A 1 438 ? 105.486 24.140  2.328   1.00 6.86  ? 438  GLY A CA  1 
ATOM   3309  C C   . GLY A 1 438 ? 106.138 25.180  1.433   1.00 7.87  ? 438  GLY A C   1 
ATOM   3310  O O   . GLY A 1 438 ? 105.887 26.396  1.583   1.00 7.77  ? 438  GLY A O   1 
ATOM   3311  N N   . GLY A 1 439 ? 106.957 24.751  0.460   1.00 8.01  ? 439  GLY A N   1 
ATOM   3312  C CA  . GLY A 1 439 ? 107.636 25.666  -0.431  1.00 7.58  ? 439  GLY A CA  1 
ATOM   3313  C C   . GLY A 1 439 ? 106.857 26.062  -1.661  1.00 9.43  ? 439  GLY A C   1 
ATOM   3314  O O   . GLY A 1 439 ? 107.343 26.916  -2.433  1.00 6.82  ? 439  GLY A O   1 
ATOM   3315  N N   . ASP A 1 440 ? 105.651 25.486  -1.887  1.00 8.08  ? 440  ASP A N   1 
ATOM   3316  C CA  . ASP A 1 440 ? 104.925 25.866  -3.098  1.00 7.80  ? 440  ASP A CA  1 
ATOM   3317  C C   . ASP A 1 440 ? 104.383 27.280  -2.904  1.00 7.65  ? 440  ASP A C   1 
ATOM   3318  O O   . ASP A 1 440 ? 104.226 27.654  -1.757  1.00 8.47  ? 440  ASP A O   1 
ATOM   3319  C CB  . ASP A 1 440 ? 103.753 24.923  -3.404  1.00 10.95 ? 440  ASP A CB  1 
ATOM   3320  C CG  . ASP A 1 440 ? 104.253 23.548  -3.821  1.00 12.06 ? 440  ASP A CG  1 
ATOM   3321  O OD1 . ASP A 1 440 ? 105.355 23.378  -4.363  1.00 11.58 ? 440  ASP A OD1 1 
ATOM   3322  O OD2 . ASP A 1 440 ? 103.494 22.588  -3.609  1.00 14.32 ? 440  ASP A OD2 1 
ATOM   3323  N N   . CYS A 1 441 ? 104.100 28.001  -3.971  1.00 8.99  ? 441  CYS A N   1 
ATOM   3324  C CA  . CYS A 1 441 ? 103.590 29.349  -3.920  1.00 10.49 ? 441  CYS A CA  1 
ATOM   3325  C C   . CYS A 1 441 ? 102.084 29.428  -3.726  1.00 11.12 ? 441  CYS A C   1 
ATOM   3326  O O   . CYS A 1 441 ? 101.325 28.669  -4.336  1.00 9.39  ? 441  CYS A O   1 
ATOM   3327  C CB  . CYS A 1 441 ? 103.959 30.051  -5.266  1.00 12.06 ? 441  CYS A CB  1 
ATOM   3328  S SG  . CYS A 1 441 ? 105.760 29.983  -5.620  1.00 14.39 ? 441  CYS A SG  1 
ATOM   3329  N N   . TYR A 1 442 ? 101.614 30.357  -2.903  1.00 10.16 ? 442  TYR A N   1 
ATOM   3330  C CA  . TYR A 1 442 ? 100.197 30.585  -2.667  1.00 8.44  ? 442  TYR A CA  1 
ATOM   3331  C C   . TYR A 1 442 ? 99.546  31.063  -3.954  1.00 9.22  ? 442  TYR A C   1 
ATOM   3332  O O   . TYR A 1 442 ? 99.968  32.046  -4.544  1.00 8.80  ? 442  TYR A O   1 
ATOM   3333  C CB  . TYR A 1 442 ? 100.081 31.671  -1.587  1.00 8.67  ? 442  TYR A CB  1 
ATOM   3334  C CG  . TYR A 1 442 ? 98.718  31.664  -0.906  1.00 8.04  ? 442  TYR A CG  1 
ATOM   3335  C CD1 . TYR A 1 442 ? 97.608  32.204  -1.500  1.00 7.24  ? 442  TYR A CD1 1 
ATOM   3336  C CD2 . TYR A 1 442 ? 98.590  31.006  0.326   1.00 7.91  ? 442  TYR A CD2 1 
ATOM   3337  C CE1 . TYR A 1 442 ? 96.378  32.130  -0.845  1.00 8.21  ? 442  TYR A CE1 1 
ATOM   3338  C CE2 . TYR A 1 442 ? 97.378  30.940  0.974   1.00 6.85  ? 442  TYR A CE2 1 
ATOM   3339  C CZ  . TYR A 1 442 ? 96.281  31.504  0.374   1.00 7.18  ? 442  TYR A CZ  1 
ATOM   3340  O OH  . TYR A 1 442 ? 95.066  31.463  1.036   1.00 8.33  ? 442  TYR A OH  1 
ATOM   3341  N N   . PRO A 1 443 ? 98.477  30.403  -4.411  1.00 8.28  ? 443  PRO A N   1 
ATOM   3342  C CA  . PRO A 1 443 ? 97.824  30.733  -5.643  1.00 8.72  ? 443  PRO A CA  1 
ATOM   3343  C C   . PRO A 1 443 ? 96.961  31.964  -5.542  1.00 9.27  ? 443  PRO A C   1 
ATOM   3344  O O   . PRO A 1 443 ? 96.329  32.182  -4.498  1.00 10.33 ? 443  PRO A O   1 
ATOM   3345  C CB  . PRO A 1 443 ? 97.014  29.478  -5.981  1.00 9.68  ? 443  PRO A CB  1 
ATOM   3346  C CG  . PRO A 1 443 ? 96.696  28.887  -4.644  1.00 8.51  ? 443  PRO A CG  1 
ATOM   3347  C CD  . PRO A 1 443 ? 97.909  29.185  -3.771  1.00 7.51  ? 443  PRO A CD  1 
ATOM   3348  N N   . ASP A 1 444 ? 96.987  32.836  -6.542  1.00 7.85  ? 444  ASP A N   1 
ATOM   3349  C CA  . ASP A 1 444 ? 96.184  34.054  -6.558  1.00 7.90  ? 444  ASP A CA  1 
ATOM   3350  C C   . ASP A 1 444 ? 96.213  34.879  -5.288  1.00 7.95  ? 444  ASP A C   1 
ATOM   3351  O O   . ASP A 1 444 ? 95.178  35.263  -4.731  1.00 7.51  ? 444  ASP A O   1 
ATOM   3352  C CB  . ASP A 1 444 ? 94.726  33.654  -6.830  1.00 10.82 ? 444  ASP A CB  1 
ATOM   3353  C CG  . ASP A 1 444 ? 94.571  32.957  -8.172  1.00 15.01 ? 444  ASP A CG  1 
ATOM   3354  O OD1 . ASP A 1 444 ? 95.092  33.485  -9.182  1.00 15.87 ? 444  ASP A OD1 1 
ATOM   3355  O OD2 . ASP A 1 444 ? 93.959  31.858  -8.158  1.00 16.67 ? 444  ASP A OD2 1 
ATOM   3356  N N   . PRO A 1 445 ? 97.402  35.268  -4.836  1.00 8.04  ? 445  PRO A N   1 
ATOM   3357  C CA  . PRO A 1 445 ? 97.539  36.077  -3.640  1.00 6.97  ? 445  PRO A CA  1 
ATOM   3358  C C   . PRO A 1 445 ? 96.917  37.457  -3.836  1.00 5.70  ? 445  PRO A C   1 
ATOM   3359  O O   . PRO A 1 445 ? 96.841  37.996  -4.959  1.00 4.59  ? 445  PRO A O   1 
ATOM   3360  C CB  . PRO A 1 445 ? 99.049  36.069  -3.409  1.00 7.40  ? 445  PRO A CB  1 
ATOM   3361  C CG  . PRO A 1 445 ? 99.639  35.960  -4.778  1.00 8.31  ? 445  PRO A CG  1 
ATOM   3362  C CD  . PRO A 1 445 ? 98.698  35.032  -5.527  1.00 8.10  ? 445  PRO A CD  1 
ATOM   3363  N N   . VAL A 1 446 ? 96.380  37.999  -2.754  1.00 5.72  ? 446  VAL A N   1 
ATOM   3364  C CA  . VAL A 1 446 ? 95.707  39.292  -2.751  1.00 6.77  ? 446  VAL A CA  1 
ATOM   3365  C C   . VAL A 1 446 ? 96.113  40.125  -1.532  1.00 7.86  ? 446  VAL A C   1 
ATOM   3366  O O   . VAL A 1 446 ? 96.754  39.626  -0.604  1.00 9.02  ? 446  VAL A O   1 
ATOM   3367  C CB  . VAL A 1 446 ? 94.168  39.164  -2.660  1.00 6.45  ? 446  VAL A CB  1 
ATOM   3368  C CG1 . VAL A 1 446 ? 93.527  38.553  -3.900  1.00 9.06  ? 446  VAL A CG1 1 
ATOM   3369  C CG2 . VAL A 1 446 ? 93.750  38.356  -1.438  1.00 7.01  ? 446  VAL A CG2 1 
ATOM   3370  N N   . TYR A 1 447 ? 95.699  41.380  -1.527  1.00 7.18  ? 447  TYR A N   1 
ATOM   3371  C CA  . TYR A 1 447 ? 95.799  42.281  -0.393  1.00 7.87  ? 447  TYR A CA  1 
ATOM   3372  C C   . TYR A 1 447 ? 94.580  43.201  -0.460  1.00 7.17  ? 447  TYR A C   1 
ATOM   3373  O O   . TYR A 1 447 ? 94.125  43.599  -1.538  1.00 6.60  ? 447  TYR A O   1 
ATOM   3374  C CB  . TYR A 1 447 ? 97.083  43.093  -0.338  1.00 10.04 ? 447  TYR A CB  1 
ATOM   3375  C CG  . TYR A 1 447 ? 97.306  44.117  -1.416  1.00 15.95 ? 447  TYR A CG  1 
ATOM   3376  C CD1 . TYR A 1 447 ? 96.798  45.402  -1.302  1.00 16.99 ? 447  TYR A CD1 1 
ATOM   3377  C CD2 . TYR A 1 447 ? 98.035  43.839  -2.560  1.00 18.42 ? 447  TYR A CD2 1 
ATOM   3378  C CE1 . TYR A 1 447 ? 97.008  46.364  -2.270  1.00 18.75 ? 447  TYR A CE1 1 
ATOM   3379  C CE2 . TYR A 1 447 ? 98.246  44.801  -3.530  1.00 20.03 ? 447  TYR A CE2 1 
ATOM   3380  C CZ  . TYR A 1 447 ? 97.736  46.074  -3.392  1.00 19.73 ? 447  TYR A CZ  1 
ATOM   3381  O OH  . TYR A 1 447 ? 97.941  47.027  -4.373  1.00 19.94 ? 447  TYR A OH  1 
ATOM   3382  N N   . PRO A 1 448 ? 93.945  43.459  0.668   1.00 7.61  ? 448  PRO A N   1 
ATOM   3383  C CA  . PRO A 1 448 ? 92.809  44.361  0.725   1.00 8.28  ? 448  PRO A CA  1 
ATOM   3384  C C   . PRO A 1 448 ? 93.174  45.796  0.322   1.00 8.85  ? 448  PRO A C   1 
ATOM   3385  O O   . PRO A 1 448 ? 94.282  46.244  0.624   1.00 9.90  ? 448  PRO A O   1 
ATOM   3386  C CB  . PRO A 1 448 ? 92.428  44.416  2.210   1.00 6.86  ? 448  PRO A CB  1 
ATOM   3387  C CG  . PRO A 1 448 ? 93.038  43.194  2.787   1.00 7.20  ? 448  PRO A CG  1 
ATOM   3388  C CD  . PRO A 1 448 ? 94.313  42.965  2.012   1.00 7.22  ? 448  PRO A CD  1 
ATOM   3389  N N   . ASP A 1 449 ? 92.209  46.503  -0.248  1.00 7.83  ? 449  ASP A N   1 
ATOM   3390  C CA  . ASP A 1 449 ? 92.473  47.906  -0.601  1.00 7.68  ? 449  ASP A CA  1 
ATOM   3391  C C   . ASP A 1 449 ? 92.499  48.695  0.695   1.00 6.94  ? 449  ASP A C   1 
ATOM   3392  O O   . ASP A 1 449 ? 92.183  48.182  1.792   1.00 4.02  ? 449  ASP A O   1 
ATOM   3393  C CB  . ASP A 1 449 ? 91.525  48.404  -1.681  1.00 8.99  ? 449  ASP A CB  1 
ATOM   3394  C CG  . ASP A 1 449 ? 90.095  48.522  -1.198  1.00 11.30 ? 449  ASP A CG  1 
ATOM   3395  O OD1 . ASP A 1 449 ? 89.818  48.383  0.010   1.00 11.58 ? 449  ASP A OD1 1 
ATOM   3396  O OD2 . ASP A 1 449 ? 89.231  48.807  -2.055  1.00 14.62 ? 449  ASP A OD2 1 
ATOM   3397  N N   . ASP A 1 450 ? 92.883  49.971  0.627   1.00 6.02  ? 450  ASP A N   1 
ATOM   3398  C CA  . ASP A 1 450 ? 93.070  50.759  1.843   1.00 7.19  ? 450  ASP A CA  1 
ATOM   3399  C C   . ASP A 1 450 ? 91.801  50.924  2.652   1.00 5.81  ? 450  ASP A C   1 
ATOM   3400  O O   . ASP A 1 450 ? 91.846  51.207  3.860   1.00 6.72  ? 450  ASP A O   1 
ATOM   3401  C CB  . ASP A 1 450 ? 93.690  52.122  1.505   1.00 8.27  ? 450  ASP A CB  1 
ATOM   3402  C CG  . ASP A 1 450 ? 95.045  52.046  0.841   1.00 10.94 ? 450  ASP A CG  1 
ATOM   3403  O OD1 . ASP A 1 450 ? 95.756  51.014  0.789   1.00 12.67 ? 450  ASP A OD1 1 
ATOM   3404  O OD2 . ASP A 1 450 ? 95.512  53.077  0.344   1.00 12.46 ? 450  ASP A OD2 1 
ATOM   3405  N N   . ASP A 1 451 ? 90.627  50.842  2.041   1.00 5.10  ? 451  ASP A N   1 
ATOM   3406  C CA  . ASP A 1 451 ? 89.383  50.919  2.817   1.00 7.78  ? 451  ASP A CA  1 
ATOM   3407  C C   . ASP A 1 451 ? 88.977  49.531  3.311   1.00 8.28  ? 451  ASP A C   1 
ATOM   3408  O O   . ASP A 1 451 ? 87.989  49.389  4.044   1.00 7.96  ? 451  ASP A O   1 
ATOM   3409  C CB  . ASP A 1 451 ? 88.278  51.494  1.912   1.00 11.44 ? 451  ASP A CB  1 
ATOM   3410  C CG  . ASP A 1 451 ? 88.649  52.934  1.546   1.00 14.00 ? 451  ASP A CG  1 
ATOM   3411  O OD1 . ASP A 1 451 ? 89.218  53.665  2.400   1.00 15.41 ? 451  ASP A OD1 1 
ATOM   3412  O OD2 . ASP A 1 451 ? 88.385  53.303  0.405   1.00 16.41 ? 451  ASP A OD2 1 
ATOM   3413  N N   . GLY A 1 452 ? 89.660  48.472  2.847   1.00 8.56  ? 452  GLY A N   1 
ATOM   3414  C CA  . GLY A 1 452 ? 89.310  47.116  3.267   1.00 8.85  ? 452  GLY A CA  1 
ATOM   3415  C C   . GLY A 1 452 ? 87.955  46.669  2.708   1.00 8.80  ? 452  GLY A C   1 
ATOM   3416  O O   . GLY A 1 452 ? 87.268  45.881  3.361   1.00 8.48  ? 452  GLY A O   1 
ATOM   3417  N N   . LEU A 1 453 ? 87.585  47.141  1.532   1.00 9.45  ? 453  LEU A N   1 
ATOM   3418  C CA  . LEU A 1 453 ? 86.313  46.824  0.897   1.00 11.76 ? 453  LEU A CA  1 
ATOM   3419  C C   . LEU A 1 453 ? 86.478  45.865  -0.273  1.00 12.31 ? 453  LEU A C   1 
ATOM   3420  O O   . LEU A 1 453 ? 85.517  45.208  -0.625  1.00 13.04 ? 453  LEU A O   1 
ATOM   3421  C CB  . LEU A 1 453 ? 85.596  48.096  0.377   1.00 11.64 ? 453  LEU A CB  1 
ATOM   3422  C CG  . LEU A 1 453 ? 85.268  49.086  1.515   1.00 11.32 ? 453  LEU A CG  1 
ATOM   3423  C CD1 . LEU A 1 453 ? 84.604  50.348  1.018   1.00 12.14 ? 453  LEU A CD1 1 
ATOM   3424  C CD2 . LEU A 1 453 ? 84.329  48.411  2.520   1.00 11.20 ? 453  LEU A CD2 1 
ATOM   3425  N N   . LYS A 1 454 ? 87.644  45.818  -0.896  1.00 13.03 ? 454  LYS A N   1 
ATOM   3426  C CA  . LYS A 1 454 ? 87.916  45.020  -2.067  1.00 14.14 ? 454  LYS A CA  1 
ATOM   3427  C C   . LYS A 1 454 ? 89.291  44.344  -1.977  1.00 13.36 ? 454  LYS A C   1 
ATOM   3428  O O   . LYS A 1 454 ? 90.170  44.869  -1.278  1.00 12.07 ? 454  LYS A O   1 
ATOM   3429  C CB  . LYS A 1 454 ? 87.895  45.901  -3.308  1.00 16.83 ? 454  LYS A CB  1 
ATOM   3430  C CG  . LYS A 1 454 ? 86.618  46.568  -3.747  1.00 21.49 ? 454  LYS A CG  1 
ATOM   3431  C CD  . LYS A 1 454 ? 85.468  45.592  -3.932  1.00 24.52 ? 454  LYS A CD  1 
ATOM   3432  C CE  . LYS A 1 454 ? 84.347  46.194  -4.770  1.00 26.32 ? 454  LYS A CE  1 
ATOM   3433  N NZ  . LYS A 1 454 ? 83.474  45.150  -5.384  1.00 28.15 ? 454  LYS A NZ  1 
ATOM   3434  N N   . LEU A 1 455 ? 89.434  43.185  -2.615  1.00 11.55 ? 455  LEU A N   1 
ATOM   3435  C CA  . LEU A 1 455 ? 90.722  42.488  -2.614  1.00 11.70 ? 455  LEU A CA  1 
ATOM   3436  C C   . LEU A 1 455 ? 91.500  42.883  -3.862  1.00 11.72 ? 455  LEU A C   1 
ATOM   3437  O O   . LEU A 1 455 ? 90.891  42.944  -4.934  1.00 11.39 ? 455  LEU A O   1 
ATOM   3438  C CB  . LEU A 1 455 ? 90.526  40.966  -2.602  1.00 9.76  ? 455  LEU A CB  1 
ATOM   3439  C CG  . LEU A 1 455 ? 89.959  40.397  -1.292  1.00 11.04 ? 455  LEU A CG  1 
ATOM   3440  C CD1 . LEU A 1 455 ? 89.846  38.872  -1.347  1.00 8.29  ? 455  LEU A CD1 1 
ATOM   3441  C CD2 . LEU A 1 455 ? 90.778  40.841  -0.089  1.00 8.17  ? 455  LEU A CD2 1 
ATOM   3442  N N   . ILE A 1 456 ? 92.778  43.207  -3.775  1.00 11.92 ? 456  ILE A N   1 
ATOM   3443  C CA  . ILE A 1 456 ? 93.539  43.563  -4.989  1.00 10.11 ? 456  ILE A CA  1 
ATOM   3444  C C   . ILE A 1 456 ? 94.491  42.432  -5.322  1.00 9.52  ? 456  ILE A C   1 
ATOM   3445  O O   . ILE A 1 456 ? 95.129  41.948  -4.395  1.00 9.76  ? 456  ILE A O   1 
ATOM   3446  C CB  . ILE A 1 456 ? 94.367  44.850  -4.762  1.00 11.24 ? 456  ILE A CB  1 
ATOM   3447  C CG1 . ILE A 1 456 ? 93.483  46.005  -4.235  1.00 11.82 ? 456  ILE A CG1 1 
ATOM   3448  C CG2 . ILE A 1 456 ? 95.117  45.246  -6.018  1.00 10.54 ? 456  ILE A CG2 1 
ATOM   3449  C CD1 . ILE A 1 456 ? 92.329  46.372  -5.174  1.00 11.58 ? 456  ILE A CD1 1 
ATOM   3450  N N   . ASP A 1 457 ? 94.610  41.978  -6.561  1.00 9.84  ? 457  ASP A N   1 
ATOM   3451  C CA  . ASP A 1 457 ? 95.544  40.941  -6.947  1.00 12.20 ? 457  ASP A CA  1 
ATOM   3452  C C   . ASP A 1 457 ? 97.009  41.263  -6.679  1.00 14.22 ? 457  ASP A C   1 
ATOM   3453  O O   . ASP A 1 457 ? 97.474  42.271  -7.234  1.00 15.17 ? 457  ASP A O   1 
ATOM   3454  C CB  . ASP A 1 457 ? 95.410  40.719  -8.470  1.00 13.27 ? 457  ASP A CB  1 
ATOM   3455  C CG  . ASP A 1 457 ? 94.128  39.982  -8.821  1.00 16.65 ? 457  ASP A CG  1 
ATOM   3456  O OD1 . ASP A 1 457 ? 93.347  39.586  -7.930  1.00 17.39 ? 457  ASP A OD1 1 
ATOM   3457  O OD2 . ASP A 1 457 ? 93.874  39.778  -10.026 1.00 19.25 ? 457  ASP A OD2 1 
ATOM   3458  N N   . PHE A 1 458 ? 97.734  40.476  -5.901  1.00 13.54 ? 458  PHE A N   1 
ATOM   3459  C CA  . PHE A 1 458 ? 99.129  40.768  -5.624  1.00 14.84 ? 458  PHE A CA  1 
ATOM   3460  C C   . PHE A 1 458 ? 100.000 40.159  -6.722  1.00 17.78 ? 458  PHE A C   1 
ATOM   3461  O O   . PHE A 1 458 ? 99.878  38.982  -7.058  1.00 16.10 ? 458  PHE A O   1 
ATOM   3462  C CB  . PHE A 1 458 ? 99.579  40.260  -4.255  1.00 13.55 ? 458  PHE A CB  1 
ATOM   3463  C CG  . PHE A 1 458 ? 101.069 40.309  -4.016  1.00 11.92 ? 458  PHE A CG  1 
ATOM   3464  C CD1 . PHE A 1 458 ? 101.691 41.516  -3.736  1.00 11.94 ? 458  PHE A CD1 1 
ATOM   3465  C CD2 . PHE A 1 458 ? 101.843 39.176  -4.087  1.00 10.92 ? 458  PHE A CD2 1 
ATOM   3466  C CE1 . PHE A 1 458 ? 103.055 41.585  -3.503  1.00 11.36 ? 458  PHE A CE1 1 
ATOM   3467  C CE2 . PHE A 1 458 ? 103.208 39.242  -3.867  1.00 13.01 ? 458  PHE A CE2 1 
ATOM   3468  C CZ  . PHE A 1 458 ? 103.834 40.442  -3.566  1.00 11.88 ? 458  PHE A CZ  1 
ATOM   3469  N N   . ARG A 1 459 ? 100.853 40.995  -7.291  1.00 21.16 ? 459  ARG A N   1 
ATOM   3470  C CA  . ARG A 1 459 ? 101.750 40.586  -8.366  1.00 26.67 ? 459  ARG A CA  1 
ATOM   3471  C C   . ARG A 1 459 ? 103.206 40.746  -7.959  1.00 26.33 ? 459  ARG A C   1 
ATOM   3472  O O   . ARG A 1 459 ? 103.784 41.810  -8.205  1.00 28.88 ? 459  ARG A O   1 
ATOM   3473  C CB  . ARG A 1 459 ? 101.463 41.442  -9.607  1.00 31.31 ? 459  ARG A CB  1 
ATOM   3474  C CG  . ARG A 1 459 ? 100.181 41.031  -10.314 1.00 37.65 ? 459  ARG A CG  1 
ATOM   3475  C CD  . ARG A 1 459 ? 99.797  42.064  -11.366 1.00 42.99 ? 459  ARG A CD  1 
ATOM   3476  N NE  . ARG A 1 459 ? 98.354  42.001  -11.578 1.00 48.46 ? 459  ARG A NE  1 
ATOM   3477  C CZ  . ARG A 1 459 ? 97.666  42.519  -12.588 1.00 51.56 ? 459  ARG A CZ  1 
ATOM   3478  N NH1 . ARG A 1 459 ? 98.270  43.183  -13.574 1.00 52.77 ? 459  ARG A NH1 1 
ATOM   3479  N NH2 . ARG A 1 459 ? 96.342  42.335  -12.572 1.00 52.77 ? 459  ARG A NH2 1 
ATOM   3480  N N   . GLY A 1 460 ? 103.816 39.784  -7.290  1.00 24.56 ? 460  GLY A N   1 
ATOM   3481  C CA  . GLY A 1 460 ? 105.211 39.989  -6.853  1.00 22.23 ? 460  GLY A CA  1 
ATOM   3482  C C   . GLY A 1 460 ? 105.847 38.627  -6.609  1.00 19.51 ? 460  GLY A C   1 
ATOM   3483  O O   . GLY A 1 460 ? 105.480 37.688  -7.307  1.00 20.20 ? 460  GLY A O   1 
ATOM   3484  N N   . SER A 1 461 ? 106.736 38.536  -5.643  1.00 17.40 ? 461  SER A N   1 
ATOM   3485  C CA  . SER A 1 461 ? 107.405 37.299  -5.316  1.00 16.77 ? 461  SER A CA  1 
ATOM   3486  C C   . SER A 1 461 ? 106.433 36.183  -4.856  1.00 16.15 ? 461  SER A C   1 
ATOM   3487  O O   . SER A 1 461 ? 105.359 36.439  -4.308  1.00 12.98 ? 461  SER A O   1 
ATOM   3488  C CB  . SER A 1 461 ? 108.347 37.507  -4.121  1.00 18.34 ? 461  SER A CB  1 
ATOM   3489  O OG  . SER A 1 461 ? 109.281 38.554  -4.340  1.00 22.27 ? 461  SER A OG  1 
ATOM   3490  N N   . CYS A 1 462 ? 106.917 34.958  -5.022  1.00 12.66 ? 462  CYS A N   1 
ATOM   3491  C CA  . CYS A 1 462 ? 106.210 33.783  -4.592  1.00 12.81 ? 462  CYS A CA  1 
ATOM   3492  C C   . CYS A 1 462 ? 105.882 33.930  -3.114  1.00 11.91 ? 462  CYS A C   1 
ATOM   3493  O O   . CYS A 1 462 ? 106.864 34.118  -2.381  1.00 12.68 ? 462  CYS A O   1 
ATOM   3494  C CB  . CYS A 1 462 ? 107.142 32.570  -4.729  1.00 12.52 ? 462  CYS A CB  1 
ATOM   3495  S SG  . CYS A 1 462 ? 106.568 31.005  -4.061  1.00 11.17 ? 462  CYS A SG  1 
ATOM   3496  N N   . LEU A 1 463 ? 104.637 33.781  -2.702  1.00 8.94  ? 463  LEU A N   1 
ATOM   3497  C CA  . LEU A 1 463 ? 104.419 33.749  -1.238  1.00 9.13  ? 463  LEU A CA  1 
ATOM   3498  C C   . LEU A 1 463 ? 104.302 32.272  -0.866  1.00 10.27 ? 463  LEU A C   1 
ATOM   3499  O O   . LEU A 1 463 ? 103.280 31.656  -1.227  1.00 11.83 ? 463  LEU A O   1 
ATOM   3500  C CB  . LEU A 1 463 ? 103.164 34.515  -0.833  1.00 8.33  ? 463  LEU A CB  1 
ATOM   3501  C CG  . LEU A 1 463 ? 103.060 35.948  -1.389  1.00 7.82  ? 463  LEU A CG  1 
ATOM   3502  C CD1 . LEU A 1 463 ? 101.770 36.588  -0.912  1.00 5.63  ? 463  LEU A CD1 1 
ATOM   3503  C CD2 . LEU A 1 463 ? 104.265 36.789  -0.955  1.00 8.11  ? 463  LEU A CD2 1 
ATOM   3504  N N   . THR A 1 464 ? 105.278 31.671  -0.206  1.00 8.27  ? 464  THR A N   1 
ATOM   3505  C CA  . THR A 1 464 ? 105.194 30.252  0.072   1.00 8.20  ? 464  THR A CA  1 
ATOM   3506  C C   . THR A 1 464 ? 104.137 29.942  1.134   1.00 8.47  ? 464  THR A C   1 
ATOM   3507  O O   . THR A 1 464 ? 103.935 30.681  2.089   1.00 7.53  ? 464  THR A O   1 
ATOM   3508  C CB  . THR A 1 464 ? 106.543 29.654  0.509   1.00 5.50  ? 464  THR A CB  1 
ATOM   3509  O OG1 . THR A 1 464 ? 106.881 30.160  1.810   1.00 6.32  ? 464  THR A OG1 1 
ATOM   3510  C CG2 . THR A 1 464 ? 107.640 29.986  -0.498  1.00 6.24  ? 464  THR A CG2 1 
ATOM   3511  N N   . PHE A 1 465 ? 103.553 28.732  1.009   1.00 7.02  ? 465  PHE A N   1 
ATOM   3512  C CA  . PHE A 1 465 ? 102.596 28.290  2.010   1.00 6.44  ? 465  PHE A CA  1 
ATOM   3513  C C   . PHE A 1 465 ? 103.173 28.385  3.415   1.00 5.90  ? 465  PHE A C   1 
ATOM   3514  O O   . PHE A 1 465 ? 102.489 28.897  4.312   1.00 3.40  ? 465  PHE A O   1 
ATOM   3515  C CB  . PHE A 1 465 ? 102.065 26.858  1.779   1.00 5.07  ? 465  PHE A CB  1 
ATOM   3516  C CG  . PHE A 1 465 ? 101.061 26.787  0.670   1.00 6.99  ? 465  PHE A CG  1 
ATOM   3517  C CD1 . PHE A 1 465 ? 99.870  27.501  0.753   1.00 6.99  ? 465  PHE A CD1 1 
ATOM   3518  C CD2 . PHE A 1 465 ? 101.270 25.995  -0.445  1.00 8.50  ? 465  PHE A CD2 1 
ATOM   3519  C CE1 . PHE A 1 465 ? 98.899  27.393  -0.228  1.00 7.64  ? 465  PHE A CE1 1 
ATOM   3520  C CE2 . PHE A 1 465 ? 100.315 25.861  -1.441  1.00 8.34  ? 465  PHE A CE2 1 
ATOM   3521  C CZ  . PHE A 1 465 ? 99.145  26.602  -1.331  1.00 8.80  ? 465  PHE A CZ  1 
ATOM   3522  N N   . GLU A 1 466 ? 104.412 27.911  3.612   1.00 6.52  ? 466  GLU A N   1 
ATOM   3523  C CA  . GLU A 1 466 ? 105.011 27.957  4.939   1.00 6.29  ? 466  GLU A CA  1 
ATOM   3524  C C   . GLU A 1 466 ? 105.237 29.398  5.416   1.00 5.91  ? 466  GLU A C   1 
ATOM   3525  O O   . GLU A 1 466 ? 105.115 29.699  6.614   1.00 6.56  ? 466  GLU A O   1 
ATOM   3526  C CB  . GLU A 1 466 ? 106.339 27.169  4.989   1.00 7.77  ? 466  GLU A CB  1 
ATOM   3527  C CG  . GLU A 1 466 ? 107.484 27.813  4.237   1.00 10.89 ? 466  GLU A CG  1 
ATOM   3528  C CD  . GLU A 1 466 ? 108.645 26.845  3.997   1.00 13.53 ? 466  GLU A CD  1 
ATOM   3529  O OE1 . GLU A 1 466 ? 108.510 25.601  4.104   1.00 13.55 ? 466  GLU A OE1 1 
ATOM   3530  O OE2 . GLU A 1 466 ? 109.744 27.360  3.724   1.00 13.32 ? 466  GLU A OE2 1 
ATOM   3531  N N   . GLY A 1 467 ? 105.553 30.300  4.496   1.00 4.99  ? 467  GLY A N   1 
ATOM   3532  C CA  . GLY A 1 467 ? 105.748 31.701  4.830   1.00 5.91  ? 467  GLY A CA  1 
ATOM   3533  C C   . GLY A 1 467 ? 104.406 32.348  5.185   1.00 4.17  ? 467  GLY A C   1 
ATOM   3534  O O   . GLY A 1 467 ? 104.324 33.160  6.112   1.00 6.15  ? 467  GLY A O   1 
ATOM   3535  N N   . GLU A 1 468 ? 103.350 31.954  4.463   1.00 4.31  ? 468  GLU A N   1 
ATOM   3536  C CA  . GLU A 1 468 ? 102.034 32.565  4.800   1.00 4.11  ? 468  GLU A CA  1 
ATOM   3537  C C   . GLU A 1 468 ? 101.509 32.055  6.094   1.00 3.41  ? 468  GLU A C   1 
ATOM   3538  O O   . GLU A 1 468 ? 100.807 32.767  6.872   1.00 5.15  ? 468  GLU A O   1 
ATOM   3539  C CB  . GLU A 1 468 ? 101.094 32.473  3.605   1.00 4.55  ? 468  GLU A CB  1 
ATOM   3540  C CG  . GLU A 1 468 ? 101.570 33.285  2.395   1.00 4.62  ? 468  GLU A CG  1 
ATOM   3541  C CD  . GLU A 1 468 ? 101.657 34.772  2.758   1.00 6.81  ? 468  GLU A CD  1 
ATOM   3542  O OE1 . GLU A 1 468 ? 100.630 35.373  3.169   1.00 3.29  ? 468  GLU A OE1 1 
ATOM   3543  O OE2 . GLU A 1 468 ? 102.763 35.366  2.665   1.00 7.57  ? 468  GLU A OE2 1 
ATOM   3544  N N   . ILE A 1 469 ? 101.872 30.843  6.509   1.00 3.71  ? 469  ILE A N   1 
ATOM   3545  C CA  . ILE A 1 469 ? 101.492 30.246  7.800   1.00 3.59  ? 469  ILE A CA  1 
ATOM   3546  C C   . ILE A 1 469 ? 102.299 30.988  8.864   1.00 3.37  ? 469  ILE A C   1 
ATOM   3547  O O   . ILE A 1 469 ? 101.781 31.380  9.921   1.00 2.08  ? 469  ILE A O   1 
ATOM   3548  C CB  . ILE A 1 469 ? 101.819 28.746  7.811   1.00 2.61  ? 469  ILE A CB  1 
ATOM   3549  C CG1 . ILE A 1 469 ? 100.885 27.878  6.981   1.00 4.79  ? 469  ILE A CG1 1 
ATOM   3550  C CG2 . ILE A 1 469 ? 101.969 28.179  9.216   1.00 3.69  ? 469  ILE A CG2 1 
ATOM   3551  C CD1 . ILE A 1 469 ? 101.302 26.483  6.540   1.00 3.93  ? 469  ILE A CD1 1 
ATOM   3552  N N   . ASN A 1 470 ? 103.622 31.113  8.611   1.00 2.24  ? 470  ASN A N   1 
ATOM   3553  C CA  . ASN A 1 470 ? 104.391 31.899  9.608   1.00 2.49  ? 470  ASN A CA  1 
ATOM   3554  C C   . ASN A 1 470 ? 103.842 33.327  9.688   1.00 2.18  ? 470  ASN A C   1 
ATOM   3555  O O   . ASN A 1 470 ? 103.724 33.841  10.805  1.00 3.85  ? 470  ASN A O   1 
ATOM   3556  C CB  . ASN A 1 470 ? 105.870 31.978  9.188   1.00 2.08  ? 470  ASN A CB  1 
ATOM   3557  C CG  . ASN A 1 470 ? 106.593 30.649  9.249   1.00 2.91  ? 470  ASN A CG  1 
ATOM   3558  O OD1 . ASN A 1 470 ? 106.176 29.679  9.907   1.00 2.62  ? 470  ASN A OD1 1 
ATOM   3559  N ND2 . ASN A 1 470 ? 107.706 30.588  8.516   1.00 3.43  ? 470  ASN A ND2 1 
ATOM   3560  N N   . LYS A 1 471 ? 103.540 33.980  8.570   1.00 2.47  ? 471  LYS A N   1 
ATOM   3561  C CA  . LYS A 1 471 ? 103.004 35.333  8.621   1.00 4.09  ? 471  LYS A CA  1 
ATOM   3562  C C   . LYS A 1 471 ? 101.749 35.427  9.473   1.00 4.80  ? 471  LYS A C   1 
ATOM   3563  O O   . LYS A 1 471 ? 101.516 36.346  10.278  1.00 4.13  ? 471  LYS A O   1 
ATOM   3564  C CB  . LYS A 1 471 ? 102.776 35.814  7.169   1.00 3.73  ? 471  LYS A CB  1 
ATOM   3565  C CG  . LYS A 1 471 ? 102.499 37.315  7.065   1.00 3.71  ? 471  LYS A CG  1 
ATOM   3566  C CD  . LYS A 1 471 ? 102.266 37.785  5.652   1.00 3.40  ? 471  LYS A CD  1 
ATOM   3567  C CE  . LYS A 1 471 ? 103.568 37.862  4.846   1.00 2.84  ? 471  LYS A CE  1 
ATOM   3568  N NZ  . LYS A 1 471 ? 103.267 38.002  3.397   1.00 3.11  ? 471  LYS A NZ  1 
ATOM   3569  N N   . LEU A 1 472 ? 100.883 34.406  9.358   1.00 4.87  ? 472  LEU A N   1 
ATOM   3570  C CA  . LEU A 1 472 ? 99.648  34.358  10.127  1.00 5.03  ? 472  LEU A CA  1 
ATOM   3571  C C   . LEU A 1 472 ? 99.987  34.362  11.588  1.00 4.05  ? 472  LEU A C   1 
ATOM   3572  O O   . LEU A 1 472 ? 99.432  35.178  12.359  1.00 2.21  ? 472  LEU A O   1 
ATOM   3573  C CB  . LEU A 1 472 ? 98.715  33.177  9.781   1.00 5.54  ? 472  LEU A CB  1 
ATOM   3574  C CG  . LEU A 1 472 ? 97.576  32.923  10.789  1.00 8.26  ? 472  LEU A CG  1 
ATOM   3575  C CD1 . LEU A 1 472 ? 96.711  34.163  10.869  1.00 9.49  ? 472  LEU A CD1 1 
ATOM   3576  C CD2 . LEU A 1 472 ? 96.646  31.796  10.301  1.00 8.79  ? 472  LEU A CD2 1 
ATOM   3577  N N   . ALA A 1 473 ? 100.907 33.479  11.988  1.00 3.47  ? 473  ALA A N   1 
ATOM   3578  C CA  . ALA A 1 473 ? 101.250 33.481  13.408  1.00 2.08  ? 473  ALA A CA  1 
ATOM   3579  C C   . ALA A 1 473 ? 101.846 34.791  13.913  1.00 3.28  ? 473  ALA A C   1 
ATOM   3580  O O   . ALA A 1 473 ? 101.570 35.156  15.064  1.00 3.13  ? 473  ALA A O   1 
ATOM   3581  C CB  . ALA A 1 473 ? 102.218 32.372  13.772  1.00 2.08  ? 473  ALA A CB  1 
ATOM   3582  N N   . VAL A 1 474 ? 102.706 35.429  13.137  1.00 2.87  ? 474  VAL A N   1 
ATOM   3583  C CA  . VAL A 1 474 ? 103.337 36.680  13.585  1.00 3.48  ? 474  VAL A CA  1 
ATOM   3584  C C   . VAL A 1 474 ? 102.259 37.779  13.536  1.00 2.66  ? 474  VAL A C   1 
ATOM   3585  O O   . VAL A 1 474 ? 102.284 38.625  14.420  1.00 4.03  ? 474  VAL A O   1 
ATOM   3586  C CB  . VAL A 1 474 ? 104.579 37.004  12.745  1.00 3.67  ? 474  VAL A CB  1 
ATOM   3587  C CG1 . VAL A 1 474 ? 105.185 38.370  13.102  1.00 3.82  ? 474  VAL A CG1 1 
ATOM   3588  C CG2 . VAL A 1 474 ? 105.653 35.915  12.882  1.00 3.92  ? 474  VAL A CG2 1 
ATOM   3589  N N   . ASN A 1 475 ? 101.307 37.736  12.628  1.00 2.43  ? 475  ASN A N   1 
ATOM   3590  C CA  . ASN A 1 475 ? 100.208 38.701  12.591  1.00 3.15  ? 475  ASN A CA  1 
ATOM   3591  C C   . ASN A 1 475 ? 99.439  38.653  13.913  1.00 3.79  ? 475  ASN A C   1 
ATOM   3592  O O   . ASN A 1 475 ? 99.180  39.676  14.567  1.00 2.92  ? 475  ASN A O   1 
ATOM   3593  C CB  . ASN A 1 475 ? 99.248  38.434  11.437  1.00 4.26  ? 475  ASN A CB  1 
ATOM   3594  C CG  . ASN A 1 475 ? 99.739  38.843  10.082  1.00 4.54  ? 475  ASN A CG  1 
ATOM   3595  O OD1 . ASN A 1 475 ? 99.152  38.385  9.076   1.00 5.29  ? 475  ASN A OD1 1 
ATOM   3596  N ND2 . ASN A 1 475 ? 100.791 39.682  9.992   1.00 3.59  ? 475  ASN A ND2 1 
ATOM   3597  N N   . VAL A 1 476 ? 99.034  37.466  14.359  1.00 2.42  ? 476  VAL A N   1 
ATOM   3598  C CA  . VAL A 1 476 ? 98.290  37.338  15.608  1.00 3.61  ? 476  VAL A CA  1 
ATOM   3599  C C   . VAL A 1 476 ? 99.125  37.844  16.793  1.00 4.11  ? 476  VAL A C   1 
ATOM   3600  O O   . VAL A 1 476 ? 98.586  38.546  17.675  1.00 2.61  ? 476  VAL A O   1 
ATOM   3601  C CB  . VAL A 1 476 ? 97.829  35.910  15.941  1.00 3.00  ? 476  VAL A CB  1 
ATOM   3602  C CG1 . VAL A 1 476 ? 97.059  35.900  17.277  1.00 3.96  ? 476  VAL A CG1 1 
ATOM   3603  C CG2 . VAL A 1 476 ? 96.916  35.324  14.859  1.00 3.36  ? 476  VAL A CG2 1 
ATOM   3604  N N   . ALA A 1 477 ? 100.393 37.404  16.866  1.00 3.54  ? 477  ALA A N   1 
ATOM   3605  C CA  . ALA A 1 477 ? 101.230 37.863  17.956  1.00 2.35  ? 477  ALA A CA  1 
ATOM   3606  C C   . ALA A 1 477 ? 101.322 39.396  17.967  1.00 3.14  ? 477  ALA A C   1 
ATOM   3607  O O   . ALA A 1 477 ? 101.110 40.006  18.997  1.00 3.44  ? 477  ALA A O   1 
ATOM   3608  C CB  . ALA A 1 477 ? 102.651 37.259  17.897  1.00 2.08  ? 477  ALA A CB  1 
ATOM   3609  N N   . PHE A 1 478 ? 101.671 40.000  16.847  1.00 2.59  ? 478  PHE A N   1 
ATOM   3610  C CA  . PHE A 1 478 ? 101.897 41.435  16.745  1.00 3.08  ? 478  PHE A CA  1 
ATOM   3611  C C   . PHE A 1 478 ? 100.554 42.212  16.797  1.00 2.08  ? 478  PHE A C   1 
ATOM   3612  O O   . PHE A 1 478 ? 100.567 43.337  17.286  1.00 2.54  ? 478  PHE A O   1 
ATOM   3613  C CB  . PHE A 1 478 ? 102.700 41.798  15.513  1.00 2.08  ? 478  PHE A CB  1 
ATOM   3614  C CG  . PHE A 1 478 ? 104.186 41.531  15.573  1.00 2.41  ? 478  PHE A CG  1 
ATOM   3615  C CD1 . PHE A 1 478 ? 104.827 40.741  16.506  1.00 2.51  ? 478  PHE A CD1 1 
ATOM   3616  C CD2 . PHE A 1 478 ? 104.937 42.130  14.551  1.00 2.82  ? 478  PHE A CD2 1 
ATOM   3617  C CE1 . PHE A 1 478 ? 106.215 40.574  16.482  1.00 2.08  ? 478  PHE A CE1 1 
ATOM   3618  C CE2 . PHE A 1 478 ? 106.310 41.989  14.541  1.00 4.22  ? 478  PHE A CE2 1 
ATOM   3619  C CZ  . PHE A 1 478 ? 106.940 41.227  15.495  1.00 2.08  ? 478  PHE A CZ  1 
ATOM   3620  N N   . GLY A 1 479 ? 99.415  41.560  16.506  1.00 4.39  ? 479  GLY A N   1 
ATOM   3621  C CA  . GLY A 1 479 ? 98.124  42.164  16.707  1.00 4.19  ? 479  GLY A CA  1 
ATOM   3622  C C   . GLY A 1 479 ? 97.867  42.439  18.173  1.00 3.99  ? 479  GLY A C   1 
ATOM   3623  O O   . GLY A 1 479 ? 97.250  43.480  18.471  1.00 2.85  ? 479  GLY A O   1 
ATOM   3624  N N   . ARG A 1 480 ? 98.367  41.629  19.113  1.00 3.45  ? 480  ARG A N   1 
ATOM   3625  C CA  . ARG A 1 480 ? 98.163  41.930  20.515  1.00 3.78  ? 480  ARG A CA  1 
ATOM   3626  C C   . ARG A 1 480 ? 99.034  43.112  20.958  1.00 5.28  ? 480  ARG A C   1 
ATOM   3627  O O   . ARG A 1 480 ? 98.668  43.875  21.859  1.00 3.84  ? 480  ARG A O   1 
ATOM   3628  C CB  . ARG A 1 480 ? 98.516  40.724  21.391  1.00 2.08  ? 480  ARG A CB  1 
ATOM   3629  C CG  . ARG A 1 480 ? 97.795  39.421  20.963  1.00 2.73  ? 480  ARG A CG  1 
ATOM   3630  C CD  . ARG A 1 480 ? 96.347  39.513  21.497  1.00 3.85  ? 480  ARG A CD  1 
ATOM   3631  N NE  . ARG A 1 480 ? 96.267  39.276  22.919  1.00 2.08  ? 480  ARG A NE  1 
ATOM   3632  C CZ  . ARG A 1 480 ? 95.159  39.443  23.651  1.00 3.16  ? 480  ARG A CZ  1 
ATOM   3633  N NH1 . ARG A 1 480 ? 94.007  39.887  23.123  1.00 3.14  ? 480  ARG A NH1 1 
ATOM   3634  N NH2 . ARG A 1 480 ? 95.108  39.180  24.939  1.00 3.40  ? 480  ARG A NH2 1 
ATOM   3635  N N   . GLN A 1 481 ? 100.251 43.136  20.379  1.00 3.85  ? 481  GLN A N   1 
ATOM   3636  C CA  . GLN A 1 481 ? 101.152 44.252  20.605  1.00 2.71  ? 481  GLN A CA  1 
ATOM   3637  C C   . GLN A 1 481 ? 100.459 45.548  20.137  1.00 3.54  ? 481  GLN A C   1 
ATOM   3638  O O   . GLN A 1 481 ? 100.543 46.570  20.807  1.00 2.76  ? 481  GLN A O   1 
ATOM   3639  C CB  . GLN A 1 481 ? 102.466 44.030  19.816  1.00 2.45  ? 481  GLN A CB  1 
ATOM   3640  C CG  . GLN A 1 481 ? 103.303 42.968  20.582  1.00 3.30  ? 481  GLN A CG  1 
ATOM   3641  C CD  . GLN A 1 481 ? 104.332 42.278  19.723  1.00 3.72  ? 481  GLN A CD  1 
ATOM   3642  O OE1 . GLN A 1 481 ? 104.470 41.033  19.831  1.00 3.80  ? 481  GLN A OE1 1 
ATOM   3643  N NE2 . GLN A 1 481 ? 105.005 43.038  18.863  1.00 3.65  ? 481  GLN A NE2 1 
ATOM   3644  N N   . MET A 1 482 ? 99.838  45.528  18.978  1.00 3.05  ? 482  MET A N   1 
ATOM   3645  C CA  . MET A 1 482 ? 99.080  46.593  18.376  1.00 3.11  ? 482  MET A CA  1 
ATOM   3646  C C   . MET A 1 482 ? 97.821  46.984  19.165  1.00 3.50  ? 482  MET A C   1 
ATOM   3647  O O   . MET A 1 482 ? 97.373  48.141  18.987  1.00 2.26  ? 482  MET A O   1 
ATOM   3648  C CB  . MET A 1 482 ? 98.728  46.395  16.914  1.00 3.46  ? 482  MET A CB  1 
ATOM   3649  C CG  . MET A 1 482 ? 99.915  46.191  15.962  1.00 3.24  ? 482  MET A CG  1 
ATOM   3650  S SD  . MET A 1 482 ? 99.373  45.328  14.463  1.00 4.05  ? 482  MET A SD  1 
ATOM   3651  C CE  . MET A 1 482 ? 100.883 45.521  13.502  1.00 5.71  ? 482  MET A CE  1 
ATOM   3652  N N   . LEU A 1 483 ? 97.303  46.167  20.073  1.00 3.31  ? 483  LEU A N   1 
ATOM   3653  C CA  . LEU A 1 483 ? 96.260  46.612  20.992  1.00 3.62  ? 483  LEU A CA  1 
ATOM   3654  C C   . LEU A 1 483 ? 96.840  47.482  22.115  1.00 4.23  ? 483  LEU A C   1 
ATOM   3655  O O   . LEU A 1 483 ? 96.084  48.167  22.810  1.00 2.26  ? 483  LEU A O   1 
ATOM   3656  C CB  . LEU A 1 483 ? 95.638  45.461  21.775  1.00 2.37  ? 483  LEU A CB  1 
ATOM   3657  C CG  . LEU A 1 483 ? 94.697  44.534  20.964  1.00 2.08  ? 483  LEU A CG  1 
ATOM   3658  C CD1 . LEU A 1 483 ? 94.403  43.221  21.710  1.00 2.08  ? 483  LEU A CD1 1 
ATOM   3659  C CD2 . LEU A 1 483 ? 93.347  45.190  20.691  1.00 2.08  ? 483  LEU A CD2 1 
ATOM   3660  N N   . GLY A 1 484 ? 98.139  47.329  22.396  1.00 4.02  ? 484  GLY A N   1 
ATOM   3661  C CA  . GLY A 1 484 ? 98.816  48.038  23.451  1.00 4.56  ? 484  GLY A CA  1 
ATOM   3662  C C   . GLY A 1 484 ? 99.246  47.182  24.613  1.00 3.48  ? 484  GLY A C   1 
ATOM   3663  O O   . GLY A 1 484 ? 99.591  47.656  25.696  1.00 2.60  ? 484  GLY A O   1 
ATOM   3664  N N   . ILE A 1 485 ? 99.042  45.847  24.480  1.00 2.80  ? 485  ILE A N   1 
ATOM   3665  C CA  . ILE A 1 485 ? 99.191  45.013  25.689  1.00 2.88  ? 485  ILE A CA  1 
ATOM   3666  C C   . ILE A 1 485 ? 100.345 44.035  25.686  1.00 2.93  ? 485  ILE A C   1 
ATOM   3667  O O   . ILE A 1 485 ? 100.503 43.268  26.649  1.00 2.33  ? 485  ILE A O   1 
ATOM   3668  C CB  . ILE A 1 485 ? 97.826  44.292  25.875  1.00 3.99  ? 485  ILE A CB  1 
ATOM   3669  C CG1 . ILE A 1 485 ? 97.559  43.367  24.678  1.00 3.62  ? 485  ILE A CG1 1 
ATOM   3670  C CG2 . ILE A 1 485 ? 96.734  45.340  26.029  1.00 4.29  ? 485  ILE A CG2 1 
ATOM   3671  C CD1 . ILE A 1 485 ? 96.458  42.338  24.873  1.00 3.73  ? 485  ILE A CD1 1 
ATOM   3672  N N   . HIS A 1 486 ? 101.216 44.023  24.674  1.00 2.08  ? 486  HIS A N   1 
ATOM   3673  C CA  . HIS A 1 486 ? 102.405 43.144  24.758  1.00 3.77  ? 486  HIS A CA  1 
ATOM   3674  C C   . HIS A 1 486 ? 103.567 43.862  24.056  1.00 5.02  ? 486  HIS A C   1 
ATOM   3675  O O   . HIS A 1 486 ? 103.319 44.856  23.317  1.00 2.78  ? 486  HIS A O   1 
ATOM   3676  C CB  . HIS A 1 486 ? 102.191 41.811  24.034  1.00 2.12  ? 486  HIS A CB  1 
ATOM   3677  C CG  . HIS A 1 486 ? 101.563 40.734  24.871  1.00 2.10  ? 486  HIS A CG  1 
ATOM   3678  N ND1 . HIS A 1 486 ? 102.004 40.319  26.083  1.00 2.93  ? 486  HIS A ND1 1 
ATOM   3679  C CD2 . HIS A 1 486 ? 100.488 39.945  24.575  1.00 2.08  ? 486  HIS A CD2 1 
ATOM   3680  C CE1 . HIS A 1 486 ? 101.199 39.360  26.510  1.00 4.16  ? 486  HIS A CE1 1 
ATOM   3681  N NE2 . HIS A 1 486 ? 100.203 39.091  25.634  1.00 2.20  ? 486  HIS A NE2 1 
ATOM   3682  N N   . TYR A 1 487 ? 104.773 43.362  24.308  1.00 4.00  ? 487  TYR A N   1 
ATOM   3683  C CA  . TYR A 1 487 ? 105.954 43.962  23.626  1.00 5.78  ? 487  TYR A CA  1 
ATOM   3684  C C   . TYR A 1 487 ? 106.418 42.941  22.596  1.00 4.80  ? 487  TYR A C   1 
ATOM   3685  O O   . TYR A 1 487 ? 106.042 41.758  22.658  1.00 4.19  ? 487  TYR A O   1 
ATOM   3686  C CB  . TYR A 1 487 ? 107.026 44.182  24.680  1.00 3.94  ? 487  TYR A CB  1 
ATOM   3687  C CG  . TYR A 1 487 ? 106.767 44.826  26.013  1.00 3.80  ? 487  TYR A CG  1 
ATOM   3688  C CD1 . TYR A 1 487 ? 106.238 44.104  27.089  1.00 2.08  ? 487  TYR A CD1 1 
ATOM   3689  C CD2 . TYR A 1 487 ? 107.089 46.169  26.269  1.00 4.09  ? 487  TYR A CD2 1 
ATOM   3690  C CE1 . TYR A 1 487 ? 106.000 44.689  28.304  1.00 2.08  ? 487  TYR A CE1 1 
ATOM   3691  C CE2 . TYR A 1 487 ? 106.894 46.744  27.514  1.00 2.55  ? 487  TYR A CE2 1 
ATOM   3692  C CZ  . TYR A 1 487 ? 106.352 46.022  28.546  1.00 2.08  ? 487  TYR A CZ  1 
ATOM   3693  O OH  . TYR A 1 487 ? 106.129 46.560  29.778  1.00 2.08  ? 487  TYR A OH  1 
ATOM   3694  N N   . ARG A 1 488 ? 107.265 43.306  21.648  1.00 5.37  ? 488  ARG A N   1 
ATOM   3695  C CA  . ARG A 1 488 ? 107.820 42.406  20.673  1.00 4.30  ? 488  ARG A CA  1 
ATOM   3696  C C   . ARG A 1 488 ? 108.470 41.193  21.360  1.00 3.80  ? 488  ARG A C   1 
ATOM   3697  O O   . ARG A 1 488 ? 108.399 40.130  20.741  1.00 3.47  ? 488  ARG A O   1 
ATOM   3698  C CB  . ARG A 1 488 ? 108.816 43.147  19.762  1.00 4.62  ? 488  ARG A CB  1 
ATOM   3699  C CG  . ARG A 1 488 ? 109.752 42.277  18.950  1.00 4.09  ? 488  ARG A CG  1 
ATOM   3700  C CD  . ARG A 1 488 ? 110.764 43.081  18.102  1.00 3.39  ? 488  ARG A CD  1 
ATOM   3701  N NE  . ARG A 1 488 ? 110.081 43.872  17.074  1.00 2.08  ? 488  ARG A NE  1 
ATOM   3702  C CZ  . ARG A 1 488 ? 109.952 43.505  15.801  1.00 3.02  ? 488  ARG A CZ  1 
ATOM   3703  N NH1 . ARG A 1 488 ? 110.497 42.364  15.396  1.00 2.52  ? 488  ARG A NH1 1 
ATOM   3704  N NH2 . ARG A 1 488 ? 109.313 44.286  14.927  1.00 3.54  ? 488  ARG A NH2 1 
ATOM   3705  N N   . PHE A 1 489 ? 109.129 41.327  22.515  1.00 3.02  ? 489  PHE A N   1 
ATOM   3706  C CA  . PHE A 1 489 ? 109.782 40.174  23.118  1.00 2.97  ? 489  PHE A CA  1 
ATOM   3707  C C   . PHE A 1 489 ? 108.717 39.142  23.575  1.00 3.94  ? 489  PHE A C   1 
ATOM   3708  O O   . PHE A 1 489 ? 108.949 37.919  23.432  1.00 3.43  ? 489  PHE A O   1 
ATOM   3709  C CB  . PHE A 1 489 ? 110.712 40.499  24.260  1.00 3.53  ? 489  PHE A CB  1 
ATOM   3710  C CG  . PHE A 1 489 ? 110.329 41.495  25.305  1.00 3.41  ? 489  PHE A CG  1 
ATOM   3711  C CD1 . PHE A 1 489 ? 109.270 41.282  26.175  1.00 3.23  ? 489  PHE A CD1 1 
ATOM   3712  C CD2 . PHE A 1 489 ? 111.054 42.668  25.481  1.00 2.44  ? 489  PHE A CD2 1 
ATOM   3713  C CE1 . PHE A 1 489 ? 108.951 42.194  27.163  1.00 4.81  ? 489  PHE A CE1 1 
ATOM   3714  C CE2 . PHE A 1 489 ? 110.712 43.608  26.430  1.00 3.02  ? 489  PHE A CE2 1 
ATOM   3715  C CZ  . PHE A 1 489 ? 109.661 43.389  27.300  1.00 3.15  ? 489  PHE A CZ  1 
ATOM   3716  N N   . ASP A 1 490 ? 107.580 39.634  24.030  1.00 3.92  ? 490  ASP A N   1 
ATOM   3717  C CA  . ASP A 1 490 ? 106.477 38.720  24.341  1.00 3.08  ? 490  ASP A CA  1 
ATOM   3718  C C   . ASP A 1 490 ? 106.083 37.901  23.129  1.00 4.08  ? 490  ASP A C   1 
ATOM   3719  O O   . ASP A 1 490 ? 105.794 36.712  23.235  1.00 2.43  ? 490  ASP A O   1 
ATOM   3720  C CB  . ASP A 1 490 ? 105.219 39.444  24.812  1.00 3.61  ? 490  ASP A CB  1 
ATOM   3721  C CG  . ASP A 1 490 ? 105.416 40.285  26.049  1.00 3.71  ? 490  ASP A CG  1 
ATOM   3722  O OD1 . ASP A 1 490 ? 106.333 40.056  26.859  1.00 3.13  ? 490  ASP A OD1 1 
ATOM   3723  O OD2 . ASP A 1 490 ? 104.628 41.228  26.256  1.00 3.50  ? 490  ASP A OD2 1 
ATOM   3724  N N   . GLY A 1 491 ? 105.987 38.509  21.957  1.00 3.85  ? 491  GLY A N   1 
ATOM   3725  C CA  . GLY A 1 491 ? 105.482 37.866  20.763  1.00 2.08  ? 491  GLY A CA  1 
ATOM   3726  C C   . GLY A 1 491 ? 106.580 36.940  20.208  1.00 4.44  ? 491  GLY A C   1 
ATOM   3727  O O   . GLY A 1 491 ? 106.257 35.780  20.038  1.00 3.06  ? 491  GLY A O   1 
ATOM   3728  N N   . ILE A 1 492 ? 107.792 37.464  19.966  1.00 3.90  ? 492  ILE A N   1 
ATOM   3729  C CA  . ILE A 1 492 ? 108.796 36.606  19.353  1.00 4.26  ? 492  ILE A CA  1 
ATOM   3730  C C   . ILE A 1 492 ? 109.133 35.425  20.232  1.00 2.62  ? 492  ILE A C   1 
ATOM   3731  O O   . ILE A 1 492 ? 109.234 34.316  19.718  1.00 3.68  ? 492  ILE A O   1 
ATOM   3732  C CB  . ILE A 1 492 ? 110.079 37.410  18.958  1.00 5.88  ? 492  ILE A CB  1 
ATOM   3733  C CG1 . ILE A 1 492 ? 109.726 38.413  17.877  1.00 4.12  ? 492  ILE A CG1 1 
ATOM   3734  C CG2 . ILE A 1 492 ? 111.186 36.428  18.538  1.00 3.70  ? 492  ILE A CG2 1 
ATOM   3735  C CD1 . ILE A 1 492 ? 109.146 37.819  16.595  1.00 2.24  ? 492  ILE A CD1 1 
ATOM   3736  N N   . GLN A 1 493 ? 109.428 35.613  21.509  1.00 2.89  ? 493  GLN A N   1 
ATOM   3737  C CA  . GLN A 1 493 ? 109.817 34.535  22.401  1.00 2.39  ? 493  GLN A CA  1 
ATOM   3738  C C   . GLN A 1 493 ? 108.624 33.597  22.659  1.00 2.54  ? 493  GLN A C   1 
ATOM   3739  O O   . GLN A 1 493 ? 108.819 32.429  23.019  1.00 2.78  ? 493  GLN A O   1 
ATOM   3740  C CB  . GLN A 1 493 ? 110.438 35.112  23.672  1.00 3.05  ? 493  GLN A CB  1 
ATOM   3741  C CG  . GLN A 1 493 ? 111.709 35.986  23.402  1.00 2.15  ? 493  GLN A CG  1 
ATOM   3742  C CD  . GLN A 1 493 ? 112.754 35.211  22.614  1.00 3.45  ? 493  GLN A CD  1 
ATOM   3743  O OE1 . GLN A 1 493 ? 112.877 33.985  22.778  1.00 3.93  ? 493  GLN A OE1 1 
ATOM   3744  N NE2 . GLN A 1 493 ? 113.498 35.818  21.692  1.00 3.74  ? 493  GLN A NE2 1 
ATOM   3745  N N   . GLY A 1 494 ? 107.369 34.092  22.664  1.00 3.64  ? 494  GLY A N   1 
ATOM   3746  C CA  . GLY A 1 494 ? 106.219 33.161  22.866  1.00 3.44  ? 494  GLY A CA  1 
ATOM   3747  C C   . GLY A 1 494 ? 106.166 32.309  21.581  1.00 4.08  ? 494  GLY A C   1 
ATOM   3748  O O   . GLY A 1 494 ? 105.976 31.101  21.665  1.00 3.44  ? 494  GLY A O   1 
ATOM   3749  N N   . LEU A 1 495 ? 106.324 32.885  20.405  1.00 2.83  ? 495  LEU A N   1 
ATOM   3750  C CA  . LEU A 1 495 ? 106.264 32.040  19.184  1.00 3.03  ? 495  LEU A CA  1 
ATOM   3751  C C   . LEU A 1 495 ? 107.281 30.883  19.225  1.00 5.05  ? 495  LEU A C   1 
ATOM   3752  O O   . LEU A 1 495 ? 106.936 29.775  18.762  1.00 2.08  ? 495  LEU A O   1 
ATOM   3753  C CB  . LEU A 1 495 ? 106.488 32.865  17.933  1.00 3.64  ? 495  LEU A CB  1 
ATOM   3754  C CG  . LEU A 1 495 ? 105.383 33.860  17.520  1.00 4.68  ? 495  LEU A CG  1 
ATOM   3755  C CD1 . LEU A 1 495 ? 105.929 34.941  16.580  1.00 2.50  ? 495  LEU A CD1 1 
ATOM   3756  C CD2 . LEU A 1 495 ? 104.248 33.095  16.870  1.00 2.08  ? 495  LEU A CD2 1 
ATOM   3757  N N   . LEU A 1 496 ? 108.505 31.191  19.673  1.00 3.50  ? 496  LEU A N   1 
ATOM   3758  C CA  . LEU A 1 496 ? 109.558 30.153  19.725  1.00 5.41  ? 496  LEU A CA  1 
ATOM   3759  C C   . LEU A 1 496 ? 109.252 29.144  20.815  1.00 4.26  ? 496  LEU A C   1 
ATOM   3760  O O   . LEU A 1 496 ? 109.507 27.970  20.563  1.00 3.56  ? 496  LEU A O   1 
ATOM   3761  C CB  . LEU A 1 496 ? 110.955 30.773  19.926  1.00 3.82  ? 496  LEU A CB  1 
ATOM   3762  C CG  . LEU A 1 496 ? 111.413 31.683  18.786  1.00 4.56  ? 496  LEU A CG  1 
ATOM   3763  C CD1 . LEU A 1 496 ? 112.597 32.555  19.227  1.00 6.87  ? 496  LEU A CD1 1 
ATOM   3764  C CD2 . LEU A 1 496 ? 111.777 30.888  17.547  1.00 3.12  ? 496  LEU A CD2 1 
ATOM   3765  N N   . LEU A 1 497 ? 108.760 29.549  21.974  1.00 4.26  ? 497  LEU A N   1 
ATOM   3766  C CA  . LEU A 1 497 ? 108.334 28.655  23.018  1.00 3.70  ? 497  LEU A CA  1 
ATOM   3767  C C   . LEU A 1 497 ? 107.329 27.623  22.478  1.00 4.16  ? 497  LEU A C   1 
ATOM   3768  O O   . LEU A 1 497 ? 107.459 26.397  22.642  1.00 3.39  ? 497  LEU A O   1 
ATOM   3769  C CB  . LEU A 1 497 ? 107.665 29.368  24.203  1.00 4.11  ? 497  LEU A CB  1 
ATOM   3770  C CG  . LEU A 1 497 ? 107.218 28.476  25.359  1.00 4.42  ? 497  LEU A CG  1 
ATOM   3771  C CD1 . LEU A 1 497 ? 108.389 27.659  25.955  1.00 2.08  ? 497  LEU A CD1 1 
ATOM   3772  C CD2 . LEU A 1 497 ? 106.655 29.319  26.522  1.00 2.09  ? 497  LEU A CD2 1 
ATOM   3773  N N   . GLY A 1 498 ? 106.342 28.090  21.739  1.00 3.68  ? 498  GLY A N   1 
ATOM   3774  C CA  . GLY A 1 498 ? 105.281 27.340  21.105  1.00 4.39  ? 498  GLY A CA  1 
ATOM   3775  C C   . GLY A 1 498 ? 105.813 26.325  20.074  1.00 4.66  ? 498  GLY A C   1 
ATOM   3776  O O   . GLY A 1 498 ? 105.419 25.163  20.166  1.00 3.93  ? 498  GLY A O   1 
ATOM   3777  N N   . GLU A 1 499 ? 106.743 26.726  19.224  1.00 2.65  ? 499  GLU A N   1 
ATOM   3778  C CA  . GLU A 1 499 ? 107.368 25.826  18.268  1.00 3.94  ? 499  GLU A CA  1 
ATOM   3779  C C   . GLU A 1 499 ? 108.136 24.727  18.986  1.00 4.26  ? 499  GLU A C   1 
ATOM   3780  O O   . GLU A 1 499 ? 107.918 23.541  18.711  1.00 5.12  ? 499  GLU A O   1 
ATOM   3781  C CB  . GLU A 1 499 ? 108.280 26.673  17.372  1.00 4.14  ? 499  GLU A CB  1 
ATOM   3782  C CG  . GLU A 1 499 ? 109.056 25.890  16.315  1.00 4.23  ? 499  GLU A CG  1 
ATOM   3783  C CD  . GLU A 1 499 ? 110.037 26.779  15.565  1.00 2.96  ? 499  GLU A CD  1 
ATOM   3784  O OE1 . GLU A 1 499 ? 111.050 27.187  16.218  1.00 3.57  ? 499  GLU A OE1 1 
ATOM   3785  O OE2 . GLU A 1 499 ? 109.764 27.041  14.388  1.00 3.30  ? 499  GLU A OE2 1 
ATOM   3786  N N   . THR A 1 500 ? 108.967 25.047  19.979  1.00 3.87  ? 500  THR A N   1 
ATOM   3787  C CA  . THR A 1 500 ? 109.775 24.041  20.662  1.00 4.40  ? 500  THR A CA  1 
ATOM   3788  C C   . THR A 1 500 ? 108.918 22.987  21.347  1.00 6.75  ? 500  THR A C   1 
ATOM   3789  O O   . THR A 1 500 ? 109.189 21.782  21.209  1.00 4.81  ? 500  THR A O   1 
ATOM   3790  C CB  . THR A 1 500 ? 110.771 24.703  21.643  1.00 4.02  ? 500  THR A CB  1 
ATOM   3791  O OG1 . THR A 1 500 ? 111.664 25.487  20.854  1.00 4.66  ? 500  THR A OG1 1 
ATOM   3792  C CG2 . THR A 1 500 ? 111.587 23.735  22.476  1.00 4.84  ? 500  THR A CG2 1 
ATOM   3793  N N   . ILE A 1 501 ? 107.923 23.450  22.120  1.00 4.57  ? 501  ILE A N   1 
ATOM   3794  C CA  . ILE A 1 501 ? 107.036 22.498  22.795  1.00 4.31  ? 501  ILE A CA  1 
ATOM   3795  C C   . ILE A 1 501 ? 106.323 21.608  21.781  1.00 4.84  ? 501  ILE A C   1 
ATOM   3796  O O   . ILE A 1 501 ? 106.127 20.403  22.016  1.00 5.16  ? 501  ILE A O   1 
ATOM   3797  C CB  . ILE A 1 501 ? 105.997 23.234  23.658  1.00 5.30  ? 501  ILE A CB  1 
ATOM   3798  C CG1 . ILE A 1 501 ? 106.703 23.855  24.858  1.00 4.97  ? 501  ILE A CG1 1 
ATOM   3799  C CG2 . ILE A 1 501 ? 104.872 22.308  24.143  1.00 4.44  ? 501  ILE A CG2 1 
ATOM   3800  C CD1 . ILE A 1 501 ? 105.952 25.039  25.439  1.00 6.51  ? 501  ILE A CD1 1 
ATOM   3801  N N   . THR A 1 502 ? 105.872 22.216  20.676  1.00 3.17  ? 502  THR A N   1 
ATOM   3802  C CA  . THR A 1 502 ? 105.147 21.456  19.662  1.00 5.24  ? 502  THR A CA  1 
ATOM   3803  C C   . THR A 1 502 ? 106.030 20.440  18.942  1.00 6.27  ? 502  THR A C   1 
ATOM   3804  O O   . THR A 1 502 ? 105.531 19.347  18.642  1.00 5.38  ? 502  THR A O   1 
ATOM   3805  C CB  . THR A 1 502 ? 104.373 22.387  18.713  1.00 4.39  ? 502  THR A CB  1 
ATOM   3806  O OG1 . THR A 1 502 ? 103.478 23.152  19.556  1.00 2.94  ? 502  THR A OG1 1 
ATOM   3807  C CG2 . THR A 1 502 ? 103.523 21.631  17.709  1.00 4.33  ? 502  THR A CG2 1 
ATOM   3808  N N   . VAL A 1 503 ? 107.302 20.731  18.690  1.00 3.96  ? 503  VAL A N   1 
ATOM   3809  C CA  . VAL A 1 503 ? 108.211 19.733  18.116  1.00 3.95  ? 503  VAL A CA  1 
ATOM   3810  C C   . VAL A 1 503 ? 108.319 18.570  19.109  1.00 3.63  ? 503  VAL A C   1 
ATOM   3811  O O   . VAL A 1 503 ? 108.246 17.408  18.723  1.00 4.94  ? 503  VAL A O   1 
ATOM   3812  C CB  . VAL A 1 503 ? 109.590 20.352  17.828  1.00 3.30  ? 503  VAL A CB  1 
ATOM   3813  C CG1 . VAL A 1 503 ? 110.624 19.262  17.575  1.00 2.14  ? 503  VAL A CG1 1 
ATOM   3814  C CG2 . VAL A 1 503 ? 109.512 21.368  16.680  1.00 2.08  ? 503  VAL A CG2 1 
ATOM   3815  N N   . ARG A 1 504 ? 108.434 18.838  20.400  1.00 2.08  ? 504  ARG A N   1 
ATOM   3816  C CA  . ARG A 1 504 ? 108.527 17.771  21.403  1.00 3.42  ? 504  ARG A CA  1 
ATOM   3817  C C   . ARG A 1 504 ? 107.302 16.833  21.374  1.00 5.26  ? 504  ARG A C   1 
ATOM   3818  O O   . ARG A 1 504 ? 107.433 15.599  21.432  1.00 3.21  ? 504  ARG A O   1 
ATOM   3819  C CB  . ARG A 1 504 ? 108.790 18.330  22.781  1.00 4.87  ? 504  ARG A CB  1 
ATOM   3820  C CG  . ARG A 1 504 ? 110.212 18.828  23.065  1.00 7.67  ? 504  ARG A CG  1 
ATOM   3821  C CD  . ARG A 1 504 ? 111.177 17.707  23.460  1.00 3.23  ? 504  ARG A CD  1 
ATOM   3822  N NE  . ARG A 1 504 ? 111.084 17.381  24.888  1.00 2.08  ? 504  ARG A NE  1 
ATOM   3823  C CZ  . ARG A 1 504 ? 111.755 18.098  25.793  1.00 4.16  ? 504  ARG A CZ  1 
ATOM   3824  N NH1 . ARG A 1 504 ? 112.537 19.104  25.365  1.00 5.01  ? 504  ARG A NH1 1 
ATOM   3825  N NH2 . ARG A 1 504 ? 111.647 17.807  27.054  1.00 4.86  ? 504  ARG A NH2 1 
ATOM   3826  N N   . THR A 1 505 ? 106.072 17.342  21.346  1.00 4.88  ? 505  THR A N   1 
ATOM   3827  C CA  . THR A 1 505 ? 104.839 16.541  21.284  1.00 3.77  ? 505  THR A CA  1 
ATOM   3828  C C   . THR A 1 505 ? 104.727 15.785  19.970  1.00 4.41  ? 505  THR A C   1 
ATOM   3829  O O   . THR A 1 505 ? 104.488 14.563  19.955  1.00 5.63  ? 505  THR A O   1 
ATOM   3830  C CB  . THR A 1 505 ? 103.619 17.478  21.497  1.00 4.34  ? 505  THR A CB  1 
ATOM   3831  O OG1 . THR A 1 505 ? 103.800 18.073  22.799  1.00 2.64  ? 505  THR A OG1 1 
ATOM   3832  C CG2 . THR A 1 505 ? 102.307 16.712  21.543  1.00 3.12  ? 505  THR A CG2 1 
ATOM   3833  N N   . LEU A 1 506 ? 104.939 16.442  18.832  1.00 3.88  ? 506  LEU A N   1 
ATOM   3834  C CA  . LEU A 1 506 ? 104.959 15.898  17.517  1.00 4.98  ? 506  LEU A CA  1 
ATOM   3835  C C   . LEU A 1 506 ? 105.904 14.663  17.453  1.00 7.28  ? 506  LEU A C   1 
ATOM   3836  O O   . LEU A 1 506 ? 105.493 13.609  16.945  1.00 5.94  ? 506  LEU A O   1 
ATOM   3837  C CB  . LEU A 1 506 ? 105.415 16.909  16.482  1.00 3.28  ? 506  LEU A CB  1 
ATOM   3838  C CG  . LEU A 1 506 ? 104.442 17.977  15.949  1.00 5.16  ? 506  LEU A CG  1 
ATOM   3839  C CD1 . LEU A 1 506 ? 105.160 18.968  15.048  1.00 3.59  ? 506  LEU A CD1 1 
ATOM   3840  C CD2 . LEU A 1 506 ? 103.280 17.355  15.156  1.00 2.20  ? 506  LEU A CD2 1 
ATOM   3841  N N   . HIS A 1 507 ? 107.113 14.838  17.987  1.00 6.27  ? 507  HIS A N   1 
ATOM   3842  C CA  . HIS A 1 507 ? 108.111 13.745  17.960  1.00 7.40  ? 507  HIS A CA  1 
ATOM   3843  C C   . HIS A 1 507 ? 107.662 12.620  18.877  1.00 5.58  ? 507  HIS A C   1 
ATOM   3844  O O   . HIS A 1 507 ? 107.758 11.439  18.495  1.00 7.00  ? 507  HIS A O   1 
ATOM   3845  C CB  . HIS A 1 507 ? 109.494 14.254  18.381  1.00 7.48  ? 507  HIS A CB  1 
ATOM   3846  C CG  . HIS A 1 507 ? 110.637 13.435  17.871  1.00 10.98 ? 507  HIS A CG  1 
ATOM   3847  N ND1 . HIS A 1 507 ? 111.954 13.818  18.083  1.00 10.39 ? 507  HIS A ND1 1 
ATOM   3848  C CD2 . HIS A 1 507 ? 110.669 12.296  17.121  1.00 10.10 ? 507  HIS A CD2 1 
ATOM   3849  C CE1 . HIS A 1 507 ? 112.746 12.942  17.494  1.00 11.99 ? 507  HIS A CE1 1 
ATOM   3850  N NE2 . HIS A 1 507 ? 112.002 12.014  16.902  1.00 12.64 ? 507  HIS A NE2 1 
ATOM   3851  N N   . GLN A 1 508 ? 107.194 12.935  20.065  1.00 5.21  ? 508  GLN A N   1 
ATOM   3852  C CA  . GLN A 1 508 ? 106.655 11.928  20.984  1.00 5.02  ? 508  GLN A CA  1 
ATOM   3853  C C   . GLN A 1 508 ? 105.582 11.070  20.288  1.00 5.22  ? 508  GLN A C   1 
ATOM   3854  O O   . GLN A 1 508 ? 105.654 9.824   20.319  1.00 5.52  ? 508  GLN A O   1 
ATOM   3855  C CB  . GLN A 1 508 ? 106.076 12.554  22.246  1.00 6.35  ? 508  GLN A CB  1 
ATOM   3856  C CG  . GLN A 1 508 ? 105.785 11.545  23.374  1.00 6.48  ? 508  GLN A CG  1 
ATOM   3857  C CD  . GLN A 1 508 ? 105.311 12.141  24.653  1.00 6.87  ? 508  GLN A CD  1 
ATOM   3858  O OE1 . GLN A 1 508 ? 104.301 12.902  24.661  1.00 8.77  ? 508  GLN A OE1 1 
ATOM   3859  N NE2 . GLN A 1 508 ? 105.935 11.900  25.793  1.00 4.23  ? 508  GLN A NE2 1 
ATOM   3860  N N   . GLU A 1 509 ? 104.602 11.669  19.627  1.00 4.50  ? 509  GLU A N   1 
ATOM   3861  C CA  . GLU A 1 509 ? 103.544 10.937  18.928  1.00 5.05  ? 509  GLU A CA  1 
ATOM   3862  C C   . GLU A 1 509 ? 104.080 10.140  17.741  1.00 5.25  ? 509  GLU A C   1 
ATOM   3863  O O   . GLU A 1 509 ? 103.725 8.965   17.585  1.00 5.01  ? 509  GLU A O   1 
ATOM   3864  C CB  . GLU A 1 509 ? 102.426 11.846  18.442  1.00 4.43  ? 509  GLU A CB  1 
ATOM   3865  C CG  . GLU A 1 509 ? 101.561 12.423  19.541  1.00 3.20  ? 509  GLU A CG  1 
ATOM   3866  C CD  . GLU A 1 509 ? 100.335 13.194  19.116  1.00 3.12  ? 509  GLU A CD  1 
ATOM   3867  O OE1 . GLU A 1 509 ? 100.188 13.554  17.928  1.00 2.13  ? 509  GLU A OE1 1 
ATOM   3868  O OE2 . GLU A 1 509 ? 99.495  13.455  20.033  1.00 2.54  ? 509  GLU A OE2 1 
ATOM   3869  N N   . LEU A 1 510 ? 104.942 10.720  16.924  1.00 5.36  ? 510  LEU A N   1 
ATOM   3870  C CA  . LEU A 1 510 ? 105.538 10.058  15.790  1.00 7.16  ? 510  LEU A CA  1 
ATOM   3871  C C   . LEU A 1 510 ? 106.190 8.721   16.178  1.00 6.72  ? 510  LEU A C   1 
ATOM   3872  O O   . LEU A 1 510 ? 106.025 7.795   15.386  1.00 8.59  ? 510  LEU A O   1 
ATOM   3873  C CB  . LEU A 1 510 ? 106.651 10.892  15.131  1.00 7.46  ? 510  LEU A CB  1 
ATOM   3874  C CG  . LEU A 1 510 ? 107.336 10.289  13.908  1.00 8.55  ? 510  LEU A CG  1 
ATOM   3875  C CD1 . LEU A 1 510 ? 106.372 10.166  12.737  1.00 6.88  ? 510  LEU A CD1 1 
ATOM   3876  C CD2 . LEU A 1 510 ? 108.544 11.133  13.472  1.00 8.23  ? 510  LEU A CD2 1 
ATOM   3877  N N   . MET A 1 511 ? 106.855 8.620   17.308  1.00 5.60  ? 511  MET A N   1 
ATOM   3878  C CA  . MET A 1 511 ? 107.536 7.441   17.773  1.00 6.51  ? 511  MET A CA  1 
ATOM   3879  C C   . MET A 1 511 ? 106.567 6.291   18.067  1.00 9.24  ? 511  MET A C   1 
ATOM   3880  O O   . MET A 1 511 ? 106.957 5.120   17.977  1.00 7.86  ? 511  MET A O   1 
ATOM   3881  C CB  . MET A 1 511 ? 108.406 7.763   19.010  1.00 3.35  ? 511  MET A CB  1 
ATOM   3882  C CG  . MET A 1 511 ? 109.588 8.701   18.569  1.00 5.82  ? 511  MET A CG  1 
ATOM   3883  S SD  . MET A 1 511 ? 110.581 9.081   20.010  1.00 3.77  ? 511  MET A SD  1 
ATOM   3884  C CE  . MET A 1 511 ? 111.177 7.457   20.494  1.00 3.65  ? 511  MET A CE  1 
ATOM   3885  N N   . THR A 1 512 ? 105.296 6.575   18.365  1.00 6.95  ? 512  THR A N   1 
ATOM   3886  C CA  . THR A 1 512 ? 104.314 5.550   18.648  1.00 6.72  ? 512  THR A CA  1 
ATOM   3887  C C   . THR A 1 512 ? 103.650 4.959   17.395  1.00 7.98  ? 512  THR A C   1 
ATOM   3888  O O   . THR A 1 512 ? 103.087 3.863   17.563  1.00 8.41  ? 512  THR A O   1 
ATOM   3889  C CB  . THR A 1 512 ? 103.119 6.049   19.503  1.00 5.80  ? 512  THR A CB  1 
ATOM   3890  O OG1 . THR A 1 512 ? 102.341 6.940   18.656  1.00 3.94  ? 512  THR A OG1 1 
ATOM   3891  C CG2 . THR A 1 512 ? 103.482 6.791   20.763  1.00 5.68  ? 512  THR A CG2 1 
ATOM   3892  N N   . PHE A 1 513 ? 103.667 5.634   16.253  1.00 8.11  ? 513  PHE A N   1 
ATOM   3893  C CA  . PHE A 1 513 ? 102.899 5.152   15.116  1.00 9.82  ? 513  PHE A CA  1 
ATOM   3894  C C   . PHE A 1 513 ? 103.426 3.835   14.489  1.00 12.07 ? 513  PHE A C   1 
ATOM   3895  O O   . PHE A 1 513 ? 104.608 3.675   14.239  1.00 8.02  ? 513  PHE A O   1 
ATOM   3896  C CB  . PHE A 1 513 ? 102.718 6.167   14.001  1.00 10.14 ? 513  PHE A CB  1 
ATOM   3897  C CG  . PHE A 1 513 ? 102.196 7.552   14.329  1.00 10.29 ? 513  PHE A CG  1 
ATOM   3898  C CD1 . PHE A 1 513 ? 101.371 7.765   15.421  1.00 10.63 ? 513  PHE A CD1 1 
ATOM   3899  C CD2 . PHE A 1 513 ? 102.547 8.627   13.537  1.00 8.97  ? 513  PHE A CD2 1 
ATOM   3900  C CE1 . PHE A 1 513 ? 100.896 9.030   15.734  1.00 10.44 ? 513  PHE A CE1 1 
ATOM   3901  C CE2 . PHE A 1 513 ? 102.078 9.906   13.847  1.00 10.47 ? 513  PHE A CE2 1 
ATOM   3902  C CZ  . PHE A 1 513 ? 101.264 10.108  14.946  1.00 9.48  ? 513  PHE A CZ  1 
ATOM   3903  N N   . ALA A 1 514 ? 102.485 2.963   14.107  1.00 12.16 ? 514  ALA A N   1 
ATOM   3904  C CA  . ALA A 1 514 ? 102.792 1.709   13.462  1.00 12.82 ? 514  ALA A CA  1 
ATOM   3905  C C   . ALA A 1 514 ? 103.422 1.937   12.088  1.00 12.49 ? 514  ALA A C   1 
ATOM   3906  O O   . ALA A 1 514 ? 104.454 1.325   11.814  1.00 12.24 ? 514  ALA A O   1 
ATOM   3907  C CB  . ALA A 1 514 ? 101.576 0.823   13.197  1.00 12.29 ? 514  ALA A CB  1 
ATOM   3908  N N   . GLU A 1 515 ? 102.846 2.767   11.242  1.00 9.58  ? 515  GLU A N   1 
ATOM   3909  C CA  . GLU A 1 515 ? 103.418 2.901   9.914   1.00 9.86  ? 515  GLU A CA  1 
ATOM   3910  C C   . GLU A 1 515 ? 104.759 3.626   9.926   1.00 10.82 ? 515  GLU A C   1 
ATOM   3911  O O   . GLU A 1 515 ? 104.949 4.595   10.683  1.00 8.93  ? 515  GLU A O   1 
ATOM   3912  C CB  . GLU A 1 515 ? 102.443 3.626   8.984   1.00 10.27 ? 515  GLU A CB  1 
ATOM   3913  C CG  . GLU A 1 515 ? 101.833 4.883   9.562   1.00 11.41 ? 515  GLU A CG  1 
ATOM   3914  C CD  . GLU A 1 515 ? 100.518 4.713   10.299  1.00 10.16 ? 515  GLU A CD  1 
ATOM   3915  O OE1 . GLU A 1 515 ? 100.344 3.880   11.205  1.00 7.65  ? 515  GLU A OE1 1 
ATOM   3916  O OE2 . GLU A 1 515 ? 99.567  5.469   9.953   1.00 11.21 ? 515  GLU A OE2 1 
ATOM   3917  N N   . GLU A 1 516 ? 105.638 3.226   9.001   1.00 9.96  ? 516  GLU A N   1 
ATOM   3918  C CA  . GLU A 1 516 ? 106.926 3.892   8.896   1.00 9.80  ? 516  GLU A CA  1 
ATOM   3919  C C   . GLU A 1 516 ? 106.665 5.321   8.414   1.00 7.13  ? 516  GLU A C   1 
ATOM   3920  O O   . GLU A 1 516 ? 106.065 5.470   7.343   1.00 6.98  ? 516  GLU A O   1 
ATOM   3921  C CB  . GLU A 1 516 ? 107.895 3.263   7.891   1.00 11.80 ? 516  GLU A CB  1 
ATOM   3922  C CG  . GLU A 1 516 ? 108.487 1.957   8.370   1.00 17.85 ? 516  GLU A CG  1 
ATOM   3923  C CD  . GLU A 1 516 ? 109.665 1.495   7.508   1.00 20.83 ? 516  GLU A CD  1 
ATOM   3924  O OE1 . GLU A 1 516 ? 110.061 2.173   6.531   1.00 21.82 ? 516  GLU A OE1 1 
ATOM   3925  O OE2 . GLU A 1 516 ? 110.183 0.412   7.883   1.00 22.73 ? 516  GLU A OE2 1 
ATOM   3926  N N   . SER A 1 517 ? 107.210 6.286   9.126   1.00 5.46  ? 517  SER A N   1 
ATOM   3927  C CA  . SER A 1 517 ? 107.032 7.669   8.681   1.00 5.87  ? 517  SER A CA  1 
ATOM   3928  C C   . SER A 1 517 ? 107.950 8.640   9.405   1.00 5.53  ? 517  SER A C   1 
ATOM   3929  O O   . SER A 1 517 ? 108.673 8.318   10.365  1.00 5.74  ? 517  SER A O   1 
ATOM   3930  C CB  . SER A 1 517 ? 105.563 8.072   9.038   1.00 4.31  ? 517  SER A CB  1 
ATOM   3931  O OG  . SER A 1 517 ? 105.321 7.736   10.396  1.00 4.29  ? 517  SER A OG  1 
ATOM   3932  N N   . THR A 1 518 ? 107.982 9.868   8.900   1.00 5.29  ? 518  THR A N   1 
ATOM   3933  C CA  . THR A 1 518 ? 108.767 10.912  9.583   1.00 5.33  ? 518  THR A CA  1 
ATOM   3934  C C   . THR A 1 518 ? 107.969 12.218  9.553   1.00 6.50  ? 518  THR A C   1 
ATOM   3935  O O   . THR A 1 518 ? 106.933 12.259  8.870   1.00 5.87  ? 518  THR A O   1 
ATOM   3936  C CB  . THR A 1 518 ? 110.072 11.194  8.788   1.00 5.15  ? 518  THR A CB  1 
ATOM   3937  O OG1 . THR A 1 518 ? 109.732 11.549  7.462   1.00 5.19  ? 518  THR A OG1 1 
ATOM   3938  C CG2 . THR A 1 518 ? 111.024 10.015  8.758   1.00 6.50  ? 518  THR A CG2 1 
ATOM   3939  N N   . PHE A 1 519 ? 108.557 13.279  10.129  1.00 5.96  ? 519  PHE A N   1 
ATOM   3940  C CA  . PHE A 1 519 ? 108.053 14.625  9.890   1.00 6.50  ? 519  PHE A CA  1 
ATOM   3941  C C   . PHE A 1 519 ? 109.259 15.444  9.380   1.00 7.15  ? 519  PHE A C   1 
ATOM   3942  O O   . PHE A 1 519 ? 110.353 15.252  9.920   1.00 5.81  ? 519  PHE A O   1 
ATOM   3943  C CB  . PHE A 1 519 ? 107.521 15.358  11.114  1.00 3.94  ? 519  PHE A CB  1 
ATOM   3944  C CG  . PHE A 1 519 ? 106.188 14.928  11.654  1.00 3.87  ? 519  PHE A CG  1 
ATOM   3945  C CD1 . PHE A 1 519 ? 105.047 15.042  10.870  1.00 3.43  ? 519  PHE A CD1 1 
ATOM   3946  C CD2 . PHE A 1 519 ? 106.070 14.464  12.941  1.00 4.28  ? 519  PHE A CD2 1 
ATOM   3947  C CE1 . PHE A 1 519 ? 103.819 14.658  11.400  1.00 3.39  ? 519  PHE A CE1 1 
ATOM   3948  C CE2 . PHE A 1 519 ? 104.837 14.086  13.453  1.00 4.85  ? 519  PHE A CE2 1 
ATOM   3949  C CZ  . PHE A 1 519 ? 103.712 14.193  12.693  1.00 2.08  ? 519  PHE A CZ  1 
ATOM   3950  N N   . GLU A 1 520 ? 109.017 16.376  8.465   1.00 6.84  ? 520  GLU A N   1 
ATOM   3951  C CA  . GLU A 1 520 ? 110.039 17.246  7.970   1.00 7.95  ? 520  GLU A CA  1 
ATOM   3952  C C   . GLU A 1 520 ? 109.458 18.620  7.607   1.00 7.16  ? 520  GLU A C   1 
ATOM   3953  O O   . GLU A 1 520 ? 108.549 18.661  6.789   1.00 8.09  ? 520  GLU A O   1 
ATOM   3954  C CB  . GLU A 1 520 ? 110.709 16.672  6.686   1.00 9.02  ? 520  GLU A CB  1 
ATOM   3955  C CG  . GLU A 1 520 ? 111.870 17.577  6.255   1.00 9.97  ? 520  GLU A CG  1 
ATOM   3956  C CD  . GLU A 1 520 ? 112.737 16.943  5.187   1.00 11.46 ? 520  GLU A CD  1 
ATOM   3957  O OE1 . GLU A 1 520 ? 112.207 16.229  4.309   1.00 11.80 ? 520  GLU A OE1 1 
ATOM   3958  O OE2 . GLU A 1 520 ? 113.969 17.171  5.154   1.00 12.00 ? 520  GLU A OE2 1 
ATOM   3959  N N   . PHE A 1 521 ? 109.992 19.727  8.120   1.00 4.09  ? 521  PHE A N   1 
ATOM   3960  C CA  . PHE A 1 521 ? 109.443 21.029  7.792   1.00 5.75  ? 521  PHE A CA  1 
ATOM   3961  C C   . PHE A 1 521 ? 110.403 22.144  8.237   1.00 5.97  ? 521  PHE A C   1 
ATOM   3962  O O   . PHE A 1 521 ? 111.353 21.818  8.965   1.00 6.51  ? 521  PHE A O   1 
ATOM   3963  C CB  . PHE A 1 521 ? 108.094 21.157  8.521   1.00 4.03  ? 521  PHE A CB  1 
ATOM   3964  C CG  . PHE A 1 521 ? 108.170 21.184  10.006  1.00 5.60  ? 521  PHE A CG  1 
ATOM   3965  C CD1 . PHE A 1 521 ? 108.145 20.029  10.783  1.00 5.81  ? 521  PHE A CD1 1 
ATOM   3966  C CD2 . PHE A 1 521 ? 108.257 22.393  10.700  1.00 6.08  ? 521  PHE A CD2 1 
ATOM   3967  C CE1 . PHE A 1 521 ? 108.212 20.037  12.147  1.00 4.95  ? 521  PHE A CE1 1 
ATOM   3968  C CE2 . PHE A 1 521 ? 108.348 22.422  12.063  1.00 4.31  ? 521  PHE A CE2 1 
ATOM   3969  C CZ  . PHE A 1 521 ? 108.321 21.259  12.807  1.00 6.40  ? 521  PHE A CZ  1 
ATOM   3970  N N   . ARG A 1 522 ? 110.119 23.364  7.824   1.00 5.15  ? 522  ARG A N   1 
ATOM   3971  C CA  . ARG A 1 522 ? 111.008 24.488  8.163   1.00 6.15  ? 522  ARG A CA  1 
ATOM   3972  C C   . ARG A 1 522 ? 110.558 25.266  9.394   1.00 7.21  ? 522  ARG A C   1 
ATOM   3973  O O   . ARG A 1 522 ? 109.390 25.689  9.515   1.00 6.47  ? 522  ARG A O   1 
ATOM   3974  C CB  . ARG A 1 522 ? 111.116 25.422  6.947   1.00 5.27  ? 522  ARG A CB  1 
ATOM   3975  C CG  . ARG A 1 522 ? 112.300 26.388  6.986   1.00 6.13  ? 522  ARG A CG  1 
ATOM   3976  C CD  . ARG A 1 522 ? 112.232 27.375  5.816   1.00 5.81  ? 522  ARG A CD  1 
ATOM   3977  N NE  . ARG A 1 522 ? 112.241 26.597  4.551   1.00 8.23  ? 522  ARG A NE  1 
ATOM   3978  C CZ  . ARG A 1 522 ? 113.359 26.051  4.033   1.00 9.18  ? 522  ARG A CZ  1 
ATOM   3979  N NH1 . ARG A 1 522 ? 114.546 26.159  4.628   1.00 8.28  ? 522  ARG A NH1 1 
ATOM   3980  N NH2 . ARG A 1 522 ? 113.257 25.337  2.891   1.00 8.49  ? 522  ARG A NH2 1 
ATOM   3981  N N   . LEU A 1 523 ? 111.488 25.434  10.337  1.00 5.04  ? 523  LEU A N   1 
ATOM   3982  C CA  . LEU A 1 523 ? 111.282 26.183  11.540  1.00 4.86  ? 523  LEU A CA  1 
ATOM   3983  C C   . LEU A 1 523 ? 111.204 27.681  11.229  1.00 3.58  ? 523  LEU A C   1 
ATOM   3984  O O   . LEU A 1 523 ? 111.578 28.149  10.148  1.00 3.36  ? 523  LEU A O   1 
ATOM   3985  C CB  . LEU A 1 523 ? 112.391 25.910  12.554  1.00 4.87  ? 523  LEU A CB  1 
ATOM   3986  C CG  . LEU A 1 523 ? 112.599 24.483  13.012  1.00 6.53  ? 523  LEU A CG  1 
ATOM   3987  C CD1 . LEU A 1 523 ? 113.926 24.321  13.794  1.00 4.86  ? 523  LEU A CD1 1 
ATOM   3988  C CD2 . LEU A 1 523 ? 111.403 24.062  13.873  1.00 7.19  ? 523  LEU A CD2 1 
ATOM   3989  N N   . PHE A 1 524 ? 110.694 28.457  12.193  1.00 3.15  ? 524  PHE A N   1 
ATOM   3990  C CA  . PHE A 1 524 ? 110.567 29.905  11.999  1.00 4.03  ? 524  PHE A CA  1 
ATOM   3991  C C   . PHE A 1 524 ? 111.890 30.567  11.581  1.00 5.17  ? 524  PHE A C   1 
ATOM   3992  O O   . PHE A 1 524 ? 111.827 31.364  10.661  1.00 5.41  ? 524  PHE A O   1 
ATOM   3993  C CB  . PHE A 1 524 ? 110.154 30.560  13.344  1.00 4.62  ? 524  PHE A CB  1 
ATOM   3994  C CG  . PHE A 1 524 ? 108.670 30.386  13.685  1.00 2.08  ? 524  PHE A CG  1 
ATOM   3995  C CD1 . PHE A 1 524 ? 107.748 30.725  12.739  1.00 2.46  ? 524  PHE A CD1 1 
ATOM   3996  C CD2 . PHE A 1 524 ? 108.322 29.954  14.936  1.00 2.08  ? 524  PHE A CD2 1 
ATOM   3997  C CE1 . PHE A 1 524 ? 106.384 30.588  13.041  1.00 3.17  ? 524  PHE A CE1 1 
ATOM   3998  C CE2 . PHE A 1 524 ? 106.950 29.849  15.239  1.00 4.20  ? 524  PHE A CE2 1 
ATOM   3999  C CZ  . PHE A 1 524 ? 105.985 30.133  14.288  1.00 2.78  ? 524  PHE A CZ  1 
ATOM   4000  N N   . THR A 1 525 ? 113.005 30.179  12.196  1.00 6.26  ? 525  THR A N   1 
ATOM   4001  C CA  . THR A 1 525 ? 114.288 30.791  11.801  1.00 6.54  ? 525  THR A CA  1 
ATOM   4002  C C   . THR A 1 525 ? 114.915 30.238  10.542  1.00 7.09  ? 525  THR A C   1 
ATOM   4003  O O   . THR A 1 525 ? 116.001 30.691  10.142  1.00 6.72  ? 525  THR A O   1 
ATOM   4004  C CB  . THR A 1 525 ? 115.257 30.812  12.958  1.00 5.09  ? 525  THR A CB  1 
ATOM   4005  O OG1 . THR A 1 525 ? 115.396 29.563  13.666  1.00 6.78  ? 525  THR A OG1 1 
ATOM   4006  C CG2 . THR A 1 525 ? 114.753 31.830  13.994  1.00 2.93  ? 525  THR A CG2 1 
ATOM   4007  N N   . GLY A 1 526 ? 114.280 29.311  9.843   1.00 5.96  ? 526  GLY A N   1 
ATOM   4008  C CA  . GLY A 1 526 ? 114.711 28.838  8.556   1.00 5.40  ? 526  GLY A CA  1 
ATOM   4009  C C   . GLY A 1 526 ? 115.346 27.480  8.420   1.00 4.25  ? 526  GLY A C   1 
ATOM   4010  O O   . GLY A 1 526 ? 115.398 26.989  7.297   1.00 4.24  ? 526  GLY A O   1 
ATOM   4011  N N   . GLU A 1 527 ? 115.787 26.889  9.512   1.00 6.00  ? 527  GLU A N   1 
ATOM   4012  C CA  . GLU A 1 527 ? 116.412 25.567  9.439   1.00 9.92  ? 527  GLU A CA  1 
ATOM   4013  C C   . GLU A 1 527 ? 115.340 24.501  9.144   1.00 11.02 ? 527  GLU A C   1 
ATOM   4014  O O   . GLU A 1 527 ? 114.193 24.641  9.590   1.00 11.38 ? 527  GLU A O   1 
ATOM   4015  C CB  . GLU A 1 527 ? 117.049 25.260  10.798  1.00 8.01  ? 527  GLU A CB  1 
ATOM   4016  C CG  . GLU A 1 527 ? 118.202 26.206  11.134  1.00 9.45  ? 527  GLU A CG  1 
ATOM   4017  C CD  . GLU A 1 527 ? 117.756 27.435  11.896  1.00 11.48 ? 527  GLU A CD  1 
ATOM   4018  O OE1 . GLU A 1 527 ? 116.535 27.672  12.025  1.00 8.30  ? 527  GLU A OE1 1 
ATOM   4019  O OE2 . GLU A 1 527 ? 118.626 28.161  12.429  1.00 11.26 ? 527  GLU A OE2 1 
ATOM   4020  N N   . VAL A 1 528 ? 115.751 23.422  8.497   1.00 10.58 ? 528  VAL A N   1 
ATOM   4021  C CA  . VAL A 1 528 ? 114.870 22.295  8.231   1.00 7.34  ? 528  VAL A CA  1 
ATOM   4022  C C   . VAL A 1 528 ? 115.040 21.266  9.325   1.00 8.42  ? 528  VAL A C   1 
ATOM   4023  O O   . VAL A 1 528 ? 116.172 20.826  9.613   1.00 8.98  ? 528  VAL A O   1 
ATOM   4024  C CB  . VAL A 1 528 ? 115.120 21.657  6.866   1.00 7.72  ? 528  VAL A CB  1 
ATOM   4025  C CG1 . VAL A 1 528 ? 114.297 20.387  6.659   1.00 5.70  ? 528  VAL A CG1 1 
ATOM   4026  C CG2 . VAL A 1 528 ? 114.786 22.657  5.768   1.00 5.12  ? 528  VAL A CG2 1 
ATOM   4027  N N   . ILE A 1 529 ? 113.924 20.962  10.018  1.00 6.55  ? 529  ILE A N   1 
ATOM   4028  C CA  . ILE A 1 529 ? 114.021 19.906  11.038  1.00 4.55  ? 529  ILE A CA  1 
ATOM   4029  C C   . ILE A 1 529 ? 113.446 18.616  10.459  1.00 6.33  ? 529  ILE A C   1 
ATOM   4030  O O   . ILE A 1 529 ? 112.508 18.609  9.639   1.00 6.43  ? 529  ILE A O   1 
ATOM   4031  C CB  . ILE A 1 529 ? 113.315 20.329  12.315  1.00 5.95  ? 529  ILE A CB  1 
ATOM   4032  C CG1 . ILE A 1 529 ? 113.594 19.351  13.453  1.00 3.23  ? 529  ILE A CG1 1 
ATOM   4033  C CG2 . ILE A 1 529 ? 111.799 20.512  12.068  1.00 6.23  ? 529  ILE A CG2 1 
ATOM   4034  C CD1 . ILE A 1 529 ? 113.109 19.819  14.801  1.00 3.71  ? 529  ILE A CD1 1 
ATOM   4035  N N   . LYS A 1 530 ? 113.974 17.455  10.860  1.00 7.56  ? 530  LYS A N   1 
ATOM   4036  C CA  . LYS A 1 530 ? 113.453 16.175  10.387  1.00 6.25  ? 530  LYS A CA  1 
ATOM   4037  C C   . LYS A 1 530 ? 113.383 15.295  11.611  1.00 7.53  ? 530  LYS A C   1 
ATOM   4038  O O   . LYS A 1 530 ? 114.361 15.276  12.374  1.00 7.29  ? 530  LYS A O   1 
ATOM   4039  C CB  . LYS A 1 530 ? 114.221 15.545  9.241   1.00 9.45  ? 530  LYS A CB  1 
ATOM   4040  C CG  . LYS A 1 530 ? 113.410 14.425  8.584   1.00 9.05  ? 530  LYS A CG  1 
ATOM   4041  C CD  . LYS A 1 530 ? 114.015 14.054  7.228   1.00 9.50  ? 530  LYS A CD  1 
ATOM   4042  C CE  . LYS A 1 530 ? 113.467 12.668  6.842   1.00 8.49  ? 530  LYS A CE  1 
ATOM   4043  N NZ  . LYS A 1 530 ? 113.831 12.270  5.442   1.00 6.69  ? 530  LYS A NZ  1 
ATOM   4044  N N   . LEU A 1 531 ? 112.194 14.713  11.845  1.00 4.92  ? 531  LEU A N   1 
ATOM   4045  C CA  . LEU A 1 531 ? 112.023 13.912  13.061  1.00 5.30  ? 531  LEU A CA  1 
ATOM   4046  C C   . LEU A 1 531 ? 111.950 12.423  12.670  1.00 6.98  ? 531  LEU A C   1 
ATOM   4047  O O   . LEU A 1 531 ? 111.231 12.143  11.694  1.00 6.17  ? 531  LEU A O   1 
ATOM   4048  C CB  . LEU A 1 531 ? 110.719 14.320  13.768  1.00 5.20  ? 531  LEU A CB  1 
ATOM   4049  C CG  . LEU A 1 531 ? 110.596 15.813  14.142  1.00 7.37  ? 531  LEU A CG  1 
ATOM   4050  C CD1 . LEU A 1 531 ? 109.308 16.093  14.939  1.00 5.98  ? 531  LEU A CD1 1 
ATOM   4051  C CD2 . LEU A 1 531 ? 111.804 16.309  14.941  1.00 5.76  ? 531  LEU A CD2 1 
ATOM   4052  N N   . PHE A 1 532 ? 112.599 11.550  13.446  1.00 6.57  ? 532  PHE A N   1 
ATOM   4053  C CA  . PHE A 1 532 ? 112.585 10.133  13.093  1.00 7.55  ? 532  PHE A CA  1 
ATOM   4054  C C   . PHE A 1 532 ? 111.942 9.307   14.205  1.00 7.17  ? 532  PHE A C   1 
ATOM   4055  O O   . PHE A 1 532 ? 112.016 9.620   15.401  1.00 4.96  ? 532  PHE A O   1 
ATOM   4056  C CB  . PHE A 1 532 ? 114.009 9.630   12.776  1.00 7.25  ? 532  PHE A CB  1 
ATOM   4057  C CG  . PHE A 1 532 ? 114.654 10.253  11.563  1.00 6.98  ? 532  PHE A CG  1 
ATOM   4058  C CD1 . PHE A 1 532 ? 115.391 11.420  11.675  1.00 9.60  ? 532  PHE A CD1 1 
ATOM   4059  C CD2 . PHE A 1 532 ? 114.572 9.686   10.326  1.00 7.67  ? 532  PHE A CD2 1 
ATOM   4060  C CE1 . PHE A 1 532 ? 115.963 12.016  10.564  1.00 8.97  ? 532  PHE A CE1 1 
ATOM   4061  C CE2 . PHE A 1 532 ? 115.155 10.242  9.197   1.00 7.73  ? 532  PHE A CE2 1 
ATOM   4062  C CZ  . PHE A 1 532 ? 115.852 11.427  9.315   1.00 8.14  ? 532  PHE A CZ  1 
ATOM   4063  N N   . GLN A 1 533 ? 111.366 8.147   13.816  1.00 6.98  ? 533  GLN A N   1 
ATOM   4064  C CA  . GLN A 1 533 ? 110.700 7.270   14.788  1.00 6.15  ? 533  GLN A CA  1 
ATOM   4065  C C   . GLN A 1 533 ? 111.600 6.656   15.814  1.00 7.31  ? 533  GLN A C   1 
ATOM   4066  O O   . GLN A 1 533 ? 111.111 6.298   16.913  1.00 6.32  ? 533  GLN A O   1 
ATOM   4067  C CB  . GLN A 1 533 ? 109.867 6.167   14.079  1.00 7.49  ? 533  GLN A CB  1 
ATOM   4068  C CG  . GLN A 1 533 ? 108.611 6.732   13.439  1.00 8.27  ? 533  GLN A CG  1 
ATOM   4069  C CD  . GLN A 1 533 ? 107.701 5.708   12.767  1.00 10.29 ? 533  GLN A CD  1 
ATOM   4070  O OE1 . GLN A 1 533 ? 108.116 5.005   11.853  1.00 9.98  ? 533  GLN A OE1 1 
ATOM   4071  N NE2 . GLN A 1 533 ? 106.430 5.636   13.179  1.00 8.08  ? 533  GLN A NE2 1 
ATOM   4072  N N   . ASP A 1 534 ? 112.928 6.552   15.593  1.00 7.88  ? 534  ASP A N   1 
ATOM   4073  C CA  . ASP A 1 534 ? 113.782 6.025   16.666  1.00 9.35  ? 534  ASP A CA  1 
ATOM   4074  C C   . ASP A 1 534 ? 114.152 7.111   17.674  1.00 8.51  ? 534  ASP A C   1 
ATOM   4075  O O   . ASP A 1 534 ? 114.936 6.815   18.586  1.00 6.79  ? 534  ASP A O   1 
ATOM   4076  C CB  . ASP A 1 534 ? 115.107 5.415   16.172  1.00 11.23 ? 534  ASP A CB  1 
ATOM   4077  C CG  . ASP A 1 534 ? 115.880 6.356   15.291  1.00 14.05 ? 534  ASP A CG  1 
ATOM   4078  O OD1 . ASP A 1 534 ? 115.665 7.595   15.234  1.00 14.14 ? 534  ASP A OD1 1 
ATOM   4079  O OD2 . ASP A 1 534 ? 116.796 5.896   14.581  1.00 16.72 ? 534  ASP A OD2 1 
ATOM   4080  N N   . GLY A 1 535 ? 113.685 8.353   17.530  1.00 8.07  ? 535  GLY A N   1 
ATOM   4081  C CA  . GLY A 1 535 ? 114.037 9.307   18.608  1.00 9.26  ? 535  GLY A CA  1 
ATOM   4082  C C   . GLY A 1 535 ? 115.135 10.272  18.143  1.00 10.76 ? 535  GLY A C   1 
ATOM   4083  O O   . GLY A 1 535 ? 115.380 11.218  18.896  1.00 11.55 ? 535  GLY A O   1 
ATOM   4084  N N   . THR A 1 536 ? 115.675 10.050  16.954  1.00 10.53 ? 536  THR A N   1 
ATOM   4085  C CA  . THR A 1 536 ? 116.711 10.938  16.457  1.00 10.87 ? 536  THR A CA  1 
ATOM   4086  C C   . THR A 1 536 ? 116.099 12.070  15.647  1.00 9.33  ? 536  THR A C   1 
ATOM   4087  O O   . THR A 1 536 ? 114.951 11.975  15.203  1.00 7.03  ? 536  THR A O   1 
ATOM   4088  C CB  . THR A 1 536 ? 117.791 10.216  15.625  1.00 10.91 ? 536  THR A CB  1 
ATOM   4089  O OG1 . THR A 1 536 ? 117.242 9.730   14.410  1.00 11.70 ? 536  THR A OG1 1 
ATOM   4090  C CG2 . THR A 1 536 ? 118.407 9.069   16.435  1.00 12.16 ? 536  THR A CG2 1 
ATOM   4091  N N   . PHE A 1 537 ? 116.888 13.142  15.511  1.00 8.18  ? 537  PHE A N   1 
ATOM   4092  C CA  . PHE A 1 537 ? 116.394 14.276  14.729  1.00 8.78  ? 537  PHE A CA  1 
ATOM   4093  C C   . PHE A 1 537 ? 117.544 15.073  14.149  1.00 9.27  ? 537  PHE A C   1 
ATOM   4094  O O   . PHE A 1 537 ? 118.624 15.093  14.752  1.00 9.35  ? 537  PHE A O   1 
ATOM   4095  C CB  . PHE A 1 537 ? 115.533 15.202  15.596  1.00 9.19  ? 537  PHE A CB  1 
ATOM   4096  C CG  . PHE A 1 537 ? 116.132 15.704  16.870  1.00 7.78  ? 537  PHE A CG  1 
ATOM   4097  C CD1 . PHE A 1 537 ? 116.314 14.899  17.960  1.00 7.13  ? 537  PHE A CD1 1 
ATOM   4098  C CD2 . PHE A 1 537 ? 116.538 17.041  16.952  1.00 7.86  ? 537  PHE A CD2 1 
ATOM   4099  C CE1 . PHE A 1 537 ? 116.893 15.367  19.127  1.00 7.60  ? 537  PHE A CE1 1 
ATOM   4100  C CE2 . PHE A 1 537 ? 117.092 17.526  18.116  1.00 5.50  ? 537  PHE A CE2 1 
ATOM   4101  C CZ  . PHE A 1 537 ? 117.270 16.707  19.199  1.00 6.44  ? 537  PHE A CZ  1 
ATOM   4102  N N   . THR A 1 538 ? 117.284 15.724  13.016  1.00 9.00  ? 538  THR A N   1 
ATOM   4103  C CA  . THR A 1 538 ? 118.331 16.517  12.408  1.00 9.31  ? 538  THR A CA  1 
ATOM   4104  C C   . THR A 1 538 ? 117.904 17.978  12.272  1.00 10.46 ? 538  THR A C   1 
ATOM   4105  O O   . THR A 1 538 ? 116.709 18.307  12.187  1.00 7.71  ? 538  THR A O   1 
ATOM   4106  C CB  . THR A 1 538 ? 118.724 15.962  11.019  1.00 9.19  ? 538  THR A CB  1 
ATOM   4107  O OG1 . THR A 1 538 ? 117.602 15.890  10.148  1.00 9.07  ? 538  THR A OG1 1 
ATOM   4108  C CG2 . THR A 1 538 ? 119.393 14.584  11.103  1.00 8.50  ? 538  THR A CG2 1 
ATOM   4109  N N   . ILE A 1 539 ? 118.921 18.849  12.182  1.00 9.64  ? 539  ILE A N   1 
ATOM   4110  C CA  . ILE A 1 539 ? 118.697 20.255  11.862  1.00 8.56  ? 539  ILE A CA  1 
ATOM   4111  C C   . ILE A 1 539 ? 119.518 20.498  10.599  1.00 11.38 ? 539  ILE A C   1 
ATOM   4112  O O   . ILE A 1 539 ? 120.750 20.348  10.574  1.00 13.45 ? 539  ILE A O   1 
ATOM   4113  C CB  . ILE A 1 539 ? 119.021 21.230  12.997  1.00 7.30  ? 539  ILE A CB  1 
ATOM   4114  C CG1 . ILE A 1 539 ? 118.013 21.114  14.118  1.00 6.50  ? 539  ILE A CG1 1 
ATOM   4115  C CG2 . ILE A 1 539 ? 119.063 22.666  12.457  1.00 6.38  ? 539  ILE A CG2 1 
ATOM   4116  C CD1 . ILE A 1 539 ? 116.594 21.539  13.713  1.00 6.51  ? 539  ILE A CD1 1 
ATOM   4117  N N   . ASP A 1 540 ? 118.893 20.740  9.473   1.00 11.19 ? 540  ASP A N   1 
ATOM   4118  C CA  . ASP A 1 540 ? 119.524 20.929  8.195   1.00 12.78 ? 540  ASP A CA  1 
ATOM   4119  C C   . ASP A 1 540 ? 120.448 19.733  7.887   1.00 14.53 ? 540  ASP A C   1 
ATOM   4120  O O   . ASP A 1 540 ? 121.514 19.952  7.304   1.00 11.76 ? 540  ASP A O   1 
ATOM   4121  C CB  . ASP A 1 540 ? 120.312 22.232  8.130   1.00 12.56 ? 540  ASP A CB  1 
ATOM   4122  C CG  . ASP A 1 540 ? 119.420 23.466  8.069   1.00 12.47 ? 540  ASP A CG  1 
ATOM   4123  O OD1 . ASP A 1 540 ? 118.406 23.463  7.348   1.00 10.84 ? 540  ASP A OD1 1 
ATOM   4124  O OD2 . ASP A 1 540 ? 119.794 24.455  8.733   1.00 11.02 ? 540  ASP A OD2 1 
ATOM   4125  N N   . GLY A 1 541 ? 119.989 18.497  8.150   1.00 14.26 ? 541  GLY A N   1 
ATOM   4126  C CA  . GLY A 1 541 ? 120.825 17.345  7.794   1.00 15.83 ? 541  GLY A CA  1 
ATOM   4127  C C   . GLY A 1 541 ? 121.832 16.914  8.842   1.00 16.75 ? 541  GLY A C   1 
ATOM   4128  O O   . GLY A 1 541 ? 122.229 15.743  8.837   1.00 17.90 ? 541  GLY A O   1 
ATOM   4129  N N   . PHE A 1 542 ? 122.145 17.746  9.823   1.00 16.16 ? 542  PHE A N   1 
ATOM   4130  C CA  . PHE A 1 542 ? 123.066 17.471  10.904  1.00 16.29 ? 542  PHE A CA  1 
ATOM   4131  C C   . PHE A 1 542 ? 122.392 16.703  12.013  1.00 16.12 ? 542  PHE A C   1 
ATOM   4132  O O   . PHE A 1 542 ? 121.447 17.226  12.610  1.00 15.08 ? 542  PHE A O   1 
ATOM   4133  C CB  . PHE A 1 542 ? 123.639 18.801  11.448  1.00 16.36 ? 542  PHE A CB  1 
ATOM   4134  C CG  . PHE A 1 542 ? 124.557 18.611  12.621  1.00 17.31 ? 542  PHE A CG  1 
ATOM   4135  C CD1 . PHE A 1 542 ? 125.887 18.232  12.412  1.00 18.34 ? 542  PHE A CD1 1 
ATOM   4136  C CD2 . PHE A 1 542 ? 124.111 18.780  13.910  1.00 17.24 ? 542  PHE A CD2 1 
ATOM   4137  C CE1 . PHE A 1 542 ? 126.725 18.035  13.502  1.00 18.52 ? 542  PHE A CE1 1 
ATOM   4138  C CE2 . PHE A 1 542 ? 124.933 18.582  14.998  1.00 18.42 ? 542  PHE A CE2 1 
ATOM   4139  C CZ  . PHE A 1 542 ? 126.255 18.214  14.785  1.00 18.67 ? 542  PHE A CZ  1 
ATOM   4140  N N   . LYS A 1 543 ? 122.863 15.510  12.348  1.00 15.68 ? 543  LYS A N   1 
ATOM   4141  C CA  . LYS A 1 543 ? 122.216 14.745  13.419  1.00 16.79 ? 543  LYS A CA  1 
ATOM   4142  C C   . LYS A 1 543 ? 122.436 15.424  14.754  1.00 15.76 ? 543  LYS A C   1 
ATOM   4143  O O   . LYS A 1 543 ? 123.603 15.668  15.094  1.00 15.47 ? 543  LYS A O   1 
ATOM   4144  C CB  . LYS A 1 543 ? 122.716 13.297  13.436  1.00 18.84 ? 543  LYS A CB  1 
ATOM   4145  C CG  . LYS A 1 543 ? 121.974 12.481  14.508  1.00 23.05 ? 543  LYS A CG  1 
ATOM   4146  C CD  . LYS A 1 543 ? 122.591 11.073  14.595  1.00 24.77 ? 543  LYS A CD  1 
ATOM   4147  C CE  . LYS A 1 543 ? 122.093 10.334  15.827  1.00 26.91 ? 543  LYS A CE  1 
ATOM   4148  N NZ  . LYS A 1 543 ? 122.456 8.873   15.750  1.00 28.87 ? 543  LYS A NZ  1 
ATOM   4149  N N   . CYS A 1 544 ? 121.382 15.735  15.518  1.00 12.40 ? 544  CYS A N   1 
ATOM   4150  C CA  . CYS A 1 544 ? 121.571 16.420  16.789  1.00 10.86 ? 544  CYS A CA  1 
ATOM   4151  C C   . CYS A 1 544 ? 122.007 15.511  17.913  1.00 12.46 ? 544  CYS A C   1 
ATOM   4152  O O   . CYS A 1 544 ? 121.522 14.387  17.984  1.00 11.93 ? 544  CYS A O   1 
ATOM   4153  C CB  . CYS A 1 544 ? 120.247 17.088  17.252  1.00 9.96  ? 544  CYS A CB  1 
ATOM   4154  S SG  . CYS A 1 544 ? 119.580 18.147  15.952  1.00 8.43  ? 544  CYS A SG  1 
ATOM   4155  N N   . PRO A 1 545 ? 122.730 16.067  18.885  1.00 13.52 ? 545  PRO A N   1 
ATOM   4156  C CA  . PRO A 1 545 ? 123.236 15.320  19.993  1.00 13.89 ? 545  PRO A CA  1 
ATOM   4157  C C   . PRO A 1 545 ? 122.274 15.033  21.109  1.00 14.61 ? 545  PRO A C   1 
ATOM   4158  O O   . PRO A 1 545 ? 122.578 14.047  21.788  1.00 16.52 ? 545  PRO A O   1 
ATOM   4159  C CB  . PRO A 1 545 ? 124.407 16.172  20.531  1.00 14.21 ? 545  PRO A CB  1 
ATOM   4160  C CG  . PRO A 1 545 ? 123.993 17.570  20.176  1.00 14.51 ? 545  PRO A CG  1 
ATOM   4161  C CD  . PRO A 1 545 ? 123.343 17.429  18.820  1.00 13.97 ? 545  PRO A CD  1 
ATOM   4162  N N   . GLY A 1 546 ? 121.220 15.807  21.372  1.00 13.02 ? 546  GLY A N   1 
ATOM   4163  C CA  . GLY A 1 546 ? 120.446 15.411  22.561  1.00 12.66 ? 546  GLY A CA  1 
ATOM   4164  C C   . GLY A 1 546 ? 119.499 14.243  22.265  1.00 10.90 ? 546  GLY A C   1 
ATOM   4165  O O   . GLY A 1 546 ? 119.165 13.898  21.127  1.00 10.44 ? 546  GLY A O   1 
ATOM   4166  N N   . LEU A 1 547 ? 118.973 13.691  23.336  1.00 10.26 ? 547  LEU A N   1 
ATOM   4167  C CA  . LEU A 1 547 ? 117.925 12.676  23.264  1.00 11.59 ? 547  LEU A CA  1 
ATOM   4168  C C   . LEU A 1 547 ? 116.641 13.328  22.722  1.00 10.35 ? 547  LEU A C   1 
ATOM   4169  O O   . LEU A 1 547 ? 115.994 12.741  21.871  1.00 8.35  ? 547  LEU A O   1 
ATOM   4170  C CB  . LEU A 1 547 ? 117.742 12.190  24.691  1.00 12.95 ? 547  LEU A CB  1 
ATOM   4171  C CG  . LEU A 1 547 ? 117.166 10.809  24.910  1.00 16.31 ? 547  LEU A CG  1 
ATOM   4172  C CD1 . LEU A 1 547 ? 118.000 9.716   24.231  1.00 16.82 ? 547  LEU A CD1 1 
ATOM   4173  C CD2 . LEU A 1 547 ? 117.112 10.550  26.421  1.00 17.33 ? 547  LEU A CD2 1 
ATOM   4174  N N   . VAL A 1 548 ? 116.282 14.548  23.152  1.00 7.65  ? 548  VAL A N   1 
ATOM   4175  C CA  . VAL A 1 548 ? 115.070 15.216  22.673  1.00 8.38  ? 548  VAL A CA  1 
ATOM   4176  C C   . VAL A 1 548 ? 115.282 16.659  22.221  1.00 8.71  ? 548  VAL A C   1 
ATOM   4177  O O   . VAL A 1 548 ? 116.251 17.267  22.695  1.00 9.71  ? 548  VAL A O   1 
ATOM   4178  C CB  . VAL A 1 548 ? 113.986 15.285  23.768  1.00 8.06  ? 548  VAL A CB  1 
ATOM   4179  C CG1 . VAL A 1 548 ? 113.579 13.904  24.306  1.00 7.33  ? 548  VAL A CG1 1 
ATOM   4180  C CG2 . VAL A 1 548 ? 114.433 16.225  24.887  1.00 6.93  ? 548  VAL A CG2 1 
ATOM   4181  N N   . TYR A 1 549 ? 114.440 17.214  21.348  1.00 6.64  ? 549  TYR A N   1 
ATOM   4182  C CA  . TYR A 1 549 ? 114.597 18.558  20.828  1.00 5.42  ? 549  TYR A CA  1 
ATOM   4183  C C   . TYR A 1 549 ? 114.479 19.618  21.902  1.00 5.15  ? 549  TYR A C   1 
ATOM   4184  O O   . TYR A 1 549 ? 113.625 19.610  22.790  1.00 3.14  ? 549  TYR A O   1 
ATOM   4185  C CB  . TYR A 1 549 ? 113.623 18.881  19.709  1.00 4.36  ? 549  TYR A CB  1 
ATOM   4186  C CG  . TYR A 1 549 ? 113.696 20.237  19.078  1.00 6.01  ? 549  TYR A CG  1 
ATOM   4187  C CD1 . TYR A 1 549 ? 114.738 20.530  18.207  1.00 4.29  ? 549  TYR A CD1 1 
ATOM   4188  C CD2 . TYR A 1 549 ? 112.755 21.243  19.361  1.00 4.03  ? 549  TYR A CD2 1 
ATOM   4189  C CE1 . TYR A 1 549 ? 114.849 21.776  17.601  1.00 5.54  ? 549  TYR A CE1 1 
ATOM   4190  C CE2 . TYR A 1 549 ? 112.860 22.487  18.735  1.00 3.45  ? 549  TYR A CE2 1 
ATOM   4191  C CZ  . TYR A 1 549 ? 113.886 22.753  17.857  1.00 4.30  ? 549  TYR A CZ  1 
ATOM   4192  O OH  . TYR A 1 549 ? 114.044 23.955  17.221  1.00 3.78  ? 549  TYR A OH  1 
ATOM   4193  N N   . THR A 1 550 ? 115.507 20.516  21.917  1.00 5.59  ? 550  THR A N   1 
ATOM   4194  C CA  . THR A 1 550 ? 115.502 21.572  22.937  1.00 5.45  ? 550  THR A CA  1 
ATOM   4195  C C   . THR A 1 550 ? 115.842 22.899  22.265  1.00 4.15  ? 550  THR A C   1 
ATOM   4196  O O   . THR A 1 550 ? 116.297 23.807  22.966  1.00 4.53  ? 550  THR A O   1 
ATOM   4197  C CB  . THR A 1 550 ? 116.478 21.345  24.107  1.00 5.25  ? 550  THR A CB  1 
ATOM   4198  O OG1 . THR A 1 550 ? 117.809 21.325  23.548  1.00 3.34  ? 550  THR A OG1 1 
ATOM   4199  C CG2 . THR A 1 550 ? 116.247 20.051  24.853  1.00 5.41  ? 550  THR A CG2 1 
ATOM   4200  N N   . GLY A 1 551 ? 115.712 23.005  20.954  1.00 4.09  ? 551  GLY A N   1 
ATOM   4201  C CA  . GLY A 1 551 ? 115.964 24.269  20.265  1.00 5.13  ? 551  GLY A CA  1 
ATOM   4202  C C   . GLY A 1 551 ? 117.151 24.166  19.317  1.00 6.50  ? 551  GLY A C   1 
ATOM   4203  O O   . GLY A 1 551 ? 118.033 23.325  19.617  1.00 6.58  ? 551  GLY A O   1 
ATOM   4204  N N   . VAL A 1 552 ? 117.155 24.946  18.255  1.00 7.88  ? 552  VAL A N   1 
ATOM   4205  C CA  . VAL A 1 552 ? 118.213 24.862  17.260  1.00 12.54 ? 552  VAL A CA  1 
ATOM   4206  C C   . VAL A 1 552 ? 119.613 25.129  17.816  1.00 15.77 ? 552  VAL A C   1 
ATOM   4207  O O   . VAL A 1 552 ? 120.574 24.437  17.441  1.00 15.85 ? 552  VAL A O   1 
ATOM   4208  C CB  . VAL A 1 552 ? 118.014 25.810  16.078  1.00 13.39 ? 552  VAL A CB  1 
ATOM   4209  C CG1 . VAL A 1 552 ? 116.715 25.532  15.347  1.00 12.80 ? 552  VAL A CG1 1 
ATOM   4210  C CG2 . VAL A 1 552 ? 117.997 27.263  16.548  1.00 14.72 ? 552  VAL A CG2 1 
ATOM   4211  N N   . GLU A 1 553 ? 119.729 26.036  18.768  1.00 17.79 ? 553  GLU A N   1 
ATOM   4212  C CA  . GLU A 1 553 ? 120.982 26.417  19.395  1.00 21.61 ? 553  GLU A CA  1 
ATOM   4213  C C   . GLU A 1 553 ? 121.678 25.226  20.042  1.00 20.42 ? 553  GLU A C   1 
ATOM   4214  O O   . GLU A 1 553 ? 122.907 25.193  20.086  1.00 19.03 ? 553  GLU A O   1 
ATOM   4215  C CB  . GLU A 1 553 ? 120.729 27.517  20.431  1.00 26.63 ? 553  GLU A CB  1 
ATOM   4216  C CG  . GLU A 1 553 ? 121.842 28.531  20.530  1.00 36.43 ? 553  GLU A CG  1 
ATOM   4217  C CD  . GLU A 1 553 ? 121.821 29.480  21.718  1.00 41.30 ? 553  GLU A CD  1 
ATOM   4218  O OE1 . GLU A 1 553 ? 120.872 29.406  22.550  1.00 44.13 ? 553  GLU A OE1 1 
ATOM   4219  O OE2 . GLU A 1 553 ? 122.767 30.319  21.823  1.00 43.57 ? 553  GLU A OE2 1 
ATOM   4220  N N   . ASN A 1 554 ? 120.924 24.235  20.522  1.00 17.76 ? 554  ASN A N   1 
ATOM   4221  C CA  . ASN A 1 554 ? 121.495 23.057  21.134  1.00 17.08 ? 554  ASN A CA  1 
ATOM   4222  C C   . ASN A 1 554 ? 121.794 21.970  20.122  1.00 16.05 ? 554  ASN A C   1 
ATOM   4223  O O   . ASN A 1 554 ? 122.364 20.959  20.525  1.00 16.64 ? 554  ASN A O   1 
ATOM   4224  C CB  . ASN A 1 554 ? 120.609 22.560  22.270  1.00 16.87 ? 554  ASN A CB  1 
ATOM   4225  C CG  . ASN A 1 554 ? 120.428 23.673  23.290  1.00 19.71 ? 554  ASN A CG  1 
ATOM   4226  O OD1 . ASN A 1 554 ? 121.404 24.285  23.729  1.00 19.00 ? 554  ASN A OD1 1 
ATOM   4227  N ND2 . ASN A 1 554 ? 119.201 23.979  23.709  1.00 19.92 ? 554  ASN A ND2 1 
ATOM   4228  N N   . CYS A 1 555 ? 121.501 22.146  18.845  1.00 14.73 ? 555  CYS A N   1 
ATOM   4229  C CA  . CYS A 1 555 ? 121.765 21.102  17.863  1.00 14.92 ? 555  CYS A CA  1 
ATOM   4230  C C   . CYS A 1 555 ? 123.062 21.430  17.100  1.00 16.45 ? 555  CYS A C   1 
ATOM   4231  O O   . CYS A 1 555 ? 123.071 21.849  15.947  1.00 15.65 ? 555  CYS A O   1 
ATOM   4232  C CB  . CYS A 1 555 ? 120.636 20.849  16.883  1.00 11.22 ? 555  CYS A CB  1 
ATOM   4233  S SG  . CYS A 1 555 ? 121.030 19.555  15.657  1.00 8.73  ? 555  CYS A SG  1 
ATOM   4234  N N   . VAL A 1 556 ? 124.146 21.217  17.836  1.00 19.27 ? 556  VAL A N   1 
ATOM   4235  C CA  . VAL A 1 556 ? 125.460 21.538  17.285  1.00 22.27 ? 556  VAL A CA  1 
ATOM   4236  C C   . VAL A 1 556 ? 126.523 20.599  17.832  1.00 23.41 ? 556  VAL A C   1 
ATOM   4237  O O   . VAL A 1 556 ? 126.128 19.735  18.653  1.00 22.30 ? 556  VAL A O   1 
ATOM   4238  C CB  . VAL A 1 556 ? 125.703 23.016  17.665  1.00 23.37 ? 556  VAL A CB  1 
ATOM   4239  C CG1 . VAL A 1 556 ? 126.008 23.146  19.145  1.00 22.32 ? 556  VAL A CG1 1 
ATOM   4240  C CG2 . VAL A 1 556 ? 126.780 23.561  16.753  1.00 25.90 ? 556  VAL A CG2 1 
ATOM   4241  O OXT . VAL A 1 556 ? 127.600 20.488  17.183  1.00 24.95 ? 556  VAL A OXT 1 
HETATM 4242  N N   . PCA B 1 1   ? 123.255 29.680  32.490  1.00 7.19  ? 1    PCA B N   1 
HETATM 4243  C CA  . PCA B 1 1   ? 123.528 29.302  33.882  1.00 6.55  ? 1    PCA B CA  1 
HETATM 4244  C CB  . PCA B 1 1   ? 122.700 30.211  34.764  1.00 5.94  ? 1    PCA B CB  1 
HETATM 4245  C CG  . PCA B 1 1   ? 122.436 31.417  33.832  1.00 7.99  ? 1    PCA B CG  1 
HETATM 4246  C CD  . PCA B 1 1   ? 122.407 30.745  32.456  1.00 8.61  ? 1    PCA B CD  1 
HETATM 4247  O OE  . PCA B 1 1   ? 122.022 31.293  31.387  1.00 10.45 ? 1    PCA B OE  1 
HETATM 4248  C C   . PCA B 1 1   ? 123.270 27.831  34.215  1.00 7.86  ? 1    PCA B C   1 
HETATM 4249  O O   . PCA B 1 1   ? 122.049 27.503  34.071  1.00 7.82  ? 1    PCA B O   1 
ATOM   4250  N N   . THR B 1 2   ? 124.051 27.122  35.027  1.00 5.97  ? 2    THR B N   1 
ATOM   4251  C CA  . THR B 1 2   ? 123.552 25.913  35.574  1.00 5.30  ? 2    THR B CA  1 
ATOM   4252  C C   . THR B 1 2   ? 122.979 26.248  36.940  1.00 5.24  ? 2    THR B C   1 
ATOM   4253  O O   . THR B 1 2   ? 123.174 27.337  37.504  1.00 4.46  ? 2    THR B O   1 
ATOM   4254  C CB  . THR B 1 2   ? 124.928 25.277  35.553  1.00 5.59  ? 2    THR B CB  1 
ATOM   4255  O OG1 . THR B 1 2   ? 125.876 25.886  36.434  1.00 6.82  ? 2    THR B OG1 1 
ATOM   4256  C CG2 . THR B 1 2   ? 125.638 24.951  34.255  1.00 6.93  ? 2    THR B CG2 1 
ATOM   4257  N N   . CYS B 1 3   ? 122.376 25.188  37.488  1.00 3.84  ? 3    CYS B N   1 
ATOM   4258  C CA  . CYS B 1 3   ? 121.786 25.299  38.799  1.00 4.37  ? 3    CYS B CA  1 
ATOM   4259  C C   . CYS B 1 3   ? 121.516 23.909  39.358  1.00 3.14  ? 3    CYS B C   1 
ATOM   4260  O O   . CYS B 1 3   ? 121.631 22.957  38.582  1.00 7.01  ? 3    CYS B O   1 
ATOM   4261  C CB  . CYS B 1 3   ? 120.432 26.051  38.651  1.00 4.29  ? 3    CYS B CB  1 
ATOM   4262  S SG  . CYS B 1 3   ? 119.209 25.077  37.689  1.00 4.65  ? 3    CYS B SG  1 
ATOM   4263  N N   . SER B 1 4   ? 121.113 23.773  40.592  1.00 3.94  ? 4    SER B N   1 
ATOM   4264  C CA  . SER B 1 4   ? 120.761 22.489  41.147  1.00 6.58  ? 4    SER B CA  1 
ATOM   4265  C C   . SER B 1 4   ? 119.469 22.617  41.967  1.00 7.33  ? 4    SER B C   1 
ATOM   4266  O O   . SER B 1 4   ? 118.467 22.103  41.482  1.00 6.51  ? 4    SER B O   1 
ATOM   4267  C CB  . SER B 1 4   ? 121.812 21.866  42.094  1.00 6.94  ? 4    SER B CB  1 
ATOM   4268  O OG  . SER B 1 4   ? 122.906 21.463  41.302  1.00 10.92 ? 4    SER B OG  1 
ATOM   4269  N N   . THR B 1 5   ? 119.553 23.137  43.183  1.00 6.67  ? 5    THR B N   1 
ATOM   4270  C CA  . THR B 1 5   ? 118.386 23.208  44.041  1.00 10.34 ? 5    THR B CA  1 
ATOM   4271  C C   . THR B 1 5   ? 117.639 24.539  44.013  1.00 8.98  ? 5    THR B C   1 
ATOM   4272  O O   . THR B 1 5   ? 116.542 24.628  44.598  1.00 8.91  ? 5    THR B O   1 
ATOM   4273  C CB  . THR B 1 5   ? 118.800 22.791  45.463  1.00 12.91 ? 5    THR B CB  1 
ATOM   4274  O OG1 . THR B 1 5   ? 119.639 21.579  45.310  1.00 18.12 ? 5    THR B OG1 1 
ATOM   4275  C CG2 . THR B 1 5   ? 117.637 22.294  46.292  1.00 14.34 ? 5    THR B CG2 1 
ATOM   4276  N N   . SER B 1 6   ? 118.107 25.537  43.292  1.00 5.70  ? 6    SER B N   1 
ATOM   4277  C CA  . SER B 1 6   ? 117.401 26.823  43.306  1.00 7.10  ? 6    SER B CA  1 
ATOM   4278  C C   . SER B 1 6   ? 117.592 27.581  42.021  1.00 6.82  ? 6    SER B C   1 
ATOM   4279  O O   . SER B 1 6   ? 118.679 27.618  41.429  1.00 7.18  ? 6    SER B O   1 
ATOM   4280  C CB  . SER B 1 6   ? 117.897 27.540  44.543  1.00 8.19  ? 6    SER B CB  1 
ATOM   4281  O OG  . SER B 1 6   ? 117.709 28.905  44.597  1.00 12.11 ? 6    SER B OG  1 
ATOM   4282  N N   . ASP B 1 7   ? 116.492 28.155  41.497  1.00 3.93  ? 7    ASP B N   1 
ATOM   4283  C CA  . ASP B 1 7   ? 116.633 28.983  40.291  1.00 3.80  ? 7    ASP B CA  1 
ATOM   4284  C C   . ASP B 1 7   ? 115.651 30.145  40.384  1.00 3.87  ? 7    ASP B C   1 
ATOM   4285  O O   . ASP B 1 7   ? 115.186 30.335  41.544  1.00 3.96  ? 7    ASP B O   1 
ATOM   4286  C CB  . ASP B 1 7   ? 116.431 28.156  39.051  1.00 4.51  ? 7    ASP B CB  1 
ATOM   4287  C CG  . ASP B 1 7   ? 115.004 27.660  38.858  1.00 3.25  ? 7    ASP B CG  1 
ATOM   4288  O OD1 . ASP B 1 7   ? 114.127 27.869  39.711  1.00 5.21  ? 7    ASP B OD1 1 
ATOM   4289  O OD2 . ASP B 1 7   ? 114.799 27.009  37.835  1.00 5.69  ? 7    ASP B OD2 1 
ATOM   4290  N N   . ASP B 1 8   ? 115.355 30.921  39.367  1.00 4.79  ? 8    ASP B N   1 
ATOM   4291  C CA  . ASP B 1 8   ? 114.452 32.054  39.548  1.00 5.52  ? 8    ASP B CA  1 
ATOM   4292  C C   . ASP B 1 8   ? 112.973 31.683  39.466  1.00 8.62  ? 8    ASP B C   1 
ATOM   4293  O O   . ASP B 1 8   ? 112.114 32.591  39.356  1.00 10.78 ? 8    ASP B O   1 
ATOM   4294  C CB  . ASP B 1 8   ? 114.780 33.118  38.493  1.00 3.18  ? 8    ASP B CB  1 
ATOM   4295  C CG  . ASP B 1 8   ? 116.161 33.775  38.722  1.00 3.06  ? 8    ASP B CG  1 
ATOM   4296  O OD1 . ASP B 1 8   ? 116.532 33.931  39.887  1.00 2.75  ? 8    ASP B OD1 1 
ATOM   4297  O OD2 . ASP B 1 8   ? 116.792 34.082  37.701  1.00 2.86  ? 8    ASP B OD2 1 
ATOM   4298  N N   . ALA B 1 9   ? 112.632 30.378  39.413  1.00 6.74  ? 9    ALA B N   1 
ATOM   4299  C CA  . ALA B 1 9   ? 111.226 30.016  39.353  1.00 5.22  ? 9    ALA B CA  1 
ATOM   4300  C C   . ALA B 1 9   ? 110.668 29.980  40.769  1.00 6.67  ? 9    ALA B C   1 
ATOM   4301  O O   . ALA B 1 9   ? 111.300 29.497  41.725  1.00 5.41  ? 9    ALA B O   1 
ATOM   4302  C CB  . ALA B 1 9   ? 111.038 28.679  38.637  1.00 6.11  ? 9    ALA B CB  1 
ATOM   4303  N N   . ASP B 1 10  ? 109.469 30.544  40.940  1.00 7.36  ? 10   ASP B N   1 
ATOM   4304  C CA  . ASP B 1 10  ? 108.739 30.465  42.196  1.00 8.21  ? 10   ASP B CA  1 
ATOM   4305  C C   . ASP B 1 10  ? 108.011 29.103  42.123  1.00 8.37  ? 10   ASP B C   1 
ATOM   4306  O O   . ASP B 1 10  ? 106.814 29.029  41.836  1.00 5.40  ? 10   ASP B O   1 
ATOM   4307  C CB  . ASP B 1 10  ? 107.694 31.558  42.359  1.00 11.65 ? 10   ASP B CB  1 
ATOM   4308  C CG  . ASP B 1 10  ? 108.086 32.846  43.037  1.00 16.09 ? 10   ASP B CG  1 
ATOM   4309  O OD1 . ASP B 1 10  ? 109.109 32.871  43.765  1.00 18.35 ? 10   ASP B OD1 1 
ATOM   4310  O OD2 . ASP B 1 10  ? 107.345 33.873  42.896  1.00 17.77 ? 10   ASP B OD2 1 
ATOM   4311  N N   . ASP B 1 11  ? 108.760 28.038  42.412  1.00 7.63  ? 11   ASP B N   1 
ATOM   4312  C CA  . ASP B 1 11  ? 108.322 26.655  42.338  1.00 6.79  ? 11   ASP B CA  1 
ATOM   4313  C C   . ASP B 1 11  ? 108.904 25.927  43.532  1.00 7.26  ? 11   ASP B C   1 
ATOM   4314  O O   . ASP B 1 11  ? 110.113 25.955  43.741  1.00 8.04  ? 11   ASP B O   1 
ATOM   4315  C CB  . ASP B 1 11  ? 108.865 26.104  41.003  1.00 6.45  ? 11   ASP B CB  1 
ATOM   4316  C CG  . ASP B 1 11  ? 108.341 24.699  40.655  1.00 4.80  ? 11   ASP B CG  1 
ATOM   4317  O OD1 . ASP B 1 11  ? 107.951 23.967  41.574  1.00 5.25  ? 11   ASP B OD1 1 
ATOM   4318  O OD2 . ASP B 1 11  ? 108.305 24.339  39.476  1.00 6.30  ? 11   ASP B OD2 1 
ATOM   4319  N N   . PRO B 1 12  ? 108.122 25.265  44.382  1.00 6.70  ? 12   PRO B N   1 
ATOM   4320  C CA  . PRO B 1 12  ? 108.574 24.514  45.507  1.00 5.13  ? 12   PRO B CA  1 
ATOM   4321  C C   . PRO B 1 12  ? 109.518 23.361  45.158  1.00 3.55  ? 12   PRO B C   1 
ATOM   4322  O O   . PRO B 1 12  ? 110.272 22.902  46.017  1.00 4.24  ? 12   PRO B O   1 
ATOM   4323  C CB  . PRO B 1 12  ? 107.330 23.909  46.177  1.00 6.37  ? 12   PRO B CB  1 
ATOM   4324  C CG  . PRO B 1 12  ? 106.160 24.581  45.516  1.00 9.57  ? 12   PRO B CG  1 
ATOM   4325  C CD  . PRO B 1 12  ? 106.647 25.094  44.168  1.00 9.00  ? 12   PRO B CD  1 
ATOM   4326  N N   . THR B 1 13  ? 109.456 22.829  43.961  1.00 3.76  ? 13   THR B N   1 
ATOM   4327  C CA  . THR B 1 13  ? 110.340 21.721  43.586  1.00 5.19  ? 13   THR B CA  1 
ATOM   4328  C C   . THR B 1 13  ? 111.651 22.284  43.032  1.00 5.37  ? 13   THR B C   1 
ATOM   4329  O O   . THR B 1 13  ? 111.604 23.044  42.078  1.00 4.78  ? 13   THR B O   1 
ATOM   4330  C CB  . THR B 1 13  ? 109.675 20.900  42.463  1.00 5.72  ? 13   THR B CB  1 
ATOM   4331  O OG1 . THR B 1 13  ? 108.363 20.508  42.951  1.00 5.76  ? 13   THR B OG1 1 
ATOM   4332  C CG2 . THR B 1 13  ? 110.492 19.665  42.105  1.00 4.32  ? 13   THR B CG2 1 
ATOM   4333  N N   . PRO B 1 14  ? 112.764 21.805  43.546  1.00 7.50  ? 14   PRO B N   1 
ATOM   4334  C CA  . PRO B 1 14  ? 114.067 22.175  43.033  1.00 8.04  ? 14   PRO B CA  1 
ATOM   4335  C C   . PRO B 1 14  ? 114.173 21.778  41.571  1.00 7.74  ? 14   PRO B C   1 
ATOM   4336  O O   . PRO B 1 14  ? 113.648 20.764  41.129  1.00 7.14  ? 14   PRO B O   1 
ATOM   4337  C CB  . PRO B 1 14  ? 115.071 21.456  43.903  1.00 7.19  ? 14   PRO B CB  1 
ATOM   4338  C CG  . PRO B 1 14  ? 114.321 20.525  44.784  1.00 10.02 ? 14   PRO B CG  1 
ATOM   4339  C CD  . PRO B 1 14  ? 112.850 20.845  44.694  1.00 8.22  ? 14   PRO B CD  1 
ATOM   4340  N N   . PRO B 1 15  ? 114.870 22.582  40.763  1.00 5.89  ? 15   PRO B N   1 
ATOM   4341  C CA  . PRO B 1 15  ? 115.076 22.334  39.360  1.00 5.30  ? 15   PRO B CA  1 
ATOM   4342  C C   . PRO B 1 15  ? 115.488 20.887  39.062  1.00 6.78  ? 15   PRO B C   1 
ATOM   4343  O O   . PRO B 1 15  ? 115.040 20.295  38.067  1.00 4.70  ? 15   PRO B O   1 
ATOM   4344  C CB  . PRO B 1 15  ? 116.257 23.251  39.005  1.00 3.19  ? 15   PRO B CB  1 
ATOM   4345  C CG  . PRO B 1 15  ? 116.014 24.465  39.892  1.00 2.87  ? 15   PRO B CG  1 
ATOM   4346  C CD  . PRO B 1 15  ? 115.566 23.830  41.205  1.00 6.44  ? 15   PRO B CD  1 
ATOM   4347  N N   . ASN B 1 16  ? 116.422 20.380  39.885  1.00 6.50  ? 16   ASN B N   1 
ATOM   4348  C CA  . ASN B 1 16  ? 116.978 19.064  39.703  1.00 8.66  ? 16   ASN B CA  1 
ATOM   4349  C C   . ASN B 1 16  ? 116.045 17.949  40.154  1.00 8.91  ? 16   ASN B C   1 
ATOM   4350  O O   . ASN B 1 16  ? 116.522 16.805  40.052  1.00 7.33  ? 16   ASN B O   1 
ATOM   4351  C CB  . ASN B 1 16  ? 118.370 18.869  40.349  1.00 6.60  ? 16   ASN B CB  1 
ATOM   4352  C CG  . ASN B 1 16  ? 118.391 18.813  41.832  1.00 7.70  ? 16   ASN B CG  1 
ATOM   4353  O OD1 . ASN B 1 16  ? 117.445 18.965  42.599  1.00 8.82  ? 16   ASN B OD1 1 
ATOM   4354  N ND2 . ASN B 1 16  ? 119.602 18.606  42.380  1.00 9.84  ? 16   ASN B ND2 1 
ATOM   4355  N N   . GLU B 1 17  ? 114.865 18.257  40.695  1.00 8.32  ? 17   GLU B N   1 
ATOM   4356  C CA  . GLU B 1 17  ? 113.876 17.226  40.981  1.00 8.32  ? 17   GLU B CA  1 
ATOM   4357  C C   . GLU B 1 17  ? 112.651 17.397  40.060  1.00 9.94  ? 17   GLU B C   1 
ATOM   4358  O O   . GLU B 1 17  ? 111.782 16.524  40.070  1.00 8.38  ? 17   GLU B O   1 
ATOM   4359  C CB  . GLU B 1 17  ? 113.454 17.178  42.428  1.00 9.16  ? 17   GLU B CB  1 
ATOM   4360  C CG  . GLU B 1 17  ? 114.547 16.748  43.409  1.00 11.23 ? 17   GLU B CG  1 
ATOM   4361  C CD  . GLU B 1 17  ? 114.216 16.938  44.863  1.00 14.67 ? 17   GLU B CD  1 
ATOM   4362  O OE1 . GLU B 1 17  ? 113.049 17.166  45.286  1.00 16.20 ? 17   GLU B OE1 1 
ATOM   4363  O OE2 . GLU B 1 17  ? 115.132 16.889  45.721  1.00 18.05 ? 17   GLU B OE2 1 
ATOM   4364  N N   . ARG B 1 18  ? 112.550 18.458  39.233  1.00 7.81  ? 18   ARG B N   1 
ATOM   4365  C CA  . ARG B 1 18  ? 111.376 18.671  38.398  1.00 7.19  ? 18   ARG B CA  1 
ATOM   4366  C C   . ARG B 1 18  ? 111.258 17.597  37.322  1.00 8.68  ? 18   ARG B C   1 
ATOM   4367  O O   . ARG B 1 18  ? 110.124 17.203  36.961  1.00 9.16  ? 18   ARG B O   1 
ATOM   4368  C CB  . ARG B 1 18  ? 111.247 20.089  37.779  1.00 5.10  ? 18   ARG B CB  1 
ATOM   4369  C CG  . ARG B 1 18  ? 111.313 21.200  38.824  1.00 4.94  ? 18   ARG B CG  1 
ATOM   4370  C CD  . ARG B 1 18  ? 111.279 22.649  38.300  1.00 5.17  ? 18   ARG B CD  1 
ATOM   4371  N NE  . ARG B 1 18  ? 111.653 23.566  39.404  1.00 5.33  ? 18   ARG B NE  1 
ATOM   4372  C CZ  . ARG B 1 18  ? 112.324 24.726  39.260  1.00 3.84  ? 18   ARG B CZ  1 
ATOM   4373  N NH1 . ARG B 1 18  ? 112.682 25.126  38.047  1.00 2.08  ? 18   ARG B NH1 1 
ATOM   4374  N NH2 . ARG B 1 18  ? 112.647 25.459  40.325  1.00 2.23  ? 18   ARG B NH2 1 
ATOM   4375  N N   . ASP B 1 19  ? 112.372 17.129  36.793  1.00 5.55  ? 19   ASP B N   1 
ATOM   4376  C CA  . ASP B 1 19  ? 112.344 16.017  35.825  1.00 6.38  ? 19   ASP B CA  1 
ATOM   4377  C C   . ASP B 1 19  ? 111.834 14.758  36.525  1.00 6.75  ? 19   ASP B C   1 
ATOM   4378  O O   . ASP B 1 19  ? 110.973 14.044  35.988  1.00 9.17  ? 19   ASP B O   1 
ATOM   4379  C CB  . ASP B 1 19  ? 113.738 15.817  35.249  1.00 4.93  ? 19   ASP B CB  1 
ATOM   4380  C CG  . ASP B 1 19  ? 114.812 15.693  36.317  1.00 6.10  ? 19   ASP B CG  1 
ATOM   4381  O OD1 . ASP B 1 19  ? 114.675 16.024  37.511  1.00 4.74  ? 19   ASP B OD1 1 
ATOM   4382  O OD2 . ASP B 1 19  ? 115.895 15.205  35.949  1.00 7.73  ? 19   ASP B OD2 1 
ATOM   4383  N N   . ASP B 1 20  ? 112.304 14.449  37.731  1.00 8.78  ? 20   ASP B N   1 
ATOM   4384  C CA  . ASP B 1 20  ? 111.893 13.295  38.505  1.00 8.74  ? 20   ASP B CA  1 
ATOM   4385  C C   . ASP B 1 20  ? 110.398 13.288  38.821  1.00 9.70  ? 20   ASP B C   1 
ATOM   4386  O O   . ASP B 1 20  ? 109.744 12.251  38.729  1.00 7.87  ? 20   ASP B O   1 
ATOM   4387  C CB  . ASP B 1 20  ? 112.602 13.205  39.868  1.00 10.26 ? 20   ASP B CB  1 
ATOM   4388  C CG  . ASP B 1 20  ? 114.052 12.781  39.695  1.00 13.99 ? 20   ASP B CG  1 
ATOM   4389  O OD1 . ASP B 1 20  ? 114.445 12.125  38.738  1.00 13.36 ? 20   ASP B OD1 1 
ATOM   4390  O OD2 . ASP B 1 20  ? 114.836 13.108  40.612  1.00 18.00 ? 20   ASP B OD2 1 
ATOM   4391  N N   . GLU B 1 21  ? 109.899 14.431  39.334  1.00 7.71  ? 21   GLU B N   1 
ATOM   4392  C CA  . GLU B 1 21  ? 108.508 14.581  39.667  1.00 7.70  ? 21   GLU B CA  1 
ATOM   4393  C C   . GLU B 1 21  ? 107.612 14.416  38.435  1.00 6.44  ? 21   GLU B C   1 
ATOM   4394  O O   . GLU B 1 21  ? 106.529 13.838  38.651  1.00 7.33  ? 21   GLU B O   1 
ATOM   4395  C CB  . GLU B 1 21  ? 108.172 15.922  40.314  1.00 10.21 ? 21   GLU B CB  1 
ATOM   4396  C CG  . GLU B 1 21  ? 108.643 15.940  41.762  1.00 13.57 ? 21   GLU B CG  1 
ATOM   4397  C CD  . GLU B 1 21  ? 108.109 17.178  42.479  1.00 14.67 ? 21   GLU B CD  1 
ATOM   4398  O OE1 . GLU B 1 21  ? 107.396 17.991  41.848  1.00 16.02 ? 21   GLU B OE1 1 
ATOM   4399  O OE2 . GLU B 1 21  ? 108.436 17.259  43.669  1.00 14.57 ? 21   GLU B OE2 1 
ATOM   4400  N N   . ALA B 1 22  ? 108.028 14.848  37.257  1.00 4.06  ? 22   ALA B N   1 
ATOM   4401  C CA  . ALA B 1 22  ? 107.161 14.645  36.091  1.00 6.40  ? 22   ALA B CA  1 
ATOM   4402  C C   . ALA B 1 22  ? 107.132 13.157  35.718  1.00 7.30  ? 22   ALA B C   1 
ATOM   4403  O O   . ALA B 1 22  ? 106.078 12.582  35.361  1.00 6.51  ? 22   ALA B O   1 
ATOM   4404  C CB  . ALA B 1 22  ? 107.559 15.521  34.921  1.00 4.32  ? 22   ALA B CB  1 
ATOM   4405  N N   . PHE B 1 23  ? 108.284 12.481  35.850  1.00 6.39  ? 23   PHE B N   1 
ATOM   4406  C CA  . PHE B 1 23  ? 108.304 11.041  35.515  1.00 5.88  ? 23   PHE B CA  1 
ATOM   4407  C C   . PHE B 1 23  ? 107.438 10.312  36.519  1.00 5.65  ? 23   PHE B C   1 
ATOM   4408  O O   . PHE B 1 23  ? 106.603 9.480   36.150  1.00 7.08  ? 23   PHE B O   1 
ATOM   4409  C CB  . PHE B 1 23  ? 109.749 10.539  35.485  1.00 7.40  ? 23   PHE B CB  1 
ATOM   4410  C CG  . PHE B 1 23  ? 109.944 9.064   35.309  1.00 7.12  ? 23   PHE B CG  1 
ATOM   4411  C CD1 . PHE B 1 23  ? 109.866 8.509   34.047  1.00 7.31  ? 23   PHE B CD1 1 
ATOM   4412  C CD2 . PHE B 1 23  ? 110.186 8.249   36.403  1.00 6.75  ? 23   PHE B CD2 1 
ATOM   4413  C CE1 . PHE B 1 23  ? 110.046 7.139   33.869  1.00 7.13  ? 23   PHE B CE1 1 
ATOM   4414  C CE2 . PHE B 1 23  ? 110.367 6.862   36.238  1.00 6.15  ? 23   PHE B CE2 1 
ATOM   4415  C CZ  . PHE B 1 23  ? 110.286 6.335   34.977  1.00 5.43  ? 23   PHE B CZ  1 
ATOM   4416  N N   . ALA B 1 24  ? 107.518 10.605  37.813  1.00 5.50  ? 24   ALA B N   1 
ATOM   4417  C CA  . ALA B 1 24  ? 106.748 9.919   38.823  1.00 6.40  ? 24   ALA B CA  1 
ATOM   4418  C C   . ALA B 1 24  ? 105.248 10.060  38.561  1.00 6.90  ? 24   ALA B C   1 
ATOM   4419  O O   . ALA B 1 24  ? 104.484 9.149   38.819  1.00 6.32  ? 24   ALA B O   1 
ATOM   4420  C CB  . ALA B 1 24  ? 107.044 10.389  40.252  1.00 3.72  ? 24   ALA B CB  1 
ATOM   4421  N N   . SER B 1 25  ? 104.780 11.239  38.176  1.00 7.37  ? 25   SER B N   1 
ATOM   4422  C CA  . SER B 1 25  ? 103.355 11.498  38.012  1.00 6.89  ? 25   SER B CA  1 
ATOM   4423  C C   . SER B 1 25  ? 102.847 10.735  36.801  1.00 5.84  ? 25   SER B C   1 
ATOM   4424  O O   . SER B 1 25  ? 101.763 10.150  36.826  1.00 8.87  ? 25   SER B O   1 
ATOM   4425  C CB  . SER B 1 25  ? 103.077 13.003  37.870  1.00 7.50  ? 25   SER B CB  1 
ATOM   4426  O OG  . SER B 1 25  ? 101.768 13.227  37.290  1.00 7.07  ? 25   SER B OG  1 
ATOM   4427  N N   . ARG B 1 26  ? 103.635 10.703  35.750  1.00 5.86  ? 26   ARG B N   1 
ATOM   4428  C CA  . ARG B 1 26  ? 103.302 10.014  34.523  1.00 7.01  ? 26   ARG B CA  1 
ATOM   4429  C C   . ARG B 1 26  ? 103.268 8.493   34.694  1.00 8.41  ? 26   ARG B C   1 
ATOM   4430  O O   . ARG B 1 26  ? 102.379 7.852   34.115  1.00 6.86  ? 26   ARG B O   1 
ATOM   4431  C CB  . ARG B 1 26  ? 104.233 10.445  33.393  1.00 6.43  ? 26   ARG B CB  1 
ATOM   4432  C CG  . ARG B 1 26  ? 103.985 11.936  33.097  1.00 4.88  ? 26   ARG B CG  1 
ATOM   4433  C CD  . ARG B 1 26  ? 104.992 12.429  32.110  1.00 5.20  ? 26   ARG B CD  1 
ATOM   4434  N NE  . ARG B 1 26  ? 104.737 13.791  31.647  1.00 7.18  ? 26   ARG B NE  1 
ATOM   4435  C CZ  . ARG B 1 26  ? 105.653 14.611  31.164  1.00 7.38  ? 26   ARG B CZ  1 
ATOM   4436  N NH1 . ARG B 1 26  ? 106.938 14.224  31.090  1.00 2.83  ? 26   ARG B NH1 1 
ATOM   4437  N NH2 . ARG B 1 26  ? 105.233 15.807  30.707  1.00 8.19  ? 26   ARG B NH2 1 
ATOM   4438  N N   . VAL B 1 27  ? 104.192 7.948   35.479  1.00 6.31  ? 27   VAL B N   1 
ATOM   4439  C CA  . VAL B 1 27  ? 104.186 6.512   35.761  1.00 8.07  ? 27   VAL B CA  1 
ATOM   4440  C C   . VAL B 1 27  ? 102.953 6.171   36.596  1.00 8.05  ? 27   VAL B C   1 
ATOM   4441  O O   . VAL B 1 27  ? 102.279 5.155   36.359  1.00 7.00  ? 27   VAL B O   1 
ATOM   4442  C CB  . VAL B 1 27  ? 105.487 6.140   36.508  1.00 8.98  ? 27   VAL B CB  1 
ATOM   4443  C CG1 . VAL B 1 27  ? 105.428 4.745   37.123  1.00 10.65 ? 27   VAL B CG1 1 
ATOM   4444  C CG2 . VAL B 1 27  ? 106.633 6.235   35.510  1.00 8.71  ? 27   VAL B CG2 1 
ATOM   4445  N N   . ALA B 1 28  ? 102.643 7.017   37.594  1.00 6.00  ? 28   ALA B N   1 
ATOM   4446  C CA  . ALA B 1 28  ? 101.475 6.745   38.416  1.00 7.40  ? 28   ALA B CA  1 
ATOM   4447  C C   . ALA B 1 28  ? 100.182 6.793   37.585  1.00 9.09  ? 28   ALA B C   1 
ATOM   4448  O O   . ALA B 1 28  ? 99.248  6.011   37.849  1.00 9.12  ? 28   ALA B O   1 
ATOM   4449  C CB  . ALA B 1 28  ? 101.339 7.683   39.608  1.00 5.98  ? 28   ALA B CB  1 
ATOM   4450  N N   . ALA B 1 29  ? 100.106 7.688   36.610  1.00 7.77  ? 29   ALA B N   1 
ATOM   4451  C CA  . ALA B 1 29  ? 98.935  7.832   35.755  1.00 9.02  ? 29   ALA B CA  1 
ATOM   4452  C C   . ALA B 1 29  ? 98.831  6.627   34.820  1.00 9.98  ? 29   ALA B C   1 
ATOM   4453  O O   . ALA B 1 29  ? 97.757  6.053   34.602  1.00 10.67 ? 29   ALA B O   1 
ATOM   4454  C CB  . ALA B 1 29  ? 98.972  9.122   34.938  1.00 4.92  ? 29   ALA B CB  1 
ATOM   4455  N N   . ALA B 1 30  ? 99.962  6.205   34.245  1.00 8.71  ? 30   ALA B N   1 
ATOM   4456  C CA  . ALA B 1 30  ? 99.975  5.055   33.373  1.00 8.27  ? 30   ALA B CA  1 
ATOM   4457  C C   . ALA B 1 30  ? 99.611  3.810   34.203  1.00 10.25 ? 30   ALA B C   1 
ATOM   4458  O O   . ALA B 1 30  ? 98.954  2.934   33.638  1.00 11.40 ? 30   ALA B O   1 
ATOM   4459  C CB  . ALA B 1 30  ? 101.296 4.820   32.700  1.00 6.33  ? 30   ALA B CB  1 
ATOM   4460  N N   . LYS B 1 31  ? 100.083 3.740   35.430  1.00 9.68  ? 31   LYS B N   1 
ATOM   4461  C CA  . LYS B 1 31  ? 99.803  2.597   36.288  1.00 11.55 ? 31   LYS B CA  1 
ATOM   4462  C C   . LYS B 1 31  ? 98.313  2.511   36.661  1.00 9.95  ? 31   LYS B C   1 
ATOM   4463  O O   . LYS B 1 31  ? 97.733  1.438   36.857  1.00 7.66  ? 31   LYS B O   1 
ATOM   4464  C CB  . LYS B 1 31  ? 100.671 2.688   37.542  1.00 11.89 ? 31   LYS B CB  1 
ATOM   4465  C CG  . LYS B 1 31  ? 100.566 1.478   38.447  1.00 15.68 ? 31   LYS B CG  1 
ATOM   4466  C CD  . LYS B 1 31  ? 101.231 1.767   39.808  1.00 17.93 ? 31   LYS B CD  1 
ATOM   4467  C CE  . LYS B 1 31  ? 101.198 0.474   40.615  1.00 21.83 ? 31   LYS B CE  1 
ATOM   4468  N NZ  . LYS B 1 31  ? 100.759 0.611   42.028  1.00 23.89 ? 31   LYS B NZ  1 
ATOM   4469  N N   . ARG B 1 32  ? 97.674  3.660   36.827  1.00 7.28  ? 32   ARG B N   1 
ATOM   4470  C CA  . ARG B 1 32  ? 96.237  3.705   37.114  1.00 7.99  ? 32   ARG B CA  1 
ATOM   4471  C C   . ARG B 1 32  ? 95.469  3.180   35.910  1.00 6.37  ? 32   ARG B C   1 
ATOM   4472  O O   . ARG B 1 32  ? 94.514  2.418   36.103  1.00 6.64  ? 32   ARG B O   1 
ATOM   4473  C CB  . ARG B 1 32  ? 95.799  5.097   37.547  1.00 10.66 ? 32   ARG B CB  1 
ATOM   4474  C CG  . ARG B 1 32  ? 94.301  5.263   37.746  1.00 12.79 ? 32   ARG B CG  1 
ATOM   4475  C CD  . ARG B 1 32  ? 94.080  6.722   38.181  1.00 16.19 ? 32   ARG B CD  1 
ATOM   4476  N NE  . ARG B 1 32  ? 92.714  7.083   37.885  1.00 17.47 ? 32   ARG B NE  1 
ATOM   4477  C CZ  . ARG B 1 32  ? 91.653  6.844   38.645  1.00 19.06 ? 32   ARG B CZ  1 
ATOM   4478  N NH1 . ARG B 1 32  ? 91.928  6.226   39.801  1.00 18.46 ? 32   ARG B NH1 1 
ATOM   4479  N NH2 . ARG B 1 32  ? 90.443  7.247   38.190  1.00 16.68 ? 32   ARG B NH2 1 
ATOM   4480  N N   . GLU B 1 33  ? 95.892  3.500   34.699  1.00 4.29  ? 33   GLU B N   1 
ATOM   4481  C CA  . GLU B 1 33  ? 95.342  2.969   33.479  1.00 6.15  ? 33   GLU B CA  1 
ATOM   4482  C C   . GLU B 1 33  ? 95.626  1.440   33.373  1.00 8.67  ? 33   GLU B C   1 
ATOM   4483  O O   . GLU B 1 33  ? 94.736  0.678   32.948  1.00 6.58  ? 33   GLU B O   1 
ATOM   4484  C CB  . GLU B 1 33  ? 95.850  3.648   32.221  1.00 3.02  ? 33   GLU B CB  1 
ATOM   4485  C CG  . GLU B 1 33  ? 95.089  4.945   31.847  1.00 5.63  ? 33   GLU B CG  1 
ATOM   4486  C CD  . GLU B 1 33  ? 93.630  4.647   31.504  1.00 6.35  ? 33   GLU B CD  1 
ATOM   4487  O OE1 . GLU B 1 33  ? 93.392  3.789   30.609  1.00 6.05  ? 33   GLU B OE1 1 
ATOM   4488  O OE2 . GLU B 1 33  ? 92.753  5.259   32.154  1.00 4.34  ? 33   GLU B OE2 1 
ATOM   4489  N N   . LEU B 1 34  ? 96.821  0.984   33.749  1.00 6.37  ? 34   LEU B N   1 
ATOM   4490  C CA  . LEU B 1 34  ? 97.136  -0.445  33.725  1.00 8.69  ? 34   LEU B CA  1 
ATOM   4491  C C   . LEU B 1 34  ? 96.178  -1.233  34.627  1.00 8.75  ? 34   LEU B C   1 
ATOM   4492  O O   . LEU B 1 34  ? 95.507  -2.164  34.197  1.00 9.14  ? 34   LEU B O   1 
ATOM   4493  C CB  . LEU B 1 34  ? 98.575  -0.689  34.221  1.00 7.85  ? 34   LEU B CB  1 
ATOM   4494  C CG  . LEU B 1 34  ? 98.957  -2.131  34.550  1.00 8.38  ? 34   LEU B CG  1 
ATOM   4495  C CD1 . LEU B 1 34  ? 98.971  -2.966  33.275  1.00 6.26  ? 34   LEU B CD1 1 
ATOM   4496  C CD2 . LEU B 1 34  ? 100.315 -2.188  35.248  1.00 8.03  ? 34   LEU B CD2 1 
ATOM   4497  N N   . GLU B 1 35  ? 96.112  -0.840  35.889  1.00 8.58  ? 35   GLU B N   1 
ATOM   4498  C CA  . GLU B 1 35  ? 95.292  -1.495  36.874  1.00 11.93 ? 35   GLU B CA  1 
ATOM   4499  C C   . GLU B 1 35  ? 93.800  -1.316  36.619  1.00 13.02 ? 35   GLU B C   1 
ATOM   4500  O O   . GLU B 1 35  ? 93.049  -2.266  36.845  1.00 12.05 ? 35   GLU B O   1 
ATOM   4501  C CB  . GLU B 1 35  ? 95.650  -1.044  38.284  1.00 13.97 ? 35   GLU B CB  1 
ATOM   4502  C CG  . GLU B 1 35  ? 97.089  -1.384  38.672  1.00 16.27 ? 35   GLU B CG  1 
ATOM   4503  C CD  . GLU B 1 35  ? 97.480  -0.768  39.995  1.00 19.45 ? 35   GLU B CD  1 
ATOM   4504  O OE1 . GLU B 1 35  ? 96.821  0.133   40.572  1.00 22.14 ? 35   GLU B OE1 1 
ATOM   4505  O OE2 . GLU B 1 35  ? 98.523  -1.161  40.557  1.00 22.60 ? 35   GLU B OE2 1 
ATOM   4506  N N   . GLY B 1 36  ? 93.353  -0.195  36.060  1.00 11.28 ? 36   GLY B N   1 
ATOM   4507  C CA  . GLY B 1 36  ? 91.919  -0.033  35.799  1.00 9.90  ? 36   GLY B CA  1 
ATOM   4508  C C   . GLY B 1 36  ? 91.529  -0.776  34.525  1.00 9.44  ? 36   GLY B C   1 
ATOM   4509  O O   . GLY B 1 36  ? 90.341  -1.036  34.295  1.00 10.42 ? 36   GLY B O   1 
ATOM   4510  N N   . THR B 1 37  ? 92.447  -1.032  33.612  1.00 8.87  ? 37   THR B N   1 
ATOM   4511  C CA  . THR B 1 37  ? 92.140  -1.676  32.336  1.00 9.01  ? 37   THR B CA  1 
ATOM   4512  C C   . THR B 1 37  ? 92.056  -3.189  32.496  1.00 9.83  ? 37   THR B C   1 
ATOM   4513  O O   . THR B 1 37  ? 90.988  -3.766  32.296  1.00 7.95  ? 37   THR B O   1 
ATOM   4514  C CB  . THR B 1 37  ? 93.135  -1.287  31.251  1.00 10.02 ? 37   THR B CB  1 
ATOM   4515  O OG1 . THR B 1 37  ? 92.991  0.125   30.973  1.00 8.30  ? 37   THR B OG1 1 
ATOM   4516  C CG2 . THR B 1 37  ? 92.976  -2.090  29.964  1.00 9.45  ? 37   THR B CG2 1 
ATOM   4517  N N   . GLY B 1 38  ? 93.129  -3.820  32.960  1.00 11.26 ? 38   GLY B N   1 
ATOM   4518  C CA  . GLY B 1 38  ? 93.091  -5.290  33.135  1.00 9.55  ? 38   GLY B CA  1 
ATOM   4519  C C   . GLY B 1 38  ? 92.970  -5.943  31.754  1.00 9.00  ? 38   GLY B C   1 
ATOM   4520  O O   . GLY B 1 38  ? 93.421  -5.448  30.712  1.00 7.96  ? 38   GLY B O   1 
ATOM   4521  N N   . THR B 1 39  ? 92.341  -7.137  31.757  1.00 7.24  ? 39   THR B N   1 
ATOM   4522  C CA  . THR B 1 39  ? 92.175  -7.867  30.496  1.00 6.71  ? 39   THR B CA  1 
ATOM   4523  C C   . THR B 1 39  ? 90.860  -7.403  29.887  1.00 7.51  ? 39   THR B C   1 
ATOM   4524  O O   . THR B 1 39  ? 89.839  -7.507  30.570  1.00 9.12  ? 39   THR B O   1 
ATOM   4525  C CB  . THR B 1 39  ? 92.171  -9.402  30.730  1.00 8.08  ? 39   THR B CB  1 
ATOM   4526  O OG1 . THR B 1 39  ? 93.459  -9.743  31.248  1.00 8.02  ? 39   THR B OG1 1 
ATOM   4527  C CG2 . THR B 1 39  ? 91.931  -10.194 29.446  1.00 7.51  ? 39   THR B CG2 1 
ATOM   4528  N N   . VAL B 1 40  ? 90.848  -6.955  28.650  1.00 6.14  ? 40   VAL B N   1 
ATOM   4529  C CA  . VAL B 1 40  ? 89.643  -6.490  28.007  1.00 6.89  ? 40   VAL B CA  1 
ATOM   4530  C C   . VAL B 1 40  ? 89.446  -7.397  26.799  1.00 7.35  ? 40   VAL B C   1 
ATOM   4531  O O   . VAL B 1 40  ? 90.300  -7.424  25.937  1.00 4.14  ? 40   VAL B O   1 
ATOM   4532  C CB  . VAL B 1 40  ? 89.728  -4.994  27.639  1.00 5.61  ? 40   VAL B CB  1 
ATOM   4533  C CG1 . VAL B 1 40  ? 88.599  -4.585  26.728  1.00 5.16  ? 40   VAL B CG1 1 
ATOM   4534  C CG2 . VAL B 1 40  ? 89.736  -4.145  28.921  1.00 5.91  ? 40   VAL B CG2 1 
ATOM   4535  N N   . CYS B 1 41  ? 88.291  -8.078  26.765  1.00 8.05  ? 41   CYS B N   1 
ATOM   4536  C CA  . CYS B 1 41  ? 88.064  -9.011  25.646  1.00 8.54  ? 41   CYS B CA  1 
ATOM   4537  C C   . CYS B 1 41  ? 87.297  -8.426  24.498  1.00 9.02  ? 41   CYS B C   1 
ATOM   4538  O O   . CYS B 1 41  ? 86.157  -8.012  24.718  1.00 10.36 ? 41   CYS B O   1 
ATOM   4539  C CB  . CYS B 1 41  ? 87.306  -10.232 26.235  1.00 8.97  ? 41   CYS B CB  1 
ATOM   4540  S SG  . CYS B 1 41  ? 88.263  -10.966 27.630  1.00 11.85 ? 41   CYS B SG  1 
ATOM   4541  N N   . GLN B 1 42  ? 87.843  -8.358  23.294  1.00 8.66  ? 42   GLN B N   1 
ATOM   4542  C CA  . GLN B 1 42  ? 87.162  -7.852  22.128  1.00 9.81  ? 42   GLN B CA  1 
ATOM   4543  C C   . GLN B 1 42  ? 86.320  -8.971  21.494  1.00 11.89 ? 42   GLN B C   1 
ATOM   4544  O O   . GLN B 1 42  ? 86.850  -9.976  21.001  1.00 9.71  ? 42   GLN B O   1 
ATOM   4545  C CB  . GLN B 1 42  ? 88.158  -7.329  21.084  1.00 8.22  ? 42   GLN B CB  1 
ATOM   4546  C CG  . GLN B 1 42  ? 89.082  -6.238  21.661  1.00 8.23  ? 42   GLN B CG  1 
ATOM   4547  C CD  . GLN B 1 42  ? 88.362  -4.954  22.032  1.00 8.86  ? 42   GLN B CD  1 
ATOM   4548  O OE1 . GLN B 1 42  ? 87.274  -4.685  21.497  1.00 6.37  ? 42   GLN B OE1 1 
ATOM   4549  N NE2 . GLN B 1 42  ? 88.963  -4.167  22.936  1.00 7.94  ? 42   GLN B NE2 1 
ATOM   4550  N N   . ILE B 1 43  ? 84.993  -8.782  21.502  1.00 10.66 ? 43   ILE B N   1 
ATOM   4551  C CA  . ILE B 1 43  ? 84.082  -9.795  20.983  1.00 9.02  ? 43   ILE B CA  1 
ATOM   4552  C C   . ILE B 1 43  ? 83.297  -9.343  19.774  1.00 8.23  ? 43   ILE B C   1 
ATOM   4553  O O   . ILE B 1 43  ? 82.585  -8.331  19.904  1.00 6.46  ? 43   ILE B O   1 
ATOM   4554  C CB  . ILE B 1 43  ? 83.105  -10.150 22.129  1.00 12.13 ? 43   ILE B CB  1 
ATOM   4555  C CG1 . ILE B 1 43  ? 83.909  -10.649 23.338  1.00 13.61 ? 43   ILE B CG1 1 
ATOM   4556  C CG2 . ILE B 1 43  ? 82.131  -11.241 21.657  1.00 11.48 ? 43   ILE B CG2 1 
ATOM   4557  C CD1 . ILE B 1 43  ? 83.231  -10.494 24.662  1.00 16.15 ? 43   ILE B CD1 1 
ATOM   4558  N N   . ASN B 1 44  ? 83.388  -10.018 18.631  1.00 6.34  ? 44   ASN B N   1 
ATOM   4559  C CA  . ASN B 1 44  ? 82.548  -9.611  17.499  1.00 8.07  ? 44   ASN B CA  1 
ATOM   4560  C C   . ASN B 1 44  ? 81.359  -10.566 17.416  1.00 10.13 ? 44   ASN B C   1 
ATOM   4561  O O   . ASN B 1 44  ? 81.195  -11.419 18.309  1.00 8.65  ? 44   ASN B O   1 
ATOM   4562  C CB  . ASN B 1 44  ? 83.329  -9.429  16.241  1.00 7.73  ? 44   ASN B CB  1 
ATOM   4563  C CG  . ASN B 1 44  ? 84.024  -10.678 15.702  1.00 8.68  ? 44   ASN B CG  1 
ATOM   4564  O OD1 . ASN B 1 44  ? 83.571  -11.786 15.971  1.00 8.08  ? 44   ASN B OD1 1 
ATOM   4565  N ND2 . ASN B 1 44  ? 85.065  -10.429 14.930  1.00 6.63  ? 44   ASN B ND2 1 
ATOM   4566  N N   . ASN B 1 45  ? 80.506  -10.467 16.402  1.00 10.85 ? 45   ASN B N   1 
ATOM   4567  C CA  . ASN B 1 45  ? 79.303  -11.302 16.372  1.00 11.36 ? 45   ASN B CA  1 
ATOM   4568  C C   . ASN B 1 45  ? 79.536  -12.749 15.948  1.00 13.40 ? 45   ASN B C   1 
ATOM   4569  O O   . ASN B 1 45  ? 78.615  -13.569 15.964  1.00 11.92 ? 45   ASN B O   1 
ATOM   4570  C CB  . ASN B 1 45  ? 78.206  -10.635 15.544  1.00 8.00  ? 45   ASN B CB  1 
ATOM   4571  C CG  . ASN B 1 45  ? 78.481  -10.518 14.077  1.00 9.14  ? 45   ASN B CG  1 
ATOM   4572  O OD1 . ASN B 1 45  ? 79.337  -11.264 13.562  1.00 7.92  ? 45   ASN B OD1 1 
ATOM   4573  N ND2 . ASN B 1 45  ? 77.745  -9.654  13.351  1.00 4.78  ? 45   ASN B ND2 1 
ATOM   4574  N N   . GLY B 1 46  ? 80.757  -13.075 15.530  1.00 13.89 ? 46   GLY B N   1 
ATOM   4575  C CA  . GLY B 1 46  ? 81.182  -14.384 15.144  1.00 13.38 ? 46   GLY B CA  1 
ATOM   4576  C C   . GLY B 1 46  ? 80.733  -14.835 13.783  1.00 14.62 ? 46   GLY B C   1 
ATOM   4577  O O   . GLY B 1 46  ? 81.188  -15.925 13.424  1.00 14.01 ? 46   GLY B O   1 
ATOM   4578  N N   . GLU B 1 47  ? 79.974  -14.066 12.987  1.00 12.48 ? 47   GLU B N   1 
ATOM   4579  C CA  . GLU B 1 47  ? 79.522  -14.622 11.710  1.00 10.84 ? 47   GLU B CA  1 
ATOM   4580  C C   . GLU B 1 47  ? 80.699  -14.748 10.764  1.00 12.64 ? 47   GLU B C   1 
ATOM   4581  O O   . GLU B 1 47  ? 81.638  -13.938 10.799  1.00 10.11 ? 47   GLU B O   1 
ATOM   4582  C CB  . GLU B 1 47  ? 78.350  -13.793 11.192  1.00 10.68 ? 47   GLU B CB  1 
ATOM   4583  C CG  . GLU B 1 47  ? 78.741  -12.511 10.453  1.00 8.39  ? 47   GLU B CG  1 
ATOM   4584  C CD  . GLU B 1 47  ? 77.507  -11.610 10.360  1.00 10.01 ? 47   GLU B CD  1 
ATOM   4585  O OE1 . GLU B 1 47  ? 76.421  -12.120 10.022  1.00 7.37  ? 47   GLU B OE1 1 
ATOM   4586  O OE2 . GLU B 1 47  ? 77.639  -10.391 10.636  1.00 8.55  ? 47   GLU B OE2 1 
ATOM   4587  N N   . THR B 1 48  ? 80.656  -15.749 9.871   1.00 10.54 ? 48   THR B N   1 
ATOM   4588  C CA  . THR B 1 48  ? 81.794  -15.959 8.984   1.00 11.32 ? 48   THR B CA  1 
ATOM   4589  C C   . THR B 1 48  ? 81.503  -15.542 7.560   1.00 11.32 ? 48   THR B C   1 
ATOM   4590  O O   . THR B 1 48  ? 82.437  -15.382 6.779   1.00 12.53 ? 48   THR B O   1 
ATOM   4591  C CB  . THR B 1 48  ? 82.239  -17.444 8.993   1.00 12.72 ? 48   THR B CB  1 
ATOM   4592  O OG1 . THR B 1 48  ? 81.127  -18.248 8.547   1.00 11.94 ? 48   THR B OG1 1 
ATOM   4593  C CG2 . THR B 1 48  ? 82.638  -17.894 10.390  1.00 12.04 ? 48   THR B CG2 1 
ATOM   4594  N N   . ASP B 1 49  ? 80.252  -15.326 7.189   1.00 11.35 ? 49   ASP B N   1 
ATOM   4595  C CA  . ASP B 1 49  ? 79.897  -14.966 5.813   1.00 11.04 ? 49   ASP B CA  1 
ATOM   4596  C C   . ASP B 1 49  ? 80.642  -13.735 5.337   1.00 11.73 ? 49   ASP B C   1 
ATOM   4597  O O   . ASP B 1 49  ? 80.524  -12.681 5.970   1.00 11.12 ? 49   ASP B O   1 
ATOM   4598  C CB  . ASP B 1 49  ? 78.379  -14.761 5.762   1.00 11.59 ? 49   ASP B CB  1 
ATOM   4599  C CG  . ASP B 1 49  ? 77.814  -14.420 4.418   1.00 11.85 ? 49   ASP B CG  1 
ATOM   4600  O OD1 . ASP B 1 49  ? 78.507  -14.478 3.385   1.00 12.54 ? 49   ASP B OD1 1 
ATOM   4601  O OD2 . ASP B 1 49  ? 76.592  -14.116 4.340   1.00 12.92 ? 49   ASP B OD2 1 
ATOM   4602  N N   . LEU B 1 50  ? 81.292  -13.772 4.181   1.00 9.08  ? 50   LEU B N   1 
ATOM   4603  C CA  . LEU B 1 50  ? 82.048  -12.645 3.691   1.00 10.46 ? 50   LEU B CA  1 
ATOM   4604  C C   . LEU B 1 50  ? 81.183  -11.478 3.211   1.00 11.90 ? 50   LEU B C   1 
ATOM   4605  O O   . LEU B 1 50  ? 81.664  -10.335 3.161   1.00 10.25 ? 50   LEU B O   1 
ATOM   4606  C CB  . LEU B 1 50  ? 83.051  -13.068 2.618   1.00 10.42 ? 50   LEU B CB  1 
ATOM   4607  C CG  . LEU B 1 50  ? 84.276  -13.866 3.119   1.00 10.93 ? 50   LEU B CG  1 
ATOM   4608  C CD1 . LEU B 1 50  ? 85.203  -14.110 1.933   1.00 11.09 ? 50   LEU B CD1 1 
ATOM   4609  C CD2 . LEU B 1 50  ? 85.014  -13.144 4.221   1.00 11.07 ? 50   LEU B CD2 1 
ATOM   4610  N N   . ALA B 1 51  ? 79.924  -11.743 2.869   1.00 9.47  ? 51   ALA B N   1 
ATOM   4611  C CA  . ALA B 1 51  ? 78.954  -10.739 2.494   1.00 8.90  ? 51   ALA B CA  1 
ATOM   4612  C C   . ALA B 1 51  ? 78.710  -9.759  3.646   1.00 7.65  ? 51   ALA B C   1 
ATOM   4613  O O   . ALA B 1 51  ? 78.335  -8.624  3.361   1.00 8.22  ? 51   ALA B O   1 
ATOM   4614  C CB  . ALA B 1 51  ? 77.605  -11.383 2.124   1.00 8.54  ? 51   ALA B CB  1 
ATOM   4615  N N   . ALA B 1 52  ? 78.895  -10.169 4.885   1.00 6.48  ? 52   ALA B N   1 
ATOM   4616  C CA  . ALA B 1 52  ? 78.724  -9.356  6.049   1.00 6.61  ? 52   ALA B CA  1 
ATOM   4617  C C   . ALA B 1 52  ? 79.997  -8.655  6.536   1.00 6.30  ? 52   ALA B C   1 
ATOM   4618  O O   . ALA B 1 52  ? 79.955  -8.127  7.635   1.00 5.86  ? 52   ALA B O   1 
ATOM   4619  C CB  . ALA B 1 52  ? 78.170  -10.187 7.195   1.00 5.42  ? 52   ALA B CB  1 
ATOM   4620  N N   . LYS B 1 53  ? 81.049  -8.608  5.749   1.00 7.11  ? 53   LYS B N   1 
ATOM   4621  C CA  . LYS B 1 53  ? 82.311  -8.020  6.106   1.00 7.18  ? 53   LYS B CA  1 
ATOM   4622  C C   . LYS B 1 53  ? 82.644  -6.900  5.134   1.00 5.88  ? 53   LYS B C   1 
ATOM   4623  O O   . LYS B 1 53  ? 82.164  -6.946  4.018   1.00 4.55  ? 53   LYS B O   1 
ATOM   4624  C CB  . LYS B 1 53  ? 83.466  -9.060  5.974   1.00 8.79  ? 53   LYS B CB  1 
ATOM   4625  C CG  . LYS B 1 53  ? 83.264  -10.323 6.792   1.00 10.27 ? 53   LYS B CG  1 
ATOM   4626  C CD  . LYS B 1 53  ? 83.118  -10.107 8.275   1.00 11.02 ? 53   LYS B CD  1 
ATOM   4627  C CE  . LYS B 1 53  ? 82.528  -11.327 8.954   1.00 9.34  ? 53   LYS B CE  1 
ATOM   4628  N NZ  . LYS B 1 53  ? 82.319  -11.214 10.422  1.00 8.30  ? 53   LYS B NZ  1 
ATOM   4629  N N   . PHE B 1 54  ? 83.436  -5.936  5.635   1.00 5.41  ? 54   PHE B N   1 
ATOM   4630  C CA  . PHE B 1 54  ? 83.916  -4.875  4.750   1.00 4.35  ? 54   PHE B CA  1 
ATOM   4631  C C   . PHE B 1 54  ? 84.969  -5.362  3.761   1.00 4.91  ? 54   PHE B C   1 
ATOM   4632  O O   . PHE B 1 54  ? 85.950  -5.989  4.192   1.00 5.34  ? 54   PHE B O   1 
ATOM   4633  C CB  . PHE B 1 54  ? 84.594  -3.791  5.649   1.00 4.83  ? 54   PHE B CB  1 
ATOM   4634  C CG  . PHE B 1 54  ? 85.230  -2.699  4.815   1.00 5.23  ? 54   PHE B CG  1 
ATOM   4635  C CD1 . PHE B 1 54  ? 84.523  -1.631  4.289   1.00 2.08  ? 54   PHE B CD1 1 
ATOM   4636  C CD2 . PHE B 1 54  ? 86.597  -2.825  4.542   1.00 5.79  ? 54   PHE B CD2 1 
ATOM   4637  C CE1 . PHE B 1 54  ? 85.175  -0.690  3.515   1.00 4.55  ? 54   PHE B CE1 1 
ATOM   4638  C CE2 . PHE B 1 54  ? 87.239  -1.873  3.773   1.00 4.65  ? 54   PHE B CE2 1 
ATOM   4639  C CZ  . PHE B 1 54  ? 86.532  -0.801  3.267   1.00 6.20  ? 54   PHE B CZ  1 
ATOM   4640  N N   . HIS B 1 55  ? 84.874  -5.026  2.478   1.00 4.99  ? 55   HIS B N   1 
ATOM   4641  C CA  . HIS B 1 55  ? 85.912  -5.310  1.516   1.00 7.47  ? 55   HIS B CA  1 
ATOM   4642  C C   . HIS B 1 55  ? 85.803  -4.367  0.327   1.00 6.89  ? 55   HIS B C   1 
ATOM   4643  O O   . HIS B 1 55  ? 86.175  -4.653  -0.830  1.00 7.51  ? 55   HIS B O   1 
ATOM   4644  C CB  . HIS B 1 55  ? 85.958  -6.785  1.087   1.00 8.26  ? 55   HIS B CB  1 
ATOM   4645  C CG  . HIS B 1 55  ? 84.608  -7.431  0.979   1.00 5.98  ? 55   HIS B CG  1 
ATOM   4646  N ND1 . HIS B 1 55  ? 83.737  -7.121  -0.034  1.00 5.84  ? 55   HIS B ND1 1 
ATOM   4647  C CD2 . HIS B 1 55  ? 83.999  -8.324  1.805   1.00 6.31  ? 55   HIS B CD2 1 
ATOM   4648  C CE1 . HIS B 1 55  ? 82.627  -7.849  0.156   1.00 6.70  ? 55   HIS B CE1 1 
ATOM   4649  N NE2 . HIS B 1 55  ? 82.766  -8.595  1.233   1.00 5.61  ? 55   HIS B NE2 1 
ATOM   4650  N N   . LYS B 1 56  ? 85.348  -3.119  0.596   1.00 6.70  ? 56   LYS B N   1 
ATOM   4651  C CA  . LYS B 1 56  ? 85.240  -2.147  -0.479  1.00 5.98  ? 56   LYS B CA  1 
ATOM   4652  C C   . LYS B 1 56  ? 86.652  -1.849  -1.044  1.00 6.56  ? 56   LYS B C   1 
ATOM   4653  O O   . LYS B 1 56  ? 87.580  -1.705  -0.254  1.00 7.01  ? 56   LYS B O   1 
ATOM   4654  C CB  . LYS B 1 56  ? 84.636  -0.814  -0.029  1.00 6.39  ? 56   LYS B CB  1 
ATOM   4655  C CG  . LYS B 1 56  ? 84.242  0.078   -1.198  1.00 5.26  ? 56   LYS B CG  1 
ATOM   4656  C CD  . LYS B 1 56  ? 83.412  1.282   -0.747  1.00 5.02  ? 56   LYS B CD  1 
ATOM   4657  C CE  . LYS B 1 56  ? 83.233  2.310   -1.826  1.00 5.36  ? 56   LYS B CE  1 
ATOM   4658  N NZ  . LYS B 1 56  ? 82.230  3.342   -1.345  1.00 6.46  ? 56   LYS B NZ  1 
ATOM   4659  N N   . SER B 1 57  ? 86.807  -1.745  -2.315  1.00 5.37  ? 57   SER B N   1 
ATOM   4660  C CA  . SER B 1 57  ? 88.001  -1.467  -3.084  1.00 7.78  ? 57   SER B CA  1 
ATOM   4661  C C   . SER B 1 57  ? 88.752  -2.749  -3.472  1.00 7.28  ? 57   SER B C   1 
ATOM   4662  O O   . SER B 1 57  ? 89.567  -2.709  -4.411  1.00 6.33  ? 57   SER B O   1 
ATOM   4663  C CB  . SER B 1 57  ? 88.957  -0.393  -2.531  1.00 5.54  ? 57   SER B CB  1 
ATOM   4664  O OG  . SER B 1 57  ? 89.773  -0.955  -1.509  1.00 2.67  ? 57   SER B OG  1 
ATOM   4665  N N   . LEU B 1 58  ? 88.454  -3.891  -2.855  1.00 9.26  ? 58   LEU B N   1 
ATOM   4666  C CA  . LEU B 1 58  ? 89.121  -5.114  -3.317  1.00 8.35  ? 58   LEU B CA  1 
ATOM   4667  C C   . LEU B 1 58  ? 88.382  -5.628  -4.555  1.00 9.73  ? 58   LEU B C   1 
ATOM   4668  O O   . LEU B 1 58  ? 87.315  -5.156  -4.929  1.00 8.98  ? 58   LEU B O   1 
ATOM   4669  C CB  . LEU B 1 58  ? 89.175  -6.233  -2.319  1.00 8.16  ? 58   LEU B CB  1 
ATOM   4670  C CG  . LEU B 1 58  ? 89.380  -6.060  -0.852  1.00 10.14 ? 58   LEU B CG  1 
ATOM   4671  C CD1 . LEU B 1 58  ? 89.810  -7.404  -0.255  1.00 9.18  ? 58   LEU B CD1 1 
ATOM   4672  C CD2 . LEU B 1 58  ? 90.258  -4.892  -0.421  1.00 7.65  ? 58   LEU B CD2 1 
ATOM   4673  N N   . PRO B 1 59  ? 88.988  -6.624  -5.208  1.00 10.49 ? 59   PRO B N   1 
ATOM   4674  C CA  . PRO B 1 59  ? 88.407  -7.224  -6.390  1.00 9.57  ? 59   PRO B CA  1 
ATOM   4675  C C   . PRO B 1 59  ? 87.145  -7.972  -5.974  1.00 8.18  ? 59   PRO B C   1 
ATOM   4676  O O   . PRO B 1 59  ? 87.149  -8.607  -4.922  1.00 7.84  ? 59   PRO B O   1 
ATOM   4677  C CB  . PRO B 1 59  ? 89.445  -8.263  -6.843  1.00 10.41 ? 59   PRO B CB  1 
ATOM   4678  C CG  . PRO B 1 59  ? 90.724  -7.729  -6.269  1.00 10.95 ? 59   PRO B CG  1 
ATOM   4679  C CD  . PRO B 1 59  ? 90.298  -7.240  -4.885  1.00 9.54  ? 59   PRO B CD  1 
ATOM   4680  N N   . HIS B 1 60  ? 86.100  -7.894  -6.759  1.00 8.21  ? 60   HIS B N   1 
ATOM   4681  C CA  . HIS B 1 60  ? 84.886  -8.648  -6.500  1.00 9.66  ? 60   HIS B CA  1 
ATOM   4682  C C   . HIS B 1 60  ? 84.492  -9.373  -7.801  1.00 10.92 ? 60   HIS B C   1 
ATOM   4683  O O   . HIS B 1 60  ? 84.808  -8.859  -8.881  1.00 10.89 ? 60   HIS B O   1 
ATOM   4684  C CB  . HIS B 1 60  ? 83.689  -7.723  -6.134  1.00 8.06  ? 60   HIS B CB  1 
ATOM   4685  C CG  . HIS B 1 60  ? 83.892  -7.065  -4.791  1.00 8.73  ? 60   HIS B CG  1 
ATOM   4686  N ND1 . HIS B 1 60  ? 84.635  -5.898  -4.653  1.00 7.69  ? 60   HIS B ND1 1 
ATOM   4687  C CD2 . HIS B 1 60  ? 83.507  -7.435  -3.555  1.00 6.89  ? 60   HIS B CD2 1 
ATOM   4688  C CE1 . HIS B 1 60  ? 84.683  -5.603  -3.368  1.00 7.74  ? 60   HIS B CE1 1 
ATOM   4689  N NE2 . HIS B 1 60  ? 84.007  -6.514  -2.668  1.00 7.55  ? 60   HIS B NE2 1 
ATOM   4690  N N   . ASP B 1 61  ? 83.685  -10.438 -7.688  1.00 12.10 ? 61   ASP B N   1 
ATOM   4691  C CA  . ASP B 1 61  ? 83.193  -11.057 -8.928  1.00 13.84 ? 61   ASP B CA  1 
ATOM   4692  C C   . ASP B 1 61  ? 82.031  -10.191 -9.411  1.00 14.75 ? 61   ASP B C   1 
ATOM   4693  O O   . ASP B 1 61  ? 81.730  -9.187  -8.744  1.00 15.55 ? 61   ASP B O   1 
ATOM   4694  C CB  . ASP B 1 61  ? 82.740  -12.507 -8.714  1.00 14.00 ? 61   ASP B CB  1 
ATOM   4695  C CG  . ASP B 1 61  ? 81.529  -12.603 -7.803  1.00 15.25 ? 61   ASP B CG  1 
ATOM   4696  O OD1 . ASP B 1 61  ? 80.813  -11.609 -7.533  1.00 15.40 ? 61   ASP B OD1 1 
ATOM   4697  O OD2 . ASP B 1 61  ? 81.291  -13.717 -7.306  1.00 16.13 ? 61   ASP B OD2 1 
ATOM   4698  N N   . ASP B 1 62  ? 81.296  -10.605 -10.445 1.00 14.80 ? 62   ASP B N   1 
ATOM   4699  C CA  . ASP B 1 62  ? 80.188  -9.812  -10.938 1.00 15.58 ? 62   ASP B CA  1 
ATOM   4700  C C   . ASP B 1 62  ? 78.921  -9.852  -10.101 1.00 13.18 ? 62   ASP B C   1 
ATOM   4701  O O   . ASP B 1 62  ? 77.974  -9.182  -10.524 1.00 12.52 ? 62   ASP B O   1 
ATOM   4702  C CB  . ASP B 1 62  ? 79.808  -10.112 -12.399 1.00 20.27 ? 62   ASP B CB  1 
ATOM   4703  C CG  . ASP B 1 62  ? 80.943  -9.650  -13.307 1.00 24.67 ? 62   ASP B CG  1 
ATOM   4704  O OD1 . ASP B 1 62  ? 81.721  -8.740  -12.898 1.00 25.59 ? 62   ASP B OD1 1 
ATOM   4705  O OD2 . ASP B 1 62  ? 81.036  -10.247 -14.410 1.00 27.88 ? 62   ASP B OD2 1 
ATOM   4706  N N   . LEU B 1 63  ? 78.886  -10.569 -9.001  1.00 10.13 ? 63   LEU B N   1 
ATOM   4707  C CA  . LEU B 1 63  ? 77.788  -10.524 -8.070  1.00 10.74 ? 63   LEU B CA  1 
ATOM   4708  C C   . LEU B 1 63  ? 78.193  -9.727  -6.835  1.00 9.33  ? 63   LEU B C   1 
ATOM   4709  O O   . LEU B 1 63  ? 77.553  -9.833  -5.780  1.00 7.99  ? 63   LEU B O   1 
ATOM   4710  C CB  . LEU B 1 63  ? 77.345  -11.942 -7.611  1.00 10.93 ? 63   LEU B CB  1 
ATOM   4711  C CG  . LEU B 1 63  ? 76.926  -12.799 -8.834  1.00 11.74 ? 63   LEU B CG  1 
ATOM   4712  C CD1 . LEU B 1 63  ? 76.648  -14.246 -8.416  1.00 10.52 ? 63   LEU B CD1 1 
ATOM   4713  C CD2 . LEU B 1 63  ? 75.715  -12.169 -9.491  1.00 12.55 ? 63   LEU B CD2 1 
ATOM   4714  N N   . GLY B 1 64  ? 79.348  -9.049  -6.897  1.00 10.32 ? 64   GLY B N   1 
ATOM   4715  C CA  . GLY B 1 64  ? 79.829  -8.259  -5.762  1.00 8.67  ? 64   GLY B CA  1 
ATOM   4716  C C   . GLY B 1 64  ? 80.381  -9.076  -4.626  1.00 8.51  ? 64   GLY B C   1 
ATOM   4717  O O   . GLY B 1 64  ? 80.449  -8.571  -3.487  1.00 9.58  ? 64   GLY B O   1 
ATOM   4718  N N   . GLN B 1 65  ? 80.757  -10.335 -4.860  1.00 8.50  ? 65   GLN B N   1 
ATOM   4719  C CA  . GLN B 1 65  ? 81.320  -11.197 -3.835  1.00 8.44  ? 65   GLN B CA  1 
ATOM   4720  C C   . GLN B 1 65  ? 82.833  -11.034 -3.853  1.00 8.75  ? 65   GLN B C   1 
ATOM   4721  O O   . GLN B 1 65  ? 83.401  -11.047 -4.953  1.00 10.72 ? 65   GLN B O   1 
ATOM   4722  C CB  . GLN B 1 65  ? 80.943  -12.682 -4.044  1.00 9.08  ? 65   GLN B CB  1 
ATOM   4723  C CG  . GLN B 1 65  ? 79.416  -12.793 -3.913  1.00 10.49 ? 65   GLN B CG  1 
ATOM   4724  C CD  . GLN B 1 65  ? 78.935  -14.225 -4.213  1.00 10.96 ? 65   GLN B CD  1 
ATOM   4725  O OE1 . GLN B 1 65  ? 78.339  -14.807 -3.320  1.00 10.97 ? 65   GLN B OE1 1 
ATOM   4726  N NE2 . GLN B 1 65  ? 79.179  -14.704 -5.416  1.00 9.84  ? 65   GLN B NE2 1 
ATOM   4727  N N   . VAL B 1 66  ? 83.402  -10.941 -2.663  1.00 10.12 ? 66   VAL B N   1 
ATOM   4728  C CA  . VAL B 1 66  ? 84.838  -10.620 -2.575  1.00 10.36 ? 66   VAL B CA  1 
ATOM   4729  C C   . VAL B 1 66  ? 85.724  -11.786 -3.026  1.00 12.07 ? 66   VAL B C   1 
ATOM   4730  O O   . VAL B 1 66  ? 85.408  -12.941 -2.715  1.00 9.83  ? 66   VAL B O   1 
ATOM   4731  C CB  . VAL B 1 66  ? 85.214  -10.162 -1.159  1.00 8.09  ? 66   VAL B CB  1 
ATOM   4732  C CG1 . VAL B 1 66  ? 85.128  -11.226 -0.093  1.00 7.37  ? 66   VAL B CG1 1 
ATOM   4733  C CG2 . VAL B 1 66  ? 86.638  -9.580  -1.062  1.00 9.74  ? 66   VAL B CG2 1 
ATOM   4734  N N   . ASP B 1 67  ? 86.782  -11.426 -3.744  1.00 12.85 ? 67   ASP B N   1 
ATOM   4735  C CA  . ASP B 1 67  ? 87.766  -12.468 -4.112  1.00 14.92 ? 67   ASP B CA  1 
ATOM   4736  C C   . ASP B 1 67  ? 88.330  -13.007 -2.805  1.00 14.32 ? 67   ASP B C   1 
ATOM   4737  O O   . ASP B 1 67  ? 88.816  -12.243 -1.961  1.00 13.58 ? 67   ASP B O   1 
ATOM   4738  C CB  . ASP B 1 67  ? 88.841  -11.904 -5.030  1.00 16.78 ? 67   ASP B CB  1 
ATOM   4739  C CG  . ASP B 1 67  ? 90.012  -12.863 -5.160  1.00 20.67 ? 67   ASP B CG  1 
ATOM   4740  O OD1 . ASP B 1 67  ? 90.936  -12.889 -4.322  1.00 22.93 ? 67   ASP B OD1 1 
ATOM   4741  O OD2 . ASP B 1 67  ? 90.018  -13.694 -6.091  1.00 23.95 ? 67   ASP B OD2 1 
ATOM   4742  N N   . ALA B 1 68  ? 88.316  -14.316 -2.578  1.00 11.95 ? 68   ALA B N   1 
ATOM   4743  C CA  . ALA B 1 68  ? 88.784  -14.882 -1.328  1.00 12.99 ? 68   ALA B CA  1 
ATOM   4744  C C   . ALA B 1 68  ? 90.240  -14.602 -0.948  1.00 12.56 ? 68   ALA B C   1 
ATOM   4745  O O   . ALA B 1 68  ? 90.513  -14.414 0.246   1.00 11.99 ? 68   ALA B O   1 
ATOM   4746  C CB  . ALA B 1 68  ? 88.606  -16.415 -1.354  1.00 13.75 ? 68   ALA B CB  1 
ATOM   4747  N N   . ASP B 1 69  ? 91.162  -14.676 -1.906  1.00 12.05 ? 69   ASP B N   1 
ATOM   4748  C CA  . ASP B 1 69  ? 92.568  -14.454 -1.546  1.00 12.50 ? 69   ASP B CA  1 
ATOM   4749  C C   . ASP B 1 69  ? 92.818  -12.964 -1.238  1.00 11.49 ? 69   ASP B C   1 
ATOM   4750  O O   . ASP B 1 69  ? 93.644  -12.655 -0.402  1.00 10.20 ? 69   ASP B O   1 
ATOM   4751  C CB  . ASP B 1 69  ? 93.486  -14.811 -2.715  1.00 12.99 ? 69   ASP B CB  1 
ATOM   4752  C CG  . ASP B 1 69  ? 93.437  -16.310 -3.020  1.00 15.18 ? 69   ASP B CG  1 
ATOM   4753  O OD1 . ASP B 1 69  ? 93.103  -17.091 -2.111  1.00 16.44 ? 69   ASP B OD1 1 
ATOM   4754  O OD2 . ASP B 1 69  ? 93.781  -16.613 -4.168  1.00 16.97 ? 69   ASP B OD2 1 
ATOM   4755  N N   . ALA B 1 70  ? 92.135  -12.083 -1.969  1.00 9.84  ? 70   ALA B N   1 
ATOM   4756  C CA  . ALA B 1 70  ? 92.279  -10.643 -1.664  1.00 11.68 ? 70   ALA B CA  1 
ATOM   4757  C C   . ALA B 1 70  ? 91.845  -10.395 -0.234  1.00 12.05 ? 70   ALA B C   1 
ATOM   4758  O O   . ALA B 1 70  ? 92.518  -9.769  0.590   1.00 13.15 ? 70   ALA B O   1 
ATOM   4759  C CB  . ALA B 1 70  ? 91.487  -9.831  -2.669  1.00 8.99  ? 70   ALA B CB  1 
ATOM   4760  N N   . PHE B 1 71  ? 90.698  -10.977 0.170   1.00 12.26 ? 71   PHE B N   1 
ATOM   4761  C CA  . PHE B 1 71  ? 90.243  -10.773 1.546   1.00 11.26 ? 71   PHE B CA  1 
ATOM   4762  C C   . PHE B 1 71  ? 91.239  -11.275 2.565   1.00 12.17 ? 71   PHE B C   1 
ATOM   4763  O O   . PHE B 1 71  ? 91.421  -10.654 3.630   1.00 11.99 ? 71   PHE B O   1 
ATOM   4764  C CB  . PHE B 1 71  ? 88.847  -11.369 1.740   1.00 10.49 ? 71   PHE B CB  1 
ATOM   4765  C CG  . PHE B 1 71  ? 88.250  -10.979 3.078   1.00 10.47 ? 71   PHE B CG  1 
ATOM   4766  C CD1 . PHE B 1 71  ? 87.588  -9.764  3.198   1.00 10.38 ? 71   PHE B CD1 1 
ATOM   4767  C CD2 . PHE B 1 71  ? 88.343  -11.798 4.178   1.00 8.85  ? 71   PHE B CD2 1 
ATOM   4768  C CE1 . PHE B 1 71  ? 87.050  -9.355  4.409   1.00 9.54  ? 71   PHE B CE1 1 
ATOM   4769  C CE2 . PHE B 1 71  ? 87.795  -11.412 5.384   1.00 10.20 ? 71   PHE B CE2 1 
ATOM   4770  C CZ  . PHE B 1 71  ? 87.145  -10.187 5.504   1.00 10.39 ? 71   PHE B CZ  1 
ATOM   4771  N N   . ALA B 1 72  ? 91.888  -12.434 2.365   1.00 11.09 ? 72   ALA B N   1 
ATOM   4772  C CA  . ALA B 1 72  ? 92.906  -12.894 3.315   1.00 11.39 ? 72   ALA B CA  1 
ATOM   4773  C C   . ALA B 1 72  ? 94.103  -11.911 3.258   1.00 10.64 ? 72   ALA B C   1 
ATOM   4774  O O   . ALA B 1 72  ? 94.680  -11.636 4.304   1.00 11.88 ? 72   ALA B O   1 
ATOM   4775  C CB  . ALA B 1 72  ? 93.385  -14.305 2.982   1.00 10.42 ? 72   ALA B CB  1 
ATOM   4776  N N   . ALA B 1 73  ? 94.422  -11.327 2.107   1.00 10.15 ? 73   ALA B N   1 
ATOM   4777  C CA  . ALA B 1 73  ? 95.472  -10.297 2.083   1.00 12.52 ? 73   ALA B CA  1 
ATOM   4778  C C   . ALA B 1 73  ? 95.066  -9.079  2.933   1.00 13.17 ? 73   ALA B C   1 
ATOM   4779  O O   . ALA B 1 73  ? 95.880  -8.480  3.653   1.00 11.86 ? 73   ALA B O   1 
ATOM   4780  C CB  . ALA B 1 73  ? 95.738  -9.939  0.633   1.00 11.51 ? 73   ALA B CB  1 
ATOM   4781  N N   . LEU B 1 74  ? 93.772  -8.690  2.879   1.00 12.68 ? 74   LEU B N   1 
ATOM   4782  C CA  . LEU B 1 74  ? 93.290  -7.569  3.709   1.00 10.62 ? 74   LEU B CA  1 
ATOM   4783  C C   . LEU B 1 74  ? 93.339  -7.906  5.172   1.00 10.85 ? 74   LEU B C   1 
ATOM   4784  O O   . LEU B 1 74  ? 93.751  -7.074  6.010   1.00 12.41 ? 74   LEU B O   1 
ATOM   4785  C CB  . LEU B 1 74  ? 91.871  -7.167  3.295   1.00 9.16  ? 74   LEU B CB  1 
ATOM   4786  C CG  . LEU B 1 74  ? 91.204  -6.094  4.165   1.00 7.67  ? 74   LEU B CG  1 
ATOM   4787  C CD1 . LEU B 1 74  ? 91.958  -4.765  4.035   1.00 6.26  ? 74   LEU B CD1 1 
ATOM   4788  C CD2 . LEU B 1 74  ? 89.722  -5.972  3.781   1.00 5.19  ? 74   LEU B CD2 1 
ATOM   4789  N N   . GLU B 1 75  ? 92.982  -9.140  5.574   1.00 10.72 ? 75   GLU B N   1 
ATOM   4790  C CA  . GLU B 1 75  ? 93.110  -9.519  6.977   1.00 11.99 ? 75   GLU B CA  1 
ATOM   4791  C C   . GLU B 1 75  ? 94.572  -9.447  7.468   1.00 10.99 ? 75   GLU B C   1 
ATOM   4792  O O   . GLU B 1 75  ? 94.834  -9.173  8.645   1.00 10.71 ? 75   GLU B O   1 
ATOM   4793  C CB  . GLU B 1 75  ? 92.558  -10.898 7.308   1.00 12.64 ? 75   GLU B CB  1 
ATOM   4794  C CG  . GLU B 1 75  ? 91.021  -10.942 7.218   1.00 15.99 ? 75   GLU B CG  1 
ATOM   4795  C CD  . GLU B 1 75  ? 90.557  -12.384 7.434   1.00 17.76 ? 75   GLU B CD  1 
ATOM   4796  O OE1 . GLU B 1 75  ? 91.064  -13.257 6.695   1.00 16.91 ? 75   GLU B OE1 1 
ATOM   4797  O OE2 . GLU B 1 75  ? 89.691  -12.620 8.311   1.00 18.20 ? 75   GLU B OE2 1 
ATOM   4798  N N   . ASP B 1 76  ? 95.504  -9.822  6.620   1.00 12.03 ? 76   ASP B N   1 
ATOM   4799  C CA  . ASP B 1 76  ? 96.930  -9.779  6.996   1.00 14.03 ? 76   ASP B CA  1 
ATOM   4800  C C   . ASP B 1 76  ? 97.366  -8.316  7.153   1.00 11.91 ? 76   ASP B C   1 
ATOM   4801  O O   . ASP B 1 76  ? 98.093  -7.958  8.091   1.00 9.73  ? 76   ASP B O   1 
ATOM   4802  C CB  . ASP B 1 76  ? 97.684  -10.551 5.922   1.00 17.53 ? 76   ASP B CB  1 
ATOM   4803  C CG  . ASP B 1 76  ? 99.146  -10.793 6.221   1.00 21.66 ? 76   ASP B CG  1 
ATOM   4804  O OD1 . ASP B 1 76  ? 99.529  -10.986 7.395   1.00 23.44 ? 76   ASP B OD1 1 
ATOM   4805  O OD2 . ASP B 1 76  ? 99.906  -10.802 5.219   1.00 24.34 ? 76   ASP B OD2 1 
ATOM   4806  N N   . CYS B 1 77  ? 96.846  -7.465  6.278   1.00 10.79 ? 77   CYS B N   1 
ATOM   4807  C CA  . CYS B 1 77  ? 97.096  -6.014  6.352   1.00 11.01 ? 77   CYS B CA  1 
ATOM   4808  C C   . CYS B 1 77  ? 96.564  -5.434  7.656   1.00 10.40 ? 77   CYS B C   1 
ATOM   4809  O O   . CYS B 1 77  ? 97.301  -4.805  8.460   1.00 8.94  ? 77   CYS B O   1 
ATOM   4810  C CB  . CYS B 1 77  ? 96.545  -5.279  5.138   1.00 9.79  ? 77   CYS B CB  1 
ATOM   4811  S SG  . CYS B 1 77  ? 96.082  -3.543  5.499   1.00 8.64  ? 77   CYS B SG  1 
ATOM   4812  N N   . ILE B 1 78  ? 95.336  -5.818  8.027   1.00 9.23  ? 78   ILE B N   1 
ATOM   4813  C CA  . ILE B 1 78  ? 94.744  -5.380  9.281   1.00 7.86  ? 78   ILE B CA  1 
ATOM   4814  C C   . ILE B 1 78  ? 95.503  -5.839  10.500  1.00 8.56  ? 78   ILE B C   1 
ATOM   4815  O O   . ILE B 1 78  ? 95.627  -5.095  11.484  1.00 5.14  ? 78   ILE B O   1 
ATOM   4816  C CB  . ILE B 1 78  ? 93.257  -5.865  9.363   1.00 8.05  ? 78   ILE B CB  1 
ATOM   4817  C CG1 . ILE B 1 78  ? 92.440  -5.062  8.338   1.00 6.65  ? 78   ILE B CG1 1 
ATOM   4818  C CG2 . ILE B 1 78  ? 92.691  -5.799  10.765  1.00 8.95  ? 78   ILE B CG2 1 
ATOM   4819  C CD1 . ILE B 1 78  ? 91.081  -5.615  7.981   1.00 4.04  ? 78   ILE B CD1 1 
ATOM   4820  N N   . LEU B 1 79  ? 95.912  -7.110  10.522  1.00 8.15  ? 79   LEU B N   1 
ATOM   4821  C CA  . LEU B 1 79  ? 96.607  -7.669  11.659  1.00 8.87  ? 79   LEU B CA  1 
ATOM   4822  C C   . LEU B 1 79  ? 98.003  -7.134  11.964  1.00 8.41  ? 79   LEU B C   1 
ATOM   4823  O O   . LEU B 1 79  ? 98.339  -7.092  13.159  1.00 8.48  ? 79   LEU B O   1 
ATOM   4824  C CB  . LEU B 1 79  ? 96.813  -9.194  11.375  1.00 9.81  ? 79   LEU B CB  1 
ATOM   4825  C CG  . LEU B 1 79  ? 97.617  -9.985  12.387  1.00 10.32 ? 79   LEU B CG  1 
ATOM   4826  C CD1 . LEU B 1 79  ? 96.925  -10.007 13.735  1.00 11.72 ? 79   LEU B CD1 1 
ATOM   4827  C CD2 . LEU B 1 79  ? 97.858  -11.441 11.918  1.00 13.26 ? 79   LEU B CD2 1 
ATOM   4828  N N   . ASN B 1 80  ? 98.815  -6.839  10.968  1.00 9.11  ? 80   ASN B N   1 
ATOM   4829  C CA  . ASN B 1 80  ? 100.236 -6.592  11.191  1.00 11.38 ? 80   ASN B CA  1 
ATOM   4830  C C   . ASN B 1 80  ? 100.793 -5.193  11.366  1.00 13.34 ? 80   ASN B C   1 
ATOM   4831  O O   . ASN B 1 80  ? 102.021 -5.104  11.591  1.00 11.66 ? 80   ASN B O   1 
ATOM   4832  C CB  . ASN B 1 80  ? 101.018 -7.288  10.031  1.00 10.61 ? 80   ASN B CB  1 
ATOM   4833  C CG  . ASN B 1 80  ? 100.920 -8.790  10.300  1.00 11.44 ? 80   ASN B CG  1 
ATOM   4834  O OD1 . ASN B 1 80  ? 101.254 -9.206  11.411  1.00 14.37 ? 80   ASN B OD1 1 
ATOM   4835  N ND2 . ASN B 1 80  ? 100.407 -9.559  9.373   1.00 8.96  ? 80   ASN B ND2 1 
ATOM   4836  N N   . GLY B 1 81  ? 99.990  -4.130  11.277  1.00 11.39 ? 81   GLY B N   1 
ATOM   4837  C CA  . GLY B 1 81  ? 100.489 -2.783  11.522  1.00 11.74 ? 81   GLY B CA  1 
ATOM   4838  C C   . GLY B 1 81  ? 101.694 -2.436  10.659  1.00 11.80 ? 81   GLY B C   1 
ATOM   4839  O O   . GLY B 1 81  ? 102.584 -1.731  11.107  1.00 14.34 ? 81   GLY B O   1 
ATOM   4840  N N   . ASP B 1 82  ? 101.679 -2.844  9.411   1.00 10.91 ? 82   ASP B N   1 
ATOM   4841  C CA  . ASP B 1 82  ? 102.764 -2.746  8.477   1.00 11.20 ? 82   ASP B CA  1 
ATOM   4842  C C   . ASP B 1 82  ? 102.315 -2.121  7.187   1.00 10.50 ? 82   ASP B C   1 
ATOM   4843  O O   . ASP B 1 82  ? 101.449 -2.689  6.509   1.00 12.70 ? 82   ASP B O   1 
ATOM   4844  C CB  . ASP B 1 82  ? 103.320 -4.153  8.166   1.00 11.28 ? 82   ASP B CB  1 
ATOM   4845  C CG  . ASP B 1 82  ? 104.571 -4.051  7.321   1.00 14.34 ? 82   ASP B CG  1 
ATOM   4846  O OD1 . ASP B 1 82  ? 104.546 -3.877  6.095   1.00 16.73 ? 82   ASP B OD1 1 
ATOM   4847  O OD2 . ASP B 1 82  ? 105.677 -4.104  7.899   1.00 18.19 ? 82   ASP B OD2 1 
ATOM   4848  N N   . LEU B 1 83  ? 102.896 -0.983  6.835   1.00 10.10 ? 83   LEU B N   1 
ATOM   4849  C CA  . LEU B 1 83  ? 102.487 -0.282  5.635   1.00 11.84 ? 83   LEU B CA  1 
ATOM   4850  C C   . LEU B 1 83  ? 102.670 -1.140  4.389   1.00 13.17 ? 83   LEU B C   1 
ATOM   4851  O O   . LEU B 1 83  ? 101.867 -1.091  3.472   1.00 13.28 ? 83   LEU B O   1 
ATOM   4852  C CB  . LEU B 1 83  ? 103.275 0.977   5.368   1.00 12.70 ? 83   LEU B CB  1 
ATOM   4853  C CG  . LEU B 1 83  ? 102.891 2.390   5.714   1.00 14.34 ? 83   LEU B CG  1 
ATOM   4854  C CD1 . LEU B 1 83  ? 103.972 3.313   5.099   1.00 13.18 ? 83   LEU B CD1 1 
ATOM   4855  C CD2 . LEU B 1 83  ? 101.508 2.812   5.219   1.00 13.20 ? 83   LEU B CD2 1 
ATOM   4856  N N   . SER B 1 84  ? 103.841 -1.764  4.290   1.00 13.52 ? 84   SER B N   1 
ATOM   4857  C CA  . SER B 1 84  ? 104.201 -2.566  3.134   1.00 12.82 ? 84   SER B CA  1 
ATOM   4858  C C   . SER B 1 84  ? 103.222 -3.711  2.876   1.00 9.68  ? 84   SER B C   1 
ATOM   4859  O O   . SER B 1 84  ? 102.824 -3.967  1.749   1.00 10.09 ? 84   SER B O   1 
ATOM   4860  C CB  . SER B 1 84  ? 105.606 -3.192  3.425   1.00 14.41 ? 84   SER B CB  1 
ATOM   4861  O OG  . SER B 1 84  ? 106.011 -3.695  2.158   1.00 18.05 ? 84   SER B OG  1 
ATOM   4862  N N   . ILE B 1 85  ? 102.814 -4.393  3.920   1.00 9.15  ? 85   ILE B N   1 
ATOM   4863  C CA  . ILE B 1 85  ? 101.828 -5.490  3.772   1.00 10.59 ? 85   ILE B CA  1 
ATOM   4864  C C   . ILE B 1 85  ? 100.506 -4.958  3.283   1.00 11.96 ? 85   ILE B C   1 
ATOM   4865  O O   . ILE B 1 85  ? 99.930  -5.448  2.286   1.00 14.65 ? 85   ILE B O   1 
ATOM   4866  C CB  . ILE B 1 85  ? 101.755 -6.268  5.084   1.00 11.44 ? 85   ILE B CB  1 
ATOM   4867  C CG1 . ILE B 1 85  ? 103.092 -7.063  5.204   1.00 9.60  ? 85   ILE B CG1 1 
ATOM   4868  C CG2 . ILE B 1 85  ? 100.562 -7.217  5.152   1.00 11.66 ? 85   ILE B CG2 1 
ATOM   4869  C CD1 . ILE B 1 85  ? 103.176 -7.832  6.508   1.00 8.20  ? 85   ILE B CD1 1 
ATOM   4870  N N   . CYS B 1 86  ? 100.094 -3.785  3.779   1.00 10.64 ? 86   CYS B N   1 
ATOM   4871  C CA  . CYS B 1 86  ? 98.857  -3.155  3.319   1.00 9.75  ? 86   CYS B CA  1 
ATOM   4872  C C   . CYS B 1 86  ? 98.984  -2.681  1.898   1.00 10.61 ? 86   CYS B C   1 
ATOM   4873  O O   . CYS B 1 86  ? 97.970  -2.719  1.160   1.00 12.30 ? 86   CYS B O   1 
ATOM   4874  C CB  . CYS B 1 86  ? 98.420  -2.059  4.314   1.00 7.18  ? 86   CYS B CB  1 
ATOM   4875  S SG  . CYS B 1 86  ? 97.945  -2.704  5.910   1.00 6.24  ? 86   CYS B SG  1 
ATOM   4876  N N   . GLU B 1 87  ? 100.176 -2.371  1.367   1.00 9.49  ? 87   GLU B N   1 
ATOM   4877  C CA  . GLU B 1 87  ? 100.300 -2.027  -0.030  1.00 9.03  ? 87   GLU B CA  1 
ATOM   4878  C C   . GLU B 1 87  ? 100.131 -3.281  -0.915  1.00 10.73 ? 87   GLU B C   1 
ATOM   4879  O O   . GLU B 1 87  ? 99.896  -3.137  -2.127  1.00 10.35 ? 87   GLU B O   1 
ATOM   4880  C CB  . GLU B 1 87  ? 101.629 -1.364  -0.402  1.00 11.98 ? 87   GLU B CB  1 
ATOM   4881  C CG  . GLU B 1 87  ? 101.816 0.095   -0.013  1.00 12.24 ? 87   GLU B CG  1 
ATOM   4882  C CD  . GLU B 1 87  ? 100.721 0.984   -0.576  1.00 11.50 ? 87   GLU B CD  1 
ATOM   4883  O OE1 . GLU B 1 87  ? 100.699 1.214   -1.804  1.00 11.23 ? 87   GLU B OE1 1 
ATOM   4884  O OE2 . GLU B 1 87  ? 99.873  1.408   0.248   1.00 10.87 ? 87   GLU B OE2 1 
ATOM   4885  N N   . ASP B 1 88  ? 100.239 -4.484  -0.366  1.00 9.22  ? 88   ASP B N   1 
ATOM   4886  C CA  . ASP B 1 88  ? 100.021 -5.680  -1.182  1.00 11.18 ? 88   ASP B CA  1 
ATOM   4887  C C   . ASP B 1 88  ? 98.538  -6.024  -1.279  1.00 11.51 ? 88   ASP B C   1 
ATOM   4888  O O   . ASP B 1 88  ? 98.246  -7.062  -1.868  1.00 11.10 ? 88   ASP B O   1 
ATOM   4889  C CB  . ASP B 1 88  ? 100.749 -6.890  -0.543  1.00 9.94  ? 88   ASP B CB  1 
ATOM   4890  C CG  . ASP B 1 88  ? 102.264 -6.732  -0.541  1.00 11.19 ? 88   ASP B CG  1 
ATOM   4891  O OD1 . ASP B 1 88  ? 102.780 -6.095  -1.465  1.00 8.26  ? 88   ASP B OD1 1 
ATOM   4892  O OD2 . ASP B 1 88  ? 102.912 -7.273  0.395   1.00 12.47 ? 88   ASP B OD2 1 
ATOM   4893  N N   . VAL B 1 89  ? 97.608  -5.318  -0.606  1.00 11.39 ? 89   VAL B N   1 
ATOM   4894  C CA  . VAL B 1 89  ? 96.199  -5.760  -0.763  1.00 10.23 ? 89   VAL B CA  1 
ATOM   4895  C C   . VAL B 1 89  ? 95.746  -5.461  -2.161  1.00 9.57  ? 89   VAL B C   1 
ATOM   4896  O O   . VAL B 1 89  ? 95.844  -4.318  -2.655  1.00 10.58 ? 89   VAL B O   1 
ATOM   4897  C CB  . VAL B 1 89  ? 95.313  -5.059  0.303   1.00 10.21 ? 89   VAL B CB  1 
ATOM   4898  C CG1 . VAL B 1 89  ? 93.848  -5.433  0.093   1.00 9.09  ? 89   VAL B CG1 1 
ATOM   4899  C CG2 . VAL B 1 89  ? 95.776  -5.413  1.706   1.00 7.16  ? 89   VAL B CG2 1 
ATOM   4900  N N   . PRO B 1 90  ? 95.181  -6.433  -2.879  1.00 9.51  ? 90   PRO B N   1 
ATOM   4901  C CA  . PRO B 1 90  ? 94.755  -6.220  -4.253  1.00 9.25  ? 90   PRO B CA  1 
ATOM   4902  C C   . PRO B 1 90  ? 93.689  -5.129  -4.369  1.00 10.30 ? 90   PRO B C   1 
ATOM   4903  O O   . PRO B 1 90  ? 92.944  -4.883  -3.408  1.00 8.49  ? 90   PRO B O   1 
ATOM   4904  C CB  . PRO B 1 90  ? 94.233  -7.595  -4.694  1.00 10.15 ? 90   PRO B CB  1 
ATOM   4905  C CG  . PRO B 1 90  ? 94.898  -8.573  -3.759  1.00 10.03 ? 90   PRO B CG  1 
ATOM   4906  C CD  . PRO B 1 90  ? 95.037  -7.850  -2.444  1.00 8.71  ? 90   PRO B CD  1 
ATOM   4907  N N   . VAL B 1 91  ? 93.565  -4.478  -5.507  1.00 10.30 ? 91   VAL B N   1 
ATOM   4908  C CA  . VAL B 1 91  ? 92.592  -3.445  -5.763  1.00 13.19 ? 91   VAL B CA  1 
ATOM   4909  C C   . VAL B 1 91  ? 91.768  -3.939  -6.970  1.00 13.57 ? 91   VAL B C   1 
ATOM   4910  O O   . VAL B 1 91  ? 92.338  -4.489  -7.919  1.00 13.02 ? 91   VAL B O   1 
ATOM   4911  C CB  . VAL B 1 91  ? 93.072  -2.064  -6.243  1.00 14.88 ? 91   VAL B CB  1 
ATOM   4912  C CG1 . VAL B 1 91  ? 92.272  -0.942  -5.599  1.00 14.54 ? 91   VAL B CG1 1 
ATOM   4913  C CG2 . VAL B 1 91  ? 94.559  -1.877  -6.130  1.00 17.36 ? 91   VAL B CG2 1 
ATOM   4914  N N   . GLY B 1 92  ? 90.464  -3.671  -6.941  1.00 13.45 ? 92   GLY B N   1 
ATOM   4915  C CA  . GLY B 1 92  ? 89.552  -4.159  -7.959  1.00 10.45 ? 92   GLY B CA  1 
ATOM   4916  C C   . GLY B 1 92  ? 89.461  -3.278  -9.161  1.00 12.42 ? 92   GLY B C   1 
ATOM   4917  O O   . GLY B 1 92  ? 88.657  -3.513  -10.061 1.00 12.24 ? 92   GLY B O   1 
ATOM   4918  N N   . ASN B 1 93  ? 90.191  -2.151  -9.150  1.00 11.63 ? 93   ASN B N   1 
ATOM   4919  C CA  . ASN B 1 93  ? 90.105  -1.211  -10.272 1.00 11.70 ? 93   ASN B CA  1 
ATOM   4920  C C   . ASN B 1 93  ? 91.452  -0.480  -10.313 1.00 12.96 ? 93   ASN B C   1 
ATOM   4921  O O   . ASN B 1 93  ? 91.971  -0.085  -9.277  1.00 11.82 ? 93   ASN B O   1 
ATOM   4922  C CB  . ASN B 1 93  ? 88.932  -0.239  -10.119 1.00 11.79 ? 93   ASN B CB  1 
ATOM   4923  C CG  . ASN B 1 93  ? 88.946  0.834   -11.187 1.00 11.26 ? 93   ASN B CG  1 
ATOM   4924  O OD1 . ASN B 1 93  ? 89.719  1.798   -11.135 1.00 11.94 ? 93   ASN B OD1 1 
ATOM   4925  N ND2 . ASN B 1 93  ? 88.090  0.708   -12.173 1.00 11.29 ? 93   ASN B ND2 1 
ATOM   4926  N N   . SER B 1 94  ? 91.975  -0.355  -11.502 1.00 15.46 ? 94   SER B N   1 
ATOM   4927  C CA  . SER B 1 94  ? 93.292  0.188   -11.740 1.00 19.57 ? 94   SER B CA  1 
ATOM   4928  C C   . SER B 1 94  ? 93.471  1.648   -12.023 1.00 20.43 ? 94   SER B C   1 
ATOM   4929  O O   . SER B 1 94  ? 94.593  2.118   -12.258 1.00 21.50 ? 94   SER B O   1 
ATOM   4930  C CB  . SER B 1 94  ? 93.770  -0.519  -13.072 1.00 20.39 ? 94   SER B CB  1 
ATOM   4931  O OG  . SER B 1 94  ? 94.772  -1.376  -12.563 1.00 23.68 ? 94   SER B OG  1 
ATOM   4932  N N   . GLU B 1 95  ? 92.377  2.394   -12.057 1.00 21.61 ? 95   GLU B N   1 
ATOM   4933  C CA  . GLU B 1 95  ? 92.468  3.816   -12.409 1.00 20.93 ? 95   GLU B CA  1 
ATOM   4934  C C   . GLU B 1 95  ? 93.258  4.632   -11.418 1.00 20.06 ? 95   GLU B C   1 
ATOM   4935  O O   . GLU B 1 95  ? 93.616  5.768   -11.771 1.00 20.07 ? 95   GLU B O   1 
ATOM   4936  C CB  . GLU B 1 95  ? 91.032  4.282   -12.689 1.00 22.57 ? 95   GLU B CB  1 
ATOM   4937  C CG  . GLU B 1 95  ? 90.449  3.437   -13.818 1.00 23.72 ? 95   GLU B CG  1 
ATOM   4938  C CD  . GLU B 1 95  ? 89.076  3.818   -14.305 1.00 24.75 ? 95   GLU B CD  1 
ATOM   4939  O OE1 . GLU B 1 95  ? 88.950  4.915   -14.891 1.00 25.30 ? 95   GLU B OE1 1 
ATOM   4940  O OE2 . GLU B 1 95  ? 88.107  3.035   -14.145 1.00 24.96 ? 95   GLU B OE2 1 
ATOM   4941  N N   . GLY B 1 96  ? 93.566  4.162   -10.211 1.00 17.42 ? 96   GLY B N   1 
ATOM   4942  C CA  . GLY B 1 96  ? 94.356  4.961   -9.286  1.00 16.73 ? 96   GLY B CA  1 
ATOM   4943  C C   . GLY B 1 96  ? 93.594  6.106   -8.629  1.00 17.41 ? 96   GLY B C   1 
ATOM   4944  O O   . GLY B 1 96  ? 94.202  7.033   -8.054  1.00 16.71 ? 96   GLY B O   1 
ATOM   4945  N N   . ASP B 1 97  ? 92.257  6.048   -8.635  1.00 14.42 ? 97   ASP B N   1 
ATOM   4946  C CA  . ASP B 1 97  ? 91.503  7.128   -8.002  1.00 12.56 ? 97   ASP B CA  1 
ATOM   4947  C C   . ASP B 1 97  ? 91.711  7.040   -6.508  1.00 11.79 ? 97   ASP B C   1 
ATOM   4948  O O   . ASP B 1 97  ? 91.544  5.977   -5.893  1.00 11.57 ? 97   ASP B O   1 
ATOM   4949  C CB  . ASP B 1 97  ? 90.004  6.978   -8.292  1.00 13.69 ? 97   ASP B CB  1 
ATOM   4950  C CG  . ASP B 1 97  ? 89.267  8.284   -8.011  1.00 12.75 ? 97   ASP B CG  1 
ATOM   4951  O OD1 . ASP B 1 97  ? 89.020  8.537   -6.817  1.00 11.24 ? 97   ASP B OD1 1 
ATOM   4952  O OD2 . ASP B 1 97  ? 88.985  9.007   -8.981  1.00 14.25 ? 97   ASP B OD2 1 
ATOM   4953  N N   . PRO B 1 98  ? 91.915  8.187   -5.855  1.00 10.81 ? 98   PRO B N   1 
ATOM   4954  C CA  . PRO B 1 98  ? 92.019  8.234   -4.408  1.00 9.36  ? 98   PRO B CA  1 
ATOM   4955  C C   . PRO B 1 98  ? 90.832  7.658   -3.666  1.00 7.82  ? 98   PRO B C   1 
ATOM   4956  O O   . PRO B 1 98  ? 91.051  7.110   -2.569  1.00 5.54  ? 98   PRO B O   1 
ATOM   4957  C CB  . PRO B 1 98  ? 92.251  9.711   -4.097  1.00 11.58 ? 98   PRO B CB  1 
ATOM   4958  C CG  . PRO B 1 98  ? 91.945  10.448  -5.345  1.00 12.31 ? 98   PRO B CG  1 
ATOM   4959  C CD  . PRO B 1 98  ? 92.061  9.503   -6.507  1.00 10.66 ? 98   PRO B CD  1 
ATOM   4960  N N   . VAL B 1 99  ? 89.586  7.605   -4.195  1.00 7.37  ? 99   VAL B N   1 
ATOM   4961  C CA  . VAL B 1 99  ? 88.490  6.969   -3.433  1.00 6.88  ? 99   VAL B CA  1 
ATOM   4962  C C   . VAL B 1 99  ? 88.676  5.474   -3.201  1.00 7.00  ? 99   VAL B C   1 
ATOM   4963  O O   . VAL B 1 99  ? 88.177  4.884   -2.222  1.00 6.43  ? 99   VAL B O   1 
ATOM   4964  C CB  . VAL B 1 99  ? 87.096  7.167   -4.056  1.00 7.45  ? 99   VAL B CB  1 
ATOM   4965  C CG1 . VAL B 1 99  ? 86.737  8.634   -4.252  1.00 4.99  ? 99   VAL B CG1 1 
ATOM   4966  C CG2 . VAL B 1 99  ? 86.949  6.407   -5.373  1.00 6.13  ? 99   VAL B CG2 1 
ATOM   4967  N N   . GLY B 1 100 ? 89.510  4.828   -4.004  1.00 7.63  ? 100  GLY B N   1 
ATOM   4968  C CA  . GLY B 1 100 ? 89.867  3.424   -3.874  1.00 7.22  ? 100  GLY B CA  1 
ATOM   4969  C C   . GLY B 1 100 ? 90.900  3.106   -2.815  1.00 8.20  ? 100  GLY B C   1 
ATOM   4970  O O   . GLY B 1 100 ? 91.038  1.921   -2.417  1.00 5.67  ? 100  GLY B O   1 
ATOM   4971  N N   . ARG B 1 101 ? 91.684  4.101   -2.340  1.00 6.74  ? 101  ARG B N   1 
ATOM   4972  C CA  . ARG B 1 101 ? 92.655  3.757   -1.279  1.00 5.71  ? 101  ARG B CA  1 
ATOM   4973  C C   . ARG B 1 101 ? 92.032  3.267   0.009   1.00 7.21  ? 101  ARG B C   1 
ATOM   4974  O O   . ARG B 1 101 ? 91.041  3.858   0.482   1.00 7.72  ? 101  ARG B O   1 
ATOM   4975  C CB  . ARG B 1 101 ? 93.501  5.013   -0.989  1.00 5.33  ? 101  ARG B CB  1 
ATOM   4976  C CG  . ARG B 1 101 ? 94.186  5.582   -2.235  1.00 5.76  ? 101  ARG B CG  1 
ATOM   4977  C CD  . ARG B 1 101 ? 95.102  6.771   -1.795  1.00 5.00  ? 101  ARG B CD  1 
ATOM   4978  N NE  . ARG B 1 101 ? 95.852  7.184   -2.994  1.00 6.57  ? 101  ARG B NE  1 
ATOM   4979  C CZ  . ARG B 1 101 ? 97.208  7.225   -2.951  1.00 7.90  ? 101  ARG B CZ  1 
ATOM   4980  N NH1 . ARG B 1 101 ? 97.858  6.931   -1.835  1.00 5.34  ? 101  ARG B NH1 1 
ATOM   4981  N NH2 . ARG B 1 101 ? 97.817  7.572   -4.083  1.00 6.11  ? 101  ARG B NH2 1 
ATOM   4982  N N   . LEU B 1 102 ? 92.644  2.290   0.702   1.00 6.10  ? 102  LEU B N   1 
ATOM   4983  C CA  . LEU B 1 102 ? 92.227  1.827   2.001   1.00 6.48  ? 102  LEU B CA  1 
ATOM   4984  C C   . LEU B 1 102 ? 92.507  2.969   3.004   1.00 7.52  ? 102  LEU B C   1 
ATOM   4985  O O   . LEU B 1 102 ? 93.601  3.542   2.978   1.00 5.41  ? 102  LEU B O   1 
ATOM   4986  C CB  . LEU B 1 102 ? 93.048  0.594   2.456   1.00 6.68  ? 102  LEU B CB  1 
ATOM   4987  C CG  . LEU B 1 102 ? 92.937  -0.659  1.584   1.00 5.85  ? 102  LEU B CG  1 
ATOM   4988  C CD1 . LEU B 1 102 ? 93.818  -1.810  2.068   1.00 6.90  ? 102  LEU B CD1 1 
ATOM   4989  C CD2 . LEU B 1 102 ? 91.506  -1.200  1.601   1.00 5.81  ? 102  LEU B CD2 1 
ATOM   4990  N N   . VAL B 1 103 ? 91.542  3.309   3.873   1.00 4.90  ? 103  VAL B N   1 
ATOM   4991  C CA  . VAL B 1 103 ? 91.772  4.453   4.760   1.00 4.75  ? 103  VAL B CA  1 
ATOM   4992  C C   . VAL B 1 103 ? 92.484  4.085   6.041   1.00 4.08  ? 103  VAL B C   1 
ATOM   4993  O O   . VAL B 1 103 ? 91.949  3.590   7.038   1.00 4.58  ? 103  VAL B O   1 
ATOM   4994  C CB  . VAL B 1 103 ? 90.471  5.244   5.030   1.00 3.76  ? 103  VAL B CB  1 
ATOM   4995  C CG1 . VAL B 1 103 ? 90.696  6.471   5.931   1.00 4.77  ? 103  VAL B CG1 1 
ATOM   4996  C CG2 . VAL B 1 103 ? 89.851  5.751   3.724   1.00 2.08  ? 103  VAL B CG2 1 
ATOM   4997  N N   . ASN B 1 104 ? 93.827  4.286   6.044   1.00 4.68  ? 104  ASN B N   1 
ATOM   4998  C CA  . ASN B 1 104 ? 94.687  4.097   7.196   1.00 3.62  ? 104  ASN B CA  1 
ATOM   4999  C C   . ASN B 1 104 ? 94.392  2.888   8.038   1.00 3.18  ? 104  ASN B C   1 
ATOM   5000  O O   . ASN B 1 104 ? 94.274  2.973   9.259   1.00 2.66  ? 104  ASN B O   1 
ATOM   5001  C CB  . ASN B 1 104 ? 94.438  5.368   8.065   1.00 2.90  ? 104  ASN B CB  1 
ATOM   5002  C CG  . ASN B 1 104 ? 95.630  5.784   8.906   1.00 6.34  ? 104  ASN B CG  1 
ATOM   5003  O OD1 . ASN B 1 104 ? 95.472  6.671   9.776   1.00 5.02  ? 104  ASN B OD1 1 
ATOM   5004  N ND2 . ASN B 1 104 ? 96.814  5.170   8.681   1.00 2.21  ? 104  ASN B ND2 1 
ATOM   5005  N N   . PRO B 1 105 ? 94.451  1.644   7.506   1.00 5.19  ? 105  PRO B N   1 
ATOM   5006  C CA  . PRO B 1 105 ? 94.189  0.432   8.273   1.00 5.79  ? 105  PRO B CA  1 
ATOM   5007  C C   . PRO B 1 105 ? 95.117  0.130   9.421   1.00 5.68  ? 105  PRO B C   1 
ATOM   5008  O O   . PRO B 1 105 ? 94.758  -0.530  10.416  1.00 5.02  ? 105  PRO B O   1 
ATOM   5009  C CB  . PRO B 1 105 ? 94.198  -0.669  7.201   1.00 7.48  ? 105  PRO B CB  1 
ATOM   5010  C CG  . PRO B 1 105 ? 95.013  -0.129  6.058   1.00 5.58  ? 105  PRO B CG  1 
ATOM   5011  C CD  . PRO B 1 105 ? 94.720  1.364   6.077   1.00 4.58  ? 105  PRO B CD  1 
ATOM   5012  N N   . THR B 1 106 ? 96.357  0.633   9.403   1.00 6.64  ? 106  THR B N   1 
ATOM   5013  C CA  . THR B 1 106 ? 97.328  0.429   10.491  1.00 5.25  ? 106  THR B CA  1 
ATOM   5014  C C   . THR B 1 106 ? 97.204  1.460   11.607  1.00 5.56  ? 106  THR B C   1 
ATOM   5015  O O   . THR B 1 106 ? 97.891  1.396   12.645  1.00 4.02  ? 106  THR B O   1 
ATOM   5016  C CB  . THR B 1 106 ? 98.763  0.541   9.895   1.00 7.43  ? 106  THR B CB  1 
ATOM   5017  O OG1 . THR B 1 106 ? 99.006  1.877   9.446   1.00 8.01  ? 106  THR B OG1 1 
ATOM   5018  C CG2 . THR B 1 106 ? 98.970  -0.363  8.675   1.00 4.66  ? 106  THR B CG2 1 
ATOM   5019  N N   . ALA B 1 107 ? 96.270  2.419   11.485  1.00 4.81  ? 107  ALA B N   1 
ATOM   5020  C CA  . ALA B 1 107 ? 96.167  3.502   12.479  1.00 4.71  ? 107  ALA B CA  1 
ATOM   5021  C C   . ALA B 1 107 ? 96.033  3.127   13.909  1.00 4.03  ? 107  ALA B C   1 
ATOM   5022  O O   . ALA B 1 107 ? 96.635  3.754   14.791  1.00 6.26  ? 107  ALA B O   1 
ATOM   5023  C CB  . ALA B 1 107 ? 94.980  4.428   12.120  1.00 4.11  ? 107  ALA B CB  1 
ATOM   5024  N N   . ALA B 1 108 ? 95.231  2.091   14.210  1.00 4.73  ? 108  ALA B N   1 
ATOM   5025  C CA  . ALA B 1 108 ? 94.970  1.704   15.574  1.00 4.96  ? 108  ALA B CA  1 
ATOM   5026  C C   . ALA B 1 108 ? 96.198  1.330   16.384  1.00 4.48  ? 108  ALA B C   1 
ATOM   5027  O O   . ALA B 1 108 ? 96.151  1.522   17.594  1.00 3.52  ? 108  ALA B O   1 
ATOM   5028  C CB  . ALA B 1 108 ? 94.073  0.451   15.563  1.00 6.19  ? 108  ALA B CB  1 
ATOM   5029  N N   . PHE B 1 109 ? 97.195  0.709   15.744  1.00 6.05  ? 109  PHE B N   1 
ATOM   5030  C CA  . PHE B 1 109 ? 98.378  0.236   16.483  1.00 6.44  ? 109  PHE B CA  1 
ATOM   5031  C C   . PHE B 1 109 ? 99.331  1.346   16.882  1.00 6.70  ? 109  PHE B C   1 
ATOM   5032  O O   . PHE B 1 109 ? 100.455 1.454   16.404  1.00 6.65  ? 109  PHE B O   1 
ATOM   5033  C CB  . PHE B 1 109 ? 99.129  -0.834  15.622  1.00 5.05  ? 109  PHE B CB  1 
ATOM   5034  C CG  . PHE B 1 109 ? 98.260  -2.083  15.512  1.00 5.31  ? 109  PHE B CG  1 
ATOM   5035  C CD1 . PHE B 1 109 ? 97.874  -2.736  16.659  1.00 3.83  ? 109  PHE B CD1 1 
ATOM   5036  C CD2 . PHE B 1 109 ? 97.840  -2.565  14.289  1.00 6.31  ? 109  PHE B CD2 1 
ATOM   5037  C CE1 . PHE B 1 109 ? 97.094  -3.879  16.621  1.00 4.60  ? 109  PHE B CE1 1 
ATOM   5038  C CE2 . PHE B 1 109 ? 97.070  -3.726  14.225  1.00 5.78  ? 109  PHE B CE2 1 
ATOM   5039  C CZ  . PHE B 1 109 ? 96.687  -4.358  15.403  1.00 4.13  ? 109  PHE B CZ  1 
ATOM   5040  N N   . ALA B 1 110 ? 98.887  2.193   17.787  1.00 6.68  ? 110  ALA B N   1 
ATOM   5041  C CA  . ALA B 1 110 ? 99.740  3.281   18.309  1.00 7.72  ? 110  ALA B CA  1 
ATOM   5042  C C   . ALA B 1 110 ? 99.289  3.495   19.726  1.00 6.63  ? 110  ALA B C   1 
ATOM   5043  O O   . ALA B 1 110 ? 98.096  3.787   19.966  1.00 10.84 ? 110  ALA B O   1 
ATOM   5044  C CB  . ALA B 1 110 ? 99.665  4.499   17.417  1.00 5.22  ? 110  ALA B CB  1 
ATOM   5045  N N   . ILE B 1 111 ? 100.150 3.310   20.699  1.00 5.50  ? 111  ILE B N   1 
ATOM   5046  C CA  . ILE B 1 111 ? 99.807  3.555   22.075  1.00 5.23  ? 111  ILE B CA  1 
ATOM   5047  C C   . ILE B 1 111 ? 99.987  5.047   22.385  1.00 8.44  ? 111  ILE B C   1 
ATOM   5048  O O   . ILE B 1 111 ? 101.112 5.526   22.552  1.00 8.24  ? 111  ILE B O   1 
ATOM   5049  C CB  . ILE B 1 111 ? 100.633 2.685   23.054  1.00 5.38  ? 111  ILE B CB  1 
ATOM   5050  C CG1 . ILE B 1 111 ? 100.430 1.205   22.638  1.00 4.48  ? 111  ILE B CG1 1 
ATOM   5051  C CG2 . ILE B 1 111 ? 100.150 2.969   24.461  1.00 2.33  ? 111  ILE B CG2 1 
ATOM   5052  C CD1 . ILE B 1 111 ? 101.465 0.253   23.176  1.00 6.23  ? 111  ILE B CD1 1 
ATOM   5053  N N   . ASP B 1 112 ? 98.867  5.765   22.534  1.00 7.72  ? 112  ASP B N   1 
ATOM   5054  C CA  . ASP B 1 112 ? 98.953  7.198   22.840  1.00 7.70  ? 112  ASP B CA  1 
ATOM   5055  C C   . ASP B 1 112 ? 99.314  7.307   24.302  1.00 5.86  ? 112  ASP B C   1 
ATOM   5056  O O   . ASP B 1 112 ? 98.822  6.522   25.123  1.00 5.20  ? 112  ASP B O   1 
ATOM   5057  C CB  . ASP B 1 112 ? 97.659  7.950   22.500  1.00 7.27  ? 112  ASP B CB  1 
ATOM   5058  C CG  . ASP B 1 112 ? 97.391  7.880   21.019  1.00 6.28  ? 112  ASP B CG  1 
ATOM   5059  O OD1 . ASP B 1 112 ? 98.053  8.511   20.150  1.00 6.69  ? 112  ASP B OD1 1 
ATOM   5060  O OD2 . ASP B 1 112 ? 96.435  7.147   20.650  1.00 6.14  ? 112  ASP B OD2 1 
ATOM   5061  N N   . ILE B 1 113 ? 100.218 8.261   24.628  1.00 5.22  ? 113  ILE B N   1 
ATOM   5062  C CA  . ILE B 1 113 ? 100.583 8.324   26.057  1.00 4.39  ? 113  ILE B CA  1 
ATOM   5063  C C   . ILE B 1 113 ? 99.418  8.784   26.896  1.00 3.76  ? 113  ILE B C   1 
ATOM   5064  O O   . ILE B 1 113 ? 99.267  8.330   28.025  1.00 3.07  ? 113  ILE B O   1 
ATOM   5065  C CB  . ILE B 1 113 ? 101.863 9.153   26.304  1.00 4.36  ? 113  ILE B CB  1 
ATOM   5066  C CG1 . ILE B 1 113 ? 102.421 8.875   27.703  1.00 4.83  ? 113  ILE B CG1 1 
ATOM   5067  C CG2 . ILE B 1 113 ? 101.604 10.629  26.097  1.00 2.23  ? 113  ILE B CG2 1 
ATOM   5068  C CD1 . ILE B 1 113 ? 103.770 9.592   27.916  1.00 4.32  ? 113  ILE B CD1 1 
ATOM   5069  N N   . SER B 1 114 ? 98.546  9.682   26.359  1.00 3.97  ? 114  SER B N   1 
ATOM   5070  C CA  . SER B 1 114 ? 97.412  10.109  27.186  1.00 4.28  ? 114  SER B CA  1 
ATOM   5071  C C   . SER B 1 114 ? 96.142  9.290   26.873  1.00 4.53  ? 114  SER B C   1 
ATOM   5072  O O   . SER B 1 114 ? 96.077  8.756   25.802  1.00 3.84  ? 114  SER B O   1 
ATOM   5073  C CB  . SER B 1 114 ? 97.004  11.571  26.929  1.00 2.08  ? 114  SER B CB  1 
ATOM   5074  O OG  . SER B 1 114 ? 96.591  11.772  25.602  1.00 3.54  ? 114  SER B OG  1 
ATOM   5075  N N   . GLY B 1 115 ? 95.173  9.306   27.781  1.00 6.14  ? 115  GLY B N   1 
ATOM   5076  C CA  . GLY B 1 115 ? 93.872  8.668   27.598  1.00 6.56  ? 115  GLY B CA  1 
ATOM   5077  C C   . GLY B 1 115 ? 93.908  7.130   27.671  1.00 7.96  ? 115  GLY B C   1 
ATOM   5078  O O   . GLY B 1 115 ? 94.909  6.504   28.013  1.00 6.28  ? 115  GLY B O   1 
ATOM   5079  N N   . PRO B 1 116 ? 92.762  6.502   27.409  1.00 6.15  ? 116  PRO B N   1 
ATOM   5080  C CA  . PRO B 1 116 ? 92.666  5.039   27.372  1.00 4.93  ? 116  PRO B CA  1 
ATOM   5081  C C   . PRO B 1 116 ? 93.321  4.470   26.123  1.00 3.54  ? 116  PRO B C   1 
ATOM   5082  O O   . PRO B 1 116 ? 93.186  5.045   25.026  1.00 2.92  ? 116  PRO B O   1 
ATOM   5083  C CB  . PRO B 1 116 ? 91.158  4.807   27.429  1.00 4.41  ? 116  PRO B CB  1 
ATOM   5084  C CG  . PRO B 1 116 ? 90.535  6.009   26.798  1.00 4.89  ? 116  PRO B CG  1 
ATOM   5085  C CD  . PRO B 1 116 ? 91.485  7.158   26.982  1.00 5.37  ? 116  PRO B CD  1 
ATOM   5086  N N   . ALA B 1 117 ? 94.136  3.402   26.271  1.00 4.34  ? 117  ALA B N   1 
ATOM   5087  C CA  . ALA B 1 117 ? 94.799  2.857   25.079  1.00 5.39  ? 117  ALA B CA  1 
ATOM   5088  C C   . ALA B 1 117 ? 93.748  2.366   24.089  1.00 3.74  ? 117  ALA B C   1 
ATOM   5089  O O   . ALA B 1 117 ? 92.618  2.162   24.546  1.00 4.11  ? 117  ALA B O   1 
ATOM   5090  C CB  . ALA B 1 117 ? 95.744  1.694   25.404  1.00 4.49  ? 117  ALA B CB  1 
ATOM   5091  N N   . PHE B 1 118 ? 94.048  2.192   22.839  1.00 5.48  ? 118  PHE B N   1 
ATOM   5092  C CA  . PHE B 1 118 ? 93.188  1.827   21.739  1.00 6.61  ? 118  PHE B CA  1 
ATOM   5093  C C   . PHE B 1 118 ? 92.410  0.522   21.973  1.00 7.19  ? 118  PHE B C   1 
ATOM   5094  O O   . PHE B 1 118 ? 91.286  0.442   21.455  1.00 5.20  ? 118  PHE B O   1 
ATOM   5095  C CB  . PHE B 1 118 ? 93.947  1.744   20.396  1.00 7.20  ? 118  PHE B CB  1 
ATOM   5096  C CG  . PHE B 1 118 ? 95.004  0.665   20.311  1.00 9.17  ? 118  PHE B CG  1 
ATOM   5097  C CD1 . PHE B 1 118 ? 94.651  -0.649  19.995  1.00 8.17  ? 118  PHE B CD1 1 
ATOM   5098  C CD2 . PHE B 1 118 ? 96.337  0.937   20.560  1.00 9.43  ? 118  PHE B CD2 1 
ATOM   5099  C CE1 . PHE B 1 118 ? 95.617  -1.655  19.974  1.00 9.83  ? 118  PHE B CE1 1 
ATOM   5100  C CE2 . PHE B 1 118 ? 97.324  -0.039  20.530  1.00 8.11  ? 118  PHE B CE2 1 
ATOM   5101  C CZ  . PHE B 1 118 ? 96.954  -1.348  20.231  1.00 10.37 ? 118  PHE B CZ  1 
ATOM   5102  N N   . SER B 1 119 ? 92.887  -0.408  22.790  1.00 5.70  ? 119  SER B N   1 
ATOM   5103  C CA  . SER B 1 119 ? 92.195  -1.689  22.963  1.00 5.21  ? 119  SER B CA  1 
ATOM   5104  C C   . SER B 1 119 ? 91.575  -1.791  24.326  1.00 5.80  ? 119  SER B C   1 
ATOM   5105  O O   . SER B 1 119 ? 91.070  -2.844  24.741  1.00 6.25  ? 119  SER B O   1 
ATOM   5106  C CB  . SER B 1 119 ? 93.266  -2.794  22.710  1.00 4.91  ? 119  SER B CB  1 
ATOM   5107  O OG  . SER B 1 119 ? 93.929  -3.082  23.939  1.00 5.15  ? 119  SER B OG  1 
ATOM   5108  N N   . ALA B 1 120 ? 91.583  -0.712  25.139  1.00 4.64  ? 120  ALA B N   1 
ATOM   5109  C CA  . ALA B 1 120 ? 91.051  -0.709  26.489  1.00 4.41  ? 120  ALA B CA  1 
ATOM   5110  C C   . ALA B 1 120 ? 89.534  -0.554  26.589  1.00 3.84  ? 120  ALA B C   1 
ATOM   5111  O O   . ALA B 1 120 ? 88.961  -0.709  27.698  1.00 4.90  ? 120  ALA B O   1 
ATOM   5112  C CB  . ALA B 1 120 ? 91.677  0.370   27.392  1.00 4.16  ? 120  ALA B CB  1 
ATOM   5113  N N   . THR B 1 121 ? 88.908  -0.281  25.455  1.00 5.33  ? 121  THR B N   1 
ATOM   5114  C CA  . THR B 1 121 ? 87.439  -0.136  25.487  1.00 6.12  ? 121  THR B CA  1 
ATOM   5115  C C   . THR B 1 121 ? 86.814  -1.100  24.473  1.00 4.75  ? 121  THR B C   1 
ATOM   5116  O O   . THR B 1 121 ? 87.534  -1.597  23.600  1.00 6.34  ? 121  THR B O   1 
ATOM   5117  C CB  . THR B 1 121 ? 87.012  1.299   25.079  1.00 2.70  ? 121  THR B CB  1 
ATOM   5118  O OG1 . THR B 1 121 ? 87.717  1.611   23.889  1.00 4.32  ? 121  THR B OG1 1 
ATOM   5119  C CG2 . THR B 1 121 ? 87.288  2.323   26.162  1.00 4.43  ? 121  THR B CG2 1 
ATOM   5120  N N   . THR B 1 122 ? 85.534  -1.412  24.588  1.00 5.05  ? 122  THR B N   1 
ATOM   5121  C CA  . THR B 1 122 ? 84.821  -2.279  23.631  1.00 5.74  ? 122  THR B CA  1 
ATOM   5122  C C   . THR B 1 122 ? 83.480  -1.639  23.212  1.00 7.25  ? 122  THR B C   1 
ATOM   5123  O O   . THR B 1 122 ? 82.985  -0.713  23.874  1.00 7.13  ? 122  THR B O   1 
ATOM   5124  C CB  . THR B 1 122 ? 84.401  -3.605  24.265  1.00 6.33  ? 122  THR B CB  1 
ATOM   5125  O OG1 . THR B 1 122 ? 83.565  -3.312  25.423  1.00 8.51  ? 122  THR B OG1 1 
ATOM   5126  C CG2 . THR B 1 122 ? 85.585  -4.415  24.784  1.00 5.61  ? 122  THR B CG2 1 
ATOM   5127  N N   . ILE B 1 123 ? 82.891  -2.103  22.121  1.00 5.29  ? 123  ILE B N   1 
ATOM   5128  C CA  . ILE B 1 123 ? 81.555  -1.744  21.655  1.00 6.45  ? 123  ILE B CA  1 
ATOM   5129  C C   . ILE B 1 123 ? 80.880  -3.114  21.381  1.00 7.68  ? 123  ILE B C   1 
ATOM   5130  O O   . ILE B 1 123 ? 81.596  -4.102  21.197  1.00 8.11  ? 123  ILE B O   1 
ATOM   5131  C CB  . ILE B 1 123 ? 81.490  -0.804  20.443  1.00 5.34  ? 123  ILE B CB  1 
ATOM   5132  C CG1 . ILE B 1 123 ? 82.152  -1.391  19.211  1.00 6.03  ? 123  ILE B CG1 1 
ATOM   5133  C CG2 . ILE B 1 123 ? 82.142  0.557   20.758  1.00 4.85  ? 123  ILE B CG2 1 
ATOM   5134  C CD1 . ILE B 1 123 ? 82.197  -0.575  17.938  1.00 5.16  ? 123  ILE B CD1 1 
ATOM   5135  N N   . PRO B 1 124 ? 79.562  -3.234  21.470  1.00 7.03  ? 124  PRO B N   1 
ATOM   5136  C CA  . PRO B 1 124 ? 78.888  -4.514  21.299  1.00 6.08  ? 124  PRO B CA  1 
ATOM   5137  C C   . PRO B 1 124 ? 79.048  -5.123  19.927  1.00 5.47  ? 124  PRO B C   1 
ATOM   5138  O O   . PRO B 1 124 ? 79.158  -4.515  18.849  1.00 3.63  ? 124  PRO B O   1 
ATOM   5139  C CB  . PRO B 1 124 ? 77.409  -4.217  21.604  1.00 5.80  ? 124  PRO B CB  1 
ATOM   5140  C CG  . PRO B 1 124 ? 77.311  -2.789  22.060  1.00 7.00  ? 124  PRO B CG  1 
ATOM   5141  C CD  . PRO B 1 124 ? 78.627  -2.111  21.743  1.00 5.57  ? 124  PRO B CD  1 
ATOM   5142  N N   . PRO B 1 125 ? 78.878  -6.460  19.852  1.00 6.34  ? 125  PRO B N   1 
ATOM   5143  C CA  . PRO B 1 125 ? 78.845  -7.172  18.593  1.00 5.49  ? 125  PRO B CA  1 
ATOM   5144  C C   . PRO B 1 125 ? 77.780  -6.575  17.677  1.00 4.69  ? 125  PRO B C   1 
ATOM   5145  O O   . PRO B 1 125 ? 76.760  -6.110  18.199  1.00 3.83  ? 125  PRO B O   1 
ATOM   5146  C CB  . PRO B 1 125 ? 78.442  -8.594  19.003  1.00 6.87  ? 125  PRO B CB  1 
ATOM   5147  C CG  . PRO B 1 125 ? 78.957  -8.737  20.403  1.00 7.26  ? 125  PRO B CG  1 
ATOM   5148  C CD  . PRO B 1 125 ? 78.685  -7.381  21.011  1.00 8.73  ? 125  PRO B CD  1 
ATOM   5149  N N   . VAL B 1 126 ? 77.935  -6.526  16.374  1.00 4.50  ? 126  VAL B N   1 
ATOM   5150  C CA  . VAL B 1 126 ? 76.929  -6.071  15.452  1.00 3.96  ? 126  VAL B CA  1 
ATOM   5151  C C   . VAL B 1 126 ? 75.861  -7.165  15.255  1.00 7.67  ? 126  VAL B C   1 
ATOM   5152  O O   . VAL B 1 126 ? 76.217  -8.343  15.186  1.00 6.24  ? 126  VAL B O   1 
ATOM   5153  C CB  . VAL B 1 126 ? 77.523  -5.850  14.050  1.00 4.66  ? 126  VAL B CB  1 
ATOM   5154  C CG1 . VAL B 1 126 ? 76.504  -5.307  13.049  1.00 3.26  ? 126  VAL B CG1 1 
ATOM   5155  C CG2 . VAL B 1 126 ? 78.704  -4.855  14.057  1.00 3.64  ? 126  VAL B CG2 1 
ATOM   5156  N N   . PRO B 1 127 ? 74.595  -6.812  15.135  1.00 7.83  ? 127  PRO B N   1 
ATOM   5157  C CA  . PRO B 1 127 ? 73.552  -7.771  14.727  1.00 8.17  ? 127  PRO B CA  1 
ATOM   5158  C C   . PRO B 1 127 ? 74.022  -8.536  13.490  1.00 8.42  ? 127  PRO B C   1 
ATOM   5159  O O   . PRO B 1 127 ? 74.617  -7.952  12.569  1.00 6.87  ? 127  PRO B O   1 
ATOM   5160  C CB  . PRO B 1 127 ? 72.371  -6.854  14.331  1.00 7.59  ? 127  PRO B CB  1 
ATOM   5161  C CG  . PRO B 1 127 ? 72.545  -5.682  15.274  1.00 7.98  ? 127  PRO B CG  1 
ATOM   5162  C CD  . PRO B 1 127 ? 74.038  -5.446  15.282  1.00 8.18  ? 127  PRO B CD  1 
ATOM   5163  N N   . THR B 1 128 ? 73.773  -9.868  13.446  1.00 7.81  ? 128  THR B N   1 
ATOM   5164  C CA  . THR B 1 128 ? 74.242  -10.648 12.293  1.00 6.03  ? 128  THR B CA  1 
ATOM   5165  C C   . THR B 1 128 ? 73.409  -10.352 11.077  1.00 7.19  ? 128  THR B C   1 
ATOM   5166  O O   . THR B 1 128 ? 72.278  -9.890  11.237  1.00 9.55  ? 128  THR B O   1 
ATOM   5167  C CB  . THR B 1 128 ? 74.181  -12.160 12.637  1.00 7.03  ? 128  THR B CB  1 
ATOM   5168  O OG1 . THR B 1 128 ? 72.842  -12.507 13.066  1.00 4.06  ? 128  THR B OG1 1 
ATOM   5169  C CG2 . THR B 1 128 ? 75.119  -12.411 13.812  1.00 5.12  ? 128  THR B CG2 1 
ATOM   5170  N N   . LEU B 1 129 ? 73.863  -10.679 9.889   1.00 6.35  ? 129  LEU B N   1 
ATOM   5171  C CA  . LEU B 1 129 ? 73.126  -10.453 8.653   1.00 9.03  ? 129  LEU B CA  1 
ATOM   5172  C C   . LEU B 1 129 ? 71.718  -11.038 8.645   1.00 10.07 ? 129  LEU B C   1 
ATOM   5173  O O   . LEU B 1 129 ? 70.830  -10.306 8.208   1.00 9.81  ? 129  LEU B O   1 
ATOM   5174  C CB  . LEU B 1 129 ? 73.941  -10.717 7.441   1.00 9.01  ? 129  LEU B CB  1 
ATOM   5175  C CG  . LEU B 1 129 ? 73.708  -11.241 6.068   1.00 12.72 ? 129  LEU B CG  1 
ATOM   5176  C CD1 . LEU B 1 129 ? 72.271  -11.435 5.631   1.00 11.18 ? 129  LEU B CD1 1 
ATOM   5177  C CD2 . LEU B 1 129 ? 74.504  -10.485 4.992   1.00 11.21 ? 129  LEU B CD2 1 
ATOM   5178  N N   . PRO B 1 130 ? 71.469  -12.227 9.138   1.00 10.02 ? 130  PRO B N   1 
ATOM   5179  C CA  . PRO B 1 130 ? 70.141  -12.824 9.143   1.00 10.53 ? 130  PRO B CA  1 
ATOM   5180  C C   . PRO B 1 130 ? 69.254  -12.323 10.252  1.00 9.07  ? 130  PRO B C   1 
ATOM   5181  O O   . PRO B 1 130 ? 68.084  -12.754 10.334  1.00 9.46  ? 130  PRO B O   1 
ATOM   5182  C CB  . PRO B 1 130 ? 70.393  -14.336 9.341   1.00 10.69 ? 130  PRO B CB  1 
ATOM   5183  C CG  . PRO B 1 130 ? 71.857  -14.545 9.071   1.00 11.42 ? 130  PRO B CG  1 
ATOM   5184  C CD  . PRO B 1 130 ? 72.500  -13.232 9.559   1.00 10.55 ? 130  PRO B CD  1 
ATOM   5185  N N   . SER B 1 131 ? 69.712  -11.488 11.193  1.00 7.79  ? 131  SER B N   1 
ATOM   5186  C CA  . SER B 1 131 ? 68.873  -11.102 12.321  1.00 5.63  ? 131  SER B CA  1 
ATOM   5187  C C   . SER B 1 131 ? 67.803  -10.082 11.946  1.00 5.30  ? 131  SER B C   1 
ATOM   5188  O O   . SER B 1 131 ? 67.882  -9.338  10.951  1.00 4.72  ? 131  SER B O   1 
ATOM   5189  C CB  . SER B 1 131 ? 69.706  -10.568 13.498  1.00 7.72  ? 131  SER B CB  1 
ATOM   5190  O OG  . SER B 1 131 ? 70.365  -9.335  13.093  1.00 7.04  ? 131  SER B OG  1 
ATOM   5191  N N   . PRO B 1 132 ? 66.756  -10.039 12.775  1.00 5.20  ? 132  PRO B N   1 
ATOM   5192  C CA  . PRO B 1 132 ? 65.683  -9.072  12.601  1.00 6.17  ? 132  PRO B CA  1 
ATOM   5193  C C   . PRO B 1 132 ? 66.206  -7.694  13.020  1.00 6.16  ? 132  PRO B C   1 
ATOM   5194  O O   . PRO B 1 132 ? 65.763  -6.735  12.391  1.00 6.73  ? 132  PRO B O   1 
ATOM   5195  C CB  . PRO B 1 132 ? 64.549  -9.552  13.467  1.00 6.21  ? 132  PRO B CB  1 
ATOM   5196  C CG  . PRO B 1 132 ? 65.103  -10.586 14.377  1.00 8.80  ? 132  PRO B CG  1 
ATOM   5197  C CD  . PRO B 1 132 ? 66.525  -10.896 13.963  1.00 6.28  ? 132  PRO B CD  1 
ATOM   5198  N N   . GLU B 1 133 ? 67.116  -7.604  13.986  1.00 7.13  ? 133  GLU B N   1 
ATOM   5199  C CA  . GLU B 1 133 ? 67.688  -6.287  14.334  1.00 5.90  ? 133  GLU B CA  1 
ATOM   5200  C C   . GLU B 1 133 ? 68.419  -5.726  13.129  1.00 5.51  ? 133  GLU B C   1 
ATOM   5201  O O   . GLU B 1 133 ? 68.109  -4.595  12.711  1.00 6.60  ? 133  GLU B O   1 
ATOM   5202  C CB  . GLU B 1 133 ? 68.617  -6.360  15.537  1.00 6.00  ? 133  GLU B CB  1 
ATOM   5203  C CG  . GLU B 1 133 ? 67.946  -6.711  16.856  1.00 7.33  ? 133  GLU B CG  1 
ATOM   5204  C CD  . GLU B 1 133 ? 67.567  -8.209  16.925  1.00 9.29  ? 133  GLU B CD  1 
ATOM   5205  O OE1 . GLU B 1 133 ? 68.090  -9.029  16.142  1.00 5.42  ? 133  GLU B OE1 1 
ATOM   5206  O OE2 . GLU B 1 133 ? 66.701  -8.522  17.780  1.00 9.68  ? 133  GLU B OE2 1 
ATOM   5207  N N   . LEU B 1 134 ? 69.291  -6.509  12.446  1.00 5.87  ? 134  LEU B N   1 
ATOM   5208  C CA  . LEU B 1 134 ? 69.983  -6.028  11.280  1.00 5.00  ? 134  LEU B CA  1 
ATOM   5209  C C   . LEU B 1 134 ? 69.012  -5.603  10.199  1.00 6.24  ? 134  LEU B C   1 
ATOM   5210  O O   . LEU B 1 134 ? 69.192  -4.612  9.478   1.00 3.98  ? 134  LEU B O   1 
ATOM   5211  C CB  . LEU B 1 134 ? 71.015  -7.009  10.615  1.00 6.65  ? 134  LEU B CB  1 
ATOM   5212  C CG  . LEU B 1 134 ? 71.546  -6.298  9.347   1.00 6.83  ? 134  LEU B CG  1 
ATOM   5213  C CD1 . LEU B 1 134 ? 72.788  -5.438  9.561   1.00 5.48  ? 134  LEU B CD1 1 
ATOM   5214  C CD2 . LEU B 1 134 ? 71.512  -7.138  8.117   1.00 7.50  ? 134  LEU B CD2 1 
ATOM   5215  N N   . ALA B 1 135 ? 67.975  -6.422  9.975   1.00 5.01  ? 135  ALA B N   1 
ATOM   5216  C CA  . ALA B 1 135 ? 66.981  -6.128  8.940   1.00 4.95  ? 135  ALA B CA  1 
ATOM   5217  C C   . ALA B 1 135 ? 66.341  -4.754  9.191   1.00 3.33  ? 135  ALA B C   1 
ATOM   5218  O O   . ALA B 1 135 ? 66.188  -3.977  8.260   1.00 3.63  ? 135  ALA B O   1 
ATOM   5219  C CB  . ALA B 1 135 ? 65.909  -7.224  8.912   1.00 2.75  ? 135  ALA B CB  1 
ATOM   5220  N N   . ALA B 1 136 ? 65.934  -4.468  10.411  1.00 3.88  ? 136  ALA B N   1 
ATOM   5221  C CA  . ALA B 1 136 ? 65.314  -3.177  10.745  1.00 4.09  ? 136  ALA B CA  1 
ATOM   5222  C C   . ALA B 1 136 ? 66.368  -2.056  10.708  1.00 5.28  ? 136  ALA B C   1 
ATOM   5223  O O   . ALA B 1 136 ? 66.023  -0.945  10.365  1.00 5.93  ? 136  ALA B O   1 
ATOM   5224  C CB  . ALA B 1 136 ? 64.634  -3.199  12.118  1.00 2.30  ? 136  ALA B CB  1 
ATOM   5225  N N   . GLN B 1 137 ? 67.630  -2.308  11.033  1.00 4.87  ? 137  GLN B N   1 
ATOM   5226  C CA  . GLN B 1 137 ? 68.704  -1.321  10.948  1.00 5.41  ? 137  GLN B CA  1 
ATOM   5227  C C   . GLN B 1 137 ? 68.834  -0.856  9.512   1.00 4.77  ? 137  GLN B C   1 
ATOM   5228  O O   . GLN B 1 137 ? 68.761  0.345   9.157   1.00 6.83  ? 137  GLN B O   1 
ATOM   5229  C CB  . GLN B 1 137 ? 70.034  -1.932  11.460  1.00 4.06  ? 137  GLN B CB  1 
ATOM   5230  C CG  . GLN B 1 137 ? 70.034  -2.086  12.970  1.00 3.47  ? 137  GLN B CG  1 
ATOM   5231  C CD  . GLN B 1 137 ? 70.540  -0.861  13.734  1.00 5.00  ? 137  GLN B CD  1 
ATOM   5232  O OE1 . GLN B 1 137 ? 71.089  0.030   13.071  1.00 3.24  ? 137  GLN B OE1 1 
ATOM   5233  N NE2 . GLN B 1 137 ? 70.427  -0.813  15.051  1.00 4.38  ? 137  GLN B NE2 1 
ATOM   5234  N N   . LEU B 1 138 ? 68.977  -1.822  8.602   1.00 4.03  ? 138  LEU B N   1 
ATOM   5235  C CA  . LEU B 1 138 ? 69.098  -1.543  7.191   1.00 3.52  ? 138  LEU B CA  1 
ATOM   5236  C C   . LEU B 1 138 ? 67.845  -0.942  6.552   1.00 4.50  ? 138  LEU B C   1 
ATOM   5237  O O   . LEU B 1 138 ? 67.997  -0.084  5.667   1.00 2.61  ? 138  LEU B O   1 
ATOM   5238  C CB  . LEU B 1 138 ? 69.570  -2.793  6.444   1.00 3.72  ? 138  LEU B CB  1 
ATOM   5239  C CG  . LEU B 1 138 ? 69.724  -2.704  4.945   1.00 4.21  ? 138  LEU B CG  1 
ATOM   5240  C CD1 . LEU B 1 138 ? 70.739  -1.660  4.512   1.00 2.70  ? 138  LEU B CD1 1 
ATOM   5241  C CD2 . LEU B 1 138 ? 70.093  -4.087  4.371   1.00 4.66  ? 138  LEU B CD2 1 
ATOM   5242  N N   . ALA B 1 139 ? 66.647  -1.378  6.988   1.00 4.53  ? 139  ALA B N   1 
ATOM   5243  C CA  . ALA B 1 139 ? 65.406  -0.780  6.462   1.00 4.26  ? 139  ALA B CA  1 
ATOM   5244  C C   . ALA B 1 139 ? 65.399  0.704   6.834   1.00 3.10  ? 139  ALA B C   1 
ATOM   5245  O O   . ALA B 1 139 ? 64.972  1.531   6.058   1.00 4.15  ? 139  ALA B O   1 
ATOM   5246  C CB  . ALA B 1 139 ? 64.190  -1.458  7.147   1.00 3.95  ? 139  ALA B CB  1 
ATOM   5247  N N   . GLU B 1 140 ? 65.758  1.069   8.061   1.00 2.36  ? 140  GLU B N   1 
ATOM   5248  C CA  . GLU B 1 140 ? 65.802  2.484   8.473   1.00 2.99  ? 140  GLU B CA  1 
ATOM   5249  C C   . GLU B 1 140 ? 66.691  3.315   7.556   1.00 3.52  ? 140  GLU B C   1 
ATOM   5250  O O   . GLU B 1 140 ? 66.339  4.410   7.102   1.00 3.85  ? 140  GLU B O   1 
ATOM   5251  C CB  . GLU B 1 140 ? 66.203  2.620   9.954   1.00 2.65  ? 140  GLU B CB  1 
ATOM   5252  C CG  . GLU B 1 140 ? 66.187  4.083   10.424  1.00 3.39  ? 140  GLU B CG  1 
ATOM   5253  C CD  . GLU B 1 140 ? 66.514  4.218   11.879  1.00 3.77  ? 140  GLU B CD  1 
ATOM   5254  O OE1 . GLU B 1 140 ? 67.399  3.498   12.412  1.00 3.83  ? 140  GLU B OE1 1 
ATOM   5255  O OE2 . GLU B 1 140 ? 65.850  5.014   12.578  1.00 4.13  ? 140  GLU B OE2 1 
ATOM   5256  N N   . VAL B 1 141 ? 67.869  2.758   7.170   1.00 3.54  ? 141  VAL B N   1 
ATOM   5257  C CA  . VAL B 1 141 ? 68.759  3.442   6.245   1.00 3.39  ? 141  VAL B CA  1 
ATOM   5258  C C   . VAL B 1 141 ? 68.029  3.674   4.926   1.00 5.42  ? 141  VAL B C   1 
ATOM   5259  O O   . VAL B 1 141 ? 68.053  4.794   4.355   1.00 2.08  ? 141  VAL B O   1 
ATOM   5260  C CB  . VAL B 1 141 ? 70.098  2.714   5.995   1.00 2.14  ? 141  VAL B CB  1 
ATOM   5261  C CG1 . VAL B 1 141 ? 70.950  3.546   5.048   1.00 3.53  ? 141  VAL B CG1 1 
ATOM   5262  C CG2 . VAL B 1 141 ? 70.825  2.477   7.319   1.00 2.32  ? 141  VAL B CG2 1 
ATOM   5263  N N   . TYR B 1 142 ? 67.423  2.616   4.364   1.00 2.68  ? 142  TYR B N   1 
ATOM   5264  C CA  . TYR B 1 142 ? 66.621  2.773   3.149   1.00 4.51  ? 142  TYR B CA  1 
ATOM   5265  C C   . TYR B 1 142 ? 65.490  3.791   3.307   1.00 2.74  ? 142  TYR B C   1 
ATOM   5266  O O   . TYR B 1 142 ? 65.161  4.525   2.365   1.00 3.67  ? 142  TYR B O   1 
ATOM   5267  C CB  . TYR B 1 142 ? 65.963  1.421   2.738   1.00 5.76  ? 142  TYR B CB  1 
ATOM   5268  C CG  . TYR B 1 142 ? 66.805  0.497   1.869   1.00 4.16  ? 142  TYR B CG  1 
ATOM   5269  C CD1 . TYR B 1 142 ? 66.805  0.624   0.487   1.00 4.13  ? 142  TYR B CD1 1 
ATOM   5270  C CD2 . TYR B 1 142 ? 67.580  -0.499  2.441   1.00 5.15  ? 142  TYR B CD2 1 
ATOM   5271  C CE1 . TYR B 1 142 ? 67.569  -0.215  -0.328  1.00 4.16  ? 142  TYR B CE1 1 
ATOM   5272  C CE2 . TYR B 1 142 ? 68.335  -1.377  1.645   1.00 4.54  ? 142  TYR B CE2 1 
ATOM   5273  C CZ  . TYR B 1 142 ? 68.311  -1.205  0.282   1.00 4.51  ? 142  TYR B CZ  1 
ATOM   5274  O OH  . TYR B 1 142 ? 69.076  -2.027  -0.511  1.00 5.46  ? 142  TYR B OH  1 
ATOM   5275  N N   . TRP B 1 143 ? 64.745  3.783   4.428   1.00 3.82  ? 143  TRP B N   1 
ATOM   5276  C CA  . TRP B 1 143 ? 63.652  4.780   4.552   1.00 3.80  ? 143  TRP B CA  1 
ATOM   5277  C C   . TRP B 1 143 ? 64.255  6.191   4.613   1.00 4.12  ? 143  TRP B C   1 
ATOM   5278  O O   . TRP B 1 143 ? 63.717  7.165   4.084   1.00 3.92  ? 143  TRP B O   1 
ATOM   5279  C CB  . TRP B 1 143 ? 62.806  4.565   5.794   1.00 3.76  ? 143  TRP B CB  1 
ATOM   5280  C CG  . TRP B 1 143 ? 61.752  3.512   5.618   1.00 4.03  ? 143  TRP B CG  1 
ATOM   5281  C CD1 . TRP B 1 143 ? 61.732  2.266   6.167   1.00 3.82  ? 143  TRP B CD1 1 
ATOM   5282  C CD2 . TRP B 1 143 ? 60.593  3.618   4.763   1.00 6.38  ? 143  TRP B CD2 1 
ATOM   5283  N NE1 . TRP B 1 143 ? 60.607  1.591   5.705   1.00 4.80  ? 143  TRP B NE1 1 
ATOM   5284  C CE2 . TRP B 1 143 ? 59.908  2.381   4.833   1.00 5.24  ? 143  TRP B CE2 1 
ATOM   5285  C CE3 . TRP B 1 143 ? 60.083  4.627   3.937   1.00 5.60  ? 143  TRP B CE3 1 
ATOM   5286  C CZ2 . TRP B 1 143 ? 58.712  2.164   4.158   1.00 4.52  ? 143  TRP B CZ2 1 
ATOM   5287  C CZ3 . TRP B 1 143 ? 58.908  4.398   3.242   1.00 6.79  ? 143  TRP B CZ3 1 
ATOM   5288  C CH2 . TRP B 1 143 ? 58.241  3.157   3.367   1.00 6.08  ? 143  TRP B CH2 1 
ATOM   5289  N N   . MET B 1 144 ? 65.392  6.356   5.311   1.00 2.08  ? 144  MET B N   1 
ATOM   5290  C CA  . MET B 1 144 ? 66.091  7.666   5.312   1.00 4.70  ? 144  MET B CA  1 
ATOM   5291  C C   . MET B 1 144 ? 66.394  8.075   3.880   1.00 3.55  ? 144  MET B C   1 
ATOM   5292  O O   . MET B 1 144 ? 66.083  9.237   3.536   1.00 3.17  ? 144  MET B O   1 
ATOM   5293  C CB  . MET B 1 144 ? 67.410  7.552   6.086   1.00 4.13  ? 144  MET B CB  1 
ATOM   5294  C CG  . MET B 1 144 ? 67.193  7.594   7.595   1.00 4.44  ? 144  MET B CG  1 
ATOM   5295  S SD  . MET B 1 144 ? 68.814  7.504   8.350   1.00 3.91  ? 144  MET B SD  1 
ATOM   5296  C CE  . MET B 1 144 ? 68.507  7.869   10.054  1.00 2.41  ? 144  MET B CE  1 
ATOM   5297  N N   . ALA B 1 145 ? 66.804  7.160   2.998   1.00 3.97  ? 145  ALA B N   1 
ATOM   5298  C CA  . ALA B 1 145 ? 67.052  7.548   1.610   1.00 3.60  ? 145  ALA B CA  1 
ATOM   5299  C C   . ALA B 1 145 ? 65.765  7.991   0.930   1.00 4.29  ? 145  ALA B C   1 
ATOM   5300  O O   . ALA B 1 145 ? 65.741  8.942   0.134   1.00 4.30  ? 145  ALA B O   1 
ATOM   5301  C CB  . ALA B 1 145 ? 67.687  6.393   0.815   1.00 3.20  ? 145  ALA B CB  1 
ATOM   5302  N N   . LEU B 1 146 ? 64.662  7.250   1.202   1.00 5.47  ? 146  LEU B N   1 
ATOM   5303  C CA  . LEU B 1 146 ? 63.375  7.593   0.561   1.00 5.55  ? 146  LEU B CA  1 
ATOM   5304  C C   . LEU B 1 146 ? 62.785  8.906   1.088   1.00 5.29  ? 146  LEU B C   1 
ATOM   5305  O O   . LEU B 1 146 ? 62.089  9.601   0.309   1.00 5.55  ? 146  LEU B O   1 
ATOM   5306  C CB  . LEU B 1 146 ? 62.353  6.473   0.793   1.00 4.90  ? 146  LEU B CB  1 
ATOM   5307  C CG  . LEU B 1 146 ? 62.622  5.116   0.129   1.00 4.41  ? 146  LEU B CG  1 
ATOM   5308  C CD1 . LEU B 1 146 ? 61.546  4.095   0.517   1.00 5.15  ? 146  LEU B CD1 1 
ATOM   5309  C CD2 . LEU B 1 146 ? 62.686  5.268   -1.373  1.00 4.31  ? 146  LEU B CD2 1 
ATOM   5310  N N   . ALA B 1 147 ? 63.064  9.248   2.341   1.00 4.40  ? 147  ALA B N   1 
ATOM   5311  C CA  . ALA B 1 147 ? 62.614  10.474  2.962   1.00 3.88  ? 147  ALA B CA  1 
ATOM   5312  C C   . ALA B 1 147 ? 63.555  11.683  2.821   1.00 3.98  ? 147  ALA B C   1 
ATOM   5313  O O   . ALA B 1 147 ? 63.322  12.719  3.453   1.00 3.80  ? 147  ALA B O   1 
ATOM   5314  C CB  . ALA B 1 147 ? 62.428  10.287  4.489   1.00 3.80  ? 147  ALA B CB  1 
ATOM   5315  N N   . ARG B 1 148 ? 64.628  11.563  2.062   1.00 2.08  ? 148  ARG B N   1 
ATOM   5316  C CA  . ARG B 1 148 ? 65.639  12.603  1.926   1.00 5.42  ? 148  ARG B CA  1 
ATOM   5317  C C   . ARG B 1 148 ? 65.117  13.999  1.613   1.00 3.73  ? 148  ARG B C   1 
ATOM   5318  O O   . ARG B 1 148 ? 65.612  14.938  2.198   1.00 3.44  ? 148  ARG B O   1 
ATOM   5319  C CB  . ARG B 1 148 ? 66.691  12.231  0.865   1.00 4.26  ? 148  ARG B CB  1 
ATOM   5320  C CG  . ARG B 1 148 ? 67.825  11.405  1.471   1.00 4.27  ? 148  ARG B CG  1 
ATOM   5321  C CD  . ARG B 1 148 ? 68.746  10.850  0.383   1.00 3.32  ? 148  ARG B CD  1 
ATOM   5322  N NE  . ARG B 1 148 ? 69.637  9.843   0.952   1.00 3.46  ? 148  ARG B NE  1 
ATOM   5323  C CZ  . ARG B 1 148 ? 70.153  8.815   0.277   1.00 2.63  ? 148  ARG B CZ  1 
ATOM   5324  N NH1 . ARG B 1 148 ? 69.924  8.576   -1.001  1.00 3.30  ? 148  ARG B NH1 1 
ATOM   5325  N NH2 . ARG B 1 148 ? 70.898  7.992   1.017   1.00 2.43  ? 148  ARG B NH2 1 
ATOM   5326  N N   . ASP B 1 149 ? 64.156  14.160  0.726   1.00 6.02  ? 149  ASP B N   1 
ATOM   5327  C CA  . ASP B 1 149 ? 63.664  15.461  0.303   1.00 5.26  ? 149  ASP B CA  1 
ATOM   5328  C C   . ASP B 1 149 ? 62.431  15.974  1.012   1.00 4.86  ? 149  ASP B C   1 
ATOM   5329  O O   . ASP B 1 149 ? 61.853  16.963  0.548   1.00 5.89  ? 149  ASP B O   1 
ATOM   5330  C CB  . ASP B 1 149 ? 63.482  15.430  -1.241  1.00 4.89  ? 149  ASP B CB  1 
ATOM   5331  C CG  . ASP B 1 149 ? 64.847  15.111  -1.854  1.00 7.13  ? 149  ASP B CG  1 
ATOM   5332  O OD1 . ASP B 1 149 ? 65.819  15.871  -1.561  1.00 6.11  ? 149  ASP B OD1 1 
ATOM   5333  O OD2 . ASP B 1 149 ? 65.012  14.108  -2.584  1.00 6.58  ? 149  ASP B OD2 1 
ATOM   5334  N N   . VAL B 1 150 ? 61.997  15.384  2.098   1.00 3.74  ? 150  VAL B N   1 
ATOM   5335  C CA  . VAL B 1 150 ? 60.859  15.782  2.891   1.00 5.23  ? 150  VAL B CA  1 
ATOM   5336  C C   . VAL B 1 150 ? 61.308  16.735  3.998   1.00 4.04  ? 150  VAL B C   1 
ATOM   5337  O O   . VAL B 1 150 ? 62.068  16.353  4.870   1.00 5.73  ? 150  VAL B O   1 
ATOM   5338  C CB  . VAL B 1 150 ? 60.145  14.595  3.590   1.00 2.87  ? 150  VAL B CB  1 
ATOM   5339  C CG1 . VAL B 1 150 ? 58.896  15.105  4.298   1.00 2.14  ? 150  VAL B CG1 1 
ATOM   5340  C CG2 . VAL B 1 150 ? 59.758  13.512  2.579   1.00 3.99  ? 150  VAL B CG2 1 
ATOM   5341  N N   . PRO B 1 151 ? 60.770  17.947  4.012   1.00 4.99  ? 151  PRO B N   1 
ATOM   5342  C CA  . PRO B 1 151 ? 61.160  18.938  5.003   1.00 5.25  ? 151  PRO B CA  1 
ATOM   5343  C C   . PRO B 1 151 ? 60.815  18.420  6.372   1.00 6.03  ? 151  PRO B C   1 
ATOM   5344  O O   . PRO B 1 151 ? 59.706  17.832  6.494   1.00 6.29  ? 151  PRO B O   1 
ATOM   5345  C CB  . PRO B 1 151 ? 60.418  20.208  4.604   1.00 6.16  ? 151  PRO B CB  1 
ATOM   5346  C CG  . PRO B 1 151 ? 59.933  19.981  3.231   1.00 7.50  ? 151  PRO B CG  1 
ATOM   5347  C CD  . PRO B 1 151 ? 59.856  18.484  2.985   1.00 5.37  ? 151  PRO B CD  1 
ATOM   5348  N N   . PHE B 1 152 ? 61.682  18.574  7.366   1.00 4.30  ? 152  PHE B N   1 
ATOM   5349  C CA  . PHE B 1 152 ? 61.364  18.046  8.684   1.00 5.01  ? 152  PHE B CA  1 
ATOM   5350  C C   . PHE B 1 152 ? 60.000  18.421  9.251   1.00 6.24  ? 152  PHE B C   1 
ATOM   5351  O O   . PHE B 1 152 ? 59.418  17.633  10.012  1.00 3.76  ? 152  PHE B O   1 
ATOM   5352  C CB  . PHE B 1 152 ? 62.447  18.424  9.706   1.00 4.55  ? 152  PHE B CB  1 
ATOM   5353  C CG  . PHE B 1 152 ? 63.799  17.789  9.416   1.00 6.06  ? 152  PHE B CG  1 
ATOM   5354  C CD1 . PHE B 1 152 ? 63.951  16.420  9.400   1.00 4.92  ? 152  PHE B CD1 1 
ATOM   5355  C CD2 . PHE B 1 152 ? 64.921  18.590  9.195   1.00 5.08  ? 152  PHE B CD2 1 
ATOM   5356  C CE1 . PHE B 1 152 ? 65.177  15.830  9.168   1.00 5.93  ? 152  PHE B CE1 1 
ATOM   5357  C CE2 . PHE B 1 152 ? 66.150  18.015  8.945   1.00 5.06  ? 152  PHE B CE2 1 
ATOM   5358  C CZ  . PHE B 1 152 ? 66.286  16.632  8.949   1.00 4.98  ? 152  PHE B CZ  1 
ATOM   5359  N N   . MET B 1 153 ? 59.480  19.630  8.994   1.00 6.89  ? 153  MET B N   1 
ATOM   5360  C CA  . MET B 1 153 ? 58.212  20.045  9.569   1.00 8.00  ? 153  MET B CA  1 
ATOM   5361  C C   . MET B 1 153 ? 57.032  19.422  8.793   1.00 8.00  ? 153  MET B C   1 
ATOM   5362  O O   . MET B 1 153 ? 55.901  19.556  9.280   1.00 9.04  ? 153  MET B O   1 
ATOM   5363  C CB  . MET B 1 153 ? 58.009  21.554  9.637   1.00 9.46  ? 153  MET B CB  1 
ATOM   5364  C CG  . MET B 1 153 ? 59.011  22.300  10.500  1.00 11.73 ? 153  MET B CG  1 
ATOM   5365  S SD  . MET B 1 153 ? 59.033  21.590  12.174  1.00 16.81 ? 153  MET B SD  1 
ATOM   5366  C CE  . MET B 1 153 ? 57.456  21.912  12.749  1.00 11.80 ? 153  MET B CE  1 
ATOM   5367  N N   . GLN B 1 154 ? 57.254  18.777  7.676   1.00 6.60  ? 154  GLN B N   1 
ATOM   5368  C CA  . GLN B 1 154 ? 56.214  18.069  6.945   1.00 8.71  ? 154  GLN B CA  1 
ATOM   5369  C C   . GLN B 1 154 ? 56.270  16.546  7.197   1.00 9.18  ? 154  GLN B C   1 
ATOM   5370  O O   . GLN B 1 154 ? 55.585  15.776  6.505   1.00 6.64  ? 154  GLN B O   1 
ATOM   5371  C CB  . GLN B 1 154 ? 56.361  18.362  5.452   1.00 9.56  ? 154  GLN B CB  1 
ATOM   5372  C CG  . GLN B 1 154 ? 55.950  19.788  5.071   1.00 14.05 ? 154  GLN B CG  1 
ATOM   5373  C CD  . GLN B 1 154 ? 56.287  20.091  3.626   1.00 18.25 ? 154  GLN B CD  1 
ATOM   5374  O OE1 . GLN B 1 154 ? 56.451  19.120  2.865   1.00 21.59 ? 154  GLN B OE1 1 
ATOM   5375  N NE2 . GLN B 1 154 ? 56.434  21.347  3.181   1.00 19.13 ? 154  GLN B NE2 1 
ATOM   5376  N N   . TYR B 1 155 ? 56.974  16.083  8.211   1.00 6.88  ? 155  TYR B N   1 
ATOM   5377  C CA  . TYR B 1 155 ? 57.101  14.655  8.514   1.00 8.09  ? 155  TYR B CA  1 
ATOM   5378  C C   . TYR B 1 155 ? 55.727  14.043  8.865   1.00 10.03 ? 155  TYR B C   1 
ATOM   5379  O O   . TYR B 1 155 ? 55.408  12.959  8.364   1.00 8.89  ? 155  TYR B O   1 
ATOM   5380  C CB  . TYR B 1 155 ? 58.086  14.343  9.638   1.00 5.92  ? 155  TYR B CB  1 
ATOM   5381  C CG  . TYR B 1 155 ? 59.502  14.038  9.182   1.00 6.92  ? 155  TYR B CG  1 
ATOM   5382  C CD1 . TYR B 1 155 ? 60.012  14.631  8.039   1.00 5.97  ? 155  TYR B CD1 1 
ATOM   5383  C CD2 . TYR B 1 155 ? 60.348  13.198  9.915   1.00 6.51  ? 155  TYR B CD2 1 
ATOM   5384  C CE1 . TYR B 1 155 ? 61.279  14.361  7.569   1.00 6.71  ? 155  TYR B CE1 1 
ATOM   5385  C CE2 . TYR B 1 155 ? 61.625  12.926  9.452   1.00 5.52  ? 155  TYR B CE2 1 
ATOM   5386  C CZ  . TYR B 1 155 ? 62.081  13.493  8.295   1.00 6.53  ? 155  TYR B CZ  1 
ATOM   5387  O OH  . TYR B 1 155 ? 63.347  13.247  7.793   1.00 5.21  ? 155  TYR B OH  1 
ATOM   5388  N N   . GLY B 1 156 ? 54.926  14.784  9.613   1.00 9.03  ? 156  GLY B N   1 
ATOM   5389  C CA  . GLY B 1 156 ? 53.617  14.331  10.021  1.00 10.44 ? 156  GLY B CA  1 
ATOM   5390  C C   . GLY B 1 156 ? 52.579  14.279  8.914   1.00 10.29 ? 156  GLY B C   1 
ATOM   5391  O O   . GLY B 1 156 ? 51.540  13.636  9.133   1.00 11.62 ? 156  GLY B O   1 
ATOM   5392  N N   . THR B 1 157 ? 52.785  14.931  7.792   1.00 8.72  ? 157  THR B N   1 
ATOM   5393  C CA  . THR B 1 157 ? 51.833  14.951  6.700   1.00 9.52  ? 157  THR B CA  1 
ATOM   5394  C C   . THR B 1 157 ? 52.350  14.251  5.461   1.00 8.89  ? 157  THR B C   1 
ATOM   5395  O O   . THR B 1 157 ? 51.544  13.803  4.626   1.00 10.20 ? 157  THR B O   1 
ATOM   5396  C CB  . THR B 1 157 ? 51.460  16.399  6.286   1.00 9.93  ? 157  THR B CB  1 
ATOM   5397  O OG1 . THR B 1 157 ? 52.655  17.101  5.922   1.00 9.76  ? 157  THR B OG1 1 
ATOM   5398  C CG2 . THR B 1 157 ? 50.817  17.157  7.443   1.00 9.71  ? 157  THR B CG2 1 
ATOM   5399  N N   . ASP B 1 158 ? 53.661  14.187  5.259   1.00 5.70  ? 158  ASP B N   1 
ATOM   5400  C CA  . ASP B 1 158 ? 54.166  13.606  4.032   1.00 6.80  ? 158  ASP B CA  1 
ATOM   5401  C C   . ASP B 1 158 ? 53.883  12.103  3.997   1.00 4.75  ? 158  ASP B C   1 
ATOM   5402  O O   . ASP B 1 158 ? 54.255  11.422  4.949   1.00 7.02  ? 158  ASP B O   1 
ATOM   5403  C CB  . ASP B 1 158 ? 55.682  13.850  3.858   1.00 7.52  ? 158  ASP B CB  1 
ATOM   5404  C CG  . ASP B 1 158 ? 56.003  13.662  2.391   1.00 8.20  ? 158  ASP B CG  1 
ATOM   5405  O OD1 . ASP B 1 158 ? 56.022  12.491  1.919   1.00 10.71 ? 158  ASP B OD1 1 
ATOM   5406  O OD2 . ASP B 1 158 ? 56.221  14.634  1.666   1.00 8.48  ? 158  ASP B OD2 1 
ATOM   5407  N N   . ASP B 1 159 ? 53.297  11.596  2.921   1.00 6.74  ? 159  ASP B N   1 
ATOM   5408  C CA  . ASP B 1 159 ? 53.022  10.131  2.877   1.00 8.83  ? 159  ASP B CA  1 
ATOM   5409  C C   . ASP B 1 159 ? 54.302  9.315   3.031   1.00 7.26  ? 159  ASP B C   1 
ATOM   5410  O O   . ASP B 1 159 ? 54.293  8.211   3.613   1.00 6.57  ? 159  ASP B O   1 
ATOM   5411  C CB  . ASP B 1 159 ? 52.280  9.800   1.580   1.00 10.34 ? 159  ASP B CB  1 
ATOM   5412  C CG  . ASP B 1 159 ? 52.174  8.299   1.334   1.00 14.21 ? 159  ASP B CG  1 
ATOM   5413  O OD1 . ASP B 1 159 ? 51.423  7.634   2.073   1.00 14.88 ? 159  ASP B OD1 1 
ATOM   5414  O OD2 . ASP B 1 159 ? 52.858  7.781   0.426   1.00 16.67 ? 159  ASP B OD2 1 
ATOM   5415  N N   . ILE B 1 160 ? 55.442  9.770   2.480   1.00 6.19  ? 160  ILE B N   1 
ATOM   5416  C CA  . ILE B 1 160 ? 56.696  9.014   2.655   1.00 5.54  ? 160  ILE B CA  1 
ATOM   5417  C C   . ILE B 1 160 ? 57.044  8.806   4.119   1.00 5.12  ? 160  ILE B C   1 
ATOM   5418  O O   . ILE B 1 160 ? 57.332  7.664   4.510   1.00 5.67  ? 160  ILE B O   1 
ATOM   5419  C CB  . ILE B 1 160 ? 57.888  9.679   1.936   1.00 5.67  ? 160  ILE B CB  1 
ATOM   5420  C CG1 . ILE B 1 160 ? 57.674  9.671   0.416   1.00 4.81  ? 160  ILE B CG1 1 
ATOM   5421  C CG2 . ILE B 1 160 ? 59.204  8.937   2.230   1.00 4.57  ? 160  ILE B CG2 1 
ATOM   5422  C CD1 . ILE B 1 160 ? 58.374  10.848  -0.265  1.00 4.44  ? 160  ILE B CD1 1 
ATOM   5423  N N   . THR B 1 161 ? 57.010  9.839   4.961   1.00 5.80  ? 161  THR B N   1 
ATOM   5424  C CA  . THR B 1 161 ? 57.427  9.715   6.354   1.00 6.52  ? 161  THR B CA  1 
ATOM   5425  C C   . THR B 1 161 ? 56.348  9.145   7.251   1.00 5.89  ? 161  THR B C   1 
ATOM   5426  O O   . THR B 1 161 ? 56.605  8.499   8.267   1.00 4.52  ? 161  THR B O   1 
ATOM   5427  C CB  . THR B 1 161 ? 57.970  11.059  6.889   1.00 7.86  ? 161  THR B CB  1 
ATOM   5428  O OG1 . THR B 1 161 ? 57.105  12.136  6.475   1.00 9.20  ? 161  THR B OG1 1 
ATOM   5429  C CG2 . THR B 1 161 ? 59.383  11.329  6.313   1.00 4.82  ? 161  THR B CG2 1 
ATOM   5430  N N   . VAL B 1 162 ? 55.088  9.449   6.955   1.00 7.24  ? 162  VAL B N   1 
ATOM   5431  C CA  . VAL B 1 162 ? 53.981  8.815   7.711   1.00 6.83  ? 162  VAL B CA  1 
ATOM   5432  C C   . VAL B 1 162 ? 54.075  7.292   7.528   1.00 6.92  ? 162  VAL B C   1 
ATOM   5433  O O   . VAL B 1 162 ? 53.929  6.532   8.477   1.00 7.80  ? 162  VAL B O   1 
ATOM   5434  C CB  . VAL B 1 162 ? 52.636  9.391   7.243   1.00 7.72  ? 162  VAL B CB  1 
ATOM   5435  C CG1 . VAL B 1 162 ? 51.431  8.493   7.565   1.00 7.20  ? 162  VAL B CG1 1 
ATOM   5436  C CG2 . VAL B 1 162 ? 52.404  10.760  7.940   1.00 6.89  ? 162  VAL B CG2 1 
ATOM   5437  N N   . THR B 1 163 ? 54.297  6.797   6.327   1.00 5.95  ? 163  THR B N   1 
ATOM   5438  C CA  . THR B 1 163 ? 54.388  5.357   6.060   1.00 6.01  ? 163  THR B CA  1 
ATOM   5439  C C   . THR B 1 163 ? 55.689  4.805   6.609   1.00 5.27  ? 163  THR B C   1 
ATOM   5440  O O   . THR B 1 163 ? 55.693  3.742   7.247   1.00 5.22  ? 163  THR B O   1 
ATOM   5441  C CB  . THR B 1 163 ? 54.332  5.142   4.531   1.00 5.81  ? 163  THR B CB  1 
ATOM   5442  O OG1 . THR B 1 163 ? 53.157  5.817   4.039   1.00 7.62  ? 163  THR B OG1 1 
ATOM   5443  C CG2 . THR B 1 163 ? 54.346  3.710   4.074   1.00 4.70  ? 163  THR B CG2 1 
ATOM   5444  N N   . ALA B 1 164 ? 56.816  5.544   6.518   1.00 5.04  ? 164  ALA B N   1 
ATOM   5445  C CA  . ALA B 1 164 ? 58.083  5.051   7.061   1.00 4.74  ? 164  ALA B CA  1 
ATOM   5446  C C   . ALA B 1 164 ? 57.960  4.671   8.521   1.00 5.78  ? 164  ALA B C   1 
ATOM   5447  O O   . ALA B 1 164 ? 58.351  3.600   9.027   1.00 5.35  ? 164  ALA B O   1 
ATOM   5448  C CB  . ALA B 1 164 ? 59.183  6.116   6.941   1.00 3.38  ? 164  ALA B CB  1 
ATOM   5449  N N   . ALA B 1 165 ? 57.354  5.633   9.260   1.00 5.45  ? 165  ALA B N   1 
ATOM   5450  C CA  . ALA B 1 165 ? 57.179  5.448   10.689  1.00 5.77  ? 165  ALA B CA  1 
ATOM   5451  C C   . ALA B 1 165 ? 56.364  4.193   11.015  1.00 5.23  ? 165  ALA B C   1 
ATOM   5452  O O   . ALA B 1 165 ? 56.699  3.487   11.960  1.00 4.52  ? 165  ALA B O   1 
ATOM   5453  C CB  . ALA B 1 165 ? 56.438  6.670   11.264  1.00 5.68  ? 165  ALA B CB  1 
ATOM   5454  N N   . ALA B 1 166 ? 55.256  4.007   10.295  1.00 6.31  ? 166  ALA B N   1 
ATOM   5455  C CA  . ALA B 1 166 ? 54.417  2.821   10.599  1.00 7.58  ? 166  ALA B CA  1 
ATOM   5456  C C   . ALA B 1 166 ? 55.127  1.549   10.125  1.00 7.17  ? 166  ALA B C   1 
ATOM   5457  O O   . ALA B 1 166 ? 55.062  0.532   10.803  1.00 7.11  ? 166  ALA B O   1 
ATOM   5458  C CB  . ALA B 1 166 ? 53.068  2.982   9.882   1.00 6.41  ? 166  ALA B CB  1 
ATOM   5459  N N   . ASN B 1 167 ? 55.753  1.624   8.939   1.00 5.74  ? 167  ASN B N   1 
ATOM   5460  C CA  . ASN B 1 167 ? 56.440  0.457   8.405   1.00 8.07  ? 167  ASN B CA  1 
ATOM   5461  C C   . ASN B 1 167 ? 57.523  -0.017  9.366   1.00 7.74  ? 167  ASN B C   1 
ATOM   5462  O O   . ASN B 1 167 ? 57.514  -1.181  9.763   1.00 6.89  ? 167  ASN B O   1 
ATOM   5463  C CB  . ASN B 1 167 ? 57.011  0.708   7.011   1.00 8.20  ? 167  ASN B CB  1 
ATOM   5464  C CG  . ASN B 1 167 ? 57.722  -0.533  6.492   1.00 9.22  ? 167  ASN B CG  1 
ATOM   5465  O OD1 . ASN B 1 167 ? 58.944  -0.674  6.527   1.00 6.73  ? 167  ASN B OD1 1 
ATOM   5466  N ND2 . ASN B 1 167 ? 56.887  -1.430  5.960   1.00 7.80  ? 167  ASN B ND2 1 
ATOM   5467  N N   . LEU B 1 168 ? 58.397  0.893   9.808   1.00 6.79  ? 168  LEU B N   1 
ATOM   5468  C CA  . LEU B 1 168 ? 59.433  0.565   10.756  1.00 3.81  ? 168  LEU B CA  1 
ATOM   5469  C C   . LEU B 1 168 ? 58.907  0.085   12.083  1.00 4.53  ? 168  LEU B C   1 
ATOM   5470  O O   . LEU B 1 168 ? 59.379  -0.911  12.650  1.00 4.08  ? 168  LEU B O   1 
ATOM   5471  C CB  . LEU B 1 168 ? 60.353  1.786   10.994  1.00 3.41  ? 168  LEU B CB  1 
ATOM   5472  C CG  . LEU B 1 168 ? 61.350  2.134   9.863   1.00 3.32  ? 168  LEU B CG  1 
ATOM   5473  C CD1 . LEU B 1 168 ? 61.940  3.534   10.099  1.00 3.21  ? 168  LEU B CD1 1 
ATOM   5474  C CD2 . LEU B 1 168 ? 62.476  1.108   9.824   1.00 3.59  ? 168  LEU B CD2 1 
ATOM   5475  N N   . ALA B 1 169 ? 57.860  0.724   12.646  1.00 5.64  ? 169  ALA B N   1 
ATOM   5476  C CA  . ALA B 1 169 ? 57.337  0.277   13.929  1.00 4.87  ? 169  ALA B CA  1 
ATOM   5477  C C   . ALA B 1 169 ? 56.799  -1.157  13.831  1.00 4.83  ? 169  ALA B C   1 
ATOM   5478  O O   . ALA B 1 169 ? 56.770  -1.840  14.866  1.00 5.39  ? 169  ALA B O   1 
ATOM   5479  C CB  . ALA B 1 169 ? 56.161  1.149   14.395  1.00 7.23  ? 169  ALA B CB  1 
ATOM   5480  N N   . GLY B 1 170 ? 56.348  -1.562  12.635  1.00 5.02  ? 170  GLY B N   1 
ATOM   5481  C CA  . GLY B 1 170 ? 55.801  -2.930  12.536  1.00 7.19  ? 170  GLY B CA  1 
ATOM   5482  C C   . GLY B 1 170 ? 56.882  -3.985  12.290  1.00 7.54  ? 170  GLY B C   1 
ATOM   5483  O O   . GLY B 1 170 ? 56.573  -5.197  12.339  1.00 6.80  ? 170  GLY B O   1 
ATOM   5484  N N   . MET B 1 171 ? 58.134  -3.590  12.032  1.00 5.79  ? 171  MET B N   1 
ATOM   5485  C CA  . MET B 1 171 ? 59.200  -4.586  11.816  1.00 4.66  ? 171  MET B CA  1 
ATOM   5486  C C   . MET B 1 171 ? 59.593  -5.216  13.126  1.00 4.83  ? 171  MET B C   1 
ATOM   5487  O O   . MET B 1 171 ? 59.864  -4.527  14.114  1.00 4.09  ? 171  MET B O   1 
ATOM   5488  C CB  . MET B 1 171 ? 60.433  -4.003  11.115  1.00 4.38  ? 171  MET B CB  1 
ATOM   5489  C CG  . MET B 1 171 ? 60.167  -3.606  9.670   1.00 2.36  ? 171  MET B CG  1 
ATOM   5490  S SD  . MET B 1 171 ? 61.669  -3.024  8.846   1.00 4.24  ? 171  MET B SD  1 
ATOM   5491  C CE  . MET B 1 171 ? 62.639  -4.569  8.780   1.00 3.99  ? 171  MET B CE  1 
ATOM   5492  N N   . GLU B 1 172 ? 59.644  -6.553  13.178  1.00 5.48  ? 172  GLU B N   1 
ATOM   5493  C CA  . GLU B 1 172 ? 59.966  -7.282  14.403  1.00 5.29  ? 172  GLU B CA  1 
ATOM   5494  C C   . GLU B 1 172 ? 61.137  -6.729  15.192  1.00 4.64  ? 172  GLU B C   1 
ATOM   5495  O O   . GLU B 1 172 ? 61.070  -6.585  16.402  1.00 5.13  ? 172  GLU B O   1 
ATOM   5496  C CB  . GLU B 1 172 ? 60.249  -8.762  13.996  1.00 6.37  ? 172  GLU B CB  1 
ATOM   5497  C CG  . GLU B 1 172 ? 60.498  -9.655  15.207  1.00 9.56  ? 172  GLU B CG  1 
ATOM   5498  C CD  . GLU B 1 172 ? 61.040  -11.046 14.935  1.00 9.89  ? 172  GLU B CD  1 
ATOM   5499  O OE1 . GLU B 1 172 ? 61.024  -11.548 13.807  1.00 11.65 ? 172  GLU B OE1 1 
ATOM   5500  O OE2 . GLU B 1 172 ? 61.515  -11.731 15.870  1.00 13.21 ? 172  GLU B OE2 1 
ATOM   5501  N N   . GLY B 1 173 ? 62.306  -6.502  14.592  1.00 6.78  ? 173  GLY B N   1 
ATOM   5502  C CA  . GLY B 1 173 ? 63.497  -6.060  15.345  1.00 4.48  ? 173  GLY B CA  1 
ATOM   5503  C C   . GLY B 1 173 ? 63.535  -4.574  15.621  1.00 6.11  ? 173  GLY B C   1 
ATOM   5504  O O   . GLY B 1 173 ? 64.350  -4.121  16.439  1.00 5.05  ? 173  GLY B O   1 
ATOM   5505  N N   . PHE B 1 174 ? 62.576  -3.776  15.087  1.00 5.94  ? 174  PHE B N   1 
ATOM   5506  C CA  . PHE B 1 174 ? 62.645  -2.318  15.280  1.00 6.18  ? 174  PHE B CA  1 
ATOM   5507  C C   . PHE B 1 174 ? 62.702  -1.837  16.699  1.00 6.60  ? 174  PHE B C   1 
ATOM   5508  O O   . PHE B 1 174 ? 63.540  -0.966  17.002  1.00 9.22  ? 174  PHE B O   1 
ATOM   5509  C CB  . PHE B 1 174 ? 61.634  -1.508  14.484  1.00 5.91  ? 174  PHE B CB  1 
ATOM   5510  C CG  . PHE B 1 174 ? 61.771  0.000   14.533  1.00 7.39  ? 174  PHE B CG  1 
ATOM   5511  C CD1 . PHE B 1 174 ? 62.688  0.654   13.725  1.00 6.99  ? 174  PHE B CD1 1 
ATOM   5512  C CD2 . PHE B 1 174 ? 60.975  0.754   15.371  1.00 6.97  ? 174  PHE B CD2 1 
ATOM   5513  C CE1 . PHE B 1 174 ? 62.821  2.030   13.747  1.00 5.06  ? 174  PHE B CE1 1 
ATOM   5514  C CE2 . PHE B 1 174 ? 61.085  2.134   15.405  1.00 7.99  ? 174  PHE B CE2 1 
ATOM   5515  C CZ  . PHE B 1 174 ? 62.006  2.769   14.577  1.00 7.36  ? 174  PHE B CZ  1 
ATOM   5516  N N   . PRO B 1 175 ? 61.910  -2.335  17.618  1.00 8.13  ? 175  PRO B N   1 
ATOM   5517  C CA  . PRO B 1 175 ? 61.923  -1.949  19.011  1.00 8.10  ? 175  PRO B CA  1 
ATOM   5518  C C   . PRO B 1 175 ? 63.203  -2.242  19.745  1.00 6.46  ? 175  PRO B C   1 
ATOM   5519  O O   . PRO B 1 175 ? 63.386  -1.836  20.900  1.00 5.15  ? 175  PRO B O   1 
ATOM   5520  C CB  . PRO B 1 175 ? 60.779  -2.778  19.659  1.00 9.74  ? 175  PRO B CB  1 
ATOM   5521  C CG  . PRO B 1 175 ? 59.897  -3.131  18.509  1.00 10.10 ? 175  PRO B CG  1 
ATOM   5522  C CD  . PRO B 1 175 ? 60.852  -3.358  17.357  1.00 9.24  ? 175  PRO B CD  1 
ATOM   5523  N N   . ASN B 1 176 ? 64.075  -3.085  19.203  1.00 7.30  ? 176  ASN B N   1 
ATOM   5524  C CA  . ASN B 1 176 ? 65.343  -3.404  19.817  1.00 9.22  ? 176  ASN B CA  1 
ATOM   5525  C C   . ASN B 1 176 ? 66.450  -2.541  19.207  1.00 7.58  ? 176  ASN B C   1 
ATOM   5526  O O   . ASN B 1 176 ? 67.599  -2.828  19.480  1.00 8.96  ? 176  ASN B O   1 
ATOM   5527  C CB  . ASN B 1 176 ? 65.686  -4.887  19.633  1.00 13.97 ? 176  ASN B CB  1 
ATOM   5528  C CG  . ASN B 1 176 ? 64.638  -5.789  20.247  1.00 18.64 ? 176  ASN B CG  1 
ATOM   5529  O OD1 . ASN B 1 176 ? 64.145  -6.730  19.584  1.00 22.70 ? 176  ASN B OD1 1 
ATOM   5530  N ND2 . ASN B 1 176 ? 64.233  -5.524  21.477  1.00 17.95 ? 176  ASN B ND2 1 
ATOM   5531  N N   . LEU B 1 177 ? 66.197  -1.563  18.360  1.00 6.33  ? 177  LEU B N   1 
ATOM   5532  C CA  . LEU B 1 177 ? 67.297  -0.739  17.841  1.00 5.39  ? 177  LEU B CA  1 
ATOM   5533  C C   . LEU B 1 177 ? 67.839  0.191   18.924  1.00 4.52  ? 177  LEU B C   1 
ATOM   5534  O O   . LEU B 1 177 ? 67.253  0.525   19.966  1.00 3.73  ? 177  LEU B O   1 
ATOM   5535  C CB  . LEU B 1 177 ? 66.947  -0.037  16.543  1.00 5.46  ? 177  LEU B CB  1 
ATOM   5536  C CG  . LEU B 1 177 ? 66.492  -0.832  15.322  1.00 6.93  ? 177  LEU B CG  1 
ATOM   5537  C CD1 . LEU B 1 177 ? 66.631  0.042   14.103  1.00 7.70  ? 177  LEU B CD1 1 
ATOM   5538  C CD2 . LEU B 1 177 ? 67.153  -2.185  15.112  1.00 4.80  ? 177  LEU B CD2 1 
ATOM   5539  N N   . ASP B 1 178 ? 69.114  0.603   18.713  1.00 4.43  ? 178  ASP B N   1 
ATOM   5540  C CA  . ASP B 1 178 ? 69.885  1.373   19.680  1.00 4.22  ? 178  ASP B CA  1 
ATOM   5541  C C   . ASP B 1 178 ? 69.218  2.686   20.068  1.00 2.28  ? 178  ASP B C   1 
ATOM   5542  O O   . ASP B 1 178 ? 69.003  3.482   19.167  1.00 3.62  ? 178  ASP B O   1 
ATOM   5543  C CB  . ASP B 1 178 ? 71.255  1.713   19.068  1.00 5.10  ? 178  ASP B CB  1 
ATOM   5544  C CG  . ASP B 1 178 ? 71.949  0.512   18.462  1.00 5.14  ? 178  ASP B CG  1 
ATOM   5545  O OD1 . ASP B 1 178 ? 71.419  -0.026  17.494  1.00 5.43  ? 178  ASP B OD1 1 
ATOM   5546  O OD2 . ASP B 1 178 ? 73.008  0.102   18.994  1.00 4.22  ? 178  ASP B OD2 1 
ATOM   5547  N N   . ALA B 1 179 ? 68.829  2.913   21.289  1.00 3.30  ? 179  ALA B N   1 
ATOM   5548  C CA  . ALA B 1 179 ? 68.182  4.124   21.771  1.00 5.26  ? 179  ALA B CA  1 
ATOM   5549  C C   . ALA B 1 179 ? 67.050  4.561   20.845  1.00 5.04  ? 179  ALA B C   1 
ATOM   5550  O O   . ALA B 1 179 ? 66.833  5.750   20.578  1.00 3.57  ? 179  ALA B O   1 
ATOM   5551  C CB  . ALA B 1 179 ? 69.259  5.202   21.907  1.00 3.67  ? 179  ALA B CB  1 
ATOM   5552  N N   . VAL B 1 180 ? 66.244  3.583   20.396  1.00 4.75  ? 180  VAL B N   1 
ATOM   5553  C CA  . VAL B 1 180 ? 65.234  3.905   19.363  1.00 4.05  ? 180  VAL B CA  1 
ATOM   5554  C C   . VAL B 1 180 ? 64.145  4.735   20.024  1.00 3.62  ? 180  VAL B C   1 
ATOM   5555  O O   . VAL B 1 180 ? 63.764  4.524   21.175  1.00 5.02  ? 180  VAL B O   1 
ATOM   5556  C CB  . VAL B 1 180 ? 64.718  2.634   18.659  1.00 2.66  ? 180  VAL B CB  1 
ATOM   5557  C CG1 . VAL B 1 180 ? 63.976  1.714   19.637  1.00 2.08  ? 180  VAL B CG1 1 
ATOM   5558  C CG2 . VAL B 1 180 ? 63.829  2.948   17.454  1.00 4.56  ? 180  VAL B CG2 1 
ATOM   5559  N N   . SER B 1 181 ? 63.693  5.757   19.330  1.00 4.21  ? 181  SER B N   1 
ATOM   5560  C CA  . SER B 1 181 ? 62.634  6.632   19.849  1.00 4.91  ? 181  SER B CA  1 
ATOM   5561  C C   . SER B 1 181 ? 61.285  6.065   19.390  1.00 4.01  ? 181  SER B C   1 
ATOM   5562  O O   . SER B 1 181 ? 61.055  5.846   18.202  1.00 2.97  ? 181  SER B O   1 
ATOM   5563  C CB  . SER B 1 181 ? 62.866  8.039   19.298  1.00 5.31  ? 181  SER B CB  1 
ATOM   5564  O OG  . SER B 1 181 ? 61.752  8.872   19.575  1.00 8.72  ? 181  SER B OG  1 
ATOM   5565  N N   . ILE B 1 182 ? 60.450  5.711   20.370  1.00 5.50  ? 182  ILE B N   1 
ATOM   5566  C CA  . ILE B 1 182 ? 59.159  5.075   20.036  1.00 7.30  ? 182  ILE B CA  1 
ATOM   5567  C C   . ILE B 1 182 ? 58.178  5.295   21.176  1.00 6.67  ? 182  ILE B C   1 
ATOM   5568  O O   . ILE B 1 182 ? 58.620  5.409   22.324  1.00 7.47  ? 182  ILE B O   1 
ATOM   5569  C CB  . ILE B 1 182 ? 59.388  3.576   19.790  1.00 7.21  ? 182  ILE B CB  1 
ATOM   5570  C CG1 . ILE B 1 182 ? 58.167  2.798   19.298  1.00 8.38  ? 182  ILE B CG1 1 
ATOM   5571  C CG2 . ILE B 1 182 ? 59.925  2.916   21.074  1.00 10.47 ? 182  ILE B CG2 1 
ATOM   5572  C CD1 . ILE B 1 182 ? 58.667  1.439   18.746  1.00 10.73 ? 182  ILE B CD1 1 
ATOM   5573  N N   . GLY B 1 183 ? 56.877  5.330   20.837  1.00 5.55  ? 183  GLY B N   1 
ATOM   5574  C CA  . GLY B 1 183 ? 55.897  5.547   21.907  1.00 5.59  ? 183  GLY B CA  1 
ATOM   5575  C C   . GLY B 1 183 ? 55.800  4.319   22.780  1.00 5.53  ? 183  GLY B C   1 
ATOM   5576  O O   . GLY B 1 183 ? 56.074  3.203   22.288  1.00 7.34  ? 183  GLY B O   1 
ATOM   5577  N N   . SER B 1 184 ? 55.244  4.474   23.980  1.00 5.36  ? 184  SER B N   1 
ATOM   5578  C CA  . SER B 1 184 ? 54.908  3.420   24.911  1.00 6.27  ? 184  SER B CA  1 
ATOM   5579  C C   . SER B 1 184 ? 53.794  2.569   24.283  1.00 7.08  ? 184  SER B C   1 
ATOM   5580  O O   . SER B 1 184 ? 53.695  1.379   24.543  1.00 8.01  ? 184  SER B O   1 
ATOM   5581  C CB  . SER B 1 184 ? 54.412  3.869   26.288  1.00 5.93  ? 184  SER B CB  1 
ATOM   5582  O OG  . SER B 1 184 ? 53.246  4.737   26.178  1.00 5.78  ? 184  SER B OG  1 
ATOM   5583  N N   . ASP B 1 185 ? 53.068  3.123   23.322  1.00 8.24  ? 185  ASP B N   1 
ATOM   5584  C CA  . ASP B 1 185 ? 52.021  2.427   22.607  1.00 9.94  ? 185  ASP B CA  1 
ATOM   5585  C C   . ASP B 1 185 ? 52.602  1.669   21.425  1.00 8.89  ? 185  ASP B C   1 
ATOM   5586  O O   . ASP B 1 185 ? 51.832  1.074   20.687  1.00 8.73  ? 185  ASP B O   1 
ATOM   5587  C CB  . ASP B 1 185 ? 50.926  3.408   22.184  1.00 8.34  ? 185  ASP B CB  1 
ATOM   5588  C CG  . ASP B 1 185 ? 51.220  4.294   21.009  1.00 9.56  ? 185  ASP B CG  1 
ATOM   5589  O OD1 . ASP B 1 185 ? 52.376  4.303   20.529  1.00 8.18  ? 185  ASP B OD1 1 
ATOM   5590  O OD2 . ASP B 1 185 ? 50.293  5.026   20.542  1.00 8.27  ? 185  ASP B OD2 1 
ATOM   5591  N N   . GLY B 1 186 ? 53.921  1.700   21.207  1.00 7.84  ? 186  GLY B N   1 
ATOM   5592  C CA  . GLY B 1 186 ? 54.540  0.959   20.123  1.00 6.33  ? 186  GLY B CA  1 
ATOM   5593  C C   . GLY B 1 186 ? 54.543  1.664   18.785  1.00 6.05  ? 186  GLY B C   1 
ATOM   5594  O O   . GLY B 1 186 ? 55.097  1.152   17.819  1.00 6.52  ? 186  GLY B O   1 
ATOM   5595  N N   . THR B 1 187 ? 53.996  2.856   18.640  1.00 5.81  ? 187  THR B N   1 
ATOM   5596  C CA  . THR B 1 187 ? 53.989  3.564   17.379  1.00 6.26  ? 187  THR B CA  1 
ATOM   5597  C C   . THR B 1 187 ? 55.185  4.554   17.308  1.00 5.51  ? 187  THR B C   1 
ATOM   5598  O O   . THR B 1 187 ? 55.698  4.972   18.332  1.00 4.69  ? 187  THR B O   1 
ATOM   5599  C CB  . THR B 1 187 ? 52.717  4.423   17.187  1.00 6.06  ? 187  THR B CB  1 
ATOM   5600  O OG1 . THR B 1 187 ? 52.660  5.393   18.241  1.00 5.38  ? 187  THR B OG1 1 
ATOM   5601  C CG2 . THR B 1 187 ? 51.428  3.593   17.202  1.00 7.13  ? 187  THR B CG2 1 
ATOM   5602  N N   . VAL B 1 188 ? 55.527  4.977   16.108  1.00 5.34  ? 188  VAL B N   1 
ATOM   5603  C CA  . VAL B 1 188 ? 56.581  5.987   15.960  1.00 4.71  ? 188  VAL B CA  1 
ATOM   5604  C C   . VAL B 1 188 ? 55.909  7.290   15.491  1.00 5.28  ? 188  VAL B C   1 
ATOM   5605  O O   . VAL B 1 188 ? 55.284  7.257   14.435  1.00 5.55  ? 188  VAL B O   1 
ATOM   5606  C CB  . VAL B 1 188 ? 57.645  5.538   14.964  1.00 5.54  ? 188  VAL B CB  1 
ATOM   5607  C CG1 . VAL B 1 188 ? 58.581  6.674   14.565  1.00 4.35  ? 188  VAL B CG1 1 
ATOM   5608  C CG2 . VAL B 1 188 ? 58.487  4.368   15.536  1.00 3.39  ? 188  VAL B CG2 1 
ATOM   5609  N N   . ASP B 1 189 ? 56.049  8.377   16.259  1.00 5.13  ? 189  ASP B N   1 
ATOM   5610  C CA  . ASP B 1 189 ? 55.468  9.640   15.763  1.00 6.11  ? 189  ASP B CA  1 
ATOM   5611  C C   . ASP B 1 189 ? 56.447  10.223  14.755  1.00 6.49  ? 189  ASP B C   1 
ATOM   5612  O O   . ASP B 1 189 ? 57.604  10.548  15.082  1.00 7.57  ? 189  ASP B O   1 
ATOM   5613  C CB  . ASP B 1 189 ? 55.200  10.603  16.925  1.00 6.03  ? 189  ASP B CB  1 
ATOM   5614  C CG  . ASP B 1 189 ? 54.777  11.987  16.419  1.00 7.43  ? 189  ASP B CG  1 
ATOM   5615  O OD1 . ASP B 1 189 ? 53.785  12.094  15.672  1.00 8.66  ? 189  ASP B OD1 1 
ATOM   5616  O OD2 . ASP B 1 189 ? 55.467  12.999  16.702  1.00 7.75  ? 189  ASP B OD2 1 
ATOM   5617  N N   . PRO B 1 190 ? 56.022  10.452  13.536  1.00 5.32  ? 190  PRO B N   1 
ATOM   5618  C CA  . PRO B 1 190 ? 56.852  10.997  12.493  1.00 6.31  ? 190  PRO B CA  1 
ATOM   5619  C C   . PRO B 1 190 ? 57.562  12.286  12.854  1.00 7.63  ? 190  PRO B C   1 
ATOM   5620  O O   . PRO B 1 190 ? 58.792  12.355  12.752  1.00 5.32  ? 190  PRO B O   1 
ATOM   5621  C CB  . PRO B 1 190 ? 55.916  11.171  11.299  1.00 5.28  ? 190  PRO B CB  1 
ATOM   5622  C CG  . PRO B 1 190 ? 54.799  10.204  11.544  1.00 5.52  ? 190  PRO B CG  1 
ATOM   5623  C CD  . PRO B 1 190 ? 54.645  10.125  13.040  1.00 6.08  ? 190  PRO B CD  1 
ATOM   5624  N N   . LEU B 1 191 ? 56.838  13.313  13.324  1.00 7.43  ? 191  LEU B N   1 
ATOM   5625  C CA  . LEU B 1 191 ? 57.454  14.593  13.647  1.00 7.50  ? 191  LEU B CA  1 
ATOM   5626  C C   . LEU B 1 191 ? 58.485  14.527  14.770  1.00 5.89  ? 191  LEU B C   1 
ATOM   5627  O O   . LEU B 1 191 ? 59.535  15.190  14.660  1.00 6.65  ? 191  LEU B O   1 
ATOM   5628  C CB  . LEU B 1 191 ? 56.343  15.551  14.087  1.00 8.50  ? 191  LEU B CB  1 
ATOM   5629  C CG  . LEU B 1 191 ? 56.125  16.897  13.436  1.00 10.80 ? 191  LEU B CG  1 
ATOM   5630  C CD1 . LEU B 1 191 ? 56.843  17.212  12.141  1.00 7.85  ? 191  LEU B CD1 1 
ATOM   5631  C CD2 . LEU B 1 191 ? 54.601  17.067  13.220  1.00 10.90 ? 191  LEU B CD2 1 
ATOM   5632  N N   . SER B 1 192 ? 58.200  13.820  15.861  1.00 2.30  ? 192  SER B N   1 
ATOM   5633  C CA  . SER B 1 192 ? 59.115  13.861  16.997  1.00 3.03  ? 192  SER B CA  1 
ATOM   5634  C C   . SER B 1 192 ? 59.889  12.601  17.256  1.00 3.74  ? 192  SER B C   1 
ATOM   5635  O O   . SER B 1 192 ? 60.680  12.555  18.217  1.00 4.66  ? 192  SER B O   1 
ATOM   5636  C CB  . SER B 1 192 ? 58.213  14.172  18.220  1.00 3.02  ? 192  SER B CB  1 
ATOM   5637  O OG  . SER B 1 192 ? 57.414  13.024  18.520  1.00 3.50  ? 192  SER B OG  1 
ATOM   5638  N N   . GLN B 1 193 ? 59.652  11.517  16.495  1.00 4.94  ? 193  GLN B N   1 
ATOM   5639  C CA  . GLN B 1 193 ? 60.350  10.260  16.809  1.00 4.73  ? 193  GLN B CA  1 
ATOM   5640  C C   . GLN B 1 193 ? 61.061  9.617   15.646  1.00 4.77  ? 193  GLN B C   1 
ATOM   5641  O O   . GLN B 1 193 ? 62.070  8.951   15.827  1.00 5.00  ? 193  GLN B O   1 
ATOM   5642  C CB  . GLN B 1 193 ? 59.330  9.281   17.444  1.00 4.86  ? 193  GLN B CB  1 
ATOM   5643  C CG  . GLN B 1 193 ? 58.806  9.745   18.799  1.00 4.07  ? 193  GLN B CG  1 
ATOM   5644  C CD  . GLN B 1 193 ? 57.838  8.791   19.474  1.00 4.63  ? 193  GLN B CD  1 
ATOM   5645  O OE1 . GLN B 1 193 ? 57.102  8.070   18.778  1.00 3.63  ? 193  GLN B OE1 1 
ATOM   5646  N NE2 . GLN B 1 193 ? 57.822  8.812   20.795  1.00 5.65  ? 193  GLN B NE2 1 
ATOM   5647  N N   . LEU B 1 194 ? 60.571  9.764   14.428  1.00 5.06  ? 194  LEU B N   1 
ATOM   5648  C CA  . LEU B 1 194 ? 61.156  9.185   13.242  1.00 6.21  ? 194  LEU B CA  1 
ATOM   5649  C C   . LEU B 1 194 ? 62.609  9.685   13.075  1.00 6.57  ? 194  LEU B C   1 
ATOM   5650  O O   . LEU B 1 194 ? 62.855  10.889  13.017  1.00 4.01  ? 194  LEU B O   1 
ATOM   5651  C CB  . LEU B 1 194 ? 60.377  9.554   11.982  1.00 3.97  ? 194  LEU B CB  1 
ATOM   5652  C CG  . LEU B 1 194 ? 60.810  8.806   10.717  1.00 3.17  ? 194  LEU B CG  1 
ATOM   5653  C CD1 . LEU B 1 194 ? 60.733  7.293   10.868  1.00 2.41  ? 194  LEU B CD1 1 
ATOM   5654  C CD2 . LEU B 1 194 ? 60.026  9.277   9.487   1.00 3.86  ? 194  LEU B CD2 1 
ATOM   5655  N N   . PHE B 1 195 ? 63.537  8.748   12.938  1.00 5.39  ? 195  PHE B N   1 
ATOM   5656  C CA  . PHE B 1 195 ? 64.954  9.048   12.836  1.00 5.07  ? 195  PHE B CA  1 
ATOM   5657  C C   . PHE B 1 195 ? 65.486  9.832   14.033  1.00 4.30  ? 195  PHE B C   1 
ATOM   5658  O O   . PHE B 1 195 ? 66.426  10.637  13.899  1.00 3.97  ? 195  PHE B O   1 
ATOM   5659  C CB  . PHE B 1 195 ? 65.250  9.711   11.486  1.00 4.65  ? 195  PHE B CB  1 
ATOM   5660  C CG  . PHE B 1 195 ? 64.650  9.146   10.232  1.00 4.12  ? 195  PHE B CG  1 
ATOM   5661  C CD1 . PHE B 1 195 ? 64.467  7.783   10.045  1.00 3.26  ? 195  PHE B CD1 1 
ATOM   5662  C CD2 . PHE B 1 195 ? 64.249  10.013  9.208   1.00 3.91  ? 195  PHE B CD2 1 
ATOM   5663  C CE1 . PHE B 1 195 ? 63.907  7.304   8.872   1.00 2.35  ? 195  PHE B CE1 1 
ATOM   5664  C CE2 . PHE B 1 195 ? 63.674  9.546   8.043   1.00 3.56  ? 195  PHE B CE2 1 
ATOM   5665  C CZ  . PHE B 1 195 ? 63.504  8.179   7.879   1.00 2.84  ? 195  PHE B CZ  1 
ATOM   5666  N N   . ARG B 1 196 ? 64.984  9.637   15.257  1.00 4.20  ? 196  ARG B N   1 
ATOM   5667  C CA  . ARG B 1 196 ? 65.487  10.254  16.465  1.00 4.68  ? 196  ARG B CA  1 
ATOM   5668  C C   . ARG B 1 196 ? 66.032  9.191   17.428  1.00 4.13  ? 196  ARG B C   1 
ATOM   5669  O O   . ARG B 1 196 ? 66.077  7.987   17.170  1.00 5.41  ? 196  ARG B O   1 
ATOM   5670  C CB  . ARG B 1 196 ? 64.472  11.143  17.224  1.00 4.48  ? 196  ARG B CB  1 
ATOM   5671  C CG  . ARG B 1 196 ? 63.901  12.241  16.328  1.00 5.15  ? 196  ARG B CG  1 
ATOM   5672  C CD  . ARG B 1 196 ? 63.543  13.486  17.167  1.00 4.45  ? 196  ARG B CD  1 
ATOM   5673  N NE  . ARG B 1 196 ? 62.770  14.432  16.341  1.00 4.27  ? 196  ARG B NE  1 
ATOM   5674  C CZ  . ARG B 1 196 ? 62.601  15.711  16.601  1.00 3.41  ? 196  ARG B CZ  1 
ATOM   5675  N NH1 . ARG B 1 196 ? 63.227  16.240  17.669  1.00 2.08  ? 196  ARG B NH1 1 
ATOM   5676  N NH2 . ARG B 1 196 ? 61.880  16.435  15.755  1.00 3.79  ? 196  ARG B NH2 1 
ATOM   5677  N N   . ALA B 1 197 ? 66.559  9.619   18.559  1.00 3.77  ? 197  ALA B N   1 
ATOM   5678  C CA  . ALA B 1 197 ? 67.125  8.733   19.564  1.00 2.26  ? 197  ALA B CA  1 
ATOM   5679  C C   . ALA B 1 197 ? 66.682  9.261   20.926  1.00 3.21  ? 197  ALA B C   1 
ATOM   5680  O O   . ALA B 1 197 ? 66.326  10.417  21.004  1.00 3.44  ? 197  ALA B O   1 
ATOM   5681  C CB  . ALA B 1 197 ? 68.645  8.611   19.480  1.00 4.05  ? 197  ALA B CB  1 
ATOM   5682  N N   . THR B 1 198 ? 66.760  8.391   21.927  1.00 3.22  ? 198  THR B N   1 
ATOM   5683  C CA  . THR B 1 198 ? 66.361  8.730   23.257  1.00 4.39  ? 198  THR B CA  1 
ATOM   5684  C C   . THR B 1 198 ? 67.441  9.442   24.090  1.00 4.51  ? 198  THR B C   1 
ATOM   5685  O O   . THR B 1 198 ? 67.124  9.681   25.249  1.00 3.07  ? 198  THR B O   1 
ATOM   5686  C CB  . THR B 1 198 ? 65.851  7.520   24.061  1.00 4.07  ? 198  THR B CB  1 
ATOM   5687  O OG1 . THR B 1 198 ? 66.832  6.497   24.081  1.00 5.28  ? 198  THR B OG1 1 
ATOM   5688  C CG2 . THR B 1 198 ? 64.575  6.931   23.378  1.00 2.08  ? 198  THR B CG2 1 
ATOM   5689  N N   . PHE B 1 199 ? 68.605  9.763   23.528  1.00 2.57  ? 199  PHE B N   1 
ATOM   5690  C CA  . PHE B 1 199 ? 69.585  10.543  24.320  1.00 2.55  ? 199  PHE B CA  1 
ATOM   5691  C C   . PHE B 1 199 ? 68.925  11.846  24.790  1.00 3.85  ? 199  PHE B C   1 
ATOM   5692  O O   . PHE B 1 199 ? 68.042  12.343  24.086  1.00 3.23  ? 199  PHE B O   1 
ATOM   5693  C CB  . PHE B 1 199 ? 70.812  10.760  23.416  1.00 2.21  ? 199  PHE B CB  1 
ATOM   5694  C CG  . PHE B 1 199 ? 71.676  9.525   23.211  1.00 3.15  ? 199  PHE B CG  1 
ATOM   5695  C CD1 . PHE B 1 199 ? 71.476  8.346   23.899  1.00 3.25  ? 199  PHE B CD1 1 
ATOM   5696  C CD2 . PHE B 1 199 ? 72.753  9.575   22.329  1.00 4.25  ? 199  PHE B CD2 1 
ATOM   5697  C CE1 . PHE B 1 199 ? 72.278  7.238   23.723  1.00 5.56  ? 199  PHE B CE1 1 
ATOM   5698  C CE2 . PHE B 1 199 ? 73.586  8.476   22.138  1.00 4.17  ? 199  PHE B CE2 1 
ATOM   5699  C CZ  . PHE B 1 199 ? 73.345  7.318   22.826  1.00 4.98  ? 199  PHE B CZ  1 
ATOM   5700  N N   . VAL B 1 200 ? 69.241  12.352  25.949  1.00 4.33  ? 200  VAL B N   1 
ATOM   5701  C CA  . VAL B 1 200 ? 68.610  13.533  26.530  1.00 3.82  ? 200  VAL B CA  1 
ATOM   5702  C C   . VAL B 1 200 ? 68.497  14.684  25.528  1.00 4.59  ? 200  VAL B C   1 
ATOM   5703  O O   . VAL B 1 200 ? 69.411  15.077  24.787  1.00 3.44  ? 200  VAL B O   1 
ATOM   5704  C CB  . VAL B 1 200 ? 69.355  14.005  27.794  1.00 6.51  ? 200  VAL B CB  1 
ATOM   5705  C CG1 . VAL B 1 200 ? 68.637  15.199  28.431  1.00 4.52  ? 200  VAL B CG1 1 
ATOM   5706  C CG2 . VAL B 1 200 ? 69.534  12.873  28.793  1.00 5.10  ? 200  VAL B CG2 1 
ATOM   5707  N N   . GLY B 1 201 ? 67.279  15.185  25.365  1.00 4.12  ? 201  GLY B N   1 
ATOM   5708  C CA  . GLY B 1 201 ? 66.877  16.317  24.593  1.00 2.85  ? 201  GLY B CA  1 
ATOM   5709  C C   . GLY B 1 201 ? 66.663  16.136  23.134  1.00 3.56  ? 201  GLY B C   1 
ATOM   5710  O O   . GLY B 1 201 ? 66.159  16.988  22.386  1.00 5.06  ? 201  GLY B O   1 
ATOM   5711  N N   . VAL B 1 202 ? 67.087  14.993  22.608  1.00 3.17  ? 202  VAL B N   1 
ATOM   5712  C CA  . VAL B 1 202 ? 67.056  14.783  21.147  1.00 2.74  ? 202  VAL B CA  1 
ATOM   5713  C C   . VAL B 1 202 ? 65.655  14.784  20.546  1.00 2.99  ? 202  VAL B C   1 
ATOM   5714  O O   . VAL B 1 202 ? 65.423  15.210  19.391  1.00 2.27  ? 202  VAL B O   1 
ATOM   5715  C CB  . VAL B 1 202 ? 67.803  13.474  20.830  1.00 3.31  ? 202  VAL B CB  1 
ATOM   5716  C CG1 . VAL B 1 202 ? 67.622  13.057  19.386  1.00 2.08  ? 202  VAL B CG1 1 
ATOM   5717  C CG2 . VAL B 1 202 ? 69.307  13.617  21.117  1.00 4.05  ? 202  VAL B CG2 1 
ATOM   5718  N N   . GLU B 1 203 ? 64.704  14.276  21.322  1.00 4.17  ? 203  GLU B N   1 
ATOM   5719  C CA  . GLU B 1 203 ? 63.306  14.160  20.919  1.00 4.43  ? 203  GLU B CA  1 
ATOM   5720  C C   . GLU B 1 203 ? 62.491  15.425  21.225  1.00 4.80  ? 203  GLU B C   1 
ATOM   5721  O O   . GLU B 1 203 ? 61.338  15.484  20.785  1.00 3.64  ? 203  GLU B O   1 
ATOM   5722  C CB  . GLU B 1 203 ? 62.628  12.964  21.620  1.00 5.37  ? 203  GLU B CB  1 
ATOM   5723  C CG  . GLU B 1 203 ? 63.268  11.609  21.328  1.00 5.08  ? 203  GLU B CG  1 
ATOM   5724  C CD  . GLU B 1 203 ? 62.913  10.588  22.385  1.00 8.52  ? 203  GLU B CD  1 
ATOM   5725  O OE1 . GLU B 1 203 ? 63.457  10.662  23.512  1.00 7.39  ? 203  GLU B OE1 1 
ATOM   5726  O OE2 . GLU B 1 203 ? 62.077  9.701   22.055  1.00 6.81  ? 203  GLU B OE2 1 
ATOM   5727  N N   . THR B 1 204 ? 63.060  16.393  21.919  1.00 3.64  ? 204  THR B N   1 
ATOM   5728  C CA  . THR B 1 204 ? 62.362  17.634  22.264  1.00 2.08  ? 204  THR B CA  1 
ATOM   5729  C C   . THR B 1 204 ? 62.623  18.698  21.219  1.00 4.26  ? 204  THR B C   1 
ATOM   5730  O O   . THR B 1 204 ? 63.802  18.893  20.811  1.00 4.74  ? 204  THR B O   1 
ATOM   5731  C CB  . THR B 1 204 ? 62.817  18.165  23.621  1.00 3.64  ? 204  THR B CB  1 
ATOM   5732  O OG1 . THR B 1 204 ? 62.575  17.154  24.599  1.00 2.68  ? 204  THR B OG1 1 
ATOM   5733  C CG2 . THR B 1 204 ? 61.993  19.392  24.091  1.00 3.33  ? 204  THR B CG2 1 
ATOM   5734  N N   . GLY B 1 205 ? 61.567  19.387  20.774  1.00 3.72  ? 205  GLY B N   1 
ATOM   5735  C CA  . GLY B 1 205 ? 61.748  20.445  19.800  1.00 2.08  ? 205  GLY B CA  1 
ATOM   5736  C C   . GLY B 1 205 ? 62.086  19.992  18.396  1.00 4.87  ? 205  GLY B C   1 
ATOM   5737  O O   . GLY B 1 205 ? 61.855  18.862  18.002  1.00 5.90  ? 205  GLY B O   1 
ATOM   5738  N N   . PRO B 1 206 ? 62.555  20.954  17.591  1.00 3.86  ? 206  PRO B N   1 
ATOM   5739  C CA  . PRO B 1 206 ? 62.868  20.704  16.207  1.00 4.38  ? 206  PRO B CA  1 
ATOM   5740  C C   . PRO B 1 206 ? 63.941  19.640  16.046  1.00 4.50  ? 206  PRO B C   1 
ATOM   5741  O O   . PRO B 1 206 ? 64.764  19.421  16.941  1.00 5.45  ? 206  PRO B O   1 
ATOM   5742  C CB  . PRO B 1 206 ? 63.248  22.066  15.641  1.00 3.10  ? 206  PRO B CB  1 
ATOM   5743  C CG  . PRO B 1 206 ? 62.812  23.086  16.668  1.00 3.54  ? 206  PRO B CG  1 
ATOM   5744  C CD  . PRO B 1 206 ? 62.799  22.366  17.982  1.00 3.17  ? 206  PRO B CD  1 
ATOM   5745  N N   . PHE B 1 207 ? 63.937  18.994  14.878  1.00 2.08  ? 207  PHE B N   1 
ATOM   5746  C CA  . PHE B 1 207 ? 64.896  17.942  14.604  1.00 4.52  ? 207  PHE B CA  1 
ATOM   5747  C C   . PHE B 1 207 ? 66.365  18.395  14.628  1.00 3.24  ? 207  PHE B C   1 
ATOM   5748  O O   . PHE B 1 207 ? 67.202  17.665  15.158  1.00 3.64  ? 207  PHE B O   1 
ATOM   5749  C CB  . PHE B 1 207 ? 64.586  17.340  13.217  1.00 3.65  ? 207  PHE B CB  1 
ATOM   5750  C CG  . PHE B 1 207 ? 65.212  16.014  12.908  1.00 3.79  ? 207  PHE B CG  1 
ATOM   5751  C CD1 . PHE B 1 207 ? 66.567  16.013  12.488  1.00 4.02  ? 207  PHE B CD1 1 
ATOM   5752  C CD2 . PHE B 1 207 ? 64.516  14.810  12.952  1.00 2.70  ? 207  PHE B CD2 1 
ATOM   5753  C CE1 . PHE B 1 207 ? 67.200  14.819  12.173  1.00 5.25  ? 207  PHE B CE1 1 
ATOM   5754  C CE2 . PHE B 1 207 ? 65.146  13.619  12.645  1.00 5.20  ? 207  PHE B CE2 1 
ATOM   5755  C CZ  . PHE B 1 207 ? 66.499  13.626  12.253  1.00 5.61  ? 207  PHE B CZ  1 
ATOM   5756  N N   . ILE B 1 208 ? 66.618  19.544  14.006  1.00 3.17  ? 208  ILE B N   1 
ATOM   5757  C CA  . ILE B 1 208 ? 68.006  20.031  13.922  1.00 2.87  ? 208  ILE B CA  1 
ATOM   5758  C C   . ILE B 1 208 ? 68.404  20.871  15.125  1.00 4.62  ? 208  ILE B C   1 
ATOM   5759  O O   . ILE B 1 208 ? 67.689  21.833  15.535  1.00 2.74  ? 208  ILE B O   1 
ATOM   5760  C CB  . ILE B 1 208 ? 68.223  20.813  12.620  1.00 3.63  ? 208  ILE B CB  1 
ATOM   5761  C CG1 . ILE B 1 208 ? 67.921  19.920  11.409  1.00 3.98  ? 208  ILE B CG1 1 
ATOM   5762  C CG2 . ILE B 1 208 ? 69.649  21.386  12.503  1.00 3.54  ? 208  ILE B CG2 1 
ATOM   5763  C CD1 . ILE B 1 208 ? 68.868  18.754  11.227  1.00 5.28  ? 208  ILE B CD1 1 
ATOM   5764  N N   . SER B 1 209 ? 69.574  20.536  15.663  1.00 3.02  ? 209  SER B N   1 
ATOM   5765  C CA  . SER B 1 209 ? 70.109  21.343  16.751  1.00 4.06  ? 209  SER B CA  1 
ATOM   5766  C C   . SER B 1 209 ? 70.104  22.858  16.476  1.00 2.08  ? 209  SER B C   1 
ATOM   5767  O O   . SER B 1 209 ? 70.492  23.304  15.408  1.00 3.27  ? 209  SER B O   1 
ATOM   5768  C CB  . SER B 1 209 ? 71.622  21.016  16.955  1.00 2.24  ? 209  SER B CB  1 
ATOM   5769  O OG  . SER B 1 209 ? 72.039  21.631  18.174  1.00 2.88  ? 209  SER B OG  1 
ATOM   5770  N N   . GLN B 1 210 ? 69.908  23.630  17.535  1.00 3.84  ? 210  GLN B N   1 
ATOM   5771  C CA  . GLN B 1 210 ? 69.975  25.101  17.398  1.00 3.79  ? 210  GLN B CA  1 
ATOM   5772  C C   . GLN B 1 210 ? 71.385  25.516  16.987  1.00 4.45  ? 210  GLN B C   1 
ATOM   5773  O O   . GLN B 1 210 ? 71.574  26.537  16.333  1.00 3.77  ? 210  GLN B O   1 
ATOM   5774  C CB  . GLN B 1 210 ? 69.609  25.742  18.741  1.00 3.09  ? 210  GLN B CB  1 
ATOM   5775  C CG  . GLN B 1 210 ? 68.155  25.596  19.214  1.00 4.22  ? 210  GLN B CG  1 
ATOM   5776  C CD  . GLN B 1 210 ? 67.219  26.089  18.122  1.00 4.87  ? 210  GLN B CD  1 
ATOM   5777  O OE1 . GLN B 1 210 ? 67.419  27.207  17.649  1.00 2.69  ? 210  GLN B OE1 1 
ATOM   5778  N NE2 . GLN B 1 210 ? 66.293  25.245  17.644  1.00 2.89  ? 210  GLN B NE2 1 
ATOM   5779  N N   . LEU B 1 211 ? 72.411  24.703  17.310  1.00 2.90  ? 211  LEU B N   1 
ATOM   5780  C CA  . LEU B 1 211 ? 73.804  24.990  17.001  1.00 3.68  ? 211  LEU B CA  1 
ATOM   5781  C C   . LEU B 1 211 ? 74.150  24.921  15.534  1.00 5.02  ? 211  LEU B C   1 
ATOM   5782  O O   . LEU B 1 211 ? 75.200  25.377  15.073  1.00 4.12  ? 211  LEU B O   1 
ATOM   5783  C CB  . LEU B 1 211 ? 74.715  24.070  17.854  1.00 3.32  ? 211  LEU B CB  1 
ATOM   5784  C CG  . LEU B 1 211 ? 74.471  24.130  19.353  1.00 2.56  ? 211  LEU B CG  1 
ATOM   5785  C CD1 . LEU B 1 211 ? 75.246  23.075  20.118  1.00 2.58  ? 211  LEU B CD1 1 
ATOM   5786  C CD2 . LEU B 1 211 ? 74.737  25.517  19.923  1.00 3.93  ? 211  LEU B CD2 1 
ATOM   5787  N N   . LEU B 1 212 ? 73.293  24.274  14.729  1.00 4.53  ? 212  LEU B N   1 
ATOM   5788  C CA  . LEU B 1 212 ? 73.501  24.167  13.302  1.00 4.34  ? 212  LEU B CA  1 
ATOM   5789  C C   . LEU B 1 212 ? 72.729  25.172  12.468  1.00 2.45  ? 212  LEU B C   1 
ATOM   5790  O O   . LEU B 1 212 ? 72.939  25.287  11.281  1.00 2.69  ? 212  LEU B O   1 
ATOM   5791  C CB  . LEU B 1 212 ? 72.952  22.772  12.921  1.00 5.90  ? 212  LEU B CB  1 
ATOM   5792  C CG  . LEU B 1 212 ? 73.941  21.685  12.520  1.00 10.30 ? 212  LEU B CG  1 
ATOM   5793  C CD1 . LEU B 1 212 ? 75.398  22.014  12.711  1.00 9.49  ? 212  LEU B CD1 1 
ATOM   5794  C CD2 . LEU B 1 212 ? 73.594  20.351  13.191  1.00 9.70  ? 212  LEU B CD2 1 
ATOM   5795  N N   . VAL B 1 213 ? 71.714  25.786  13.101  1.00 2.37  ? 213  VAL B N   1 
ATOM   5796  C CA  . VAL B 1 213 ? 70.882  26.726  12.325  1.00 4.37  ? 213  VAL B CA  1 
ATOM   5797  C C   . VAL B 1 213 ? 70.981  28.206  12.705  1.00 5.79  ? 213  VAL B C   1 
ATOM   5798  O O   . VAL B 1 213 ? 70.462  29.119  12.018  1.00 7.04  ? 213  VAL B O   1 
ATOM   5799  C CB  . VAL B 1 213 ? 69.392  26.300  12.332  1.00 3.44  ? 213  VAL B CB  1 
ATOM   5800  C CG1 . VAL B 1 213 ? 69.178  24.948  11.625  1.00 3.77  ? 213  VAL B CG1 1 
ATOM   5801  C CG2 . VAL B 1 213 ? 68.858  26.246  13.758  1.00 2.40  ? 213  VAL B CG2 1 
ATOM   5802  N N   . ASN B 1 214 ? 71.634  28.549  13.802  1.00 6.14  ? 214  ASN B N   1 
ATOM   5803  C CA  . ASN B 1 214 ? 71.816  29.932  14.226  1.00 5.30  ? 214  ASN B CA  1 
ATOM   5804  C C   . ASN B 1 214 ? 73.203  30.440  13.811  1.00 6.56  ? 214  ASN B C   1 
ATOM   5805  O O   . ASN B 1 214 ? 74.162  29.678  13.628  1.00 4.92  ? 214  ASN B O   1 
ATOM   5806  C CB  . ASN B 1 214 ? 71.674  30.023  15.740  1.00 5.25  ? 214  ASN B CB  1 
ATOM   5807  C CG  . ASN B 1 214 ? 70.192  29.922  16.113  1.00 9.48  ? 214  ASN B CG  1 
ATOM   5808  O OD1 . ASN B 1 214 ? 69.449  30.878  15.800  1.00 6.84  ? 214  ASN B OD1 1 
ATOM   5809  N ND2 . ASN B 1 214 ? 69.814  28.773  16.680  1.00 7.69  ? 214  ASN B ND2 1 
ATOM   5810  N N   . SER B 1 215 ? 73.308  31.748  13.649  1.00 4.72  ? 215  SER B N   1 
ATOM   5811  C CA  . SER B 1 215 ? 74.548  32.397  13.278  1.00 4.39  ? 215  SER B CA  1 
ATOM   5812  C C   . SER B 1 215 ? 75.617  32.155  14.339  1.00 3.07  ? 215  SER B C   1 
ATOM   5813  O O   . SER B 1 215 ? 75.386  32.072  15.540  1.00 5.12  ? 215  SER B O   1 
ATOM   5814  C CB  . SER B 1 215 ? 74.282  33.916  13.076  1.00 3.64  ? 215  SER B CB  1 
ATOM   5815  O OG  . SER B 1 215 ? 73.406  34.004  11.946  1.00 4.95  ? 215  SER B OG  1 
ATOM   5816  N N   . PHE B 1 216 ? 76.866  32.128  13.868  1.00 4.73  ? 216  PHE B N   1 
ATOM   5817  C CA  . PHE B 1 216 ? 78.021  32.005  14.763  1.00 3.34  ? 216  PHE B CA  1 
ATOM   5818  C C   . PHE B 1 216 ? 78.957  33.167  14.403  1.00 3.52  ? 216  PHE B C   1 
ATOM   5819  O O   . PHE B 1 216 ? 78.949  33.632  13.265  1.00 4.55  ? 216  PHE B O   1 
ATOM   5820  C CB  . PHE B 1 216 ? 78.679  30.611  14.733  1.00 3.31  ? 216  PHE B CB  1 
ATOM   5821  C CG  . PHE B 1 216 ? 79.246  30.235  13.399  1.00 4.31  ? 216  PHE B CG  1 
ATOM   5822  C CD1 . PHE B 1 216 ? 78.464  29.598  12.452  1.00 4.62  ? 216  PHE B CD1 1 
ATOM   5823  C CD2 . PHE B 1 216 ? 80.579  30.469  13.047  1.00 5.03  ? 216  PHE B CD2 1 
ATOM   5824  C CE1 . PHE B 1 216 ? 78.956  29.225  11.225  1.00 5.80  ? 216  PHE B CE1 1 
ATOM   5825  C CE2 . PHE B 1 216 ? 81.101  30.093  11.838  1.00 4.44  ? 216  PHE B CE2 1 
ATOM   5826  C CZ  . PHE B 1 216 ? 80.301  29.475  10.899  1.00 6.03  ? 216  PHE B CZ  1 
ATOM   5827  N N   . THR B 1 217 ? 79.746  33.631  15.378  1.00 2.08  ? 217  THR B N   1 
ATOM   5828  C CA  . THR B 1 217 ? 80.701  34.696  15.046  1.00 3.27  ? 217  THR B CA  1 
ATOM   5829  C C   . THR B 1 217 ? 82.122  34.171  15.192  1.00 3.84  ? 217  THR B C   1 
ATOM   5830  O O   . THR B 1 217 ? 82.353  33.566  16.231  1.00 4.54  ? 217  THR B O   1 
ATOM   5831  C CB  . THR B 1 217 ? 80.496  35.949  15.912  1.00 4.12  ? 217  THR B CB  1 
ATOM   5832  O OG1 . THR B 1 217 ? 79.156  36.428  15.628  1.00 3.68  ? 217  THR B OG1 1 
ATOM   5833  C CG2 . THR B 1 217 ? 81.484  37.053  15.503  1.00 2.62  ? 217  THR B CG2 1 
ATOM   5834  N N   . ILE B 1 218 ? 82.958  34.401  14.168  1.00 4.36  ? 218  ILE B N   1 
ATOM   5835  C CA  . ILE B 1 218 ? 84.335  33.929  14.301  1.00 3.05  ? 218  ILE B CA  1 
ATOM   5836  C C   . ILE B 1 218 ? 85.278  35.105  13.968  1.00 2.08  ? 218  ILE B C   1 
ATOM   5837  O O   . ILE B 1 218 ? 85.049  35.698  12.922  1.00 2.15  ? 218  ILE B O   1 
ATOM   5838  C CB  . ILE B 1 218 ? 84.634  32.706  13.433  1.00 3.68  ? 218  ILE B CB  1 
ATOM   5839  C CG1 . ILE B 1 218 ? 86.102  32.293  13.649  1.00 2.40  ? 218  ILE B CG1 1 
ATOM   5840  C CG2 . ILE B 1 218 ? 84.356  32.945  11.950  1.00 2.30  ? 218  ILE B CG2 1 
ATOM   5841  C CD1 . ILE B 1 218 ? 86.504  31.001  12.947  1.00 2.16  ? 218  ILE B CD1 1 
ATOM   5842  N N   . ASP B 1 219 ? 86.118  35.482  14.919  1.00 3.00  ? 219  ASP B N   1 
ATOM   5843  C CA  . ASP B 1 219 ? 87.016  36.637  14.680  1.00 2.84  ? 219  ASP B CA  1 
ATOM   5844  C C   . ASP B 1 219 ? 86.245  37.860  14.209  1.00 3.79  ? 219  ASP B C   1 
ATOM   5845  O O   . ASP B 1 219 ? 86.538  38.419  13.155  1.00 2.29  ? 219  ASP B O   1 
ATOM   5846  C CB  . ASP B 1 219 ? 88.063  36.182  13.648  1.00 3.56  ? 219  ASP B CB  1 
ATOM   5847  C CG  . ASP B 1 219 ? 88.945  35.072  14.255  1.00 4.14  ? 219  ASP B CG  1 
ATOM   5848  O OD1 . ASP B 1 219 ? 88.971  34.919  15.493  1.00 2.42  ? 219  ASP B OD1 1 
ATOM   5849  O OD2 . ASP B 1 219 ? 89.641  34.347  13.520  1.00 3.99  ? 219  ASP B OD2 1 
ATOM   5850  N N   . SER B 1 220 ? 85.150  38.240  14.878  1.00 3.72  ? 220  SER B N   1 
ATOM   5851  C CA  . SER B 1 220 ? 84.315  39.365  14.457  1.00 3.85  ? 220  SER B CA  1 
ATOM   5852  C C   . SER B 1 220 ? 83.636  39.199  13.113  1.00 3.54  ? 220  SER B C   1 
ATOM   5853  O O   . SER B 1 220 ? 83.144  40.196  12.517  1.00 3.63  ? 220  SER B O   1 
ATOM   5854  C CB  . SER B 1 220 ? 85.084  40.711  14.487  1.00 3.34  ? 220  SER B CB  1 
ATOM   5855  O OG  . SER B 1 220 ? 85.367  40.955  15.865  1.00 3.98  ? 220  SER B OG  1 
ATOM   5856  N N   . ILE B 1 221 ? 83.589  37.962  12.600  1.00 4.29  ? 221  ILE B N   1 
ATOM   5857  C CA  . ILE B 1 221 ? 82.918  37.729  11.320  1.00 2.83  ? 221  ILE B CA  1 
ATOM   5858  C C   . ILE B 1 221 ? 81.637  36.946  11.624  1.00 4.86  ? 221  ILE B C   1 
ATOM   5859  O O   . ILE B 1 221 ? 81.744  35.795  12.102  1.00 2.74  ? 221  ILE B O   1 
ATOM   5860  C CB  . ILE B 1 221 ? 83.828  36.941  10.378  1.00 4.71  ? 221  ILE B CB  1 
ATOM   5861  C CG1 . ILE B 1 221 ? 85.211  37.622  10.175  1.00 5.54  ? 221  ILE B CG1 1 
ATOM   5862  C CG2 . ILE B 1 221 ? 83.175  36.767  9.018   1.00 2.08  ? 221  ILE B CG2 1 
ATOM   5863  C CD1 . ILE B 1 221 ? 86.239  36.680  9.567   1.00 3.83  ? 221  ILE B CD1 1 
ATOM   5864  N N   . THR B 1 222 ? 80.479  37.531  11.413  1.00 4.12  ? 222  THR B N   1 
ATOM   5865  C CA  . THR B 1 222 ? 79.205  36.838  11.718  1.00 3.48  ? 222  THR B CA  1 
ATOM   5866  C C   . THR B 1 222 ? 78.710  36.052  10.524  1.00 4.31  ? 222  THR B C   1 
ATOM   5867  O O   . THR B 1 222 ? 78.690  36.477  9.366   1.00 3.99  ? 222  THR B O   1 
ATOM   5868  C CB  . THR B 1 222 ? 78.157  37.857  12.226  1.00 4.69  ? 222  THR B CB  1 
ATOM   5869  O OG1 . THR B 1 222 ? 78.678  38.321  13.487  1.00 2.45  ? 222  THR B OG1 1 
ATOM   5870  C CG2 . THR B 1 222 ? 76.812  37.159  12.496  1.00 4.13  ? 222  THR B CG2 1 
ATOM   5871  N N   . VAL B 1 223 ? 78.459  34.756  10.783  1.00 5.69  ? 223  VAL B N   1 
ATOM   5872  C CA  . VAL B 1 223 ? 78.139  33.840  9.686   1.00 4.86  ? 223  VAL B CA  1 
ATOM   5873  C C   . VAL B 1 223 ? 76.737  33.228  9.789   1.00 4.78  ? 223  VAL B C   1 
ATOM   5874  O O   . VAL B 1 223 ? 76.464  32.548  10.772  1.00 3.69  ? 223  VAL B O   1 
ATOM   5875  C CB  . VAL B 1 223 ? 79.190  32.700  9.681   1.00 5.74  ? 223  VAL B CB  1 
ATOM   5876  C CG1 . VAL B 1 223 ? 78.942  31.753  8.497   1.00 4.18  ? 223  VAL B CG1 1 
ATOM   5877  C CG2 . VAL B 1 223 ? 80.623  33.230  9.570   1.00 2.71  ? 223  VAL B CG2 1 
ATOM   5878  N N   . GLU B 1 224 ? 75.903  33.435  8.781   1.00 5.10  ? 224  GLU B N   1 
ATOM   5879  C CA  . GLU B 1 224 ? 74.545  32.815  8.779   1.00 6.52  ? 224  GLU B CA  1 
ATOM   5880  C C   . GLU B 1 224 ? 74.695  31.471  8.082   1.00 5.62  ? 224  GLU B C   1 
ATOM   5881  O O   . GLU B 1 224 ? 75.187  31.403  6.944   1.00 4.68  ? 224  GLU B O   1 
ATOM   5882  C CB  . GLU B 1 224 ? 73.623  33.731  7.967   1.00 7.34  ? 224  GLU B CB  1 
ATOM   5883  C CG  . GLU B 1 224 ? 72.254  33.033  7.747   1.00 7.01  ? 224  GLU B CG  1 
ATOM   5884  C CD  . GLU B 1 224 ? 71.329  33.977  6.992   1.00 9.06  ? 224  GLU B CD  1 
ATOM   5885  O OE1 . GLU B 1 224 ? 71.556  34.179  5.801   1.00 9.84  ? 224  GLU B OE1 1 
ATOM   5886  O OE2 . GLU B 1 224 ? 70.370  34.500  7.593   1.00 9.60  ? 224  GLU B OE2 1 
ATOM   5887  N N   . PRO B 1 225 ? 74.289  30.382  8.690   1.00 6.15  ? 225  PRO B N   1 
ATOM   5888  C CA  . PRO B 1 225 ? 74.542  29.048  8.147   1.00 4.89  ? 225  PRO B CA  1 
ATOM   5889  C C   . PRO B 1 225 ? 73.631  28.547  7.053   1.00 4.94  ? 225  PRO B C   1 
ATOM   5890  O O   . PRO B 1 225 ? 72.960  27.519  7.192   1.00 4.24  ? 225  PRO B O   1 
ATOM   5891  C CB  . PRO B 1 225 ? 74.549  28.188  9.402   1.00 5.50  ? 225  PRO B CB  1 
ATOM   5892  C CG  . PRO B 1 225 ? 73.544  28.849  10.285  1.00 4.79  ? 225  PRO B CG  1 
ATOM   5893  C CD  . PRO B 1 225 ? 73.693  30.328  10.051  1.00 5.97  ? 225  PRO B CD  1 
ATOM   5894  N N   . LYS B 1 226 ? 73.534  29.320  5.971   1.00 3.74  ? 226  LYS B N   1 
ATOM   5895  C CA  . LYS B 1 226 ? 72.887  28.934  4.746   1.00 5.87  ? 226  LYS B CA  1 
ATOM   5896  C C   . LYS B 1 226 ? 74.011  28.255  3.943   1.00 6.33  ? 226  LYS B C   1 
ATOM   5897  O O   . LYS B 1 226 ? 74.983  28.931  3.627   1.00 5.49  ? 226  LYS B O   1 
ATOM   5898  C CB  . LYS B 1 226 ? 72.298  30.051  3.887   1.00 6.41  ? 226  LYS B CB  1 
ATOM   5899  C CG  . LYS B 1 226 ? 70.988  30.594  4.482   1.00 7.40  ? 226  LYS B CG  1 
ATOM   5900  C CD  . LYS B 1 226 ? 70.382  31.672  3.557   1.00 8.44  ? 226  LYS B CD  1 
ATOM   5901  C CE  . LYS B 1 226 ? 69.019  32.080  4.173   1.00 10.15 ? 226  LYS B CE  1 
ATOM   5902  N NZ  . LYS B 1 226 ? 68.209  32.966  3.283   1.00 9.82  ? 226  LYS B NZ  1 
ATOM   5903  N N   . GLN B 1 227 ? 73.856  26.974  3.646   1.00 5.16  ? 227  GLN B N   1 
ATOM   5904  C CA  . GLN B 1 227 ? 74.876  26.218  2.948   1.00 5.24  ? 227  GLN B CA  1 
ATOM   5905  C C   . GLN B 1 227 ? 74.578  25.967  1.483   1.00 5.18  ? 227  GLN B C   1 
ATOM   5906  O O   . GLN B 1 227 ? 73.426  26.104  1.073   1.00 5.93  ? 227  GLN B O   1 
ATOM   5907  C CB  . GLN B 1 227 ? 75.036  24.820  3.568   1.00 5.57  ? 227  GLN B CB  1 
ATOM   5908  C CG  . GLN B 1 227 ? 73.782  23.956  3.579   1.00 5.05  ? 227  GLN B CG  1 
ATOM   5909  C CD  . GLN B 1 227 ? 74.041  22.513  4.018   1.00 7.38  ? 227  GLN B CD  1 
ATOM   5910  O OE1 . GLN B 1 227 ? 75.158  22.190  4.421   1.00 6.04  ? 227  GLN B OE1 1 
ATOM   5911  N NE2 . GLN B 1 227 ? 73.045  21.621  3.941   1.00 4.32  ? 227  GLN B NE2 1 
ATOM   5912  N N   . GLU B 1 228 ? 75.606  25.590  0.746   1.00 3.65  ? 228  GLU B N   1 
ATOM   5913  C CA  . GLU B 1 228 ? 75.477  25.129  -0.620  1.00 4.18  ? 228  GLU B CA  1 
ATOM   5914  C C   . GLU B 1 228 ? 75.068  23.646  -0.415  1.00 4.80  ? 228  GLU B C   1 
ATOM   5915  O O   . GLU B 1 228 ? 75.823  22.920  0.265   1.00 3.56  ? 228  GLU B O   1 
ATOM   5916  C CB  . GLU B 1 228 ? 76.799  25.193  -1.409  1.00 4.19  ? 228  GLU B CB  1 
ATOM   5917  C CG  . GLU B 1 228 ? 76.517  24.796  -2.854  1.00 4.71  ? 228  GLU B CG  1 
ATOM   5918  C CD  . GLU B 1 228 ? 77.642  24.998  -3.829  1.00 5.83  ? 228  GLU B CD  1 
ATOM   5919  O OE1 . GLU B 1 228 ? 78.807  24.716  -3.468  1.00 7.22  ? 228  GLU B OE1 1 
ATOM   5920  O OE2 . GLU B 1 228 ? 77.350  25.391  -4.968  1.00 5.00  ? 228  GLU B OE2 1 
ATOM   5921  N N   . THR B 1 229 ? 73.869  23.275  -0.866  1.00 4.93  ? 229  THR B N   1 
ATOM   5922  C CA  . THR B 1 229 ? 73.357  21.916  -0.582  1.00 5.25  ? 229  THR B CA  1 
ATOM   5923  C C   . THR B 1 229 ? 73.112  21.071  -1.830  1.00 4.23  ? 229  THR B C   1 
ATOM   5924  O O   . THR B 1 229 ? 73.287  21.530  -2.952  1.00 2.71  ? 229  THR B O   1 
ATOM   5925  C CB  . THR B 1 229 ? 72.050  21.938  0.246   1.00 4.95  ? 229  THR B CB  1 
ATOM   5926  O OG1 . THR B 1 229 ? 71.775  20.612  0.745   1.00 3.23  ? 229  THR B OG1 1 
ATOM   5927  C CG2 . THR B 1 229 ? 70.857  22.451  -0.566  1.00 3.94  ? 229  THR B CG2 1 
ATOM   5928  N N   . PHE B 1 230 ? 72.741  19.795  -1.610  1.00 2.97  ? 230  PHE B N   1 
ATOM   5929  C CA  . PHE B 1 230 ? 72.510  18.923  -2.767  1.00 4.68  ? 230  PHE B CA  1 
ATOM   5930  C C   . PHE B 1 230 ? 71.186  19.288  -3.443  1.00 4.78  ? 230  PHE B C   1 
ATOM   5931  O O   . PHE B 1 230 ? 70.270  19.742  -2.744  1.00 4.50  ? 230  PHE B O   1 
ATOM   5932  C CB  . PHE B 1 230 ? 72.474  17.450  -2.346  1.00 3.66  ? 230  PHE B CB  1 
ATOM   5933  C CG  . PHE B 1 230 ? 73.735  16.845  -1.779  1.00 3.31  ? 230  PHE B CG  1 
ATOM   5934  C CD1 . PHE B 1 230 ? 74.900  16.864  -2.537  1.00 4.79  ? 230  PHE B CD1 1 
ATOM   5935  C CD2 . PHE B 1 230 ? 73.765  16.259  -0.531  1.00 2.08  ? 230  PHE B CD2 1 
ATOM   5936  C CE1 . PHE B 1 230 ? 76.082  16.288  -2.046  1.00 4.99  ? 230  PHE B CE1 1 
ATOM   5937  C CE2 . PHE B 1 230 ? 74.918  15.681  -0.033  1.00 5.34  ? 230  PHE B CE2 1 
ATOM   5938  C CZ  . PHE B 1 230 ? 76.084  15.692  -0.795  1.00 4.67  ? 230  PHE B CZ  1 
ATOM   5939  N N   . ALA B 1 231 ? 71.049  19.024  -4.722  1.00 6.83  ? 231  ALA B N   1 
ATOM   5940  C CA  . ALA B 1 231 ? 69.763  19.227  -5.411  1.00 7.44  ? 231  ALA B CA  1 
ATOM   5941  C C   . ALA B 1 231 ? 68.835  18.127  -4.903  1.00 7.65  ? 231  ALA B C   1 
ATOM   5942  O O   . ALA B 1 231 ? 69.309  17.062  -4.519  1.00 6.99  ? 231  ALA B O   1 
ATOM   5943  C CB  . ALA B 1 231 ? 69.917  19.055  -6.910  1.00 5.58  ? 231  ALA B CB  1 
ATOM   5944  N N   . PRO B 1 232 ? 67.525  18.333  -4.968  1.00 8.86  ? 232  PRO B N   1 
ATOM   5945  C CA  . PRO B 1 232 ? 66.586  17.302  -4.560  1.00 8.50  ? 232  PRO B CA  1 
ATOM   5946  C C   . PRO B 1 232 ? 66.493  16.157  -5.544  1.00 8.07  ? 232  PRO B C   1 
ATOM   5947  O O   . PRO B 1 232 ? 66.802  16.251  -6.727  1.00 5.56  ? 232  PRO B O   1 
ATOM   5948  C CB  . PRO B 1 232 ? 65.232  18.023  -4.520  1.00 8.61  ? 232  PRO B CB  1 
ATOM   5949  C CG  . PRO B 1 232 ? 65.402  19.173  -5.466  1.00 10.96 ? 232  PRO B CG  1 
ATOM   5950  C CD  . PRO B 1 232 ? 66.856  19.567  -5.418  1.00 8.68  ? 232  PRO B CD  1 
ATOM   5951  N N   . ASP B 1 233 ? 65.982  15.012  -5.107  1.00 9.27  ? 233  ASP B N   1 
ATOM   5952  C CA  . ASP B 1 233 ? 65.468  13.865  -5.869  1.00 10.13 ? 233  ASP B CA  1 
ATOM   5953  C C   . ASP B 1 233 ? 66.633  13.032  -6.410  1.00 11.10 ? 233  ASP B C   1 
ATOM   5954  O O   . ASP B 1 233 ? 66.415  11.743  -6.412  1.00 12.90 ? 233  ASP B O   1 
ATOM   5955  C CB  . ASP B 1 233 ? 64.609  14.317  -7.019  1.00 11.01 ? 233  ASP B CB  1 
ATOM   5956  C CG  . ASP B 1 233 ? 63.371  14.960  -6.442  1.00 11.17 ? 233  ASP B CG  1 
ATOM   5957  O OD1 . ASP B 1 233 ? 62.815  14.464  -5.458  1.00 11.37 ? 233  ASP B OD1 1 
ATOM   5958  O OD2 . ASP B 1 233 ? 62.977  16.049  -6.870  1.00 14.29 ? 233  ASP B OD2 1 
ATOM   5959  N N   . VAL B 1 234 ? 67.710  13.493  -6.942  1.00 8.90  ? 234  VAL B N   1 
ATOM   5960  C CA  . VAL B 1 234 ? 68.734  12.639  -7.534  1.00 7.62  ? 234  VAL B CA  1 
ATOM   5961  C C   . VAL B 1 234 ? 69.470  11.814  -6.501  1.00 7.23  ? 234  VAL B C   1 
ATOM   5962  O O   . VAL B 1 234 ? 69.991  12.332  -5.509  1.00 5.73  ? 234  VAL B O   1 
ATOM   5963  C CB  . VAL B 1 234 ? 69.722  13.547  -8.300  1.00 9.12  ? 234  VAL B CB  1 
ATOM   5964  C CG1 . VAL B 1 234 ? 70.836  12.725  -8.919  1.00 9.59  ? 234  VAL B CG1 1 
ATOM   5965  C CG2 . VAL B 1 234 ? 68.928  14.356  -9.338  1.00 8.65  ? 234  VAL B CG2 1 
ATOM   5966  N N   . ASN B 1 235 ? 69.632  10.510  -6.794  1.00 3.79  ? 235  ASN B N   1 
ATOM   5967  C CA  . ASN B 1 235 ? 70.434  9.646   -5.950  1.00 5.73  ? 235  ASN B CA  1 
ATOM   5968  C C   . ASN B 1 235 ? 71.432  8.931   -6.875  1.00 5.48  ? 235  ASN B C   1 
ATOM   5969  O O   . ASN B 1 235 ? 71.300  9.059   -8.090  1.00 5.66  ? 235  ASN B O   1 
ATOM   5970  C CB  . ASN B 1 235 ? 69.680  8.616   -5.127  1.00 6.80  ? 235  ASN B CB  1 
ATOM   5971  C CG  . ASN B 1 235 ? 68.705  9.221   -4.142  1.00 8.80  ? 235  ASN B CG  1 
ATOM   5972  O OD1 . ASN B 1 235 ? 69.064  10.040  -3.284  1.00 7.35  ? 235  ASN B OD1 1 
ATOM   5973  N ND2 . ASN B 1 235 ? 67.448  8.787   -4.237  1.00 8.17  ? 235  ASN B ND2 1 
ATOM   5974  N N   . TYR B 1 236 ? 72.469  8.323   -6.304  1.00 4.89  ? 236  TYR B N   1 
ATOM   5975  C CA  . TYR B 1 236 ? 73.543  7.704   -7.068  1.00 5.49  ? 236  TYR B CA  1 
ATOM   5976  C C   . TYR B 1 236 ? 73.744  6.247   -6.680  1.00 5.65  ? 236  TYR B C   1 
ATOM   5977  O O   . TYR B 1 236 ? 73.161  5.738   -5.716  1.00 4.76  ? 236  TYR B O   1 
ATOM   5978  C CB  . TYR B 1 236 ? 74.888  8.520   -6.858  1.00 5.35  ? 236  TYR B CB  1 
ATOM   5979  C CG  . TYR B 1 236 ? 74.631  10.023  -7.006  1.00 5.94  ? 236  TYR B CG  1 
ATOM   5980  C CD1 . TYR B 1 236 ? 74.510  10.595  -8.246  1.00 6.72  ? 236  TYR B CD1 1 
ATOM   5981  C CD2 . TYR B 1 236 ? 74.383  10.818  -5.899  1.00 6.50  ? 236  TYR B CD2 1 
ATOM   5982  C CE1 . TYR B 1 236 ? 74.215  11.946  -8.403  1.00 7.20  ? 236  TYR B CE1 1 
ATOM   5983  C CE2 . TYR B 1 236 ? 74.075  12.176  -6.021  1.00 8.49  ? 236  TYR B CE2 1 
ATOM   5984  C CZ  . TYR B 1 236 ? 74.008  12.731  -7.281  1.00 8.44  ? 236  TYR B CZ  1 
ATOM   5985  O OH  . TYR B 1 236 ? 73.708  14.064  -7.455  1.00 8.36  ? 236  TYR B OH  1 
ATOM   5986  N N   . MET B 1 237 ? 74.599  5.524   -7.396  1.00 5.01  ? 237  MET B N   1 
ATOM   5987  C CA  . MET B 1 237 ? 74.866  4.117   -7.204  1.00 5.12  ? 237  MET B CA  1 
ATOM   5988  C C   . MET B 1 237 ? 73.579  3.255   -7.189  1.00 5.12  ? 237  MET B C   1 
ATOM   5989  O O   . MET B 1 237 ? 73.498  2.318   -6.391  1.00 4.31  ? 237  MET B O   1 
ATOM   5990  C CB  . MET B 1 237 ? 75.732  3.849   -5.969  1.00 4.53  ? 237  MET B CB  1 
ATOM   5991  C CG  . MET B 1 237 ? 77.113  4.554   -6.086  1.00 6.12  ? 237  MET B CG  1 
ATOM   5992  S SD  . MET B 1 237 ? 77.947  4.576   -4.524  1.00 4.83  ? 237  MET B SD  1 
ATOM   5993  C CE  . MET B 1 237 ? 77.955  2.904   -3.963  1.00 4.92  ? 237  MET B CE  1 
ATOM   5994  N N   . VAL B 1 238 ? 72.620  3.556   -8.062  1.00 6.48  ? 238  VAL B N   1 
ATOM   5995  C CA  . VAL B 1 238 ? 71.399  2.736   -8.143  1.00 6.63  ? 238  VAL B CA  1 
ATOM   5996  C C   . VAL B 1 238 ? 71.368  1.969   -9.471  1.00 8.44  ? 238  VAL B C   1 
ATOM   5997  O O   . VAL B 1 238 ? 70.496  1.102   -9.692  1.00 5.87  ? 238  VAL B O   1 
ATOM   5998  C CB  . VAL B 1 238 ? 70.090  3.455   -7.856  1.00 6.33  ? 238  VAL B CB  1 
ATOM   5999  C CG1 . VAL B 1 238 ? 70.023  3.898   -6.382  1.00 5.48  ? 238  VAL B CG1 1 
ATOM   6000  C CG2 . VAL B 1 238 ? 69.801  4.649   -8.743  1.00 5.35  ? 238  VAL B CG2 1 
ATOM   6001  N N   . ASP B 1 239 ? 72.339  2.234   -10.330 1.00 7.56  ? 239  ASP B N   1 
ATOM   6002  C CA  . ASP B 1 239 ? 72.538  1.481   -11.580 1.00 8.45  ? 239  ASP B CA  1 
ATOM   6003  C C   . ASP B 1 239 ? 73.527  0.389   -11.164 1.00 9.56  ? 239  ASP B C   1 
ATOM   6004  O O   . ASP B 1 239 ? 74.491  0.723   -10.456 1.00 10.85 ? 239  ASP B O   1 
ATOM   6005  C CB  . ASP B 1 239 ? 73.073  2.334   -12.704 1.00 9.49  ? 239  ASP B CB  1 
ATOM   6006  C CG  . ASP B 1 239 ? 73.793  1.633   -13.839 1.00 10.81 ? 239  ASP B CG  1 
ATOM   6007  O OD1 . ASP B 1 239 ? 74.983  1.238   -13.776 1.00 11.21 ? 239  ASP B OD1 1 
ATOM   6008  O OD2 . ASP B 1 239 ? 73.181  1.398   -14.889 1.00 9.47  ? 239  ASP B OD2 1 
ATOM   6009  N N   . PHE B 1 240 ? 73.295  -0.883  -11.479 1.00 8.57  ? 240  PHE B N   1 
ATOM   6010  C CA  . PHE B 1 240 ? 74.171  -1.952  -11.012 1.00 9.04  ? 240  PHE B CA  1 
ATOM   6011  C C   . PHE B 1 240 ? 75.645  -1.817  -11.377 1.00 8.48  ? 240  PHE B C   1 
ATOM   6012  O O   . PHE B 1 240 ? 76.485  -2.014  -10.480 1.00 8.62  ? 240  PHE B O   1 
ATOM   6013  C CB  . PHE B 1 240 ? 73.625  -3.328  -11.478 1.00 6.92  ? 240  PHE B CB  1 
ATOM   6014  C CG  . PHE B 1 240 ? 74.396  -4.441  -10.833 1.00 6.40  ? 240  PHE B CG  1 
ATOM   6015  C CD1 . PHE B 1 240 ? 74.097  -4.867  -9.568  1.00 7.22  ? 240  PHE B CD1 1 
ATOM   6016  C CD2 . PHE B 1 240 ? 75.439  -5.062  -11.537 1.00 6.89  ? 240  PHE B CD2 1 
ATOM   6017  C CE1 . PHE B 1 240 ? 74.778  -5.902  -8.942  1.00 7.69  ? 240  PHE B CE1 1 
ATOM   6018  C CE2 . PHE B 1 240 ? 76.125  -6.096  -10.915 1.00 6.57  ? 240  PHE B CE2 1 
ATOM   6019  C CZ  . PHE B 1 240 ? 75.823  -6.510  -9.645  1.00 6.62  ? 240  PHE B CZ  1 
ATOM   6020  N N   . ASP B 1 241 ? 75.961  -1.504  -12.624 1.00 8.74  ? 241  ASP B N   1 
ATOM   6021  C CA  . ASP B 1 241 ? 77.359  -1.380  -13.025 1.00 11.51 ? 241  ASP B CA  1 
ATOM   6022  C C   . ASP B 1 241 ? 78.062  -0.266  -12.251 1.00 12.18 ? 241  ASP B C   1 
ATOM   6023  O O   . ASP B 1 241 ? 79.177  -0.496  -11.764 1.00 10.42 ? 241  ASP B O   1 
ATOM   6024  C CB  . ASP B 1 241 ? 77.501  -1.162  -14.524 1.00 12.58 ? 241  ASP B CB  1 
ATOM   6025  C CG  . ASP B 1 241 ? 77.108  -2.376  -15.361 1.00 14.35 ? 241  ASP B CG  1 
ATOM   6026  O OD1 . ASP B 1 241 ? 76.957  -3.506  -14.876 1.00 13.94 ? 241  ASP B OD1 1 
ATOM   6027  O OD2 . ASP B 1 241 ? 76.958  -2.177  -16.579 1.00 14.99 ? 241  ASP B OD2 1 
ATOM   6028  N N   . GLU B 1 242 ? 77.355  0.854   -12.043 1.00 12.37 ? 242  GLU B N   1 
ATOM   6029  C CA  . GLU B 1 242 ? 77.982  1.941   -11.274 1.00 11.69 ? 242  GLU B CA  1 
ATOM   6030  C C   . GLU B 1 242 ? 78.258  1.533   -9.853  1.00 10.01 ? 242  GLU B C   1 
ATOM   6031  O O   . GLU B 1 242 ? 79.313  1.824   -9.285  1.00 10.84 ? 242  GLU B O   1 
ATOM   6032  C CB  . GLU B 1 242 ? 77.134  3.215   -11.287 1.00 11.76 ? 242  GLU B CB  1 
ATOM   6033  C CG  . GLU B 1 242 ? 77.177  3.873   -12.659 1.00 12.75 ? 242  GLU B CG  1 
ATOM   6034  C CD  . GLU B 1 242 ? 76.236  5.084   -12.730 1.00 13.30 ? 242  GLU B CD  1 
ATOM   6035  O OE1 . GLU B 1 242 ? 75.784  5.529   -11.662 1.00 14.76 ? 242  GLU B OE1 1 
ATOM   6036  O OE2 . GLU B 1 242 ? 75.958  5.602   -13.819 1.00 12.70 ? 242  GLU B OE2 1 
ATOM   6037  N N   . TRP B 1 243 ? 77.286  0.850   -9.245  1.00 7.47  ? 243  TRP B N   1 
ATOM   6038  C CA  . TRP B 1 243 ? 77.440  0.337   -7.894  1.00 5.97  ? 243  TRP B CA  1 
ATOM   6039  C C   . TRP B 1 243 ? 78.641  -0.605  -7.810  1.00 7.09  ? 243  TRP B C   1 
ATOM   6040  O O   . TRP B 1 243 ? 79.357  -0.567  -6.816  1.00 5.64  ? 243  TRP B O   1 
ATOM   6041  C CB  . TRP B 1 243 ? 76.148  -0.384  -7.437  1.00 3.19  ? 243  TRP B CB  1 
ATOM   6042  C CG  . TRP B 1 243 ? 76.321  -1.130  -6.147  1.00 5.32  ? 243  TRP B CG  1 
ATOM   6043  C CD1 . TRP B 1 243 ? 76.225  -0.681  -4.879  1.00 5.73  ? 243  TRP B CD1 1 
ATOM   6044  C CD2 . TRP B 1 243 ? 76.645  -2.529  -6.041  1.00 6.56  ? 243  TRP B CD2 1 
ATOM   6045  N NE1 . TRP B 1 243 ? 76.459  -1.681  -3.970  1.00 7.58  ? 243  TRP B NE1 1 
ATOM   6046  C CE2 . TRP B 1 243 ? 76.720  -2.839  -4.686  1.00 7.52  ? 243  TRP B CE2 1 
ATOM   6047  C CE3 . TRP B 1 243 ? 76.859  -3.531  -7.000  1.00 6.89  ? 243  TRP B CE3 1 
ATOM   6048  C CZ2 . TRP B 1 243 ? 76.998  -4.129  -4.215  1.00 8.19  ? 243  TRP B CZ2 1 
ATOM   6049  C CZ3 . TRP B 1 243 ? 77.133  -4.802  -6.526  1.00 7.82  ? 243  TRP B CZ3 1 
ATOM   6050  C CH2 . TRP B 1 243 ? 77.226  -5.086  -5.174  1.00 6.80  ? 243  TRP B CH2 1 
ATOM   6051  N N   . LEU B 1 244 ? 78.793  -1.502  -8.785  1.00 8.71  ? 244  LEU B N   1 
ATOM   6052  C CA  . LEU B 1 244 ? 79.821  -2.525  -8.782  1.00 9.84  ? 244  LEU B CA  1 
ATOM   6053  C C   . LEU B 1 244 ? 81.208  -1.856  -8.932  1.00 9.31  ? 244  LEU B C   1 
ATOM   6054  O O   . LEU B 1 244 ? 82.121  -2.239  -8.215  1.00 8.48  ? 244  LEU B O   1 
ATOM   6055  C CB  . LEU B 1 244 ? 79.648  -3.551  -9.903  1.00 10.38 ? 244  LEU B CB  1 
ATOM   6056  C CG  . LEU B 1 244 ? 79.946  -5.030  -9.679  1.00 12.42 ? 244  LEU B CG  1 
ATOM   6057  C CD1 . LEU B 1 244 ? 80.093  -5.813  -11.000 1.00 12.56 ? 244  LEU B CD1 1 
ATOM   6058  C CD2 . LEU B 1 244 ? 81.078  -5.356  -8.759  1.00 9.97  ? 244  LEU B CD2 1 
ATOM   6059  N N   . ASN B 1 245 ? 81.262  -0.877  -9.821  1.00 9.30  ? 245  ASN B N   1 
ATOM   6060  C CA  . ASN B 1 245 ? 82.482  -0.104  -10.043 1.00 9.51  ? 245  ASN B CA  1 
ATOM   6061  C C   . ASN B 1 245 ? 82.955  0.515   -8.739  1.00 8.49  ? 245  ASN B C   1 
ATOM   6062  O O   . ASN B 1 245 ? 84.102  0.357   -8.308  1.00 10.07 ? 245  ASN B O   1 
ATOM   6063  C CB  . ASN B 1 245 ? 82.239  0.972   -11.098 1.00 10.10 ? 245  ASN B CB  1 
ATOM   6064  C CG  . ASN B 1 245 ? 83.374  1.989   -11.131 1.00 12.35 ? 245  ASN B CG  1 
ATOM   6065  O OD1 . ASN B 1 245 ? 84.499  1.617   -11.498 1.00 12.15 ? 245  ASN B OD1 1 
ATOM   6066  N ND2 . ASN B 1 245 ? 83.128  3.233   -10.750 1.00 10.69 ? 245  ASN B ND2 1 
ATOM   6067  N N   . ILE B 1 246 ? 82.051  1.161   -8.001  1.00 8.78  ? 246  ILE B N   1 
ATOM   6068  C CA  . ILE B 1 246 ? 82.347  1.722   -6.699  1.00 6.24  ? 246  ILE B CA  1 
ATOM   6069  C C   . ILE B 1 246 ? 82.798  0.650   -5.732  1.00 5.64  ? 246  ILE B C   1 
ATOM   6070  O O   . ILE B 1 246 ? 83.830  0.829   -5.047  1.00 4.89  ? 246  ILE B O   1 
ATOM   6071  C CB  . ILE B 1 246 ? 81.156  2.521   -6.112  1.00 6.73  ? 246  ILE B CB  1 
ATOM   6072  C CG1 . ILE B 1 246 ? 80.947  3.803   -6.939  1.00 6.42  ? 246  ILE B CG1 1 
ATOM   6073  C CG2 . ILE B 1 246 ? 81.450  2.857   -4.653  1.00 5.29  ? 246  ILE B CG2 1 
ATOM   6074  C CD1 . ILE B 1 246 ? 82.142  4.745   -6.936  1.00 6.17  ? 246  ILE B CD1 1 
ATOM   6075  N N   . GLN B 1 247 ? 82.123  -0.494  -5.644  1.00 5.43  ? 247  GLN B N   1 
ATOM   6076  C CA  . GLN B 1 247 ? 82.643  -1.546  -4.746  1.00 6.31  ? 247  GLN B CA  1 
ATOM   6077  C C   . GLN B 1 247 ? 84.031  -2.042  -5.147  1.00 6.28  ? 247  GLN B C   1 
ATOM   6078  O O   . GLN B 1 247 ? 84.783  -2.491  -4.250  1.00 8.25  ? 247  GLN B O   1 
ATOM   6079  C CB  . GLN B 1 247 ? 81.709  -2.754  -4.646  1.00 6.79  ? 247  GLN B CB  1 
ATOM   6080  C CG  . GLN B 1 247 ? 80.293  -2.470  -4.145  1.00 6.07  ? 247  GLN B CG  1 
ATOM   6081  C CD  . GLN B 1 247 ? 80.251  -1.499  -2.980  1.00 6.60  ? 247  GLN B CD  1 
ATOM   6082  O OE1 . GLN B 1 247 ? 80.664  -1.761  -1.841  1.00 7.05  ? 247  GLN B OE1 1 
ATOM   6083  N NE2 . GLN B 1 247 ? 79.749  -0.290  -3.288  1.00 5.14  ? 247  GLN B NE2 1 
ATOM   6084  N N   . ASN B 1 248 ? 84.418  -2.042  -6.421  1.00 6.38  ? 248  ASN B N   1 
ATOM   6085  C CA  . ASN B 1 248 ? 85.757  -2.512  -6.763  1.00 7.16  ? 248  ASN B CA  1 
ATOM   6086  C C   . ASN B 1 248 ? 86.785  -1.395  -6.663  1.00 9.62  ? 248  ASN B C   1 
ATOM   6087  O O   . ASN B 1 248 ? 87.905  -1.576  -7.168  1.00 10.80 ? 248  ASN B O   1 
ATOM   6088  C CB  . ASN B 1 248 ? 85.754  -3.096  -8.192  1.00 7.18  ? 248  ASN B CB  1 
ATOM   6089  C CG  . ASN B 1 248 ? 84.984  -4.409  -8.278  1.00 7.48  ? 248  ASN B CG  1 
ATOM   6090  O OD1 . ASN B 1 248 ? 84.974  -5.202  -7.325  1.00 7.21  ? 248  ASN B OD1 1 
ATOM   6091  N ND2 . ASN B 1 248 ? 84.262  -4.589  -9.384  1.00 8.43  ? 248  ASN B ND2 1 
ATOM   6092  N N   . GLY B 1 249 ? 86.481  -0.225  -6.081  1.00 8.04  ? 249  GLY B N   1 
ATOM   6093  C CA  . GLY B 1 249 ? 87.431  0.842   -5.915  1.00 7.99  ? 249  GLY B CA  1 
ATOM   6094  C C   . GLY B 1 249 ? 87.609  1.759   -7.108  1.00 7.34  ? 249  GLY B C   1 
ATOM   6095  O O   . GLY B 1 249 ? 88.598  2.491   -7.191  1.00 8.79  ? 249  GLY B O   1 
ATOM   6096  N N   . GLY B 1 250 ? 86.688  1.760   -8.049  1.00 7.46  ? 250  GLY B N   1 
ATOM   6097  C CA  . GLY B 1 250 ? 86.720  2.619   -9.213  1.00 8.25  ? 250  GLY B CA  1 
ATOM   6098  C C   . GLY B 1 250 ? 86.244  4.045   -8.845  1.00 9.20  ? 250  GLY B C   1 
ATOM   6099  O O   . GLY B 1 250 ? 85.706  4.332   -7.770  1.00 9.06  ? 250  GLY B O   1 
ATOM   6100  N N   . PRO B 1 251 ? 86.492  4.959   -9.764  1.00 9.85  ? 251  PRO B N   1 
ATOM   6101  C CA  . PRO B 1 251 ? 86.178  6.359   -9.552  1.00 10.85 ? 251  PRO B CA  1 
ATOM   6102  C C   . PRO B 1 251 ? 84.673  6.594   -9.570  1.00 11.11 ? 251  PRO B C   1 
ATOM   6103  O O   . PRO B 1 251 ? 83.951  5.944   -10.307 1.00 11.52 ? 251  PRO B O   1 
ATOM   6104  C CB  . PRO B 1 251 ? 86.828  7.054   -10.748 1.00 10.41 ? 251  PRO B CB  1 
ATOM   6105  C CG  . PRO B 1 251 ? 86.843  6.010   -11.816 1.00 10.74 ? 251  PRO B CG  1 
ATOM   6106  C CD  . PRO B 1 251 ? 87.201  4.742   -11.052 1.00 9.43  ? 251  PRO B CD  1 
ATOM   6107  N N   . PRO B 1 252 ? 84.224  7.650   -8.889  1.00 11.94 ? 252  PRO B N   1 
ATOM   6108  C CA  . PRO B 1 252 ? 82.824  8.020   -8.881  1.00 11.30 ? 252  PRO B CA  1 
ATOM   6109  C C   . PRO B 1 252 ? 82.389  8.287   -10.308 1.00 9.41  ? 252  PRO B C   1 
ATOM   6110  O O   . PRO B 1 252 ? 83.166  8.752   -11.122 1.00 8.34  ? 252  PRO B O   1 
ATOM   6111  C CB  . PRO B 1 252 ? 82.741  9.290   -8.051  1.00 11.81 ? 252  PRO B CB  1 
ATOM   6112  C CG  . PRO B 1 252 ? 84.073  9.497   -7.432  1.00 12.50 ? 252  PRO B CG  1 
ATOM   6113  C CD  . PRO B 1 252 ? 85.057  8.531   -8.025  1.00 11.57 ? 252  PRO B CD  1 
ATOM   6114  N N   . ALA B 1 253 ? 81.097  8.095   -10.580 1.00 10.76 ? 253  ALA B N   1 
ATOM   6115  C CA  . ALA B 1 253 ? 80.595  8.317   -11.933 1.00 9.42  ? 253  ALA B CA  1 
ATOM   6116  C C   . ALA B 1 253 ? 80.560  9.774   -12.311 1.00 10.22 ? 253  ALA B C   1 
ATOM   6117  O O   . ALA B 1 253 ? 80.527  10.072  -13.498 1.00 11.40 ? 253  ALA B O   1 
ATOM   6118  C CB  . ALA B 1 253 ? 79.208  7.690   -12.073 1.00 10.19 ? 253  ALA B CB  1 
ATOM   6119  N N   . GLY B 1 254 ? 80.458  10.688  -11.347 1.00 10.50 ? 254  GLY B N   1 
ATOM   6120  C CA  . GLY B 1 254 ? 80.376  12.118  -11.662 1.00 10.11 ? 254  GLY B CA  1 
ATOM   6121  C C   . GLY B 1 254 ? 80.358  12.883  -10.340 1.00 8.82  ? 254  GLY B C   1 
ATOM   6122  O O   . GLY B 1 254 ? 80.510  12.300  -9.266  1.00 9.19  ? 254  GLY B O   1 
ATOM   6123  N N   . PRO B 1 255 ? 80.158  14.176  -10.395 1.00 10.00 ? 255  PRO B N   1 
ATOM   6124  C CA  . PRO B 1 255 ? 80.033  14.991  -9.183  1.00 9.68  ? 255  PRO B CA  1 
ATOM   6125  C C   . PRO B 1 255 ? 78.567  14.948  -8.754  1.00 10.36 ? 255  PRO B C   1 
ATOM   6126  O O   . PRO B 1 255 ? 77.753  14.516  -9.578  1.00 10.16 ? 255  PRO B O   1 
ATOM   6127  C CB  . PRO B 1 255 ? 80.434  16.366  -9.695  1.00 9.84  ? 255  PRO B CB  1 
ATOM   6128  C CG  . PRO B 1 255 ? 79.895  16.411  -11.089 1.00 10.50 ? 255  PRO B CG  1 
ATOM   6129  C CD  . PRO B 1 255 ? 79.998  14.991  -11.625 1.00 10.67 ? 255  PRO B CD  1 
ATOM   6130  N N   . GLU B 1 256 ? 78.206  15.409  -7.559  1.00 9.33  ? 256  GLU B N   1 
ATOM   6131  C CA  . GLU B 1 256 ? 76.784  15.419  -7.196  1.00 10.69 ? 256  GLU B CA  1 
ATOM   6132  C C   . GLU B 1 256 ? 76.169  16.717  -7.721  1.00 11.07 ? 256  GLU B C   1 
ATOM   6133  O O   . GLU B 1 256 ? 76.818  17.783  -7.729  1.00 12.08 ? 256  GLU B O   1 
ATOM   6134  C CB  . GLU B 1 256 ? 76.567  15.340  -5.701  1.00 8.68  ? 256  GLU B CB  1 
ATOM   6135  C CG  . GLU B 1 256 ? 77.016  14.125  -4.923  1.00 7.82  ? 256  GLU B CG  1 
ATOM   6136  C CD  . GLU B 1 256 ? 78.521  13.950  -4.859  1.00 9.49  ? 256  GLU B CD  1 
ATOM   6137  O OE1 . GLU B 1 256 ? 79.225  14.985  -4.742  1.00 8.47  ? 256  GLU B OE1 1 
ATOM   6138  O OE2 . GLU B 1 256 ? 78.996  12.787  -4.926  1.00 8.03  ? 256  GLU B OE2 1 
ATOM   6139  N N   . LEU B 1 257 ? 74.931  16.662  -8.169  1.00 11.35 ? 257  LEU B N   1 
ATOM   6140  C CA  . LEU B 1 257 ? 74.172  17.819  -8.611  1.00 10.93 ? 257  LEU B CA  1 
ATOM   6141  C C   . LEU B 1 257 ? 73.825  18.652  -7.372  1.00 9.27  ? 257  LEU B C   1 
ATOM   6142  O O   . LEU B 1 257 ? 73.377  18.143  -6.342  1.00 7.17  ? 257  LEU B O   1 
ATOM   6143  C CB  . LEU B 1 257 ? 72.900  17.364  -9.344  1.00 14.26 ? 257  LEU B CB  1 
ATOM   6144  C CG  . LEU B 1 257 ? 72.100  18.430  -10.100 1.00 16.85 ? 257  LEU B CG  1 
ATOM   6145  C CD1 . LEU B 1 257 ? 72.898  18.964  -11.282 1.00 18.61 ? 257  LEU B CD1 1 
ATOM   6146  C CD2 . LEU B 1 257 ? 70.761  17.892  -10.627 1.00 16.84 ? 257  LEU B CD2 1 
ATOM   6147  N N   . LEU B 1 258 ? 74.083  19.954  -7.420  1.00 8.24  ? 258  LEU B N   1 
ATOM   6148  C CA  . LEU B 1 258 ? 73.892  20.871  -6.305  1.00 8.14  ? 258  LEU B CA  1 
ATOM   6149  C C   . LEU B 1 258 ? 72.764  21.859  -6.551  1.00 8.19  ? 258  LEU B C   1 
ATOM   6150  O O   . LEU B 1 258 ? 72.504  22.203  -7.692  1.00 8.51  ? 258  LEU B O   1 
ATOM   6151  C CB  . LEU B 1 258 ? 75.203  21.677  -6.049  1.00 7.22  ? 258  LEU B CB  1 
ATOM   6152  C CG  . LEU B 1 258 ? 76.458  20.850  -5.741  1.00 6.12  ? 258  LEU B CG  1 
ATOM   6153  C CD1 . LEU B 1 258 ? 77.670  21.731  -5.400  1.00 7.08  ? 258  LEU B CD1 1 
ATOM   6154  C CD2 . LEU B 1 258 ? 76.259  19.843  -4.632  1.00 5.88  ? 258  LEU B CD2 1 
ATOM   6155  N N   . ASP B 1 259 ? 72.096  22.342  -5.526  1.00 8.76  ? 259  ASP B N   1 
ATOM   6156  C CA  . ASP B 1 259 ? 71.034  23.332  -5.669  1.00 10.79 ? 259  ASP B CA  1 
ATOM   6157  C C   . ASP B 1 259 ? 71.654  24.723  -5.882  1.00 12.41 ? 259  ASP B C   1 
ATOM   6158  O O   . ASP B 1 259 ? 72.648  25.064  -5.219  1.00 8.71  ? 259  ASP B O   1 
ATOM   6159  C CB  . ASP B 1 259 ? 70.244  23.385  -4.365  1.00 10.28 ? 259  ASP B CB  1 
ATOM   6160  C CG  . ASP B 1 259 ? 68.922  24.144  -4.420  1.00 12.56 ? 259  ASP B CG  1 
ATOM   6161  O OD1 . ASP B 1 259 ? 68.795  25.133  -5.164  1.00 11.20 ? 259  ASP B OD1 1 
ATOM   6162  O OD2 . ASP B 1 259 ? 67.968  23.809  -3.669  1.00 12.35 ? 259  ASP B OD2 1 
ATOM   6163  N N   . ASP B 1 260 ? 71.055  25.515  -6.743  1.00 13.53 ? 260  ASP B N   1 
ATOM   6164  C CA  . ASP B 1 260 ? 71.478  26.872  -6.980  1.00 17.46 ? 260  ASP B CA  1 
ATOM   6165  C C   . ASP B 1 260 ? 71.169  27.811  -5.826  1.00 15.36 ? 260  ASP B C   1 
ATOM   6166  O O   . ASP B 1 260 ? 71.781  28.879  -5.828  1.00 16.61 ? 260  ASP B O   1 
ATOM   6167  C CB  . ASP B 1 260 ? 70.735  27.540  -8.162  1.00 22.49 ? 260  ASP B CB  1 
ATOM   6168  C CG  . ASP B 1 260 ? 71.123  26.917  -9.481  1.00 25.98 ? 260  ASP B CG  1 
ATOM   6169  O OD1 . ASP B 1 260 ? 72.231  26.341  -9.538  1.00 27.05 ? 260  ASP B OD1 1 
ATOM   6170  O OD2 . ASP B 1 260 ? 70.299  27.020  -10.423 1.00 28.42 ? 260  ASP B OD2 1 
ATOM   6171  N N   . GLU B 1 261 ? 70.246  27.540  -4.931  1.00 15.43 ? 261  GLU B N   1 
ATOM   6172  C CA  . GLU B 1 261 ? 69.946  28.442  -3.832  1.00 15.06 ? 261  GLU B CA  1 
ATOM   6173  C C   . GLU B 1 261 ? 70.589  27.944  -2.542  1.00 13.86 ? 261  GLU B C   1 
ATOM   6174  O O   . GLU B 1 261 ? 70.363  26.787  -2.171  1.00 10.81 ? 261  GLU B O   1 
ATOM   6175  C CB  . GLU B 1 261 ? 68.429  28.558  -3.512  1.00 18.50 ? 261  GLU B CB  1 
ATOM   6176  C CG  . GLU B 1 261 ? 67.691  29.359  -4.558  1.00 24.12 ? 261  GLU B CG  1 
ATOM   6177  C CD  . GLU B 1 261 ? 66.174  29.282  -4.581  1.00 26.26 ? 261  GLU B CD  1 
ATOM   6178  O OE1 . GLU B 1 261 ? 65.638  28.491  -5.414  1.00 27.62 ? 261  GLU B OE1 1 
ATOM   6179  O OE2 . GLU B 1 261 ? 65.472  29.998  -3.826  1.00 27.31 ? 261  GLU B OE2 1 
ATOM   6180  N N   . LEU B 1 262 ? 71.267  28.867  -1.857  1.00 10.68 ? 262  LEU B N   1 
ATOM   6181  C CA  . LEU B 1 262 ? 71.872  28.525  -0.568  1.00 10.06 ? 262  LEU B CA  1 
ATOM   6182  C C   . LEU B 1 262 ? 70.760  28.352  0.440   1.00 8.37  ? 262  LEU B C   1 
ATOM   6183  O O   . LEU B 1 262 ? 69.829  29.186  0.444   1.00 6.90  ? 262  LEU B O   1 
ATOM   6184  C CB  . LEU B 1 262 ? 72.794  29.669  -0.152  1.00 10.06 ? 262  LEU B CB  1 
ATOM   6185  C CG  . LEU B 1 262 ? 74.254  29.702  -0.538  1.00 12.46 ? 262  LEU B CG  1 
ATOM   6186  C CD1 . LEU B 1 262 ? 74.712  28.648  -1.513  1.00 13.59 ? 262  LEU B CD1 1 
ATOM   6187  C CD2 . LEU B 1 262 ? 74.580  31.085  -1.117  1.00 13.16 ? 262  LEU B CD2 1 
ATOM   6188  N N   . ARG B 1 263 ? 70.817  27.391  1.346   1.00 5.70  ? 263  ARG B N   1 
ATOM   6189  C CA  . ARG B 1 263 ? 69.722  27.155  2.272   1.00 5.81  ? 263  ARG B CA  1 
ATOM   6190  C C   . ARG B 1 263 ? 70.121  26.651  3.643   1.00 4.87  ? 263  ARG B C   1 
ATOM   6191  O O   . ARG B 1 263 ? 71.096  25.916  3.784   1.00 5.27  ? 263  ARG B O   1 
ATOM   6192  C CB  . ARG B 1 263 ? 68.769  26.072  1.689   1.00 4.56  ? 263  ARG B CB  1 
ATOM   6193  C CG  . ARG B 1 263 ? 68.103  26.345  0.340   1.00 5.99  ? 263  ARG B CG  1 
ATOM   6194  C CD  . ARG B 1 263 ? 67.262  25.123  -0.074  1.00 5.91  ? 263  ARG B CD  1 
ATOM   6195  N NE  . ARG B 1 263 ? 66.967  25.233  -1.505  1.00 7.77  ? 263  ARG B NE  1 
ATOM   6196  C CZ  . ARG B 1 263 ? 65.905  25.876  -1.992  1.00 8.69  ? 263  ARG B CZ  1 
ATOM   6197  N NH1 . ARG B 1 263 ? 65.039  26.459  -1.175  1.00 8.98  ? 263  ARG B NH1 1 
ATOM   6198  N NH2 . ARG B 1 263 ? 65.741  25.919  -3.299  1.00 9.21  ? 263  ARG B NH2 1 
ATOM   6199  N N   . PHE B 1 264 ? 69.355  26.987  4.664   1.00 5.04  ? 264  PHE B N   1 
ATOM   6200  C CA  . PHE B 1 264 ? 69.541  26.405  5.992   1.00 4.41  ? 264  PHE B CA  1 
ATOM   6201  C C   . PHE B 1 264 ? 69.248  24.888  5.877   1.00 4.29  ? 264  PHE B C   1 
ATOM   6202  O O   . PHE B 1 264 ? 68.567  24.491  4.935   1.00 2.61  ? 264  PHE B O   1 
ATOM   6203  C CB  . PHE B 1 264 ? 68.555  26.991  7.000   1.00 4.77  ? 264  PHE B CB  1 
ATOM   6204  C CG  . PHE B 1 264 ? 68.793  28.450  7.377   1.00 5.65  ? 264  PHE B CG  1 
ATOM   6205  C CD1 . PHE B 1 264 ? 69.841  28.820  8.175   1.00 4.13  ? 264  PHE B CD1 1 
ATOM   6206  C CD2 . PHE B 1 264 ? 67.950  29.445  6.931   1.00 4.96  ? 264  PHE B CD2 1 
ATOM   6207  C CE1 . PHE B 1 264 ? 70.048  30.146  8.539   1.00 6.65  ? 264  PHE B CE1 1 
ATOM   6208  C CE2 . PHE B 1 264 ? 68.131  30.780  7.286   1.00 7.40  ? 264  PHE B CE2 1 
ATOM   6209  C CZ  . PHE B 1 264 ? 69.194  31.147  8.107   1.00 5.04  ? 264  PHE B CZ  1 
ATOM   6210  N N   . VAL B 1 265 ? 69.690  24.086  6.825   1.00 4.85  ? 265  VAL B N   1 
ATOM   6211  C CA  . VAL B 1 265 ? 69.416  22.638  6.810   1.00 3.89  ? 265  VAL B CA  1 
ATOM   6212  C C   . VAL B 1 265 ? 67.933  22.405  7.126   1.00 4.28  ? 265  VAL B C   1 
ATOM   6213  O O   . VAL B 1 265 ? 67.538  22.751  8.234   1.00 3.80  ? 265  VAL B O   1 
ATOM   6214  C CB  . VAL B 1 265 ? 70.264  21.940  7.895   1.00 4.59  ? 265  VAL B CB  1 
ATOM   6215  C CG1 . VAL B 1 265 ? 69.842  20.463  8.013   1.00 2.08  ? 265  VAL B CG1 1 
ATOM   6216  C CG2 . VAL B 1 265 ? 71.750  22.118  7.546   1.00 2.23  ? 265  VAL B CG2 1 
ATOM   6217  N N   . ARG B 1 266 ? 67.177  21.840  6.168   1.00 4.01  ? 266  ARG B N   1 
ATOM   6218  C CA  . ARG B 1 266 ? 65.746  21.673  6.470   1.00 4.71  ? 266  ARG B CA  1 
ATOM   6219  C C   . ARG B 1 266 ? 65.215  20.297  6.075   1.00 3.59  ? 266  ARG B C   1 
ATOM   6220  O O   . ARG B 1 266 ? 64.002  20.095  6.163   1.00 3.91  ? 266  ARG B O   1 
ATOM   6221  C CB  . ARG B 1 266 ? 64.917  22.825  5.855   1.00 2.53  ? 266  ARG B CB  1 
ATOM   6222  C CG  . ARG B 1 266 ? 65.182  23.092  4.384   1.00 4.47  ? 266  ARG B CG  1 
ATOM   6223  C CD  . ARG B 1 266 ? 64.613  21.988  3.491   1.00 4.88  ? 266  ARG B CD  1 
ATOM   6224  N NE  . ARG B 1 266 ? 64.404  22.349  2.109   1.00 5.68  ? 266  ARG B NE  1 
ATOM   6225  C CZ  . ARG B 1 266 ? 65.197  22.326  1.071   1.00 7.22  ? 266  ARG B CZ  1 
ATOM   6226  N NH1 . ARG B 1 266 ? 66.463  21.915  1.146   1.00 9.15  ? 266  ARG B NH1 1 
ATOM   6227  N NH2 . ARG B 1 266 ? 64.809  22.741  -0.140  1.00 7.62  ? 266  ARG B NH2 1 
ATOM   6228  N N   . ASN B 1 267 ? 66.042  19.361  5.608   1.00 2.36  ? 267  ASN B N   1 
ATOM   6229  C CA  . ASN B 1 267 ? 65.620  17.986  5.335   1.00 2.52  ? 267  ASN B CA  1 
ATOM   6230  C C   . ASN B 1 267 ? 66.804  17.041  5.553   1.00 2.08  ? 267  ASN B C   1 
ATOM   6231  O O   . ASN B 1 267 ? 67.923  17.499  5.856   1.00 3.12  ? 267  ASN B O   1 
ATOM   6232  C CB  . ASN B 1 267 ? 64.968  17.792  3.962   1.00 2.08  ? 267  ASN B CB  1 
ATOM   6233  C CG  . ASN B 1 267 ? 65.839  18.151  2.808   1.00 4.61  ? 267  ASN B CG  1 
ATOM   6234  O OD1 . ASN B 1 267 ? 67.073  17.926  2.915   1.00 4.40  ? 267  ASN B OD1 1 
ATOM   6235  N ND2 . ASN B 1 267 ? 65.234  18.737  1.756   1.00 3.37  ? 267  ASN B ND2 1 
ATOM   6236  N N   . ALA B 1 268 ? 66.555  15.742  5.451   1.00 2.08  ? 268  ALA B N   1 
ATOM   6237  C CA  . ALA B 1 268 ? 67.583  14.728  5.640   1.00 3.23  ? 268  ALA B CA  1 
ATOM   6238  C C   . ALA B 1 268 ? 68.685  14.862  4.579   1.00 4.35  ? 268  ALA B C   1 
ATOM   6239  O O   . ALA B 1 268 ? 69.826  14.624  4.985   1.00 3.06  ? 268  ALA B O   1 
ATOM   6240  C CB  . ALA B 1 268 ? 67.083  13.293  5.561   1.00 3.10  ? 268  ALA B CB  1 
ATOM   6241  N N   . ARG B 1 269 ? 68.344  15.235  3.355   1.00 3.10  ? 269  ARG B N   1 
ATOM   6242  C CA  . ARG B 1 269 ? 69.389  15.376  2.361   1.00 3.86  ? 269  ARG B CA  1 
ATOM   6243  C C   . ARG B 1 269 ? 70.355  16.507  2.760   1.00 5.45  ? 269  ARG B C   1 
ATOM   6244  O O   . ARG B 1 269 ? 71.548  16.415  2.507   1.00 4.31  ? 269  ARG B O   1 
ATOM   6245  C CB  . ARG B 1 269 ? 68.835  15.677  0.979   1.00 2.08  ? 269  ARG B CB  1 
ATOM   6246  C CG  . ARG B 1 269 ? 69.884  15.248  -0.050  1.00 2.08  ? 269  ARG B CG  1 
ATOM   6247  C CD  . ARG B 1 269 ? 69.450  15.602  -1.463  1.00 3.69  ? 269  ARG B CD  1 
ATOM   6248  N NE  . ARG B 1 269 ? 68.442  14.650  -1.916  1.00 4.07  ? 269  ARG B NE  1 
ATOM   6249  C CZ  . ARG B 1 269 ? 68.646  13.415  -2.383  1.00 5.57  ? 269  ARG B CZ  1 
ATOM   6250  N NH1 . ARG B 1 269 ? 69.848  12.843  -2.519  1.00 4.88  ? 269  ARG B NH1 1 
ATOM   6251  N NH2 . ARG B 1 269 ? 67.582  12.684  -2.721  1.00 3.49  ? 269  ARG B NH2 1 
ATOM   6252  N N   . ASP B 1 270 ? 69.811  17.585  3.328   1.00 5.38  ? 270  ASP B N   1 
ATOM   6253  C CA  . ASP B 1 270 ? 70.614  18.726  3.739   1.00 3.48  ? 270  ASP B CA  1 
ATOM   6254  C C   . ASP B 1 270 ? 71.500  18.392  4.931   1.00 3.33  ? 270  ASP B C   1 
ATOM   6255  O O   . ASP B 1 270 ? 72.632  18.851  4.966   1.00 2.55  ? 270  ASP B O   1 
ATOM   6256  C CB  . ASP B 1 270 ? 69.756  19.935  4.163   1.00 2.08  ? 270  ASP B CB  1 
ATOM   6257  C CG  . ASP B 1 270 ? 68.975  20.532  3.001   1.00 3.13  ? 270  ASP B CG  1 
ATOM   6258  O OD1 . ASP B 1 270 ? 69.326  20.359  1.810   1.00 3.37  ? 270  ASP B OD1 1 
ATOM   6259  O OD2 . ASP B 1 270 ? 67.968  21.219  3.299   1.00 4.75  ? 270  ASP B OD2 1 
ATOM   6260  N N   . LEU B 1 271 ? 70.991  17.595  5.862   1.00 3.56  ? 271  LEU B N   1 
ATOM   6261  C CA  . LEU B 1 271 ? 71.742  17.197  7.026   1.00 4.94  ? 271  LEU B CA  1 
ATOM   6262  C C   . LEU B 1 271 ? 72.868  16.254  6.571   1.00 3.94  ? 271  LEU B C   1 
ATOM   6263  O O   . LEU B 1 271 ? 73.998  16.381  7.045   1.00 3.61  ? 271  LEU B O   1 
ATOM   6264  C CB  . LEU B 1 271 ? 70.879  16.595  8.141   1.00 4.13  ? 271  LEU B CB  1 
ATOM   6265  C CG  . LEU B 1 271 ? 71.627  16.142  9.382   1.00 4.77  ? 271  LEU B CG  1 
ATOM   6266  C CD1 . LEU B 1 271 ? 72.474  17.254  10.032  1.00 2.79  ? 271  LEU B CD1 1 
ATOM   6267  C CD2 . LEU B 1 271 ? 70.683  15.553  10.457  1.00 3.22  ? 271  LEU B CD2 1 
ATOM   6268  N N   . ALA B 1 272 ? 72.587  15.428  5.566   1.00 4.23  ? 272  ALA B N   1 
ATOM   6269  C CA  . ALA B 1 272 ? 73.582  14.529  5.009   1.00 4.23  ? 272  ALA B CA  1 
ATOM   6270  C C   . ALA B 1 272 ? 74.741  15.343  4.389   1.00 4.40  ? 272  ALA B C   1 
ATOM   6271  O O   . ALA B 1 272 ? 75.909  14.973  4.492   1.00 3.59  ? 272  ALA B O   1 
ATOM   6272  C CB  . ALA B 1 272 ? 72.923  13.648  3.973   1.00 2.86  ? 272  ALA B CB  1 
ATOM   6273  N N   . ARG B 1 273 ? 74.352  16.388  3.641   1.00 3.86  ? 273  ARG B N   1 
ATOM   6274  C CA  . ARG B 1 273 ? 75.290  17.307  2.998   1.00 5.07  ? 273  ARG B CA  1 
ATOM   6275  C C   . ARG B 1 273 ? 76.263  17.949  3.982   1.00 5.45  ? 273  ARG B C   1 
ATOM   6276  O O   . ARG B 1 273 ? 77.464  18.042  3.686   1.00 8.04  ? 273  ARG B O   1 
ATOM   6277  C CB  . ARG B 1 273 ? 74.512  18.400  2.245   1.00 3.47  ? 273  ARG B CB  1 
ATOM   6278  C CG  . ARG B 1 273 ? 75.368  19.528  1.707   1.00 4.55  ? 273  ARG B CG  1 
ATOM   6279  C CD  . ARG B 1 273 ? 76.155  19.065  0.479   1.00 5.46  ? 273  ARG B CD  1 
ATOM   6280  N NE  . ARG B 1 273 ? 76.900  20.188  -0.077  1.00 6.76  ? 273  ARG B NE  1 
ATOM   6281  C CZ  . ARG B 1 273 ? 77.790  20.060  -1.064  1.00 7.08  ? 273  ARG B CZ  1 
ATOM   6282  N NH1 . ARG B 1 273 ? 78.055  18.887  -1.622  1.00 6.48  ? 273  ARG B NH1 1 
ATOM   6283  N NH2 . ARG B 1 273 ? 78.427  21.136  -1.538  1.00 7.17  ? 273  ARG B NH2 1 
ATOM   6284  N N   . VAL B 1 274 ? 75.833  18.335  5.162   1.00 5.24  ? 274  VAL B N   1 
ATOM   6285  C CA  . VAL B 1 274 ? 76.666  18.865  6.228   1.00 5.71  ? 274  VAL B CA  1 
ATOM   6286  C C   . VAL B 1 274 ? 77.788  17.850  6.510   1.00 6.56  ? 274  VAL B C   1 
ATOM   6287  O O   . VAL B 1 274 ? 78.988  18.166  6.536   1.00 3.26  ? 274  VAL B O   1 
ATOM   6288  C CB  . VAL B 1 274 ? 75.868  19.067  7.531   1.00 5.72  ? 274  VAL B CB  1 
ATOM   6289  C CG1 . VAL B 1 274 ? 76.732  19.570  8.676   1.00 4.73  ? 274  VAL B CG1 1 
ATOM   6290  C CG2 . VAL B 1 274 ? 74.719  20.088  7.322   1.00 7.13  ? 274  VAL B CG2 1 
ATOM   6291  N N   . THR B 1 275 ? 77.344  16.596  6.712   1.00 5.11  ? 275  THR B N   1 
ATOM   6292  C CA  . THR B 1 275 ? 78.259  15.540  7.084   1.00 4.65  ? 275  THR B CA  1 
ATOM   6293  C C   . THR B 1 275 ? 79.153  15.120  5.934   1.00 5.21  ? 275  THR B C   1 
ATOM   6294  O O   . THR B 1 275 ? 80.210  14.525  6.234   1.00 7.45  ? 275  THR B O   1 
ATOM   6295  C CB  . THR B 1 275 ? 77.575  14.330  7.762   1.00 3.79  ? 275  THR B CB  1 
ATOM   6296  O OG1 . THR B 1 275 ? 76.929  13.528  6.768   1.00 2.38  ? 275  THR B OG1 1 
ATOM   6297  C CG2 . THR B 1 275 ? 76.518  14.791  8.735   1.00 2.85  ? 275  THR B CG2 1 
ATOM   6298  N N   . PHE B 1 276 ? 78.816  15.451  4.691   1.00 4.11  ? 276  PHE B N   1 
ATOM   6299  C CA  . PHE B 1 276 ? 79.676  15.123  3.570   1.00 3.10  ? 276  PHE B CA  1 
ATOM   6300  C C   . PHE B 1 276 ? 80.801  16.179  3.446   1.00 3.94  ? 276  PHE B C   1 
ATOM   6301  O O   . PHE B 1 276 ? 81.809  15.901  2.795   1.00 2.21  ? 276  PHE B O   1 
ATOM   6302  C CB  . PHE B 1 276 ? 78.989  15.105  2.217   1.00 2.22  ? 276  PHE B CB  1 
ATOM   6303  C CG  . PHE B 1 276 ? 79.755  14.624  1.019   1.00 5.21  ? 276  PHE B CG  1 
ATOM   6304  C CD1 . PHE B 1 276 ? 80.429  13.422  1.017   1.00 5.23  ? 276  PHE B CD1 1 
ATOM   6305  C CD2 . PHE B 1 276 ? 79.785  15.398  -0.129  1.00 4.85  ? 276  PHE B CD2 1 
ATOM   6306  C CE1 . PHE B 1 276 ? 81.126  12.989  -0.096  1.00 5.72  ? 276  PHE B CE1 1 
ATOM   6307  C CE2 . PHE B 1 276 ? 80.460  14.979  -1.253  1.00 5.81  ? 276  PHE B CE2 1 
ATOM   6308  C CZ  . PHE B 1 276 ? 81.133  13.782  -1.244  1.00 6.17  ? 276  PHE B CZ  1 
ATOM   6309  N N   . THR B 1 277 ? 80.544  17.378  3.949   1.00 3.31  ? 277  THR B N   1 
ATOM   6310  C CA  . THR B 1 277 ? 81.473  18.496  3.756   1.00 3.41  ? 277  THR B CA  1 
ATOM   6311  C C   . THR B 1 277 ? 82.037  19.094  5.033   1.00 4.17  ? 277  THR B C   1 
ATOM   6312  O O   . THR B 1 277 ? 82.675  20.155  5.017   1.00 3.88  ? 277  THR B O   1 
ATOM   6313  C CB  . THR B 1 277 ? 80.761  19.576  2.907   1.00 3.38  ? 277  THR B CB  1 
ATOM   6314  O OG1 . THR B 1 277 ? 79.629  20.070  3.646   1.00 3.57  ? 277  THR B OG1 1 
ATOM   6315  C CG2 . THR B 1 277 ? 80.218  19.086  1.579   1.00 2.17  ? 277  THR B CG2 1 
ATOM   6316  N N   . ASP B 1 278 ? 81.910  18.413  6.158   1.00 3.30  ? 278  ASP B N   1 
ATOM   6317  C CA  . ASP B 1 278 ? 82.462  18.856  7.410   1.00 2.15  ? 278  ASP B CA  1 
ATOM   6318  C C   . ASP B 1 278 ? 83.942  18.428  7.492   1.00 2.54  ? 278  ASP B C   1 
ATOM   6319  O O   . ASP B 1 278 ? 84.475  17.760  6.616   1.00 4.49  ? 278  ASP B O   1 
ATOM   6320  C CB  . ASP B 1 278 ? 81.700  18.316  8.603   1.00 2.08  ? 278  ASP B CB  1 
ATOM   6321  C CG  . ASP B 1 278 ? 81.621  16.809  8.703   1.00 3.62  ? 278  ASP B CG  1 
ATOM   6322  O OD1 . ASP B 1 278 ? 82.394  16.086  8.049   1.00 6.38  ? 278  ASP B OD1 1 
ATOM   6323  O OD2 . ASP B 1 278 ? 80.748  16.311  9.438   1.00 3.50  ? 278  ASP B OD2 1 
ATOM   6324  N N   . ASN B 1 279 ? 84.609  18.805  8.566   1.00 3.07  ? 279  ASN B N   1 
ATOM   6325  C CA  . ASN B 1 279 ? 86.038  18.438  8.716   1.00 3.62  ? 279  ASN B CA  1 
ATOM   6326  C C   . ASN B 1 279 ? 86.312  18.219  10.171  1.00 3.29  ? 279  ASN B C   1 
ATOM   6327  O O   . ASN B 1 279 ? 86.666  19.138  10.934  1.00 3.15  ? 279  ASN B O   1 
ATOM   6328  C CB  . ASN B 1 279 ? 86.968  19.488  8.088   1.00 2.08  ? 279  ASN B CB  1 
ATOM   6329  C CG  . ASN B 1 279 ? 87.065  19.424  6.614   1.00 2.57  ? 279  ASN B CG  1 
ATOM   6330  O OD1 . ASN B 1 279 ? 87.517  18.384  6.105   1.00 2.65  ? 279  ASN B OD1 1 
ATOM   6331  N ND2 . ASN B 1 279 ? 86.650  20.418  5.791   1.00 3.58  ? 279  ASN B ND2 1 
ATOM   6332  N N   . ILE B 1 280 ? 86.097  16.982  10.603  1.00 3.16  ? 280  ILE B N   1 
ATOM   6333  C CA  . ILE B 1 280 ? 86.361  16.509  11.936  1.00 3.86  ? 280  ILE B CA  1 
ATOM   6334  C C   . ILE B 1 280 ? 85.489  17.134  13.005  1.00 4.65  ? 280  ILE B C   1 
ATOM   6335  O O   . ILE B 1 280 ? 84.620  16.457  13.610  1.00 4.17  ? 280  ILE B O   1 
ATOM   6336  C CB  . ILE B 1 280 ? 87.874  16.612  12.284  1.00 3.09  ? 280  ILE B CB  1 
ATOM   6337  C CG1 . ILE B 1 280 ? 88.730  15.820  11.314  1.00 4.05  ? 280  ILE B CG1 1 
ATOM   6338  C CG2 . ILE B 1 280 ? 88.080  16.205  13.749  1.00 2.08  ? 280  ILE B CG2 1 
ATOM   6339  C CD1 . ILE B 1 280 ? 88.367  14.331  11.124  1.00 3.50  ? 280  ILE B CD1 1 
ATOM   6340  N N   . ASN B 1 281 ? 85.740  18.417  13.321  1.00 3.80  ? 281  ASN B N   1 
ATOM   6341  C CA  . ASN B 1 281 ? 84.986  19.070  14.374  1.00 2.49  ? 281  ASN B CA  1 
ATOM   6342  C C   . ASN B 1 281 ? 84.367  20.398  13.934  1.00 2.08  ? 281  ASN B C   1 
ATOM   6343  O O   . ASN B 1 281 ? 84.021  21.189  14.836  1.00 3.19  ? 281  ASN B O   1 
ATOM   6344  C CB  . ASN B 1 281 ? 85.895  19.261  15.584  1.00 2.18  ? 281  ASN B CB  1 
ATOM   6345  C CG  . ASN B 1 281 ? 87.174  20.053  15.410  1.00 2.65  ? 281  ASN B CG  1 
ATOM   6346  O OD1 . ASN B 1 281 ? 87.414  20.539  14.303  1.00 2.08  ? 281  ASN B OD1 1 
ATOM   6347  N ND2 . ASN B 1 281 ? 87.964  20.223  16.449  1.00 2.08  ? 281  ASN B ND2 1 
ATOM   6348  N N   . THR B 1 282 ? 84.158  20.672  12.673  1.00 3.85  ? 282  THR B N   1 
ATOM   6349  C CA  . THR B 1 282 ? 83.600  21.951  12.278  1.00 3.22  ? 282  THR B CA  1 
ATOM   6350  C C   . THR B 1 282 ? 82.214  22.207  12.876  1.00 4.65  ? 282  THR B C   1 
ATOM   6351  O O   . THR B 1 282 ? 81.912  23.338  13.282  1.00 3.36  ? 282  THR B O   1 
ATOM   6352  C CB  . THR B 1 282 ? 83.572  22.007  10.740  1.00 5.73  ? 282  THR B CB  1 
ATOM   6353  O OG1 . THR B 1 282 ? 83.029  20.766  10.286  1.00 4.60  ? 282  THR B OG1 1 
ATOM   6354  C CG2 . THR B 1 282 ? 84.983  22.221  10.166  1.00 4.96  ? 282  THR B CG2 1 
ATOM   6355  N N   . GLU B 1 283 ? 81.354  21.155  12.981  1.00 3.37  ? 283  GLU B N   1 
ATOM   6356  C CA  . GLU B 1 283 ? 80.020  21.370  13.533  1.00 3.45  ? 283  GLU B CA  1 
ATOM   6357  C C   . GLU B 1 283 ? 80.099  21.666  15.013  1.00 2.52  ? 283  GLU B C   1 
ATOM   6358  O O   . GLU B 1 283 ? 79.501  22.681  15.452  1.00 4.20  ? 283  GLU B O   1 
ATOM   6359  C CB  . GLU B 1 283 ? 79.051  20.215  13.257  1.00 3.17  ? 283  GLU B CB  1 
ATOM   6360  C CG  . GLU B 1 283 ? 78.754  19.878  11.790  1.00 2.08  ? 283  GLU B CG  1 
ATOM   6361  C CD  . GLU B 1 283 ? 79.640  18.684  11.399  1.00 3.45  ? 283  GLU B CD  1 
ATOM   6362  O OE1 . GLU B 1 283 ? 80.731  18.547  11.993  1.00 3.58  ? 283  GLU B OE1 1 
ATOM   6363  O OE2 . GLU B 1 283 ? 79.226  17.920  10.477  1.00 3.87  ? 283  GLU B OE2 1 
ATOM   6364  N N   . ALA B 1 284 ? 80.913  20.941  15.794  1.00 2.94  ? 284  ALA B N   1 
ATOM   6365  C CA  . ALA B 1 284 ? 81.004  21.293  17.211  1.00 3.99  ? 284  ALA B CA  1 
ATOM   6366  C C   . ALA B 1 284 ? 81.732  22.607  17.466  1.00 2.08  ? 284  ALA B C   1 
ATOM   6367  O O   . ALA B 1 284 ? 81.539  23.169  18.546  1.00 2.50  ? 284  ALA B O   1 
ATOM   6368  C CB  . ALA B 1 284 ? 81.762  20.175  17.961  1.00 2.96  ? 284  ALA B CB  1 
ATOM   6369  N N   . TYR B 1 285 ? 82.621  23.008  16.564  1.00 2.22  ? 285  TYR B N   1 
ATOM   6370  C CA  . TYR B 1 285 ? 83.405  24.246  16.737  1.00 3.55  ? 285  TYR B CA  1 
ATOM   6371  C C   . TYR B 1 285 ? 82.412  25.395  16.567  1.00 2.94  ? 285  TYR B C   1 
ATOM   6372  O O   . TYR B 1 285 ? 82.359  26.312  17.368  1.00 2.79  ? 285  TYR B O   1 
ATOM   6373  C CB  . TYR B 1 285 ? 84.497  24.246  15.647  1.00 3.58  ? 285  TYR B CB  1 
ATOM   6374  C CG  . TYR B 1 285 ? 85.650  25.200  15.912  1.00 6.03  ? 285  TYR B CG  1 
ATOM   6375  C CD1 . TYR B 1 285 ? 86.717  24.879  16.738  1.00 5.30  ? 285  TYR B CD1 1 
ATOM   6376  C CD2 . TYR B 1 285 ? 85.645  26.456  15.318  1.00 7.17  ? 285  TYR B CD2 1 
ATOM   6377  C CE1 . TYR B 1 285 ? 87.800  25.743  16.956  1.00 3.63  ? 285  TYR B CE1 1 
ATOM   6378  C CE2 . TYR B 1 285 ? 86.697  27.344  15.539  1.00 6.93  ? 285  TYR B CE2 1 
ATOM   6379  C CZ  . TYR B 1 285 ? 87.753  26.982  16.359  1.00 5.50  ? 285  TYR B CZ  1 
ATOM   6380  O OH  . TYR B 1 285 ? 88.754  27.917  16.574  1.00 5.34  ? 285  TYR B OH  1 
ATOM   6381  N N   . ARG B 1 286 ? 81.595  25.316  15.524  1.00 3.26  ? 286  ARG B N   1 
ATOM   6382  C CA  . ARG B 1 286 ? 80.503  26.269  15.379  1.00 4.71  ? 286  ARG B CA  1 
ATOM   6383  C C   . ARG B 1 286 ? 79.649  26.270  16.651  1.00 5.48  ? 286  ARG B C   1 
ATOM   6384  O O   . ARG B 1 286 ? 79.357  27.337  17.212  1.00 4.50  ? 286  ARG B O   1 
ATOM   6385  C CB  . ARG B 1 286 ? 79.643  25.928  14.169  1.00 4.03  ? 286  ARG B CB  1 
ATOM   6386  C CG  . ARG B 1 286 ? 80.309  26.166  12.830  1.00 4.77  ? 286  ARG B CG  1 
ATOM   6387  C CD  . ARG B 1 286 ? 79.622  25.460  11.685  1.00 6.15  ? 286  ARG B CD  1 
ATOM   6388  N NE  . ARG B 1 286 ? 78.187  25.771  11.665  1.00 6.51  ? 286  ARG B NE  1 
ATOM   6389  C CZ  . ARG B 1 286 ? 77.289  25.061  10.960  1.00 8.19  ? 286  ARG B CZ  1 
ATOM   6390  N NH1 . ARG B 1 286 ? 77.639  23.978  10.250  1.00 3.55  ? 286  ARG B NH1 1 
ATOM   6391  N NH2 . ARG B 1 286 ? 75.994  25.428  10.972  1.00 5.02  ? 286  ARG B NH2 1 
ATOM   6392  N N   . GLY B 1 287 ? 79.221  25.114  17.176  1.00 4.24  ? 287  GLY B N   1 
ATOM   6393  C CA  . GLY B 1 287 ? 78.403  25.091  18.387  1.00 4.26  ? 287  GLY B CA  1 
ATOM   6394  C C   . GLY B 1 287 ? 79.170  25.682  19.559  1.00 5.81  ? 287  GLY B C   1 
ATOM   6395  O O   . GLY B 1 287 ? 78.631  26.420  20.416  1.00 4.60  ? 287  GLY B O   1 
ATOM   6396  N N   . ALA B 1 288 ? 80.457  25.334  19.687  1.00 3.82  ? 288  ALA B N   1 
ATOM   6397  C CA  . ALA B 1 288 ? 81.269  25.891  20.782  1.00 3.70  ? 288  ALA B CA  1 
ATOM   6398  C C   . ALA B 1 288 ? 81.279  27.440  20.751  1.00 3.17  ? 288  ALA B C   1 
ATOM   6399  O O   . ALA B 1 288 ? 81.149  28.035  21.813  1.00 2.37  ? 288  ALA B O   1 
ATOM   6400  C CB  . ALA B 1 288 ? 82.676  25.336  20.667  1.00 3.35  ? 288  ALA B CB  1 
ATOM   6401  N N   . LEU B 1 289 ? 81.399  28.038  19.575  1.00 3.57  ? 289  LEU B N   1 
ATOM   6402  C CA  . LEU B 1 289 ? 81.435  29.494  19.520  1.00 4.62  ? 289  LEU B CA  1 
ATOM   6403  C C   . LEU B 1 289 ? 80.048  30.079  19.898  1.00 4.55  ? 289  LEU B C   1 
ATOM   6404  O O   . LEU B 1 289 ? 79.951  31.090  20.571  1.00 3.77  ? 289  LEU B O   1 
ATOM   6405  C CB  . LEU B 1 289 ? 81.839  29.971  18.139  1.00 3.55  ? 289  LEU B CB  1 
ATOM   6406  C CG  . LEU B 1 289 ? 83.305  29.666  17.724  1.00 4.01  ? 289  LEU B CG  1 
ATOM   6407  C CD1 . LEU B 1 289 ? 83.401  29.877  16.221  1.00 2.66  ? 289  LEU B CD1 1 
ATOM   6408  C CD2 . LEU B 1 289 ? 84.198  30.599  18.530  1.00 3.76  ? 289  LEU B CD2 1 
ATOM   6409  N N   . ILE B 1 290 ? 78.983  29.418  19.421  1.00 3.29  ? 290  ILE B N   1 
ATOM   6410  C CA  . ILE B 1 290 ? 77.611  29.834  19.753  1.00 3.90  ? 290  ILE B CA  1 
ATOM   6411  C C   . ILE B 1 290 ? 77.389  29.766  21.243  1.00 4.16  ? 290  ILE B C   1 
ATOM   6412  O O   . ILE B 1 290 ? 76.914  30.731  21.876  1.00 3.27  ? 290  ILE B O   1 
ATOM   6413  C CB  . ILE B 1 290 ? 76.511  28.997  19.022  1.00 3.07  ? 290  ILE B CB  1 
ATOM   6414  C CG1 . ILE B 1 290 ? 76.608  29.275  17.540  1.00 2.08  ? 290  ILE B CG1 1 
ATOM   6415  C CG2 . ILE B 1 290 ? 75.112  29.338  19.599  1.00 2.08  ? 290  ILE B CG2 1 
ATOM   6416  C CD1 . ILE B 1 290 ? 75.717  28.493  16.614  1.00 3.18  ? 290  ILE B CD1 1 
ATOM   6417  N N   . LEU B 1 291 ? 77.782  28.652  21.882  1.00 3.61  ? 291  LEU B N   1 
ATOM   6418  C CA  . LEU B 1 291 ? 77.603  28.494  23.317  1.00 3.07  ? 291  LEU B CA  1 
ATOM   6419  C C   . LEU B 1 291 ? 78.375  29.519  24.147  1.00 4.23  ? 291  LEU B C   1 
ATOM   6420  O O   . LEU B 1 291 ? 77.955  30.016  25.192  1.00 3.25  ? 291  LEU B O   1 
ATOM   6421  C CB  . LEU B 1 291 ? 77.962  27.055  23.754  1.00 3.83  ? 291  LEU B CB  1 
ATOM   6422  C CG  . LEU B 1 291 ? 77.063  25.950  23.165  1.00 4.85  ? 291  LEU B CG  1 
ATOM   6423  C CD1 . LEU B 1 291 ? 77.794  24.614  23.127  1.00 4.57  ? 291  LEU B CD1 1 
ATOM   6424  C CD2 . LEU B 1 291 ? 75.769  25.811  23.979  1.00 5.16  ? 291  LEU B CD2 1 
ATOM   6425  N N   . LEU B 1 292 ? 79.584  29.836  23.686  1.00 3.83  ? 292  LEU B N   1 
ATOM   6426  C CA  . LEU B 1 292 ? 80.449  30.804  24.368  1.00 2.79  ? 292  LEU B CA  1 
ATOM   6427  C C   . LEU B 1 292 ? 79.759  32.178  24.293  1.00 3.23  ? 292  LEU B C   1 
ATOM   6428  O O   . LEU B 1 292 ? 79.678  32.869  25.274  1.00 3.73  ? 292  LEU B O   1 
ATOM   6429  C CB  . LEU B 1 292 ? 81.785  30.870  23.603  1.00 2.08  ? 292  LEU B CB  1 
ATOM   6430  C CG  . LEU B 1 292 ? 82.931  31.636  24.300  1.00 3.18  ? 292  LEU B CG  1 
ATOM   6431  C CD1 . LEU B 1 292 ? 83.254  31.104  25.686  1.00 3.39  ? 292  LEU B CD1 1 
ATOM   6432  C CD2 . LEU B 1 292 ? 84.157  31.657  23.390  1.00 3.70  ? 292  LEU B CD2 1 
ATOM   6433  N N   . GLY B 1 293 ? 79.285  32.568  23.118  1.00 3.40  ? 293  GLY B N   1 
ATOM   6434  C CA  . GLY B 1 293 ? 78.593  33.831  22.927  1.00 4.87  ? 293  GLY B CA  1 
ATOM   6435  C C   . GLY B 1 293 ? 77.306  33.937  23.758  1.00 5.43  ? 293  GLY B C   1 
ATOM   6436  O O   . GLY B 1 293 ? 76.944  35.045  24.170  1.00 5.20  ? 293  GLY B O   1 
ATOM   6437  N N   . LEU B 1 294 ? 76.645  32.831  24.102  1.00 4.53  ? 294  LEU B N   1 
ATOM   6438  C CA  . LEU B 1 294 ? 75.449  32.837  24.922  1.00 3.63  ? 294  LEU B CA  1 
ATOM   6439  C C   . LEU B 1 294 ? 75.783  32.737  26.381  1.00 4.50  ? 294  LEU B C   1 
ATOM   6440  O O   . LEU B 1 294 ? 74.925  32.765  27.265  1.00 3.73  ? 294  LEU B O   1 
ATOM   6441  C CB  . LEU B 1 294 ? 74.523  31.648  24.532  1.00 3.90  ? 294  LEU B CB  1 
ATOM   6442  C CG  . LEU B 1 294 ? 73.967  31.817  23.123  1.00 6.90  ? 294  LEU B CG  1 
ATOM   6443  C CD1 . LEU B 1 294 ? 73.077  30.624  22.758  1.00 7.12  ? 294  LEU B CD1 1 
ATOM   6444  C CD2 . LEU B 1 294 ? 73.141  33.124  22.997  1.00 6.13  ? 294  LEU B CD2 1 
ATOM   6445  N N   . ASP B 1 295 ? 77.074  32.590  26.707  1.00 5.12  ? 295  ASP B N   1 
ATOM   6446  C CA  . ASP B 1 295 ? 77.534  32.531  28.087  1.00 2.08  ? 295  ASP B CA  1 
ATOM   6447  C C   . ASP B 1 295 ? 77.099  31.249  28.773  1.00 4.39  ? 295  ASP B C   1 
ATOM   6448  O O   . ASP B 1 295 ? 76.950  31.181  29.989  1.00 3.59  ? 295  ASP B O   1 
ATOM   6449  C CB  . ASP B 1 295 ? 77.081  33.780  28.856  1.00 7.25  ? 295  ASP B CB  1 
ATOM   6450  C CG  . ASP B 1 295 ? 77.890  33.989  30.120  1.00 8.11  ? 295  ASP B CG  1 
ATOM   6451  O OD1 . ASP B 1 295 ? 79.083  33.655  30.184  1.00 10.08 ? 295  ASP B OD1 1 
ATOM   6452  O OD2 . ASP B 1 295 ? 77.369  34.406  31.173  1.00 10.37 ? 295  ASP B OD2 1 
ATOM   6453  N N   . ALA B 1 296 ? 76.959  30.166  28.000  1.00 4.35  ? 296  ALA B N   1 
ATOM   6454  C CA  . ALA B 1 296 ? 76.759  28.835  28.559  1.00 3.89  ? 296  ALA B CA  1 
ATOM   6455  C C   . ALA B 1 296 ? 78.144  28.371  29.079  1.00 4.07  ? 296  ALA B C   1 
ATOM   6456  O O   . ALA B 1 296 ? 78.230  27.619  30.054  1.00 3.47  ? 296  ALA B O   1 
ATOM   6457  C CB  . ALA B 1 296 ? 76.133  27.847  27.604  1.00 2.08  ? 296  ALA B CB  1 
ATOM   6458  N N   . PHE B 1 297 ? 79.191  28.793  28.383  1.00 2.48  ? 297  PHE B N   1 
ATOM   6459  C CA  . PHE B 1 297 ? 80.586  28.696  28.833  1.00 4.50  ? 297  PHE B CA  1 
ATOM   6460  C C   . PHE B 1 297 ? 81.030  30.165  28.980  1.00 4.20  ? 297  PHE B C   1 
ATOM   6461  O O   . PHE B 1 297 ? 80.794  30.922  28.021  1.00 4.17  ? 297  PHE B O   1 
ATOM   6462  C CB  . PHE B 1 297 ? 81.500  27.963  27.825  1.00 3.90  ? 297  PHE B CB  1 
ATOM   6463  C CG  . PHE B 1 297 ? 82.829  27.639  28.511  1.00 4.85  ? 297  PHE B CG  1 
ATOM   6464  C CD1 . PHE B 1 297 ? 82.899  26.750  29.563  1.00 2.77  ? 297  PHE B CD1 1 
ATOM   6465  C CD2 . PHE B 1 297 ? 83.996  28.281  28.073  1.00 3.43  ? 297  PHE B CD2 1 
ATOM   6466  C CE1 . PHE B 1 297 ? 84.110  26.467  30.193  1.00 3.59  ? 297  PHE B CE1 1 
ATOM   6467  C CE2 . PHE B 1 297 ? 85.215  27.989  28.694  1.00 2.12  ? 297  PHE B CE2 1 
ATOM   6468  C CZ  . PHE B 1 297 ? 85.272  27.111  29.756  1.00 2.08  ? 297  PHE B CZ  1 
ATOM   6469  N N   . ASN B 1 298 ? 81.674  30.646  29.994  1.00 3.48  ? 298  ASN B N   1 
ATOM   6470  C CA  . ASN B 1 298 ? 82.023  32.053  30.203  1.00 3.48  ? 298  ASN B CA  1 
ATOM   6471  C C   . ASN B 1 298 ? 83.392  32.383  29.623  1.00 4.11  ? 298  ASN B C   1 
ATOM   6472  O O   . ASN B 1 298 ? 84.423  31.905  30.109  1.00 2.51  ? 298  ASN B O   1 
ATOM   6473  C CB  . ASN B 1 298 ? 81.884  32.401  31.690  1.00 3.30  ? 298  ASN B CB  1 
ATOM   6474  C CG  . ASN B 1 298 ? 82.176  33.855  32.027  1.00 4.25  ? 298  ASN B CG  1 
ATOM   6475  O OD1 . ASN B 1 298 ? 83.230  34.240  32.556  1.00 2.91  ? 298  ASN B OD1 1 
ATOM   6476  N ND2 . ASN B 1 298 ? 81.192  34.694  31.680  1.00 4.23  ? 298  ASN B ND2 1 
ATOM   6477  N N   . ARG B 1 299 ? 83.444  33.248  28.629  1.00 3.15  ? 299  ARG B N   1 
ATOM   6478  C CA  . ARG B 1 299 ? 84.684  33.649  27.977  1.00 3.71  ? 299  ARG B CA  1 
ATOM   6479  C C   . ARG B 1 299 ? 85.647  34.282  28.963  1.00 3.04  ? 299  ARG B C   1 
ATOM   6480  O O   . ARG B 1 299 ? 86.861  34.031  28.832  1.00 3.22  ? 299  ARG B O   1 
ATOM   6481  C CB  . ARG B 1 299 ? 84.383  34.485  26.728  1.00 2.71  ? 299  ARG B CB  1 
ATOM   6482  C CG  . ARG B 1 299 ? 85.586  34.897  25.878  1.00 4.47  ? 299  ARG B CG  1 
ATOM   6483  C CD  . ARG B 1 299 ? 85.201  35.440  24.542  1.00 4.37  ? 299  ARG B CD  1 
ATOM   6484  N NE  . ARG B 1 299 ? 86.290  35.633  23.587  1.00 5.17  ? 299  ARG B NE  1 
ATOM   6485  C CZ  . ARG B 1 299 ? 86.983  36.779  23.501  1.00 6.30  ? 299  ARG B CZ  1 
ATOM   6486  N NH1 . ARG B 1 299 ? 86.662  37.782  24.340  1.00 3.76  ? 299  ARG B NH1 1 
ATOM   6487  N NH2 . ARG B 1 299 ? 87.977  36.948  22.633  1.00 5.11  ? 299  ARG B NH2 1 
ATOM   6488  N N   . ALA B 1 300 ? 85.224  35.031  29.986  1.00 3.62  ? 300  ALA B N   1 
ATOM   6489  C CA  . ALA B 1 300 ? 86.117  35.610  30.969  1.00 4.64  ? 300  ALA B CA  1 
ATOM   6490  C C   . ALA B 1 300 ? 86.735  34.606  31.944  1.00 5.58  ? 300  ALA B C   1 
ATOM   6491  O O   . ALA B 1 300 ? 87.608  34.989  32.730  1.00 5.35  ? 300  ALA B O   1 
ATOM   6492  C CB  . ALA B 1 300 ? 85.432  36.731  31.775  1.00 4.79  ? 300  ALA B CB  1 
ATOM   6493  N N   . GLY B 1 301 ? 86.346  33.324  31.946  1.00 4.46  ? 301  GLY B N   1 
ATOM   6494  C CA  . GLY B 1 301 ? 86.954  32.311  32.784  1.00 4.11  ? 301  GLY B CA  1 
ATOM   6495  C C   . GLY B 1 301 ? 86.212  32.007  34.078  1.00 4.33  ? 301  GLY B C   1 
ATOM   6496  O O   . GLY B 1 301 ? 86.743  31.249  34.888  1.00 3.99  ? 301  GLY B O   1 
ATOM   6497  N N   . VAL B 1 302 ? 84.982  32.517  34.236  1.00 2.29  ? 302  VAL B N   1 
ATOM   6498  C CA  . VAL B 1 302 ? 84.247  32.235  35.471  1.00 3.47  ? 302  VAL B CA  1 
ATOM   6499  C C   . VAL B 1 302 ? 83.460  30.940  35.283  1.00 5.52  ? 302  VAL B C   1 
ATOM   6500  O O   . VAL B 1 302 ? 82.289  30.872  34.852  1.00 3.33  ? 302  VAL B O   1 
ATOM   6501  C CB  . VAL B 1 302 ? 83.348  33.414  35.877  1.00 2.91  ? 302  VAL B CB  1 
ATOM   6502  C CG1 . VAL B 1 302 ? 82.666  33.080  37.204  1.00 2.19  ? 302  VAL B CG1 1 
ATOM   6503  C CG2 . VAL B 1 302 ? 84.209  34.692  36.076  1.00 2.77  ? 302  VAL B CG2 1 
ATOM   6504  N N   . ASN B 1 303 ? 84.174  29.824  35.397  1.00 4.05  ? 303  ASN B N   1 
ATOM   6505  C CA  . ASN B 1 303 ? 83.722  28.482  35.133  1.00 3.75  ? 303  ASN B CA  1 
ATOM   6506  C C   . ASN B 1 303 ? 84.346  27.527  36.133  1.00 4.19  ? 303  ASN B C   1 
ATOM   6507  O O   . ASN B 1 303 ? 85.301  27.880  36.840  1.00 4.29  ? 303  ASN B O   1 
ATOM   6508  C CB  . ASN B 1 303 ? 84.127  28.001  33.732  1.00 4.91  ? 303  ASN B CB  1 
ATOM   6509  C CG  . ASN B 1 303 ? 83.819  28.891  32.572  1.00 6.76  ? 303  ASN B CG  1 
ATOM   6510  O OD1 . ASN B 1 303 ? 82.671  29.085  32.112  1.00 3.82  ? 303  ASN B OD1 1 
ATOM   6511  N ND2 . ASN B 1 303 ? 84.909  29.486  32.065  1.00 2.66  ? 303  ASN B ND2 1 
ATOM   6512  N N   . GLY B 1 304 ? 83.810  26.287  36.211  1.00 5.26  ? 304  GLY B N   1 
ATOM   6513  C CA  . GLY B 1 304 ? 84.402  25.289  37.109  1.00 2.38  ? 304  GLY B CA  1 
ATOM   6514  C C   . GLY B 1 304 ? 84.502  25.810  38.516  1.00 2.98  ? 304  GLY B C   1 
ATOM   6515  O O   . GLY B 1 304 ? 83.552  26.412  39.018  1.00 3.92  ? 304  GLY B O   1 
ATOM   6516  N N   . PRO B 1 305 ? 85.655  25.668  39.197  1.00 3.15  ? 305  PRO B N   1 
ATOM   6517  C CA  . PRO B 1 305 ? 85.847  26.112  40.548  1.00 2.78  ? 305  PRO B CA  1 
ATOM   6518  C C   . PRO B 1 305 ? 85.858  27.619  40.766  1.00 2.63  ? 305  PRO B C   1 
ATOM   6519  O O   . PRO B 1 305 ? 85.653  28.059  41.895  1.00 3.69  ? 305  PRO B O   1 
ATOM   6520  C CB  . PRO B 1 305 ? 87.184  25.489  40.978  1.00 4.83  ? 305  PRO B CB  1 
ATOM   6521  C CG  . PRO B 1 305 ? 87.939  25.419  39.677  1.00 5.83  ? 305  PRO B CG  1 
ATOM   6522  C CD  . PRO B 1 305 ? 86.889  25.055  38.637  1.00 4.89  ? 305  PRO B CD  1 
ATOM   6523  N N   . PHE B 1 306 ? 85.942  28.394  39.693  1.00 3.51  ? 306  PHE B N   1 
ATOM   6524  C CA  . PHE B 1 306 ? 85.943  29.850  39.794  1.00 3.82  ? 306  PHE B CA  1 
ATOM   6525  C C   . PHE B 1 306 ? 84.571  30.478  39.956  1.00 6.16  ? 306  PHE B C   1 
ATOM   6526  O O   . PHE B 1 306 ? 84.452  31.654  40.343  1.00 5.03  ? 306  PHE B O   1 
ATOM   6527  C CB  . PHE B 1 306 ? 86.636  30.378  38.506  1.00 2.97  ? 306  PHE B CB  1 
ATOM   6528  C CG  . PHE B 1 306 ? 88.050  29.815  38.513  1.00 3.40  ? 306  PHE B CG  1 
ATOM   6529  C CD1 . PHE B 1 306 ? 89.034  30.331  39.328  1.00 3.72  ? 306  PHE B CD1 1 
ATOM   6530  C CD2 . PHE B 1 306 ? 88.357  28.755  37.678  1.00 2.87  ? 306  PHE B CD2 1 
ATOM   6531  C CE1 . PHE B 1 306 ? 90.319  29.805  39.330  1.00 5.13  ? 306  PHE B CE1 1 
ATOM   6532  C CE2 . PHE B 1 306 ? 89.643  28.239  37.662  1.00 5.46  ? 306  PHE B CE2 1 
ATOM   6533  C CZ  . PHE B 1 306 ? 90.624  28.761  38.508  1.00 3.97  ? 306  PHE B CZ  1 
ATOM   6534  N N   . ILE B 1 307 ? 83.513  29.731  39.632  1.00 5.99  ? 307  ILE B N   1 
ATOM   6535  C CA  . ILE B 1 307 ? 82.144  30.212  39.795  1.00 8.16  ? 307  ILE B CA  1 
ATOM   6536  C C   . ILE B 1 307 ? 81.860  30.560  41.234  1.00 9.82  ? 307  ILE B C   1 
ATOM   6537  O O   . ILE B 1 307 ? 81.174  31.564  41.492  1.00 13.39 ? 307  ILE B O   1 
ATOM   6538  C CB  . ILE B 1 307 ? 81.122  29.170  39.284  1.00 8.61  ? 307  ILE B CB  1 
ATOM   6539  C CG1 . ILE B 1 307 ? 81.124  29.111  37.758  1.00 7.87  ? 307  ILE B CG1 1 
ATOM   6540  C CG2 . ILE B 1 307 ? 79.697  29.447  39.785  1.00 10.13 ? 307  ILE B CG2 1 
ATOM   6541  C CD1 . ILE B 1 307 ? 80.515  27.825  37.199  1.00 8.18  ? 307  ILE B CD1 1 
ATOM   6542  N N   . ASP B 1 308 ? 82.324  29.840  42.216  1.00 10.82 ? 308  ASP B N   1 
ATOM   6543  C CA  . ASP B 1 308 ? 82.085  30.077  43.612  1.00 12.11 ? 308  ASP B CA  1 
ATOM   6544  C C   . ASP B 1 308 ? 83.105  30.968  44.314  1.00 11.79 ? 308  ASP B C   1 
ATOM   6545  O O   . ASP B 1 308 ? 83.051  31.090  45.564  1.00 9.59  ? 308  ASP B O   1 
ATOM   6546  C CB  . ASP B 1 308 ? 82.066  28.668  44.251  1.00 15.27 ? 308  ASP B CB  1 
ATOM   6547  C CG  . ASP B 1 308 ? 80.891  27.808  43.785  1.00 20.37 ? 308  ASP B CG  1 
ATOM   6548  O OD1 . ASP B 1 308 ? 79.780  28.295  43.433  1.00 19.94 ? 308  ASP B OD1 1 
ATOM   6549  O OD2 . ASP B 1 308 ? 81.036  26.551  43.787  1.00 22.87 ? 308  ASP B OD2 1 
ATOM   6550  N N   . ILE B 1 309 ? 84.109  31.537  43.630  1.00 9.09  ? 309  ILE B N   1 
ATOM   6551  C CA  . ILE B 1 309 ? 85.088  32.382  44.350  1.00 7.52  ? 309  ILE B CA  1 
ATOM   6552  C C   . ILE B 1 309 ? 85.179  33.718  43.625  1.00 6.48  ? 309  ILE B C   1 
ATOM   6553  O O   . ILE B 1 309 ? 84.594  33.840  42.549  1.00 7.02  ? 309  ILE B O   1 
ATOM   6554  C CB  . ILE B 1 309 ? 86.440  31.688  44.553  1.00 7.29  ? 309  ILE B CB  1 
ATOM   6555  C CG1 . ILE B 1 309 ? 86.945  31.087  43.239  1.00 6.94  ? 309  ILE B CG1 1 
ATOM   6556  C CG2 . ILE B 1 309 ? 86.276  30.555  45.583  1.00 10.11 ? 309  ILE B CG2 1 
ATOM   6557  C CD1 . ILE B 1 309 ? 88.299  30.418  43.244  1.00 4.34  ? 309  ILE B CD1 1 
ATOM   6558  N N   . ASP B 1 310 ? 85.867  34.726  44.177  1.00 6.71  ? 310  ASP B N   1 
ATOM   6559  C CA  . ASP B 1 310 ? 85.862  36.045  43.526  1.00 5.78  ? 310  ASP B CA  1 
ATOM   6560  C C   . ASP B 1 310 ? 87.149  36.551  42.912  1.00 5.31  ? 310  ASP B C   1 
ATOM   6561  O O   . ASP B 1 310 ? 87.085  37.420  42.019  1.00 4.34  ? 310  ASP B O   1 
ATOM   6562  C CB  . ASP B 1 310 ? 85.458  37.040  44.663  1.00 9.30  ? 310  ASP B CB  1 
ATOM   6563  C CG  . ASP B 1 310 ? 84.011  36.787  45.070  1.00 15.21 ? 310  ASP B CG  1 
ATOM   6564  O OD1 . ASP B 1 310 ? 83.085  36.750  44.235  1.00 15.58 ? 310  ASP B OD1 1 
ATOM   6565  O OD2 . ASP B 1 310 ? 83.803  36.539  46.276  1.00 19.78 ? 310  ASP B OD2 1 
ATOM   6566  N N   . ARG B 1 311 ? 88.301  36.135  43.453  1.00 4.51  ? 311  ARG B N   1 
ATOM   6567  C CA  . ARG B 1 311 ? 89.561  36.709  42.984  1.00 5.55  ? 311  ARG B CA  1 
ATOM   6568  C C   . ARG B 1 311 ? 90.113  36.214  41.673  1.00 5.73  ? 311  ARG B C   1 
ATOM   6569  O O   . ARG B 1 311 ? 90.857  36.983  41.004  1.00 8.65  ? 311  ARG B O   1 
ATOM   6570  C CB  . ARG B 1 311 ? 90.611  36.554  44.119  1.00 3.66  ? 311  ARG B CB  1 
ATOM   6571  C CG  . ARG B 1 311 ? 91.778  37.530  43.958  1.00 5.69  ? 311  ARG B CG  1 
ATOM   6572  C CD  . ARG B 1 311 ? 91.420  38.959  44.383  1.00 5.34  ? 311  ARG B CD  1 
ATOM   6573  N NE  . ARG B 1 311 ? 92.530  39.879  44.059  1.00 5.38  ? 311  ARG B NE  1 
ATOM   6574  C CZ  . ARG B 1 311 ? 92.820  40.359  42.854  1.00 4.28  ? 311  ARG B CZ  1 
ATOM   6575  N NH1 . ARG B 1 311 ? 92.118  40.114  41.747  1.00 6.01  ? 311  ARG B NH1 1 
ATOM   6576  N NH2 . ARG B 1 311 ? 93.861  41.166  42.723  1.00 6.52  ? 311  ARG B NH2 1 
ATOM   6577  N N   . GLN B 1 312 ? 89.879  34.977  41.274  1.00 4.66  ? 312  GLN B N   1 
ATOM   6578  C CA  . GLN B 1 312 ? 90.469  34.370  40.110  1.00 4.58  ? 312  GLN B CA  1 
ATOM   6579  C C   . GLN B 1 312 ? 89.468  33.913  39.049  1.00 4.45  ? 312  GLN B C   1 
ATOM   6580  O O   . GLN B 1 312 ? 88.277  33.691  39.301  1.00 6.16  ? 312  GLN B O   1 
ATOM   6581  C CB  . GLN B 1 312 ? 91.278  33.109  40.513  1.00 4.58  ? 312  GLN B CB  1 
ATOM   6582  C CG  . GLN B 1 312 ? 92.298  33.320  41.622  1.00 4.43  ? 312  GLN B CG  1 
ATOM   6583  C CD  . GLN B 1 312 ? 92.673  32.007  42.301  1.00 5.85  ? 312  GLN B CD  1 
ATOM   6584  O OE1 . GLN B 1 312 ? 93.516  31.247  41.793  1.00 5.11  ? 312  GLN B OE1 1 
ATOM   6585  N NE2 . GLN B 1 312 ? 92.091  31.716  43.460  1.00 4.52  ? 312  GLN B NE2 1 
ATOM   6586  N N   . ALA B 1 313 ? 89.900  33.820  37.826  1.00 3.95  ? 313  ALA B N   1 
ATOM   6587  C CA  . ALA B 1 313 ? 89.219  33.312  36.677  1.00 3.36  ? 313  ALA B CA  1 
ATOM   6588  C C   . ALA B 1 313 ? 90.048  32.150  36.123  1.00 5.43  ? 313  ALA B C   1 
ATOM   6589  O O   . ALA B 1 313 ? 91.281  32.081  36.371  1.00 5.84  ? 313  ALA B O   1 
ATOM   6590  C CB  . ALA B 1 313 ? 89.065  34.362  35.597  1.00 2.41  ? 313  ALA B CB  1 
ATOM   6591  N N   . GLY B 1 314 ? 89.411  31.251  35.383  1.00 4.40  ? 314  GLY B N   1 
ATOM   6592  C CA  . GLY B 1 314 ? 90.114  30.143  34.778  1.00 3.84  ? 314  GLY B CA  1 
ATOM   6593  C C   . GLY B 1 314 ? 90.648  30.511  33.418  1.00 4.22  ? 314  GLY B C   1 
ATOM   6594  O O   . GLY B 1 314 ? 90.227  31.527  32.867  1.00 5.59  ? 314  GLY B O   1 
ATOM   6595  N N   . PHE B 1 315 ? 91.542  29.745  32.824  1.00 3.28  ? 315  PHE B N   1 
ATOM   6596  C CA  . PHE B 1 315 ? 91.972  29.961  31.462  1.00 3.47  ? 315  PHE B CA  1 
ATOM   6597  C C   . PHE B 1 315 ? 92.541  28.632  30.933  1.00 3.79  ? 315  PHE B C   1 
ATOM   6598  O O   . PHE B 1 315 ? 91.821  27.911  30.238  1.00 2.44  ? 315  PHE B O   1 
ATOM   6599  C CB  . PHE B 1 315 ? 92.946  31.111  31.284  1.00 3.34  ? 315  PHE B CB  1 
ATOM   6600  C CG  . PHE B 1 315 ? 93.379  31.320  29.857  1.00 2.77  ? 315  PHE B CG  1 
ATOM   6601  C CD1 . PHE B 1 315 ? 92.470  31.821  28.925  1.00 2.86  ? 315  PHE B CD1 1 
ATOM   6602  C CD2 . PHE B 1 315 ? 94.680  31.058  29.439  1.00 3.16  ? 315  PHE B CD2 1 
ATOM   6603  C CE1 . PHE B 1 315 ? 92.842  32.067  27.611  1.00 2.41  ? 315  PHE B CE1 1 
ATOM   6604  C CE2 . PHE B 1 315 ? 95.044  31.294  28.137  1.00 2.60  ? 315  PHE B CE2 1 
ATOM   6605  C CZ  . PHE B 1 315 ? 94.140  31.779  27.197  1.00 2.59  ? 315  PHE B CZ  1 
ATOM   6606  N N   . VAL B 1 316 ? 93.743  28.275  31.365  1.00 2.73  ? 316  VAL B N   1 
ATOM   6607  C CA  . VAL B 1 316 ? 94.354  27.018  30.893  1.00 2.65  ? 316  VAL B CA  1 
ATOM   6608  C C   . VAL B 1 316 ? 93.483  25.857  31.407  1.00 3.54  ? 316  VAL B C   1 
ATOM   6609  O O   . VAL B 1 316 ? 93.278  24.848  30.741  1.00 4.27  ? 316  VAL B O   1 
ATOM   6610  C CB  . VAL B 1 316 ? 95.794  26.940  31.424  1.00 3.89  ? 316  VAL B CB  1 
ATOM   6611  C CG1 . VAL B 1 316 ? 96.513  25.714  30.907  1.00 2.60  ? 316  VAL B CG1 1 
ATOM   6612  C CG2 . VAL B 1 316 ? 96.568  28.209  30.945  1.00 2.08  ? 316  VAL B CG2 1 
ATOM   6613  N N   . ASN B 1 317 ? 93.081  26.037  32.652  1.00 3.67  ? 317  ASN B N   1 
ATOM   6614  C CA  . ASN B 1 317 ? 92.154  25.171  33.335  1.00 3.23  ? 317  ASN B CA  1 
ATOM   6615  C C   . ASN B 1 317 ? 90.844  25.978  33.539  1.00 3.28  ? 317  ASN B C   1 
ATOM   6616  O O   . ASN B 1 317 ? 90.784  27.067  34.091  1.00 2.11  ? 317  ASN B O   1 
ATOM   6617  C CB  . ASN B 1 317 ? 92.592  24.647  34.687  1.00 3.14  ? 317  ASN B CB  1 
ATOM   6618  C CG  . ASN B 1 317 ? 93.906  23.854  34.701  1.00 4.32  ? 317  ASN B CG  1 
ATOM   6619  O OD1 . ASN B 1 317 ? 94.326  23.274  33.699  1.00 2.65  ? 317  ASN B OD1 1 
ATOM   6620  N ND2 . ASN B 1 317 ? 94.521  23.881  35.870  1.00 4.16  ? 317  ASN B ND2 1 
ATOM   6621  N N   . PHE B 1 318 ? 89.776  25.414  33.032  1.00 4.13  ? 318  PHE B N   1 
ATOM   6622  C CA  . PHE B 1 318 ? 88.417  25.942  33.255  1.00 3.96  ? 318  PHE B CA  1 
ATOM   6623  C C   . PHE B 1 318 ? 88.143  27.288  32.624  1.00 2.89  ? 318  PHE B C   1 
ATOM   6624  O O   . PHE B 1 318 ? 87.414  28.136  33.151  1.00 3.70  ? 318  PHE B O   1 
ATOM   6625  C CB  . PHE B 1 318 ? 88.103  25.903  34.756  1.00 3.53  ? 318  PHE B CB  1 
ATOM   6626  C CG  . PHE B 1 318 ? 88.301  24.549  35.387  1.00 4.65  ? 318  PHE B CG  1 
ATOM   6627  C CD1 . PHE B 1 318 ? 87.428  23.515  35.062  1.00 4.74  ? 318  PHE B CD1 1 
ATOM   6628  C CD2 . PHE B 1 318 ? 89.356  24.288  36.253  1.00 3.97  ? 318  PHE B CD2 1 
ATOM   6629  C CE1 . PHE B 1 318 ? 87.592  22.253  35.619  1.00 5.69  ? 318  PHE B CE1 1 
ATOM   6630  C CE2 . PHE B 1 318 ? 89.509  23.047  36.814  1.00 5.62  ? 318  PHE B CE2 1 
ATOM   6631  C CZ  . PHE B 1 318 ? 88.640  22.017  36.474  1.00 5.37  ? 318  PHE B CZ  1 
ATOM   6632  N N   . GLY B 1 319 ? 88.748  27.515  31.465  1.00 3.97  ? 319  GLY B N   1 
ATOM   6633  C CA  . GLY B 1 319 ? 88.594  28.739  30.683  1.00 3.78  ? 319  GLY B CA  1 
ATOM   6634  C C   . GLY B 1 319 ? 88.698  28.404  29.212  1.00 3.50  ? 319  GLY B C   1 
ATOM   6635  O O   . GLY B 1 319 ? 88.741  27.191  28.926  1.00 3.59  ? 319  GLY B O   1 
ATOM   6636  N N   . ILE B 1 320 ? 88.692  29.359  28.291  1.00 2.46  ? 320  ILE B N   1 
ATOM   6637  C CA  . ILE B 1 320 ? 88.660  29.070  26.870  1.00 3.72  ? 320  ILE B CA  1 
ATOM   6638  C C   . ILE B 1 320 ? 89.800  28.242  26.288  1.00 4.12  ? 320  ILE B C   1 
ATOM   6639  O O   . ILE B 1 320 ? 89.588  27.562  25.259  1.00 3.50  ? 320  ILE B O   1 
ATOM   6640  C CB  . ILE B 1 320 ? 88.407  30.320  26.001  1.00 3.98  ? 320  ILE B CB  1 
ATOM   6641  C CG1 . ILE B 1 320 ? 89.397  31.479  26.210  1.00 5.22  ? 320  ILE B CG1 1 
ATOM   6642  C CG2 . ILE B 1 320 ? 86.995  30.834  26.329  1.00 3.97  ? 320  ILE B CG2 1 
ATOM   6643  C CD1 . ILE B 1 320 ? 89.280  32.484  25.052  1.00 2.08  ? 320  ILE B CD1 1 
ATOM   6644  N N   . SER B 1 321 ? 90.990  28.308  26.844  1.00 3.10  ? 321  SER B N   1 
ATOM   6645  C CA  . SER B 1 321 ? 92.133  27.508  26.374  1.00 2.99  ? 321  SER B CA  1 
ATOM   6646  C C   . SER B 1 321 ? 91.781  26.025  26.611  1.00 2.08  ? 321  SER B C   1 
ATOM   6647  O O   . SER B 1 321 ? 91.834  25.239  25.686  1.00 2.20  ? 321  SER B O   1 
ATOM   6648  C CB  . SER B 1 321 ? 93.354  27.895  27.210  1.00 2.24  ? 321  SER B CB  1 
ATOM   6649  O OG  . SER B 1 321 ? 94.401  26.967  27.178  1.00 2.14  ? 321  SER B OG  1 
ATOM   6650  N N   . HIS B 1 322 ? 91.344  25.685  27.809  1.00 2.37  ? 322  HIS B N   1 
ATOM   6651  C CA  . HIS B 1 322 ? 90.880  24.331  28.152  1.00 3.04  ? 322  HIS B CA  1 
ATOM   6652  C C   . HIS B 1 322 ? 89.835  23.815  27.174  1.00 3.80  ? 322  HIS B C   1 
ATOM   6653  O O   . HIS B 1 322 ? 89.910  22.730  26.578  1.00 3.07  ? 322  HIS B O   1 
ATOM   6654  C CB  . HIS B 1 322 ? 90.270  24.284  29.545  1.00 3.87  ? 322  HIS B CB  1 
ATOM   6655  C CG  . HIS B 1 322 ? 90.176  22.949  30.234  1.00 2.08  ? 322  HIS B CG  1 
ATOM   6656  N ND1 . HIS B 1 322 ? 89.946  22.922  31.578  1.00 3.59  ? 322  HIS B ND1 1 
ATOM   6657  C CD2 . HIS B 1 322 ? 90.231  21.646  29.834  1.00 2.11  ? 322  HIS B CD2 1 
ATOM   6658  C CE1 . HIS B 1 322 ? 89.872  21.691  32.029  1.00 4.05  ? 322  HIS B CE1 1 
ATOM   6659  N NE2 . HIS B 1 322 ? 90.066  20.873  30.994  1.00 2.64  ? 322  HIS B NE2 1 
ATOM   6660  N N   . TYR B 1 323 ? 88.808  24.646  26.996  1.00 3.20  ? 323  TYR B N   1 
ATOM   6661  C CA  . TYR B 1 323 ? 87.682  24.402  26.091  1.00 3.18  ? 323  TYR B CA  1 
ATOM   6662  C C   . TYR B 1 323 ? 88.104  24.196  24.656  1.00 3.33  ? 323  TYR B C   1 
ATOM   6663  O O   . TYR B 1 323 ? 87.890  23.073  24.142  1.00 2.46  ? 323  TYR B O   1 
ATOM   6664  C CB  . TYR B 1 323 ? 86.766  25.583  26.221  1.00 3.70  ? 323  TYR B CB  1 
ATOM   6665  C CG  . TYR B 1 323 ? 85.432  25.793  25.614  1.00 2.19  ? 323  TYR B CG  1 
ATOM   6666  C CD1 . TYR B 1 323 ? 84.314  25.223  26.242  1.00 3.27  ? 323  TYR B CD1 1 
ATOM   6667  C CD2 . TYR B 1 323 ? 85.237  26.620  24.515  1.00 2.10  ? 323  TYR B CD2 1 
ATOM   6668  C CE1 . TYR B 1 323 ? 83.040  25.439  25.765  1.00 4.15  ? 323  TYR B CE1 1 
ATOM   6669  C CE2 . TYR B 1 323 ? 83.947  26.840  24.020  1.00 2.60  ? 323  TYR B CE2 1 
ATOM   6670  C CZ  . TYR B 1 323 ? 82.860  26.251  24.680  1.00 2.76  ? 323  TYR B CZ  1 
ATOM   6671  O OH  . TYR B 1 323 ? 81.588  26.477  24.216  1.00 3.82  ? 323  TYR B OH  1 
ATOM   6672  N N   . PHE B 1 324 ? 88.779  25.162  23.973  1.00 2.08  ? 324  PHE B N   1 
ATOM   6673  C CA  . PHE B 1 324 ? 89.193  24.906  22.606  1.00 3.42  ? 324  PHE B CA  1 
ATOM   6674  C C   . PHE B 1 324 ? 90.281  23.806  22.465  1.00 3.71  ? 324  PHE B C   1 
ATOM   6675  O O   . PHE B 1 324 ? 90.269  23.091  21.434  1.00 2.08  ? 324  PHE B O   1 
ATOM   6676  C CB  . PHE B 1 324 ? 89.609  26.167  21.838  1.00 4.50  ? 324  PHE B CB  1 
ATOM   6677  C CG  . PHE B 1 324 ? 88.366  27.029  21.590  1.00 4.69  ? 324  PHE B CG  1 
ATOM   6678  C CD1 . PHE B 1 324 ? 87.575  26.775  20.501  1.00 4.36  ? 324  PHE B CD1 1 
ATOM   6679  C CD2 . PHE B 1 324 ? 88.058  28.041  22.480  1.00 4.63  ? 324  PHE B CD2 1 
ATOM   6680  C CE1 . PHE B 1 324 ? 86.416  27.538  20.292  1.00 6.99  ? 324  PHE B CE1 1 
ATOM   6681  C CE2 . PHE B 1 324 ? 86.906  28.811  22.275  1.00 5.23  ? 324  PHE B CE2 1 
ATOM   6682  C CZ  . PHE B 1 324 ? 86.105  28.553  21.195  1.00 3.99  ? 324  PHE B CZ  1 
ATOM   6683  N N   . ARG B 1 325 ? 91.115  23.656  23.479  1.00 2.08  ? 325  ARG B N   1 
ATOM   6684  C CA  . ARG B 1 325 ? 92.148  22.626  23.421  1.00 5.00  ? 325  ARG B CA  1 
ATOM   6685  C C   . ARG B 1 325 ? 91.500  21.231  23.270  1.00 4.15  ? 325  ARG B C   1 
ATOM   6686  O O   . ARG B 1 325 ? 91.817  20.503  22.348  1.00 3.10  ? 325  ARG B O   1 
ATOM   6687  C CB  . ARG B 1 325 ? 93.073  22.637  24.619  1.00 3.62  ? 325  ARG B CB  1 
ATOM   6688  C CG  . ARG B 1 325 ? 94.220  21.616  24.670  1.00 2.60  ? 325  ARG B CG  1 
ATOM   6689  C CD  . ARG B 1 325 ? 95.065  21.818  25.911  1.00 3.86  ? 325  ARG B CD  1 
ATOM   6690  N NE  . ARG B 1 325 ? 94.439  21.581  27.192  1.00 3.11  ? 325  ARG B NE  1 
ATOM   6691  C CZ  . ARG B 1 325 ? 94.075  20.381  27.672  1.00 3.16  ? 325  ARG B CZ  1 
ATOM   6692  N NH1 . ARG B 1 325 ? 94.290  19.299  26.933  1.00 2.08  ? 325  ARG B NH1 1 
ATOM   6693  N NH2 . ARG B 1 325 ? 93.541  20.270  28.859  1.00 3.64  ? 325  ARG B NH2 1 
ATOM   6694  N N   . LEU B 1 326 ? 90.542  20.925  24.136  1.00 4.23  ? 326  LEU B N   1 
ATOM   6695  C CA  . LEU B 1 326 ? 89.849  19.637  24.172  1.00 4.38  ? 326  LEU B CA  1 
ATOM   6696  C C   . LEU B 1 326 ? 88.908  19.403  23.038  1.00 4.85  ? 326  LEU B C   1 
ATOM   6697  O O   . LEU B 1 326 ? 88.846  18.274  22.489  1.00 3.17  ? 326  LEU B O   1 
ATOM   6698  C CB  . LEU B 1 326 ? 89.178  19.455  25.520  1.00 3.69  ? 326  LEU B CB  1 
ATOM   6699  C CG  . LEU B 1 326 ? 90.075  19.194  26.727  1.00 3.35  ? 326  LEU B CG  1 
ATOM   6700  C CD1 . LEU B 1 326 ? 89.216  18.987  27.949  1.00 3.96  ? 326  LEU B CD1 1 
ATOM   6701  C CD2 . LEU B 1 326 ? 91.007  18.000  26.522  1.00 3.22  ? 326  LEU B CD2 1 
ATOM   6702  N N   . ILE B 1 327 ? 88.361  20.480  22.431  1.00 2.31  ? 327  ILE B N   1 
ATOM   6703  C CA  . ILE B 1 327 ? 87.514  20.357  21.253  1.00 2.22  ? 327  ILE B CA  1 
ATOM   6704  C C   . ILE B 1 327 ? 88.307  19.743  20.123  1.00 3.38  ? 327  ILE B C   1 
ATOM   6705  O O   . ILE B 1 327 ? 87.759  19.106  19.206  1.00 3.75  ? 327  ILE B O   1 
ATOM   6706  C CB  . ILE B 1 327 ? 86.843  21.694  20.863  1.00 3.81  ? 327  ILE B CB  1 
ATOM   6707  C CG1 . ILE B 1 327 ? 85.720  21.945  21.881  1.00 4.71  ? 327  ILE B CG1 1 
ATOM   6708  C CG2 . ILE B 1 327 ? 86.208  21.718  19.491  1.00 4.70  ? 327  ILE B CG2 1 
ATOM   6709  C CD1 . ILE B 1 327 ? 85.251  23.382  22.022  1.00 2.08  ? 327  ILE B CD1 1 
ATOM   6710  N N   . GLY B 1 328 ? 89.652  19.984  20.111  1.00 2.32  ? 328  GLY B N   1 
ATOM   6711  C CA  . GLY B 1 328 ? 90.457  19.311  19.059  1.00 2.89  ? 328  GLY B CA  1 
ATOM   6712  C C   . GLY B 1 328 ? 91.067  18.009  19.642  1.00 2.19  ? 328  GLY B C   1 
ATOM   6713  O O   . GLY B 1 328 ? 91.069  16.989  18.977  1.00 3.00  ? 328  GLY B O   1 
ATOM   6714  N N   . ALA B 1 329 ? 91.630  18.081  20.849  1.00 2.74  ? 329  ALA B N   1 
ATOM   6715  C CA  . ALA B 1 329 ? 92.339  16.955  21.427  1.00 4.00  ? 329  ALA B CA  1 
ATOM   6716  C C   . ALA B 1 329 ? 91.533  15.664  21.604  1.00 5.41  ? 329  ALA B C   1 
ATOM   6717  O O   . ALA B 1 329 ? 92.071  14.539  21.606  1.00 3.56  ? 329  ALA B O   1 
ATOM   6718  C CB  . ALA B 1 329 ? 92.942  17.303  22.783  1.00 2.82  ? 329  ALA B CB  1 
ATOM   6719  N N   . ALA B 1 330 ? 90.229  15.841  21.885  1.00 2.80  ? 330  ALA B N   1 
ATOM   6720  C CA  . ALA B 1 330 ? 89.313  14.737  22.079  1.00 2.82  ? 330  ALA B CA  1 
ATOM   6721  C C   . ALA B 1 330 ? 89.061  13.949  20.795  1.00 2.19  ? 330  ALA B C   1 
ATOM   6722  O O   . ALA B 1 330 ? 88.486  12.866  20.898  1.00 3.26  ? 330  ALA B O   1 
ATOM   6723  C CB  . ALA B 1 330 ? 87.954  15.203  22.604  1.00 4.22  ? 330  ALA B CB  1 
ATOM   6724  N N   . GLU B 1 331 ? 89.562  14.343  19.637  1.00 2.08  ? 331  GLU B N   1 
ATOM   6725  C CA  . GLU B 1 331 ? 89.527  13.613  18.380  1.00 3.50  ? 331  GLU B CA  1 
ATOM   6726  C C   . GLU B 1 331 ? 90.400  12.344  18.511  1.00 3.64  ? 331  GLU B C   1 
ATOM   6727  O O   . GLU B 1 331 ? 90.297  11.383  17.745  1.00 3.86  ? 331  GLU B O   1 
ATOM   6728  C CB  . GLU B 1 331 ? 90.013  14.458  17.212  1.00 4.31  ? 331  GLU B CB  1 
ATOM   6729  C CG  . GLU B 1 331 ? 90.331  13.722  15.903  1.00 5.33  ? 331  GLU B CG  1 
ATOM   6730  C CD  . GLU B 1 331 ? 89.106  13.038  15.281  1.00 4.37  ? 331  GLU B CD  1 
ATOM   6731  O OE1 . GLU B 1 331 ? 87.967  13.353  15.704  1.00 3.69  ? 331  GLU B OE1 1 
ATOM   6732  O OE2 . GLU B 1 331 ? 89.188  12.231  14.343  1.00 3.10  ? 331  GLU B OE2 1 
ATOM   6733  N N   . LEU B 1 332 ? 91.227  12.284  19.564  1.00 3.26  ? 332  LEU B N   1 
ATOM   6734  C CA  . LEU B 1 332 ? 92.091  11.148  19.838  1.00 3.26  ? 332  LEU B CA  1 
ATOM   6735  C C   . LEU B 1 332 ? 91.292  9.846   19.981  1.00 4.12  ? 332  LEU B C   1 
ATOM   6736  O O   . LEU B 1 332 ? 91.784  8.742   19.728  1.00 2.85  ? 332  LEU B O   1 
ATOM   6737  C CB  . LEU B 1 332 ? 92.908  11.378  21.088  1.00 3.47  ? 332  LEU B CB  1 
ATOM   6738  C CG  . LEU B 1 332 ? 94.065  10.362  21.209  1.00 3.97  ? 332  LEU B CG  1 
ATOM   6739  C CD1 . LEU B 1 332 ? 95.014  10.404  20.028  1.00 3.36  ? 332  LEU B CD1 1 
ATOM   6740  C CD2 . LEU B 1 332 ? 94.817  10.595  22.514  1.00 3.22  ? 332  LEU B CD2 1 
ATOM   6741  N N   . ALA B 1 333 ? 90.021  9.932   20.390  1.00 3.42  ? 333  ALA B N   1 
ATOM   6742  C CA  . ALA B 1 333 ? 89.092  8.807   20.380  1.00 2.08  ? 333  ALA B CA  1 
ATOM   6743  C C   . ALA B 1 333 ? 89.013  8.108   19.046  1.00 2.74  ? 333  ALA B C   1 
ATOM   6744  O O   . ALA B 1 333 ? 88.607  6.908   18.964  1.00 4.25  ? 333  ALA B O   1 
ATOM   6745  C CB  . ALA B 1 333 ? 87.680  9.277   20.784  1.00 2.22  ? 333  ALA B CB  1 
ATOM   6746  N N   . GLN B 1 334 ? 89.355  8.707   17.925  1.00 3.94  ? 334  GLN B N   1 
ATOM   6747  C CA  . GLN B 1 334 ? 89.359  8.147   16.605  1.00 4.00  ? 334  GLN B CA  1 
ATOM   6748  C C   . GLN B 1 334 ? 90.347  6.969   16.475  1.00 3.69  ? 334  GLN B C   1 
ATOM   6749  O O   . GLN B 1 334 ? 90.114  6.130   15.620  1.00 2.53  ? 334  GLN B O   1 
ATOM   6750  C CB  . GLN B 1 334 ? 89.679  9.160   15.535  1.00 4.34  ? 334  GLN B CB  1 
ATOM   6751  C CG  . GLN B 1 334 ? 89.224  8.827   14.129  1.00 4.51  ? 334  GLN B CG  1 
ATOM   6752  C CD  . GLN B 1 334 ? 87.697  8.912   14.084  1.00 7.36  ? 334  GLN B CD  1 
ATOM   6753  O OE1 . GLN B 1 334 ? 87.044  7.874   14.218  1.00 7.27  ? 334  GLN B OE1 1 
ATOM   6754  N NE2 . GLN B 1 334 ? 87.118  10.104  13.903  1.00 4.63  ? 334  GLN B NE2 1 
ATOM   6755  N N   . ARG B 1 335 ? 91.355  6.866   17.324  1.00 3.68  ? 335  ARG B N   1 
ATOM   6756  C CA  . ARG B 1 335 ? 92.276  5.735   17.222  1.00 5.47  ? 335  ARG B CA  1 
ATOM   6757  C C   . ARG B 1 335 ? 91.507  4.486   17.673  1.00 5.06  ? 335  ARG B C   1 
ATOM   6758  O O   . ARG B 1 335 ? 91.668  3.452   17.021  1.00 4.85  ? 335  ARG B O   1 
ATOM   6759  C CB  . ARG B 1 335 ? 93.556  5.969   18.028  1.00 5.10  ? 335  ARG B CB  1 
ATOM   6760  C CG  . ARG B 1 335 ? 94.470  4.733   18.028  1.00 6.96  ? 335  ARG B CG  1 
ATOM   6761  C CD  . ARG B 1 335 ? 95.864  5.009   17.543  1.00 6.58  ? 335  ARG B CD  1 
ATOM   6762  N NE  . ARG B 1 335 ? 96.410  6.332   17.894  1.00 3.26  ? 335  ARG B NE  1 
ATOM   6763  C CZ  . ARG B 1 335 ? 96.951  7.080   16.959  1.00 2.65  ? 335  ARG B CZ  1 
ATOM   6764  N NH1 . ARG B 1 335 ? 97.029  6.764   15.702  1.00 2.51  ? 335  ARG B NH1 1 
ATOM   6765  N NH2 . ARG B 1 335 ? 97.423  8.330   17.228  1.00 4.09  ? 335  ARG B NH2 1 
ATOM   6766  N N   . SER B 1 336 ? 90.682  4.603   18.704  1.00 4.69  ? 336  SER B N   1 
ATOM   6767  C CA  . SER B 1 336 ? 89.926  3.466   19.222  1.00 5.19  ? 336  SER B CA  1 
ATOM   6768  C C   . SER B 1 336 ? 88.863  3.072   18.217  1.00 5.55  ? 336  SER B C   1 
ATOM   6769  O O   . SER B 1 336 ? 88.646  1.892   17.920  1.00 5.14  ? 336  SER B O   1 
ATOM   6770  C CB  . SER B 1 336 ? 89.290  3.788   20.558  1.00 5.31  ? 336  SER B CB  1 
ATOM   6771  O OG  . SER B 1 336 ? 90.280  4.072   21.549  1.00 7.67  ? 336  SER B OG  1 
ATOM   6772  N N   . SER B 1 337 ? 88.177  4.086   17.654  1.00 4.17  ? 337  SER B N   1 
ATOM   6773  C CA  . SER B 1 337 ? 87.199  3.834   16.601  1.00 4.58  ? 337  SER B CA  1 
ATOM   6774  C C   . SER B 1 337 ? 87.848  3.039   15.470  1.00 6.77  ? 337  SER B C   1 
ATOM   6775  O O   . SER B 1 337 ? 87.217  2.115   14.925  1.00 4.46  ? 337  SER B O   1 
ATOM   6776  C CB  . SER B 1 337 ? 86.622  5.174   16.129  1.00 5.19  ? 337  SER B CB  1 
ATOM   6777  O OG  . SER B 1 337 ? 86.145  5.157   14.795  1.00 7.30  ? 337  SER B OG  1 
ATOM   6778  N N   . TRP B 1 338 ? 89.075  3.401   15.044  1.00 5.93  ? 338  TRP B N   1 
ATOM   6779  C CA  . TRP B 1 338 ? 89.770  2.707   13.980  1.00 5.15  ? 338  TRP B CA  1 
ATOM   6780  C C   . TRP B 1 338 ? 90.037  1.246   14.374  1.00 4.63  ? 338  TRP B C   1 
ATOM   6781  O O   . TRP B 1 338 ? 89.898  0.350   13.535  1.00 5.19  ? 338  TRP B O   1 
ATOM   6782  C CB  . TRP B 1 338 ? 91.043  3.470   13.535  1.00 4.36  ? 338  TRP B CB  1 
ATOM   6783  C CG  . TRP B 1 338 ? 90.912  3.902   12.107  1.00 4.09  ? 338  TRP B CG  1 
ATOM   6784  C CD1 . TRP B 1 338 ? 91.664  3.543   11.054  1.00 2.08  ? 338  TRP B CD1 1 
ATOM   6785  C CD2 . TRP B 1 338 ? 89.900  4.793   11.573  1.00 4.51  ? 338  TRP B CD2 1 
ATOM   6786  N NE1 . TRP B 1 338 ? 91.190  4.106   9.878   1.00 4.31  ? 338  TRP B NE1 1 
ATOM   6787  C CE2 . TRP B 1 338 ? 90.091  4.889   10.202  1.00 4.24  ? 338  TRP B CE2 1 
ATOM   6788  C CE3 . TRP B 1 338 ? 88.846  5.508   12.167  1.00 3.61  ? 338  TRP B CE3 1 
ATOM   6789  C CZ2 . TRP B 1 338 ? 89.267  5.672   9.364   1.00 3.89  ? 338  TRP B CZ2 1 
ATOM   6790  C CZ3 . TRP B 1 338 ? 88.033  6.274   11.353  1.00 2.08  ? 338  TRP B CZ3 1 
ATOM   6791  C CH2 . TRP B 1 338 ? 88.227  6.351   9.980   1.00 2.18  ? 338  TRP B CH2 1 
ATOM   6792  N N   . TYR B 1 339 ? 90.391  0.982   15.614  1.00 4.71  ? 339  TYR B N   1 
ATOM   6793  C CA  . TYR B 1 339 ? 90.666  -0.375  16.072  1.00 6.23  ? 339  TYR B CA  1 
ATOM   6794  C C   . TYR B 1 339 ? 89.345  -1.181  15.948  1.00 7.44  ? 339  TYR B C   1 
ATOM   6795  O O   . TYR B 1 339 ? 89.390  -2.265  15.403  1.00 6.43  ? 339  TYR B O   1 
ATOM   6796  C CB  . TYR B 1 339 ? 91.087  -0.477  17.512  1.00 4.82  ? 339  TYR B CB  1 
ATOM   6797  C CG  . TYR B 1 339 ? 91.563  -1.784  18.115  1.00 5.48  ? 339  TYR B CG  1 
ATOM   6798  C CD1 . TYR B 1 339 ? 92.689  -2.480  17.670  1.00 4.76  ? 339  TYR B CD1 1 
ATOM   6799  C CD2 . TYR B 1 339 ? 90.942  -2.266  19.237  1.00 4.40  ? 339  TYR B CD2 1 
ATOM   6800  C CE1 . TYR B 1 339 ? 93.127  -3.643  18.314  1.00 4.67  ? 339  TYR B CE1 1 
ATOM   6801  C CE2 . TYR B 1 339 ? 91.343  -3.411  19.902  1.00 6.43  ? 339  TYR B CE2 1 
ATOM   6802  C CZ  . TYR B 1 339 ? 92.451  -4.110  19.402  1.00 6.15  ? 339  TYR B CZ  1 
ATOM   6803  O OH  . TYR B 1 339 ? 92.824  -5.226  20.132  1.00 6.70  ? 339  TYR B OH  1 
ATOM   6804  N N   . GLN B 1 340 ? 88.260  -0.610  16.475  1.00 6.17  ? 340  GLN B N   1 
ATOM   6805  C CA  . GLN B 1 340 ? 86.983  -1.305  16.398  1.00 6.41  ? 340  GLN B CA  1 
ATOM   6806  C C   . GLN B 1 340 ? 86.527  -1.557  14.981  1.00 5.30  ? 340  GLN B C   1 
ATOM   6807  O O   . GLN B 1 340 ? 86.026  -2.669  14.709  1.00 3.87  ? 340  GLN B O   1 
ATOM   6808  C CB  . GLN B 1 340 ? 85.893  -0.567  17.178  1.00 5.03  ? 340  GLN B CB  1 
ATOM   6809  C CG  . GLN B 1 340 ? 86.081  -0.494  18.666  1.00 2.08  ? 340  GLN B CG  1 
ATOM   6810  C CD  . GLN B 1 340 ? 86.200  -1.838  19.351  1.00 3.18  ? 340  GLN B CD  1 
ATOM   6811  O OE1 . GLN B 1 340 ? 85.597  -2.802  18.835  1.00 2.60  ? 340  GLN B OE1 1 
ATOM   6812  N NE2 . GLN B 1 340 ? 86.896  -1.864  20.455  1.00 3.47  ? 340  GLN B NE2 1 
ATOM   6813  N N   . LYS B 1 341 ? 86.728  -0.626  14.056  1.00 4.37  ? 341  LYS B N   1 
ATOM   6814  C CA  . LYS B 1 341 ? 86.353  -0.781  12.684  1.00 4.23  ? 341  LYS B CA  1 
ATOM   6815  C C   . LYS B 1 341 ? 87.107  -1.933  11.991  1.00 5.77  ? 341  LYS B C   1 
ATOM   6816  O O   . LYS B 1 341 ? 86.486  -2.762  11.329  1.00 4.82  ? 341  LYS B O   1 
ATOM   6817  C CB  . LYS B 1 341 ? 86.666  0.474   11.846  1.00 7.04  ? 341  LYS B CB  1 
ATOM   6818  C CG  . LYS B 1 341 ? 85.742  1.684   12.103  1.00 7.64  ? 341  LYS B CG  1 
ATOM   6819  C CD  . LYS B 1 341 ? 86.260  2.824   11.205  1.00 9.71  ? 341  LYS B CD  1 
ATOM   6820  C CE  . LYS B 1 341 ? 85.379  4.057   11.301  1.00 9.64  ? 341  LYS B CE  1 
ATOM   6821  N NZ  . LYS B 1 341 ? 84.142  3.897   10.475  1.00 9.20  ? 341  LYS B NZ  1 
ATOM   6822  N N   . TRP B 1 342 ? 88.438  -1.862  12.008  1.00 4.73  ? 342  TRP B N   1 
ATOM   6823  C CA  . TRP B 1 342 ? 89.267  -2.753  11.238  1.00 5.84  ? 342  TRP B CA  1 
ATOM   6824  C C   . TRP B 1 342 ? 89.689  -4.007  11.983  1.00 5.84  ? 342  TRP B C   1 
ATOM   6825  O O   . TRP B 1 342 ? 89.493  -5.112  11.454  1.00 8.59  ? 342  TRP B O   1 
ATOM   6826  C CB  . TRP B 1 342 ? 90.568  -2.098  10.760  1.00 4.67  ? 342  TRP B CB  1 
ATOM   6827  C CG  . TRP B 1 342 ? 90.446  -0.977  9.789   1.00 3.84  ? 342  TRP B CG  1 
ATOM   6828  C CD1 . TRP B 1 342 ? 90.517  0.364   10.134  1.00 3.09  ? 342  TRP B CD1 1 
ATOM   6829  C CD2 . TRP B 1 342 ? 90.348  -1.003  8.364   1.00 4.02  ? 342  TRP B CD2 1 
ATOM   6830  N NE1 . TRP B 1 342 ? 90.408  1.136   9.003   1.00 3.35  ? 342  TRP B NE1 1 
ATOM   6831  C CE2 . TRP B 1 342 ? 90.321  0.320   7.906   1.00 3.65  ? 342  TRP B CE2 1 
ATOM   6832  C CE3 . TRP B 1 342 ? 90.250  -2.048  7.435   1.00 3.72  ? 342  TRP B CE3 1 
ATOM   6833  C CZ2 . TRP B 1 342 ? 90.230  0.647   6.568   1.00 4.19  ? 342  TRP B CZ2 1 
ATOM   6834  C CZ3 . TRP B 1 342 ? 90.158  -1.700  6.126   1.00 2.70  ? 342  TRP B CZ3 1 
ATOM   6835  C CH2 . TRP B 1 342 ? 90.150  -0.387  5.648   1.00 3.90  ? 342  TRP B CH2 1 
ATOM   6836  N N   . GLN B 1 343 ? 90.257  -3.850  13.153  1.00 6.07  ? 343  GLN B N   1 
ATOM   6837  C CA  . GLN B 1 343 ? 90.777  -4.984  13.883  1.00 6.67  ? 343  GLN B CA  1 
ATOM   6838  C C   . GLN B 1 343 ? 89.690  -5.798  14.564  1.00 9.33  ? 343  GLN B C   1 
ATOM   6839  O O   . GLN B 1 343 ? 89.982  -6.986  14.812  1.00 9.51  ? 343  GLN B O   1 
ATOM   6840  C CB  . GLN B 1 343 ? 91.849  -4.509  14.885  1.00 6.22  ? 343  GLN B CB  1 
ATOM   6841  C CG  . GLN B 1 343 ? 93.176  -4.113  14.246  1.00 5.62  ? 343  GLN B CG  1 
ATOM   6842  C CD  . GLN B 1 343 ? 93.201  -2.864  13.405  1.00 6.53  ? 343  GLN B CD  1 
ATOM   6843  O OE1 . GLN B 1 343 ? 92.521  -1.882  13.750  1.00 4.84  ? 343  GLN B OE1 1 
ATOM   6844  N NE2 . GLN B 1 343 ? 93.966  -2.833  12.315  1.00 4.09  ? 343  GLN B NE2 1 
ATOM   6845  N N   . VAL B 1 344 ? 88.549  -5.210  14.952  1.00 7.62  ? 344  VAL B N   1 
ATOM   6846  C CA  . VAL B 1 344 ? 87.570  -6.004  15.710  1.00 6.95  ? 344  VAL B CA  1 
ATOM   6847  C C   . VAL B 1 344 ? 86.333  -6.480  14.941  1.00 9.51  ? 344  VAL B C   1 
ATOM   6848  O O   . VAL B 1 344 ? 86.095  -7.700  14.798  1.00 7.09  ? 344  VAL B O   1 
ATOM   6849  C CB  . VAL B 1 344 ? 87.113  -5.286  16.978  1.00 4.95  ? 344  VAL B CB  1 
ATOM   6850  C CG1 . VAL B 1 344 ? 86.140  -6.118  17.825  1.00 5.22  ? 344  VAL B CG1 1 
ATOM   6851  C CG2 . VAL B 1 344 ? 88.272  -4.909  17.905  1.00 4.96  ? 344  VAL B CG2 1 
ATOM   6852  N N   . HIS B 1 345 ? 85.499  -5.543  14.428  1.00 7.46  ? 345  HIS B N   1 
ATOM   6853  C CA  . HIS B 1 345 ? 84.233  -5.972  13.824  1.00 8.38  ? 345  HIS B CA  1 
ATOM   6854  C C   . HIS B 1 345 ? 84.220  -6.067  12.319  1.00 8.78  ? 345  HIS B C   1 
ATOM   6855  O O   . HIS B 1 345 ? 83.533  -6.927  11.783  1.00 7.64  ? 345  HIS B O   1 
ATOM   6856  C CB  . HIS B 1 345 ? 83.104  -5.029  14.292  1.00 6.09  ? 345  HIS B CB  1 
ATOM   6857  C CG  . HIS B 1 345 ? 83.061  -4.964  15.779  1.00 5.56  ? 345  HIS B CG  1 
ATOM   6858  N ND1 . HIS B 1 345 ? 82.315  -5.880  16.497  1.00 5.77  ? 345  HIS B ND1 1 
ATOM   6859  C CD2 . HIS B 1 345 ? 83.644  -4.161  16.696  1.00 4.75  ? 345  HIS B CD2 1 
ATOM   6860  C CE1 . HIS B 1 345 ? 82.431  -5.651  17.786  1.00 3.53  ? 345  HIS B CE1 1 
ATOM   6861  N NE2 . HIS B 1 345 ? 83.252  -4.615  17.942  1.00 2.89  ? 345  HIS B NE2 1 
ATOM   6862  N N   . ARG B 1 346 ? 84.943  -5.175  11.626  1.00 8.13  ? 346  ARG B N   1 
ATOM   6863  C CA  . ARG B 1 346 ? 85.054  -5.248  10.201  1.00 9.09  ? 346  ARG B CA  1 
ATOM   6864  C C   . ARG B 1 346 ? 83.707  -5.417  9.525   1.00 9.32  ? 346  ARG B C   1 
ATOM   6865  O O   . ARG B 1 346 ? 83.631  -6.218  8.593   1.00 9.71  ? 346  ARG B O   1 
ATOM   6866  C CB  . ARG B 1 346 ? 85.897  -6.524  9.868   1.00 11.86 ? 346  ARG B CB  1 
ATOM   6867  C CG  . ARG B 1 346 ? 87.320  -6.314  9.503   1.00 14.57 ? 346  ARG B CG  1 
ATOM   6868  C CD  . ARG B 1 346 ? 88.155  -7.548  9.179   1.00 16.54 ? 346  ARG B CD  1 
ATOM   6869  N NE  . ARG B 1 346 ? 88.019  -8.648  10.106  1.00 16.97 ? 346  ARG B NE  1 
ATOM   6870  C CZ  . ARG B 1 346 ? 88.317  -8.728  11.374  1.00 16.65 ? 346  ARG B CZ  1 
ATOM   6871  N NH1 . ARG B 1 346 ? 88.868  -7.715  12.010  1.00 18.38 ? 346  ARG B NH1 1 
ATOM   6872  N NH2 . ARG B 1 346 ? 88.084  -9.837  12.057  1.00 18.32 ? 346  ARG B NH2 1 
ATOM   6873  N N   . PHE B 1 347 ? 82.678  -4.656  9.852   1.00 9.36  ? 347  PHE B N   1 
ATOM   6874  C CA  . PHE B 1 347 ? 81.346  -4.858  9.279   1.00 8.55  ? 347  PHE B CA  1 
ATOM   6875  C C   . PHE B 1 347 ? 81.126  -4.165  7.971   1.00 6.00  ? 347  PHE B C   1 
ATOM   6876  O O   . PHE B 1 347 ? 81.654  -3.083  7.645   1.00 5.79  ? 347  PHE B O   1 
ATOM   6877  C CB  . PHE B 1 347 ? 80.283  -4.494  10.364  1.00 9.78  ? 347  PHE B CB  1 
ATOM   6878  C CG  . PHE B 1 347 ? 78.911  -5.055  10.074  1.00 10.08 ? 347  PHE B CG  1 
ATOM   6879  C CD1 . PHE B 1 347 ? 78.607  -6.378  10.357  1.00 10.42 ? 347  PHE B CD1 1 
ATOM   6880  C CD2 . PHE B 1 347 ? 77.924  -4.248  9.526   1.00 10.47 ? 347  PHE B CD2 1 
ATOM   6881  C CE1 . PHE B 1 347 ? 77.352  -6.913  10.085  1.00 9.62  ? 347  PHE B CE1 1 
ATOM   6882  C CE2 . PHE B 1 347 ? 76.666  -4.762  9.251   1.00 10.54 ? 347  PHE B CE2 1 
ATOM   6883  C CZ  . PHE B 1 347 ? 76.376  -6.093  9.527   1.00 9.37  ? 347  PHE B CZ  1 
ATOM   6884  N N   . ALA B 1 348 ? 80.354  -4.820  7.096   1.00 4.72  ? 348  ALA B N   1 
ATOM   6885  C CA  . ALA B 1 348 ? 80.006  -4.343  5.775   1.00 4.52  ? 348  ALA B CA  1 
ATOM   6886  C C   . ALA B 1 348 ? 79.135  -3.073  5.844   1.00 4.29  ? 348  ALA B C   1 
ATOM   6887  O O   . ALA B 1 348 ? 78.238  -2.936  6.689   1.00 3.95  ? 348  ALA B O   1 
ATOM   6888  C CB  . ALA B 1 348 ? 79.158  -5.378  5.016   1.00 4.38  ? 348  ALA B CB  1 
ATOM   6889  N N   . ARG B 1 349 ? 79.341  -2.202  4.866   1.00 3.94  ? 349  ARG B N   1 
ATOM   6890  C CA  . ARG B 1 349 ? 78.585  -0.960  4.808   1.00 4.76  ? 349  ARG B CA  1 
ATOM   6891  C C   . ARG B 1 349 ? 77.181  -1.264  4.243   1.00 5.80  ? 349  ARG B C   1 
ATOM   6892  O O   . ARG B 1 349 ? 76.986  -2.165  3.416   1.00 2.52  ? 349  ARG B O   1 
ATOM   6893  C CB  . ARG B 1 349 ? 79.261  0.056   3.893   1.00 3.13  ? 349  ARG B CB  1 
ATOM   6894  C CG  . ARG B 1 349 ? 80.583  0.596   4.461   1.00 4.88  ? 349  ARG B CG  1 
ATOM   6895  C CD  . ARG B 1 349 ? 80.302  1.827   5.324   1.00 4.14  ? 349  ARG B CD  1 
ATOM   6896  N NE  . ARG B 1 349 ? 81.550  2.370   5.843   1.00 5.57  ? 349  ARG B NE  1 
ATOM   6897  C CZ  . ARG B 1 349 ? 81.750  3.621   6.270   1.00 5.60  ? 349  ARG B CZ  1 
ATOM   6898  N NH1 . ARG B 1 349 ? 80.740  4.488   6.231   1.00 4.40  ? 349  ARG B NH1 1 
ATOM   6899  N NH2 . ARG B 1 349 ? 82.925  4.029   6.719   1.00 3.74  ? 349  ARG B NH2 1 
ATOM   6900  N N   . PRO B 1 350 ? 76.263  -0.328  4.480   1.00 5.07  ? 350  PRO B N   1 
ATOM   6901  C CA  . PRO B 1 350 ? 74.894  -0.467  4.044   1.00 5.24  ? 350  PRO B CA  1 
ATOM   6902  C C   . PRO B 1 350 ? 74.793  -0.653  2.542   1.00 6.33  ? 350  PRO B C   1 
ATOM   6903  O O   . PRO B 1 350 ? 73.981  -1.461  2.059   1.00 6.71  ? 350  PRO B O   1 
ATOM   6904  C CB  . PRO B 1 350 ? 74.194  0.791   4.564   1.00 4.68  ? 350  PRO B CB  1 
ATOM   6905  C CG  . PRO B 1 350 ? 75.014  1.219   5.736   1.00 4.97  ? 350  PRO B CG  1 
ATOM   6906  C CD  . PRO B 1 350 ? 76.440  0.837   5.414   1.00 4.11  ? 350  PRO B CD  1 
ATOM   6907  N N   . GLU B 1 351 ? 75.604  0.036   1.729   1.00 4.01  ? 351  GLU B N   1 
ATOM   6908  C CA  . GLU B 1 351 ? 75.584  -0.115  0.290   1.00 3.97  ? 351  GLU B CA  1 
ATOM   6909  C C   . GLU B 1 351 ? 75.994  -1.547  -0.089  1.00 3.58  ? 351  GLU B C   1 
ATOM   6910  O O   . GLU B 1 351 ? 75.576  -1.992  -1.167  1.00 4.32  ? 351  GLU B O   1 
ATOM   6911  C CB  . GLU B 1 351 ? 76.502  0.894   -0.428  1.00 4.88  ? 351  GLU B CB  1 
ATOM   6912  C CG  . GLU B 1 351 ? 77.994  0.625   -0.304  1.00 3.62  ? 351  GLU B CG  1 
ATOM   6913  C CD  . GLU B 1 351 ? 78.873  1.846   -0.508  1.00 5.20  ? 351  GLU B CD  1 
ATOM   6914  O OE1 . GLU B 1 351 ? 78.635  2.852   0.210   1.00 6.75  ? 351  GLU B OE1 1 
ATOM   6915  O OE2 . GLU B 1 351 ? 79.733  1.884   -1.398  1.00 3.65  ? 351  GLU B OE2 1 
ATOM   6916  N N   . ALA B 1 352 ? 76.838  -2.190  0.721   1.00 4.94  ? 352  ALA B N   1 
ATOM   6917  C CA  . ALA B 1 352 ? 77.307  -3.540  0.399   1.00 6.07  ? 352  ALA B CA  1 
ATOM   6918  C C   . ALA B 1 352 ? 76.193  -4.558  0.711   1.00 6.10  ? 352  ALA B C   1 
ATOM   6919  O O   . ALA B 1 352 ? 75.916  -5.336  -0.212  1.00 5.38  ? 352  ALA B O   1 
ATOM   6920  C CB  . ALA B 1 352 ? 78.592  -3.925  1.142   1.00 5.06  ? 352  ALA B CB  1 
ATOM   6921  N N   . LEU B 1 353 ? 75.533  -4.425  1.854   1.00 5.82  ? 353  LEU B N   1 
ATOM   6922  C CA  . LEU B 1 353 ? 74.378  -5.275  2.161   1.00 8.04  ? 353  LEU B CA  1 
ATOM   6923  C C   . LEU B 1 353 ? 73.220  -5.002  1.210   1.00 9.00  ? 353  LEU B C   1 
ATOM   6924  O O   . LEU B 1 353 ? 72.442  -5.899  0.851   1.00 8.49  ? 353  LEU B O   1 
ATOM   6925  C CB  . LEU B 1 353 ? 73.949  -5.107  3.619   1.00 6.66  ? 353  LEU B CB  1 
ATOM   6926  C CG  . LEU B 1 353 ? 74.952  -5.658  4.640   1.00 8.33  ? 353  LEU B CG  1 
ATOM   6927  C CD1 . LEU B 1 353 ? 74.262  -5.840  5.974   1.00 4.46  ? 353  LEU B CD1 1 
ATOM   6928  C CD2 . LEU B 1 353 ? 75.583  -6.970  4.151   1.00 6.11  ? 353  LEU B CD2 1 
ATOM   6929  N N   . GLY B 1 354 ? 73.136  -3.769  0.702   1.00 7.01  ? 354  GLY B N   1 
ATOM   6930  C CA  . GLY B 1 354 ? 72.163  -3.394  -0.302  1.00 7.01  ? 354  GLY B CA  1 
ATOM   6931  C C   . GLY B 1 354 ? 72.396  -4.172  -1.596  1.00 8.23  ? 354  GLY B C   1 
ATOM   6932  O O   . GLY B 1 354 ? 71.399  -4.506  -2.255  1.00 8.68  ? 354  GLY B O   1 
ATOM   6933  N N   . GLY B 1 355 ? 73.634  -4.392  -2.024  1.00 7.09  ? 355  GLY B N   1 
ATOM   6934  C CA  . GLY B 1 355 ? 73.917  -5.130  -3.254  1.00 7.39  ? 355  GLY B CA  1 
ATOM   6935  C C   . GLY B 1 355 ? 73.545  -6.607  -3.037  1.00 7.62  ? 355  GLY B C   1 
ATOM   6936  O O   . GLY B 1 355 ? 72.861  -7.195  -3.874  1.00 8.14  ? 355  GLY B O   1 
ATOM   6937  N N   . THR B 1 356 ? 73.826  -7.153  -1.863  1.00 7.53  ? 356  THR B N   1 
ATOM   6938  C CA  . THR B 1 356 ? 73.426  -8.507  -1.509  1.00 8.34  ? 356  THR B CA  1 
ATOM   6939  C C   . THR B 1 356 ? 71.899  -8.651  -1.473  1.00 8.82  ? 356  THR B C   1 
ATOM   6940  O O   . THR B 1 356 ? 71.324  -9.627  -1.984  1.00 6.49  ? 356  THR B O   1 
ATOM   6941  C CB  . THR B 1 356 ? 74.035  -8.882  -0.147  1.00 7.45  ? 356  THR B CB  1 
ATOM   6942  O OG1 . THR B 1 356 ? 75.457  -8.610  -0.164  1.00 5.32  ? 356  THR B OG1 1 
ATOM   6943  C CG2 . THR B 1 356 ? 73.824  -10.366 0.113   1.00 6.72  ? 356  THR B CG2 1 
ATOM   6944  N N   . LEU B 1 357 ? 71.204  -7.658  -0.911  1.00 8.77  ? 357  LEU B N   1 
ATOM   6945  C CA  . LEU B 1 357 ? 69.756  -7.642  -0.857  1.00 7.61  ? 357  LEU B CA  1 
ATOM   6946  C C   . LEU B 1 357 ? 69.235  -7.656  -2.295  1.00 7.95  ? 357  LEU B C   1 
ATOM   6947  O O   . LEU B 1 357 ? 68.351  -8.430  -2.631  1.00 7.41  ? 357  LEU B O   1 
ATOM   6948  C CB  . LEU B 1 357 ? 69.156  -6.381  -0.272  1.00 8.31  ? 357  LEU B CB  1 
ATOM   6949  C CG  . LEU B 1 357 ? 68.011  -6.389  0.732   1.00 10.99 ? 357  LEU B CG  1 
ATOM   6950  C CD1 . LEU B 1 357 ? 67.239  -5.072  0.702   1.00 9.89  ? 357  LEU B CD1 1 
ATOM   6951  C CD2 . LEU B 1 357 ? 67.087  -7.582  0.699   1.00 8.56  ? 357  LEU B CD2 1 
ATOM   6952  N N   . HIS B 1 358 ? 69.717  -6.709  -3.110  1.00 5.87  ? 358  HIS B N   1 
ATOM   6953  C CA  . HIS B 1 358 ? 69.252  -6.551  -4.475  1.00 6.68  ? 358  HIS B CA  1 
ATOM   6954  C C   . HIS B 1 358 ? 69.336  -7.875  -5.238  1.00 8.72  ? 358  HIS B C   1 
ATOM   6955  O O   . HIS B 1 358 ? 68.381  -8.252  -5.951  1.00 7.00  ? 358  HIS B O   1 
ATOM   6956  C CB  . HIS B 1 358 ? 70.024  -5.454  -5.208  1.00 6.16  ? 358  HIS B CB  1 
ATOM   6957  C CG  . HIS B 1 358 ? 69.963  -5.476  -6.699  1.00 5.82  ? 358  HIS B CG  1 
ATOM   6958  N ND1 . HIS B 1 358 ? 68.925  -4.939  -7.430  1.00 5.41  ? 358  HIS B ND1 1 
ATOM   6959  C CD2 . HIS B 1 358 ? 70.818  -5.988  -7.621  1.00 6.75  ? 358  HIS B CD2 1 
ATOM   6960  C CE1 . HIS B 1 358 ? 69.136  -5.133  -8.722  1.00 5.89  ? 358  HIS B CE1 1 
ATOM   6961  N NE2 . HIS B 1 358 ? 70.293  -5.751  -8.872  1.00 5.96  ? 358  HIS B NE2 1 
ATOM   6962  N N   . LEU B 1 359 ? 70.532  -8.483  -5.118  1.00 8.31  ? 359  LEU B N   1 
ATOM   6963  C CA  . LEU B 1 359 ? 70.794  -9.727  -5.855  1.00 8.82  ? 359  LEU B CA  1 
ATOM   6964  C C   . LEU B 1 359 ? 69.980  -10.899 -5.326  1.00 8.64  ? 359  LEU B C   1 
ATOM   6965  O O   . LEU B 1 359 ? 69.588  -11.766 -6.103  1.00 9.42  ? 359  LEU B O   1 
ATOM   6966  C CB  . LEU B 1 359 ? 72.289  -10.032 -5.869  1.00 5.86  ? 359  LEU B CB  1 
ATOM   6967  C CG  . LEU B 1 359 ? 73.157  -9.094  -6.725  1.00 8.03  ? 359  LEU B CG  1 
ATOM   6968  C CD1 . LEU B 1 359 ? 74.622  -9.315  -6.417  1.00 8.37  ? 359  LEU B CD1 1 
ATOM   6969  C CD2 . LEU B 1 359 ? 72.897  -9.289  -8.208  1.00 7.13  ? 359  LEU B CD2 1 
ATOM   6970  N N   . THR B 1 360 ? 69.660  -10.917 -4.047  1.00 11.18 ? 360  THR B N   1 
ATOM   6971  C CA  . THR B 1 360 ? 68.827  -11.939 -3.422  1.00 11.84 ? 360  THR B CA  1 
ATOM   6972  C C   . THR B 1 360 ? 67.384  -11.798 -3.888  1.00 13.15 ? 360  THR B C   1 
ATOM   6973  O O   . THR B 1 360 ? 66.762  -12.774 -4.295  1.00 14.03 ? 360  THR B O   1 
ATOM   6974  C CB  . THR B 1 360 ? 68.896  -11.902 -1.896  1.00 10.75 ? 360  THR B CB  1 
ATOM   6975  O OG1 . THR B 1 360 ? 70.257  -12.253 -1.546  1.00 12.51 ? 360  THR B OG1 1 
ATOM   6976  C CG2 . THR B 1 360 ? 67.930  -12.894 -1.281  1.00 10.78 ? 360  THR B CG2 1 
ATOM   6977  N N   . ILE B 1 361 ? 66.862  -10.580 -3.925  1.00 12.14 ? 361  ILE B N   1 
ATOM   6978  C CA  . ILE B 1 361 ? 65.498  -10.340 -4.409  1.00 10.70 ? 361  ILE B CA  1 
ATOM   6979  C C   . ILE B 1 361 ? 65.426  -10.760 -5.856  1.00 10.97 ? 361  ILE B C   1 
ATOM   6980  O O   . ILE B 1 361 ? 64.419  -11.365 -6.258  1.00 10.75 ? 361  ILE B O   1 
ATOM   6981  C CB  . ILE B 1 361 ? 65.067  -8.868  -4.279  1.00 9.93  ? 361  ILE B CB  1 
ATOM   6982  C CG1 . ILE B 1 361 ? 64.848  -8.518  -2.795  1.00 10.17 ? 361  ILE B CG1 1 
ATOM   6983  C CG2 . ILE B 1 361 ? 63.830  -8.555  -5.104  1.00 8.31  ? 361  ILE B CG2 1 
ATOM   6984  C CD1 . ILE B 1 361 ? 64.890  -6.991  -2.559  1.00 8.52  ? 361  ILE B CD1 1 
ATOM   6985  N N   . LYS B 1 362 ? 66.480  -10.531 -6.658  1.00 10.99 ? 362  LYS B N   1 
ATOM   6986  C CA  . LYS B 1 362 ? 66.424  -10.924 -8.047  1.00 12.35 ? 362  LYS B CA  1 
ATOM   6987  C C   . LYS B 1 362 ? 66.672  -12.421 -8.292  1.00 12.97 ? 362  LYS B C   1 
ATOM   6988  O O   . LYS B 1 362 ? 66.760  -12.792 -9.461  1.00 12.63 ? 362  LYS B O   1 
ATOM   6989  C CB  . LYS B 1 362 ? 67.370  -10.111 -8.938  1.00 13.92 ? 362  LYS B CB  1 
ATOM   6990  C CG  . LYS B 1 362 ? 66.998  -8.619  -8.874  1.00 16.43 ? 362  LYS B CG  1 
ATOM   6991  C CD  . LYS B 1 362 ? 67.427  -7.933  -10.130 1.00 18.79 ? 362  LYS B CD  1 
ATOM   6992  C CE  . LYS B 1 362 ? 66.268  -7.544  -11.031 1.00 21.90 ? 362  LYS B CE  1 
ATOM   6993  N NZ  . LYS B 1 362 ? 66.687  -7.745  -12.467 1.00 22.68 ? 362  LYS B NZ  1 
ATOM   6994  N N   . GLY B 1 363 ? 66.911  -13.199 -7.275  1.00 12.69 ? 363  GLY B N   1 
ATOM   6995  C CA  . GLY B 1 363 ? 67.209  -14.607 -7.344  1.00 14.69 ? 363  GLY B CA  1 
ATOM   6996  C C   . GLY B 1 363 ? 68.621  -14.923 -7.792  1.00 16.12 ? 363  GLY B C   1 
ATOM   6997  O O   . GLY B 1 363 ? 68.866  -16.105 -8.088  1.00 15.80 ? 363  GLY B O   1 
ATOM   6998  N N   . GLU B 1 364 ? 69.532  -13.950 -7.883  1.00 16.51 ? 364  GLU B N   1 
ATOM   6999  C CA  . GLU B 1 364 ? 70.903  -14.227 -8.300  1.00 15.33 ? 364  GLU B CA  1 
ATOM   7000  C C   . GLU B 1 364 ? 71.758  -14.587 -7.096  1.00 14.36 ? 364  GLU B C   1 
ATOM   7001  O O   . GLU B 1 364 ? 72.803  -15.240 -7.277  1.00 15.82 ? 364  GLU B O   1 
ATOM   7002  C CB  . GLU B 1 364 ? 71.527  -13.095 -9.108  1.00 18.64 ? 364  GLU B CB  1 
ATOM   7003  C CG  . GLU B 1 364 ? 70.605  -12.568 -10.197 1.00 21.35 ? 364  GLU B CG  1 
ATOM   7004  C CD  . GLU B 1 364 ? 71.262  -11.492 -11.044 1.00 24.18 ? 364  GLU B CD  1 
ATOM   7005  O OE1 . GLU B 1 364 ? 72.391  -11.718 -11.549 1.00 24.55 ? 364  GLU B OE1 1 
ATOM   7006  O OE2 . GLU B 1 364 ? 70.650  -10.407 -11.204 1.00 25.78 ? 364  GLU B OE2 1 
ATOM   7007  N N   . LEU B 1 365 ? 71.324  -14.276 -5.889  1.00 10.61 ? 365  LEU B N   1 
ATOM   7008  C CA  . LEU B 1 365 ? 72.034  -14.667 -4.687  1.00 10.00 ? 365  LEU B CA  1 
ATOM   7009  C C   . LEU B 1 365 ? 70.932  -15.213 -3.755  1.00 8.95  ? 365  LEU B C   1 
ATOM   7010  O O   . LEU B 1 365 ? 69.781  -15.001 -4.114  1.00 8.09  ? 365  LEU B O   1 
ATOM   7011  C CB  . LEU B 1 365 ? 72.837  -13.610 -3.917  1.00 7.45  ? 365  LEU B CB  1 
ATOM   7012  C CG  . LEU B 1 365 ? 74.203  -13.261 -4.518  1.00 8.87  ? 365  LEU B CG  1 
ATOM   7013  C CD1 . LEU B 1 365 ? 74.880  -12.152 -3.689  1.00 6.36  ? 365  LEU B CD1 1 
ATOM   7014  C CD2 . LEU B 1 365 ? 75.083  -14.500 -4.563  1.00 7.80  ? 365  LEU B CD2 1 
ATOM   7015  N N   . ASN B 1 366 ? 71.300  -15.749 -2.627  1.00 8.85  ? 366  ASN B N   1 
ATOM   7016  C CA  . ASN B 1 366 ? 70.343  -16.325 -1.716  1.00 11.62 ? 366  ASN B CA  1 
ATOM   7017  C C   . ASN B 1 366 ? 70.616  -16.022 -0.256  1.00 10.34 ? 366  ASN B C   1 
ATOM   7018  O O   . ASN B 1 366 ? 70.647  -16.900 0.607   1.00 9.29  ? 366  ASN B O   1 
ATOM   7019  C CB  . ASN B 1 366 ? 70.407  -17.866 -1.925  1.00 16.35 ? 366  ASN B CB  1 
ATOM   7020  C CG  . ASN B 1 366 ? 68.998  -18.392 -1.659  1.00 20.13 ? 366  ASN B CG  1 
ATOM   7021  O OD1 . ASN B 1 366 ? 68.594  -18.806 -0.598  1.00 20.76 ? 366  ASN B OD1 1 
ATOM   7022  N ND2 . ASN B 1 366 ? 68.293  -18.258 -2.783  1.00 24.44 ? 366  ASN B ND2 1 
ATOM   7023  N N   . ALA B 1 367 ? 70.882  -14.736 0.045   1.00 8.87  ? 367  ALA B N   1 
ATOM   7024  C CA  . ALA B 1 367 ? 71.250  -14.375 1.412   1.00 7.15  ? 367  ALA B CA  1 
ATOM   7025  C C   . ALA B 1 367 ? 70.070  -14.555 2.360   1.00 7.31  ? 367  ALA B C   1 
ATOM   7026  O O   . ALA B 1 367 ? 68.934  -14.140 2.012   1.00 4.02  ? 367  ALA B O   1 
ATOM   7027  C CB  . ALA B 1 367 ? 71.693  -12.898 1.434   1.00 7.11  ? 367  ALA B CB  1 
ATOM   7028  N N   . ASP B 1 368 ? 70.385  -15.042 3.553   1.00 5.38  ? 368  ASP B N   1 
ATOM   7029  C CA  . ASP B 1 368 ? 69.376  -15.271 4.578   1.00 7.54  ? 368  ASP B CA  1 
ATOM   7030  C C   . ASP B 1 368 ? 68.905  -14.035 5.347   1.00 7.72  ? 368  ASP B C   1 
ATOM   7031  O O   . ASP B 1 368 ? 68.830  -14.056 6.579   1.00 7.26  ? 368  ASP B O   1 
ATOM   7032  C CB  . ASP B 1 368 ? 69.935  -16.344 5.533   1.00 7.09  ? 368  ASP B CB  1 
ATOM   7033  C CG  . ASP B 1 368 ? 68.904  -16.953 6.462   1.00 8.27  ? 368  ASP B CG  1 
ATOM   7034  O OD1 . ASP B 1 368 ? 67.683  -16.849 6.248   1.00 7.88  ? 368  ASP B OD1 1 
ATOM   7035  O OD2 . ASP B 1 368 ? 69.282  -17.504 7.506   1.00 9.99  ? 368  ASP B OD2 1 
ATOM   7036  N N   . PHE B 1 369 ? 68.592  -12.918 4.669   1.00 7.22  ? 369  PHE B N   1 
ATOM   7037  C CA  . PHE B 1 369 ? 68.054  -11.763 5.402   1.00 5.70  ? 369  PHE B CA  1 
ATOM   7038  C C   . PHE B 1 369 ? 66.752  -12.123 6.077   1.00 6.13  ? 369  PHE B C   1 
ATOM   7039  O O   . PHE B 1 369 ? 65.962  -12.873 5.487   1.00 6.87  ? 369  PHE B O   1 
ATOM   7040  C CB  . PHE B 1 369 ? 67.745  -10.616 4.436   1.00 5.34  ? 369  PHE B CB  1 
ATOM   7041  C CG  . PHE B 1 369 ? 68.990  -9.922  3.921   1.00 4.07  ? 369  PHE B CG  1 
ATOM   7042  C CD1 . PHE B 1 369 ? 69.693  -9.092  4.765   1.00 5.60  ? 369  PHE B CD1 1 
ATOM   7043  C CD2 . PHE B 1 369 ? 69.410  -10.120 2.612   1.00 4.49  ? 369  PHE B CD2 1 
ATOM   7044  C CE1 . PHE B 1 369 ? 70.816  -8.421  4.299   1.00 5.80  ? 369  PHE B CE1 1 
ATOM   7045  C CE2 . PHE B 1 369 ? 70.531  -9.449  2.162   1.00 5.87  ? 369  PHE B CE2 1 
ATOM   7046  C CZ  . PHE B 1 369 ? 71.239  -8.607  2.995   1.00 4.49  ? 369  PHE B CZ  1 
ATOM   7047  N N   . ASP B 1 370 ? 66.492  -11.652 7.276   1.00 6.60  ? 370  ASP B N   1 
ATOM   7048  C CA  . ASP B 1 370 ? 65.217  -11.936 7.941   1.00 8.28  ? 370  ASP B CA  1 
ATOM   7049  C C   . ASP B 1 370 ? 64.066  -11.503 7.039   1.00 8.69  ? 370  ASP B C   1 
ATOM   7050  O O   . ASP B 1 370 ? 64.126  -10.512 6.275   1.00 7.64  ? 370  ASP B O   1 
ATOM   7051  C CB  . ASP B 1 370 ? 65.231  -11.180 9.259   1.00 7.44  ? 370  ASP B CB  1 
ATOM   7052  C CG  . ASP B 1 370 ? 64.006  -11.419 10.121  1.00 7.74  ? 370  ASP B CG  1 
ATOM   7053  O OD1 . ASP B 1 370 ? 64.118  -12.372 10.910  1.00 6.23  ? 370  ASP B OD1 1 
ATOM   7054  O OD2 . ASP B 1 370 ? 63.003  -10.663 10.088  1.00 5.35  ? 370  ASP B OD2 1 
ATOM   7055  N N   . LEU B 1 371 ? 62.939  -12.204 7.096   1.00 7.39  ? 371  LEU B N   1 
ATOM   7056  C CA  . LEU B 1 371 ? 61.778  -11.888 6.261   1.00 7.08  ? 371  LEU B CA  1 
ATOM   7057  C C   . LEU B 1 371 ? 61.160  -10.527 6.548   1.00 5.05  ? 371  LEU B C   1 
ATOM   7058  O O   . LEU B 1 371 ? 60.512  -9.969  5.666   1.00 4.17  ? 371  LEU B O   1 
ATOM   7059  C CB  . LEU B 1 371 ? 60.719  -12.987 6.442   1.00 8.81  ? 371  LEU B CB  1 
ATOM   7060  C CG  . LEU B 1 371 ? 60.692  -14.173 5.484   1.00 10.38 ? 371  LEU B CG  1 
ATOM   7061  C CD1 . LEU B 1 371 ? 61.955  -14.473 4.741   1.00 8.20  ? 371  LEU B CD1 1 
ATOM   7062  C CD2 . LEU B 1 371 ? 60.129  -15.418 6.191   1.00 11.90 ? 371  LEU B CD2 1 
ATOM   7063  N N   . SER B 1 372 ? 61.311  -9.902  7.704   1.00 3.65  ? 372  SER B N   1 
ATOM   7064  C CA  . SER B 1 372 ? 60.796  -8.551  7.944   1.00 6.21  ? 372  SER B CA  1 
ATOM   7065  C C   . SER B 1 372 ? 61.329  -7.561  6.899   1.00 7.17  ? 372  SER B C   1 
ATOM   7066  O O   . SER B 1 372 ? 60.671  -6.591  6.525   1.00 5.51  ? 372  SER B O   1 
ATOM   7067  C CB  . SER B 1 372 ? 61.076  -8.085  9.350   1.00 6.85  ? 372  SER B CB  1 
ATOM   7068  O OG  . SER B 1 372 ? 62.440  -8.116  9.710   1.00 6.87  ? 372  SER B OG  1 
ATOM   7069  N N   . LEU B 1 373 ? 62.528  -7.803  6.360   1.00 8.32  ? 373  LEU B N   1 
ATOM   7070  C CA  . LEU B 1 373 ? 63.116  -6.973  5.320   1.00 8.26  ? 373  LEU B CA  1 
ATOM   7071  C C   . LEU B 1 373 ? 62.904  -7.545  3.950   1.00 7.82  ? 373  LEU B C   1 
ATOM   7072  O O   . LEU B 1 373 ? 62.445  -6.897  2.994   1.00 8.16  ? 373  LEU B O   1 
ATOM   7073  C CB  . LEU B 1 373 ? 64.617  -6.732  5.622   1.00 6.69  ? 373  LEU B CB  1 
ATOM   7074  C CG  . LEU B 1 373 ? 65.339  -5.965  4.501   1.00 8.47  ? 373  LEU B CG  1 
ATOM   7075  C CD1 . LEU B 1 373 ? 64.795  -4.542  4.351   1.00 7.97  ? 373  LEU B CD1 1 
ATOM   7076  C CD2 . LEU B 1 373 ? 66.838  -5.951  4.770   1.00 7.68  ? 373  LEU B CD2 1 
ATOM   7077  N N   . LEU B 1 374 ? 63.238  -8.828  3.752   1.00 9.27  ? 374  LEU B N   1 
ATOM   7078  C CA  . LEU B 1 374 ? 63.128  -9.482  2.441   1.00 9.48  ? 374  LEU B CA  1 
ATOM   7079  C C   . LEU B 1 374 ? 61.684  -9.484  1.937   1.00 9.82  ? 374  LEU B C   1 
ATOM   7080  O O   . LEU B 1 374 ? 61.407  -9.436  0.728   1.00 10.18 ? 374  LEU B O   1 
ATOM   7081  C CB  . LEU B 1 374 ? 63.674  -10.908 2.575   1.00 9.22  ? 374  LEU B CB  1 
ATOM   7082  C CG  . LEU B 1 374 ? 63.999  -11.672 1.308   1.00 12.17 ? 374  LEU B CG  1 
ATOM   7083  C CD1 . LEU B 1 374 ? 64.958  -10.893 0.422   1.00 12.71 ? 374  LEU B CD1 1 
ATOM   7084  C CD2 . LEU B 1 374 ? 64.618  -13.052 1.638   1.00 12.00 ? 374  LEU B CD2 1 
ATOM   7085  N N   . GLU B 1 375 ? 60.724  -9.560  2.867   1.00 8.66  ? 375  GLU B N   1 
ATOM   7086  C CA  . GLU B 1 375 ? 59.314  -9.502  2.481   1.00 9.98  ? 375  GLU B CA  1 
ATOM   7087  C C   . GLU B 1 375 ? 58.614  -8.236  2.906   1.00 9.04  ? 375  GLU B C   1 
ATOM   7088  O O   . GLU B 1 375 ? 57.421  -8.230  3.211   1.00 9.73  ? 375  GLU B O   1 
ATOM   7089  C CB  . GLU B 1 375 ? 58.601  -10.781 3.024   1.00 10.14 ? 375  GLU B CB  1 
ATOM   7090  C CG  . GLU B 1 375 ? 59.018  -11.964 2.135   1.00 12.45 ? 375  GLU B CG  1 
ATOM   7091  C CD  . GLU B 1 375 ? 58.560  -13.332 2.610   1.00 13.89 ? 375  GLU B CD  1 
ATOM   7092  O OE1 . GLU B 1 375 ? 57.806  -13.460 3.590   1.00 12.08 ? 375  GLU B OE1 1 
ATOM   7093  O OE2 . GLU B 1 375 ? 58.999  -14.333 1.975   1.00 16.62 ? 375  GLU B OE2 1 
ATOM   7094  N N   . ASN B 1 376 ? 59.313  -7.108  3.013   1.00 8.24  ? 376  ASN B N   1 
ATOM   7095  C CA  . ASN B 1 376 ? 58.728  -5.797  3.332   1.00 7.47  ? 376  ASN B CA  1 
ATOM   7096  C C   . ASN B 1 376 ? 58.208  -5.171  2.040   1.00 7.59  ? 376  ASN B C   1 
ATOM   7097  O O   . ASN B 1 376 ? 58.921  -4.538  1.242   1.00 6.65  ? 376  ASN B O   1 
ATOM   7098  C CB  . ASN B 1 376 ? 59.822  -4.892  3.918   1.00 6.11  ? 376  ASN B CB  1 
ATOM   7099  C CG  . ASN B 1 376 ? 59.268  -3.594  4.486   1.00 8.21  ? 376  ASN B CG  1 
ATOM   7100  O OD1 . ASN B 1 376 ? 58.298  -3.012  3.969   1.00 5.44  ? 376  ASN B OD1 1 
ATOM   7101  N ND2 . ASN B 1 376 ? 59.920  -3.161  5.557   1.00 4.09  ? 376  ASN B ND2 1 
ATOM   7102  N N   . ALA B 1 377 ? 56.932  -5.413  1.741   1.00 6.21  ? 377  ALA B N   1 
ATOM   7103  C CA  . ALA B 1 377 ? 56.330  -4.999  0.486   1.00 6.48  ? 377  ALA B CA  1 
ATOM   7104  C C   . ALA B 1 377 ? 56.333  -3.481  0.257   1.00 5.63  ? 377  ALA B C   1 
ATOM   7105  O O   . ALA B 1 377 ? 56.481  -3.027  -0.874  1.00 5.86  ? 377  ALA B O   1 
ATOM   7106  C CB  . ALA B 1 377 ? 54.879  -5.519  0.403   1.00 4.83  ? 377  ALA B CB  1 
ATOM   7107  N N   . GLU B 1 378 ? 56.049  -2.745  1.299   1.00 6.22  ? 378  GLU B N   1 
ATOM   7108  C CA  . GLU B 1 378 ? 55.974  -1.294  1.278   1.00 8.02  ? 378  GLU B CA  1 
ATOM   7109  C C   . GLU B 1 378 ? 57.339  -0.704  0.917   1.00 7.42  ? 378  GLU B C   1 
ATOM   7110  O O   . GLU B 1 378 ? 57.427  0.092   -0.009  1.00 4.22  ? 378  GLU B O   1 
ATOM   7111  C CB  . GLU B 1 378 ? 55.477  -0.793  2.636   1.00 9.64  ? 378  GLU B CB  1 
ATOM   7112  C CG  . GLU B 1 378 ? 55.188  0.692   2.676   1.00 11.04 ? 378  GLU B CG  1 
ATOM   7113  C CD  . GLU B 1 378 ? 54.005  1.096   1.810   1.00 14.31 ? 378  GLU B CD  1 
ATOM   7114  O OE1 . GLU B 1 378 ? 52.958  0.428   1.948   1.00 17.08 ? 378  GLU B OE1 1 
ATOM   7115  O OE2 . GLU B 1 378 ? 54.110  2.067   1.031   1.00 15.45 ? 378  GLU B OE2 1 
ATOM   7116  N N   . LEU B 1 379 ? 58.401  -1.181  1.552   1.00 8.04  ? 379  LEU B N   1 
ATOM   7117  C CA  . LEU B 1 379 ? 59.742  -0.709  1.236   1.00 7.54  ? 379  LEU B CA  1 
ATOM   7118  C C   . LEU B 1 379 ? 60.194  -1.126  -0.141  1.00 8.76  ? 379  LEU B C   1 
ATOM   7119  O O   . LEU B 1 379 ? 60.627  -0.318  -0.981  1.00 7.84  ? 379  LEU B O   1 
ATOM   7120  C CB  . LEU B 1 379 ? 60.722  -1.217  2.312   1.00 7.20  ? 379  LEU B CB  1 
ATOM   7121  C CG  . LEU B 1 379 ? 62.147  -0.656  2.170   1.00 9.13  ? 379  LEU B CG  1 
ATOM   7122  C CD1 . LEU B 1 379 ? 62.108  0.868   2.313   1.00 6.55  ? 379  LEU B CD1 1 
ATOM   7123  C CD2 . LEU B 1 379 ? 63.065  -1.328  3.182   1.00 7.65  ? 379  LEU B CD2 1 
ATOM   7124  N N   . LEU B 1 380 ? 60.008  -2.409  -0.495  1.00 9.55  ? 380  LEU B N   1 
ATOM   7125  C CA  . LEU B 1 380 ? 60.465  -2.849  -1.806  1.00 9.64  ? 380  LEU B CA  1 
ATOM   7126  C C   . LEU B 1 380 ? 59.796  -2.173  -2.965  1.00 8.20  ? 380  LEU B C   1 
ATOM   7127  O O   . LEU B 1 380 ? 60.573  -1.867  -3.892  1.00 9.12  ? 380  LEU B O   1 
ATOM   7128  C CB  . LEU B 1 380 ? 60.409  -4.376  -1.978  1.00 12.70 ? 380  LEU B CB  1 
ATOM   7129  C CG  . LEU B 1 380 ? 61.229  -5.139  -0.925  1.00 15.72 ? 380  LEU B CG  1 
ATOM   7130  C CD1 . LEU B 1 380 ? 61.017  -6.639  -1.069  1.00 18.29 ? 380  LEU B CD1 1 
ATOM   7131  C CD2 . LEU B 1 380 ? 62.695  -4.797  -1.065  1.00 17.29 ? 380  LEU B CD2 1 
ATOM   7132  N N   . LYS B 1 381 ? 58.487  -1.936  -2.998  1.00 6.00  ? 381  LYS B N   1 
ATOM   7133  C CA  . LYS B 1 381 ? 57.876  -1.292  -4.128  1.00 5.27  ? 381  LYS B CA  1 
ATOM   7134  C C   . LYS B 1 381 ? 58.414  0.136   -4.298  1.00 4.87  ? 381  LYS B C   1 
ATOM   7135  O O   . LYS B 1 381 ? 58.641  0.554   -5.433  1.00 5.55  ? 381  LYS B O   1 
ATOM   7136  C CB  . LYS B 1 381 ? 56.322  -1.212  -4.083  1.00 4.01  ? 381  LYS B CB  1 
ATOM   7137  C CG  . LYS B 1 381 ? 55.665  -0.466  -2.951  1.00 2.96  ? 381  LYS B CG  1 
ATOM   7138  C CD  . LYS B 1 381 ? 54.135  -0.298  -3.087  1.00 2.08  ? 381  LYS B CD  1 
ATOM   7139  C CE  . LYS B 1 381 ? 53.568  0.385   -1.859  1.00 2.99  ? 381  LYS B CE  1 
ATOM   7140  N NZ  . LYS B 1 381 ? 52.120  0.723   -1.958  1.00 2.08  ? 381  LYS B NZ  1 
ATOM   7141  N N   . ARG B 1 382 ? 58.607  0.844   -3.200  1.00 5.30  ? 382  ARG B N   1 
ATOM   7142  C CA  . ARG B 1 382 ? 59.084  2.241   -3.273  1.00 5.92  ? 382  ARG B CA  1 
ATOM   7143  C C   . ARG B 1 382 ? 60.545  2.338   -3.739  1.00 4.24  ? 382  ARG B C   1 
ATOM   7144  O O   . ARG B 1 382 ? 60.932  3.166   -4.559  1.00 3.40  ? 382  ARG B O   1 
ATOM   7145  C CB  . ARG B 1 382 ? 58.886  2.863   -1.896  1.00 6.42  ? 382  ARG B CB  1 
ATOM   7146  C CG  . ARG B 1 382 ? 57.481  3.326   -1.533  1.00 6.60  ? 382  ARG B CG  1 
ATOM   7147  C CD  . ARG B 1 382 ? 57.497  3.856   -0.094  1.00 6.31  ? 382  ARG B CD  1 
ATOM   7148  N NE  . ARG B 1 382 ? 56.116  3.996   0.389   1.00 7.06  ? 382  ARG B NE  1 
ATOM   7149  C CZ  . ARG B 1 382 ? 55.464  5.152   0.251   1.00 8.90  ? 382  ARG B CZ  1 
ATOM   7150  N NH1 . ARG B 1 382 ? 56.104  6.179   -0.315  1.00 9.10  ? 382  ARG B NH1 1 
ATOM   7151  N NH2 . ARG B 1 382 ? 54.185  5.221   0.644   1.00 7.73  ? 382  ARG B NH2 1 
ATOM   7152  N N   . VAL B 1 383 ? 61.391  1.411   -3.318  1.00 4.75  ? 383  VAL B N   1 
ATOM   7153  C CA  . VAL B 1 383 ? 62.806  1.414   -3.728  1.00 3.20  ? 383  VAL B CA  1 
ATOM   7154  C C   . VAL B 1 383 ? 62.889  1.126   -5.207  1.00 6.39  ? 383  VAL B C   1 
ATOM   7155  O O   . VAL B 1 383 ? 63.551  1.798   -6.008  1.00 7.23  ? 383  VAL B O   1 
ATOM   7156  C CB  . VAL B 1 383 ? 63.614  0.392   -2.944  1.00 3.74  ? 383  VAL B CB  1 
ATOM   7157  C CG1 . VAL B 1 383 ? 65.039  0.298   -3.498  1.00 3.23  ? 383  VAL B CG1 1 
ATOM   7158  C CG2 . VAL B 1 383 ? 63.621  0.668   -1.460  1.00 3.59  ? 383  VAL B CG2 1 
ATOM   7159  N N   . ALA B 1 384 ? 62.145  0.088   -5.672  1.00 5.79  ? 384  ALA B N   1 
ATOM   7160  C CA  . ALA B 1 384 ? 62.114  -0.208  -7.086  1.00 4.28  ? 384  ALA B CA  1 
ATOM   7161  C C   . ALA B 1 384 ? 61.696  0.988   -7.924  1.00 3.45  ? 384  ALA B C   1 
ATOM   7162  O O   . ALA B 1 384 ? 62.173  1.260   -9.039  1.00 3.89  ? 384  ALA B O   1 
ATOM   7163  C CB  . ALA B 1 384 ? 61.105  -1.347  -7.353  1.00 4.89  ? 384  ALA B CB  1 
ATOM   7164  N N   . ALA B 1 385 ? 60.643  1.689   -7.500  1.00 2.18  ? 385  ALA B N   1 
ATOM   7165  C CA  . ALA B 1 385 ? 60.148  2.787   -8.323  1.00 2.32  ? 385  ALA B CA  1 
ATOM   7166  C C   . ALA B 1 385 ? 61.102  3.997   -8.327  1.00 3.05  ? 385  ALA B C   1 
ATOM   7167  O O   . ALA B 1 385 ? 61.250  4.610   -9.381  1.00 3.35  ? 385  ALA B O   1 
ATOM   7168  C CB  . ALA B 1 385 ? 58.804  3.287   -7.771  1.00 3.44  ? 385  ALA B CB  1 
ATOM   7169  N N   . ILE B 1 386 ? 61.639  4.365   -7.169  1.00 4.33  ? 386  ILE B N   1 
ATOM   7170  C CA  . ILE B 1 386 ? 62.531  5.535   -7.151  1.00 5.31  ? 386  ILE B CA  1 
ATOM   7171  C C   . ILE B 1 386 ? 63.756  5.204   -8.017  1.00 6.72  ? 386  ILE B C   1 
ATOM   7172  O O   . ILE B 1 386 ? 64.114  6.044   -8.841  1.00 6.51  ? 386  ILE B O   1 
ATOM   7173  C CB  . ILE B 1 386 ? 62.910  5.980   -5.730  1.00 5.99  ? 386  ILE B CB  1 
ATOM   7174  C CG1 . ILE B 1 386 ? 63.508  7.414   -5.764  1.00 6.18  ? 386  ILE B CG1 1 
ATOM   7175  C CG2 . ILE B 1 386 ? 63.916  5.001   -5.116  1.00 4.34  ? 386  ILE B CG2 1 
ATOM   7176  C CD1 . ILE B 1 386 ? 63.658  8.007   -4.366  1.00 6.81  ? 386  ILE B CD1 1 
ATOM   7177  N N   . ASN B 1 387 ? 64.300  3.988   -7.957  1.00 5.66  ? 387  ASN B N   1 
ATOM   7178  C CA  . ASN B 1 387 ? 65.455  3.621   -8.761  1.00 7.44  ? 387  ASN B CA  1 
ATOM   7179  C C   . ASN B 1 387 ? 65.200  3.495   -10.247 1.00 8.09  ? 387  ASN B C   1 
ATOM   7180  O O   . ASN B 1 387 ? 66.019  3.893   -11.072 1.00 5.88  ? 387  ASN B O   1 
ATOM   7181  C CB  . ASN B 1 387 ? 66.112  2.343   -8.201  1.00 6.76  ? 387  ASN B CB  1 
ATOM   7182  C CG  . ASN B 1 387 ? 66.738  2.584   -6.845  1.00 7.49  ? 387  ASN B CG  1 
ATOM   7183  O OD1 . ASN B 1 387 ? 66.836  3.762   -6.429  1.00 8.67  ? 387  ASN B OD1 1 
ATOM   7184  N ND2 . ASN B 1 387 ? 67.187  1.518   -6.167  1.00 6.34  ? 387  ASN B ND2 1 
ATOM   7185  N N   . ALA B 1 388 ? 63.996  3.058   -10.634 1.00 7.88  ? 388  ALA B N   1 
ATOM   7186  C CA  . ALA B 1 388 ? 63.608  2.982   -12.028 1.00 8.94  ? 388  ALA B CA  1 
ATOM   7187  C C   . ALA B 1 388 ? 63.448  4.399   -12.559 1.00 9.83  ? 388  ALA B C   1 
ATOM   7188  O O   . ALA B 1 388 ? 63.840  4.652   -13.700 1.00 10.16 ? 388  ALA B O   1 
ATOM   7189  C CB  . ALA B 1 388 ? 62.343  2.155   -12.235 1.00 7.22  ? 388  ALA B CB  1 
ATOM   7190  N N   . ALA B 1 389 ? 62.940  5.324   -11.734 1.00 10.77 ? 389  ALA B N   1 
ATOM   7191  C CA  . ALA B 1 389 ? 62.852  6.699   -12.253 1.00 11.54 ? 389  ALA B CA  1 
ATOM   7192  C C   . ALA B 1 389 ? 64.267  7.290   -12.417 1.00 12.45 ? 389  ALA B C   1 
ATOM   7193  O O   . ALA B 1 389 ? 64.477  8.011   -13.399 1.00 11.38 ? 389  ALA B O   1 
ATOM   7194  C CB  . ALA B 1 389 ? 61.937  7.585   -11.430 1.00 10.12 ? 389  ALA B CB  1 
ATOM   7195  N N   . GLN B 1 390 ? 65.234  6.938   -11.582 1.00 12.28 ? 390  GLN B N   1 
ATOM   7196  C CA  . GLN B 1 390 ? 66.595  7.470   -11.680 1.00 12.29 ? 390  GLN B CA  1 
ATOM   7197  C C   . GLN B 1 390 ? 67.385  6.835   -12.820 1.00 14.23 ? 390  GLN B C   1 
ATOM   7198  O O   . GLN B 1 390 ? 68.108  7.549   -13.516 1.00 11.68 ? 390  GLN B O   1 
ATOM   7199  C CB  . GLN B 1 390 ? 67.337  7.200   -10.369 1.00 10.75 ? 390  GLN B CB  1 
ATOM   7200  C CG  . GLN B 1 390 ? 68.757  7.737   -10.216 1.00 10.91 ? 390  GLN B CG  1 
ATOM   7201  C CD  . GLN B 1 390 ? 68.719  9.264   -10.311 1.00 11.92 ? 390  GLN B CD  1 
ATOM   7202  O OE1 . GLN B 1 390 ? 68.174  9.883   -9.390  1.00 12.83 ? 390  GLN B OE1 1 
ATOM   7203  N NE2 . GLN B 1 390 ? 69.217  9.831   -11.405 1.00 10.28 ? 390  GLN B NE2 1 
ATOM   7204  N N   . ASN B 1 391 ? 67.312  5.512   -12.987 1.00 13.63 ? 391  ASN B N   1 
ATOM   7205  C CA  . ASN B 1 391 ? 68.095  4.824   -13.993 1.00 16.96 ? 391  ASN B CA  1 
ATOM   7206  C C   . ASN B 1 391 ? 67.731  5.218   -15.412 1.00 20.98 ? 391  ASN B C   1 
ATOM   7207  O O   . ASN B 1 391 ? 66.573  5.350   -15.782 1.00 19.28 ? 391  ASN B O   1 
ATOM   7208  C CB  . ASN B 1 391 ? 68.045  3.289   -13.824 1.00 14.98 ? 391  ASN B CB  1 
ATOM   7209  C CG  . ASN B 1 391 ? 68.824  2.868   -12.594 1.00 15.62 ? 391  ASN B CG  1 
ATOM   7210  O OD1 . ASN B 1 391 ? 69.784  3.553   -12.209 1.00 15.18 ? 391  ASN B OD1 1 
ATOM   7211  N ND2 . ASN B 1 391 ? 68.449  1.765   -11.939 1.00 12.83 ? 391  ASN B ND2 1 
ATOM   7212  N N   . PRO B 1 392 ? 68.758  5.338   -16.249 1.00 26.84 ? 392  PRO B N   1 
ATOM   7213  C CA  . PRO B 1 392 ? 68.669  5.716   -17.647 1.00 29.73 ? 392  PRO B CA  1 
ATOM   7214  C C   . PRO B 1 392 ? 67.578  5.027   -18.458 1.00 30.95 ? 392  PRO B C   1 
ATOM   7215  O O   . PRO B 1 392 ? 66.724  5.676   -19.097 1.00 30.68 ? 392  PRO B O   1 
ATOM   7216  C CB  . PRO B 1 392 ? 70.052  5.361   -18.215 1.00 30.94 ? 392  PRO B CB  1 
ATOM   7217  C CG  . PRO B 1 392 ? 70.757  4.562   -17.152 1.00 30.67 ? 392  PRO B CG  1 
ATOM   7218  C CD  . PRO B 1 392 ? 70.194  5.117   -15.862 1.00 28.49 ? 392  PRO B CD  1 
ATOM   7219  N N   . ASN B 1 393 ? 67.583  3.697   -18.466 1.00 31.28 ? 393  ASN B N   1 
ATOM   7220  C CA  . ASN B 1 393 ? 66.564  2.980   -19.230 1.00 32.81 ? 393  ASN B CA  1 
ATOM   7221  C C   . ASN B 1 393 ? 65.445  2.466   -18.350 1.00 30.80 ? 393  ASN B C   1 
ATOM   7222  O O   . ASN B 1 393 ? 64.797  1.473   -18.644 1.00 29.96 ? 393  ASN B O   1 
ATOM   7223  C CB  . ASN B 1 393 ? 67.237  1.870   -20.057 1.00 37.10 ? 393  ASN B CB  1 
ATOM   7224  C CG  . ASN B 1 393 ? 67.314  2.356   -21.507 1.00 40.46 ? 393  ASN B CG  1 
ATOM   7225  O OD1 . ASN B 1 393 ? 66.614  1.866   -22.409 1.00 42.83 ? 393  ASN B OD1 1 
ATOM   7226  N ND2 . ASN B 1 393 ? 68.157  3.369   -21.695 1.00 40.93 ? 393  ASN B ND2 1 
ATOM   7227  N N   . ASN B 1 394 ? 65.218  3.109   -17.205 1.00 27.88 ? 394  ASN B N   1 
ATOM   7228  C CA  . ASN B 1 394 ? 64.209  2.735   -16.244 1.00 26.02 ? 394  ASN B CA  1 
ATOM   7229  C C   . ASN B 1 394 ? 64.406  1.332   -15.679 1.00 24.08 ? 394  ASN B C   1 
ATOM   7230  O O   . ASN B 1 394 ? 63.403  0.808   -15.168 1.00 23.40 ? 394  ASN B O   1 
ATOM   7231  C CB  . ASN B 1 394 ? 62.822  2.800   -16.877 1.00 26.66 ? 394  ASN B CB  1 
ATOM   7232  C CG  . ASN B 1 394 ? 62.374  4.169   -17.319 1.00 27.81 ? 394  ASN B CG  1 
ATOM   7233  O OD1 . ASN B 1 394 ? 62.005  4.314   -18.489 1.00 28.46 ? 394  ASN B OD1 1 
ATOM   7234  N ND2 . ASN B 1 394 ? 62.353  5.171   -16.452 1.00 27.29 ? 394  ASN B ND2 1 
ATOM   7235  N N   . GLU B 1 395 ? 65.590  0.744   -15.699 1.00 22.16 ? 395  GLU B N   1 
ATOM   7236  C CA  . GLU B 1 395 ? 65.773  -0.590  -15.136 1.00 22.15 ? 395  GLU B CA  1 
ATOM   7237  C C   . GLU B 1 395 ? 65.565  -0.523  -13.626 1.00 18.12 ? 395  GLU B C   1 
ATOM   7238  O O   . GLU B 1 395 ? 66.016  0.423   -12.944 1.00 16.56 ? 395  GLU B O   1 
ATOM   7239  C CB  . GLU B 1 395 ? 67.136  -1.180  -15.498 1.00 27.84 ? 395  GLU B CB  1 
ATOM   7240  C CG  . GLU B 1 395 ? 67.746  -2.115  -14.469 1.00 35.53 ? 395  GLU B CG  1 
ATOM   7241  C CD  . GLU B 1 395 ? 69.135  -2.648  -14.763 1.00 40.51 ? 395  GLU B CD  1 
ATOM   7242  O OE1 . GLU B 1 395 ? 69.906  -1.993  -15.530 1.00 43.95 ? 395  GLU B OE1 1 
ATOM   7243  O OE2 . GLU B 1 395 ? 69.561  -3.702  -14.212 1.00 40.98 ? 395  GLU B OE2 1 
ATOM   7244  N N   . VAL B 1 396 ? 64.823  -1.479  -13.085 1.00 11.64 ? 396  VAL B N   1 
ATOM   7245  C CA  . VAL B 1 396 ? 64.601  -1.558  -11.652 1.00 9.22  ? 396  VAL B CA  1 
ATOM   7246  C C   . VAL B 1 396 ? 65.777  -2.177  -10.905 1.00 9.88  ? 396  VAL B C   1 
ATOM   7247  O O   . VAL B 1 396 ? 66.268  -3.249  -11.293 1.00 11.73 ? 396  VAL B O   1 
ATOM   7248  C CB  . VAL B 1 396 ? 63.355  -2.414  -11.348 1.00 8.51  ? 396  VAL B CB  1 
ATOM   7249  C CG1 . VAL B 1 396 ? 63.379  -3.032  -9.961  1.00 5.10  ? 396  VAL B CG1 1 
ATOM   7250  C CG2 . VAL B 1 396 ? 62.100  -1.567  -11.543 1.00 7.49  ? 396  VAL B CG2 1 
ATOM   7251  N N   . THR B 1 397 ? 66.194  -1.630  -9.764  1.00 6.81  ? 397  THR B N   1 
ATOM   7252  C CA  . THR B 1 397 ? 67.207  -2.225  -8.917  1.00 5.62  ? 397  THR B CA  1 
ATOM   7253  C C   . THR B 1 397 ? 66.733  -2.000  -7.487  1.00 6.16  ? 397  THR B C   1 
ATOM   7254  O O   . THR B 1 397 ? 65.892  -1.147  -7.266  1.00 4.55  ? 397  THR B O   1 
ATOM   7255  C CB  . THR B 1 397 ? 68.629  -1.644  -8.998  1.00 6.46  ? 397  THR B CB  1 
ATOM   7256  O OG1 . THR B 1 397 ? 68.599  -0.318  -8.452  1.00 5.14  ? 397  THR B OG1 1 
ATOM   7257  C CG2 . THR B 1 397 ? 69.177  -1.602  -10.419 1.00 2.29  ? 397  THR B CG2 1 
ATOM   7258  N N   . TYR B 1 398 ? 67.250  -2.775  -6.539  1.00 5.99  ? 398  TYR B N   1 
ATOM   7259  C CA  . TYR B 1 398 ? 66.875  -2.621  -5.161  1.00 5.48  ? 398  TYR B CA  1 
ATOM   7260  C C   . TYR B 1 398 ? 68.058  -2.056  -4.342  1.00 3.23  ? 398  TYR B C   1 
ATOM   7261  O O   . TYR B 1 398 ? 67.995  -2.116  -3.120  1.00 2.08  ? 398  TYR B O   1 
ATOM   7262  C CB  . TYR B 1 398 ? 66.391  -3.964  -4.553  1.00 7.45  ? 398  TYR B CB  1 
ATOM   7263  C CG  . TYR B 1 398 ? 65.206  -4.492  -5.364  1.00 8.90  ? 398  TYR B CG  1 
ATOM   7264  C CD1 . TYR B 1 398 ? 63.908  -4.065  -5.054  1.00 9.36  ? 398  TYR B CD1 1 
ATOM   7265  C CD2 . TYR B 1 398 ? 65.391  -5.355  -6.427  1.00 8.66  ? 398  TYR B CD2 1 
ATOM   7266  C CE1 . TYR B 1 398 ? 62.829  -4.505  -5.801  1.00 10.39 ? 398  TYR B CE1 1 
ATOM   7267  C CE2 . TYR B 1 398 ? 64.322  -5.796  -7.187  1.00 8.79  ? 398  TYR B CE2 1 
ATOM   7268  C CZ  . TYR B 1 398 ? 63.044  -5.380  -6.849  1.00 10.86 ? 398  TYR B CZ  1 
ATOM   7269  O OH  . TYR B 1 398 ? 61.977  -5.837  -7.602  1.00 10.85 ? 398  TYR B OH  1 
ATOM   7270  N N   . LEU B 1 399 ? 69.078  -1.572  -5.055  1.00 2.39  ? 399  LEU B N   1 
ATOM   7271  C CA  . LEU B 1 399 ? 70.244  -1.005  -4.369  1.00 3.28  ? 399  LEU B CA  1 
ATOM   7272  C C   . LEU B 1 399 ? 69.875  0.161   -3.473  1.00 4.73  ? 399  LEU B C   1 
ATOM   7273  O O   . LEU B 1 399 ? 68.871  0.848   -3.723  1.00 4.93  ? 399  LEU B O   1 
ATOM   7274  C CB  . LEU B 1 399 ? 71.219  -0.563  -5.482  1.00 4.52  ? 399  LEU B CB  1 
ATOM   7275  C CG  . LEU B 1 399 ? 71.785  -1.760  -6.311  1.00 4.58  ? 399  LEU B CG  1 
ATOM   7276  C CD1 . LEU B 1 399 ? 72.545  -1.209  -7.508  1.00 5.18  ? 399  LEU B CD1 1 
ATOM   7277  C CD2 . LEU B 1 399 ? 72.655  -2.665  -5.494  1.00 4.82  ? 399  LEU B CD2 1 
ATOM   7278  N N   . LEU B 1 400 ? 70.571  0.358   -2.381  1.00 5.34  ? 400  LEU B N   1 
ATOM   7279  C CA  . LEU B 1 400 ? 70.274  1.504   -1.482  1.00 5.53  ? 400  LEU B CA  1 
ATOM   7280  C C   . LEU B 1 400 ? 70.770  2.802   -2.105  1.00 5.50  ? 400  LEU B C   1 
ATOM   7281  O O   . LEU B 1 400 ? 71.966  2.955   -2.375  1.00 6.75  ? 400  LEU B O   1 
ATOM   7282  C CB  . LEU B 1 400 ? 71.016  1.165   -0.201  1.00 6.56  ? 400  LEU B CB  1 
ATOM   7283  C CG  . LEU B 1 400 ? 71.160  2.225   0.892   1.00 6.77  ? 400  LEU B CG  1 
ATOM   7284  C CD1 . LEU B 1 400 ? 69.792  2.754   1.288   1.00 6.49  ? 400  LEU B CD1 1 
ATOM   7285  C CD2 . LEU B 1 400 ? 71.871  1.577   2.070   1.00 7.64  ? 400  LEU B CD2 1 
ATOM   7286  N N   . PRO B 1 401 ? 69.877  3.712   -2.458  1.00 4.60  ? 401  PRO B N   1 
ATOM   7287  C CA  . PRO B 1 401 ? 70.241  4.953   -3.122  1.00 3.99  ? 401  PRO B CA  1 
ATOM   7288  C C   . PRO B 1 401 ? 71.162  5.779   -2.213  1.00 2.08  ? 401  PRO B C   1 
ATOM   7289  O O   . PRO B 1 401 ? 70.896  5.944   -1.031  1.00 2.50  ? 401  PRO B O   1 
ATOM   7290  C CB  . PRO B 1 401 ? 68.939  5.631   -3.515  1.00 3.63  ? 401  PRO B CB  1 
ATOM   7291  C CG  . PRO B 1 401 ? 67.855  4.631   -3.223  1.00 4.64  ? 401  PRO B CG  1 
ATOM   7292  C CD  . PRO B 1 401 ? 68.426  3.697   -2.176  1.00 4.28  ? 401  PRO B CD  1 
ATOM   7293  N N   . GLN B 1 402 ? 72.279  6.192   -2.803  1.00 3.57  ? 402  GLN B N   1 
ATOM   7294  C CA  . GLN B 1 402 ? 73.258  6.973   -2.046  1.00 5.09  ? 402  GLN B CA  1 
ATOM   7295  C C   . GLN B 1 402 ? 73.068  8.438   -2.373  1.00 4.32  ? 402  GLN B C   1 
ATOM   7296  O O   . GLN B 1 402 ? 72.819  8.768   -3.517  1.00 5.11  ? 402  GLN B O   1 
ATOM   7297  C CB  . GLN B 1 402 ? 74.707  6.582   -2.399  1.00 4.88  ? 402  GLN B CB  1 
ATOM   7298  C CG  . GLN B 1 402 ? 74.989  5.076   -2.245  1.00 5.13  ? 402  GLN B CG  1 
ATOM   7299  C CD  . GLN B 1 402 ? 74.957  4.716   -0.782  1.00 6.82  ? 402  GLN B CD  1 
ATOM   7300  O OE1 . GLN B 1 402 ? 75.762  5.294   -0.035  1.00 8.06  ? 402  GLN B OE1 1 
ATOM   7301  N NE2 . GLN B 1 402 ? 74.043  3.877   -0.310  1.00 5.14  ? 402  GLN B NE2 1 
ATOM   7302  N N   . ALA B 1 403 ? 73.335  9.314   -1.413  1.00 5.89  ? 403  ALA B N   1 
ATOM   7303  C CA  . ALA B 1 403 ? 73.257  10.751  -1.667  1.00 4.27  ? 403  ALA B CA  1 
ATOM   7304  C C   . ALA B 1 403 ? 74.538  11.283  -2.282  1.00 5.34  ? 403  ALA B C   1 
ATOM   7305  O O   . ALA B 1 403 ? 74.549  12.462  -2.729  1.00 5.60  ? 403  ALA B O   1 
ATOM   7306  C CB  . ALA B 1 403 ? 72.941  11.487  -0.372  1.00 4.20  ? 403  ALA B CB  1 
ATOM   7307  N N   . ILE B 1 404 ? 75.569  10.463  -2.419  1.00 3.80  ? 404  ILE B N   1 
ATOM   7308  C CA  . ILE B 1 404 ? 76.849  10.872  -2.998  1.00 5.41  ? 404  ILE B CA  1 
ATOM   7309  C C   . ILE B 1 404 ? 77.327  9.808   -3.969  1.00 5.64  ? 404  ILE B C   1 
ATOM   7310  O O   . ILE B 1 404 ? 77.162  8.605   -3.695  1.00 5.98  ? 404  ILE B O   1 
ATOM   7311  C CB  . ILE B 1 404 ? 77.937  11.094  -1.910  1.00 6.81  ? 404  ILE B CB  1 
ATOM   7312  C CG1 . ILE B 1 404 ? 77.868  9.918   -0.907  1.00 7.10  ? 404  ILE B CG1 1 
ATOM   7313  C CG2 . ILE B 1 404 ? 77.712  12.422  -1.189  1.00 5.43  ? 404  ILE B CG2 1 
ATOM   7314  C CD1 . ILE B 1 404 ? 78.933  9.902   0.167   1.00 7.63  ? 404  ILE B CD1 1 
ATOM   7315  N N   . GLN B 1 405 ? 77.900  10.190  -5.081  1.00 6.09  ? 405  GLN B N   1 
ATOM   7316  C CA  . GLN B 1 405 ? 78.411  9.317   -6.120  1.00 7.06  ? 405  GLN B CA  1 
ATOM   7317  C C   . GLN B 1 405 ? 79.470  8.301   -5.688  1.00 7.48  ? 405  GLN B C   1 
ATOM   7318  O O   . GLN B 1 405 ? 79.459  7.171   -6.209  1.00 5.16  ? 405  GLN B O   1 
ATOM   7319  C CB  . GLN B 1 405 ? 78.995  10.168  -7.251  1.00 7.26  ? 405  GLN B CB  1 
ATOM   7320  C CG  . GLN B 1 405 ? 77.997  11.040  -7.985  1.00 5.56  ? 405  GLN B CG  1 
ATOM   7321  C CD  . GLN B 1 405 ? 77.583  10.481  -9.331  1.00 7.72  ? 405  GLN B CD  1 
ATOM   7322  O OE1 . GLN B 1 405 ? 77.490  9.277   -9.594  1.00 6.15  ? 405  GLN B OE1 1 
ATOM   7323  N NE2 . GLN B 1 405 ? 77.277  11.424  -10.236 1.00 9.19  ? 405  GLN B NE2 1 
ATOM   7324  N N   . GLU B 1 406 ? 80.323  8.618   -4.723  1.00 5.69  ? 406  GLU B N   1 
ATOM   7325  C CA  . GLU B 1 406 ? 81.386  7.714   -4.313  1.00 6.26  ? 406  GLU B CA  1 
ATOM   7326  C C   . GLU B 1 406 ? 80.948  6.733   -3.241  1.00 7.05  ? 406  GLU B C   1 
ATOM   7327  O O   . GLU B 1 406 ? 81.727  5.842   -2.873  1.00 5.87  ? 406  GLU B O   1 
ATOM   7328  C CB  . GLU B 1 406 ? 82.598  8.534   -3.753  1.00 7.04  ? 406  GLU B CB  1 
ATOM   7329  C CG  . GLU B 1 406 ? 82.269  9.233   -2.436  1.00 6.70  ? 406  GLU B CG  1 
ATOM   7330  C CD  . GLU B 1 406 ? 83.221  10.394  -2.112  1.00 7.09  ? 406  GLU B CD  1 
ATOM   7331  O OE1 . GLU B 1 406 ? 83.272  11.344  -2.929  1.00 6.91  ? 406  GLU B OE1 1 
ATOM   7332  O OE2 . GLU B 1 406 ? 83.839  10.324  -1.039  1.00 4.75  ? 406  GLU B OE2 1 
ATOM   7333  N N   . GLY B 1 407 ? 79.750  6.932   -2.665  1.00 5.75  ? 407  GLY B N   1 
ATOM   7334  C CA  . GLY B 1 407 ? 79.297  6.050   -1.603  1.00 4.30  ? 407  GLY B CA  1 
ATOM   7335  C C   . GLY B 1 407 ? 80.154  6.196   -0.356  1.00 5.65  ? 407  GLY B C   1 
ATOM   7336  O O   . GLY B 1 407 ? 80.657  7.300   -0.068  1.00 6.56  ? 407  GLY B O   1 
ATOM   7337  N N   . SER B 1 408 ? 80.266  5.164   0.487   1.00 3.24  ? 408  SER B N   1 
ATOM   7338  C CA  . SER B 1 408 ? 81.007  5.291   1.724   1.00 4.23  ? 408  SER B CA  1 
ATOM   7339  C C   . SER B 1 408 ? 82.509  5.504   1.585   1.00 4.58  ? 408  SER B C   1 
ATOM   7340  O O   . SER B 1 408 ? 83.105  5.042   0.615   1.00 3.20  ? 408  SER B O   1 
ATOM   7341  C CB  . SER B 1 408 ? 80.863  3.951   2.471   1.00 5.02  ? 408  SER B CB  1 
ATOM   7342  O OG  . SER B 1 408 ? 81.605  2.887   1.856   1.00 5.53  ? 408  SER B OG  1 
ATOM   7343  N N   . PRO B 1 409 ? 83.137  6.067   2.617   1.00 4.52  ? 409  PRO B N   1 
ATOM   7344  C CA  . PRO B 1 409 ? 84.597  6.083   2.686   1.00 4.94  ? 409  PRO B CA  1 
ATOM   7345  C C   . PRO B 1 409 ? 85.060  4.615   2.577   1.00 5.60  ? 409  PRO B C   1 
ATOM   7346  O O   . PRO B 1 409 ? 84.284  3.667   2.799   1.00 4.78  ? 409  PRO B O   1 
ATOM   7347  C CB  . PRO B 1 409 ? 84.910  6.597   4.084   1.00 4.32  ? 409  PRO B CB  1 
ATOM   7348  C CG  . PRO B 1 409 ? 83.683  7.394   4.459   1.00 6.76  ? 409  PRO B CG  1 
ATOM   7349  C CD  . PRO B 1 409 ? 82.505  6.635   3.827   1.00 4.56  ? 409  PRO B CD  1 
ATOM   7350  N N   . THR B 1 410 ? 86.348  4.394   2.316   1.00 5.63  ? 410  THR B N   1 
ATOM   7351  C CA  . THR B 1 410 ? 86.904  3.048   2.200   1.00 5.94  ? 410  THR B CA  1 
ATOM   7352  C C   . THR B 1 410 ? 87.425  2.549   3.531   1.00 7.37  ? 410  THR B C   1 
ATOM   7353  O O   . THR B 1 410 ? 88.648  2.397   3.710   1.00 9.24  ? 410  THR B O   1 
ATOM   7354  C CB  . THR B 1 410 ? 87.969  3.006   1.102   1.00 5.76  ? 410  THR B CB  1 
ATOM   7355  O OG1 . THR B 1 410 ? 87.452  3.570   -0.111  1.00 4.44  ? 410  THR B OG1 1 
ATOM   7356  C CG2 . THR B 1 410 ? 88.365  1.584   0.718   1.00 5.28  ? 410  THR B CG2 1 
ATOM   7357  N N   . HIS B 1 411 ? 86.533  2.295   4.481   1.00 4.71  ? 411  HIS B N   1 
ATOM   7358  C CA  . HIS B 1 411 ? 86.868  1.743   5.791   1.00 6.40  ? 411  HIS B CA  1 
ATOM   7359  C C   . HIS B 1 411 ? 85.585  1.141   6.393   1.00 5.15  ? 411  HIS B C   1 
ATOM   7360  O O   . HIS B 1 411 ? 84.541  1.526   5.876   1.00 7.24  ? 411  HIS B O   1 
ATOM   7361  C CB  . HIS B 1 411 ? 87.486  2.752   6.732   1.00 4.32  ? 411  HIS B CB  1 
ATOM   7362  C CG  . HIS B 1 411 ? 86.784  4.058   6.955   1.00 4.05  ? 411  HIS B CG  1 
ATOM   7363  N ND1 . HIS B 1 411 ? 85.787  4.271   7.877   1.00 3.21  ? 411  HIS B ND1 1 
ATOM   7364  C CD2 . HIS B 1 411 ? 87.038  5.269   6.364   1.00 5.08  ? 411  HIS B CD2 1 
ATOM   7365  C CE1 . HIS B 1 411 ? 85.453  5.535   7.847   1.00 3.67  ? 411  HIS B CE1 1 
ATOM   7366  N NE2 . HIS B 1 411 ? 86.162  6.166   6.935   1.00 3.19  ? 411  HIS B NE2 1 
ATOM   7367  N N   . PRO B 1 412 ? 85.635  0.122   7.231   1.00 5.36  ? 412  PRO B N   1 
ATOM   7368  C CA  . PRO B 1 412 ? 84.490  -0.598  7.712   1.00 4.70  ? 412  PRO B CA  1 
ATOM   7369  C C   . PRO B 1 412 ? 83.409  0.273   8.321   1.00 7.00  ? 412  PRO B C   1 
ATOM   7370  O O   . PRO B 1 412 ? 83.659  1.395   8.802   1.00 5.77  ? 412  PRO B O   1 
ATOM   7371  C CB  . PRO B 1 412 ? 85.044  -1.581  8.730   1.00 5.73  ? 412  PRO B CB  1 
ATOM   7372  C CG  . PRO B 1 412 ? 86.471  -1.797  8.296   1.00 5.53  ? 412  PRO B CG  1 
ATOM   7373  C CD  . PRO B 1 412 ? 86.908  -0.490  7.713   1.00 6.47  ? 412  PRO B CD  1 
ATOM   7374  N N   . SER B 1 413 ? 82.194  -0.296  8.407   1.00 4.94  ? 413  SER B N   1 
ATOM   7375  C CA  . SER B 1 413 ? 81.072  0.487   8.917   1.00 2.08  ? 413  SER B CA  1 
ATOM   7376  C C   . SER B 1 413 ? 81.030  0.838   10.357  1.00 3.65  ? 413  SER B C   1 
ATOM   7377  O O   . SER B 1 413 ? 80.635  1.944   10.759  1.00 3.25  ? 413  SER B O   1 
ATOM   7378  C CB  . SER B 1 413 ? 79.730  -0.291  8.608   1.00 3.45  ? 413  SER B CB  1 
ATOM   7379  O OG  . SER B 1 413 ? 78.690  0.701   8.271   1.00 3.04  ? 413  SER B OG  1 
ATOM   7380  N N   . TYR B 1 414 ? 81.358  -0.085  11.271  1.00 3.77  ? 414  TYR B N   1 
ATOM   7381  C CA  . TYR B 1 414 ? 81.158  0.021   12.690  1.00 2.08  ? 414  TYR B CA  1 
ATOM   7382  C C   . TYR B 1 414 ? 82.357  0.165   13.564  1.00 3.83  ? 414  TYR B C   1 
ATOM   7383  O O   . TYR B 1 414 ? 83.259  -0.693  13.501  1.00 2.91  ? 414  TYR B O   1 
ATOM   7384  C CB  . TYR B 1 414 ? 80.395  -1.298  13.021  1.00 3.92  ? 414  TYR B CB  1 
ATOM   7385  C CG  . TYR B 1 414 ? 80.035  -1.570  14.460  1.00 2.37  ? 414  TYR B CG  1 
ATOM   7386  C CD1 . TYR B 1 414 ? 78.973  -0.804  14.948  1.00 3.47  ? 414  TYR B CD1 1 
ATOM   7387  C CD2 . TYR B 1 414 ? 80.636  -2.497  15.329  1.00 2.08  ? 414  TYR B CD2 1 
ATOM   7388  C CE1 . TYR B 1 414 ? 78.532  -0.937  16.243  1.00 3.13  ? 414  TYR B CE1 1 
ATOM   7389  C CE2 . TYR B 1 414 ? 80.166  -2.658  16.603  1.00 2.08  ? 414  TYR B CE2 1 
ATOM   7390  C CZ  . TYR B 1 414 ? 79.121  -1.890  17.061  1.00 2.72  ? 414  TYR B CZ  1 
ATOM   7391  O OH  . TYR B 1 414 ? 78.682  -1.989  18.358  1.00 3.01  ? 414  TYR B OH  1 
ATOM   7392  N N   . PRO B 1 415 ? 82.403  1.214   14.409  1.00 4.99  ? 415  PRO B N   1 
ATOM   7393  C CA  . PRO B 1 415 ? 81.382  2.249   14.479  1.00 4.48  ? 415  PRO B CA  1 
ATOM   7394  C C   . PRO B 1 415 ? 81.609  3.397   13.511  1.00 5.18  ? 415  PRO B C   1 
ATOM   7395  O O   . PRO B 1 415 ? 82.515  3.423   12.639  1.00 4.71  ? 415  PRO B O   1 
ATOM   7396  C CB  . PRO B 1 415 ? 81.571  2.715   15.924  1.00 4.87  ? 415  PRO B CB  1 
ATOM   7397  C CG  . PRO B 1 415 ? 83.074  2.733   16.070  1.00 6.41  ? 415  PRO B CG  1 
ATOM   7398  C CD  . PRO B 1 415 ? 83.520  1.456   15.368  1.00 4.96  ? 415  PRO B CD  1 
ATOM   7399  N N   . SER B 1 416 ? 80.759  4.434   13.548  1.00 4.37  ? 416  SER B N   1 
ATOM   7400  C CA  . SER B 1 416 ? 80.892  5.601   12.685  1.00 3.73  ? 416  SER B CA  1 
ATOM   7401  C C   . SER B 1 416 ? 81.995  6.454   13.344  1.00 3.58  ? 416  SER B C   1 
ATOM   7402  O O   . SER B 1 416 ? 81.969  6.582   14.571  1.00 4.33  ? 416  SER B O   1 
ATOM   7403  C CB  . SER B 1 416 ? 79.605  6.416   12.608  1.00 3.80  ? 416  SER B CB  1 
ATOM   7404  O OG  . SER B 1 416 ? 79.809  7.727   12.147  1.00 2.91  ? 416  SER B OG  1 
ATOM   7405  N N   . GLY B 1 417 ? 82.934  6.919   12.548  1.00 2.86  ? 417  GLY B N   1 
ATOM   7406  C CA  . GLY B 1 417 ? 84.014  7.772   13.092  1.00 3.43  ? 417  GLY B CA  1 
ATOM   7407  C C   . GLY B 1 417 ? 83.393  9.156   13.344  1.00 2.46  ? 417  GLY B C   1 
ATOM   7408  O O   . GLY B 1 417 ? 83.786  9.850   14.294  1.00 4.01  ? 417  GLY B O   1 
ATOM   7409  N N   . HIS B 1 418 ? 82.466  9.560   12.471  1.00 3.52  ? 418  HIS B N   1 
ATOM   7410  C CA  . HIS B 1 418 ? 81.764  10.831  12.722  1.00 3.95  ? 418  HIS B CA  1 
ATOM   7411  C C   . HIS B 1 418 ? 81.036  10.762  14.040  1.00 4.05  ? 418  HIS B C   1 
ATOM   7412  O O   . HIS B 1 418 ? 81.108  11.689  14.864  1.00 4.30  ? 418  HIS B O   1 
ATOM   7413  C CB  . HIS B 1 418 ? 80.779  11.190  11.597  1.00 3.87  ? 418  HIS B CB  1 
ATOM   7414  C CG  . HIS B 1 418 ? 81.390  11.931  10.458  1.00 4.37  ? 418  HIS B CG  1 
ATOM   7415  N ND1 . HIS B 1 418 ? 82.222  11.436  9.496   1.00 2.08  ? 418  HIS B ND1 1 
ATOM   7416  C CD2 . HIS B 1 418 ? 81.227  13.284  10.166  1.00 4.72  ? 418  HIS B CD2 1 
ATOM   7417  C CE1 . HIS B 1 418 ? 82.537  12.358  8.643   1.00 3.82  ? 418  HIS B CE1 1 
ATOM   7418  N NE2 . HIS B 1 418 ? 81.938  13.507  9.031   1.00 2.08  ? 418  HIS B NE2 1 
ATOM   7419  N N   . ALA B 1 419 ? 80.332  9.678   14.352  1.00 3.33  ? 419  ALA B N   1 
ATOM   7420  C CA  . ALA B 1 419 ? 79.650  9.569   15.638  1.00 3.22  ? 419  ALA B CA  1 
ATOM   7421  C C   . ALA B 1 419 ? 80.626  9.498   16.796  1.00 3.19  ? 419  ALA B C   1 
ATOM   7422  O O   . ALA B 1 419 ? 80.286  9.977   17.903  1.00 2.08  ? 419  ALA B O   1 
ATOM   7423  C CB  . ALA B 1 419 ? 78.690  8.376   15.716  1.00 2.08  ? 419  ALA B CB  1 
ATOM   7424  N N   . THR B 1 420 ? 81.724  8.722   16.651  1.00 2.66  ? 420  THR B N   1 
ATOM   7425  C CA  . THR B 1 420 ? 82.627  8.653   17.822  1.00 4.17  ? 420  THR B CA  1 
ATOM   7426  C C   . THR B 1 420 ? 83.200  10.033  18.165  1.00 3.04  ? 420  THR B C   1 
ATOM   7427  O O   . THR B 1 420 ? 83.228  10.373  19.354  1.00 2.59  ? 420  THR B O   1 
ATOM   7428  C CB  . THR B 1 420 ? 83.789  7.688   17.465  1.00 2.86  ? 420  THR B CB  1 
ATOM   7429  O OG1 . THR B 1 420 ? 83.221  6.395   17.074  1.00 3.70  ? 420  THR B OG1 1 
ATOM   7430  C CG2 . THR B 1 420 ? 84.710  7.487   18.655  1.00 5.19  ? 420  THR B CG2 1 
ATOM   7431  N N   . GLN B 1 421 ? 83.623  10.810  17.147  1.00 3.51  ? 421  GLN B N   1 
ATOM   7432  C CA  . GLN B 1 421 ? 84.217  12.121  17.485  1.00 4.60  ? 421  GLN B CA  1 
ATOM   7433  C C   . GLN B 1 421 ? 83.229  13.125  18.051  1.00 2.28  ? 421  GLN B C   1 
ATOM   7434  O O   . GLN B 1 421 ? 83.480  13.881  18.971  1.00 3.78  ? 421  GLN B O   1 
ATOM   7435  C CB  . GLN B 1 421 ? 84.934  12.628  16.233  1.00 2.08  ? 421  GLN B CB  1 
ATOM   7436  C CG  . GLN B 1 421 ? 84.198  13.073  15.013  1.00 2.08  ? 421  GLN B CG  1 
ATOM   7437  C CD  . GLN B 1 421 ? 84.877  13.111  13.693  1.00 4.94  ? 421  GLN B CD  1 
ATOM   7438  O OE1 . GLN B 1 421 ? 84.153  13.193  12.696  1.00 6.59  ? 421  GLN B OE1 1 
ATOM   7439  N NE2 . GLN B 1 421 ? 86.205  13.087  13.604  1.00 3.94  ? 421  GLN B NE2 1 
ATOM   7440  N N   . ASN B 1 422 ? 81.993  13.106  17.513  1.00 3.43  ? 422  ASN B N   1 
ATOM   7441  C CA  . ASN B 1 422 ? 80.939  14.022  17.983  1.00 2.71  ? 422  ASN B CA  1 
ATOM   7442  C C   . ASN B 1 422 ? 80.470  13.567  19.320  1.00 2.52  ? 422  ASN B C   1 
ATOM   7443  O O   . ASN B 1 422 ? 80.154  14.438  20.149  1.00 2.75  ? 422  ASN B O   1 
ATOM   7444  C CB  . ASN B 1 422 ? 79.851  14.123  16.908  1.00 2.70  ? 422  ASN B CB  1 
ATOM   7445  C CG  . ASN B 1 422 ? 80.279  15.144  15.869  1.00 2.67  ? 422  ASN B CG  1 
ATOM   7446  O OD1 . ASN B 1 422 ? 80.052  16.347  16.137  1.00 4.26  ? 422  ASN B OD1 1 
ATOM   7447  N ND2 . ASN B 1 422 ? 80.821  14.714  14.736  1.00 2.62  ? 422  ASN B ND2 1 
ATOM   7448  N N   . GLY B 1 423 ? 80.601  12.274  19.718  1.00 2.13  ? 423  GLY B N   1 
ATOM   7449  C CA  . GLY B 1 423 ? 80.241  11.895  21.101  1.00 2.79  ? 423  GLY B CA  1 
ATOM   7450  C C   . GLY B 1 423 ? 81.316  12.509  22.029  1.00 2.98  ? 423  GLY B C   1 
ATOM   7451  O O   . GLY B 1 423 ? 80.994  13.002  23.127  1.00 3.28  ? 423  GLY B O   1 
ATOM   7452  N N   . ALA B 1 424 ? 82.587  12.395  21.633  1.00 3.94  ? 424  ALA B N   1 
ATOM   7453  C CA  . ALA B 1 424 ? 83.652  13.021  22.425  1.00 4.38  ? 424  ALA B CA  1 
ATOM   7454  C C   . ALA B 1 424 ? 83.428  14.558  22.509  1.00 2.12  ? 424  ALA B C   1 
ATOM   7455  O O   . ALA B 1 424 ? 83.645  15.081  23.580  1.00 3.07  ? 424  ALA B O   1 
ATOM   7456  C CB  . ALA B 1 424 ? 84.999  12.779  21.734  1.00 4.38  ? 424  ALA B CB  1 
ATOM   7457  N N   . PHE B 1 425 ? 83.214  15.251  21.397  1.00 2.29  ? 425  PHE B N   1 
ATOM   7458  C CA  . PHE B 1 425 ? 83.122  16.722  21.532  1.00 3.07  ? 425  PHE B CA  1 
ATOM   7459  C C   . PHE B 1 425 ? 81.943  17.200  22.352  1.00 2.39  ? 425  PHE B C   1 
ATOM   7460  O O   . PHE B 1 425 ? 82.011  18.093  23.187  1.00 3.81  ? 425  PHE B O   1 
ATOM   7461  C CB  . PHE B 1 425 ? 83.091  17.393  20.159  1.00 2.44  ? 425  PHE B CB  1 
ATOM   7462  C CG  . PHE B 1 425 ? 84.112  16.948  19.166  1.00 3.56  ? 425  PHE B CG  1 
ATOM   7463  C CD1 . PHE B 1 425 ? 85.448  16.708  19.510  1.00 3.42  ? 425  PHE B CD1 1 
ATOM   7464  C CD2 . PHE B 1 425 ? 83.762  16.775  17.848  1.00 2.08  ? 425  PHE B CD2 1 
ATOM   7465  C CE1 . PHE B 1 425 ? 86.337  16.245  18.548  1.00 3.98  ? 425  PHE B CE1 1 
ATOM   7466  C CE2 . PHE B 1 425 ? 84.636  16.330  16.882  1.00 3.37  ? 425  PHE B CE2 1 
ATOM   7467  C CZ  . PHE B 1 425 ? 85.951  16.069  17.230  1.00 3.11  ? 425  PHE B CZ  1 
ATOM   7468  N N   . ALA B 1 426 ? 80.818  16.455  22.257  1.00 4.08  ? 426  ALA B N   1 
ATOM   7469  C CA  . ALA B 1 426 ? 79.594  16.760  23.017  1.00 4.83  ? 426  ALA B CA  1 
ATOM   7470  C C   . ALA B 1 426 ? 79.893  16.634  24.488  1.00 2.79  ? 426  ALA B C   1 
ATOM   7471  O O   . ALA B 1 426 ? 79.480  17.357  25.381  1.00 2.38  ? 426  ALA B O   1 
ATOM   7472  C CB  . ALA B 1 426 ? 78.462  15.798  22.617  1.00 3.49  ? 426  ALA B CB  1 
ATOM   7473  N N   . THR B 1 427 ? 80.736  15.635  24.748  1.00 2.17  ? 427  THR B N   1 
ATOM   7474  C CA  . THR B 1 427 ? 81.136  15.307  26.134  1.00 2.65  ? 427  THR B CA  1 
ATOM   7475  C C   . THR B 1 427 ? 82.041  16.395  26.698  1.00 3.50  ? 427  THR B C   1 
ATOM   7476  O O   . THR B 1 427 ? 81.935  16.746  27.855  1.00 2.98  ? 427  THR B O   1 
ATOM   7477  C CB  . THR B 1 427 ? 81.797  13.919  26.227  1.00 3.99  ? 427  THR B CB  1 
ATOM   7478  O OG1 . THR B 1 427 ? 80.833  12.897  25.813  1.00 3.64  ? 427  THR B OG1 1 
ATOM   7479  C CG2 . THR B 1 427 ? 82.257  13.557  27.627  1.00 2.08  ? 427  THR B CG2 1 
ATOM   7480  N N   . VAL B 1 428 ? 82.968  16.922  25.904  1.00 3.91  ? 428  VAL B N   1 
ATOM   7481  C CA  . VAL B 1 428 ? 83.802  18.036  26.305  1.00 3.40  ? 428  VAL B CA  1 
ATOM   7482  C C   . VAL B 1 428 ? 82.914  19.279  26.563  1.00 2.08  ? 428  VAL B C   1 
ATOM   7483  O O   . VAL B 1 428 ? 83.150  19.909  27.585  1.00 2.93  ? 428  VAL B O   1 
ATOM   7484  C CB  . VAL B 1 428 ? 84.777  18.359  25.142  1.00 2.84  ? 428  VAL B CB  1 
ATOM   7485  C CG1 . VAL B 1 428 ? 85.531  19.654  25.493  1.00 2.91  ? 428  VAL B CG1 1 
ATOM   7486  C CG2 . VAL B 1 428 ? 85.782  17.228  24.893  1.00 2.57  ? 428  VAL B CG2 1 
ATOM   7487  N N   . LEU B 1 429 ? 82.005  19.549  25.632  1.00 2.73  ? 429  LEU B N   1 
ATOM   7488  C CA  . LEU B 1 429 ? 81.203  20.807  25.847  1.00 2.24  ? 429  LEU B CA  1 
ATOM   7489  C C   . LEU B 1 429 ? 80.402  20.709  27.110  1.00 3.24  ? 429  LEU B C   1 
ATOM   7490  O O   . LEU B 1 429 ? 80.525  21.586  27.953  1.00 2.86  ? 429  LEU B O   1 
ATOM   7491  C CB  . LEU B 1 429 ? 80.362  21.019  24.570  1.00 2.08  ? 429  LEU B CB  1 
ATOM   7492  C CG  . LEU B 1 429 ? 81.177  21.365  23.317  1.00 3.45  ? 429  LEU B CG  1 
ATOM   7493  C CD1 . LEU B 1 429 ? 80.268  21.325  22.106  1.00 3.38  ? 429  LEU B CD1 1 
ATOM   7494  C CD2 . LEU B 1 429 ? 81.827  22.790  23.391  1.00 4.51  ? 429  LEU B CD2 1 
ATOM   7495  N N   . LYS B 1 430 ? 79.677  19.605  27.367  1.00 3.06  ? 430  LYS B N   1 
ATOM   7496  C CA  . LYS B 1 430 ? 78.940  19.442  28.618  1.00 2.24  ? 430  LYS B CA  1 
ATOM   7497  C C   . LYS B 1 430 ? 79.741  19.490  29.885  1.00 2.08  ? 430  LYS B C   1 
ATOM   7498  O O   . LYS B 1 430 ? 79.341  20.086  30.897  1.00 2.98  ? 430  LYS B O   1 
ATOM   7499  C CB  . LYS B 1 430 ? 78.129  18.087  28.592  1.00 2.40  ? 430  LYS B CB  1 
ATOM   7500  C CG  . LYS B 1 430 ? 76.995  18.230  27.562  1.00 2.08  ? 430  LYS B CG  1 
ATOM   7501  C CD  . LYS B 1 430 ? 76.124  16.968  27.528  1.00 3.41  ? 430  LYS B CD  1 
ATOM   7502  C CE  . LYS B 1 430 ? 76.827  15.779  26.881  1.00 4.82  ? 430  LYS B CE  1 
ATOM   7503  N NZ  . LYS B 1 430 ? 76.004  14.511  27.040  1.00 5.97  ? 430  LYS B NZ  1 
ATOM   7504  N N   . ALA B 1 431 ? 80.932  18.859  29.908  1.00 3.72  ? 431  ALA B N   1 
ATOM   7505  C CA  . ALA B 1 431 ? 81.769  18.836  31.100  1.00 2.37  ? 431  ALA B CA  1 
ATOM   7506  C C   . ALA B 1 431 ? 82.239  20.252  31.479  1.00 2.08  ? 431  ALA B C   1 
ATOM   7507  O O   . ALA B 1 431 ? 82.208  20.546  32.688  1.00 2.49  ? 431  ALA B O   1 
ATOM   7508  C CB  . ALA B 1 431 ? 82.967  17.889  30.871  1.00 2.59  ? 431  ALA B CB  1 
ATOM   7509  N N   . LEU B 1 432 ? 82.680  21.002  30.477  1.00 3.20  ? 432  LEU B N   1 
ATOM   7510  C CA  . LEU B 1 432 ? 83.194  22.370  30.738  1.00 2.08  ? 432  LEU B CA  1 
ATOM   7511  C C   . LEU B 1 432 ? 82.028  23.278  31.086  1.00 3.75  ? 432  LEU B C   1 
ATOM   7512  O O   . LEU B 1 432 ? 82.220  24.032  32.020  1.00 4.11  ? 432  LEU B O   1 
ATOM   7513  C CB  . LEU B 1 432 ? 84.003  22.835  29.530  1.00 4.25  ? 432  LEU B CB  1 
ATOM   7514  C CG  . LEU B 1 432 ? 85.471  22.311  29.666  1.00 6.83  ? 432  LEU B CG  1 
ATOM   7515  C CD1 . LEU B 1 432 ? 86.151  22.366  28.333  1.00 7.44  ? 432  LEU B CD1 1 
ATOM   7516  C CD2 . LEU B 1 432 ? 86.251  23.121  30.708  1.00 5.69  ? 432  LEU B CD2 1 
ATOM   7517  N N   . ILE B 1 433 ? 80.897  23.165  30.395  1.00 2.67  ? 433  ILE B N   1 
ATOM   7518  C CA  . ILE B 1 433 ? 79.734  23.990  30.738  1.00 2.66  ? 433  ILE B CA  1 
ATOM   7519  C C   . ILE B 1 433 ? 79.224  23.661  32.116  1.00 3.53  ? 433  ILE B C   1 
ATOM   7520  O O   . ILE B 1 433 ? 78.881  24.572  32.870  1.00 4.26  ? 433  ILE B O   1 
ATOM   7521  C CB  . ILE B 1 433 ? 78.644  23.848  29.646  1.00 3.65  ? 433  ILE B CB  1 
ATOM   7522  C CG1 . ILE B 1 433 ? 79.157  24.701  28.506  1.00 2.08  ? 433  ILE B CG1 1 
ATOM   7523  C CG2 . ILE B 1 433 ? 77.284  24.316  30.149  1.00 3.70  ? 433  ILE B CG2 1 
ATOM   7524  C CD1 . ILE B 1 433 ? 78.379  24.499  27.192  1.00 2.40  ? 433  ILE B CD1 1 
ATOM   7525  N N   . GLY B 1 434 ? 79.220  22.390  32.523  1.00 2.98  ? 434  GLY B N   1 
ATOM   7526  C CA  . GLY B 1 434 ? 78.795  22.004  33.856  1.00 3.59  ? 434  GLY B CA  1 
ATOM   7527  C C   . GLY B 1 434 ? 77.299  21.705  33.934  1.00 3.93  ? 434  GLY B C   1 
ATOM   7528  O O   . GLY B 1 434 ? 76.526  22.219  33.123  1.00 3.80  ? 434  GLY B O   1 
ATOM   7529  N N   . LEU B 1 435 ? 76.887  20.860  34.874  1.00 4.24  ? 435  LEU B N   1 
ATOM   7530  C CA  . LEU B 1 435 ? 75.483  20.466  34.995  1.00 4.14  ? 435  LEU B CA  1 
ATOM   7531  C C   . LEU B 1 435 ? 74.483  21.615  35.100  1.00 5.71  ? 435  LEU B C   1 
ATOM   7532  O O   . LEU B 1 435 ? 73.485  21.709  34.370  1.00 4.28  ? 435  LEU B O   1 
ATOM   7533  C CB  . LEU B 1 435 ? 75.336  19.608  36.268  1.00 5.07  ? 435  LEU B CB  1 
ATOM   7534  C CG  . LEU B 1 435 ? 74.026  18.816  36.430  1.00 6.06  ? 435  LEU B CG  1 
ATOM   7535  C CD1 . LEU B 1 435 ? 73.861  17.826  35.292  1.00 4.34  ? 435  LEU B CD1 1 
ATOM   7536  C CD2 . LEU B 1 435 ? 73.968  18.138  37.797  1.00 4.03  ? 435  LEU B CD2 1 
ATOM   7537  N N   . ASP B 1 436 ? 74.731  22.547  36.027  1.00 7.06  ? 436  ASP B N   1 
ATOM   7538  C CA  . ASP B 1 436 ? 73.794  23.673  36.206  1.00 9.09  ? 436  ASP B CA  1 
ATOM   7539  C C   . ASP B 1 436 ? 73.519  24.441  34.944  1.00 7.61  ? 436  ASP B C   1 
ATOM   7540  O O   . ASP B 1 436 ? 72.348  24.596  34.548  1.00 7.42  ? 436  ASP B O   1 
ATOM   7541  C CB  . ASP B 1 436 ? 74.279  24.563  37.358  1.00 14.66 ? 436  ASP B CB  1 
ATOM   7542  C CG  . ASP B 1 436 ? 73.529  25.882  37.354  1.00 20.81 ? 436  ASP B CG  1 
ATOM   7543  O OD1 . ASP B 1 436 ? 72.367  25.852  37.831  1.00 22.67 ? 436  ASP B OD1 1 
ATOM   7544  O OD2 . ASP B 1 436 ? 74.029  26.932  36.846  1.00 23.67 ? 436  ASP B OD2 1 
ATOM   7545  N N   . ARG B 1 437 ? 74.530  24.917  34.202  1.00 6.06  ? 437  ARG B N   1 
ATOM   7546  C CA  . ARG B 1 437 ? 74.282  25.699  32.996  1.00 5.13  ? 437  ARG B CA  1 
ATOM   7547  C C   . ARG B 1 437 ? 73.790  24.818  31.858  1.00 5.73  ? 437  ARG B C   1 
ATOM   7548  O O   . ARG B 1 437 ? 73.093  25.278  30.955  1.00 4.19  ? 437  ARG B O   1 
ATOM   7549  C CB  . ARG B 1 437 ? 75.507  26.529  32.556  1.00 3.02  ? 437  ARG B CB  1 
ATOM   7550  C CG  . ARG B 1 437 ? 75.929  27.536  33.649  1.00 5.51  ? 437  ARG B CG  1 
ATOM   7551  C CD  . ARG B 1 437 ? 77.152  28.355  33.157  1.00 6.08  ? 437  ARG B CD  1 
ATOM   7552  N NE  . ARG B 1 437 ? 78.354  27.509  33.112  1.00 7.73  ? 437  ARG B NE  1 
ATOM   7553  C CZ  . ARG B 1 437 ? 79.610  27.989  33.006  1.00 8.89  ? 437  ARG B CZ  1 
ATOM   7554  N NH1 . ARG B 1 437 ? 79.826  29.308  32.946  1.00 7.61  ? 437  ARG B NH1 1 
ATOM   7555  N NH2 . ARG B 1 437 ? 80.671  27.188  33.001  1.00 6.45  ? 437  ARG B NH2 1 
ATOM   7556  N N   . GLY B 1 438 ? 74.111  23.520  31.938  1.00 5.12  ? 438  GLY B N   1 
ATOM   7557  C CA  . GLY B 1 438 ? 73.668  22.552  30.930  1.00 3.72  ? 438  GLY B CA  1 
ATOM   7558  C C   . GLY B 1 438 ? 72.118  22.506  30.918  1.00 4.79  ? 438  GLY B C   1 
ATOM   7559  O O   . GLY B 1 438 ? 71.570  22.208  29.861  1.00 4.21  ? 438  GLY B O   1 
ATOM   7560  N N   . GLY B 1 439 ? 71.487  22.769  32.054  1.00 5.65  ? 439  GLY B N   1 
ATOM   7561  C CA  . GLY B 1 439 ? 70.037  22.797  32.203  1.00 6.10  ? 439  GLY B CA  1 
ATOM   7562  C C   . GLY B 1 439 ? 69.349  24.094  31.803  1.00 7.88  ? 439  GLY B C   1 
ATOM   7563  O O   . GLY B 1 439 ? 68.093  24.147  31.777  1.00 7.64  ? 439  GLY B O   1 
ATOM   7564  N N   . ASP B 1 440 ? 70.085  25.174  31.491  1.00 6.69  ? 440  ASP B N   1 
ATOM   7565  C CA  . ASP B 1 440 ? 69.485  26.424  31.046  1.00 5.07  ? 440  ASP B CA  1 
ATOM   7566  C C   . ASP B 1 440 ? 68.886  26.242  29.658  1.00 4.47  ? 440  ASP B C   1 
ATOM   7567  O O   . ASP B 1 440 ? 69.368  25.454  28.820  1.00 3.68  ? 440  ASP B O   1 
ATOM   7568  C CB  . ASP B 1 440 ? 70.507  27.599  31.023  1.00 4.60  ? 440  ASP B CB  1 
ATOM   7569  C CG  . ASP B 1 440 ? 70.825  27.990  32.450  1.00 6.06  ? 440  ASP B CG  1 
ATOM   7570  O OD1 . ASP B 1 440 ? 69.945  27.882  33.358  1.00 5.34  ? 440  ASP B OD1 1 
ATOM   7571  O OD2 . ASP B 1 440 ? 71.968  28.392  32.706  1.00 4.21  ? 440  ASP B OD2 1 
ATOM   7572  N N   . CYS B 1 441 ? 67.793  26.976  29.378  1.00 3.78  ? 441  CYS B N   1 
ATOM   7573  C CA  . CYS B 1 441 ? 67.107  26.862  28.101  1.00 2.09  ? 441  CYS B CA  1 
ATOM   7574  C C   . CYS B 1 441 ? 67.729  27.703  27.003  1.00 4.76  ? 441  CYS B C   1 
ATOM   7575  O O   . CYS B 1 441 ? 68.089  28.872  27.264  1.00 7.13  ? 441  CYS B O   1 
ATOM   7576  C CB  . CYS B 1 441 ? 65.635  27.365  28.193  1.00 2.96  ? 441  CYS B CB  1 
ATOM   7577  S SG  . CYS B 1 441 ? 64.724  26.658  29.571  1.00 3.51  ? 441  CYS B SG  1 
ATOM   7578  N N   . TYR B 1 442 ? 67.821  27.184  25.782  1.00 4.29  ? 442  TYR B N   1 
ATOM   7579  C CA  . TYR B 1 442 ? 68.368  27.962  24.684  1.00 5.01  ? 442  TYR B CA  1 
ATOM   7580  C C   . TYR B 1 442 ? 67.528  29.246  24.653  1.00 7.78  ? 442  TYR B C   1 
ATOM   7581  O O   . TYR B 1 442 ? 66.304  29.143  24.518  1.00 5.36  ? 442  TYR B O   1 
ATOM   7582  C CB  . TYR B 1 442 ? 68.301  27.219  23.356  1.00 2.46  ? 442  TYR B CB  1 
ATOM   7583  C CG  . TYR B 1 442 ? 69.218  27.751  22.268  1.00 3.98  ? 442  TYR B CG  1 
ATOM   7584  C CD1 . TYR B 1 442 ? 70.536  27.301  22.204  1.00 3.83  ? 442  TYR B CD1 1 
ATOM   7585  C CD2 . TYR B 1 442 ? 68.771  28.687  21.345  1.00 2.13  ? 442  TYR B CD2 1 
ATOM   7586  C CE1 . TYR B 1 442 ? 71.403  27.767  21.221  1.00 4.98  ? 442  TYR B CE1 1 
ATOM   7587  C CE2 . TYR B 1 442 ? 69.640  29.169  20.390  1.00 5.51  ? 442  TYR B CE2 1 
ATOM   7588  C CZ  . TYR B 1 442 ? 70.953  28.707  20.324  1.00 6.36  ? 442  TYR B CZ  1 
ATOM   7589  O OH  . TYR B 1 442 ? 71.753  29.243  19.351  1.00 4.06  ? 442  TYR B OH  1 
ATOM   7590  N N   . PRO B 1 443 ? 68.188  30.404  24.469  1.00 7.62  ? 443  PRO B N   1 
ATOM   7591  C CA  . PRO B 1 443 ? 67.466  31.657  24.569  1.00 6.47  ? 443  PRO B CA  1 
ATOM   7592  C C   . PRO B 1 443 ? 66.557  31.978  23.425  1.00 4.27  ? 443  PRO B C   1 
ATOM   7593  O O   . PRO B 1 443 ? 65.378  32.307  23.662  1.00 4.61  ? 443  PRO B O   1 
ATOM   7594  C CB  . PRO B 1 443 ? 68.545  32.735  24.795  1.00 7.47  ? 443  PRO B CB  1 
ATOM   7595  C CG  . PRO B 1 443 ? 69.820  32.065  24.346  1.00 9.46  ? 443  PRO B CG  1 
ATOM   7596  C CD  . PRO B 1 443 ? 69.639  30.583  24.625  1.00 7.53  ? 443  PRO B CD  1 
ATOM   7597  N N   . ASP B 1 444 ? 66.989  31.840  22.194  1.00 2.82  ? 444  ASP B N   1 
ATOM   7598  C CA  . ASP B 1 444 ? 66.181  32.192  21.026  1.00 5.96  ? 444  ASP B CA  1 
ATOM   7599  C C   . ASP B 1 444 ? 66.135  31.107  19.973  1.00 5.71  ? 444  ASP B C   1 
ATOM   7600  O O   . ASP B 1 444 ? 66.558  31.229  18.813  1.00 3.10  ? 444  ASP B O   1 
ATOM   7601  C CB  . ASP B 1 444 ? 66.817  33.495  20.468  1.00 9.57  ? 444  ASP B CB  1 
ATOM   7602  C CG  . ASP B 1 444 ? 68.302  33.262  20.113  1.00 14.26 ? 444  ASP B CG  1 
ATOM   7603  O OD1 . ASP B 1 444 ? 69.124  32.608  20.834  1.00 14.60 ? 444  ASP B OD1 1 
ATOM   7604  O OD2 . ASP B 1 444 ? 68.642  33.758  19.006  1.00 16.49 ? 444  ASP B OD2 1 
ATOM   7605  N N   . PRO B 1 445 ? 65.438  29.998  20.288  1.00 5.69  ? 445  PRO B N   1 
ATOM   7606  C CA  . PRO B 1 445 ? 65.409  28.855  19.388  1.00 4.18  ? 445  PRO B CA  1 
ATOM   7607  C C   . PRO B 1 445 ? 64.584  29.112  18.165  1.00 5.00  ? 445  PRO B C   1 
ATOM   7608  O O   . PRO B 1 445 ? 63.573  29.816  18.175  1.00 3.83  ? 445  PRO B O   1 
ATOM   7609  C CB  . PRO B 1 445 ? 64.887  27.707  20.251  1.00 3.54  ? 445  PRO B CB  1 
ATOM   7610  C CG  . PRO B 1 445 ? 64.058  28.403  21.285  1.00 5.16  ? 445  PRO B CG  1 
ATOM   7611  C CD  . PRO B 1 445 ? 64.780  29.704  21.589  1.00 4.11  ? 445  PRO B CD  1 
ATOM   7612  N N   . VAL B 1 446 ? 65.004  28.499  17.056  1.00 3.99  ? 446  VAL B N   1 
ATOM   7613  C CA  . VAL B 1 446 ? 64.329  28.615  15.804  1.00 4.60  ? 446  VAL B CA  1 
ATOM   7614  C C   . VAL B 1 446 ? 64.241  27.271  15.074  1.00 5.82  ? 446  VAL B C   1 
ATOM   7615  O O   . VAL B 1 446 ? 64.885  26.306  15.452  1.00 7.81  ? 446  VAL B O   1 
ATOM   7616  C CB  . VAL B 1 446 ? 65.064  29.558  14.815  1.00 6.11  ? 446  VAL B CB  1 
ATOM   7617  C CG1 . VAL B 1 446 ? 65.003  31.010  15.268  1.00 6.64  ? 446  VAL B CG1 1 
ATOM   7618  C CG2 . VAL B 1 446 ? 66.507  29.099  14.642  1.00 6.43  ? 446  VAL B CG2 1 
ATOM   7619  N N   . TYR B 1 447 ? 63.549  27.301  13.943  1.00 6.07  ? 447  TYR B N   1 
ATOM   7620  C CA  . TYR B 1 447 ? 63.566  26.217  12.986  1.00 7.69  ? 447  TYR B CA  1 
ATOM   7621  C C   . TYR B 1 447 ? 63.469  26.850  11.612  1.00 7.76  ? 447  TYR B C   1 
ATOM   7622  O O   . TYR B 1 447 ? 62.678  27.783  11.436  1.00 8.84  ? 447  TYR B O   1 
ATOM   7623  C CB  . TYR B 1 447 ? 62.507  25.135  13.097  1.00 11.95 ? 447  TYR B CB  1 
ATOM   7624  C CG  . TYR B 1 447 ? 61.062  25.516  12.890  1.00 14.86 ? 447  TYR B CG  1 
ATOM   7625  C CD1 . TYR B 1 447 ? 60.450  25.508  11.665  1.00 16.57 ? 447  TYR B CD1 1 
ATOM   7626  C CD2 . TYR B 1 447 ? 60.271  25.883  13.966  1.00 17.69 ? 447  TYR B CD2 1 
ATOM   7627  C CE1 . TYR B 1 447 ? 59.111  25.832  11.477  1.00 18.33 ? 447  TYR B CE1 1 
ATOM   7628  C CE2 . TYR B 1 447 ? 58.937  26.241  13.782  1.00 18.73 ? 447  TYR B CE2 1 
ATOM   7629  C CZ  . TYR B 1 447 ? 58.354  26.227  12.543  1.00 19.01 ? 447  TYR B CZ  1 
ATOM   7630  O OH  . TYR B 1 447 ? 57.019  26.565  12.367  1.00 19.88 ? 447  TYR B OH  1 
ATOM   7631  N N   . PRO B 1 448 ? 64.252  26.360  10.670  1.00 6.01  ? 448  PRO B N   1 
ATOM   7632  C CA  . PRO B 1 448 ? 64.200  26.818  9.313   1.00 6.24  ? 448  PRO B CA  1 
ATOM   7633  C C   . PRO B 1 448 ? 62.831  26.505  8.695   1.00 8.76  ? 448  PRO B C   1 
ATOM   7634  O O   . PRO B 1 448 ? 62.220  25.481  8.969   1.00 6.76  ? 448  PRO B O   1 
ATOM   7635  C CB  . PRO B 1 448 ? 65.308  26.026  8.616   1.00 5.59  ? 448  PRO B CB  1 
ATOM   7636  C CG  . PRO B 1 448 ? 66.252  25.653  9.728   1.00 4.55  ? 448  PRO B CG  1 
ATOM   7637  C CD  . PRO B 1 448 ? 65.334  25.349  10.880  1.00 5.51  ? 448  PRO B CD  1 
ATOM   7638  N N   . ASP B 1 449 ? 62.321  27.405  7.839   1.00 9.77  ? 449  ASP B N   1 
ATOM   7639  C CA  . ASP B 1 449 ? 61.068  27.137  7.140   1.00 9.94  ? 449  ASP B CA  1 
ATOM   7640  C C   . ASP B 1 449 ? 61.323  25.984  6.169   1.00 9.92  ? 449  ASP B C   1 
ATOM   7641  O O   . ASP B 1 449 ? 62.480  25.521  5.967   1.00 8.83  ? 449  ASP B O   1 
ATOM   7642  C CB  . ASP B 1 449 ? 60.521  28.370  6.444   1.00 10.06 ? 449  ASP B CB  1 
ATOM   7643  C CG  . ASP B 1 449 ? 61.359  28.954  5.331   1.00 12.13 ? 449  ASP B CG  1 
ATOM   7644  O OD1 . ASP B 1 449 ? 62.355  28.388  4.820   1.00 9.13  ? 449  ASP B OD1 1 
ATOM   7645  O OD2 . ASP B 1 449 ? 60.976  30.082  4.891   1.00 11.65 ? 449  ASP B OD2 1 
ATOM   7646  N N   . ASP B 1 450 ? 60.266  25.514  5.497   1.00 7.58  ? 450  ASP B N   1 
ATOM   7647  C CA  . ASP B 1 450 ? 60.428  24.353  4.609   1.00 8.40  ? 450  ASP B CA  1 
ATOM   7648  C C   . ASP B 1 450 ? 61.345  24.573  3.429   1.00 8.21  ? 450  ASP B C   1 
ATOM   7649  O O   . ASP B 1 450 ? 61.876  23.602  2.870   1.00 6.39  ? 450  ASP B O   1 
ATOM   7650  C CB  . ASP B 1 450 ? 59.067  23.873  4.072   1.00 8.36  ? 450  ASP B CB  1 
ATOM   7651  C CG  . ASP B 1 450 ? 58.166  23.329  5.155   1.00 10.20 ? 450  ASP B CG  1 
ATOM   7652  O OD1 . ASP B 1 450 ? 58.550  23.110  6.313   1.00 11.99 ? 450  ASP B OD1 1 
ATOM   7653  O OD2 . ASP B 1 450 ? 57.000  23.056  4.872   1.00 11.47 ? 450  ASP B OD2 1 
ATOM   7654  N N   . ASP B 1 451 ? 61.495  25.815  2.966   1.00 8.33  ? 451  ASP B N   1 
ATOM   7655  C CA  . ASP B 1 451 ? 62.414  26.084  1.863   1.00 9.37  ? 451  ASP B CA  1 
ATOM   7656  C C   . ASP B 1 451 ? 63.857  26.329  2.331   1.00 7.99  ? 451  ASP B C   1 
ATOM   7657  O O   . ASP B 1 451 ? 64.754  26.509  1.494   1.00 8.26  ? 451  ASP B O   1 
ATOM   7658  C CB  . ASP B 1 451 ? 61.968  27.350  1.099   1.00 9.84  ? 451  ASP B CB  1 
ATOM   7659  C CG  . ASP B 1 451 ? 60.706  27.058  0.296   1.00 12.92 ? 451  ASP B CG  1 
ATOM   7660  O OD1 . ASP B 1 451 ? 60.458  25.915  -0.138  1.00 12.81 ? 451  ASP B OD1 1 
ATOM   7661  O OD2 . ASP B 1 451 ? 59.906  28.000  0.116   1.00 15.08 ? 451  ASP B OD2 1 
ATOM   7662  N N   . GLY B 1 452 ? 64.056  26.428  3.618   1.00 8.45  ? 452  GLY B N   1 
ATOM   7663  C CA  . GLY B 1 452 ? 65.363  26.695  4.235   1.00 8.20  ? 452  GLY B CA  1 
ATOM   7664  C C   . GLY B 1 452 ? 65.857  28.104  3.953   1.00 7.52  ? 452  GLY B C   1 
ATOM   7665  O O   . GLY B 1 452 ? 67.060  28.352  3.845   1.00 7.41  ? 452  GLY B O   1 
ATOM   7666  N N   . LEU B 1 453 ? 64.931  29.051  3.786   1.00 6.68  ? 453  LEU B N   1 
ATOM   7667  C CA  . LEU B 1 453 ? 65.275  30.414  3.436   1.00 7.51  ? 453  LEU B CA  1 
ATOM   7668  C C   . LEU B 1 453 ? 65.061  31.378  4.602   1.00 8.13  ? 453  LEU B C   1 
ATOM   7669  O O   . LEU B 1 453 ? 65.607  32.482  4.569   1.00 8.89  ? 453  LEU B O   1 
ATOM   7670  C CB  . LEU B 1 453 ? 64.465  30.828  2.195   1.00 6.68  ? 453  LEU B CB  1 
ATOM   7671  C CG  . LEU B 1 453 ? 64.801  30.103  0.893   1.00 7.61  ? 453  LEU B CG  1 
ATOM   7672  C CD1 . LEU B 1 453 ? 63.884  30.642  -0.207  1.00 7.51  ? 453  LEU B CD1 1 
ATOM   7673  C CD2 . LEU B 1 453 ? 66.270  30.242  0.486   1.00 7.81  ? 453  LEU B CD2 1 
ATOM   7674  N N   . LYS B 1 454 ? 64.297  31.033  5.621   1.00 7.99  ? 454  LYS B N   1 
ATOM   7675  C CA  . LYS B 1 454 ? 64.019  31.891  6.753   1.00 9.90  ? 454  LYS B CA  1 
ATOM   7676  C C   . LYS B 1 454 ? 63.976  31.089  8.048   1.00 7.97  ? 454  LYS B C   1 
ATOM   7677  O O   . LYS B 1 454 ? 63.678  29.897  7.984   1.00 7.22  ? 454  LYS B O   1 
ATOM   7678  C CB  . LYS B 1 454 ? 62.652  32.591  6.616   1.00 12.68 ? 454  LYS B CB  1 
ATOM   7679  C CG  . LYS B 1 454 ? 62.511  33.661  5.545   1.00 17.39 ? 454  LYS B CG  1 
ATOM   7680  C CD  . LYS B 1 454 ? 61.111  34.268  5.644   1.00 21.73 ? 454  LYS B CD  1 
ATOM   7681  C CE  . LYS B 1 454 ? 60.510  34.629  4.284   1.00 25.38 ? 454  LYS B CE  1 
ATOM   7682  N NZ  . LYS B 1 454 ? 60.729  36.046  3.883   1.00 28.09 ? 454  LYS B NZ  1 
ATOM   7683  N N   . LEU B 1 455 ? 64.257  31.718  9.180   1.00 6.73  ? 455  LEU B N   1 
ATOM   7684  C CA  . LEU B 1 455 ? 64.207  31.057  10.460  1.00 7.35  ? 455  LEU B CA  1 
ATOM   7685  C C   . LEU B 1 455 ? 62.910  31.437  11.169  1.00 9.20  ? 455  LEU B C   1 
ATOM   7686  O O   . LEU B 1 455 ? 62.626  32.634  11.203  1.00 10.99 ? 455  LEU B O   1 
ATOM   7687  C CB  . LEU B 1 455 ? 65.375  31.409  11.383  1.00 6.58  ? 455  LEU B CB  1 
ATOM   7688  C CG  . LEU B 1 455 ? 66.762  31.135  10.782  1.00 7.06  ? 455  LEU B CG  1 
ATOM   7689  C CD1 . LEU B 1 455 ? 67.868  31.564  11.734  1.00 6.40  ? 455  LEU B CD1 1 
ATOM   7690  C CD2 . LEU B 1 455 ? 66.861  29.653  10.419  1.00 6.85  ? 455  LEU B CD2 1 
ATOM   7691  N N   . ILE B 1 456 ? 62.166  30.470  11.656  1.00 7.76  ? 456  ILE B N   1 
ATOM   7692  C CA  . ILE B 1 456 ? 60.896  30.689  12.353  1.00 7.64  ? 456  ILE B CA  1 
ATOM   7693  C C   . ILE B 1 456 ? 61.079  30.481  13.842  1.00 6.60  ? 456  ILE B C   1 
ATOM   7694  O O   . ILE B 1 456 ? 61.687  29.461  14.263  1.00 4.73  ? 456  ILE B O   1 
ATOM   7695  C CB  . ILE B 1 456 ? 59.824  29.704  11.852  1.00 9.98  ? 456  ILE B CB  1 
ATOM   7696  C CG1 . ILE B 1 456 ? 59.684  29.727  10.338  1.00 10.98 ? 456  ILE B CG1 1 
ATOM   7697  C CG2 . ILE B 1 456 ? 58.439  29.942  12.477  1.00 9.55  ? 456  ILE B CG2 1 
ATOM   7698  C CD1 . ILE B 1 456 ? 59.481  31.099  9.732   1.00 14.15 ? 456  ILE B CD1 1 
ATOM   7699  N N   . ASP B 1 457 ? 60.592  31.436  14.653  1.00 4.54  ? 457  ASP B N   1 
ATOM   7700  C CA  . ASP B 1 457 ? 60.787  31.307  16.086  1.00 4.76  ? 457  ASP B CA  1 
ATOM   7701  C C   . ASP B 1 457 ? 60.080  30.066  16.610  1.00 7.77  ? 457  ASP B C   1 
ATOM   7702  O O   . ASP B 1 457 ? 58.957  29.785  16.229  1.00 7.68  ? 457  ASP B O   1 
ATOM   7703  C CB  . ASP B 1 457 ? 60.314  32.501  16.928  1.00 5.87  ? 457  ASP B CB  1 
ATOM   7704  C CG  . ASP B 1 457 ? 61.121  33.750  16.566  1.00 7.84  ? 457  ASP B CG  1 
ATOM   7705  O OD1 . ASP B 1 457 ? 62.208  33.719  15.962  1.00 8.55  ? 457  ASP B OD1 1 
ATOM   7706  O OD2 . ASP B 1 457 ? 60.536  34.818  16.822  1.00 2.08  ? 457  ASP B OD2 1 
ATOM   7707  N N   . PHE B 1 458 ? 60.745  29.374  17.541  1.00 7.95  ? 458  PHE B N   1 
ATOM   7708  C CA  . PHE B 1 458 ? 60.180  28.142  18.088  1.00 7.25  ? 458  PHE B CA  1 
ATOM   7709  C C   . PHE B 1 458 ? 59.631  28.430  19.472  1.00 5.56  ? 458  PHE B C   1 
ATOM   7710  O O   . PHE B 1 458 ? 60.221  29.245  20.197  1.00 5.06  ? 458  PHE B O   1 
ATOM   7711  C CB  . PHE B 1 458 ? 61.292  27.049  18.173  1.00 7.03  ? 458  PHE B CB  1 
ATOM   7712  C CG  . PHE B 1 458 ? 60.885  25.872  19.025  1.00 6.33  ? 458  PHE B CG  1 
ATOM   7713  C CD1 . PHE B 1 458 ? 60.034  24.913  18.489  1.00 6.96  ? 458  PHE B CD1 1 
ATOM   7714  C CD2 . PHE B 1 458 ? 61.283  25.761  20.338  1.00 5.99  ? 458  PHE B CD2 1 
ATOM   7715  C CE1 . PHE B 1 458 ? 59.622  23.825  19.268  1.00 6.53  ? 458  PHE B CE1 1 
ATOM   7716  C CE2 . PHE B 1 458 ? 60.870  24.704  21.117  1.00 6.94  ? 458  PHE B CE2 1 
ATOM   7717  C CZ  . PHE B 1 458 ? 60.019  23.728  20.583  1.00 6.05  ? 458  PHE B CZ  1 
ATOM   7718  N N   . ARG B 1 459 ? 58.561  27.762  19.885  1.00 4.47  ? 459  ARG B N   1 
ATOM   7719  C CA  . ARG B 1 459 ? 58.086  27.960  21.263  1.00 7.10  ? 459  ARG B CA  1 
ATOM   7720  C C   . ARG B 1 459 ? 57.450  26.675  21.800  1.00 6.20  ? 459  ARG B C   1 
ATOM   7721  O O   . ARG B 1 459 ? 57.094  25.802  20.988  1.00 4.59  ? 459  ARG B O   1 
ATOM   7722  C CB  . ARG B 1 459 ? 57.059  29.091  21.290  1.00 11.64 ? 459  ARG B CB  1 
ATOM   7723  C CG  . ARG B 1 459 ? 55.698  28.770  20.681  1.00 16.39 ? 459  ARG B CG  1 
ATOM   7724  C CD  . ARG B 1 459 ? 54.825  30.036  20.666  1.00 22.64 ? 459  ARG B CD  1 
ATOM   7725  N NE  . ARG B 1 459 ? 53.554  29.831  19.994  1.00 27.87 ? 459  ARG B NE  1 
ATOM   7726  C CZ  . ARG B 1 459 ? 52.753  30.641  19.309  1.00 29.27 ? 459  ARG B CZ  1 
ATOM   7727  N NH1 . ARG B 1 459 ? 52.995  31.939  19.069  1.00 30.49 ? 459  ARG B NH1 1 
ATOM   7728  N NH2 . ARG B 1 459 ? 51.625  30.119  18.831  1.00 28.43 ? 459  ARG B NH2 1 
ATOM   7729  N N   . GLY B 1 460 ? 57.280  26.571  23.111  1.00 4.85  ? 460  GLY B N   1 
ATOM   7730  C CA  . GLY B 1 460 ? 56.560  25.435  23.664  1.00 5.51  ? 460  GLY B CA  1 
ATOM   7731  C C   . GLY B 1 460 ? 57.426  24.393  24.343  1.00 7.15  ? 460  GLY B C   1 
ATOM   7732  O O   . GLY B 1 460 ? 56.869  23.515  25.008  1.00 5.24  ? 460  GLY B O   1 
ATOM   7733  N N   . SER B 1 461 ? 58.750  24.509  24.200  1.00 4.38  ? 461  SER B N   1 
ATOM   7734  C CA  . SER B 1 461 ? 59.659  23.687  24.968  1.00 3.98  ? 461  SER B CA  1 
ATOM   7735  C C   . SER B 1 461 ? 60.933  24.479  25.341  1.00 4.11  ? 461  SER B C   1 
ATOM   7736  O O   . SER B 1 461 ? 61.434  25.275  24.573  1.00 5.04  ? 461  SER B O   1 
ATOM   7737  C CB  . SER B 1 461 ? 60.119  22.397  24.278  1.00 4.10  ? 461  SER B CB  1 
ATOM   7738  O OG  . SER B 1 461 ? 59.024  21.504  24.090  1.00 5.61  ? 461  SER B OG  1 
ATOM   7739  N N   . CYS B 1 462 ? 61.439  24.204  26.509  1.00 4.32  ? 462  CYS B N   1 
ATOM   7740  C CA  . CYS B 1 462 ? 62.747  24.676  26.927  1.00 5.39  ? 462  CYS B CA  1 
ATOM   7741  C C   . CYS B 1 462 ? 63.779  23.754  26.248  1.00 4.64  ? 462  CYS B C   1 
ATOM   7742  O O   . CYS B 1 462 ? 63.844  22.569  26.638  1.00 4.05  ? 462  CYS B O   1 
ATOM   7743  C CB  . CYS B 1 462 ? 62.877  24.510  28.438  1.00 3.66  ? 462  CYS B CB  1 
ATOM   7744  S SG  . CYS B 1 462 ? 64.583  24.678  29.061  1.00 2.90  ? 462  CYS B SG  1 
ATOM   7745  N N   . LEU B 1 463 ? 64.540  24.238  25.275  1.00 3.74  ? 463  LEU B N   1 
ATOM   7746  C CA  . LEU B 1 463 ? 65.558  23.371  24.662  1.00 3.62  ? 463  LEU B CA  1 
ATOM   7747  C C   . LEU B 1 463 ? 66.841  23.479  25.490  1.00 4.11  ? 463  LEU B C   1 
ATOM   7748  O O   . LEU B 1 463 ? 67.539  24.497  25.290  1.00 3.53  ? 463  LEU B O   1 
ATOM   7749  C CB  . LEU B 1 463 ? 65.802  23.775  23.215  1.00 4.21  ? 463  LEU B CB  1 
ATOM   7750  C CG  . LEU B 1 463 ? 64.535  23.865  22.351  1.00 4.84  ? 463  LEU B CG  1 
ATOM   7751  C CD1 . LEU B 1 463 ? 64.900  24.154  20.908  1.00 3.09  ? 463  LEU B CD1 1 
ATOM   7752  C CD2 . LEU B 1 463 ? 63.752  22.551  22.475  1.00 4.70  ? 463  LEU B CD2 1 
ATOM   7753  N N   . THR B 1 464 ? 67.108  22.588  26.442  1.00 2.08  ? 464  THR B N   1 
ATOM   7754  C CA  . THR B 1 464 ? 68.306  22.814  27.273  1.00 3.58  ? 464  THR B CA  1 
ATOM   7755  C C   . THR B 1 464 ? 69.589  22.852  26.450  1.00 3.45  ? 464  THR B C   1 
ATOM   7756  O O   . THR B 1 464 ? 69.636  22.253  25.383  1.00 3.61  ? 464  THR B O   1 
ATOM   7757  C CB  . THR B 1 464 ? 68.409  21.775  28.405  1.00 4.10  ? 464  THR B CB  1 
ATOM   7758  O OG1 . THR B 1 464 ? 68.665  20.486  27.830  1.00 2.55  ? 464  THR B OG1 1 
ATOM   7759  C CG2 . THR B 1 464 ? 67.098  21.731  29.189  1.00 4.93  ? 464  THR B CG2 1 
ATOM   7760  N N   . PHE B 1 465 ? 70.644  23.533  26.926  1.00 2.08  ? 465  PHE B N   1 
ATOM   7761  C CA  . PHE B 1 465 ? 71.915  23.550  26.202  1.00 2.08  ? 465  PHE B CA  1 
ATOM   7762  C C   . PHE B 1 465 ? 72.470  22.129  26.071  1.00 2.08  ? 465  PHE B C   1 
ATOM   7763  O O   . PHE B 1 465 ? 72.889  21.690  24.996  1.00 2.08  ? 465  PHE B O   1 
ATOM   7764  C CB  . PHE B 1 465 ? 72.868  24.458  27.011  1.00 2.22  ? 465  PHE B CB  1 
ATOM   7765  C CG  . PHE B 1 465 ? 72.643  25.937  26.761  1.00 3.67  ? 465  PHE B CG  1 
ATOM   7766  C CD1 . PHE B 1 465 ? 72.651  26.442  25.470  1.00 3.61  ? 465  PHE B CD1 1 
ATOM   7767  C CD2 . PHE B 1 465 ? 72.434  26.798  27.805  1.00 2.08  ? 465  PHE B CD2 1 
ATOM   7768  C CE1 . PHE B 1 465 ? 72.474  27.794  25.242  1.00 3.42  ? 465  PHE B CE1 1 
ATOM   7769  C CE2 . PHE B 1 465 ? 72.257  28.163  27.575  1.00 3.63  ? 465  PHE B CE2 1 
ATOM   7770  C CZ  . PHE B 1 465 ? 72.280  28.672  26.298  1.00 2.74  ? 465  PHE B CZ  1 
ATOM   7771  N N   . GLU B 1 466 ? 72.489  21.374  27.167  1.00 2.08  ? 466  GLU B N   1 
ATOM   7772  C CA  . GLU B 1 466 ? 72.974  19.976  27.091  1.00 4.04  ? 466  GLU B CA  1 
ATOM   7773  C C   . GLU B 1 466 ? 72.187  19.150  26.080  1.00 4.07  ? 466  GLU B C   1 
ATOM   7774  O O   . GLU B 1 466 ? 72.681  18.328  25.288  1.00 3.12  ? 466  GLU B O   1 
ATOM   7775  C CB  . GLU B 1 466 ? 72.968  19.329  28.470  1.00 4.18  ? 466  GLU B CB  1 
ATOM   7776  C CG  . GLU B 1 466 ? 71.623  19.000  29.076  1.00 6.15  ? 466  GLU B CG  1 
ATOM   7777  C CD  . GLU B 1 466 ? 71.605  18.573  30.514  1.00 9.48  ? 466  GLU B CD  1 
ATOM   7778  O OE1 . GLU B 1 466 ? 72.503  18.978  31.332  1.00 9.76  ? 466  GLU B OE1 1 
ATOM   7779  O OE2 . GLU B 1 466 ? 70.660  17.811  30.862  1.00 7.72  ? 466  GLU B OE2 1 
ATOM   7780  N N   . GLY B 1 467 ? 70.869  19.412  26.000  1.00 4.61  ? 467  GLY B N   1 
ATOM   7781  C CA  . GLY B 1 467 ? 70.011  18.738  25.003  1.00 3.87  ? 467  GLY B CA  1 
ATOM   7782  C C   . GLY B 1 467 ? 70.347  19.143  23.590  1.00 4.08  ? 467  GLY B C   1 
ATOM   7783  O O   . GLY B 1 467 ? 70.404  18.337  22.644  1.00 3.76  ? 467  GLY B O   1 
ATOM   7784  N N   . GLU B 1 468 ? 70.655  20.423  23.347  1.00 4.09  ? 468  GLU B N   1 
ATOM   7785  C CA  . GLU B 1 468 ? 70.958  20.851  21.981  1.00 3.68  ? 468  GLU B CA  1 
ATOM   7786  C C   . GLU B 1 468 ? 72.383  20.429  21.580  1.00 2.17  ? 468  GLU B C   1 
ATOM   7787  O O   . GLU B 1 468 ? 72.737  20.316  20.399  1.00 2.37  ? 468  GLU B O   1 
ATOM   7788  C CB  . GLU B 1 468 ? 70.727  22.352  21.808  1.00 3.63  ? 468  GLU B CB  1 
ATOM   7789  C CG  . GLU B 1 468 ? 69.260  22.797  21.973  1.00 3.05  ? 468  GLU B CG  1 
ATOM   7790  C CD  . GLU B 1 468 ? 68.377  22.100  20.955  1.00 3.73  ? 468  GLU B CD  1 
ATOM   7791  O OE1 . GLU B 1 468 ? 68.591  22.306  19.753  1.00 4.23  ? 468  GLU B OE1 1 
ATOM   7792  O OE2 . GLU B 1 468 ? 67.484  21.334  21.371  1.00 4.10  ? 468  GLU B OE2 1 
ATOM   7793  N N   . ILE B 1 469 ? 73.243  20.244  22.574  1.00 3.52  ? 469  ILE B N   1 
ATOM   7794  C CA  . ILE B 1 469 ? 74.605  19.746  22.354  1.00 2.66  ? 469  ILE B CA  1 
ATOM   7795  C C   . ILE B 1 469 ? 74.488  18.260  21.969  1.00 2.96  ? 469  ILE B C   1 
ATOM   7796  O O   . ILE B 1 469 ? 75.041  17.799  20.967  1.00 2.22  ? 469  ILE B O   1 
ATOM   7797  C CB  . ILE B 1 469 ? 75.457  19.883  23.618  1.00 2.43  ? 469  ILE B CB  1 
ATOM   7798  C CG1 . ILE B 1 469 ? 75.772  21.390  23.855  1.00 2.28  ? 469  ILE B CG1 1 
ATOM   7799  C CG2 . ILE B 1 469 ? 76.700  18.980  23.566  1.00 3.05  ? 469  ILE B CG2 1 
ATOM   7800  C CD1 . ILE B 1 469 ? 76.362  21.622  25.250  1.00 3.51  ? 469  ILE B CD1 1 
ATOM   7801  N N   . ASN B 1 470 ? 73.697  17.490  22.741  1.00 3.11  ? 470  ASN B N   1 
ATOM   7802  C CA  . ASN B 1 470 ? 73.424  16.094  22.393  1.00 3.15  ? 470  ASN B CA  1 
ATOM   7803  C C   . ASN B 1 470 ? 72.789  16.001  21.021  1.00 3.09  ? 470  ASN B C   1 
ATOM   7804  O O   . ASN B 1 470 ? 73.150  15.148  20.207  1.00 2.35  ? 470  ASN B O   1 
ATOM   7805  C CB  . ASN B 1 470 ? 72.426  15.391  23.328  1.00 2.44  ? 470  ASN B CB  1 
ATOM   7806  C CG  . ASN B 1 470 ? 73.038  15.214  24.667  1.00 2.42  ? 470  ASN B CG  1 
ATOM   7807  O OD1 . ASN B 1 470 ? 74.273  15.321  24.823  1.00 3.46  ? 470  ASN B OD1 1 
ATOM   7808  N ND2 . ASN B 1 470 ? 72.258  14.971  25.714  1.00 3.25  ? 470  ASN B ND2 1 
ATOM   7809  N N   . LYS B 1 471 ? 71.843  16.942  20.735  1.00 4.07  ? 471  LYS B N   1 
ATOM   7810  C CA  . LYS B 1 471 ? 71.175  16.819  19.434  1.00 3.27  ? 471  LYS B CA  1 
ATOM   7811  C C   . LYS B 1 471 ? 72.135  16.967  18.260  1.00 3.60  ? 471  LYS B C   1 
ATOM   7812  O O   . LYS B 1 471 ? 71.962  16.404  17.192  1.00 3.34  ? 471  LYS B O   1 
ATOM   7813  C CB  . LYS B 1 471 ? 70.041  17.839  19.329  1.00 3.05  ? 471  LYS B CB  1 
ATOM   7814  C CG  . LYS B 1 471 ? 69.093  17.597  18.143  1.00 2.31  ? 471  LYS B CG  1 
ATOM   7815  C CD  . LYS B 1 471 ? 68.036  18.725  18.132  1.00 2.08  ? 471  LYS B CD  1 
ATOM   7816  C CE  . LYS B 1 471 ? 66.994  18.495  19.231  1.00 3.30  ? 471  LYS B CE  1 
ATOM   7817  N NZ  . LYS B 1 471 ? 66.050  19.631  19.427  1.00 3.36  ? 471  LYS B NZ  1 
ATOM   7818  N N   . LEU B 1 472 ? 73.037  17.937  18.387  1.00 3.47  ? 472  LEU B N   1 
ATOM   7819  C CA  . LEU B 1 472 ? 74.029  18.185  17.320  1.00 3.76  ? 472  LEU B CA  1 
ATOM   7820  C C   . LEU B 1 472 ? 74.870  16.924  17.046  1.00 2.08  ? 472  LEU B C   1 
ATOM   7821  O O   . LEU B 1 472 ? 75.125  16.604  15.899  1.00 2.50  ? 472  LEU B O   1 
ATOM   7822  C CB  . LEU B 1 472 ? 74.962  19.329  17.795  1.00 4.22  ? 472  LEU B CB  1 
ATOM   7823  C CG  . LEU B 1 472 ? 76.213  19.551  16.945  1.00 5.22  ? 472  LEU B CG  1 
ATOM   7824  C CD1 . LEU B 1 472 ? 75.761  19.760  15.519  1.00 6.40  ? 472  LEU B CD1 1 
ATOM   7825  C CD2 . LEU B 1 472 ? 77.007  20.789  17.349  1.00 6.94  ? 472  LEU B CD2 1 
ATOM   7826  N N   . ALA B 1 473 ? 75.317  16.290  18.124  1.00 2.58  ? 473  ALA B N   1 
ATOM   7827  C CA  . ALA B 1 473 ? 76.109  15.063  17.949  1.00 4.50  ? 473  ALA B CA  1 
ATOM   7828  C C   . ALA B 1 473 ? 75.285  13.970  17.252  1.00 4.44  ? 473  ALA B C   1 
ATOM   7829  O O   . ALA B 1 473 ? 75.763  13.375  16.292  1.00 4.38  ? 473  ALA B O   1 
ATOM   7830  C CB  . ALA B 1 473 ? 76.515  14.621  19.346  1.00 2.08  ? 473  ALA B CB  1 
ATOM   7831  N N   . VAL B 1 474 ? 74.019  13.820  17.684  1.00 3.97  ? 474  VAL B N   1 
ATOM   7832  C CA  . VAL B 1 474 ? 73.168  12.799  17.019  1.00 2.95  ? 474  VAL B CA  1 
ATOM   7833  C C   . VAL B 1 474 ? 72.830  13.234  15.623  1.00 2.48  ? 474  VAL B C   1 
ATOM   7834  O O   . VAL B 1 474 ? 72.753  12.423  14.686  1.00 3.43  ? 474  VAL B O   1 
ATOM   7835  C CB  . VAL B 1 474 ? 71.904  12.523  17.878  1.00 2.08  ? 474  VAL B CB  1 
ATOM   7836  C CG1 . VAL B 1 474 ? 70.889  11.631  17.161  1.00 2.09  ? 474  VAL B CG1 1 
ATOM   7837  C CG2 . VAL B 1 474 ? 72.314  11.923  19.209  1.00 2.08  ? 474  VAL B CG2 1 
ATOM   7838  N N   . ASN B 1 475 ? 72.675  14.567  15.364  1.00 2.08  ? 475  ASN B N   1 
ATOM   7839  C CA  . ASN B 1 475 ? 72.445  15.003  13.978  1.00 2.98  ? 475  ASN B CA  1 
ATOM   7840  C C   . ASN B 1 475 ? 73.673  14.674  13.094  1.00 3.63  ? 475  ASN B C   1 
ATOM   7841  O O   . ASN B 1 475 ? 73.540  14.350  11.919  1.00 3.81  ? 475  ASN B O   1 
ATOM   7842  C CB  . ASN B 1 475 ? 72.226  16.504  13.847  1.00 2.09  ? 475  ASN B CB  1 
ATOM   7843  C CG  . ASN B 1 475 ? 70.974  17.147  14.420  1.00 2.30  ? 475  ASN B CG  1 
ATOM   7844  O OD1 . ASN B 1 475 ? 70.978  18.334  14.804  1.00 2.08  ? 475  ASN B OD1 1 
ATOM   7845  N ND2 . ASN B 1 475 ? 69.865  16.402  14.534  1.00 3.12  ? 475  ASN B ND2 1 
ATOM   7846  N N   . VAL B 1 476 ? 74.892  14.848  13.691  1.00 2.08  ? 476  VAL B N   1 
ATOM   7847  C CA  . VAL B 1 476 ? 76.043  14.566  12.801  1.00 2.08  ? 476  VAL B CA  1 
ATOM   7848  C C   . VAL B 1 476 ? 76.085  13.057  12.592  1.00 2.08  ? 476  VAL B C   1 
ATOM   7849  O O   . VAL B 1 476 ? 76.311  12.657  11.428  1.00 3.17  ? 476  VAL B O   1 
ATOM   7850  C CB  . VAL B 1 476 ? 77.404  15.117  13.271  1.00 3.42  ? 476  VAL B CB  1 
ATOM   7851  C CG1 . VAL B 1 476 ? 78.521  14.787  12.267  1.00 2.08  ? 476  VAL B CG1 1 
ATOM   7852  C CG2 . VAL B 1 476 ? 77.297  16.648  13.455  1.00 3.02  ? 476  VAL B CG2 1 
ATOM   7853  N N   . ALA B 1 477 ? 75.902  12.213  13.585  1.00 3.12  ? 477  ALA B N   1 
ATOM   7854  C CA  . ALA B 1 477 ? 75.973  10.757  13.410  1.00 3.15  ? 477  ALA B CA  1 
ATOM   7855  C C   . ALA B 1 477 ? 74.903  10.312  12.417  1.00 3.91  ? 477  ALA B C   1 
ATOM   7856  O O   . ALA B 1 477 ? 75.175  9.737   11.372  1.00 3.93  ? 477  ALA B O   1 
ATOM   7857  C CB  . ALA B 1 477 ? 75.909  10.052  14.765  1.00 2.08  ? 477  ALA B CB  1 
ATOM   7858  N N   . PHE B 1 478 ? 73.677  10.805  12.622  1.00 3.63  ? 478  PHE B N   1 
ATOM   7859  C CA  . PHE B 1 478 ? 72.564  10.375  11.745  1.00 3.60  ? 478  PHE B CA  1 
ATOM   7860  C C   . PHE B 1 478 ? 72.602  10.969  10.378  1.00 4.05  ? 478  PHE B C   1 
ATOM   7861  O O   . PHE B 1 478 ? 72.067  10.412  9.403   1.00 4.18  ? 478  PHE B O   1 
ATOM   7862  C CB  . PHE B 1 478 ? 71.200  10.599  12.419  1.00 4.63  ? 478  PHE B CB  1 
ATOM   7863  C CG  . PHE B 1 478 ? 70.836  9.667   13.523  1.00 4.26  ? 478  PHE B CG  1 
ATOM   7864  C CD1 . PHE B 1 478 ? 71.780  8.879   14.157  1.00 2.75  ? 478  PHE B CD1 1 
ATOM   7865  C CD2 . PHE B 1 478 ? 69.516  9.586   13.959  1.00 4.80  ? 478  PHE B CD2 1 
ATOM   7866  C CE1 . PHE B 1 478 ? 71.437  8.020   15.186  1.00 3.86  ? 478  PHE B CE1 1 
ATOM   7867  C CE2 . PHE B 1 478 ? 69.167  8.714   14.985  1.00 4.60  ? 478  PHE B CE2 1 
ATOM   7868  C CZ  . PHE B 1 478 ? 70.116  7.928   15.608  1.00 3.94  ? 478  PHE B CZ  1 
ATOM   7869  N N   . GLY B 1 479 ? 73.272  12.107  10.214  1.00 4.05  ? 479  GLY B N   1 
ATOM   7870  C CA  . GLY B 1 479 ? 73.449  12.653  8.866   1.00 2.08  ? 479  GLY B CA  1 
ATOM   7871  C C   . GLY B 1 479 ? 74.319  11.713  8.010   1.00 2.08  ? 479  GLY B C   1 
ATOM   7872  O O   . GLY B 1 479 ? 74.093  11.631  6.802   1.00 2.53  ? 479  GLY B O   1 
ATOM   7873  N N   . ARG B 1 480 ? 75.289  11.023  8.584   1.00 2.85  ? 480  ARG B N   1 
ATOM   7874  C CA  . ARG B 1 480 ? 76.053  10.056  7.769   1.00 3.28  ? 480  ARG B CA  1 
ATOM   7875  C C   . ARG B 1 480 ? 75.115  8.922   7.336   1.00 3.34  ? 480  ARG B C   1 
ATOM   7876  O O   . ARG B 1 480 ? 75.220  8.478   6.197   1.00 3.84  ? 480  ARG B O   1 
ATOM   7877  C CB  . ARG B 1 480 ? 77.151  9.437   8.617   1.00 2.08  ? 480  ARG B CB  1 
ATOM   7878  C CG  . ARG B 1 480 ? 78.111  10.467  9.270   1.00 2.69  ? 480  ARG B CG  1 
ATOM   7879  C CD  . ARG B 1 480 ? 78.863  11.147  8.108   1.00 3.98  ? 480  ARG B CD  1 
ATOM   7880  N NE  . ARG B 1 480 ? 79.984  10.374  7.575   1.00 5.22  ? 480  ARG B NE  1 
ATOM   7881  C CZ  . ARG B 1 480 ? 80.691  10.629  6.469   1.00 4.68  ? 480  ARG B CZ  1 
ATOM   7882  N NH1 . ARG B 1 480 ? 80.451  11.648  5.650   1.00 4.39  ? 480  ARG B NH1 1 
ATOM   7883  N NH2 . ARG B 1 480 ? 81.727  9.845   6.111   1.00 2.98  ? 480  ARG B NH2 1 
ATOM   7884  N N   . GLN B 1 481 ? 74.264  8.468   8.266   1.00 3.04  ? 481  GLN B N   1 
ATOM   7885  C CA  . GLN B 1 481 ? 73.254  7.453   7.924   1.00 3.31  ? 481  GLN B CA  1 
ATOM   7886  C C   . GLN B 1 481 ? 72.345  7.966   6.826   1.00 2.22  ? 481  GLN B C   1 
ATOM   7887  O O   . GLN B 1 481 ? 72.083  7.261   5.844   1.00 3.38  ? 481  GLN B O   1 
ATOM   7888  C CB  . GLN B 1 481 ? 72.439  7.083   9.180   1.00 3.41  ? 481  GLN B CB  1 
ATOM   7889  C CG  . GLN B 1 481 ? 73.333  6.465   10.241  1.00 3.07  ? 481  GLN B CG  1 
ATOM   7890  C CD  . GLN B 1 481 ? 72.872  6.530   11.658  1.00 3.26  ? 481  GLN B CD  1 
ATOM   7891  O OE1 . GLN B 1 481 ? 73.679  6.701   12.585  1.00 3.82  ? 481  GLN B OE1 1 
ATOM   7892  N NE2 . GLN B 1 481 ? 71.555  6.378   11.895  1.00 3.48  ? 481  GLN B NE2 1 
ATOM   7893  N N   . MET B 1 482 ? 71.974  9.267   6.870   1.00 2.72  ? 482  MET B N   1 
ATOM   7894  C CA  . MET B 1 482 ? 71.170  9.826   5.776   1.00 3.61  ? 482  MET B CA  1 
ATOM   7895  C C   . MET B 1 482 ? 71.920  9.916   4.470   1.00 2.64  ? 482  MET B C   1 
ATOM   7896  O O   . MET B 1 482 ? 71.289  10.068  3.406   1.00 3.03  ? 482  MET B O   1 
ATOM   7897  C CB  . MET B 1 482 ? 70.613  11.192  6.182   1.00 3.82  ? 482  MET B CB  1 
ATOM   7898  C CG  . MET B 1 482 ? 69.695  11.082  7.405   1.00 3.40  ? 482  MET B CG  1 
ATOM   7899  S SD  . MET B 1 482 ? 69.437  12.673  8.234   1.00 4.07  ? 482  MET B SD  1 
ATOM   7900  C CE  . MET B 1 482 ? 68.280  12.174  9.509   1.00 2.51  ? 482  MET B CE  1 
ATOM   7901  N N   . LEU B 1 483 ? 73.276  9.873   4.464   1.00 2.27  ? 483  LEU B N   1 
ATOM   7902  C CA  . LEU B 1 483 ? 73.989  9.825   3.191   1.00 2.08  ? 483  LEU B CA  1 
ATOM   7903  C C   . LEU B 1 483 ? 73.802  8.449   2.511   1.00 3.24  ? 483  LEU B C   1 
ATOM   7904  O O   . LEU B 1 483 ? 74.031  8.281   1.304   1.00 2.90  ? 483  LEU B O   1 
ATOM   7905  C CB  . LEU B 1 483 ? 75.520  9.985   3.394   1.00 4.27  ? 483  LEU B CB  1 
ATOM   7906  C CG  . LEU B 1 483 ? 76.044  11.402  3.664   1.00 3.98  ? 483  LEU B CG  1 
ATOM   7907  C CD1 . LEU B 1 483 ? 77.500  11.361  4.130   1.00 3.41  ? 483  LEU B CD1 1 
ATOM   7908  C CD2 . LEU B 1 483 ? 75.837  12.288  2.432   1.00 4.59  ? 483  LEU B CD2 1 
ATOM   7909  N N   . GLY B 1 484 ? 73.513  7.419   3.315   1.00 2.77  ? 484  GLY B N   1 
ATOM   7910  C CA  . GLY B 1 484 ? 73.352  6.058   2.827   1.00 3.17  ? 484  GLY B CA  1 
ATOM   7911  C C   . GLY B 1 484 ? 74.492  5.161   3.260   1.00 4.03  ? 484  GLY B C   1 
ATOM   7912  O O   . GLY B 1 484 ? 74.638  4.032   2.810   1.00 4.36  ? 484  GLY B O   1 
ATOM   7913  N N   . ILE B 1 485 ? 75.403  5.682   4.116   1.00 5.77  ? 485  ILE B N   1 
ATOM   7914  C CA  . ILE B 1 485 ? 76.640  5.009   4.449   1.00 4.02  ? 485  ILE B CA  1 
ATOM   7915  C C   . ILE B 1 485 ? 76.886  4.494   5.832   1.00 3.88  ? 485  ILE B C   1 
ATOM   7916  O O   . ILE B 1 485 ? 77.970  3.939   6.132   1.00 3.57  ? 485  ILE B O   1 
ATOM   7917  C CB  . ILE B 1 485 ? 77.802  5.972   4.063   1.00 3.55  ? 485  ILE B CB  1 
ATOM   7918  C CG1 . ILE B 1 485 ? 77.876  7.229   4.945   1.00 3.61  ? 485  ILE B CG1 1 
ATOM   7919  C CG2 . ILE B 1 485 ? 77.702  6.349   2.593   1.00 2.08  ? 485  ILE B CG2 1 
ATOM   7920  C CD1 . ILE B 1 485 ? 79.197  7.952   4.810   1.00 2.08  ? 485  ILE B CD1 1 
ATOM   7921  N N   . HIS B 1 486 ? 75.916  4.541   6.738   1.00 3.62  ? 486  HIS B N   1 
ATOM   7922  C CA  . HIS B 1 486 ? 76.068  4.032   8.099   1.00 4.34  ? 486  HIS B CA  1 
ATOM   7923  C C   . HIS B 1 486 ? 74.689  3.548   8.617   1.00 4.67  ? 486  HIS B C   1 
ATOM   7924  O O   . HIS B 1 486 ? 73.661  3.967   8.077   1.00 4.09  ? 486  HIS B O   1 
ATOM   7925  C CB  . HIS B 1 486 ? 76.639  5.087   9.061   1.00 4.23  ? 486  HIS B CB  1 
ATOM   7926  C CG  . HIS B 1 486 ? 78.136  5.231   9.114   1.00 7.43  ? 486  HIS B CG  1 
ATOM   7927  N ND1 . HIS B 1 486 ? 78.980  4.181   9.487   1.00 7.96  ? 486  HIS B ND1 1 
ATOM   7928  C CD2 . HIS B 1 486 ? 78.959  6.269   8.789   1.00 5.69  ? 486  HIS B CD2 1 
ATOM   7929  C CE1 . HIS B 1 486 ? 80.231  4.646   9.414   1.00 8.74  ? 486  HIS B CE1 1 
ATOM   7930  N NE2 . HIS B 1 486 ? 80.290  5.912   8.990   1.00 6.91  ? 486  HIS B NE2 1 
ATOM   7931  N N   . TYR B 1 487 ? 74.719  2.688   9.607   1.00 2.66  ? 487  TYR B N   1 
ATOM   7932  C CA  . TYR B 1 487 ? 73.511  2.231   10.251  1.00 5.44  ? 487  TYR B CA  1 
ATOM   7933  C C   . TYR B 1 487 ? 73.409  2.935   11.597  1.00 5.92  ? 487  TYR B C   1 
ATOM   7934  O O   . TYR B 1 487 ? 74.399  3.388   12.180  1.00 5.90  ? 487  TYR B O   1 
ATOM   7935  C CB  . TYR B 1 487 ? 73.512  0.710   10.512  1.00 3.43  ? 487  TYR B CB  1 
ATOM   7936  C CG  . TYR B 1 487 ? 74.006  -0.198  9.432   1.00 3.03  ? 487  TYR B CG  1 
ATOM   7937  C CD1 . TYR B 1 487 ? 75.360  -0.452  9.216   1.00 3.33  ? 487  TYR B CD1 1 
ATOM   7938  C CD2 . TYR B 1 487 ? 73.113  -0.889  8.613   1.00 4.18  ? 487  TYR B CD2 1 
ATOM   7939  C CE1 . TYR B 1 487 ? 75.830  -1.312  8.241   1.00 3.75  ? 487  TYR B CE1 1 
ATOM   7940  C CE2 . TYR B 1 487 ? 73.551  -1.747  7.601   1.00 3.48  ? 487  TYR B CE2 1 
ATOM   7941  C CZ  . TYR B 1 487 ? 74.898  -1.969  7.448   1.00 3.87  ? 487  TYR B CZ  1 
ATOM   7942  O OH  . TYR B 1 487 ? 75.321  -2.819  6.442   1.00 4.02  ? 487  TYR B OH  1 
ATOM   7943  N N   . ARG B 1 488 ? 72.215  2.926   12.196  1.00 4.33  ? 488  ARG B N   1 
ATOM   7944  C CA  . ARG B 1 488 ? 71.966  3.391   13.532  1.00 4.06  ? 488  ARG B CA  1 
ATOM   7945  C C   . ARG B 1 488 ? 72.882  2.766   14.572  1.00 2.76  ? 488  ARG B C   1 
ATOM   7946  O O   . ARG B 1 488 ? 73.356  3.480   15.493  1.00 2.33  ? 488  ARG B O   1 
ATOM   7947  C CB  . ARG B 1 488 ? 70.466  3.124   13.872  1.00 2.08  ? 488  ARG B CB  1 
ATOM   7948  C CG  . ARG B 1 488 ? 70.206  3.291   15.369  1.00 2.15  ? 488  ARG B CG  1 
ATOM   7949  C CD  . ARG B 1 488 ? 68.743  3.126   15.745  1.00 2.26  ? 488  ARG B CD  1 
ATOM   7950  N NE  . ARG B 1 488 ? 67.832  4.029   15.050  1.00 3.89  ? 488  ARG B NE  1 
ATOM   7951  C CZ  . ARG B 1 488 ? 67.336  5.131   15.642  1.00 4.12  ? 488  ARG B CZ  1 
ATOM   7952  N NH1 . ARG B 1 488 ? 67.616  5.441   16.870  1.00 3.83  ? 488  ARG B NH1 1 
ATOM   7953  N NH2 . ARG B 1 488 ? 66.525  5.946   14.981  1.00 5.02  ? 488  ARG B NH2 1 
ATOM   7954  N N   . PHE B 1 489 ? 73.251  1.459   14.484  1.00 2.65  ? 489  PHE B N   1 
ATOM   7955  C CA  . PHE B 1 489 ? 74.179  0.936   15.495  1.00 4.00  ? 489  PHE B CA  1 
ATOM   7956  C C   . PHE B 1 489 ? 75.566  1.603   15.326  1.00 3.14  ? 489  PHE B C   1 
ATOM   7957  O O   . PHE B 1 489 ? 76.241  1.833   16.329  1.00 4.26  ? 489  PHE B O   1 
ATOM   7958  C CB  . PHE B 1 489 ? 74.315  -0.590  15.514  1.00 4.08  ? 489  PHE B CB  1 
ATOM   7959  C CG  . PHE B 1 489 ? 74.450  -1.274  14.188  1.00 3.63  ? 489  PHE B CG  1 
ATOM   7960  C CD1 . PHE B 1 489 ? 75.581  -1.161  13.410  1.00 4.03  ? 489  PHE B CD1 1 
ATOM   7961  C CD2 . PHE B 1 489 ? 73.436  -2.120  13.750  1.00 3.12  ? 489  PHE B CD2 1 
ATOM   7962  C CE1 . PHE B 1 489 ? 75.696  -1.806  12.186  1.00 4.51  ? 489  PHE B CE1 1 
ATOM   7963  C CE2 . PHE B 1 489 ? 73.494  -2.790  12.544  1.00 3.94  ? 489  PHE B CE2 1 
ATOM   7964  C CZ  . PHE B 1 489 ? 74.626  -2.626  11.767  1.00 5.21  ? 489  PHE B CZ  1 
ATOM   7965  N N   . ASP B 1 490 ? 75.995  1.957   14.131  1.00 3.21  ? 490  ASP B N   1 
ATOM   7966  C CA  . ASP B 1 490 ? 77.264  2.668   13.892  1.00 2.95  ? 490  ASP B CA  1 
ATOM   7967  C C   . ASP B 1 490 ? 77.291  4.000   14.658  1.00 2.08  ? 490  ASP B C   1 
ATOM   7968  O O   . ASP B 1 490 ? 78.238  4.428   15.282  1.00 3.43  ? 490  ASP B O   1 
ATOM   7969  C CB  . ASP B 1 490 ? 77.454  3.044   12.402  1.00 2.13  ? 490  ASP B CB  1 
ATOM   7970  C CG  . ASP B 1 490 ? 77.620  1.824   11.509  1.00 2.95  ? 490  ASP B CG  1 
ATOM   7971  O OD1 . ASP B 1 490 ? 77.924  0.728   12.037  1.00 3.38  ? 490  ASP B OD1 1 
ATOM   7972  O OD2 . ASP B 1 490 ? 77.520  1.991   10.271  1.00 2.87  ? 490  ASP B OD2 1 
ATOM   7973  N N   . GLY B 1 491 ? 76.117  4.683   14.595  1.00 3.93  ? 491  GLY B N   1 
ATOM   7974  C CA  . GLY B 1 491 ? 75.939  6.012   15.153  1.00 3.44  ? 491  GLY B CA  1 
ATOM   7975  C C   . GLY B 1 491 ? 75.806  6.052   16.639  1.00 3.07  ? 491  GLY B C   1 
ATOM   7976  O O   . GLY B 1 491 ? 76.530  6.770   17.308  1.00 2.08  ? 491  GLY B O   1 
ATOM   7977  N N   . ILE B 1 492 ? 74.915  5.228   17.226  1.00 2.08  ? 492  ILE B N   1 
ATOM   7978  C CA  . ILE B 1 492 ? 74.745  5.219   18.676  1.00 2.64  ? 492  ILE B CA  1 
ATOM   7979  C C   . ILE B 1 492 ? 75.917  4.579   19.452  1.00 2.52  ? 492  ILE B C   1 
ATOM   7980  O O   . ILE B 1 492 ? 76.314  5.074   20.510  1.00 3.65  ? 492  ILE B O   1 
ATOM   7981  C CB  . ILE B 1 492 ? 73.413  4.541   19.090  1.00 3.68  ? 492  ILE B CB  1 
ATOM   7982  C CG1 . ILE B 1 492 ? 72.178  5.167   18.440  1.00 4.20  ? 492  ILE B CG1 1 
ATOM   7983  C CG2 . ILE B 1 492 ? 73.263  4.469   20.598  1.00 3.58  ? 492  ILE B CG2 1 
ATOM   7984  C CD1 . ILE B 1 492 ? 71.943  6.646   18.731  1.00 2.72  ? 492  ILE B CD1 1 
ATOM   7985  N N   . GLN B 1 493 ? 76.460  3.484   18.883  1.00 3.17  ? 493  GLN B N   1 
ATOM   7986  C CA  . GLN B 1 493 ? 77.588  2.826   19.577  1.00 2.37  ? 493  GLN B CA  1 
ATOM   7987  C C   . GLN B 1 493 ? 78.841  3.735   19.486  1.00 3.73  ? 493  GLN B C   1 
ATOM   7988  O O   . GLN B 1 493 ? 79.581  3.869   20.448  1.00 3.26  ? 493  GLN B O   1 
ATOM   7989  C CB  . GLN B 1 493 ? 77.815  1.379   19.112  1.00 3.92  ? 493  GLN B CB  1 
ATOM   7990  C CG  . GLN B 1 493 ? 76.595  0.481   19.454  1.00 3.29  ? 493  GLN B CG  1 
ATOM   7991  C CD  . GLN B 1 493 ? 76.110  0.556   20.880  1.00 2.67  ? 493  GLN B CD  1 
ATOM   7992  O OE1 . GLN B 1 493 ? 76.838  0.631   21.884  1.00 2.80  ? 493  GLN B OE1 1 
ATOM   7993  N NE2 . GLN B 1 493 ? 74.779  0.560   21.082  1.00 2.80  ? 493  GLN B NE2 1 
ATOM   7994  N N   . GLY B 1 494 ? 78.993  4.407   18.373  1.00 3.93  ? 494  GLY B N   1 
ATOM   7995  C CA  . GLY B 1 494 ? 80.072  5.366   18.099  1.00 4.96  ? 494  GLY B CA  1 
ATOM   7996  C C   . GLY B 1 494 ? 79.970  6.520   19.098  1.00 4.67  ? 494  GLY B C   1 
ATOM   7997  O O   . GLY B 1 494 ? 80.906  6.745   19.857  1.00 3.75  ? 494  GLY B O   1 
ATOM   7998  N N   . LEU B 1 495 ? 78.750  7.094   19.233  1.00 3.09  ? 495  LEU B N   1 
ATOM   7999  C CA  . LEU B 1 495 ? 78.554  8.163   20.203  1.00 3.60  ? 495  LEU B CA  1 
ATOM   8000  C C   . LEU B 1 495 ? 78.902  7.760   21.621  1.00 5.63  ? 495  LEU B C   1 
ATOM   8001  O O   . LEU B 1 495 ? 79.582  8.511   22.348  1.00 5.12  ? 495  LEU B O   1 
ATOM   8002  C CB  . LEU B 1 495 ? 77.078  8.597   20.127  1.00 2.56  ? 495  LEU B CB  1 
ATOM   8003  C CG  . LEU B 1 495 ? 76.772  9.504   18.915  1.00 3.21  ? 495  LEU B CG  1 
ATOM   8004  C CD1 . LEU B 1 495 ? 75.253  9.584   18.754  1.00 3.60  ? 495  LEU B CD1 1 
ATOM   8005  C CD2 . LEU B 1 495 ? 77.403  10.896  19.087  1.00 2.08  ? 495  LEU B CD2 1 
ATOM   8006  N N   . LEU B 1 496 ? 78.507  6.555   22.053  1.00 3.77  ? 496  LEU B N   1 
ATOM   8007  C CA  . LEU B 1 496 ? 78.801  6.109   23.401  1.00 2.85  ? 496  LEU B CA  1 
ATOM   8008  C C   . LEU B 1 496 ? 80.300  5.798   23.566  1.00 3.05  ? 496  LEU B C   1 
ATOM   8009  O O   . LEU B 1 496 ? 80.849  6.079   24.616  1.00 3.30  ? 496  LEU B O   1 
ATOM   8010  C CB  . LEU B 1 496 ? 78.000  4.810   23.675  1.00 4.54  ? 496  LEU B CB  1 
ATOM   8011  C CG  . LEU B 1 496 ? 76.481  5.077   23.815  1.00 6.79  ? 496  LEU B CG  1 
ATOM   8012  C CD1 . LEU B 1 496 ? 75.697  3.765   23.762  1.00 5.43  ? 496  LEU B CD1 1 
ATOM   8013  C CD2 . LEU B 1 496 ? 76.187  5.741   25.154  1.00 4.95  ? 496  LEU B CD2 1 
ATOM   8014  N N   . LEU B 1 497 ? 80.931  5.245   22.548  1.00 3.89  ? 497  LEU B N   1 
ATOM   8015  C CA  . LEU B 1 497 ? 82.386  4.990   22.640  1.00 6.13  ? 497  LEU B CA  1 
ATOM   8016  C C   . LEU B 1 497 ? 83.135  6.325   22.850  1.00 5.39  ? 497  LEU B C   1 
ATOM   8017  O O   . LEU B 1 497 ? 84.005  6.413   23.694  1.00 4.14  ? 497  LEU B O   1 
ATOM   8018  C CB  . LEU B 1 497 ? 82.874  4.351   21.356  1.00 5.01  ? 497  LEU B CB  1 
ATOM   8019  C CG  . LEU B 1 497 ? 84.388  4.049   21.350  1.00 4.73  ? 497  LEU B CG  1 
ATOM   8020  C CD1 . LEU B 1 497 ? 84.772  3.052   22.426  1.00 2.66  ? 497  LEU B CD1 1 
ATOM   8021  C CD2 . LEU B 1 497 ? 84.820  3.573   19.993  1.00 2.63  ? 497  LEU B CD2 1 
ATOM   8022  N N   . GLY B 1 498 ? 82.813  7.336   22.036  1.00 2.75  ? 498  GLY B N   1 
ATOM   8023  C CA  . GLY B 1 498 ? 83.419  8.656   22.143  1.00 3.46  ? 498  GLY B CA  1 
ATOM   8024  C C   . GLY B 1 498 ? 83.215  9.292   23.507  1.00 2.08  ? 498  GLY B C   1 
ATOM   8025  O O   . GLY B 1 498 ? 84.169  9.784   24.118  1.00 2.78  ? 498  GLY B O   1 
ATOM   8026  N N   . GLU B 1 499 ? 82.050  9.107   24.136  1.00 4.12  ? 499  GLU B N   1 
ATOM   8027  C CA  . GLU B 1 499 ? 81.795  9.571   25.475  1.00 4.19  ? 499  GLU B CA  1 
ATOM   8028  C C   . GLU B 1 499 ? 82.630  8.861   26.541  1.00 3.76  ? 499  GLU B C   1 
ATOM   8029  O O   . GLU B 1 499 ? 83.174  9.481   27.484  1.00 2.08  ? 499  GLU B O   1 
ATOM   8030  C CB  . GLU B 1 499 ? 80.280  9.397   25.808  1.00 2.40  ? 499  GLU B CB  1 
ATOM   8031  C CG  . GLU B 1 499 ? 79.923  9.662   27.255  1.00 3.97  ? 499  GLU B CG  1 
ATOM   8032  C CD  . GLU B 1 499 ? 78.441  9.395   27.526  1.00 5.48  ? 499  GLU B CD  1 
ATOM   8033  O OE1 . GLU B 1 499 ? 78.063  8.218   27.784  1.00 3.24  ? 499  GLU B OE1 1 
ATOM   8034  O OE2 . GLU B 1 499 ? 77.644  10.367  27.443  1.00 4.17  ? 499  GLU B OE2 1 
ATOM   8035  N N   . THR B 1 500 ? 82.703  7.513   26.476  1.00 2.39  ? 500  THR B N   1 
ATOM   8036  C CA  . THR B 1 500 ? 83.412  6.814   27.568  1.00 2.08  ? 500  THR B CA  1 
ATOM   8037  C C   . THR B 1 500 ? 84.894  7.190   27.606  1.00 2.08  ? 500  THR B C   1 
ATOM   8038  O O   . THR B 1 500 ? 85.557  7.374   28.619  1.00 2.08  ? 500  THR B O   1 
ATOM   8039  C CB  . THR B 1 500 ? 83.164  5.302   27.341  1.00 2.24  ? 500  THR B CB  1 
ATOM   8040  O OG1 . THR B 1 500 ? 81.770  5.038   27.577  1.00 3.00  ? 500  THR B OG1 1 
ATOM   8041  C CG2 . THR B 1 500 ? 83.991  4.432   28.288  1.00 3.59  ? 500  THR B CG2 1 
ATOM   8042  N N   . ILE B 1 501 ? 85.482  7.239   26.442  1.00 2.08  ? 501  ILE B N   1 
ATOM   8043  C CA  . ILE B 1 501 ? 86.884  7.506   26.132  1.00 3.33  ? 501  ILE B CA  1 
ATOM   8044  C C   . ILE B 1 501 ? 87.231  8.922   26.623  1.00 5.85  ? 501  ILE B C   1 
ATOM   8045  O O   . ILE B 1 501 ? 88.237  9.130   27.306  1.00 5.18  ? 501  ILE B O   1 
ATOM   8046  C CB  . ILE B 1 501 ? 87.228  7.374   24.643  1.00 3.43  ? 501  ILE B CB  1 
ATOM   8047  C CG1 . ILE B 1 501 ? 87.281  5.893   24.265  1.00 3.99  ? 501  ILE B CG1 1 
ATOM   8048  C CG2 . ILE B 1 501 ? 88.595  8.011   24.308  1.00 4.95  ? 501  ILE B CG2 1 
ATOM   8049  C CD1 . ILE B 1 501 ? 87.479  5.636   22.783  1.00 4.39  ? 501  ILE B CD1 1 
ATOM   8050  N N   . THR B 1 502 ? 86.303  9.837   26.271  1.00 3.90  ? 502  THR B N   1 
ATOM   8051  C CA  . THR B 1 502 ? 86.498  11.229  26.715  1.00 4.39  ? 502  THR B CA  1 
ATOM   8052  C C   . THR B 1 502 ? 86.409  11.375  28.208  1.00 4.79  ? 502  THR B C   1 
ATOM   8053  O O   . THR B 1 502 ? 87.195  12.161  28.783  1.00 6.67  ? 502  THR B O   1 
ATOM   8054  C CB  . THR B 1 502 ? 85.495  12.135  25.999  1.00 2.08  ? 502  THR B CB  1 
ATOM   8055  O OG1 . THR B 1 502 ? 85.832  12.008  24.605  1.00 2.08  ? 502  THR B OG1 1 
ATOM   8056  C CG2 . THR B 1 502 ? 85.827  13.598  26.326  1.00 2.17  ? 502  THR B CG2 1 
ATOM   8057  N N   . VAL B 1 503 ? 85.455  10.676  28.847  1.00 2.87  ? 503  VAL B N   1 
ATOM   8058  C CA  . VAL B 1 503 ? 85.409  10.705  30.311  1.00 3.42  ? 503  VAL B CA  1 
ATOM   8059  C C   . VAL B 1 503 ? 86.750  10.242  30.878  1.00 3.68  ? 503  VAL B C   1 
ATOM   8060  O O   . VAL B 1 503 ? 87.266  10.818  31.848  1.00 3.87  ? 503  VAL B O   1 
ATOM   8061  C CB  . VAL B 1 503 ? 84.299  9.790   30.879  1.00 4.04  ? 503  VAL B CB  1 
ATOM   8062  C CG1 . VAL B 1 503 ? 84.447  9.557   32.379  1.00 2.08  ? 503  VAL B CG1 1 
ATOM   8063  C CG2 . VAL B 1 503 ? 82.931  10.425  30.589  1.00 2.65  ? 503  VAL B CG2 1 
ATOM   8064  N N   . ARG B 1 504 ? 87.287  9.140   30.322  1.00 3.91  ? 504  ARG B N   1 
ATOM   8065  C CA  . ARG B 1 504 ? 88.594  8.652   30.790  1.00 4.39  ? 504  ARG B CA  1 
ATOM   8066  C C   . ARG B 1 504 ? 89.687  9.718   30.683  1.00 3.96  ? 504  ARG B C   1 
ATOM   8067  O O   . ARG B 1 504 ? 90.470  9.951   31.609  1.00 3.32  ? 504  ARG B O   1 
ATOM   8068  C CB  . ARG B 1 504 ? 88.926  7.374   29.979  1.00 5.55  ? 504  ARG B CB  1 
ATOM   8069  C CG  . ARG B 1 504 ? 88.268  6.115   30.517  1.00 6.02  ? 504  ARG B CG  1 
ATOM   8070  C CD  . ARG B 1 504 ? 88.948  5.546   31.769  1.00 6.97  ? 504  ARG B CD  1 
ATOM   8071  N NE  . ARG B 1 504 ? 90.018  4.624   31.376  1.00 7.31  ? 504  ARG B NE  1 
ATOM   8072  C CZ  . ARG B 1 504 ? 89.776  3.357   30.985  1.00 8.80  ? 504  ARG B CZ  1 
ATOM   8073  N NH1 . ARG B 1 504 ? 88.535  2.850   30.935  1.00 6.84  ? 504  ARG B NH1 1 
ATOM   8074  N NH2 . ARG B 1 504 ? 90.804  2.594   30.614  1.00 5.54  ? 504  ARG B NH2 1 
ATOM   8075  N N   . THR B 1 505 ? 89.772  10.453  29.587  1.00 4.41  ? 505  THR B N   1 
ATOM   8076  C CA  . THR B 1 505 ? 90.785  11.506  29.398  1.00 5.97  ? 505  THR B CA  1 
ATOM   8077  C C   . THR B 1 505 ? 90.564  12.728  30.281  1.00 5.53  ? 505  THR B C   1 
ATOM   8078  O O   . THR B 1 505 ? 91.440  13.212  30.991  1.00 4.50  ? 505  THR B O   1 
ATOM   8079  C CB  . THR B 1 505 ? 90.841  11.901  27.929  1.00 6.17  ? 505  THR B CB  1 
ATOM   8080  O OG1 . THR B 1 505 ? 91.211  10.760  27.175  1.00 7.22  ? 505  THR B OG1 1 
ATOM   8081  C CG2 . THR B 1 505 ? 91.842  13.021  27.641  1.00 4.31  ? 505  THR B CG2 1 
ATOM   8082  N N   . LEU B 1 506 ? 89.316  13.146  30.402  1.00 4.85  ? 506  LEU B N   1 
ATOM   8083  C CA  . LEU B 1 506 ? 88.927  14.266  31.262  1.00 4.88  ? 506  LEU B CA  1 
ATOM   8084  C C   . LEU B 1 506 ? 89.339  13.996  32.694  1.00 3.80  ? 506  LEU B C   1 
ATOM   8085  O O   . LEU B 1 506 ? 89.793  14.853  33.423  1.00 2.81  ? 506  LEU B O   1 
ATOM   8086  C CB  . LEU B 1 506 ? 87.414  14.533  31.247  1.00 3.96  ? 506  LEU B CB  1 
ATOM   8087  C CG  . LEU B 1 506 ? 86.841  15.226  30.003  1.00 4.00  ? 506  LEU B CG  1 
ATOM   8088  C CD1 . LEU B 1 506 ? 85.322  15.042  29.981  1.00 4.00  ? 506  LEU B CD1 1 
ATOM   8089  C CD2 . LEU B 1 506 ? 87.159  16.721  30.015  1.00 3.71  ? 506  LEU B CD2 1 
ATOM   8090  N N   . HIS B 1 507 ? 89.086  12.771  33.175  1.00 3.49  ? 507  HIS B N   1 
ATOM   8091  C CA  . HIS B 1 507 ? 89.395  12.408  34.542  1.00 2.77  ? 507  HIS B CA  1 
ATOM   8092  C C   . HIS B 1 507 ? 90.917  12.384  34.781  1.00 3.80  ? 507  HIS B C   1 
ATOM   8093  O O   . HIS B 1 507 ? 91.319  12.749  35.888  1.00 3.43  ? 507  HIS B O   1 
ATOM   8094  C CB  . HIS B 1 507 ? 88.858  10.984  34.842  1.00 3.72  ? 507  HIS B CB  1 
ATOM   8095  C CG  . HIS B 1 507 ? 88.567  10.806  36.299  1.00 3.54  ? 507  HIS B CG  1 
ATOM   8096  N ND1 . HIS B 1 507 ? 87.921  9.679   36.774  1.00 3.04  ? 507  HIS B ND1 1 
ATOM   8097  C CD2 . HIS B 1 507 ? 88.802  11.587  37.373  1.00 3.56  ? 507  HIS B CD2 1 
ATOM   8098  C CE1 . HIS B 1 507 ? 87.740  9.793   38.060  1.00 4.02  ? 507  HIS B CE1 1 
ATOM   8099  N NE2 . HIS B 1 507 ? 88.283  10.930  38.460  1.00 3.47  ? 507  HIS B NE2 1 
ATOM   8100  N N   . GLN B 1 508 ? 91.636  11.779  33.838  1.00 3.69  ? 508  GLN B N   1 
ATOM   8101  C CA  . GLN B 1 508 ? 93.081  11.730  33.913  1.00 4.83  ? 508  GLN B CA  1 
ATOM   8102  C C   . GLN B 1 508 ? 93.654  13.158  34.028  1.00 4.50  ? 508  GLN B C   1 
ATOM   8103  O O   . GLN B 1 508 ? 94.473  13.356  34.904  1.00 3.84  ? 508  GLN B O   1 
ATOM   8104  C CB  . GLN B 1 508 ? 93.734  11.075  32.696  1.00 5.11  ? 508  GLN B CB  1 
ATOM   8105  C CG  . GLN B 1 508 ? 95.247  10.836  32.819  1.00 3.56  ? 508  GLN B CG  1 
ATOM   8106  C CD  . GLN B 1 508 ? 95.669  10.070  31.565  1.00 5.48  ? 508  GLN B CD  1 
ATOM   8107  O OE1 . GLN B 1 508 ? 95.540  10.552  30.451  1.00 4.68  ? 508  GLN B OE1 1 
ATOM   8108  N NE2 . GLN B 1 508 ? 96.162  8.828   31.710  1.00 5.28  ? 508  GLN B NE2 1 
ATOM   8109  N N   . GLU B 1 509 ? 93.173  14.076  33.193  1.00 4.12  ? 509  GLU B N   1 
ATOM   8110  C CA  . GLU B 1 509 ? 93.677  15.451  33.288  1.00 4.37  ? 509  GLU B CA  1 
ATOM   8111  C C   . GLU B 1 509 ? 93.267  16.094  34.589  1.00 5.22  ? 509  GLU B C   1 
ATOM   8112  O O   . GLU B 1 509 ? 94.087  16.737  35.262  1.00 3.74  ? 509  GLU B O   1 
ATOM   8113  C CB  . GLU B 1 509 ? 93.203  16.274  32.110  1.00 2.08  ? 509  GLU B CB  1 
ATOM   8114  C CG  . GLU B 1 509 ? 93.887  15.964  30.798  1.00 2.50  ? 509  GLU B CG  1 
ATOM   8115  C CD  . GLU B 1 509 ? 93.578  16.967  29.723  1.00 3.08  ? 509  GLU B CD  1 
ATOM   8116  O OE1 . GLU B 1 509 ? 92.676  17.827  29.962  1.00 3.76  ? 509  GLU B OE1 1 
ATOM   8117  O OE2 . GLU B 1 509 ? 94.125  16.901  28.619  1.00 2.96  ? 509  GLU B OE2 1 
ATOM   8118  N N   . LEU B 1 510 ? 92.009  15.864  35.000  1.00 4.49  ? 510  LEU B N   1 
ATOM   8119  C CA  . LEU B 1 510 ? 91.512  16.505  36.217  1.00 4.56  ? 510  LEU B CA  1 
ATOM   8120  C C   . LEU B 1 510 ? 92.387  16.233  37.432  1.00 5.52  ? 510  LEU B C   1 
ATOM   8121  O O   . LEU B 1 510 ? 92.583  17.059  38.342  1.00 5.46  ? 510  LEU B O   1 
ATOM   8122  C CB  . LEU B 1 510 ? 90.075  16.069  36.493  1.00 4.65  ? 510  LEU B CB  1 
ATOM   8123  C CG  . LEU B 1 510 ? 89.439  16.581  37.797  1.00 4.55  ? 510  LEU B CG  1 
ATOM   8124  C CD1 . LEU B 1 510 ? 89.140  18.076  37.703  1.00 5.14  ? 510  LEU B CD1 1 
ATOM   8125  C CD2 . LEU B 1 510 ? 88.138  15.835  38.101  1.00 4.76  ? 510  LEU B CD2 1 
ATOM   8126  N N   . MET B 1 511 ? 92.837  14.991  37.558  1.00 6.45  ? 511  MET B N   1 
ATOM   8127  C CA  . MET B 1 511 ? 93.674  14.526  38.647  1.00 6.94  ? 511  MET B CA  1 
ATOM   8128  C C   . MET B 1 511 ? 95.019  15.284  38.680  1.00 5.81  ? 511  MET B C   1 
ATOM   8129  O O   . MET B 1 511 ? 95.603  15.366  39.750  1.00 5.69  ? 511  MET B O   1 
ATOM   8130  C CB  . MET B 1 511 ? 93.892  12.995  38.566  1.00 6.26  ? 511  MET B CB  1 
ATOM   8131  C CG  . MET B 1 511 ? 92.591  12.183  38.759  1.00 6.55  ? 511  MET B CG  1 
ATOM   8132  S SD  . MET B 1 511 ? 92.820  10.382  38.600  1.00 5.02  ? 511  MET B SD  1 
ATOM   8133  C CE  . MET B 1 511 ? 93.734  10.121  40.114  1.00 4.56  ? 511  MET B CE  1 
ATOM   8134  N N   . THR B 1 512 ? 95.490  15.857  37.595  1.00 3.95  ? 512  THR B N   1 
ATOM   8135  C CA  . THR B 1 512 ? 96.727  16.643  37.608  1.00 6.36  ? 512  THR B CA  1 
ATOM   8136  C C   . THR B 1 512 ? 96.639  18.092  38.079  1.00 7.18  ? 512  THR B C   1 
ATOM   8137  O O   . THR B 1 512 ? 97.640  18.691  38.506  1.00 5.58  ? 512  THR B O   1 
ATOM   8138  C CB  . THR B 1 512 ? 97.357  16.658  36.200  1.00 5.17  ? 512  THR B CB  1 
ATOM   8139  O OG1 . THR B 1 512 ? 96.638  17.462  35.230  1.00 3.85  ? 512  THR B OG1 1 
ATOM   8140  C CG2 . THR B 1 512 ? 97.414  15.220  35.659  1.00 2.81  ? 512  THR B CG2 1 
ATOM   8141  N N   . PHE B 1 513 ? 95.444  18.682  38.032  1.00 7.45  ? 513  PHE B N   1 
ATOM   8142  C CA  . PHE B 1 513 ? 95.299  20.134  38.286  1.00 5.41  ? 513  PHE B CA  1 
ATOM   8143  C C   . PHE B 1 513 ? 95.630  20.520  39.699  1.00 4.84  ? 513  PHE B C   1 
ATOM   8144  O O   . PHE B 1 513 ? 95.220  19.852  40.642  1.00 3.34  ? 513  PHE B O   1 
ATOM   8145  C CB  . PHE B 1 513 ? 93.874  20.561  37.913  1.00 2.41  ? 513  PHE B CB  1 
ATOM   8146  C CG  . PHE B 1 513 ? 93.479  20.342  36.505  1.00 3.91  ? 513  PHE B CG  1 
ATOM   8147  C CD1 . PHE B 1 513 ? 94.421  20.136  35.499  1.00 3.91  ? 513  PHE B CD1 1 
ATOM   8148  C CD2 . PHE B 1 513 ? 92.121  20.370  36.170  1.00 5.53  ? 513  PHE B CD2 1 
ATOM   8149  C CE1 . PHE B 1 513 ? 94.061  19.959  34.206  1.00 4.34  ? 513  PHE B CE1 1 
ATOM   8150  C CE2 . PHE B 1 513 ? 91.716  20.189  34.839  1.00 4.24  ? 513  PHE B CE2 1 
ATOM   8151  C CZ  . PHE B 1 513 ? 92.686  20.009  33.879  1.00 6.47  ? 513  PHE B CZ  1 
ATOM   8152  N N   . ALA B 1 514 ? 96.375  21.631  39.860  1.00 4.89  ? 514  ALA B N   1 
ATOM   8153  C CA  . ALA B 1 514 ? 96.708  22.096  41.198  1.00 4.38  ? 514  ALA B CA  1 
ATOM   8154  C C   . ALA B 1 514 ? 95.463  22.553  41.945  1.00 4.16  ? 514  ALA B C   1 
ATOM   8155  O O   . ALA B 1 514 ? 95.295  22.269  43.153  1.00 3.55  ? 514  ALA B O   1 
ATOM   8156  C CB  . ALA B 1 514 ? 97.727  23.241  41.135  1.00 4.72  ? 514  ALA B CB  1 
ATOM   8157  N N   . GLU B 1 515 ? 94.603  23.288  41.229  1.00 5.00  ? 515  GLU B N   1 
ATOM   8158  C CA  . GLU B 1 515 ? 93.439  23.794  41.982  1.00 5.89  ? 515  GLU B CA  1 
ATOM   8159  C C   . GLU B 1 515 ? 92.384  22.731  42.287  1.00 6.16  ? 515  GLU B C   1 
ATOM   8160  O O   . GLU B 1 515 ? 92.091  21.851  41.476  1.00 4.79  ? 515  GLU B O   1 
ATOM   8161  C CB  . GLU B 1 515 ? 92.825  24.981  41.250  1.00 5.37  ? 515  GLU B CB  1 
ATOM   8162  C CG  . GLU B 1 515 ? 92.551  24.843  39.786  1.00 5.59  ? 515  GLU B CG  1 
ATOM   8163  C CD  . GLU B 1 515 ? 93.650  25.173  38.817  1.00 5.75  ? 515  GLU B CD  1 
ATOM   8164  O OE1 . GLU B 1 515 ? 94.832  24.824  39.030  1.00 5.08  ? 515  GLU B OE1 1 
ATOM   8165  O OE2 . GLU B 1 515 ? 93.331  25.775  37.752  1.00 6.71  ? 515  GLU B OE2 1 
ATOM   8166  N N   . GLU B 1 516 ? 91.810  22.803  43.475  1.00 6.81  ? 516  GLU B N   1 
ATOM   8167  C CA  . GLU B 1 516 ? 90.722  21.894  43.851  1.00 9.65  ? 516  GLU B CA  1 
ATOM   8168  C C   . GLU B 1 516 ? 89.561  22.103  42.876  1.00 9.21  ? 516  GLU B C   1 
ATOM   8169  O O   . GLU B 1 516 ? 89.052  23.226  42.686  1.00 6.77  ? 516  GLU B O   1 
ATOM   8170  C CB  . GLU B 1 516 ? 90.158  22.150  45.234  1.00 12.97 ? 516  GLU B CB  1 
ATOM   8171  C CG  . GLU B 1 516 ? 91.022  21.505  46.309  1.00 20.31 ? 516  GLU B CG  1 
ATOM   8172  C CD  . GLU B 1 516 ? 90.369  21.611  47.679  1.00 24.77 ? 516  GLU B CD  1 
ATOM   8173  O OE1 . GLU B 1 516 ? 89.115  21.718  47.768  1.00 27.79 ? 516  GLU B OE1 1 
ATOM   8174  O OE2 . GLU B 1 516 ? 91.162  21.585  48.649  1.00 27.26 ? 516  GLU B OE2 1 
ATOM   8175  N N   . SER B 1 517 ? 89.132  20.968  42.311  1.00 7.26  ? 517  SER B N   1 
ATOM   8176  C CA  . SER B 1 517 ? 88.092  21.092  41.291  1.00 7.48  ? 517  SER B CA  1 
ATOM   8177  C C   . SER B 1 517 ? 87.484  19.741  40.923  1.00 7.77  ? 517  SER B C   1 
ATOM   8178  O O   . SER B 1 517 ? 88.080  18.717  41.279  1.00 6.61  ? 517  SER B O   1 
ATOM   8179  C CB  . SER B 1 517 ? 88.742  21.724  40.061  1.00 6.40  ? 517  SER B CB  1 
ATOM   8180  O OG  . SER B 1 517 ? 89.898  20.990  39.650  1.00 8.46  ? 517  SER B OG  1 
ATOM   8181  N N   . THR B 1 518 ? 86.329  19.775  40.237  1.00 6.16  ? 518  THR B N   1 
ATOM   8182  C CA  . THR B 1 518 ? 85.687  18.531  39.841  1.00 5.63  ? 518  THR B CA  1 
ATOM   8183  C C   . THR B 1 518 ? 85.070  18.751  38.474  1.00 6.59  ? 518  THR B C   1 
ATOM   8184  O O   . THR B 1 518 ? 85.017  19.889  37.951  1.00 5.60  ? 518  THR B O   1 
ATOM   8185  C CB  . THR B 1 518 ? 84.509  18.075  40.761  1.00 7.11  ? 518  THR B CB  1 
ATOM   8186  O OG1 . THR B 1 518 ? 83.492  19.119  40.798  1.00 4.82  ? 518  THR B OG1 1 
ATOM   8187  C CG2 . THR B 1 518 ? 84.883  17.799  42.218  1.00 4.97  ? 518  THR B CG2 1 
ATOM   8188  N N   . PHE B 1 519 ? 84.580  17.651  37.873  1.00 6.24  ? 519  PHE B N   1 
ATOM   8189  C CA  . PHE B 1 519 ? 83.758  17.796  36.673  1.00 4.39  ? 519  PHE B CA  1 
ATOM   8190  C C   . PHE B 1 519 ? 82.378  17.176  37.048  1.00 7.14  ? 519  PHE B C   1 
ATOM   8191  O O   . PHE B 1 519 ? 82.368  16.139  37.716  1.00 7.04  ? 519  PHE B O   1 
ATOM   8192  C CB  . PHE B 1 519 ? 84.197  17.189  35.388  1.00 5.92  ? 519  PHE B CB  1 
ATOM   8193  C CG  . PHE B 1 519 ? 85.366  17.777  34.641  1.00 5.96  ? 519  PHE B CG  1 
ATOM   8194  C CD1 . PHE B 1 519 ? 85.266  19.008  34.031  1.00 4.55  ? 519  PHE B CD1 1 
ATOM   8195  C CD2 . PHE B 1 519 ? 86.568  17.071  34.564  1.00 6.04  ? 519  PHE B CD2 1 
ATOM   8196  C CE1 . PHE B 1 519 ? 86.322  19.554  33.308  1.00 4.69  ? 519  PHE B CE1 1 
ATOM   8197  C CE2 . PHE B 1 519 ? 87.632  17.603  33.843  1.00 4.93  ? 519  PHE B CE2 1 
ATOM   8198  C CZ  . PHE B 1 519 ? 87.511  18.855  33.240  1.00 3.80  ? 519  PHE B CZ  1 
ATOM   8199  N N   . GLU B 1 520 ? 81.298  17.774  36.550  1.00 6.79  ? 520  GLU B N   1 
ATOM   8200  C CA  . GLU B 1 520 ? 79.966  17.259  36.827  1.00 7.89  ? 520  GLU B CA  1 
ATOM   8201  C C   . GLU B 1 520 ? 79.033  17.628  35.691  1.00 7.26  ? 520  GLU B C   1 
ATOM   8202  O O   . GLU B 1 520 ? 78.935  18.784  35.283  1.00 6.61  ? 520  GLU B O   1 
ATOM   8203  C CB  . GLU B 1 520 ? 79.451  17.672  38.221  1.00 7.94  ? 520  GLU B CB  1 
ATOM   8204  C CG  . GLU B 1 520 ? 78.099  16.995  38.474  1.00 8.61  ? 520  GLU B CG  1 
ATOM   8205  C CD  . GLU B 1 520 ? 77.412  17.488  39.729  1.00 10.71 ? 520  GLU B CD  1 
ATOM   8206  O OE1 . GLU B 1 520 ? 77.611  18.638  40.170  1.00 10.28 ? 520  GLU B OE1 1 
ATOM   8207  O OE2 . GLU B 1 520 ? 76.640  16.707  40.332  1.00 9.38  ? 520  GLU B OE2 1 
ATOM   8208  N N   . PHE B 1 521 ? 78.511  16.593  35.006  1.00 6.68  ? 521  PHE B N   1 
ATOM   8209  C CA  . PHE B 1 521 ? 77.662  16.798  33.846  1.00 5.60  ? 521  PHE B CA  1 
ATOM   8210  C C   . PHE B 1 521 ? 76.784  15.570  33.539  1.00 5.48  ? 521  PHE B C   1 
ATOM   8211  O O   . PHE B 1 521 ? 76.961  14.521  34.165  1.00 5.46  ? 521  PHE B O   1 
ATOM   8212  C CB  . PHE B 1 521 ? 78.442  17.123  32.573  1.00 4.93  ? 521  PHE B CB  1 
ATOM   8213  C CG  . PHE B 1 521 ? 79.330  16.030  32.068  1.00 5.52  ? 521  PHE B CG  1 
ATOM   8214  C CD1 . PHE B 1 521 ? 80.538  15.786  32.692  1.00 6.04  ? 521  PHE B CD1 1 
ATOM   8215  C CD2 . PHE B 1 521 ? 78.929  15.255  30.982  1.00 5.29  ? 521  PHE B CD2 1 
ATOM   8216  C CE1 . PHE B 1 521 ? 81.383  14.782  32.213  1.00 5.56  ? 521  PHE B CE1 1 
ATOM   8217  C CE2 . PHE B 1 521 ? 79.769  14.241  30.552  1.00 6.51  ? 521  PHE B CE2 1 
ATOM   8218  C CZ  . PHE B 1 521 ? 80.987  14.020  31.153  1.00 5.27  ? 521  PHE B CZ  1 
ATOM   8219  N N   . ARG B 1 522 ? 75.882  15.738  32.568  1.00 2.95  ? 522  ARG B N   1 
ATOM   8220  C CA  . ARG B 1 522 ? 74.945  14.632  32.277  1.00 5.09  ? 522  ARG B CA  1 
ATOM   8221  C C   . ARG B 1 522 ? 75.337  13.837  31.043  1.00 3.73  ? 522  ARG B C   1 
ATOM   8222  O O   . ARG B 1 522 ? 75.498  14.410  29.975  1.00 3.99  ? 522  ARG B O   1 
ATOM   8223  C CB  . ARG B 1 522 ? 73.508  15.170  32.083  1.00 3.19  ? 522  ARG B CB  1 
ATOM   8224  C CG  . ARG B 1 522 ? 72.421  14.107  32.234  1.00 5.07  ? 522  ARG B CG  1 
ATOM   8225  C CD  . ARG B 1 522 ? 71.017  14.654  31.897  1.00 5.04  ? 522  ARG B CD  1 
ATOM   8226  N NE  . ARG B 1 522 ? 70.665  15.787  32.755  1.00 4.27  ? 522  ARG B NE  1 
ATOM   8227  C CZ  . ARG B 1 522 ? 70.334  15.688  34.035  1.00 5.29  ? 522  ARG B CZ  1 
ATOM   8228  N NH1 . ARG B 1 522 ? 70.280  14.494  34.614  1.00 4.64  ? 522  ARG B NH1 1 
ATOM   8229  N NH2 . ARG B 1 522 ? 70.043  16.776  34.758  1.00 6.04  ? 522  ARG B NH2 1 
ATOM   8230  N N   . LEU B 1 523 ? 75.480  12.531  31.192  1.00 3.59  ? 523  LEU B N   1 
ATOM   8231  C CA  . LEU B 1 523 ? 75.787  11.654  30.051  1.00 3.73  ? 523  LEU B CA  1 
ATOM   8232  C C   . LEU B 1 523 ? 74.597  11.560  29.100  1.00 3.52  ? 523  LEU B C   1 
ATOM   8233  O O   . LEU B 1 523 ? 73.461  11.895  29.461  1.00 3.22  ? 523  LEU B O   1 
ATOM   8234  C CB  . LEU B 1 523 ? 76.139  10.283  30.595  1.00 3.74  ? 523  LEU B CB  1 
ATOM   8235  C CG  . LEU B 1 523 ? 77.251  10.206  31.663  1.00 4.56  ? 523  LEU B CG  1 
ATOM   8236  C CD1 . LEU B 1 523 ? 77.275  8.820   32.285  1.00 4.68  ? 523  LEU B CD1 1 
ATOM   8237  C CD2 . LEU B 1 523 ? 78.575  10.488  30.987  1.00 3.67  ? 523  LEU B CD2 1 
ATOM   8238  N N   . PHE B 1 524 ? 74.815  11.036  27.899  1.00 4.46  ? 524  PHE B N   1 
ATOM   8239  C CA  . PHE B 1 524 ? 73.816  10.839  26.875  1.00 3.69  ? 524  PHE B CA  1 
ATOM   8240  C C   . PHE B 1 524 ? 72.549  10.122  27.340  1.00 4.01  ? 524  PHE B C   1 
ATOM   8241  O O   . PHE B 1 524 ? 71.440  10.563  27.014  1.00 2.86  ? 524  PHE B O   1 
ATOM   8242  C CB  . PHE B 1 524 ? 74.330  10.090  25.635  1.00 3.14  ? 524  PHE B CB  1 
ATOM   8243  C CG  . PHE B 1 524 ? 75.221  10.879  24.718  1.00 4.53  ? 524  PHE B CG  1 
ATOM   8244  C CD1 . PHE B 1 524 ? 74.867  12.129  24.261  1.00 4.37  ? 524  PHE B CD1 1 
ATOM   8245  C CD2 . PHE B 1 524 ? 76.452  10.361  24.328  1.00 4.60  ? 524  PHE B CD2 1 
ATOM   8246  C CE1 . PHE B 1 524 ? 75.700  12.841  23.419  1.00 6.04  ? 524  PHE B CE1 1 
ATOM   8247  C CE2 . PHE B 1 524 ? 77.273  11.057  23.470  1.00 4.22  ? 524  PHE B CE2 1 
ATOM   8248  C CZ  . PHE B 1 524 ? 76.897  12.304  23.012  1.00 5.83  ? 524  PHE B CZ  1 
ATOM   8249  N N   . THR B 1 525 ? 72.659  9.080   28.143  1.00 4.83  ? 525  THR B N   1 
ATOM   8250  C CA  . THR B 1 525 ? 71.517  8.307   28.591  1.00 4.63  ? 525  THR B CA  1 
ATOM   8251  C C   . THR B 1 525 ? 70.895  8.874   29.857  1.00 5.99  ? 525  THR B C   1 
ATOM   8252  O O   . THR B 1 525 ? 69.928  8.289   30.363  1.00 4.39  ? 525  THR B O   1 
ATOM   8253  C CB  . THR B 1 525 ? 71.859  6.806   28.745  1.00 4.74  ? 525  THR B CB  1 
ATOM   8254  O OG1 . THR B 1 525 ? 72.986  6.713   29.635  1.00 3.91  ? 525  THR B OG1 1 
ATOM   8255  C CG2 . THR B 1 525 ? 72.134  6.195   27.382  1.00 4.13  ? 525  THR B CG2 1 
ATOM   8256  N N   . GLY B 1 526 ? 71.346  10.029  30.343  1.00 5.17  ? 526  GLY B N   1 
ATOM   8257  C CA  . GLY B 1 526 ? 70.702  10.752  31.410  1.00 3.39  ? 526  GLY B CA  1 
ATOM   8258  C C   . GLY B 1 526 ? 71.252  10.784  32.785  1.00 3.55  ? 526  GLY B C   1 
ATOM   8259  O O   . GLY B 1 526 ? 70.810  11.584  33.619  1.00 2.61  ? 526  GLY B O   1 
ATOM   8260  N N   . GLU B 1 527 ? 72.146  9.867   33.113  1.00 3.91  ? 527  GLU B N   1 
ATOM   8261  C CA  . GLU B 1 527 ? 72.752  9.837   34.448  1.00 4.52  ? 527  GLU B CA  1 
ATOM   8262  C C   . GLU B 1 527 ? 73.741  11.007  34.586  1.00 3.94  ? 527  GLU B C   1 
ATOM   8263  O O   . GLU B 1 527 ? 74.353  11.390  33.600  1.00 2.66  ? 527  GLU B O   1 
ATOM   8264  C CB  . GLU B 1 527 ? 73.513  8.537   34.640  1.00 7.17  ? 527  GLU B CB  1 
ATOM   8265  C CG  . GLU B 1 527 ? 72.635  7.295   34.518  1.00 8.52  ? 527  GLU B CG  1 
ATOM   8266  C CD  . GLU B 1 527 ? 72.470  6.791   33.111  1.00 8.44  ? 527  GLU B CD  1 
ATOM   8267  O OE1 . GLU B 1 527 ? 72.925  7.384   32.109  1.00 7.10  ? 527  GLU B OE1 1 
ATOM   8268  O OE2 . GLU B 1 527 ? 71.847  5.704   33.011  1.00 10.10 ? 527  GLU B OE2 1 
ATOM   8269  N N   . VAL B 1 528 ? 73.890  11.487  35.805  1.00 2.60  ? 528  VAL B N   1 
ATOM   8270  C CA  . VAL B 1 528 ? 74.826  12.554  36.129  1.00 5.96  ? 528  VAL B CA  1 
ATOM   8271  C C   . VAL B 1 528 ? 76.158  11.951  36.597  1.00 4.88  ? 528  VAL B C   1 
ATOM   8272  O O   . VAL B 1 528 ? 76.171  11.263  37.625  1.00 6.53  ? 528  VAL B O   1 
ATOM   8273  C CB  . VAL B 1 528 ? 74.253  13.449  37.242  1.00 5.00  ? 528  VAL B CB  1 
ATOM   8274  C CG1 . VAL B 1 528 ? 75.298  14.455  37.757  1.00 6.99  ? 528  VAL B CG1 1 
ATOM   8275  C CG2 . VAL B 1 528 ? 73.079  14.250  36.659  1.00 6.46  ? 528  VAL B CG2 1 
ATOM   8276  N N   . ILE B 1 529 ? 77.225  12.206  35.861  1.00 4.49  ? 529  ILE B N   1 
ATOM   8277  C CA  . ILE B 1 529 ? 78.531  11.700  36.293  1.00 4.63  ? 529  ILE B CA  1 
ATOM   8278  C C   . ILE B 1 529 ? 79.241  12.837  37.024  1.00 5.82  ? 529  ILE B C   1 
ATOM   8279  O O   . ILE B 1 529 ? 79.047  13.985  36.619  1.00 6.48  ? 529  ILE B O   1 
ATOM   8280  C CB  . ILE B 1 529 ? 79.380  11.194  35.119  1.00 3.74  ? 529  ILE B CB  1 
ATOM   8281  C CG1 . ILE B 1 529 ? 80.663  10.512  35.627  1.00 5.00  ? 529  ILE B CG1 1 
ATOM   8282  C CG2 . ILE B 1 529 ? 79.712  12.373  34.172  1.00 2.44  ? 529  ILE B CG2 1 
ATOM   8283  C CD1 . ILE B 1 529 ? 81.272  9.571   34.585  1.00 4.14  ? 529  ILE B CD1 1 
ATOM   8284  N N   . LYS B 1 530 ? 79.962  12.546  38.097  1.00 5.99  ? 530  LYS B N   1 
ATOM   8285  C CA  . LYS B 1 530 ? 80.739  13.537  38.819  1.00 4.01  ? 530  LYS B CA  1 
ATOM   8286  C C   . LYS B 1 530 ? 82.145  12.925  38.955  1.00 8.42  ? 530  LYS B C   1 
ATOM   8287  O O   . LYS B 1 530 ? 82.265  11.769  39.389  1.00 8.26  ? 530  LYS B O   1 
ATOM   8288  C CB  . LYS B 1 530 ? 80.191  13.919  40.188  1.00 5.47  ? 530  LYS B CB  1 
ATOM   8289  C CG  . LYS B 1 530 ? 80.911  15.160  40.763  1.00 5.97  ? 530  LYS B CG  1 
ATOM   8290  C CD  . LYS B 1 530 ? 80.273  15.749  41.997  1.00 2.14  ? 530  LYS B CD  1 
ATOM   8291  C CE  . LYS B 1 530 ? 80.919  17.117  42.374  1.00 3.29  ? 530  LYS B CE  1 
ATOM   8292  N NZ  . LYS B 1 530 ? 80.189  17.621  43.590  1.00 3.98  ? 530  LYS B NZ  1 
ATOM   8293  N N   . LEU B 1 531 ? 83.191  13.650  38.548  1.00 7.82  ? 531  LEU B N   1 
ATOM   8294  C CA  . LEU B 1 531 ? 84.567  13.147  38.597  1.00 5.44  ? 531  LEU B CA  1 
ATOM   8295  C C   . LEU B 1 531 ? 85.384  13.872  39.663  1.00 7.03  ? 531  LEU B C   1 
ATOM   8296  O O   . LEU B 1 531 ? 85.347  15.108  39.732  1.00 5.90  ? 531  LEU B O   1 
ATOM   8297  C CB  . LEU B 1 531 ? 85.236  13.307  37.238  1.00 4.60  ? 531  LEU B CB  1 
ATOM   8298  C CG  . LEU B 1 531 ? 84.537  12.794  35.984  1.00 6.00  ? 531  LEU B CG  1 
ATOM   8299  C CD1 . LEU B 1 531 ? 85.323  13.090  34.713  1.00 3.12  ? 531  LEU B CD1 1 
ATOM   8300  C CD2 . LEU B 1 531 ? 84.323  11.256  36.037  1.00 7.27  ? 531  LEU B CD2 1 
ATOM   8301  N N   . PHE B 1 532 ? 86.127  13.143  40.486  1.00 6.72  ? 532  PHE B N   1 
ATOM   8302  C CA  . PHE B 1 532 ? 86.920  13.675  41.590  1.00 8.44  ? 532  PHE B CA  1 
ATOM   8303  C C   . PHE B 1 532 ? 88.431  13.497  41.375  1.00 8.63  ? 532  PHE B C   1 
ATOM   8304  O O   . PHE B 1 532 ? 88.882  12.554  40.707  1.00 6.39  ? 532  PHE B O   1 
ATOM   8305  C CB  . PHE B 1 532 ? 86.487  12.999  42.893  1.00 9.90  ? 532  PHE B CB  1 
ATOM   8306  C CG  . PHE B 1 532 ? 85.059  13.279  43.275  1.00 11.32 ? 532  PHE B CG  1 
ATOM   8307  C CD1 . PHE B 1 532 ? 84.719  14.399  44.011  1.00 12.54 ? 532  PHE B CD1 1 
ATOM   8308  C CD2 . PHE B 1 532 ? 84.040  12.415  42.881  1.00 12.43 ? 532  PHE B CD2 1 
ATOM   8309  C CE1 . PHE B 1 532 ? 83.401  14.652  44.369  1.00 12.65 ? 532  PHE B CE1 1 
ATOM   8310  C CE2 . PHE B 1 532 ? 82.716  12.655  43.220  1.00 10.43 ? 532  PHE B CE2 1 
ATOM   8311  C CZ  . PHE B 1 532 ? 82.396  13.779  43.960  1.00 11.48 ? 532  PHE B CZ  1 
ATOM   8312  N N   . GLN B 1 533 ? 89.220  14.406  41.979  1.00 7.54  ? 533  GLN B N   1 
ATOM   8313  C CA  . GLN B 1 533 ? 90.663  14.443  41.792  1.00 6.69  ? 533  GLN B CA  1 
ATOM   8314  C C   . GLN B 1 533 ? 91.382  13.289  42.464  1.00 6.59  ? 533  GLN B C   1 
ATOM   8315  O O   . GLN B 1 533 ? 92.487  12.996  42.031  1.00 5.62  ? 533  GLN B O   1 
ATOM   8316  C CB  . GLN B 1 533 ? 91.251  15.796  42.243  1.00 6.71  ? 533  GLN B CB  1 
ATOM   8317  C CG  . GLN B 1 533 ? 90.941  16.889  41.209  1.00 5.21  ? 533  GLN B CG  1 
ATOM   8318  C CD  . GLN B 1 533 ? 91.573  18.222  41.612  1.00 6.91  ? 533  GLN B CD  1 
ATOM   8319  O OE1 . GLN B 1 533 ? 91.302  18.727  42.712  1.00 6.72  ? 533  GLN B OE1 1 
ATOM   8320  N NE2 . GLN B 1 533 ? 92.406  18.766  40.745  1.00 5.00  ? 533  GLN B NE2 1 
ATOM   8321  N N   . ASP B 1 534 ? 90.745  12.600  43.416  1.00 7.14  ? 534  ASP B N   1 
ATOM   8322  C CA  . ASP B 1 534 ? 91.353  11.427  44.019  1.00 7.61  ? 534  ASP B CA  1 
ATOM   8323  C C   . ASP B 1 534 ? 91.101  10.166  43.178  1.00 8.75  ? 534  ASP B C   1 
ATOM   8324  O O   . ASP B 1 534 ? 91.464  9.080   43.629  1.00 9.32  ? 534  ASP B O   1 
ATOM   8325  C CB  . ASP B 1 534 ? 90.888  11.184  45.436  1.00 7.89  ? 534  ASP B CB  1 
ATOM   8326  C CG  . ASP B 1 534 ? 89.431  10.871  45.582  1.00 9.43  ? 534  ASP B CG  1 
ATOM   8327  O OD1 . ASP B 1 534 ? 88.653  10.778  44.602  1.00 11.78 ? 534  ASP B OD1 1 
ATOM   8328  O OD2 . ASP B 1 534 ? 89.022  10.718  46.743  1.00 7.92  ? 534  ASP B OD2 1 
ATOM   8329  N N   . GLY B 1 535 ? 90.553  10.276  41.985  1.00 6.51  ? 535  GLY B N   1 
ATOM   8330  C CA  . GLY B 1 535 ? 90.329  9.129   41.121  1.00 7.12  ? 535  GLY B CA  1 
ATOM   8331  C C   . GLY B 1 535 ? 88.955  8.487   41.314  1.00 6.75  ? 535  GLY B C   1 
ATOM   8332  O O   . GLY B 1 535 ? 88.626  7.575   40.534  1.00 7.74  ? 535  GLY B O   1 
ATOM   8333  N N   . THR B 1 536 ? 88.200  8.886   42.315  1.00 7.33  ? 536  THR B N   1 
ATOM   8334  C CA  . THR B 1 536 ? 86.864  8.282   42.471  1.00 7.94  ? 536  THR B CA  1 
ATOM   8335  C C   . THR B 1 536 ? 85.893  8.990   41.545  1.00 9.07  ? 536  THR B C   1 
ATOM   8336  O O   . THR B 1 536 ? 86.242  10.035  40.971  1.00 7.98  ? 536  THR B O   1 
ATOM   8337  C CB  . THR B 1 536 ? 86.359  8.330   43.900  1.00 8.44  ? 536  THR B CB  1 
ATOM   8338  O OG1 . THR B 1 536 ? 86.238  9.692   44.315  1.00 7.92  ? 536  THR B OG1 1 
ATOM   8339  C CG2 . THR B 1 536 ? 87.293  7.505   44.792  1.00 7.63  ? 536  THR B CG2 1 
ATOM   8340  N N   . PHE B 1 537 ? 84.713  8.400   41.350  1.00 7.93  ? 537  PHE B N   1 
ATOM   8341  C CA  . PHE B 1 537 ? 83.698  8.962   40.469  1.00 8.09  ? 537  PHE B CA  1 
ATOM   8342  C C   . PHE B 1 537 ? 82.332  8.380   40.861  1.00 8.35  ? 537  PHE B C   1 
ATOM   8343  O O   . PHE B 1 537 ? 82.267  7.322   41.487  1.00 9.34  ? 537  PHE B O   1 
ATOM   8344  C CB  . PHE B 1 537 ? 83.952  8.792   38.975  1.00 6.74  ? 537  PHE B CB  1 
ATOM   8345  C CG  . PHE B 1 537 ? 84.160  7.354   38.557  1.00 8.49  ? 537  PHE B CG  1 
ATOM   8346  C CD1 . PHE B 1 537 ? 85.361  6.706   38.838  1.00 7.90  ? 537  PHE B CD1 1 
ATOM   8347  C CD2 . PHE B 1 537 ? 83.184  6.674   37.869  1.00 6.44  ? 537  PHE B CD2 1 
ATOM   8348  C CE1 . PHE B 1 537 ? 85.547  5.389   38.470  1.00 9.12  ? 537  PHE B CE1 1 
ATOM   8349  C CE2 . PHE B 1 537 ? 83.356  5.360   37.482  1.00 8.57  ? 537  PHE B CE2 1 
ATOM   8350  C CZ  . PHE B 1 537 ? 84.538  4.715   37.805  1.00 9.06  ? 537  PHE B CZ  1 
ATOM   8351  N N   . THR B 1 538 ? 81.264  9.098   40.553  1.00 8.02  ? 538  THR B N   1 
ATOM   8352  C CA  . THR B 1 538 ? 79.918  8.740   40.938  1.00 7.88  ? 538  THR B CA  1 
ATOM   8353  C C   . THR B 1 538 ? 78.961  8.826   39.757  1.00 8.47  ? 538  THR B C   1 
ATOM   8354  O O   . THR B 1 538 ? 79.129  9.575   38.806  1.00 6.60  ? 538  THR B O   1 
ATOM   8355  C CB  . THR B 1 538 ? 79.341  9.640   42.058  1.00 8.29  ? 538  THR B CB  1 
ATOM   8356  O OG1 . THR B 1 538 ? 79.356  11.012  41.612  1.00 7.61  ? 538  THR B OG1 1 
ATOM   8357  C CG2 . THR B 1 538 ? 80.089  9.503   43.361  1.00 7.43  ? 538  THR B CG2 1 
ATOM   8358  N N   . ILE B 1 539 ? 77.894  8.009   39.847  1.00 8.17  ? 539  ILE B N   1 
ATOM   8359  C CA  . ILE B 1 539 ? 76.871  8.010   38.797  1.00 7.95  ? 539  ILE B CA  1 
ATOM   8360  C C   . ILE B 1 539 ? 75.578  8.269   39.568  1.00 9.78  ? 539  ILE B C   1 
ATOM   8361  O O   . ILE B 1 539 ? 75.242  7.517   40.498  1.00 9.54  ? 539  ILE B O   1 
ATOM   8362  C CB  . ILE B 1 539 ? 76.854  6.719   37.993  1.00 8.12  ? 539  ILE B CB  1 
ATOM   8363  C CG1 . ILE B 1 539 ? 78.080  6.577   37.081  1.00 7.71  ? 539  ILE B CG1 1 
ATOM   8364  C CG2 . ILE B 1 539 ? 75.587  6.637   37.149  1.00 7.45  ? 539  ILE B CG2 1 
ATOM   8365  C CD1 . ILE B 1 539 ? 78.232  7.582   35.968  1.00 6.17  ? 539  ILE B CD1 1 
ATOM   8366  N N   . ASP B 1 540 ? 74.950  9.406   39.304  1.00 8.51  ? 540  ASP B N   1 
ATOM   8367  C CA  . ASP B 1 540 ? 73.814  9.880   40.071  1.00 8.95  ? 540  ASP B CA  1 
ATOM   8368  C C   . ASP B 1 540 ? 74.086  9.816   41.566  1.00 8.26  ? 540  ASP B C   1 
ATOM   8369  O O   . ASP B 1 540 ? 73.252  9.306   42.344  1.00 7.35  ? 540  ASP B O   1 
ATOM   8370  C CB  . ASP B 1 540 ? 72.508  9.149   39.745  1.00 9.09  ? 540  ASP B CB  1 
ATOM   8371  C CG  . ASP B 1 540 ? 72.084  9.425   38.325  1.00 9.88  ? 540  ASP B CG  1 
ATOM   8372  O OD1 . ASP B 1 540 ? 72.152  10.593  37.861  1.00 9.26  ? 540  ASP B OD1 1 
ATOM   8373  O OD2 . ASP B 1 540 ? 71.675  8.469   37.639  1.00 9.54  ? 540  ASP B OD2 1 
ATOM   8374  N N   . GLY B 1 541 ? 75.269  10.238  42.012  1.00 6.37  ? 541  GLY B N   1 
ATOM   8375  C CA  . GLY B 1 541 ? 75.578  10.213  43.434  1.00 7.42  ? 541  GLY B CA  1 
ATOM   8376  C C   . GLY B 1 541 ? 76.042  8.863   43.949  1.00 10.24 ? 541  GLY B C   1 
ATOM   8377  O O   . GLY B 1 541 ? 76.454  8.778   45.118  1.00 10.54 ? 541  GLY B O   1 
ATOM   8378  N N   . PHE B 1 542 ? 76.033  7.800   43.155  1.00 10.42 ? 542  PHE B N   1 
ATOM   8379  C CA  . PHE B 1 542 ? 76.478  6.505   43.673  1.00 11.56 ? 542  PHE B CA  1 
ATOM   8380  C C   . PHE B 1 542 ? 77.972  6.295   43.397  1.00 11.49 ? 542  PHE B C   1 
ATOM   8381  O O   . PHE B 1 542 ? 78.382  6.354   42.238  1.00 9.51  ? 542  PHE B O   1 
ATOM   8382  C CB  . PHE B 1 542 ? 75.683  5.390   42.993  1.00 13.09 ? 542  PHE B CB  1 
ATOM   8383  C CG  . PHE B 1 542 ? 76.146  3.989   43.275  1.00 14.90 ? 542  PHE B CG  1 
ATOM   8384  C CD1 . PHE B 1 542 ? 75.704  3.326   44.414  1.00 17.63 ? 542  PHE B CD1 1 
ATOM   8385  C CD2 . PHE B 1 542 ? 76.994  3.320   42.427  1.00 16.06 ? 542  PHE B CD2 1 
ATOM   8386  C CE1 . PHE B 1 542 ? 76.110  2.029   44.689  1.00 18.34 ? 542  PHE B CE1 1 
ATOM   8387  C CE2 . PHE B 1 542 ? 77.417  2.026   42.687  1.00 16.73 ? 542  PHE B CE2 1 
ATOM   8388  C CZ  . PHE B 1 542 ? 76.973  1.382   43.818  1.00 17.36 ? 542  PHE B CZ  1 
ATOM   8389  N N   . LYS B 1 543 ? 78.751  6.028   44.443  1.00 12.07 ? 543  LYS B N   1 
ATOM   8390  C CA  . LYS B 1 543 ? 80.178  5.795   44.233  1.00 13.65 ? 543  LYS B CA  1 
ATOM   8391  C C   . LYS B 1 543 ? 80.434  4.538   43.420  1.00 12.99 ? 543  LYS B C   1 
ATOM   8392  O O   . LYS B 1 543 ? 80.103  3.460   43.903  1.00 13.77 ? 543  LYS B O   1 
ATOM   8393  C CB  . LYS B 1 543 ? 80.933  5.678   45.566  1.00 13.79 ? 543  LYS B CB  1 
ATOM   8394  C CG  . LYS B 1 543 ? 82.445  5.596   45.306  1.00 17.74 ? 543  LYS B CG  1 
ATOM   8395  C CD  . LYS B 1 543 ? 83.233  5.633   46.607  1.00 20.44 ? 543  LYS B CD  1 
ATOM   8396  C CE  . LYS B 1 543 ? 84.709  5.273   46.390  1.00 21.72 ? 543  LYS B CE  1 
ATOM   8397  N NZ  . LYS B 1 543 ? 85.482  5.830   47.564  1.00 24.15 ? 543  LYS B NZ  1 
ATOM   8398  N N   . CYS B 1 544 ? 81.095  4.627   42.277  1.00 12.66 ? 544  CYS B N   1 
ATOM   8399  C CA  . CYS B 1 544 ? 81.409  3.497   41.425  1.00 11.75 ? 544  CYS B CA  1 
ATOM   8400  C C   . CYS B 1 544 ? 82.574  2.682   41.998  1.00 15.02 ? 544  CYS B C   1 
ATOM   8401  O O   . CYS B 1 544 ? 83.516  3.204   42.599  1.00 13.41 ? 544  CYS B O   1 
ATOM   8402  C CB  . CYS B 1 544 ? 81.775  4.002   40.028  1.00 10.81 ? 544  CYS B CB  1 
ATOM   8403  S SG  . CYS B 1 544 ? 80.493  5.048   39.267  1.00 7.59  ? 544  CYS B SG  1 
ATOM   8404  N N   . PRO B 1 545 ? 82.508  1.374   41.798  1.00 15.58 ? 545  PRO B N   1 
ATOM   8405  C CA  . PRO B 1 545 ? 83.527  0.469   42.280  1.00 16.86 ? 545  PRO B CA  1 
ATOM   8406  C C   . PRO B 1 545 ? 84.782  0.408   41.442  1.00 16.93 ? 545  PRO B C   1 
ATOM   8407  O O   . PRO B 1 545 ? 85.866  0.102   41.988  1.00 19.11 ? 545  PRO B O   1 
ATOM   8408  C CB  . PRO B 1 545 ? 82.793  -0.892  42.304  1.00 17.79 ? 545  PRO B CB  1 
ATOM   8409  C CG  . PRO B 1 545 ? 81.796  -0.795  41.192  1.00 18.03 ? 545  PRO B CG  1 
ATOM   8410  C CD  . PRO B 1 545 ? 81.392  0.664   41.134  1.00 17.07 ? 545  PRO B CD  1 
ATOM   8411  N N   . GLY B 1 546 ? 84.765  0.641   40.130  1.00 15.01 ? 546  GLY B N   1 
ATOM   8412  C CA  . GLY B 1 546 ? 86.038  0.488   39.417  1.00 14.28 ? 546  GLY B CA  1 
ATOM   8413  C C   . GLY B 1 546 ? 87.067  1.568   39.776  1.00 14.18 ? 546  GLY B C   1 
ATOM   8414  O O   . GLY B 1 546 ? 86.768  2.613   40.340  1.00 13.74 ? 546  GLY B O   1 
ATOM   8415  N N   . LEU B 1 547 ? 88.315  1.336   39.368  1.00 12.17 ? 547  LEU B N   1 
ATOM   8416  C CA  . LEU B 1 547 ? 89.359  2.307   39.498  1.00 13.24 ? 547  LEU B CA  1 
ATOM   8417  C C   . LEU B 1 547 ? 89.090  3.506   38.561  1.00 11.06 ? 547  LEU B C   1 
ATOM   8418  O O   . LEU B 1 547 ? 89.352  4.653   38.914  1.00 10.53 ? 547  LEU B O   1 
ATOM   8419  C CB  . LEU B 1 547 ? 90.730  1.794   39.091  1.00 13.81 ? 547  LEU B CB  1 
ATOM   8420  C CG  . LEU B 1 547 ? 91.789  1.578   40.162  1.00 16.69 ? 547  LEU B CG  1 
ATOM   8421  C CD1 . LEU B 1 547 ? 93.100  1.178   39.466  1.00 14.83 ? 547  LEU B CD1 1 
ATOM   8422  C CD2 . LEU B 1 547 ? 91.955  2.792   41.066  1.00 16.82 ? 547  LEU B CD2 1 
ATOM   8423  N N   . VAL B 1 548 ? 88.752  3.176   37.334  1.00 9.42  ? 548  VAL B N   1 
ATOM   8424  C CA  . VAL B 1 548 ? 88.527  4.111   36.246  1.00 8.84  ? 548  VAL B CA  1 
ATOM   8425  C C   . VAL B 1 548 ? 87.165  3.850   35.597  1.00 9.35  ? 548  VAL B C   1 
ATOM   8426  O O   . VAL B 1 548 ? 86.605  2.742   35.714  1.00 9.38  ? 548  VAL B O   1 
ATOM   8427  C CB  . VAL B 1 548 ? 89.581  3.983   35.137  1.00 9.07  ? 548  VAL B CB  1 
ATOM   8428  C CG1 . VAL B 1 548 ? 90.980  4.281   35.641  1.00 8.80  ? 548  VAL B CG1 1 
ATOM   8429  C CG2 . VAL B 1 548 ? 89.520  2.583   34.509  1.00 8.80  ? 548  VAL B CG2 1 
ATOM   8430  N N   . TYR B 1 549 ? 86.654  4.849   34.886  1.00 8.04  ? 549  TYR B N   1 
ATOM   8431  C CA  . TYR B 1 549 ? 85.307  4.722   34.294  1.00 6.70  ? 549  TYR B CA  1 
ATOM   8432  C C   . TYR B 1 549 ? 85.278  3.760   33.124  1.00 5.91  ? 549  TYR B C   1 
ATOM   8433  O O   . TYR B 1 549 ? 86.068  3.855   32.163  1.00 4.08  ? 549  TYR B O   1 
ATOM   8434  C CB  . TYR B 1 549 ? 84.787  6.116   33.916  1.00 4.09  ? 549  TYR B CB  1 
ATOM   8435  C CG  . TYR B 1 549 ? 83.441  6.169   33.209  1.00 4.61  ? 549  TYR B CG  1 
ATOM   8436  C CD1 . TYR B 1 549 ? 82.274  6.004   33.932  1.00 4.79  ? 549  TYR B CD1 1 
ATOM   8437  C CD2 . TYR B 1 549 ? 83.334  6.341   31.832  1.00 5.37  ? 549  TYR B CD2 1 
ATOM   8438  C CE1 . TYR B 1 549 ? 81.017  6.042   33.325  1.00 5.84  ? 549  TYR B CE1 1 
ATOM   8439  C CE2 . TYR B 1 549 ? 82.106  6.394   31.213  1.00 5.49  ? 549  TYR B CE2 1 
ATOM   8440  C CZ  . TYR B 1 549 ? 80.942  6.247   31.979  1.00 6.04  ? 549  TYR B CZ  1 
ATOM   8441  O OH  . TYR B 1 549 ? 79.722  6.305   31.368  1.00 6.79  ? 549  TYR B OH  1 
ATOM   8442  N N   . THR B 1 550 ? 84.293  2.828   33.127  1.00 4.94  ? 550  THR B N   1 
ATOM   8443  C CA  . THR B 1 550 ? 84.180  1.922   31.972  1.00 5.17  ? 550  THR B CA  1 
ATOM   8444  C C   . THR B 1 550 ? 82.736  1.830   31.465  1.00 6.79  ? 550  THR B C   1 
ATOM   8445  O O   . THR B 1 550 ? 82.404  0.912   30.702  1.00 6.73  ? 550  THR B O   1 
ATOM   8446  C CB  . THR B 1 550 ? 84.664  0.484   32.252  1.00 6.20  ? 550  THR B CB  1 
ATOM   8447  O OG1 . THR B 1 550 ? 83.958  0.057   33.432  1.00 5.88  ? 550  THR B OG1 1 
ATOM   8448  C CG2 . THR B 1 550 ? 86.150  0.446   32.585  1.00 4.99  ? 550  THR B CG2 1 
ATOM   8449  N N   . GLY B 1 551 ? 81.949  2.879   31.787  1.00 7.42  ? 551  GLY B N   1 
ATOM   8450  C CA  . GLY B 1 551 ? 80.569  2.903   31.270  1.00 6.33  ? 551  GLY B CA  1 
ATOM   8451  C C   . GLY B 1 551 ? 79.543  2.838   32.390  1.00 6.03  ? 551  GLY B C   1 
ATOM   8452  O O   . GLY B 1 551 ? 79.776  2.297   33.483  1.00 5.57  ? 551  GLY B O   1 
ATOM   8453  N N   . VAL B 1 552 ? 78.366  3.406   32.131  1.00 6.10  ? 552  VAL B N   1 
ATOM   8454  C CA  . VAL B 1 552 ? 77.289  3.378   33.129  1.00 10.27 ? 552  VAL B CA  1 
ATOM   8455  C C   . VAL B 1 552 ? 76.944  1.990   33.666  1.00 11.69 ? 552  VAL B C   1 
ATOM   8456  O O   . VAL B 1 552 ? 76.736  1.842   34.868  1.00 11.56 ? 552  VAL B O   1 
ATOM   8457  C CB  . VAL B 1 552 ? 75.998  4.003   32.536  1.00 10.83 ? 552  VAL B CB  1 
ATOM   8458  C CG1 . VAL B 1 552 ? 74.788  3.805   33.420  1.00 12.07 ? 552  VAL B CG1 1 
ATOM   8459  C CG2 . VAL B 1 552 ? 76.251  5.513   32.382  1.00 11.22 ? 552  VAL B CG2 1 
ATOM   8460  N N   . GLU B 1 553 ? 76.887  0.967   32.810  1.00 13.33 ? 553  GLU B N   1 
ATOM   8461  C CA  . GLU B 1 553 ? 76.532  -0.364  33.291  1.00 17.26 ? 553  GLU B CA  1 
ATOM   8462  C C   . GLU B 1 553 ? 77.502  -0.940  34.304  1.00 16.83 ? 553  GLU B C   1 
ATOM   8463  O O   . GLU B 1 553 ? 77.085  -1.830  35.053  1.00 16.40 ? 553  GLU B O   1 
ATOM   8464  C CB  . GLU B 1 553 ? 76.413  -1.363  32.148  1.00 21.12 ? 553  GLU B CB  1 
ATOM   8465  C CG  . GLU B 1 553 ? 75.418  -1.093  31.058  1.00 27.54 ? 553  GLU B CG  1 
ATOM   8466  C CD  . GLU B 1 553 ? 74.126  -0.373  31.386  1.00 31.81 ? 553  GLU B CD  1 
ATOM   8467  O OE1 . GLU B 1 553 ? 73.549  -0.488  32.502  1.00 33.62 ? 553  GLU B OE1 1 
ATOM   8468  O OE2 . GLU B 1 553 ? 73.645  0.364   30.468  1.00 33.41 ? 553  GLU B OE2 1 
ATOM   8469  N N   . ASN B 1 554 ? 78.770  -0.549  34.345  1.00 15.89 ? 554  ASN B N   1 
ATOM   8470  C CA  . ASN B 1 554 ? 79.710  -1.086  35.329  1.00 14.91 ? 554  ASN B CA  1 
ATOM   8471  C C   . ASN B 1 554 ? 79.705  -0.334  36.636  1.00 15.49 ? 554  ASN B C   1 
ATOM   8472  O O   . ASN B 1 554 ? 80.400  -0.760  37.579  1.00 16.17 ? 554  ASN B O   1 
ATOM   8473  C CB  . ASN B 1 554 ? 81.122  -1.119  34.722  1.00 16.43 ? 554  ASN B CB  1 
ATOM   8474  C CG  . ASN B 1 554 ? 81.163  -2.116  33.573  1.00 16.76 ? 554  ASN B CG  1 
ATOM   8475  O OD1 . ASN B 1 554 ? 80.430  -3.107  33.617  1.00 16.89 ? 554  ASN B OD1 1 
ATOM   8476  N ND2 . ASN B 1 554 ? 81.942  -1.868  32.533  1.00 15.62 ? 554  ASN B ND2 1 
ATOM   8477  N N   . CYS B 1 555 ? 78.924  0.752   36.760  1.00 13.55 ? 555  CYS B N   1 
ATOM   8478  C CA  . CYS B 1 555 ? 78.905  1.486   38.015  1.00 13.62 ? 555  CYS B CA  1 
ATOM   8479  C C   . CYS B 1 555 ? 77.685  1.066   38.838  1.00 15.82 ? 555  CYS B C   1 
ATOM   8480  O O   . CYS B 1 555 ? 76.669  1.758   38.981  1.00 14.32 ? 555  CYS B O   1 
ATOM   8481  C CB  . CYS B 1 555 ? 78.857  3.003   37.806  1.00 12.00 ? 555  CYS B CB  1 
ATOM   8482  S SG  . CYS B 1 555 ? 78.779  3.897   39.351  1.00 8.10  ? 555  CYS B SG  1 
ATOM   8483  N N   . VAL B 1 556 ? 77.852  -0.070  39.475  1.00 20.06 ? 556  VAL B N   1 
ATOM   8484  C CA  . VAL B 1 556 ? 76.755  -0.725  40.210  1.00 21.95 ? 556  VAL B CA  1 
ATOM   8485  C C   . VAL B 1 556 ? 77.313  -1.583  41.327  1.00 23.28 ? 556  VAL B C   1 
ATOM   8486  O O   . VAL B 1 556 ? 78.572  -1.566  41.443  1.00 22.00 ? 556  VAL B O   1 
ATOM   8487  C CB  . VAL B 1 556 ? 76.070  -1.512  39.067  1.00 24.50 ? 556  VAL B CB  1 
ATOM   8488  C CG1 . VAL B 1 556 ? 76.375  -2.998  39.108  1.00 24.81 ? 556  VAL B CG1 1 
ATOM   8489  C CG2 . VAL B 1 556 ? 74.597  -1.162  38.981  1.00 24.45 ? 556  VAL B CG2 1 
ATOM   8490  O OXT . VAL B 1 556 ? 76.570  -1.834  42.314  1.00 23.55 ? 556  VAL B OXT 1 
HETATM 8491  V V   . VO4 C 2 .   ? 98.484  37.878  25.808  1.00 3.25  ? 600  VO4 A V   1 
HETATM 8492  O O1  . VO4 C 2 .   ? 97.731  39.007  26.636  1.00 3.70  ? 600  VO4 A O1  1 
HETATM 8493  O O2  . VO4 C 2 .   ? 99.195  36.817  26.779  1.00 3.34  ? 600  VO4 A O2  1 
HETATM 8494  O O3  . VO4 C 2 .   ? 98.607  37.762  24.300  1.00 2.08  ? 600  VO4 A O3  1 
HETATM 8495  O O4  . VO4 C 2 .   ? 97.052  36.839  25.728  1.00 2.08  ? 600  VO4 A O4  1 
HETATM 8496  I I   . IOD D 3 .   ? 103.593 65.534  30.577  0.10 11.62 ? 601  IOD A I   1 
HETATM 8497  I I   . IOD E 3 .   ? 96.236  48.283  -2.050  0.50 18.62 ? 602  IOD A I   1 
HETATM 8498  I I   . IOD F 3 .   ? 99.351  44.328  -5.203  0.50 24.54 ? 603  IOD A I   1 
HETATM 8499  V V   . VO4 G 2 .   ? 81.916  7.258   8.938   1.00 5.12  ? 600  VO4 B V   1 
HETATM 8500  O O1  . VO4 G 2 .   ? 81.850  6.923   7.433   1.00 2.08  ? 600  VO4 B O1  1 
HETATM 8501  O O2  . VO4 G 2 .   ? 82.806  6.377   9.918   1.00 2.27  ? 600  VO4 B O2  1 
HETATM 8502  O O3  . VO4 G 2 .   ? 80.956  8.181   9.778   1.00 4.77  ? 600  VO4 B O3  1 
HETATM 8503  O O4  . VO4 G 2 .   ? 83.098  8.571   8.805   1.00 6.37  ? 600  VO4 B O4  1 
HETATM 8504  I I   . IOD H 3 .   ? 58.257  25.748  9.600   0.50 18.22 ? 601  IOD B I   1 
HETATM 8505  I I   . IOD I 3 .   ? 57.833  26.793  15.423  0.50 21.38 ? 602  IOD B I   1 
HETATM 8506  O O   . HOH J 4 .   ? 112.701 24.009  35.346  1.00 2.26  ? 604  HOH A O   1 
HETATM 8507  O O   . HOH J 4 .   ? 111.971 20.364  34.209  1.00 2.92  ? 605  HOH A O   1 
HETATM 8508  O O   . HOH J 4 .   ? 110.593 16.377  32.147  1.00 5.76  ? 606  HOH A O   1 
HETATM 8509  O O   . HOH J 4 .   ? 108.563 12.115  32.223  1.00 4.96  ? 607  HOH A O   1 
HETATM 8510  O O   . HOH J 4 .   ? 97.953  -0.042  30.559  1.00 3.49  ? 608  HOH A O   1 
HETATM 8511  O O   . HOH J 4 .   ? 94.126  2.199   -4.255  1.00 8.83  ? 609  HOH A O   1 
HETATM 8512  O O   . HOH J 4 .   ? 95.520  5.069   -5.683  1.00 11.55 ? 610  HOH A O   1 
HETATM 8513  O O   . HOH J 4 .   ? 90.323  9.123   1.012   1.00 8.46  ? 611  HOH A O   1 
HETATM 8514  O O   . HOH J 4 .   ? 99.645  3.769   13.803  1.00 4.02  ? 612  HOH A O   1 
HETATM 8515  O O   . HOH J 4 .   ? 102.780 2.559   19.831  1.00 3.54  ? 613  HOH A O   1 
HETATM 8516  O O   . HOH J 4 .   ? 103.073 5.484   24.813  1.00 8.66  ? 614  HOH A O   1 
HETATM 8517  O O   . HOH J 4 .   ? 106.703 5.196   21.738  1.00 8.79  ? 615  HOH A O   1 
HETATM 8518  O O   . HOH J 4 .   ? 104.935 3.116   21.603  1.00 7.63  ? 616  HOH A O   1 
HETATM 8519  O O   . HOH J 4 .   ? 107.591 4.429   24.238  1.00 6.15  ? 617  HOH A O   1 
HETATM 8520  O O   . HOH J 4 .   ? 99.929  13.888  22.502  1.00 3.90  ? 618  HOH A O   1 
HETATM 8521  O O   . HOH J 4 .   ? 101.869 13.811  15.716  1.00 4.35  ? 619  HOH A O   1 
HETATM 8522  O O   . HOH J 4 .   ? 102.226 12.218  22.822  1.00 3.31  ? 620  HOH A O   1 
HETATM 8523  O O   . HOH J 4 .   ? 95.043  14.833  21.213  1.00 3.68  ? 621  HOH A O   1 
HETATM 8524  O O   . HOH J 4 .   ? 111.306 52.755  38.334  1.00 2.85  ? 622  HOH A O   1 
HETATM 8525  O O   . HOH J 4 .   ? 117.063 39.207  41.729  1.00 4.98  ? 623  HOH A O   1 
HETATM 8526  O O   . HOH J 4 .   ? 86.180  34.268  17.591  1.00 4.31  ? 624  HOH A O   1 
HETATM 8527  O O   . HOH J 4 .   ? 84.257  35.889  21.140  1.00 12.30 ? 625  HOH A O   1 
HETATM 8528  O O   . HOH J 4 .   ? 84.518  37.134  17.505  1.00 6.95  ? 626  HOH A O   1 
HETATM 8529  O O   . HOH J 4 .   ? 90.361  38.504  9.612   1.00 7.28  ? 627  HOH A O   1 
HETATM 8530  O O   . HOH J 4 .   ? 90.238  40.100  6.783   1.00 2.82  ? 628  HOH A O   1 
HETATM 8531  O O   . HOH J 4 .   ? 90.317  34.012  6.352   1.00 3.77  ? 629  HOH A O   1 
HETATM 8532  O O   . HOH J 4 .   ? 81.198  39.806  7.139   1.00 14.95 ? 630  HOH A O   1 
HETATM 8533  O O   . HOH J 4 .   ? 81.087  41.362  15.810  1.00 11.23 ? 631  HOH A O   1 
HETATM 8534  O O   . HOH J 4 .   ? 82.777  22.542  3.408   1.00 7.37  ? 632  HOH A O   1 
HETATM 8535  O O   . HOH J 4 .   ? 85.767  23.197  4.069   1.00 7.66  ? 633  HOH A O   1 
HETATM 8536  O O   . HOH J 4 .   ? 88.242  23.523  3.153   1.00 19.95 ? 634  HOH A O   1 
HETATM 8537  O O   . HOH J 4 .   ? 88.167  26.900  2.733   1.00 14.62 ? 635  HOH A O   1 
HETATM 8538  O O   . HOH J 4 .   ? 76.181  23.415  6.745   1.00 4.85  ? 636  HOH A O   1 
HETATM 8539  O O   . HOH J 4 .   ? 90.605  21.556  16.276  1.00 2.08  ? 637  HOH A O   1 
HETATM 8540  O O   . HOH J 4 .   ? 90.216  38.729  34.553  1.00 2.78  ? 638  HOH A O   1 
HETATM 8541  O O   . HOH J 4 .   ? 91.720  39.697  32.549  1.00 4.63  ? 639  HOH A O   1 
HETATM 8542  O O   . HOH J 4 .   ? 83.537  38.755  38.791  1.00 9.46  ? 640  HOH A O   1 
HETATM 8543  O O   . HOH J 4 .   ? 80.764  48.401  37.431  1.00 38.44 ? 641  HOH A O   1 
HETATM 8544  O O   . HOH J 4 .   ? 86.958  41.775  40.420  1.00 6.70  ? 642  HOH A O   1 
HETATM 8545  O O   . HOH J 4 .   ? 86.153  45.517  39.714  1.00 3.13  ? 643  HOH A O   1 
HETATM 8546  O O   . HOH J 4 .   ? 88.232  36.609  47.526  1.00 20.42 ? 644  HOH A O   1 
HETATM 8547  O O   . HOH J 4 .   ? 113.277 60.582  15.228  1.00 6.97  ? 645  HOH A O   1 
HETATM 8548  O O   . HOH J 4 .   ? 97.004  17.221  29.167  1.00 2.25  ? 646  HOH A O   1 
HETATM 8549  O O   . HOH J 4 .   ? 97.502  14.325  31.931  1.00 2.25  ? 647  HOH A O   1 
HETATM 8550  O O   . HOH J 4 .   ? 98.216  15.033  28.182  1.00 2.83  ? 648  HOH A O   1 
HETATM 8551  O O   . HOH J 4 .   ? 98.969  16.221  23.694  1.00 2.18  ? 649  HOH A O   1 
HETATM 8552  O O   . HOH J 4 .   ? 98.656  29.411  45.650  1.00 6.20  ? 650  HOH A O   1 
HETATM 8553  O O   . HOH J 4 .   ? 100.095 28.990  42.152  1.00 6.55  ? 651  HOH A O   1 
HETATM 8554  O O   . HOH J 4 .   ? 100.660 29.475  36.480  1.00 2.38  ? 652  HOH A O   1 
HETATM 8555  O O   . HOH J 4 .   ? 92.399  25.688  47.879  1.00 13.16 ? 653  HOH A O   1 
HETATM 8556  O O   . HOH J 4 .   ? 86.799  -15.199 21.350  1.00 31.57 ? 654  HOH A O   1 
HETATM 8557  O O   . HOH J 4 .   ? 96.217  -4.901  34.748  1.00 21.40 ? 655  HOH A O   1 
HETATM 8558  O O   . HOH J 4 .   ? 104.579 -3.917  31.252  1.00 24.76 ? 656  HOH A O   1 
HETATM 8559  O O   . HOH J 4 .   ? 106.534 7.890   22.195  1.00 5.12  ? 657  HOH A O   1 
HETATM 8560  O O   . HOH J 4 .   ? 108.936 8.594   23.129  1.00 2.70  ? 658  HOH A O   1 
HETATM 8561  O O   . HOH J 4 .   ? 108.709 10.621  25.003  1.00 5.49  ? 659  HOH A O   1 
HETATM 8562  O O   . HOH J 4 .   ? 112.839 5.349   27.030  1.00 10.70 ? 660  HOH A O   1 
HETATM 8563  O O   . HOH J 4 .   ? 109.041 0.608   29.529  1.00 12.97 ? 661  HOH A O   1 
HETATM 8564  O O   . HOH J 4 .   ? 111.235 2.193   30.096  1.00 20.80 ? 662  HOH A O   1 
HETATM 8565  O O   . HOH J 4 .   ? 112.237 1.752   32.721  1.00 22.74 ? 663  HOH A O   1 
HETATM 8566  O O   . HOH J 4 .   ? 105.264 13.248  28.062  1.00 2.27  ? 664  HOH A O   1 
HETATM 8567  O O   . HOH J 4 .   ? 118.401 16.358  36.668  1.00 8.00  ? 665  HOH A O   1 
HETATM 8568  O O   . HOH J 4 .   ? 120.833 17.778  33.599  1.00 11.36 ? 666  HOH A O   1 
HETATM 8569  O O   . HOH J 4 .   ? 116.500 19.553  28.633  1.00 7.35  ? 667  HOH A O   1 
HETATM 8570  O O   . HOH J 4 .   ? 113.810 19.889  28.068  1.00 4.24  ? 668  HOH A O   1 
HETATM 8571  O O   . HOH J 4 .   ? 118.071 16.038  25.618  1.00 16.49 ? 669  HOH A O   1 
HETATM 8572  O O   . HOH J 4 .   ? 118.245 28.902  31.165  1.00 14.72 ? 670  HOH A O   1 
HETATM 8573  O O   . HOH J 4 .   ? 112.523 30.750  31.412  1.00 3.02  ? 671  HOH A O   1 
HETATM 8574  O O   . HOH J 4 .   ? 115.265 31.745  31.372  1.00 12.40 ? 672  HOH A O   1 
HETATM 8575  O O   . HOH J 4 .   ? 108.054 26.662  30.187  1.00 2.19  ? 673  HOH A O   1 
HETATM 8576  O O   . HOH J 4 .   ? 107.431 22.994  28.410  1.00 2.50  ? 674  HOH A O   1 
HETATM 8577  O O   . HOH J 4 .   ? 113.016 38.314  33.233  1.00 3.04  ? 675  HOH A O   1 
HETATM 8578  O O   . HOH J 4 .   ? 111.292 39.719  34.903  1.00 3.17  ? 676  HOH A O   1 
HETATM 8579  O O   . HOH J 4 .   ? 117.877 41.218  30.648  1.00 6.80  ? 677  HOH A O   1 
HETATM 8580  O O   . HOH J 4 .   ? 118.665 43.978  30.176  1.00 5.62  ? 678  HOH A O   1 
HETATM 8581  O O   . HOH J 4 .   ? 118.910 44.187  27.422  1.00 14.99 ? 679  HOH A O   1 
HETATM 8582  O O   . HOH J 4 .   ? 112.020 44.972  45.386  1.00 19.33 ? 680  HOH A O   1 
HETATM 8583  O O   . HOH J 4 .   ? 111.134 49.258  43.404  1.00 14.78 ? 681  HOH A O   1 
HETATM 8584  O O   . HOH J 4 .   ? 117.549 45.514  40.668  1.00 6.99  ? 682  HOH A O   1 
HETATM 8585  O O   . HOH J 4 .   ? 110.453 38.949  38.576  1.00 11.57 ? 683  HOH A O   1 
HETATM 8586  O O   . HOH J 4 .   ? 114.336 39.287  39.395  1.00 5.43  ? 684  HOH A O   1 
HETATM 8587  O O   . HOH J 4 .   ? 111.071 42.504  35.882  1.00 2.39  ? 685  HOH A O   1 
HETATM 8588  O O   . HOH J 4 .   ? 115.522 47.459  37.178  1.00 5.02  ? 686  HOH A O   1 
HETATM 8589  O O   . HOH J 4 .   ? 114.216 49.945  37.327  1.00 9.44  ? 687  HOH A O   1 
HETATM 8590  O O   . HOH J 4 .   ? 118.337 51.817  37.811  1.00 9.14  ? 688  HOH A O   1 
HETATM 8591  O O   . HOH J 4 .   ? 104.869 49.355  41.612  1.00 2.48  ? 689  HOH A O   1 
HETATM 8592  O O   . HOH J 4 .   ? 104.260 50.562  39.224  1.00 2.57  ? 690  HOH A O   1 
HETATM 8593  O O   . HOH J 4 .   ? 105.004 50.010  36.433  1.00 3.76  ? 691  HOH A O   1 
HETATM 8594  O O   . HOH J 4 .   ? 105.802 52.878  38.855  1.00 5.75  ? 692  HOH A O   1 
HETATM 8595  O O   . HOH J 4 .   ? 103.454 54.029  37.944  1.00 3.12  ? 693  HOH A O   1 
HETATM 8596  O O   . HOH J 4 .   ? 102.338 51.810  36.592  1.00 2.11  ? 694  HOH A O   1 
HETATM 8597  O O   . HOH J 4 .   ? 100.603 50.199  38.012  1.00 2.78  ? 695  HOH A O   1 
HETATM 8598  O O   . HOH J 4 .   ? 107.695 53.441  40.945  1.00 6.97  ? 696  HOH A O   1 
HETATM 8599  O O   . HOH J 4 .   ? 110.864 56.491  40.898  1.00 10.71 ? 697  HOH A O   1 
HETATM 8600  O O   . HOH J 4 .   ? 116.434 57.076  38.226  1.00 21.30 ? 698  HOH A O   1 
HETATM 8601  O O   . HOH J 4 .   ? 114.031 53.489  38.403  1.00 13.96 ? 699  HOH A O   1 
HETATM 8602  O O   . HOH J 4 .   ? 103.880 47.375  36.946  1.00 8.11  ? 700  HOH A O   1 
HETATM 8603  O O   . HOH J 4 .   ? 101.528 45.902  36.682  1.00 2.27  ? 701  HOH A O   1 
HETATM 8604  O O   . HOH J 4 .   ? 101.182 44.919  34.406  1.00 2.08  ? 702  HOH A O   1 
HETATM 8605  O O   . HOH J 4 .   ? 98.922  46.364  33.480  1.00 3.22  ? 703  HOH A O   1 
HETATM 8606  O O   . HOH J 4 .   ? 99.464  47.837  37.237  1.00 6.74  ? 704  HOH A O   1 
HETATM 8607  O O   . HOH J 4 .   ? 105.901 37.529  32.801  1.00 2.73  ? 705  HOH A O   1 
HETATM 8608  O O   . HOH J 4 .   ? 91.044  45.327  33.005  1.00 4.80  ? 706  HOH A O   1 
HETATM 8609  O O   . HOH J 4 .   ? 90.772  46.485  35.360  1.00 2.98  ? 707  HOH A O   1 
HETATM 8610  O O   . HOH J 4 .   ? 91.718  42.674  32.307  1.00 5.26  ? 708  HOH A O   1 
HETATM 8611  O O   . HOH J 4 .   ? 92.466  44.335  36.320  1.00 9.75  ? 709  HOH A O   1 
HETATM 8612  O O   . HOH J 4 .   ? 95.098  54.336  43.584  1.00 7.31  ? 710  HOH A O   1 
HETATM 8613  O O   . HOH J 4 .   ? 91.275  53.836  41.079  1.00 16.21 ? 711  HOH A O   1 
HETATM 8614  O O   . HOH J 4 .   ? 101.912 51.683  47.427  1.00 17.74 ? 712  HOH A O   1 
HETATM 8615  O O   . HOH J 4 .   ? 93.447  50.496  45.551  1.00 10.55 ? 713  HOH A O   1 
HETATM 8616  O O   . HOH J 4 .   ? 110.790 61.733  41.664  1.00 33.10 ? 714  HOH A O   1 
HETATM 8617  O O   . HOH J 4 .   ? 106.291 43.302  48.863  1.00 9.70  ? 715  HOH A O   1 
HETATM 8618  O O   . HOH J 4 .   ? 107.938 45.475  48.702  1.00 5.30  ? 716  HOH A O   1 
HETATM 8619  O O   . HOH J 4 .   ? 100.933 39.991  52.665  1.00 12.70 ? 717  HOH A O   1 
HETATM 8620  O O   . HOH J 4 .   ? 103.370 40.309  54.118  1.00 26.30 ? 718  HOH A O   1 
HETATM 8621  O O   . HOH J 4 .   ? 97.900  35.495  48.922  1.00 8.67  ? 719  HOH A O   1 
HETATM 8622  O O   . HOH J 4 .   ? 91.082  32.227  51.109  1.00 15.25 ? 720  HOH A O   1 
HETATM 8623  O O   . HOH J 4 .   ? 93.815  30.598  52.559  1.00 26.90 ? 721  HOH A O   1 
HETATM 8624  O O   . HOH J 4 .   ? 86.577  34.095  47.349  1.00 23.01 ? 722  HOH A O   1 
HETATM 8625  O O   . HOH J 4 .   ? 97.289  51.017  48.395  1.00 28.36 ? 723  HOH A O   1 
HETATM 8626  O O   . HOH J 4 .   ? 89.071  46.716  47.078  1.00 14.12 ? 724  HOH A O   1 
HETATM 8627  O O   . HOH J 4 .   ? 85.189  52.689  38.520  1.00 29.31 ? 725  HOH A O   1 
HETATM 8628  O O   . HOH J 4 .   ? 81.484  45.816  37.175  1.00 20.31 ? 726  HOH A O   1 
HETATM 8629  O O   . HOH J 4 .   ? 103.077 19.871  32.411  1.00 6.93  ? 727  HOH A O   1 
HETATM 8630  O O   . HOH J 4 .   ? 102.366 20.767  29.860  1.00 6.48  ? 728  HOH A O   1 
HETATM 8631  O O   . HOH J 4 .   ? 103.125 18.936  27.829  1.00 2.26  ? 729  HOH A O   1 
HETATM 8632  O O   . HOH J 4 .   ? 102.793 22.924  28.089  1.00 4.19  ? 730  HOH A O   1 
HETATM 8633  O O   . HOH J 4 .   ? 102.587 20.720  25.845  1.00 3.56  ? 731  HOH A O   1 
HETATM 8634  O O   . HOH J 4 .   ? 107.408 20.569  35.414  1.00 9.05  ? 732  HOH A O   1 
HETATM 8635  O O   . HOH J 4 .   ? 108.617 16.369  30.251  1.00 8.70  ? 733  HOH A O   1 
HETATM 8636  O O   . HOH J 4 .   ? 113.705 25.246  26.111  1.00 14.87 ? 734  HOH A O   1 
HETATM 8637  O O   . HOH J 4 .   ? 112.470 29.167  23.976  1.00 5.28  ? 735  HOH A O   1 
HETATM 8638  O O   . HOH J 4 .   ? 111.490 31.739  23.420  1.00 2.48  ? 736  HOH A O   1 
HETATM 8639  O O   . HOH J 4 .   ? 115.911 25.215  27.553  1.00 17.51 ? 737  HOH A O   1 
HETATM 8640  O O   . HOH J 4 .   ? 113.328 38.313  26.514  1.00 4.09  ? 738  HOH A O   1 
HETATM 8641  O O   . HOH J 4 .   ? 113.149 27.313  22.173  1.00 3.28  ? 739  HOH A O   1 
HETATM 8642  O O   . HOH J 4 .   ? 115.219 32.531  22.216  1.00 9.91  ? 740  HOH A O   1 
HETATM 8643  O O   . HOH J 4 .   ? 115.534 30.176  26.794  1.00 8.17  ? 741  HOH A O   1 
HETATM 8644  O O   . HOH J 4 .   ? 117.844 31.636  27.619  1.00 16.18 ? 742  HOH A O   1 
HETATM 8645  O O   . HOH J 4 .   ? 115.108 30.275  24.095  1.00 10.93 ? 743  HOH A O   1 
HETATM 8646  O O   . HOH J 4 .   ? 115.001 28.343  20.436  1.00 9.29  ? 744  HOH A O   1 
HETATM 8647  O O   . HOH J 4 .   ? 114.897 26.976  18.058  1.00 3.12  ? 745  HOH A O   1 
HETATM 8648  O O   . HOH J 4 .   ? 112.292 25.890  18.085  1.00 6.13  ? 746  HOH A O   1 
HETATM 8649  O O   . HOH J 4 .   ? 115.820 30.847  20.323  1.00 7.58  ? 747  HOH A O   1 
HETATM 8650  O O   . HOH J 4 .   ? 116.790 37.313  23.684  1.00 16.19 ? 748  HOH A O   1 
HETATM 8651  O O   . HOH J 4 .   ? 115.530 35.336  19.481  1.00 15.43 ? 749  HOH A O   1 
HETATM 8652  O O   . HOH J 4 .   ? 114.967 34.291  17.222  1.00 15.64 ? 750  HOH A O   1 
HETATM 8653  O O   . HOH J 4 .   ? 114.920 51.824  29.311  1.00 3.60  ? 751  HOH A O   1 
HETATM 8654  O O   . HOH J 4 .   ? 118.766 53.851  31.845  1.00 7.07  ? 752  HOH A O   1 
HETATM 8655  O O   . HOH J 4 .   ? 117.021 52.153  22.809  1.00 4.92  ? 753  HOH A O   1 
HETATM 8656  O O   . HOH J 4 .   ? 115.270 43.468  22.799  1.00 10.95 ? 754  HOH A O   1 
HETATM 8657  O O   . HOH J 4 .   ? 107.865 46.053  20.783  1.00 4.35  ? 755  HOH A O   1 
HETATM 8658  O O   . HOH J 4 .   ? 105.517 45.817  19.533  1.00 4.61  ? 756  HOH A O   1 
HETATM 8659  O O   . HOH J 4 .   ? 100.193 49.469  20.591  1.00 2.97  ? 757  HOH A O   1 
HETATM 8660  O O   . HOH J 4 .   ? 97.027  56.139  13.099  1.00 2.08  ? 758  HOH A O   1 
HETATM 8661  O O   . HOH J 4 .   ? 95.260  57.116  15.010  1.00 9.90  ? 759  HOH A O   1 
HETATM 8662  O O   . HOH J 4 .   ? 95.919  55.754  17.334  1.00 10.83 ? 760  HOH A O   1 
HETATM 8663  O O   . HOH J 4 .   ? 99.065  59.189  15.395  1.00 5.09  ? 761  HOH A O   1 
HETATM 8664  O O   . HOH J 4 .   ? 101.052 61.319  15.376  1.00 14.26 ? 762  HOH A O   1 
HETATM 8665  O O   . HOH J 4 .   ? 100.061 63.025  17.315  1.00 13.57 ? 763  HOH A O   1 
HETATM 8666  O O   . HOH J 4 .   ? 95.040  58.545  22.276  1.00 2.98  ? 764  HOH A O   1 
HETATM 8667  O O   . HOH J 4 .   ? 98.583  50.626  10.815  1.00 2.85  ? 765  HOH A O   1 
HETATM 8668  O O   . HOH J 4 .   ? 90.986  52.335  11.472  1.00 3.75  ? 766  HOH A O   1 
HETATM 8669  O O   . HOH J 4 .   ? 90.476  54.028  9.540   1.00 9.14  ? 767  HOH A O   1 
HETATM 8670  O O   . HOH J 4 .   ? 92.649  53.340  7.940   1.00 6.88  ? 768  HOH A O   1 
HETATM 8671  O O   . HOH J 4 .   ? 90.355  50.707  19.108  1.00 5.64  ? 769  HOH A O   1 
HETATM 8672  O O   . HOH J 4 .   ? 94.378  59.838  15.156  1.00 13.90 ? 770  HOH A O   1 
HETATM 8673  O O   . HOH J 4 .   ? 93.174  61.932  19.784  1.00 21.15 ? 771  HOH A O   1 
HETATM 8674  O O   . HOH J 4 .   ? 91.862  54.735  5.575   1.00 25.60 ? 772  HOH A O   1 
HETATM 8675  O O   . HOH J 4 .   ? 96.324  49.095  2.844   1.00 9.10  ? 773  HOH A O   1 
HETATM 8676  O O   . HOH J 4 .   ? 95.890  44.370  4.718   1.00 5.96  ? 774  HOH A O   1 
HETATM 8677  O O   . HOH J 4 .   ? 97.942  42.826  3.700   1.00 2.51  ? 775  HOH A O   1 
HETATM 8678  O O   . HOH J 4 .   ? 97.204  40.603  2.414   1.00 4.54  ? 776  HOH A O   1 
HETATM 8679  O O   . HOH J 4 .   ? 100.362 37.961  2.254   1.00 3.69  ? 777  HOH A O   1 
HETATM 8680  O O   . HOH J 4 .   ? 99.079  45.162  2.508   1.00 6.44  ? 778  HOH A O   1 
HETATM 8681  O O   . HOH J 4 .   ? 101.766 45.520  3.134   1.00 7.81  ? 779  HOH A O   1 
HETATM 8682  O O   . HOH J 4 .   ? 102.830 47.392  4.940   1.00 7.56  ? 780  HOH A O   1 
HETATM 8683  O O   . HOH J 4 .   ? 105.788 46.643  7.247   1.00 4.90  ? 781  HOH A O   1 
HETATM 8684  O O   . HOH J 4 .   ? 107.149 43.242  1.902   1.00 3.58  ? 782  HOH A O   1 
HETATM 8685  O O   . HOH J 4 .   ? 103.532 45.574  0.942   1.00 9.21  ? 783  HOH A O   1 
HETATM 8686  O O   . HOH J 4 .   ? 104.148 40.732  7.875   1.00 3.94  ? 784  HOH A O   1 
HETATM 8687  O O   . HOH J 4 .   ? 104.812 41.564  10.586  1.00 3.16  ? 785  HOH A O   1 
HETATM 8688  O O   . HOH J 4 .   ? 102.575 40.842  11.889  1.00 4.88  ? 786  HOH A O   1 
HETATM 8689  O O   . HOH J 4 .   ? 98.543  57.966  4.656   1.00 13.38 ? 787  HOH A O   1 
HETATM 8690  O O   . HOH J 4 .   ? 99.996  58.624  2.361   1.00 14.15 ? 788  HOH A O   1 
HETATM 8691  O O   . HOH J 4 .   ? 95.277  57.265  5.211   1.00 30.59 ? 789  HOH A O   1 
HETATM 8692  O O   . HOH J 4 .   ? 100.734 55.441  -0.339  1.00 21.12 ? 790  HOH A O   1 
HETATM 8693  O O   . HOH J 4 .   ? 103.191 53.063  0.868   1.00 9.62  ? 791  HOH A O   1 
HETATM 8694  O O   . HOH J 4 .   ? 99.521  60.931  8.859   1.00 12.11 ? 792  HOH A O   1 
HETATM 8695  O O   . HOH J 4 .   ? 108.694 52.148  2.401   1.00 4.91  ? 793  HOH A O   1 
HETATM 8696  O O   . HOH J 4 .   ? 108.920 55.058  2.850   1.00 7.56  ? 794  HOH A O   1 
HETATM 8697  O O   . HOH J 4 .   ? 112.233 57.036  7.609   1.00 9.62  ? 795  HOH A O   1 
HETATM 8698  O O   . HOH J 4 .   ? 113.864 54.821  7.097   1.00 12.90 ? 796  HOH A O   1 
HETATM 8699  O O   . HOH J 4 .   ? 115.284 54.008  9.160   1.00 11.21 ? 797  HOH A O   1 
HETATM 8700  O O   . HOH J 4 .   ? 119.166 50.808  13.470  1.00 7.96  ? 798  HOH A O   1 
HETATM 8701  O O   . HOH J 4 .   ? 111.445 43.386  3.810   1.00 18.30 ? 799  HOH A O   1 
HETATM 8702  O O   . HOH J 4 .   ? 113.818 42.907  5.098   1.00 15.03 ? 800  HOH A O   1 
HETATM 8703  O O   . HOH J 4 .   ? 109.519 49.208  0.128   1.00 7.27  ? 801  HOH A O   1 
HETATM 8704  O O   . HOH J 4 .   ? 115.668 42.162  8.108   1.00 5.71  ? 802  HOH A O   1 
HETATM 8705  O O   . HOH J 4 .   ? 111.329 46.147  12.067  1.00 3.53  ? 803  HOH A O   1 
HETATM 8706  O O   . HOH J 4 .   ? 109.655 47.643  13.652  1.00 7.80  ? 804  HOH A O   1 
HETATM 8707  O O   . HOH J 4 .   ? 119.920 44.859  3.666   1.00 27.60 ? 805  HOH A O   1 
HETATM 8708  O O   . HOH J 4 .   ? 110.942 37.289  6.614   1.00 3.06  ? 806  HOH A O   1 
HETATM 8709  O O   . HOH J 4 .   ? 105.309 34.806  2.755   1.00 2.92  ? 807  HOH A O   1 
HETATM 8710  O O   . HOH J 4 .   ? 107.088 33.145  1.514   1.00 7.34  ? 808  HOH A O   1 
HETATM 8711  O O   . HOH J 4 .   ? 109.647 29.415  2.369   1.00 8.92  ? 809  HOH A O   1 
HETATM 8712  O O   . HOH J 4 .   ? 109.493 28.281  8.297   1.00 9.04  ? 810  HOH A O   1 
HETATM 8713  O O   . HOH J 4 .   ? 112.718 28.758  14.680  1.00 3.14  ? 811  HOH A O   1 
HETATM 8714  O O   . HOH J 4 .   ? 108.421 41.337  -1.319  1.00 18.76 ? 812  HOH A O   1 
HETATM 8715  O O   . HOH J 4 .   ? 105.972 43.255  -1.643  1.00 22.05 ? 813  HOH A O   1 
HETATM 8716  O O   . HOH J 4 .   ? 107.442 41.548  -4.285  1.00 27.65 ? 814  HOH A O   1 
HETATM 8717  O O   . HOH J 4 .   ? 89.447  34.432  -1.281  1.00 12.56 ? 815  HOH A O   1 
HETATM 8718  O O   . HOH J 4 .   ? 86.481  38.231  -1.331  1.00 11.78 ? 816  HOH A O   1 
HETATM 8719  O O   . HOH J 4 .   ? 89.114  31.162  -2.284  1.00 28.01 ? 817  HOH A O   1 
HETATM 8720  O O   . HOH J 4 .   ? 87.786  36.889  0.600   1.00 8.09  ? 818  HOH A O   1 
HETATM 8721  O O   . HOH J 4 .   ? 83.933  34.657  -0.910  1.00 11.78 ? 819  HOH A O   1 
HETATM 8722  O O   . HOH J 4 .   ? 92.825  34.388  -3.718  1.00 8.87  ? 820  HOH A O   1 
HETATM 8723  O O   . HOH J 4 .   ? 92.988  31.484  -0.822  1.00 5.99  ? 821  HOH A O   1 
HETATM 8724  O O   . HOH J 4 .   ? 96.021  37.302  -7.349  1.00 19.44 ? 822  HOH A O   1 
HETATM 8725  O O   . HOH J 4 .   ? 93.737  31.782  -3.509  1.00 10.05 ? 823  HOH A O   1 
HETATM 8726  O O   . HOH J 4 .   ? 80.501  35.876  3.588   1.00 18.24 ? 824  HOH A O   1 
HETATM 8727  O O   . HOH J 4 .   ? 88.892  45.289  9.597   1.00 3.96  ? 825  HOH A O   1 
HETATM 8728  O O   . HOH J 4 .   ? 83.027  47.350  11.309  1.00 4.76  ? 826  HOH A O   1 
HETATM 8729  O O   . HOH J 4 .   ? 79.143  46.922  5.995   1.00 11.87 ? 827  HOH A O   1 
HETATM 8730  O O   . HOH J 4 .   ? 89.122  53.356  18.163  1.00 26.38 ? 828  HOH A O   1 
HETATM 8731  O O   . HOH J 4 .   ? 87.857  51.379  10.320  1.00 11.08 ? 829  HOH A O   1 
HETATM 8732  O O   . HOH J 4 .   ? 90.981  57.448  28.209  1.00 5.57  ? 830  HOH A O   1 
HETATM 8733  O O   . HOH J 4 .   ? 90.341  59.942  27.233  1.00 7.15  ? 831  HOH A O   1 
HETATM 8734  O O   . HOH J 4 .   ? 89.555  54.309  29.082  1.00 3.46  ? 832  HOH A O   1 
HETATM 8735  O O   . HOH J 4 .   ? 88.797  52.107  30.997  1.00 3.91  ? 833  HOH A O   1 
HETATM 8736  O O   . HOH J 4 .   ? 88.853  53.003  33.630  1.00 6.44  ? 834  HOH A O   1 
HETATM 8737  O O   . HOH J 4 .   ? 87.397  46.720  26.983  1.00 4.24  ? 835  HOH A O   1 
HETATM 8738  O O   . HOH J 4 .   ? 84.709  47.524  27.521  1.00 3.39  ? 836  HOH A O   1 
HETATM 8739  O O   . HOH J 4 .   ? 84.589  45.808  21.350  1.00 5.68  ? 837  HOH A O   1 
HETATM 8740  O O   . HOH J 4 .   ? 82.511  47.596  21.609  1.00 9.57  ? 838  HOH A O   1 
HETATM 8741  O O   . HOH J 4 .   ? 98.782  62.769  35.728  1.00 18.20 ? 839  HOH A O   1 
HETATM 8742  O O   . HOH J 4 .   ? 92.162  62.000  35.095  1.00 18.04 ? 840  HOH A O   1 
HETATM 8743  O O   . HOH J 4 .   ? 94.483  63.119  37.988  1.00 27.88 ? 841  HOH A O   1 
HETATM 8744  O O   . HOH J 4 .   ? 97.342  53.504  28.953  1.00 3.01  ? 842  HOH A O   1 
HETATM 8745  O O   . HOH J 4 .   ? 100.077 53.699  29.936  1.00 2.66  ? 843  HOH A O   1 
HETATM 8746  O O   . HOH J 4 .   ? 83.776  42.912  21.736  1.00 15.70 ? 844  HOH A O   1 
HETATM 8747  O O   . HOH J 4 .   ? 90.960  37.469  22.040  1.00 4.05  ? 845  HOH A O   1 
HETATM 8748  O O   . HOH J 4 .   ? 91.691  34.008  22.353  1.00 9.78  ? 846  HOH A O   1 
HETATM 8749  O O   . HOH J 4 .   ? 92.098  40.483  25.249  1.00 10.41 ? 847  HOH A O   1 
HETATM 8750  O O   . HOH J 4 .   ? 92.134  42.409  27.377  1.00 2.08  ? 848  HOH A O   1 
HETATM 8751  O O   . HOH J 4 .   ? 94.867  32.897  18.392  1.00 2.91  ? 849  HOH A O   1 
HETATM 8752  O O   . HOH J 4 .   ? 94.843  31.110  15.910  1.00 5.26  ? 850  HOH A O   1 
HETATM 8753  O O   . HOH J 4 .   ? 99.136  30.155  14.036  1.00 3.94  ? 851  HOH A O   1 
HETATM 8754  O O   . HOH J 4 .   ? 99.659  29.654  11.380  1.00 3.01  ? 852  HOH A O   1 
HETATM 8755  O O   . HOH J 4 .   ? 92.524  18.893  -0.014  1.00 6.87  ? 853  HOH A O   1 
HETATM 8756  O O   . HOH J 4 .   ? 98.590  17.760  -2.016  1.00 11.69 ? 854  HOH A O   1 
HETATM 8757  O O   . HOH J 4 .   ? 88.013  15.982  -1.050  1.00 24.35 ? 855  HOH A O   1 
HETATM 8758  O O   . HOH J 4 .   ? 92.370  12.854  5.450   1.00 6.70  ? 856  HOH A O   1 
HETATM 8759  O O   . HOH J 4 .   ? 91.319  10.520  4.840   1.00 10.80 ? 857  HOH A O   1 
HETATM 8760  O O   . HOH J 4 .   ? 88.462  12.471  2.861   1.00 19.25 ? 858  HOH A O   1 
HETATM 8761  O O   . HOH J 4 .   ? 102.495 14.657  6.987   1.00 15.75 ? 859  HOH A O   1 
HETATM 8762  O O   . HOH J 4 .   ? 102.841 15.461  4.092   1.00 5.95  ? 860  HOH A O   1 
HETATM 8763  O O   . HOH J 4 .   ? 105.430 15.415  3.259   1.00 12.92 ? 861  HOH A O   1 
HETATM 8764  O O   . HOH J 4 .   ? 105.916 12.716  2.602   1.00 22.35 ? 862  HOH A O   1 
HETATM 8765  O O   . HOH J 4 .   ? 105.152 18.211  1.536   1.00 6.24  ? 863  HOH A O   1 
HETATM 8766  O O   . HOH J 4 .   ? 106.277 16.350  7.315   1.00 2.78  ? 864  HOH A O   1 
HETATM 8767  O O   . HOH J 4 .   ? 105.873 5.720   2.435   1.00 12.57 ? 865  HOH A O   1 
HETATM 8768  O O   . HOH J 4 .   ? 98.652  14.670  -1.959  1.00 16.50 ? 866  HOH A O   1 
HETATM 8769  O O   . HOH J 4 .   ? 94.263  11.754  14.973  1.00 3.59  ? 867  HOH A O   1 
HETATM 8770  O O   . HOH J 4 .   ? 97.719  10.705  15.133  1.00 4.38  ? 868  HOH A O   1 
HETATM 8771  O O   . HOH J 4 .   ? 99.746  18.700  22.704  1.00 3.44  ? 869  HOH A O   1 
HETATM 8772  O O   . HOH J 4 .   ? 102.084 20.017  23.305  1.00 2.08  ? 870  HOH A O   1 
HETATM 8773  O O   . HOH J 4 .   ? 101.963 22.364  21.606  1.00 3.79  ? 871  HOH A O   1 
HETATM 8774  O O   . HOH J 4 .   ? 99.335  47.033  28.284  1.00 8.88  ? 872  HOH A O   1 
HETATM 8775  O O   . HOH J 4 .   ? 117.507 57.348  33.164  1.00 6.83  ? 873  HOH A O   1 
HETATM 8776  O O   . HOH J 4 .   ? 116.890 59.689  34.259  1.00 11.24 ? 874  HOH A O   1 
HETATM 8777  O O   . HOH J 4 .   ? 113.344 62.074  34.744  1.00 16.67 ? 875  HOH A O   1 
HETATM 8778  O O   . HOH J 4 .   ? 115.874 59.138  21.510  1.00 15.40 ? 876  HOH A O   1 
HETATM 8779  O O   . HOH J 4 .   ? 119.553 56.339  21.097  1.00 11.85 ? 877  HOH A O   1 
HETATM 8780  O O   . HOH J 4 .   ? 105.647 66.630  24.995  1.00 23.58 ? 878  HOH A O   1 
HETATM 8781  O O   . HOH J 4 .   ? 115.767 59.338  14.943  1.00 14.34 ? 879  HOH A O   1 
HETATM 8782  O O   . HOH J 4 .   ? 115.680 57.981  17.420  1.00 5.65  ? 880  HOH A O   1 
HETATM 8783  O O   . HOH J 4 .   ? 102.602 67.619  21.575  1.00 12.94 ? 881  HOH A O   1 
HETATM 8784  O O   . HOH J 4 .   ? 96.347  67.687  20.497  1.00 13.02 ? 882  HOH A O   1 
HETATM 8785  O O   . HOH J 4 .   ? 102.829 39.366  21.354  1.00 4.15  ? 883  HOH A O   1 
HETATM 8786  O O   . HOH J 4 .   ? 107.420 26.348  13.256  1.00 3.62  ? 884  HOH A O   1 
HETATM 8787  O O   . HOH J 4 .   ? 105.427 22.846  5.584   1.00 3.79  ? 885  HOH A O   1 
HETATM 8788  O O   . HOH J 4 .   ? 107.886 23.902  6.054   1.00 6.12  ? 886  HOH A O   1 
HETATM 8789  O O   . HOH J 4 .   ? 102.393 33.247  -4.427  1.00 6.42  ? 887  HOH A O   1 
HETATM 8790  O O   . HOH J 4 .   ? 84.852  42.095  -1.728  1.00 11.59 ? 888  HOH A O   1 
HETATM 8791  O O   . HOH J 4 .   ? 81.614  42.011  0.005   1.00 13.13 ? 889  HOH A O   1 
HETATM 8792  O O   . HOH J 4 .   ? 107.394 -0.349  25.100  1.00 13.36 ? 890  HOH A O   1 
HETATM 8793  O O   . HOH J 4 .   ? 112.212 15.408  20.480  1.00 4.22  ? 891  HOH A O   1 
HETATM 8794  O O   . HOH J 4 .   ? 107.240 2.455   12.264  1.00 19.23 ? 892  HOH A O   1 
HETATM 8795  O O   . HOH J 4 .   ? 105.219 0.385   8.296   1.00 12.16 ? 893  HOH A O   1 
HETATM 8796  O O   . HOH J 4 .   ? 111.270 7.357   11.047  1.00 10.67 ? 894  HOH A O   1 
HETATM 8797  O O   . HOH J 4 .   ? 113.618 6.137   12.795  1.00 13.82 ? 895  HOH A O   1 
HETATM 8798  O O   . HOH J 4 .   ? 112.839 3.651   13.102  1.00 21.85 ? 896  HOH A O   1 
HETATM 8799  O O   . HOH J 4 .   ? 115.249 28.968  16.237  1.00 6.72  ? 897  HOH A O   1 
HETATM 8800  O O   . HOH J 4 .   ? 118.771 30.540  13.615  1.00 11.45 ? 898  HOH A O   1 
HETATM 8801  O O   . HOH J 4 .   ? 118.479 31.087  16.317  1.00 26.53 ? 899  HOH A O   1 
HETATM 8802  O O   . HOH J 4 .   ? 118.370 22.320  4.922   1.00 20.48 ? 900  HOH A O   1 
HETATM 8803  O O   . HOH J 4 .   ? 116.777 24.274  2.887   1.00 33.93 ? 901  HOH A O   1 
HETATM 8804  O O   . HOH J 4 .   ? 117.108 18.222  8.738   1.00 5.28  ? 902  HOH A O   1 
HETATM 8805  O O   . HOH J 4 .   ? 117.833 14.228  7.870   1.00 11.21 ? 903  HOH A O   1 
HETATM 8806  O O   . HOH J 4 .   ? 119.440 12.746  17.197  1.00 5.00  ? 904  HOH A O   1 
HETATM 8807  O O   . HOH J 4 .   ? 112.053 10.262  4.405   1.00 28.19 ? 905  HOH A O   1 
HETATM 8808  O O   . HOH J 4 .   ? 118.047 11.885  19.553  1.00 15.12 ? 906  HOH A O   1 
HETATM 8809  O O   . HOH J 4 .   ? 121.753 24.762  10.471  1.00 21.98 ? 907  HOH A O   1 
HETATM 8810  O O   . HOH J 4 .   ? 120.517 18.758  20.366  1.00 5.67  ? 908  HOH A O   1 
HETATM 8811  O O   . HOH J 4 .   ? 117.778 20.512  20.016  1.00 8.40  ? 909  HOH A O   1 
HETATM 8812  O O   . HOH J 4 .   ? 120.165 14.168  26.257  1.00 34.14 ? 910  HOH A O   1 
HETATM 8813  O O   . HOH J 4 .   ? 95.700  -1.675  27.234  1.00 5.75  ? 911  HOH A O   1 
HETATM 8814  O O   . HOH J 4 .   ? 98.404  -1.872  24.203  1.00 12.73 ? 912  HOH A O   1 
HETATM 8815  O O   . HOH J 4 .   ? 105.657 -0.812  10.643  1.00 17.12 ? 913  HOH A O   1 
HETATM 8816  O O   . HOH J 4 .   ? 107.044 5.298   4.921   1.00 11.80 ? 914  HOH A O   1 
HETATM 8817  O O   . HOH J 4 .   ? 105.477 1.163   1.960   1.00 26.81 ? 915  HOH A O   1 
HETATM 8818  O O   . HOH J 4 .   ? 94.462  12.531  -3.288  1.00 17.57 ? 916  HOH A O   1 
HETATM 8819  O O   . HOH J 4 .   ? 91.397  15.532  -1.499  1.00 10.68 ? 917  HOH A O   1 
HETATM 8820  O O   . HOH J 4 .   ? 96.888  -4.199  21.527  1.00 25.74 ? 918  HOH A O   1 
HETATM 8821  O O   . HOH J 4 .   ? 115.551 47.162  39.727  1.00 3.07  ? 919  HOH A O   1 
HETATM 8822  O O   . HOH J 4 .   ? 115.232 48.332  43.407  1.00 19.79 ? 920  HOH A O   1 
HETATM 8823  O O   . HOH J 4 .   ? 116.338 49.732  40.832  1.00 15.66 ? 921  HOH A O   1 
HETATM 8824  O O   . HOH J 4 .   ? 119.012 45.067  38.127  1.00 5.64  ? 922  HOH A O   1 
HETATM 8825  O O   . HOH J 4 .   ? 78.974  33.645  4.999   1.00 25.29 ? 923  HOH A O   1 
HETATM 8826  O O   . HOH J 4 .   ? 81.093  37.756  5.523   1.00 9.87  ? 924  HOH A O   1 
HETATM 8827  O O   . HOH J 4 .   ? 93.745  33.368  21.206  1.00 13.03 ? 925  HOH A O   1 
HETATM 8828  O O   . HOH J 4 .   ? 79.668  27.250  0.028   1.00 13.59 ? 926  HOH A O   1 
HETATM 8829  O O   . HOH J 4 .   ? 89.249  39.633  24.486  1.00 15.64 ? 927  HOH A O   1 
HETATM 8830  O O   . HOH J 4 .   ? 88.079  40.637  26.890  1.00 9.65  ? 928  HOH A O   1 
HETATM 8831  O O   . HOH J 4 .   ? 89.829  41.485  30.670  1.00 5.64  ? 929  HOH A O   1 
HETATM 8832  O O   . HOH J 4 .   ? 86.028  41.931  44.771  1.00 13.40 ? 930  HOH A O   1 
HETATM 8833  O O   . HOH J 4 .   ? 86.549  43.507  42.765  1.00 10.04 ? 931  HOH A O   1 
HETATM 8834  O O   . HOH J 4 .   ? 81.769  43.170  44.963  1.00 22.80 ? 932  HOH A O   1 
HETATM 8835  O O   . HOH J 4 .   ? 113.408 39.632  36.979  1.00 4.29  ? 933  HOH A O   1 
HETATM 8836  O O   . HOH J 4 .   ? 111.393 62.970  36.821  1.00 13.47 ? 934  HOH A O   1 
HETATM 8837  O O   . HOH J 4 .   ? 114.346 59.590  35.517  1.00 14.12 ? 935  HOH A O   1 
HETATM 8838  O O   . HOH J 4 .   ? 105.739 62.306  43.666  1.00 13.61 ? 936  HOH A O   1 
HETATM 8839  O O   . HOH J 4 .   ? 98.900  62.493  38.417  1.00 27.65 ? 937  HOH A O   1 
HETATM 8840  O O   . HOH J 4 .   ? 113.667 55.613  40.856  1.00 27.52 ? 938  HOH A O   1 
HETATM 8841  O O   . HOH J 4 .   ? 115.834 51.503  38.960  1.00 16.59 ? 939  HOH A O   1 
HETATM 8842  O O   . HOH J 4 .   ? 119.652 49.337  37.997  1.00 14.25 ? 940  HOH A O   1 
HETATM 8843  O O   . HOH J 4 .   ? 112.258 37.889  40.475  1.00 11.20 ? 941  HOH A O   1 
HETATM 8844  O O   . HOH J 4 .   ? 118.166 47.254  36.811  1.00 4.89  ? 942  HOH A O   1 
HETATM 8845  O O   . HOH J 4 .   ? 101.744 47.334  52.285  1.00 15.24 ? 943  HOH A O   1 
HETATM 8846  O O   . HOH J 4 .   ? 120.693 52.561  29.962  1.00 17.26 ? 944  HOH A O   1 
HETATM 8847  O O   . HOH J 4 .   ? 121.256 47.324  30.362  1.00 41.72 ? 945  HOH A O   1 
HETATM 8848  O O   . HOH J 4 .   ? 120.904 52.801  34.426  1.00 20.98 ? 946  HOH A O   1 
HETATM 8849  O O   . HOH J 4 .   ? 119.452 46.966  34.622  1.00 10.56 ? 947  HOH A O   1 
HETATM 8850  O O   . HOH J 4 .   ? 102.834 54.709  48.167  1.00 23.75 ? 948  HOH A O   1 
HETATM 8851  O O   . HOH J 4 .   ? 119.509 42.764  36.795  1.00 6.85  ? 949  HOH A O   1 
HETATM 8852  O O   . HOH J 4 .   ? 120.991 44.665  34.716  1.00 20.87 ? 950  HOH A O   1 
HETATM 8853  O O   . HOH J 4 .   ? 120.350 56.422  29.571  1.00 16.18 ? 951  HOH A O   1 
HETATM 8854  O O   . HOH J 4 .   ? 120.756 55.523  24.791  1.00 14.75 ? 952  HOH A O   1 
HETATM 8855  O O   . HOH J 4 .   ? 123.245 51.083  28.499  1.00 16.81 ? 953  HOH A O   1 
HETATM 8856  O O   . HOH J 4 .   ? 117.515 58.140  19.898  1.00 24.72 ? 954  HOH A O   1 
HETATM 8857  O O   . HOH J 4 .   ? 120.140 58.378  17.444  1.00 23.39 ? 955  HOH A O   1 
HETATM 8858  O O   . HOH J 4 .   ? 111.632 64.845  25.569  1.00 32.87 ? 956  HOH A O   1 
HETATM 8859  O O   . HOH J 4 .   ? 104.191 68.394  23.565  1.00 19.63 ? 957  HOH A O   1 
HETATM 8860  O O   . HOH J 4 .   ? 103.297 68.708  18.940  1.00 35.62 ? 958  HOH A O   1 
HETATM 8861  O O   . HOH J 4 .   ? 96.937  60.753  14.757  1.00 12.29 ? 959  HOH A O   1 
HETATM 8862  O O   . HOH J 4 .   ? 100.204 62.897  13.134  1.00 21.72 ? 960  HOH A O   1 
HETATM 8863  O O   . HOH J 4 .   ? 93.463  58.469  11.216  1.00 12.95 ? 961  HOH A O   1 
HETATM 8864  O O   . HOH J 4 .   ? 96.113  57.962  11.032  1.00 8.34  ? 962  HOH A O   1 
HETATM 8865  O O   . HOH J 4 .   ? 101.522 65.043  16.261  1.00 19.48 ? 963  HOH A O   1 
HETATM 8866  O O   . HOH J 4 .   ? 91.351  56.696  9.616   1.00 17.17 ? 964  HOH A O   1 
HETATM 8867  O O   . HOH J 4 .   ? 96.997  58.174  8.511   1.00 19.69 ? 965  HOH A O   1 
HETATM 8868  O O   . HOH J 4 .   ? 87.362  51.891  19.187  1.00 15.97 ? 966  HOH A O   1 
HETATM 8869  O O   . HOH J 4 .   ? 89.618  50.008  12.430  1.00 6.33  ? 967  HOH A O   1 
HETATM 8870  O O   . HOH J 4 .   ? 84.490  46.048  25.422  1.00 10.51 ? 968  HOH A O   1 
HETATM 8871  O O   . HOH J 4 .   ? 84.215  43.353  25.774  1.00 23.82 ? 969  HOH A O   1 
HETATM 8872  O O   . HOH J 4 .   ? 85.497  42.773  28.910  1.00 16.86 ? 970  HOH A O   1 
HETATM 8873  O O   . HOH J 4 .   ? 82.465  43.765  19.744  1.00 9.90  ? 971  HOH A O   1 
HETATM 8874  O O   . HOH J 4 .   ? 114.441 38.761  24.097  1.00 11.45 ? 972  HOH A O   1 
HETATM 8875  O O   . HOH J 4 .   ? 107.409 16.253  4.726   1.00 9.23  ? 973  HOH A O   1 
HETATM 8876  O O   . HOH J 4 .   ? 105.162 13.933  7.251   1.00 10.00 ? 974  HOH A O   1 
HETATM 8877  O O   . HOH J 4 .   ? 108.880 13.601  6.103   1.00 13.81 ? 975  HOH A O   1 
HETATM 8878  O O   . HOH J 4 .   ? 110.472 23.080  -0.502  1.00 30.54 ? 976  HOH A O   1 
HETATM 8879  O O   . HOH J 4 .   ? 116.308 17.648  6.273   1.00 13.17 ? 977  HOH A O   1 
HETATM 8880  O O   . HOH J 4 .   ? 110.321 24.951  1.924   1.00 16.59 ? 978  HOH A O   1 
HETATM 8881  O O   . HOH J 4 .   ? 110.013 27.660  -2.157  1.00 17.52 ? 979  HOH A O   1 
HETATM 8882  O O   . HOH J 4 .   ? 114.948 17.668  2.517   1.00 30.31 ? 980  HOH A O   1 
HETATM 8883  O O   . HOH J 4 .   ? 104.567 20.041  -4.188  1.00 14.53 ? 981  HOH A O   1 
HETATM 8884  O O   . HOH J 4 .   ? 106.076 17.380  -5.307  1.00 31.22 ? 982  HOH A O   1 
HETATM 8885  O O   . HOH J 4 .   ? 100.887 22.394  -2.619  1.00 21.02 ? 983  HOH A O   1 
HETATM 8886  O O   . HOH J 4 .   ? 100.076 20.055  -3.559  1.00 22.54 ? 984  HOH A O   1 
HETATM 8887  O O   . HOH J 4 .   ? 104.590 26.659  -6.621  1.00 19.02 ? 985  HOH A O   1 
HETATM 8888  O O   . HOH J 4 .   ? 92.781  29.994  -5.187  1.00 22.75 ? 986  HOH A O   1 
HETATM 8889  O O   . HOH J 4 .   ? 90.474  30.423  -0.098  1.00 14.92 ? 987  HOH A O   1 
HETATM 8890  O O   . HOH J 4 .   ? 90.781  27.290  0.248   1.00 10.93 ? 988  HOH A O   1 
HETATM 8891  O O   . HOH J 4 .   ? 102.879 35.638  -5.583  1.00 17.38 ? 989  HOH A O   1 
HETATM 8892  O O   . HOH J 4 .   ? 91.155  35.830  -5.421  1.00 30.05 ? 990  HOH A O   1 
HETATM 8893  O O   . HOH J 4 .   ? 91.484  31.972  -6.913  1.00 29.57 ? 991  HOH A O   1 
HETATM 8894  O O   . HOH J 4 .   ? 87.776  34.620  -3.331  1.00 32.18 ? 992  HOH A O   1 
HETATM 8895  O O   . HOH J 4 .   ? 87.181  42.040  -3.738  1.00 10.65 ? 993  HOH A O   1 
HETATM 8896  O O   . HOH J 4 .   ? 96.169  46.114  2.701   1.00 4.35  ? 994  HOH A O   1 
HETATM 8897  O O   . HOH J 4 .   ? 101.775 43.716  -6.788  1.00 30.34 ? 995  HOH A O   1 
HETATM 8898  O O   . HOH J 4 .   ? 91.027  40.579  -6.364  1.00 27.37 ? 996  HOH A O   1 
HETATM 8899  O O   . HOH J 4 .   ? 89.680  38.347  -5.222  1.00 22.98 ? 997  HOH A O   1 
HETATM 8900  O O   . HOH J 4 .   ? 103.535 44.013  -1.026  1.00 24.82 ? 998  HOH A O   1 
HETATM 8901  O O   . HOH J 4 .   ? 106.075 45.631  0.973   1.00 22.78 ? 999  HOH A O   1 
HETATM 8902  O O   . HOH J 4 .   ? 109.924 34.789  -6.383  1.00 30.11 ? 1000 HOH A O   1 
HETATM 8903  O O   . HOH J 4 .   ? 109.566 34.440  1.118   1.00 21.18 ? 1001 HOH A O   1 
HETATM 8904  O O   . HOH J 4 .   ? 112.050 34.763  4.453   1.00 16.83 ? 1002 HOH A O   1 
HETATM 8905  O O   . HOH J 4 .   ? 116.019 41.026  24.075  1.00 19.46 ? 1003 HOH A O   1 
HETATM 8906  O O   . HOH J 4 .   ? 116.006 34.918  14.756  1.00 9.74  ? 1004 HOH A O   1 
HETATM 8907  O O   . HOH J 4 .   ? 118.544 29.720  8.902   1.00 34.62 ? 1005 HOH A O   1 
HETATM 8908  O O   . HOH J 4 .   ? 99.743  20.061  40.997  1.00 11.84 ? 1006 HOH A O   1 
HETATM 8909  O O   . HOH J 4 .   ? 82.658  -14.627 19.136  1.00 25.95 ? 1007 HOH A O   1 
HETATM 8910  O O   . HOH J 4 .   ? 95.316  -11.696 20.259  1.00 16.05 ? 1008 HOH A O   1 
HETATM 8911  O O   . HOH J 4 .   ? 91.269  -16.529 25.717  1.00 13.42 ? 1009 HOH A O   1 
HETATM 8912  O O   . HOH J 4 .   ? 102.921 -12.143 23.280  1.00 26.19 ? 1010 HOH A O   1 
HETATM 8913  O O   . HOH J 4 .   ? 99.372  -14.235 27.416  1.00 18.28 ? 1011 HOH A O   1 
HETATM 8914  O O   . HOH J 4 .   ? 103.333 -8.667  25.146  1.00 18.32 ? 1012 HOH A O   1 
HETATM 8915  O O   . HOH J 4 .   ? 104.884 -5.161  27.953  1.00 25.31 ? 1013 HOH A O   1 
HETATM 8916  O O   . HOH J 4 .   ? 109.911 6.177   23.879  1.00 7.38  ? 1014 HOH A O   1 
HETATM 8917  O O   . HOH J 4 .   ? 108.416 1.631   23.530  1.00 18.95 ? 1015 HOH A O   1 
HETATM 8918  O O   . HOH J 4 .   ? 109.999 14.644  21.911  1.00 5.63  ? 1016 HOH A O   1 
HETATM 8919  O O   . HOH J 4 .   ? 110.241 12.756  24.386  1.00 9.32  ? 1017 HOH A O   1 
HETATM 8920  O O   . HOH J 4 .   ? 107.302 15.374  24.443  1.00 15.95 ? 1018 HOH A O   1 
HETATM 8921  O O   . HOH J 4 .   ? 118.612 18.562  22.730  1.00 19.26 ? 1019 HOH A O   1 
HETATM 8922  O O   . HOH J 4 .   ? 119.070 24.942  31.976  1.00 8.95  ? 1020 HOH A O   1 
HETATM 8923  O O   . HOH J 4 .   ? 114.940 26.064  23.869  1.00 8.15  ? 1021 HOH A O   1 
HETATM 8924  O O   . HOH J 4 .   ? 117.585 27.164  20.683  1.00 13.87 ? 1022 HOH A O   1 
HETATM 8925  O O   . HOH J 4 .   ? 117.403 10.242  34.953  1.00 27.45 ? 1023 HOH A O   1 
HETATM 8926  O O   . HOH J 4 .   ? 119.992 36.921  33.928  1.00 20.91 ? 1024 HOH A O   1 
HETATM 8927  O O   . HOH J 4 .   ? 107.685 41.222  47.799  1.00 19.26 ? 1025 HOH A O   1 
HETATM 8928  O O   . HOH J 4 .   ? 91.106  56.034  39.435  1.00 12.49 ? 1026 HOH A O   1 
HETATM 8929  O O   . HOH J 4 .   ? 97.927  57.220  47.364  1.00 23.93 ? 1027 HOH A O   1 
HETATM 8930  O O   . HOH J 4 .   ? 103.583 49.662  49.911  1.00 17.04 ? 1028 HOH A O   1 
HETATM 8931  O O   . HOH J 4 .   ? 99.756  51.403  49.199  1.00 35.85 ? 1029 HOH A O   1 
HETATM 8932  O O   . HOH J 4 .   ? 97.042  45.297  50.580  1.00 6.91  ? 1030 HOH A O   1 
HETATM 8933  O O   . HOH J 4 .   ? 105.520 49.653  45.633  1.00 11.46 ? 1031 HOH A O   1 
HETATM 8934  O O   . HOH J 4 .   ? 97.082  33.539  52.755  1.00 17.37 ? 1032 HOH A O   1 
HETATM 8935  O O   . HOH J 4 .   ? 86.526  50.127  45.159  1.00 16.63 ? 1033 HOH A O   1 
HETATM 8936  O O   . HOH J 4 .   ? 89.398  51.384  44.026  1.00 19.85 ? 1034 HOH A O   1 
HETATM 8937  O O   . HOH J 4 .   ? 81.921  46.076  33.067  1.00 24.94 ? 1035 HOH A O   1 
HETATM 8938  O O   . HOH J 4 .   ? 83.548  42.994  32.574  1.00 19.11 ? 1036 HOH A O   1 
HETATM 8939  O O   . HOH J 4 .   ? 116.842 22.878  27.987  1.00 25.30 ? 1037 HOH A O   1 
HETATM 8940  O O   . HOH J 4 .   ? 117.589 38.084  27.409  1.00 15.38 ? 1038 HOH A O   1 
HETATM 8941  O O   . HOH J 4 .   ? 119.145 33.720  26.688  1.00 31.64 ? 1039 HOH A O   1 
HETATM 8942  O O   . HOH J 4 .   ? 117.317 34.496  22.446  1.00 20.17 ? 1040 HOH A O   1 
HETATM 8943  O O   . HOH J 4 .   ? 115.825 31.462  17.601  1.00 8.79  ? 1041 HOH A O   1 
HETATM 8944  O O   . HOH J 4 .   ? 93.551  51.225  -2.108  1.00 19.92 ? 1042 HOH A O   1 
HETATM 8945  O O   . HOH J 4 .   ? 84.936  53.493  3.197   1.00 24.26 ? 1043 HOH A O   1 
HETATM 8946  O O   . HOH J 4 .   ? 82.496  53.894  8.078   1.00 18.88 ? 1044 HOH A O   1 
HETATM 8947  O O   . HOH J 4 .   ? 117.144 57.123  11.822  1.00 11.37 ? 1045 HOH A O   1 
HETATM 8948  O O   . HOH J 4 .   ? 118.155 41.476  17.055  1.00 12.47 ? 1046 HOH A O   1 
HETATM 8949  O O   . HOH J 4 .   ? 121.831 50.696  13.678  1.00 17.19 ? 1047 HOH A O   1 
HETATM 8950  O O   . HOH J 4 .   ? 116.945 38.527  17.412  1.00 15.44 ? 1048 HOH A O   1 
HETATM 8951  O O   . HOH J 4 .   ? 117.060 38.239  12.706  1.00 14.31 ? 1049 HOH A O   1 
HETATM 8952  O O   . HOH J 4 .   ? 117.503 41.224  12.689  1.00 15.24 ? 1050 HOH A O   1 
HETATM 8953  O O   . HOH J 4 .   ? 117.053 45.256  3.767   1.00 18.44 ? 1051 HOH A O   1 
HETATM 8954  O O   . HOH J 4 .   ? 116.125 49.124  5.310   1.00 7.35  ? 1052 HOH A O   1 
HETATM 8955  O O   . HOH J 4 .   ? 119.686 42.803  8.249   1.00 25.38 ? 1053 HOH A O   1 
HETATM 8956  O O   . HOH J 4 .   ? 115.310 38.431  6.330   1.00 24.15 ? 1054 HOH A O   1 
HETATM 8957  O O   . HOH J 4 .   ? 117.906 40.897  9.536   1.00 18.23 ? 1055 HOH A O   1 
HETATM 8958  O O   . HOH J 4 .   ? 86.534  29.017  0.459   1.00 17.89 ? 1056 HOH A O   1 
HETATM 8959  O O   . HOH J 4 .   ? 84.549  32.645  -2.478  1.00 18.88 ? 1057 HOH A O   1 
HETATM 8960  O O   . HOH J 4 .   ? 84.953  23.579  -0.443  1.00 23.42 ? 1058 HOH A O   1 
HETATM 8961  O O   . HOH J 4 .   ? 78.063  30.244  1.520   1.00 20.38 ? 1059 HOH A O   1 
HETATM 8962  O O   . HOH J 4 .   ? 87.134  39.128  -3.893  1.00 17.63 ? 1060 HOH A O   1 
HETATM 8963  O O   . HOH J 4 .   ? 79.295  48.009  13.431  1.00 20.64 ? 1061 HOH A O   1 
HETATM 8964  O O   . HOH J 4 .   ? 81.597  46.456  3.725   1.00 26.03 ? 1062 HOH A O   1 
HETATM 8965  O O   . HOH J 4 .   ? 85.396  54.524  9.622   1.00 24.94 ? 1063 HOH A O   1 
HETATM 8966  O O   . HOH J 4 .   ? 86.086  57.558  15.130  1.00 18.49 ? 1064 HOH A O   1 
HETATM 8967  O O   . HOH J 4 .   ? 85.078  59.301  16.844  1.00 26.23 ? 1065 HOH A O   1 
HETATM 8968  O O   . HOH J 4 .   ? 92.278  63.556  31.246  1.00 12.41 ? 1066 HOH A O   1 
HETATM 8969  O O   . HOH J 4 .   ? 85.952  58.857  32.906  1.00 27.02 ? 1067 HOH A O   1 
HETATM 8970  O O   . HOH J 4 .   ? 86.838  54.594  34.629  1.00 9.10  ? 1068 HOH A O   1 
HETATM 8971  O O   . HOH J 4 .   ? 84.743  56.294  33.850  1.00 22.02 ? 1069 HOH A O   1 
HETATM 8972  O O   . HOH J 4 .   ? 84.944  52.592  35.067  1.00 23.46 ? 1070 HOH A O   1 
HETATM 8973  O O   . HOH J 4 .   ? 82.632  55.902  32.165  1.00 23.10 ? 1071 HOH A O   1 
HETATM 8974  O O   . HOH J 4 .   ? 84.770  55.919  27.335  1.00 21.57 ? 1072 HOH A O   1 
HETATM 8975  O O   . HOH J 4 .   ? 79.945  53.997  29.564  1.00 31.22 ? 1073 HOH A O   1 
HETATM 8976  O O   . HOH J 4 .   ? 87.158  54.105  42.126  1.00 29.70 ? 1074 HOH A O   1 
HETATM 8977  O O   . HOH J 4 .   ? 84.712  51.745  43.267  1.00 42.85 ? 1075 HOH A O   1 
HETATM 8978  O O   . HOH J 4 .   ? 93.080  53.085  45.386  1.00 18.84 ? 1076 HOH A O   1 
HETATM 8979  O O   . HOH J 4 .   ? 86.204  40.723  22.679  1.00 10.20 ? 1077 HOH A O   1 
HETATM 8980  O O   . HOH J 4 .   ? 109.866 9.271   5.746   1.00 19.98 ? 1078 HOH A O   1 
HETATM 8981  O O   . HOH J 4 .   ? 107.613 12.147  0.543   1.00 34.99 ? 1079 HOH A O   1 
HETATM 8982  O O   . HOH J 4 .   ? 107.505 12.810  -2.545  1.00 33.88 ? 1080 HOH A O   1 
HETATM 8983  O O   . HOH J 4 .   ? 107.698 4.415   -2.073  1.00 35.93 ? 1081 HOH A O   1 
HETATM 8984  O O   . HOH J 4 .   ? 100.730 11.421  -4.365  1.00 20.56 ? 1082 HOH A O   1 
HETATM 8985  O O   . HOH J 4 .   ? 110.757 65.356  32.396  1.00 43.59 ? 1083 HOH A O   1 
HETATM 8986  O O   . HOH J 4 .   ? 117.109 62.077  33.072  1.00 25.94 ? 1084 HOH A O   1 
HETATM 8987  O O   . HOH J 4 .   ? 101.060 62.873  10.755  1.00 28.36 ? 1085 HOH A O   1 
HETATM 8988  O O   . HOH J 4 .   ? 91.697  66.358  32.195  1.00 28.39 ? 1086 HOH A O   1 
HETATM 8989  O O   . HOH J 4 .   ? 102.983 16.084  -3.047  1.00 33.94 ? 1087 HOH A O   1 
HETATM 8990  O O   . HOH J 4 .   ? 89.536  53.729  5.155   1.00 9.99  ? 1088 HOH A O   1 
HETATM 8991  O O   . HOH J 4 .   ? 117.868 31.327  30.152  1.00 11.20 ? 1089 HOH A O   1 
HETATM 8992  O O   . HOH J 4 .   ? 107.218 3.597   0.978   1.00 24.59 ? 1090 HOH A O   1 
HETATM 8993  O O   . HOH J 4 .   ? 114.748 34.981  12.309  1.00 14.31 ? 1091 HOH A O   1 
HETATM 8994  O O   . HOH J 4 .   ? 118.357 33.195  13.320  1.00 23.43 ? 1092 HOH A O   1 
HETATM 8995  O O   . HOH J 4 .   ? 116.431 33.585  10.673  1.00 9.55  ? 1093 HOH A O   1 
HETATM 8996  O O   . HOH J 4 .   ? 119.577 27.078  7.795   1.00 31.85 ? 1094 HOH A O   1 
HETATM 8997  O O   . HOH J 4 .   ? 117.638 25.630  6.067   1.00 29.45 ? 1095 HOH A O   1 
HETATM 8998  O O   . HOH J 4 .   ? 110.524 4.652   10.706  1.00 17.95 ? 1096 HOH A O   1 
HETATM 8999  O O   . HOH J 4 .   ? 109.221 4.385   20.497  1.00 10.09 ? 1097 HOH A O   1 
HETATM 9000  O O   . HOH J 4 .   ? 112.505 5.756   24.440  1.00 22.44 ? 1098 HOH A O   1 
HETATM 9001  O O   . HOH J 4 .   ? 120.210 18.429  4.082   1.00 42.74 ? 1099 HOH A O   1 
HETATM 9002  O O   . HOH J 4 .   ? 124.058 22.620  13.576  1.00 36.67 ? 1100 HOH A O   1 
HETATM 9003  O O   . HOH J 4 .   ? 119.473 19.904  30.926  1.00 27.88 ? 1101 HOH A O   1 
HETATM 9004  O O   . HOH J 4 .   ? 119.924 18.277  28.694  1.00 45.03 ? 1102 HOH A O   1 
HETATM 9005  O O   . HOH J 4 .   ? 115.133 7.082   27.056  1.00 23.38 ? 1103 HOH A O   1 
HETATM 9006  O O   . HOH J 4 .   ? 118.606 25.954  25.985  1.00 18.62 ? 1104 HOH A O   1 
HETATM 9007  O O   . HOH J 4 .   ? 106.345 9.962   6.440   1.00 14.32 ? 1105 HOH A O   1 
HETATM 9008  O O   . HOH J 4 .   ? 120.114 52.865  16.422  1.00 25.13 ? 1106 HOH A O   1 
HETATM 9009  O O   . HOH J 4 .   ? 117.135 42.624  5.533   1.00 23.39 ? 1107 HOH A O   1 
HETATM 9010  O O   . HOH J 4 .   ? 122.638 48.247  12.662  1.00 22.56 ? 1108 HOH A O   1 
HETATM 9011  O O   . HOH J 4 .   ? 121.068 47.817  3.773   1.00 24.35 ? 1109 HOH A O   1 
HETATM 9012  O O   . HOH J 4 .   ? 102.421 50.572  -1.775  1.00 35.48 ? 1110 HOH A O   1 
HETATM 9013  O O   . HOH J 4 .   ? 97.471  52.473  -1.322  1.00 25.95 ? 1111 HOH A O   1 
HETATM 9014  O O   . HOH J 4 .   ? 106.679 42.899  51.685  1.00 19.07 ? 1112 HOH A O   1 
HETATM 9015  O O   . HOH J 4 .   ? 120.763 44.928  31.470  1.00 32.94 ? 1113 HOH A O   1 
HETATM 9016  O O   . HOH J 4 .   ? 119.563 39.361  31.947  1.00 32.58 ? 1114 HOH A O   1 
HETATM 9017  O O   . HOH J 4 .   ? 122.329 53.257  26.987  1.00 11.45 ? 1115 HOH A O   1 
HETATM 9018  O O   . HOH J 4 .   ? 121.144 48.981  34.229  1.00 28.49 ? 1116 HOH A O   1 
HETATM 9019  O O   . HOH J 4 .   ? 121.319 35.271  32.374  1.00 21.44 ? 1117 HOH A O   1 
HETATM 9020  O O   . HOH J 4 .   ? 121.060 22.844  33.348  1.00 19.14 ? 1118 HOH A O   1 
HETATM 9021  O O   . HOH J 4 .   ? 103.146 24.912  44.035  1.00 13.14 ? 1119 HOH A O   1 
HETATM 9022  O O   . HOH J 4 .   ? 98.444  -8.225  32.150  1.00 22.50 ? 1120 HOH A O   1 
HETATM 9023  O O   . HOH J 4 .   ? 99.622  -11.853 31.503  1.00 36.42 ? 1121 HOH A O   1 
HETATM 9024  O O   . HOH J 4 .   ? 105.568 1.489   16.159  1.00 33.24 ? 1122 HOH A O   1 
HETATM 9025  O O   . HOH J 4 .   ? 108.479 2.947   4.588   1.00 33.98 ? 1123 HOH A O   1 
HETATM 9026  O O   . HOH J 4 .   ? 87.467  12.736  0.330   1.00 23.05 ? 1124 HOH A O   1 
HETATM 9027  O O   . HOH J 4 .   ? 92.317  14.059  -3.947  1.00 22.09 ? 1125 HOH A O   1 
HETATM 9028  O O   . HOH J 4 .   ? 104.890 -1.521  24.645  1.00 14.97 ? 1126 HOH A O   1 
HETATM 9029  O O   . HOH J 4 .   ? 99.801  -3.305  22.136  1.00 16.01 ? 1127 HOH A O   1 
HETATM 9030  O O   . HOH J 4 .   ? 106.197 -4.327  25.905  1.00 21.50 ? 1128 HOH A O   1 
HETATM 9031  O O   . HOH J 4 .   ? 119.925 55.274  3.990   1.00 26.73 ? 1129 HOH A O   1 
HETATM 9032  O O   . HOH J 4 .   ? 106.861 47.966  48.082  1.00 24.68 ? 1130 HOH A O   1 
HETATM 9033  O O   . HOH J 4 .   ? 109.774 59.167  43.021  1.00 17.46 ? 1131 HOH A O   1 
HETATM 9034  O O   . HOH J 4 .   ? 110.117 36.532  48.918  1.00 38.59 ? 1132 HOH A O   1 
HETATM 9035  O O   . HOH J 4 .   ? 110.272 38.240  47.002  1.00 19.90 ? 1133 HOH A O   1 
HETATM 9036  O O   . HOH J 4 .   ? 80.534  22.579  -0.084  1.00 17.26 ? 1134 HOH A O   1 
HETATM 9037  O O   . HOH J 4 .   ? 78.532  28.933  -1.808  1.00 25.98 ? 1135 HOH A O   1 
HETATM 9038  O O   . HOH J 4 .   ? 85.515  40.554  30.423  1.00 23.07 ? 1136 HOH A O   1 
HETATM 9039  O O   . HOH J 4 .   ? 85.667  41.257  25.352  1.00 15.54 ? 1137 HOH A O   1 
HETATM 9040  O O   . HOH J 4 .   ? 91.353  39.027  48.022  1.00 25.27 ? 1138 HOH A O   1 
HETATM 9041  O O   . HOH J 4 .   ? 91.065  43.183  48.729  1.00 16.22 ? 1139 HOH A O   1 
HETATM 9042  O O   . HOH J 4 .   ? 86.415  42.763  47.194  1.00 19.37 ? 1140 HOH A O   1 
HETATM 9043  O O   . HOH J 4 .   ? 104.466 52.873  -1.293  1.00 18.64 ? 1141 HOH A O   1 
HETATM 9044  O O   . HOH J 4 .   ? 117.649 55.411  9.769   1.00 13.09 ? 1142 HOH A O   1 
HETATM 9045  O O   . HOH J 4 .   ? 121.843 55.589  7.291   1.00 33.95 ? 1143 HOH A O   1 
HETATM 9046  O O   . HOH J 4 .   ? 112.904 2.684   28.019  1.00 24.89 ? 1144 HOH A O   1 
HETATM 9047  O O   . HOH J 4 .   ? 111.220 1.325   23.922  1.00 24.70 ? 1145 HOH A O   1 
HETATM 9048  O O   . HOH J 4 .   ? 109.480 -1.004  26.830  1.00 29.73 ? 1146 HOH A O   1 
HETATM 9049  O O   . HOH J 4 .   ? 111.998 0.197   26.321  1.00 36.94 ? 1147 HOH A O   1 
HETATM 9050  O O   . HOH J 4 .   ? 108.092 1.153   36.513  1.00 29.25 ? 1148 HOH A O   1 
HETATM 9051  O O   . HOH J 4 .   ? 109.698 4.097   17.876  1.00 26.72 ? 1149 HOH A O   1 
HETATM 9052  O O   . HOH J 4 .   ? 102.372 57.740  46.830  1.00 29.84 ? 1150 HOH A O   1 
HETATM 9053  O O   . HOH J 4 .   ? 98.271  60.794  41.333  1.00 19.96 ? 1151 HOH A O   1 
HETATM 9054  O O   . HOH J 4 .   ? 96.855  43.541  52.468  1.00 14.31 ? 1152 HOH A O   1 
HETATM 9055  O O   . HOH J 4 .   ? 98.578  47.864  53.102  1.00 42.78 ? 1153 HOH A O   1 
HETATM 9056  O O   . HOH J 4 .   ? 92.720  49.385  47.857  1.00 28.39 ? 1154 HOH A O   1 
HETATM 9057  O O   . HOH J 4 .   ? 98.825  35.458  51.543  1.00 23.01 ? 1155 HOH A O   1 
HETATM 9058  O O   . HOH J 4 .   ? 104.644 42.667  53.562  1.00 24.86 ? 1156 HOH A O   1 
HETATM 9059  O O   . HOH J 4 .   ? 107.317 37.725  49.380  1.00 18.02 ? 1157 HOH A O   1 
HETATM 9060  O O   . HOH J 4 .   ? 105.286 36.105  49.786  1.00 25.87 ? 1158 HOH A O   1 
HETATM 9061  O O   . HOH J 4 .   ? 106.016 33.539  48.736  1.00 23.89 ? 1159 HOH A O   1 
HETATM 9062  O O   . HOH J 4 .   ? 101.782 37.240  52.400  1.00 25.61 ? 1160 HOH A O   1 
HETATM 9063  O O   . HOH J 4 .   ? 88.663  33.563  50.614  1.00 41.87 ? 1161 HOH A O   1 
HETATM 9064  O O   . HOH J 4 .   ? 88.975  52.289  40.996  1.00 20.25 ? 1162 HOH A O   1 
HETATM 9065  O O   . HOH J 4 .   ? 123.024 50.623  18.517  1.00 23.81 ? 1163 HOH A O   1 
HETATM 9066  O O   . HOH J 4 .   ? 122.013 54.257  17.370  1.00 28.62 ? 1164 HOH A O   1 
HETATM 9067  O O   . HOH J 4 .   ? 122.392 51.654  16.184  1.00 32.15 ? 1165 HOH A O   1 
HETATM 9068  O O   . HOH J 4 .   ? 123.591 47.159  18.461  1.00 38.52 ? 1166 HOH A O   1 
HETATM 9069  O O   . HOH J 4 .   ? 117.486 37.466  15.242  1.00 16.85 ? 1167 HOH A O   1 
HETATM 9070  O O   . HOH J 4 .   ? 116.646 38.234  19.940  1.00 31.79 ? 1168 HOH A O   1 
HETATM 9071  O O   . HOH J 4 .   ? 124.327 48.650  10.612  1.00 42.91 ? 1169 HOH A O   1 
HETATM 9072  O O   . HOH J 4 .   ? 121.470 46.295  10.907  1.00 23.69 ? 1170 HOH A O   1 
HETATM 9073  O O   . HOH J 4 .   ? 108.158 46.554  -0.632  1.00 16.44 ? 1171 HOH A O   1 
HETATM 9074  O O   . HOH J 4 .   ? 109.389 34.224  -1.927  1.00 17.67 ? 1172 HOH A O   1 
HETATM 9075  O O   . HOH J 4 .   ? 111.484 38.636  2.090   1.00 26.60 ? 1173 HOH A O   1 
HETATM 9076  O O   . HOH J 4 .   ? 111.075 42.068  1.451   1.00 32.75 ? 1174 HOH A O   1 
HETATM 9077  O O   . HOH J 4 .   ? 81.030  39.877  3.187   1.00 24.14 ? 1175 HOH A O   1 
HETATM 9078  O O   . HOH J 4 .   ? 80.249  41.483  5.089   1.00 22.57 ? 1176 HOH A O   1 
HETATM 9079  O O   . HOH J 4 .   ? 87.903  54.204  8.561   1.00 20.08 ? 1177 HOH A O   1 
HETATM 9080  O O   . HOH J 4 .   ? 81.285  54.251  11.699  1.00 16.49 ? 1178 HOH A O   1 
HETATM 9081  O O   . HOH J 4 .   ? 83.898  54.541  12.119  1.00 14.89 ? 1179 HOH A O   1 
HETATM 9082  O O   . HOH J 4 .   ? 84.011  56.770  13.490  1.00 28.16 ? 1180 HOH A O   1 
HETATM 9083  O O   . HOH J 4 .   ? 90.001  58.735  10.511  1.00 21.71 ? 1181 HOH A O   1 
HETATM 9084  O O   . HOH J 4 .   ? 88.355  57.239  25.156  1.00 15.90 ? 1182 HOH A O   1 
HETATM 9085  O O   . HOH J 4 .   ? 85.012  57.695  29.292  1.00 31.74 ? 1183 HOH A O   1 
HETATM 9086  O O   . HOH J 4 .   ? 87.496  56.574  27.652  1.00 26.12 ? 1184 HOH A O   1 
HETATM 9087  O O   . HOH J 4 .   ? 80.112  51.563  18.527  1.00 10.21 ? 1185 HOH A O   1 
HETATM 9088  O O   . HOH J 4 .   ? 80.319  51.116  21.069  1.00 27.55 ? 1186 HOH A O   1 
HETATM 9089  O O   . HOH J 4 .   ? 80.858  49.275  3.636   1.00 21.06 ? 1187 HOH A O   1 
HETATM 9090  O O   . HOH J 4 .   ? 86.293  30.353  -1.950  1.00 14.36 ? 1188 HOH A O   1 
HETATM 9091  O O   . HOH J 4 .   ? 92.567  22.892  -4.752  1.00 39.58 ? 1189 HOH A O   1 
HETATM 9092  O O   . HOH J 4 .   ? 89.745  21.611  -2.493  1.00 35.53 ? 1190 HOH A O   1 
HETATM 9093  O O   . HOH J 4 .   ? 95.503  25.808  -5.844  1.00 35.55 ? 1191 HOH A O   1 
HETATM 9094  O O   . HOH J 4 .   ? 93.508  27.546  -6.332  1.00 28.15 ? 1192 HOH A O   1 
HETATM 9095  O O   . HOH J 4 .   ? 100.603 25.963  -5.492  1.00 37.61 ? 1193 HOH A O   1 
HETATM 9096  O O   . HOH J 4 .   ? 96.960  13.595  -4.210  1.00 25.34 ? 1194 HOH A O   1 
HETATM 9097  O O   . HOH J 4 .   ? 106.382 12.613  5.162   1.00 11.61 ? 1195 HOH A O   1 
HETATM 9098  O O   . HOH J 4 .   ? 107.836 9.027   4.319   1.00 17.07 ? 1196 HOH A O   1 
HETATM 9099  O O   . HOH J 4 .   ? 109.779 6.688   6.333   1.00 30.44 ? 1197 HOH A O   1 
HETATM 9100  O O   . HOH J 4 .   ? 106.305 67.270  39.646  1.00 34.25 ? 1198 HOH A O   1 
HETATM 9101  O O   . HOH J 4 .   ? 120.027 57.845  32.268  1.00 25.65 ? 1199 HOH A O   1 
HETATM 9102  O O   . HOH J 4 .   ? 103.896 66.137  17.422  1.00 16.07 ? 1200 HOH A O   1 
HETATM 9103  O O   . HOH J 4 .   ? 99.970  68.390  22.853  1.00 30.19 ? 1201 HOH A O   1 
HETATM 9104  O O   . HOH J 4 .   ? 97.500  63.152  16.412  1.00 17.81 ? 1202 HOH A O   1 
HETATM 9105  O O   . HOH J 4 .   ? 94.998  63.827  17.288  1.00 29.81 ? 1203 HOH A O   1 
HETATM 9106  O O   . HOH J 4 .   ? 90.381  62.721  19.383  1.00 32.92 ? 1204 HOH A O   1 
HETATM 9107  O O   . HOH J 4 .   ? 88.040  60.103  25.368  1.00 25.63 ? 1205 HOH A O   1 
HETATM 9108  O O   . HOH J 4 .   ? 94.354  62.742  32.716  1.00 6.15  ? 1206 HOH A O   1 
HETATM 9109  O O   . HOH J 4 .   ? 87.885  60.485  28.210  1.00 24.00 ? 1207 HOH A O   1 
HETATM 9110  O O   . HOH J 4 .   ? 108.439 17.144  2.229   1.00 34.94 ? 1208 HOH A O   1 
HETATM 9111  O O   . HOH J 4 .   ? 105.035 16.518  -1.343  1.00 17.40 ? 1209 HOH A O   1 
HETATM 9112  O O   . HOH J 4 .   ? 110.947 27.339  0.420   1.00 20.60 ? 1210 HOH A O   1 
HETATM 9113  O O   . HOH J 4 .   ? 90.887  52.256  -1.579  1.00 38.58 ? 1211 HOH A O   1 
HETATM 9114  O O   . HOH J 4 .   ? 86.716  42.936  -6.262  1.00 32.69 ? 1212 HOH A O   1 
HETATM 9115  O O   . HOH J 4 .   ? 93.398  43.294  -8.690  1.00 15.69 ? 1213 HOH A O   1 
HETATM 9116  O O   . HOH J 4 .   ? 117.787 34.695  18.506  1.00 18.89 ? 1214 HOH A O   1 
HETATM 9117  O O   . HOH J 4 .   ? 118.552 31.203  20.812  1.00 29.88 ? 1215 HOH A O   1 
HETATM 9118  O O   . HOH J 4 .   ? 117.804 28.769  6.205   1.00 50.66 ? 1216 HOH A O   1 
HETATM 9119  O O   . HOH J 4 .   ? 122.883 22.292  11.178  1.00 23.09 ? 1217 HOH A O   1 
HETATM 9120  O O   . HOH J 4 .   ? 121.374 26.994  12.070  1.00 27.09 ? 1218 HOH A O   1 
HETATM 9121  O O   . HOH J 4 .   ? 121.572 24.111  14.918  1.00 32.60 ? 1219 HOH A O   1 
HETATM 9122  O O   . HOH J 4 .   ? 117.629 15.327  5.645   1.00 16.90 ? 1220 HOH A O   1 
HETATM 9123  O O   . HOH J 4 .   ? 116.490 11.292  5.621   1.00 24.92 ? 1221 HOH A O   1 
HETATM 9124  O O   . HOH J 4 .   ? 114.489 14.602  3.649   1.00 36.07 ? 1222 HOH A O   1 
HETATM 9125  O O   . HOH J 4 .   ? 116.140 6.263   10.800  1.00 31.71 ? 1223 HOH A O   1 
HETATM 9126  O O   . HOH J 4 .   ? 120.164 15.509  4.463   1.00 40.05 ? 1224 HOH A O   1 
HETATM 9127  O O   . HOH J 4 .   ? 125.103 14.185  11.328  1.00 26.24 ? 1225 HOH A O   1 
HETATM 9128  O O   . HOH J 4 .   ? 126.314 14.931  13.947  1.00 26.87 ? 1226 HOH A O   1 
HETATM 9129  O O   . HOH J 4 .   ? 118.736 9.460   12.013  1.00 24.96 ? 1227 HOH A O   1 
HETATM 9130  O O   . HOH J 4 .   ? 116.891 28.076  24.472  1.00 34.55 ? 1228 HOH A O   1 
HETATM 9131  O O   . HOH J 4 .   ? 92.809  -12.152 19.251  1.00 19.89 ? 1229 HOH A O   1 
HETATM 9132  O O   . HOH J 4 .   ? 96.543  -14.025 20.920  1.00 24.10 ? 1230 HOH A O   1 
HETATM 9133  O O   . HOH J 4 .   ? 95.276  -13.719 32.519  1.00 35.07 ? 1231 HOH A O   1 
HETATM 9134  O O   . HOH J 4 .   ? 102.925 -9.231  21.097  1.00 45.71 ? 1232 HOH A O   1 
HETATM 9135  O O   . HOH J 4 .   ? 104.043 -7.870  27.492  1.00 17.25 ? 1233 HOH A O   1 
HETATM 9136  O O   . HOH J 4 .   ? 106.704 1.166   21.171  1.00 36.30 ? 1234 HOH A O   1 
HETATM 9137  O O   . HOH J 4 .   ? 99.482  -5.504  19.132  1.00 32.07 ? 1235 HOH A O   1 
HETATM 9138  O O   . HOH J 4 .   ? 102.706 -9.038  29.707  1.00 27.62 ? 1236 HOH A O   1 
HETATM 9139  O O   . HOH J 4 .   ? 95.040  52.267  48.214  1.00 50.21 ? 1237 HOH A O   1 
HETATM 9140  O O   . HOH J 4 .   ? 100.867 21.840  43.178  1.00 29.58 ? 1238 HOH A O   1 
HETATM 9141  O O   . HOH J 4 .   ? 96.742  22.953  48.040  1.00 30.23 ? 1239 HOH A O   1 
HETATM 9142  O O   . HOH J 4 .   ? 88.473  44.264  48.801  1.00 26.84 ? 1240 HOH A O   1 
HETATM 9143  O O   . HOH J 4 .   ? 79.343  46.629  41.781  1.00 32.43 ? 1241 HOH A O   1 
HETATM 9144  O O   . HOH J 4 .   ? 80.563  43.993  38.677  1.00 37.16 ? 1242 HOH A O   1 
HETATM 9145  O O   . HOH J 4 .   ? 81.847  49.155  32.408  1.00 29.07 ? 1243 HOH A O   1 
HETATM 9146  O O   . HOH J 4 .   ? 91.206  38.055  30.438  1.00 22.04 ? 1244 HOH A O   1 
HETATM 9147  O O   . HOH J 4 .   ? 117.987 27.023  28.967  1.00 20.88 ? 1245 HOH A O   1 
HETATM 9148  O O   . HOH J 4 .   ? 121.763 46.785  27.460  1.00 19.35 ? 1246 HOH A O   1 
HETATM 9149  O O   . HOH J 4 .   ? 121.464 48.253  23.086  1.00 22.92 ? 1247 HOH A O   1 
HETATM 9150  O O   . HOH J 4 .   ? 92.460  55.528  3.136   1.00 35.45 ? 1248 HOH A O   1 
HETATM 9151  O O   . HOH J 4 .   ? 121.716 55.976  19.264  1.00 32.91 ? 1249 HOH A O   1 
HETATM 9152  O O   . HOH J 4 .   ? 114.729 35.830  7.222   1.00 27.51 ? 1250 HOH A O   1 
HETATM 9153  O O   . HOH J 4 .   ? 81.204  34.649  0.673   1.00 41.39 ? 1251 HOH A O   1 
HETATM 9154  O O   . HOH J 4 .   ? 78.873  31.924  -1.423  1.00 35.96 ? 1252 HOH A O   1 
HETATM 9155  O O   . HOH J 4 .   ? 88.090  56.575  36.230  1.00 23.98 ? 1253 HOH A O   1 
HETATM 9156  O O   . HOH J 4 .   ? 88.316  56.433  39.040  1.00 31.76 ? 1254 HOH A O   1 
HETATM 9157  O O   . HOH J 4 .   ? 82.217  52.126  34.564  1.00 30.29 ? 1255 HOH A O   1 
HETATM 9158  O O   . HOH J 4 .   ? 89.897  19.476  -0.626  1.00 28.48 ? 1256 HOH A O   1 
HETATM 9159  O O   . HOH J 4 .   ? 102.724 1.833   -4.037  1.00 28.94 ? 1257 HOH A O   1 
HETATM 9160  O O   . HOH J 4 .   ? 110.870 66.040  40.231  1.00 43.22 ? 1258 HOH A O   1 
HETATM 9161  O O   . HOH J 4 .   ? 109.247 63.383  43.086  1.00 34.56 ? 1259 HOH A O   1 
HETATM 9162  O O   . HOH J 4 .   ? 96.572  70.682  25.864  1.00 35.81 ? 1260 HOH A O   1 
HETATM 9163  O O   . HOH J 4 .   ? 86.396  68.669  27.491  1.00 35.21 ? 1261 HOH A O   1 
HETATM 9164  O O   . HOH J 4 .   ? 110.068 14.474  3.965   1.00 39.84 ? 1262 HOH A O   1 
HETATM 9165  O O   . HOH J 4 .   ? 104.394 28.402  -8.746  1.00 36.95 ? 1263 HOH A O   1 
HETATM 9166  O O   . HOH J 4 .   ? 101.944 37.327  -7.402  1.00 26.94 ? 1264 HOH A O   1 
HETATM 9167  O O   . HOH J 4 .   ? 117.892 19.542  5.081   1.00 19.30 ? 1265 HOH A O   1 
HETATM 9168  O O   . HOH J 4 .   ? 119.820 9.964   20.239  1.00 28.52 ? 1266 HOH A O   1 
HETATM 9169  O O   . HOH J 4 .   ? 117.238 3.118   14.807  1.00 34.29 ? 1267 HOH A O   1 
HETATM 9170  O O   . HOH J 4 .   ? 123.711 20.591  22.952  1.00 32.16 ? 1268 HOH A O   1 
HETATM 9171  O O   . HOH J 4 .   ? 84.839  -12.583 27.767  1.00 32.27 ? 1269 HOH A O   1 
HETATM 9172  O O   . HOH J 4 .   ? 89.571  -16.529 20.735  1.00 29.77 ? 1270 HOH A O   1 
HETATM 9173  O O   . HOH J 4 .   ? 119.326 53.446  39.923  1.00 25.96 ? 1271 HOH A O   1 
HETATM 9174  O O   . HOH J 4 .   ? 117.144 7.986   20.134  1.00 30.37 ? 1272 HOH A O   1 
HETATM 9175  O O   . HOH J 4 .   ? 119.653 21.498  25.426  1.00 25.76 ? 1273 HOH A O   1 
HETATM 9176  O O   . HOH J 4 .   ? 119.557 43.355  14.220  1.00 37.67 ? 1274 HOH A O   1 
HETATM 9177  O O   . HOH J 4 .   ? 107.408 38.514  51.967  1.00 21.83 ? 1275 HOH A O   1 
HETATM 9178  O O   . HOH J 4 .   ? 85.621  57.366  24.236  1.00 40.71 ? 1276 HOH A O   1 
HETATM 9179  O O   . HOH J 4 .   ? 102.018 18.240  -4.212  1.00 32.50 ? 1277 HOH A O   1 
HETATM 9180  O O   . HOH J 4 .   ? 96.153  16.267  -4.938  1.00 33.06 ? 1278 HOH A O   1 
HETATM 9181  O O   . HOH J 4 .   ? 88.940  30.271  49.056  1.00 25.93 ? 1279 HOH A O   1 
HETATM 9182  O O   . HOH J 4 .   ? 82.649  46.539  29.638  1.00 39.56 ? 1280 HOH A O   1 
HETATM 9183  O O   . HOH J 4 .   ? 81.118  48.922  29.654  1.00 37.21 ? 1281 HOH A O   1 
HETATM 9184  O O   . HOH J 4 .   ? 82.242  52.239  38.239  1.00 33.27 ? 1282 HOH A O   1 
HETATM 9185  O O   . HOH J 4 .   ? 79.929  52.086  32.203  1.00 34.84 ? 1283 HOH A O   1 
HETATM 9186  O O   . HOH J 4 .   ? 99.396  -16.047 25.372  1.00 28.52 ? 1284 HOH A O   1 
HETATM 9187  O O   . HOH J 4 .   ? 98.482  -16.284 29.925  1.00 42.32 ? 1285 HOH A O   1 
HETATM 9188  O O   . HOH J 4 .   ? 110.321 -0.108  34.235  1.00 37.90 ? 1286 HOH A O   1 
HETATM 9189  O O   . HOH J 4 .   ? 119.777 15.937  29.791  1.00 39.79 ? 1287 HOH A O   1 
HETATM 9190  O O   . HOH J 4 .   ? 119.252 22.793  29.918  1.00 39.30 ? 1288 HOH A O   1 
HETATM 9191  O O   . HOH J 4 .   ? 95.667  56.051  48.077  1.00 50.48 ? 1289 HOH A O   1 
HETATM 9192  O O   . HOH J 4 .   ? 91.985  58.442  40.960  1.00 34.76 ? 1290 HOH A O   1 
HETATM 9193  O O   . HOH J 4 .   ? 88.594  49.292  47.552  1.00 42.12 ? 1291 HOH A O   1 
HETATM 9194  O O   . HOH J 4 .   ? 95.003  49.450  49.754  1.00 42.94 ? 1292 HOH A O   1 
HETATM 9195  O O   . HOH J 4 .   ? 91.302  54.735  43.689  1.00 41.64 ? 1293 HOH A O   1 
HETATM 9196  O O   . HOH J 4 .   ? 103.668 48.963  53.520  1.00 48.11 ? 1294 HOH A O   1 
HETATM 9197  O O   . HOH J 4 .   ? 119.434 52.812  3.106   1.00 34.02 ? 1295 HOH A O   1 
HETATM 9198  O O   . HOH J 4 .   ? 105.246 38.246  53.667  1.00 27.08 ? 1296 HOH A O   1 
HETATM 9199  O O   . HOH J 4 .   ? 101.618 30.124  52.374  1.00 34.73 ? 1297 HOH A O   1 
HETATM 9200  O O   . HOH J 4 .   ? 104.976 29.813  51.047  1.00 43.60 ? 1298 HOH A O   1 
HETATM 9201  O O   . HOH J 4 .   ? 104.323 36.102  52.410  1.00 44.54 ? 1299 HOH A O   1 
HETATM 9202  O O   . HOH J 4 .   ? 103.411 24.694  48.422  1.00 28.36 ? 1300 HOH A O   1 
HETATM 9203  O O   . HOH J 4 .   ? 98.762  22.366  44.776  1.00 25.92 ? 1301 HOH A O   1 
HETATM 9204  O O   . HOH J 4 .   ? 93.795  24.507  49.838  1.00 29.55 ? 1302 HOH A O   1 
HETATM 9205  O O   . HOH J 4 .   ? 95.479  26.817  52.016  1.00 38.44 ? 1303 HOH A O   1 
HETATM 9206  O O   . HOH J 4 .   ? 118.705 40.417  28.278  1.00 38.69 ? 1304 HOH A O   1 
HETATM 9207  O O   . HOH J 4 .   ? 120.648 37.853  29.966  1.00 35.41 ? 1305 HOH A O   1 
HETATM 9208  O O   . HOH J 4 .   ? 123.589 48.606  26.699  1.00 36.40 ? 1306 HOH A O   1 
HETATM 9209  O O   . HOH J 4 .   ? 120.168 57.768  23.477  1.00 38.64 ? 1307 HOH A O   1 
HETATM 9210  O O   . HOH J 4 .   ? 123.947 55.714  21.728  1.00 32.45 ? 1308 HOH A O   1 
HETATM 9211  O O   . HOH J 4 .   ? 121.990 57.142  27.234  1.00 40.92 ? 1309 HOH A O   1 
HETATM 9212  O O   . HOH J 4 .   ? 121.230 44.718  12.866  1.00 38.40 ? 1310 HOH A O   1 
HETATM 9213  O O   . HOH J 4 .   ? 112.881 45.679  1.648   1.00 33.04 ? 1311 HOH A O   1 
HETATM 9214  O O   . HOH J 4 .   ? 115.044 41.239  3.069   1.00 43.82 ? 1312 HOH A O   1 
HETATM 9215  O O   . HOH J 4 .   ? 125.413 47.717  4.547   1.00 37.60 ? 1313 HOH A O   1 
HETATM 9216  O O   . HOH J 4 .   ? 111.855 49.075  -1.359  1.00 36.86 ? 1314 HOH A O   1 
HETATM 9217  O O   . HOH J 4 .   ? 102.500 45.280  -3.639  1.00 40.19 ? 1315 HOH A O   1 
HETATM 9218  O O   . HOH J 4 .   ? 96.317  48.935  -6.327  1.00 35.28 ? 1316 HOH A O   1 
HETATM 9219  O O   . HOH J 4 .   ? 89.723  26.427  -2.090  1.00 31.00 ? 1317 HOH A O   1 
HETATM 9220  O O   . HOH J 4 .   ? 90.259  28.609  -4.302  1.00 31.92 ? 1318 HOH A O   1 
HETATM 9221  O O   . HOH J 4 .   ? 79.725  44.038  3.990   1.00 33.93 ? 1319 HOH A O   1 
HETATM 9222  O O   . HOH J 4 .   ? 87.395  59.900  13.452  1.00 32.11 ? 1320 HOH A O   1 
HETATM 9223  O O   . HOH J 4 .   ? 87.735  59.341  39.364  1.00 46.58 ? 1321 HOH A O   1 
HETATM 9224  O O   . HOH J 4 .   ? 87.826  55.463  6.273   1.00 36.93 ? 1322 HOH A O   1 
HETATM 9225  O O   . HOH J 4 .   ? 91.462  57.166  6.566   1.00 36.65 ? 1323 HOH A O   1 
HETATM 9226  O O   . HOH J 4 .   ? 98.335  20.660  -5.435  1.00 40.92 ? 1324 HOH A O   1 
HETATM 9227  O O   . HOH J 4 .   ? 100.721 14.058  -3.439  1.00 39.80 ? 1325 HOH A O   1 
HETATM 9228  O O   . HOH J 4 .   ? 102.641 24.921  -7.016  1.00 37.60 ? 1326 HOH A O   1 
HETATM 9229  O O   . HOH J 4 .   ? 103.325 68.257  28.398  1.00 29.33 ? 1327 HOH A O   1 
HETATM 9230  O O   . HOH J 4 .   ? 97.611  69.287  30.301  1.00 31.85 ? 1328 HOH A O   1 
HETATM 9231  O O   . HOH J 4 .   ? 112.113 62.900  32.497  1.00 33.37 ? 1329 HOH A O   1 
HETATM 9232  O O   . HOH J 4 .   ? 111.616 63.222  39.447  1.00 40.62 ? 1330 HOH A O   1 
HETATM 9233  O O   . HOH J 4 .   ? 123.007 53.815  31.256  1.00 37.13 ? 1331 HOH A O   1 
HETATM 9234  O O   . HOH J 4 .   ? 111.654 3.167   15.356  1.00 34.02 ? 1332 HOH A O   1 
HETATM 9235  O O   . HOH J 4 .   ? 111.373 5.656   8.267   1.00 38.88 ? 1333 HOH A O   1 
HETATM 9236  O O   . HOH J 4 .   ? 108.878 23.221  -2.772  1.00 34.93 ? 1334 HOH A O   1 
HETATM 9237  O O   . HOH J 4 .   ? 111.523 19.989  -0.253  1.00 37.13 ? 1335 HOH A O   1 
HETATM 9238  O O   . HOH J 4 .   ? 120.480 11.380  10.715  1.00 27.69 ? 1336 HOH A O   1 
HETATM 9239  O O   . HOH J 4 .   ? 119.809 11.821  8.101   1.00 40.15 ? 1337 HOH A O   1 
HETATM 9240  O O   . HOH J 4 .   ? 124.585 21.395  9.187   1.00 39.50 ? 1338 HOH A O   1 
HETATM 9241  O O   . HOH J 4 .   ? 80.944  40.047  41.161  1.00 32.33 ? 1339 HOH A O   1 
HETATM 9242  O O   . HOH J 4 .   ? 94.245  35.838  27.977  1.00 23.99 ? 1340 HOH A O   1 
HETATM 9243  O O   . HOH J 4 .   ? 97.360  44.433  -9.038  1.00 27.94 ? 1341 HOH A O   1 
HETATM 9244  O O   . HOH J 4 .   ? 92.496  37.095  -7.710  1.00 30.44 ? 1342 HOH A O   1 
HETATM 9245  O O   . HOH J 4 .   ? 108.836 65.924  25.148  1.00 39.90 ? 1343 HOH A O   1 
HETATM 9246  O O   . HOH J 4 .   ? 120.711 41.758  5.631   1.00 48.62 ? 1344 HOH A O   1 
HETATM 9247  O O   . HOH J 4 .   ? 98.624  23.628  -3.847  1.00 36.27 ? 1345 HOH A O   1 
HETATM 9248  O O   . HOH J 4 .   ? 92.234  18.004  -2.612  1.00 40.40 ? 1346 HOH A O   1 
HETATM 9249  O O   . HOH J 4 .   ? 106.451 65.049  17.504  1.00 17.21 ? 1347 HOH A O   1 
HETATM 9250  O O   . HOH J 4 .   ? 89.752  49.082  -4.655  1.00 30.22 ? 1348 HOH A O   1 
HETATM 9251  O O   . HOH J 4 .   ? 87.824  50.879  -5.469  1.00 49.00 ? 1349 HOH A O   1 
HETATM 9252  O O   . HOH J 4 .   ? 96.635  34.373  26.627  1.00 12.55 ? 1350 HOH A O   1 
HETATM 9253  O O   . HOH J 4 .   ? 95.585  33.396  24.630  1.00 12.66 ? 1351 HOH A O   1 
HETATM 9254  O O   . HOH J 4 .   ? 92.562  37.284  26.432  1.00 39.33 ? 1352 HOH A O   1 
HETATM 9255  O O   . HOH J 4 .   ? 88.515  9.747   -0.910  1.00 5.69  ? 1353 HOH A O   1 
HETATM 9256  O O   . HOH J 4 .   ? 96.215  15.865  23.619  1.00 3.86  ? 1354 HOH A O   1 
HETATM 9257  O O   . HOH J 4 .   ? 109.637 54.650  39.359  1.00 5.39  ? 1355 HOH A O   1 
HETATM 9258  O O   . HOH J 4 .   ? 87.969  39.531  31.269  1.00 6.24  ? 1356 HOH A O   1 
HETATM 9259  O O   . HOH J 4 .   ? 119.259 56.540  7.836   1.00 9.57  ? 1357 HOH A O   1 
HETATM 9260  O O   . HOH J 4 .   ? 112.243 37.281  45.322  1.00 22.46 ? 1358 HOH A O   1 
HETATM 9261  O O   . HOH J 4 .   ? 106.715 50.439  43.483  1.00 12.60 ? 1359 HOH A O   1 
HETATM 9262  O O   . HOH J 4 .   ? 83.822  38.924  26.276  1.00 17.48 ? 1360 HOH A O   1 
HETATM 9263  O O   . HOH J 4 .   ? 114.675 60.222  19.355  1.00 14.56 ? 1361 HOH A O   1 
HETATM 9264  O O   . HOH J 4 .   ? 104.671 -1.510  22.064  1.00 29.51 ? 1362 HOH A O   1 
HETATM 9265  O O   . HOH J 4 .   ? 82.604  38.761  23.870  1.00 37.98 ? 1363 HOH A O   1 
HETATM 9266  O O   . HOH J 4 .   ? 117.010 13.183  34.251  1.00 17.76 ? 1364 HOH A O   1 
HETATM 9267  O O   . HOH J 4 .   ? 106.920 51.869  -2.103  1.00 24.53 ? 1365 HOH A O   1 
HETATM 9268  O O   . HOH J 4 .   ? 82.975  22.093  0.706   1.00 15.85 ? 1366 HOH A O   1 
HETATM 9269  O O   . HOH J 4 .   ? 86.976  32.069  48.812  1.00 31.43 ? 1367 HOH A O   1 
HETATM 9270  O O   . HOH J 4 .   ? 87.496  38.425  28.379  1.00 21.79 ? 1368 HOH A O   1 
HETATM 9271  O O   . HOH J 4 .   ? 105.460 -0.453  -0.116  1.00 33.39 ? 1369 HOH A O   1 
HETATM 9272  O O   . HOH J 4 .   ? 103.596 -3.768  35.990  1.00 29.63 ? 1370 HOH A O   1 
HETATM 9273  O O   . HOH J 4 .   ? 102.880 -2.104  37.862  1.00 35.20 ? 1371 HOH A O   1 
HETATM 9274  O O   . HOH J 4 .   ? 88.855  28.454  47.181  1.00 21.74 ? 1372 HOH A O   1 
HETATM 9275  O O   . HOH J 4 .   ? 110.059 3.097   36.747  1.00 38.72 ? 1373 HOH A O   1 
HETATM 9276  O O   . HOH J 4 .   ? 123.910 34.922  32.535  1.00 27.89 ? 1374 HOH A O   1 
HETATM 9277  O O   . HOH J 4 .   ? 108.742 39.080  42.370  1.00 14.21 ? 1375 HOH A O   1 
HETATM 9278  O O   . HOH J 4 .   ? 111.403 38.237  42.911  1.00 22.35 ? 1376 HOH A O   1 
HETATM 9279  O O   . HOH J 4 .   ? 112.451 40.661  43.299  1.00 13.62 ? 1377 HOH A O   1 
HETATM 9280  O O   . HOH J 4 .   ? 113.310 11.962  20.923  1.00 13.34 ? 1378 HOH A O   1 
HETATM 9281  O O   . HOH J 4 .   ? 110.998 12.219  21.623  1.00 26.81 ? 1379 HOH A O   1 
HETATM 9282  O O   . HOH J 4 .   ? 92.388  35.507  29.633  1.00 33.17 ? 1380 HOH A O   1 
HETATM 9283  O O   . HOH J 4 .   ? 88.244  9.036   2.709   1.00 38.08 ? 1381 HOH A O   1 
HETATM 9284  O O   . HOH J 4 .   ? 128.631 21.516  14.919  1.00 32.14 ? 1382 HOH A O   1 
HETATM 9285  O O   . HOH J 4 .   ? 119.719 18.328  24.987  1.00 29.77 ? 1383 HOH A O   1 
HETATM 9286  O O   . HOH J 4 .   ? 108.350 66.773  15.975  1.00 33.36 ? 1384 HOH A O   1 
HETATM 9287  O O   . HOH J 4 .   ? 87.217  50.247  -2.052  1.00 37.33 ? 1385 HOH A O   1 
HETATM 9288  O O   . HOH J 4 .   ? 108.681 33.476  49.207  1.00 52.86 ? 1386 HOH A O   1 
HETATM 9289  O O   . HOH J 4 .   ? 98.914  32.797  -8.714  1.00 30.57 ? 1387 HOH A O   1 
HETATM 9290  O O   . HOH J 4 .   ? 87.510  59.044  35.318  1.00 31.10 ? 1388 HOH A O   1 
HETATM 9291  O O   . HOH J 4 .   ? 116.141 20.054  2.904   1.00 31.24 ? 1389 HOH A O   1 
HETATM 9292  O O   . HOH J 4 .   ? 127.318 17.068  18.394  1.00 38.89 ? 1390 HOH A O   1 
HETATM 9293  O O   . HOH J 4 .   ? 84.147  44.395  30.346  1.00 45.34 ? 1391 HOH A O   1 
HETATM 9294  O O   . HOH J 4 .   ? 93.949  57.356  7.842   1.00 46.05 ? 1392 HOH A O   1 
HETATM 9295  O O   . HOH J 4 .   ? 98.418  69.466  20.641  1.00 30.50 ? 1393 HOH A O   1 
HETATM 9296  O O   . HOH J 4 .   ? 118.433 60.233  40.069  1.00 42.03 ? 1394 HOH A O   1 
HETATM 9297  O O   . HOH J 4 .   ? 88.604  -16.819 24.676  1.00 48.92 ? 1395 HOH A O   1 
HETATM 9298  O O   . HOH J 4 .   ? 94.837  46.859  50.631  1.00 34.34 ? 1396 HOH A O   1 
HETATM 9299  O O   . HOH J 4 .   ? 79.879  46.965  21.450  1.00 32.81 ? 1397 HOH A O   1 
HETATM 9300  O O   . HOH J 4 .   ? 94.517  54.557  -1.508  1.00 37.48 ? 1398 HOH A O   1 
HETATM 9301  O O   . HOH J 4 .   ? 118.674 60.273  23.303  1.00 34.96 ? 1399 HOH A O   1 
HETATM 9302  O O   . HOH J 4 .   ? 100.110 -7.045  34.722  1.00 31.48 ? 1400 HOH A O   1 
HETATM 9303  O O   . HOH J 4 .   ? 103.060 -4.236  33.310  1.00 36.28 ? 1401 HOH A O   1 
HETATM 9304  O O   . HOH J 4 .   ? 120.362 54.882  12.113  1.00 33.22 ? 1402 HOH A O   1 
HETATM 9305  O O   . HOH J 4 .   ? 107.940 7.624   1.896   1.00 27.75 ? 1403 HOH A O   1 
HETATM 9306  O O   . HOH J 4 .   ? 98.357  37.634  -8.761  1.00 42.12 ? 1404 HOH A O   1 
HETATM 9307  O O   . HOH J 4 .   ? 108.050 -0.676  31.951  1.00 39.46 ? 1405 HOH A O   1 
HETATM 9308  O O   . HOH J 4 .   ? 97.806  41.167  51.999  1.00 34.58 ? 1406 HOH A O   1 
HETATM 9309  O O   . HOH J 4 .   ? 111.588 17.143  1.334   1.00 42.82 ? 1407 HOH A O   1 
HETATM 9310  O O   . HOH J 4 .   ? 78.084  46.800  11.353  1.00 43.64 ? 1408 HOH A O   1 
HETATM 9311  O O   . HOH J 4 .   ? 92.850  50.366  -4.683  1.00 45.13 ? 1409 HOH A O   1 
HETATM 9312  O O   . HOH J 4 .   ? 110.478 36.864  4.109   1.00 40.43 ? 1410 HOH A O   1 
HETATM 9313  O O   . HOH J 4 .   ? 108.211 27.192  -5.327  1.00 46.14 ? 1411 HOH A O   1 
HETATM 9314  O O   . HOH J 4 .   ? 126.724 22.142  12.989  1.00 39.34 ? 1412 HOH A O   1 
HETATM 9315  O O   . HOH J 4 .   ? 81.875  56.561  15.194  1.00 53.52 ? 1413 HOH A O   1 
HETATM 9316  O O   . HOH J 4 .   ? 95.643  29.064  53.510  1.00 41.79 ? 1414 HOH A O   1 
HETATM 9317  O O   . HOH J 4 .   ? 85.243  60.080  26.977  1.00 53.63 ? 1415 HOH A O   1 
HETATM 9318  O O   . HOH J 4 .   ? 121.466 53.634  9.835   1.00 39.67 ? 1416 HOH A O   1 
HETATM 9319  O O   . HOH J 4 .   ? 90.121  30.932  53.205  1.00 44.88 ? 1417 HOH A O   1 
HETATM 9320  O O   . HOH J 4 .   ? 107.374 0.689   3.927   1.00 35.24 ? 1418 HOH A O   1 
HETATM 9321  O O   . HOH J 4 .   ? 96.248  38.840  52.274  1.00 35.78 ? 1419 HOH A O   1 
HETATM 9322  O O   . HOH J 4 .   ? 92.537  -13.682 15.845  1.00 41.75 ? 1420 HOH A O   1 
HETATM 9323  O O   . HOH J 4 .   ? 117.854 38.322  8.117   1.00 39.15 ? 1421 HOH A O   1 
HETATM 9324  O O   . HOH J 4 .   ? 97.064  60.369  4.164   1.00 48.60 ? 1422 HOH A O   1 
HETATM 9325  O O   . HOH J 4 .   ? 118.167 41.838  26.111  1.00 42.45 ? 1423 HOH A O   1 
HETATM 9326  O O   . HOH J 4 .   ? 101.783 27.345  51.974  1.00 34.50 ? 1424 HOH A O   1 
HETATM 9327  O O   . HOH J 4 .   ? 81.060  37.798  38.133  1.00 54.18 ? 1425 HOH A O   1 
HETATM 9328  O O   . HOH J 4 .   ? 114.564 59.656  43.007  1.00 45.01 ? 1426 HOH A O   1 
HETATM 9329  O O   . HOH J 4 .   ? 110.158 5.707   2.148   1.00 50.57 ? 1427 HOH A O   1 
HETATM 9330  O O   . HOH J 4 .   ? 86.773  18.104  -1.529  1.00 50.70 ? 1428 HOH A O   1 
HETATM 9331  O O   . HOH J 4 .   ? 104.917 58.677  47.336  1.00 32.65 ? 1429 HOH A O   1 
HETATM 9332  O O   . HOH J 4 .   ? 123.785 49.044  23.876  1.00 41.68 ? 1430 HOH A O   1 
HETATM 9333  O O   . HOH J 4 .   ? 111.730 63.369  29.898  1.00 42.60 ? 1431 HOH A O   1 
HETATM 9334  O O   . HOH J 4 .   ? 95.172  60.828  41.225  1.00 54.61 ? 1432 HOH A O   1 
HETATM 9335  O O   . HOH J 4 .   ? 88.803  28.644  51.334  1.00 45.47 ? 1433 HOH A O   1 
HETATM 9336  O O   . HOH J 4 .   ? 120.929 29.460  17.659  1.00 49.47 ? 1434 HOH A O   1 
HETATM 9337  O O   . HOH J 4 .   ? 88.791  58.125  41.482  1.00 47.05 ? 1435 HOH A O   1 
HETATM 9338  O O   . HOH J 4 .   ? 84.308  49.379  -2.706  1.00 40.26 ? 1436 HOH A O   1 
HETATM 9339  O O   . HOH J 4 .   ? 84.930  38.001  28.090  1.00 23.30 ? 1437 HOH A O   1 
HETATM 9340  O O   . HOH J 4 .   ? 123.492 44.827  14.485  1.00 45.91 ? 1438 HOH A O   1 
HETATM 9341  O O   . HOH J 4 .   ? 101.072 70.787  24.650  1.00 53.51 ? 1439 HOH A O   1 
HETATM 9342  O O   . HOH J 4 .   ? 125.339 32.902  30.803  1.00 55.94 ? 1440 HOH A O   1 
HETATM 9343  O O   . HOH J 4 .   ? 105.130 9.297   -5.269  1.00 49.69 ? 1441 HOH A O   1 
HETATM 9344  O O   . HOH J 4 .   ? 102.924 67.478  38.081  1.00 51.36 ? 1442 HOH A O   1 
HETATM 9345  O O   . HOH J 4 .   ? 99.774  58.278  48.942  1.00 56.12 ? 1443 HOH A O   1 
HETATM 9346  O O   . HOH J 4 .   ? 78.177  49.837  17.126  1.00 45.61 ? 1444 HOH A O   1 
HETATM 9347  O O   . HOH J 4 .   ? 121.119 7.956   13.793  1.00 29.31 ? 1445 HOH A O   1 
HETATM 9348  O O   . HOH J 4 .   ? 119.188 13.412  32.696  1.00 42.63 ? 1446 HOH A O   1 
HETATM 9349  O O   . HOH J 4 .   ? 98.418  50.608  54.611  1.00 52.46 ? 1447 HOH A O   1 
HETATM 9350  O O   . HOH J 4 .   ? 79.924  53.618  22.270  1.00 46.37 ? 1448 HOH A O   1 
HETATM 9351  O O   . HOH J 4 .   ? 118.806 20.527  27.568  1.00 31.13 ? 1449 HOH A O   1 
HETATM 9352  O O   . HOH J 4 .   ? 93.163  61.652  16.868  1.00 50.60 ? 1450 HOH A O   1 
HETATM 9353  O O   . HOH J 4 .   ? 90.704  -15.733 16.617  1.00 49.49 ? 1451 HOH A O   1 
HETATM 9354  O O   . HOH J 4 .   ? 120.783 22.951  3.960   1.00 35.76 ? 1452 HOH A O   1 
HETATM 9355  O O   . HOH J 4 .   ? 87.814  -15.540 17.074  1.00 42.57 ? 1453 HOH A O   1 
HETATM 9356  O O   . HOH J 4 .   ? 83.119  55.024  23.525  1.00 55.63 ? 1454 HOH A O   1 
HETATM 9357  O O   . HOH J 4 .   ? 105.381 61.653  46.302  1.00 35.22 ? 1455 HOH A O   1 
HETATM 9358  O O   . HOH J 4 .   ? 94.642  69.952  22.698  1.00 52.43 ? 1456 HOH A O   1 
HETATM 9359  O O   . HOH J 4 .   ? 108.422 -0.223  11.099  1.00 55.58 ? 1457 HOH A O   1 
HETATM 9360  O O   . HOH J 4 .   ? 77.528  39.696  5.843   1.00 49.56 ? 1458 HOH A O   1 
HETATM 9361  O O   . HOH J 4 .   ? 86.138  26.465  50.589  1.00 50.31 ? 1459 HOH A O   1 
HETATM 9362  O O   . HOH J 4 .   ? 90.690  39.206  28.131  1.00 44.92 ? 1460 HOH A O   1 
HETATM 9363  O O   . HOH J 4 .   ? 86.865  64.123  26.896  1.00 42.79 ? 1461 HOH A O   1 
HETATM 9364  O O   . HOH J 4 .   ? 92.928  -14.731 18.419  1.00 38.94 ? 1462 HOH A O   1 
HETATM 9365  O O   . HOH J 4 .   ? 103.258 63.486  43.133  1.00 40.71 ? 1463 HOH A O   1 
HETATM 9366  O O   . HOH J 4 .   ? 105.769 23.030  49.519  1.00 42.94 ? 1464 HOH A O   1 
HETATM 9367  O O   . HOH J 4 .   ? 117.570 67.001  28.281  1.00 45.08 ? 1465 HOH A O   1 
HETATM 9368  O O   . HOH J 4 .   ? 101.201 31.806  -7.241  1.00 43.70 ? 1466 HOH A O   1 
HETATM 9369  O O   . HOH J 4 .   ? 114.563 6.672   8.303   1.00 62.13 ? 1467 HOH A O   1 
HETATM 9370  O O   . HOH J 4 .   ? 95.941  -13.041 16.358  1.00 42.26 ? 1468 HOH A O   1 
HETATM 9371  O O   . HOH J 4 .   ? 102.874 -4.732  20.339  1.00 45.90 ? 1469 HOH A O   1 
HETATM 9372  O O   . HOH J 4 .   ? 79.909  44.266  18.862  1.00 37.83 ? 1470 HOH A O   1 
HETATM 9373  O O   . HOH J 4 .   ? 115.773 63.396  31.130  1.00 56.70 ? 1471 HOH A O   1 
HETATM 9374  O O   . HOH J 4 .   ? 102.760 -7.199  18.176  1.00 56.61 ? 1472 HOH A O   1 
HETATM 9375  O O   . HOH J 4 .   ? 122.139 19.368  37.769  1.00 52.66 ? 1473 HOH A O   1 
HETATM 9376  O O   . HOH J 4 .   ? 106.897 2.054   18.551  1.00 49.42 ? 1474 HOH A O   1 
HETATM 9377  O O   . HOH J 4 .   ? 81.085  55.335  27.345  1.00 50.00 ? 1475 HOH A O   1 
HETATM 9378  O O   . HOH J 4 .   ? 120.055 26.618  4.291   1.00 54.97 ? 1476 HOH A O   1 
HETATM 9379  O O   . HOH J 4 .   ? 115.085 44.335  1.865   1.00 41.00 ? 1477 HOH A O   1 
HETATM 9380  O O   . HOH J 4 .   ? 114.497 29.920  4.167   1.00 33.61 ? 1478 HOH A O   1 
HETATM 9381  O O   . HOH J 4 .   ? 89.199  44.237  -6.901  1.00 48.46 ? 1479 HOH A O   1 
HETATM 9382  O O   . HOH J 4 .   ? 121.986 11.623  18.605  1.00 48.60 ? 1480 HOH A O   1 
HETATM 9383  O O   . HOH K 4 .   ? 93.503  -5.909  27.989  1.00 4.85  ? 603  HOH B O   1 
HETATM 9384  O O   . HOH K 4 .   ? 104.102 8.081   23.792  1.00 8.42  ? 604  HOH B O   1 
HETATM 9385  O O   . HOH K 4 .   ? 94.212  29.742  39.578  1.00 3.55  ? 605  HOH B O   1 
HETATM 9386  O O   . HOH K 4 .   ? 93.242  24.431  45.647  1.00 22.52 ? 606  HOH B O   1 
HETATM 9387  O O   . HOH K 4 .   ? 104.024 20.084  40.187  1.00 9.95  ? 607  HOH B O   1 
HETATM 9388  O O   . HOH K 4 .   ? 101.839 18.302  40.172  1.00 17.70 ? 608  HOH B O   1 
HETATM 9389  O O   . HOH K 4 .   ? 82.163  38.418  31.937  1.00 19.77 ? 609  HOH B O   1 
HETATM 9390  O O   . HOH K 4 .   ? 120.606 36.074  36.357  1.00 28.44 ? 610  HOH B O   1 
HETATM 9391  O O   . HOH K 4 .   ? 120.753 34.590  28.749  1.00 28.80 ? 611  HOH B O   1 
HETATM 9392  O O   . HOH K 4 .   ? 82.946  39.023  19.215  1.00 20.81 ? 612  HOH B O   1 
HETATM 9393  O O   . HOH K 4 .   ? 84.213  19.353  1.062   1.00 15.52 ? 613  HOH B O   1 
HETATM 9394  O O   . HOH K 4 .   ? 84.492  15.497  -1.264  1.00 21.12 ? 614  HOH B O   1 
HETATM 9395  O O   . HOH K 4 .   ? 83.249  40.869  44.676  1.00 16.69 ? 615  HOH B O   1 
HETATM 9396  O O   . HOH K 4 .   ? 59.156  7.203   -14.820 1.00 33.18 ? 616  HOH B O   1 
HETATM 9397  O O   . HOH K 4 .   ? 49.049  29.572  17.593  1.00 32.13 ? 617  HOH B O   1 
HETATM 9398  O O   . HOH K 4 .   ? 88.172  21.367  1.617   1.00 24.21 ? 618  HOH B O   1 
HETATM 9399  O O   . HOH K 4 .   ? 114.347 5.836   35.388  1.00 32.69 ? 619  HOH B O   1 
HETATM 9400  O O   . HOH K 4 .   ? 82.843  25.526  -2.048  1.00 29.31 ? 620  HOH B O   1 
HETATM 9401  O O   . HOH K 4 .   ? 103.361 15.357  41.480  1.00 34.27 ? 621  HOH B O   1 
HETATM 9402  O O   . HOH K 4 .   ? 50.295  9.344   14.176  1.00 40.10 ? 622  HOH B O   1 
HETATM 9403  O O   . HOH K 4 .   ? 64.998  -5.382  -12.702 1.00 33.44 ? 623  HOH B O   1 
HETATM 9404  O O   . HOH K 4 .   ? 99.764  -12.804 15.089  1.00 42.44 ? 624  HOH B O   1 
HETATM 9405  O O   . HOH K 4 .   ? 88.697  11.822  -3.273  1.00 46.05 ? 625  HOH B O   1 
HETATM 9406  O O   . HOH K 4 .   ? 64.461  16.068  28.324  1.00 15.55 ? 626  HOH B O   1 
HETATM 9407  O O   . HOH K 4 .   ? 119.934 29.599  26.524  1.00 51.65 ? 627  HOH B O   1 
HETATM 9408  O O   . HOH K 4 .   ? 70.609  23.110  3.319   1.00 2.15  ? 628  HOH B O   1 
HETATM 9409  O O   . HOH K 4 .   ? 72.639  25.215  -2.464  1.00 6.65  ? 629  HOH B O   1 
HETATM 9410  O O   . HOH K 4 .   ? 74.013  -1.655  -14.852 1.00 27.54 ? 630  HOH B O   1 
HETATM 9411  O O   . HOH K 4 .   ? 77.753  -6.605  -1.975  1.00 9.79  ? 631  HOH B O   1 
HETATM 9412  O O   . HOH K 4 .   ? 79.397  16.933  18.769  1.00 4.24  ? 632  HOH B O   1 
HETATM 9413  O O   . HOH K 4 .   ? 81.594  25.089  34.826  1.00 3.01  ? 633  HOH B O   1 
HETATM 9414  O O   . HOH K 4 .   ? 93.689  22.083  31.165  1.00 3.35  ? 634  HOH B O   1 
HETATM 9415  O O   . HOH K 4 .   ? 90.338  18.110  31.292  1.00 4.67  ? 635  HOH B O   1 
HETATM 9416  O O   . HOH K 4 .   ? 83.483  -2.571  11.532  1.00 8.00  ? 636  HOH B O   1 
HETATM 9417  O O   . HOH K 4 .   ? 76.926  2.596   2.336   1.00 5.91  ? 637  HOH B O   1 
HETATM 9418  O O   . HOH K 4 .   ? 67.091  6.694   -6.235  1.00 9.30  ? 638  HOH B O   1 
HETATM 9419  O O   . HOH K 4 .   ? 73.244  -0.785  -2.445  1.00 4.04  ? 639  HOH B O   1 
HETATM 9420  O O   . HOH K 4 .   ? 73.807  1.647   -3.630  1.00 8.76  ? 640  HOH B O   1 
HETATM 9421  O O   . HOH K 4 .   ? 85.323  5.834   -1.179  1.00 8.56  ? 641  HOH B O   1 
HETATM 9422  O O   . HOH K 4 .   ? 76.424  7.161   11.995  1.00 2.82  ? 642  HOH B O   1 
HETATM 9423  O O   . HOH K 4 .   ? 73.891  29.287  31.159  1.00 10.85 ? 643  HOH B O   1 
HETATM 9424  O O   . HOH K 4 .   ? 60.869  21.746  7.675   1.00 11.47 ? 644  HOH B O   1 
HETATM 9425  O O   . HOH K 4 .   ? 65.175  34.438  8.881   1.00 15.61 ? 645  HOH B O   1 
HETATM 9426  O O   . HOH K 4 .   ? 80.129  24.019  36.795  1.00 12.52 ? 646  HOH B O   1 
HETATM 9427  O O   . HOH K 4 .   ? 88.063  7.353   35.023  1.00 6.31  ? 647  HOH B O   1 
HETATM 9428  O O   . HOH K 4 .   ? 96.567  12.098  36.094  1.00 4.86  ? 648  HOH B O   1 
HETATM 9429  O O   . HOH K 4 .   ? 100.007 17.460  38.467  1.00 4.89  ? 649  HOH B O   1 
HETATM 9430  O O   . HOH K 4 .   ? 96.742  23.473  37.502  1.00 3.91  ? 650  HOH B O   1 
HETATM 9431  O O   . HOH K 4 .   ? 73.035  14.580  28.457  1.00 3.27  ? 651  HOH B O   1 
HETATM 9432  O O   . HOH K 4 .   ? 82.772  1.118   37.960  1.00 9.70  ? 652  HOH B O   1 
HETATM 9433  O O   . HOH K 4 .   ? 122.457 22.777  35.522  1.00 9.64  ? 653  HOH B O   1 
HETATM 9434  O O   . HOH K 4 .   ? 64.506  27.042  24.758  1.00 3.85  ? 654  HOH B O   1 
HETATM 9435  O O   . HOH K 4 .   ? 62.714  20.293  27.765  1.00 10.87 ? 655  HOH B O   1 
HETATM 9436  O O   . HOH K 4 .   ? 117.249 18.384  45.270  1.00 11.08 ? 656  HOH B O   1 
HETATM 9437  O O   . HOH K 4 .   ? 110.205 18.255  33.952  1.00 10.58 ? 657  HOH B O   1 
HETATM 9438  O O   . HOH K 4 .   ? 110.510 13.854  33.367  1.00 7.61  ? 658  HOH B O   1 
HETATM 9439  O O   . HOH K 4 .   ? 116.851 14.778  38.284  1.00 8.67  ? 659  HOH B O   1 
HETATM 9440  O O   . HOH K 4 .   ? 105.164 13.413  40.976  1.00 9.00  ? 660  HOH B O   1 
HETATM 9441  O O   . HOH K 4 .   ? 107.740 19.600  45.647  1.00 36.76 ? 661  HOH B O   1 
HETATM 9442  O O   . HOH K 4 .   ? 98.276  12.237  34.008  1.00 6.75  ? 662  HOH B O   1 
HETATM 9443  O O   . HOH K 4 .   ? 97.888  12.829  38.310  1.00 7.18  ? 663  HOH B O   1 
HETATM 9444  O O   . HOH K 4 .   ? 100.004 14.681  38.670  1.00 7.69  ? 664  HOH B O   1 
HETATM 9445  O O   . HOH K 4 .   ? 105.166 6.905   40.105  1.00 5.85  ? 665  HOH B O   1 
HETATM 9446  O O   . HOH K 4 .   ? 99.695  10.700  38.572  1.00 3.81  ? 666  HOH B O   1 
HETATM 9447  O O   . HOH K 4 .   ? 100.814 11.123  40.951  1.00 14.18 ? 667  HOH B O   1 
HETATM 9448  O O   . HOH K 4 .   ? 95.586  7.850   34.516  1.00 5.51  ? 668  HOH B O   1 
HETATM 9449  O O   . HOH K 4 .   ? 95.672  9.420   36.734  1.00 6.07  ? 669  HOH B O   1 
HETATM 9450  O O   . HOH K 4 .   ? 99.101  2.424   31.046  1.00 3.07  ? 670  HOH B O   1 
HETATM 9451  O O   . HOH K 4 .   ? 97.520  8.976   38.795  1.00 8.87  ? 671  HOH B O   1 
HETATM 9452  O O   . HOH K 4 .   ? 93.045  6.786   34.211  1.00 8.99  ? 672  HOH B O   1 
HETATM 9453  O O   . HOH K 4 .   ? 90.463  8.048   33.635  1.00 10.21 ? 673  HOH B O   1 
HETATM 9454  O O   . HOH K 4 .   ? 97.159  7.307   29.572  1.00 2.74  ? 674  HOH B O   1 
HETATM 9455  O O   . HOH K 4 .   ? 94.933  2.670   28.743  1.00 5.96  ? 675  HOH B O   1 
HETATM 9456  O O   . HOH K 4 .   ? 95.466  0.061   29.399  1.00 5.32  ? 676  HOH B O   1 
HETATM 9457  O O   . HOH K 4 .   ? 88.636  -2.188  32.100  1.00 6.91  ? 677  HOH B O   1 
HETATM 9458  O O   . HOH K 4 .   ? 89.063  -0.045  30.331  1.00 6.93  ? 678  HOH B O   1 
HETATM 9459  O O   . HOH K 4 .   ? 84.726  0.788   35.990  1.00 11.98 ? 679  HOH B O   1 
HETATM 9460  O O   . HOH K 4 .   ? 91.270  -8.172  34.271  1.00 17.04 ? 680  HOH B O   1 
HETATM 9461  O O   . HOH K 4 .   ? 91.508  -5.581  24.464  1.00 10.28 ? 681  HOH B O   1 
HETATM 9462  O O   . HOH K 4 .   ? 82.788  -6.519  21.946  1.00 15.57 ? 682  HOH B O   1 
HETATM 9463  O O   . HOH K 4 .   ? 84.570  -4.291  20.688  1.00 5.73  ? 683  HOH B O   1 
HETATM 9464  O O   . HOH K 4 .   ? 80.430  -7.798  15.340  1.00 4.61  ? 684  HOH B O   1 
HETATM 9465  O O   . HOH K 4 .   ? 77.496  -15.865 14.788  1.00 11.22 ? 685  HOH B O   1 
HETATM 9466  O O   . HOH K 4 .   ? 81.943  -10.983 13.244  1.00 12.39 ? 686  HOH B O   1 
HETATM 9467  O O   . HOH K 4 .   ? 81.175  -8.075  12.647  1.00 9.15  ? 687  HOH B O   1 
HETATM 9468  O O   . HOH K 4 .   ? 80.113  -9.339  10.196  1.00 2.39  ? 688  HOH B O   1 
HETATM 9469  O O   . HOH K 4 .   ? 84.199  -9.740  11.698  1.00 14.75 ? 689  HOH B O   1 
HETATM 9470  O O   . HOH K 4 .   ? 77.850  -16.285 8.594   1.00 14.86 ? 690  HOH B O   1 
HETATM 9471  O O   . HOH K 4 .   ? 75.068  -14.922 2.360   1.00 9.87  ? 691  HOH B O   1 
HETATM 9472  O O   . HOH K 4 .   ? 74.619  -14.184 -0.139  1.00 11.22 ? 692  HOH B O   1 
HETATM 9473  O O   . HOH K 4 .   ? 73.759  -16.605 -1.614  1.00 15.84 ? 693  HOH B O   1 
HETATM 9474  O O   . HOH K 4 .   ? 73.054  -16.075 3.944   1.00 19.08 ? 694  HOH B O   1 
HETATM 9475  O O   . HOH K 4 .   ? 81.606  -10.870 -0.323  1.00 8.24  ? 695  HOH B O   1 
HETATM 9476  O O   . HOH K 4 .   ? 77.957  -7.671  0.957   1.00 5.25  ? 696  HOH B O   1 
HETATM 9477  O O   . HOH K 4 .   ? 79.349  -8.979  -0.894  1.00 9.43  ? 697  HOH B O   1 
HETATM 9478  O O   . HOH K 4 .   ? 76.650  -8.677  -3.513  1.00 12.76 ? 698  HOH B O   1 
HETATM 9479  O O   . HOH K 4 .   ? 80.350  -6.533  1.985   1.00 12.67 ? 699  HOH B O   1 
HETATM 9480  O O   . HOH K 4 .   ? 82.302  -4.520  1.387   1.00 6.27  ? 700  HOH B O   1 
HETATM 9481  O O   . HOH K 4 .   ? 82.106  -4.085  -1.129  1.00 6.47  ? 701  HOH B O   1 
HETATM 9482  O O   . HOH K 4 .   ? 80.467  -5.858  -2.372  1.00 4.25  ? 702  HOH B O   1 
HETATM 9483  O O   . HOH K 4 .   ? 83.297  -7.259  -10.612 1.00 21.14 ? 703  HOH B O   1 
HETATM 9484  O O   . HOH K 4 .   ? 98.262  -7.933  2.341   1.00 8.77  ? 704  HOH B O   1 
HETATM 9485  O O   . HOH K 4 .   ? 97.297  -3.058  10.561  1.00 8.93  ? 705  HOH B O   1 
HETATM 9486  O O   . HOH K 4 .   ? 101.647 -11.448 13.102  1.00 44.26 ? 706  HOH B O   1 
HETATM 9487  O O   . HOH K 4 .   ? 100.034 -4.549  7.779   1.00 7.35  ? 707  HOH B O   1 
HETATM 9488  O O   . HOH K 4 .   ? 97.698  -3.754  -4.481  1.00 25.53 ? 708  HOH B O   1 
HETATM 9489  O O   . HOH K 4 .   ? 95.766  -4.999  -7.437  1.00 29.07 ? 709  HOH B O   1 
HETATM 9490  O O   . HOH K 4 .   ? 93.375  1.986   -8.283  1.00 9.67  ? 710  HOH B O   1 
HETATM 9491  O O   . HOH K 4 .   ? 95.162  7.796   -5.647  1.00 13.35 ? 711  HOH B O   1 
HETATM 9492  O O   . HOH K 4 .   ? 90.155  6.433   0.098   1.00 4.60  ? 712  HOH B O   1 
HETATM 9493  O O   . HOH K 4 .   ? 84.385  5.196   -3.399  1.00 2.08  ? 713  HOH B O   1 
HETATM 9494  O O   . HOH K 4 .   ? 87.613  6.533   1.278   1.00 6.08  ? 714  HOH B O   1 
HETATM 9495  O O   . HOH K 4 .   ? 86.031  8.604   -0.614  1.00 10.01 ? 715  HOH B O   1 
HETATM 9496  O O   . HOH K 4 .   ? 85.299  3.270   -5.100  1.00 9.92  ? 716  HOH B O   1 
HETATM 9497  O O   . HOH K 4 .   ? 86.610  2.091   -2.763  1.00 12.90 ? 717  HOH B O   1 
HETATM 9498  O O   . HOH K 4 .   ? 85.752  12.498  -3.924  1.00 30.04 ? 718  HOH B O   1 
HETATM 9499  O O   . HOH K 4 .   ? 97.576  2.668   7.205   1.00 7.08  ? 719  HOH B O   1 
HETATM 9500  O O   . HOH K 4 .   ? 93.356  0.536   12.472  1.00 7.24  ? 720  HOH B O   1 
HETATM 9501  O O   . HOH K 4 .   ? 96.288  4.164   22.082  1.00 8.79  ? 721  HOH B O   1 
HETATM 9502  O O   . HOH K 4 .   ? 94.406  6.201   21.899  1.00 3.55  ? 722  HOH B O   1 
HETATM 9503  O O   . HOH K 4 .   ? 91.722  6.475   21.427  1.00 2.51  ? 723  HOH B O   1 
HETATM 9504  O O   . HOH K 4 .   ? 94.125  7.468   24.277  1.00 3.58  ? 724  HOH B O   1 
HETATM 9505  O O   . HOH K 4 .   ? 91.745  8.745   23.477  1.00 2.78  ? 725  HOH B O   1 
HETATM 9506  O O   . HOH K 4 .   ? 90.789  11.036  24.375  1.00 2.35  ? 726  HOH B O   1 
HETATM 9507  O O   . HOH K 4 .   ? 101.895 9.499   22.528  1.00 4.85  ? 727  HOH B O   1 
HETATM 9508  O O   . HOH K 4 .   ? 100.844 8.985   20.156  1.00 3.57  ? 728  HOH B O   1 
HETATM 9509  O O   . HOH K 4 .   ? 98.753  11.522  23.747  1.00 6.66  ? 729  HOH B O   1 
HETATM 9510  O O   . HOH K 4 .   ? 98.435  11.085  21.255  1.00 8.18  ? 730  HOH B O   1 
HETATM 9511  O O   . HOH K 4 .   ? 94.824  13.840  25.111  1.00 5.52  ? 731  HOH B O   1 
HETATM 9512  O O   . HOH K 4 .   ? 95.374  14.550  27.732  1.00 5.92  ? 732  HOH B O   1 
HETATM 9513  O O   . HOH K 4 .   ? 92.321  13.414  24.132  1.00 3.24  ? 733  HOH B O   1 
HETATM 9514  O O   . HOH K 4 .   ? 89.935  3.239   24.136  1.00 3.53  ? 734  HOH B O   1 
HETATM 9515  O O   . HOH K 4 .   ? 88.384  0.563   21.468  1.00 2.71  ? 735  HOH B O   1 
HETATM 9516  O O   . HOH K 4 .   ? 79.638  -5.730  27.716  1.00 36.98 ? 736  HOH B O   1 
HETATM 9517  O O   . HOH K 4 .   ? 86.248  -3.102  33.867  1.00 43.83 ? 737  HOH B O   1 
HETATM 9518  O O   . HOH K 4 .   ? 74.394  2.855   39.980  1.00 31.64 ? 738  HOH B O   1 
HETATM 9519  O O   . HOH K 4 .   ? 80.813  -3.022  24.692  1.00 9.06  ? 739  HOH B O   1 
HETATM 9520  O O   . HOH K 4 .   ? 81.192  1.223   24.325  1.00 8.64  ? 740  HOH B O   1 
HETATM 9521  O O   . HOH K 4 .   ? 79.389  1.736   22.304  1.00 7.39  ? 741  HOH B O   1 
HETATM 9522  O O   . HOH K 4 .   ? 80.934  2.552   26.789  1.00 4.17  ? 742  HOH B O   1 
HETATM 9523  O O   . HOH K 4 .   ? 76.744  -0.131  24.575  1.00 8.20  ? 743  HOH B O   1 
HETATM 9524  O O   . HOH K 4 .   ? 76.097  -3.340  17.853  1.00 6.01  ? 744  HOH B O   1 
HETATM 9525  O O   . HOH K 4 .   ? 75.050  -10.031 17.002  1.00 10.15 ? 745  HOH B O   1 
HETATM 9526  O O   . HOH K 4 .   ? 72.520  -10.803 15.844  1.00 5.03  ? 746  HOH B O   1 
HETATM 9527  O O   . HOH K 4 .   ? 68.211  -9.688  8.402   1.00 6.75  ? 747  HOH B O   1 
HETATM 9528  O O   . HOH K 4 .   ? 63.122  -6.568  11.715  1.00 4.66  ? 748  HOH B O   1 
HETATM 9529  O O   . HOH K 4 .   ? 56.709  -2.170  19.939  1.00 15.07 ? 749  HOH B O   1 
HETATM 9530  O O   . HOH K 4 .   ? 69.436  2.369   10.984  1.00 3.81  ? 750  HOH B O   1 
HETATM 9531  O O   . HOH K 4 .   ? 70.058  6.807   3.746   1.00 3.99  ? 751  HOH B O   1 
HETATM 9532  O O   . HOH K 4 .   ? 65.582  10.081  -2.334  1.00 5.80  ? 752  HOH B O   1 
HETATM 9533  O O   . HOH K 4 .   ? 63.944  14.539  5.426   1.00 2.30  ? 753  HOH B O   1 
HETATM 9534  O O   . HOH K 4 .   ? 62.158  12.292  -0.475  1.00 4.89  ? 754  HOH B O   1 
HETATM 9535  O O   . HOH K 4 .   ? 60.674  8.524   -1.827  1.00 2.91  ? 755  HOH B O   1 
HETATM 9536  O O   . HOH K 4 .   ? 63.421  11.851  -2.893  1.00 11.31 ? 756  HOH B O   1 
HETATM 9537  O O   . HOH K 4 .   ? 60.266  13.955  -1.434  1.00 7.75  ? 757  HOH B O   1 
HETATM 9538  O O   . HOH K 4 .   ? 67.549  21.617  -1.807  1.00 8.18  ? 758  HOH B O   1 
HETATM 9539  O O   . HOH K 4 .   ? 62.529  19.598  0.821   1.00 4.30  ? 759  HOH B O   1 
HETATM 9540  O O   . HOH K 4 .   ? 64.122  19.821  -1.921  1.00 7.93  ? 760  HOH B O   1 
HETATM 9541  O O   . HOH K 4 .   ? 62.680  23.355  -3.464  1.00 37.51 ? 761  HOH B O   1 
HETATM 9542  O O   . HOH K 4 .   ? 61.973  23.546  -0.805  1.00 10.16 ? 762  HOH B O   1 
HETATM 9543  O O   . HOH K 4 .   ? 60.452  21.471  -0.035  1.00 22.03 ? 763  HOH B O   1 
HETATM 9544  O O   . HOH K 4 .   ? 60.603  16.564  12.245  1.00 6.58  ? 764  HOH B O   1 
HETATM 9545  O O   . HOH K 4 .   ? 61.548  13.105  13.734  1.00 2.20  ? 765  HOH B O   1 
HETATM 9546  O O   . HOH K 4 .   ? 54.103  17.482  9.683   1.00 2.97  ? 766  HOH B O   1 
HETATM 9547  O O   . HOH K 4 .   ? 52.535  6.902   10.716  1.00 10.52 ? 767  HOH B O   1 
HETATM 9548  O O   . HOH K 4 .   ? 53.027  6.075   13.176  1.00 9.79  ? 768  HOH B O   1 
HETATM 9549  O O   . HOH K 4 .   ? 54.136  3.765   13.980  1.00 3.47  ? 769  HOH B O   1 
HETATM 9550  O O   . HOH K 4 .   ? 56.297  -3.485  8.957   1.00 5.25  ? 770  HOH B O   1 
HETATM 9551  O O   . HOH K 4 .   ? 56.226  -4.574  6.228   1.00 10.31 ? 771  HOH B O   1 
HETATM 9552  O O   . HOH K 4 .   ? 58.008  -6.474  6.772   1.00 7.63  ? 772  HOH B O   1 
HETATM 9553  O O   . HOH K 4 .   ? 57.109  -6.196  9.260   1.00 9.44  ? 773  HOH B O   1 
HETATM 9554  O O   . HOH K 4 .   ? 57.490  -4.379  15.894  1.00 12.48 ? 774  HOH B O   1 
HETATM 9555  O O   . HOH K 4 .   ? 56.368  -8.354  13.499  1.00 21.52 ? 775  HOH B O   1 
HETATM 9556  O O   . HOH K 4 .   ? 57.905  -7.883  11.070  1.00 7.79  ? 776  HOH B O   1 
HETATM 9557  O O   . HOH K 4 .   ? 60.660  -11.345 11.349  1.00 9.58  ? 777  HOH B O   1 
HETATM 9558  O O   . HOH K 4 .   ? 65.825  -0.665  21.937  1.00 19.72 ? 778  HOH B O   1 
HETATM 9559  O O   . HOH K 4 .   ? 70.141  -3.047  16.833  1.00 17.35 ? 779  HOH B O   1 
HETATM 9560  O O   . HOH K 4 .   ? 62.836  6.213   16.075  1.00 9.56  ? 780  HOH B O   1 
HETATM 9561  O O   . HOH K 4 .   ? 63.268  6.009   13.217  1.00 5.71  ? 781  HOH B O   1 
HETATM 9562  O O   . HOH K 4 .   ? 61.950  5.050   23.234  1.00 27.67 ? 782  HOH B O   1 
HETATM 9563  O O   . HOH K 4 .   ? 58.105  12.645  21.318  1.00 30.96 ? 783  HOH B O   1 
HETATM 9564  O O   . HOH K 4 .   ? 61.538  -0.364  22.423  1.00 14.79 ? 784  HOH B O   1 
HETATM 9565  O O   . HOH K 4 .   ? 57.232  0.801   23.079  1.00 22.67 ? 785  HOH B O   1 
HETATM 9566  O O   . HOH K 4 .   ? 52.688  -0.915  23.238  1.00 16.74 ? 786  HOH B O   1 
HETATM 9567  O O   . HOH K 4 .   ? 55.943  -1.262  24.311  1.00 27.00 ? 787  HOH B O   1 
HETATM 9568  O O   . HOH K 4 .   ? 54.395  7.568   19.329  1.00 6.58  ? 788  HOH B O   1 
HETATM 9569  O O   . HOH K 4 .   ? 54.106  15.199  17.006  1.00 6.80  ? 789  HOH B O   1 
HETATM 9570  O O   . HOH K 4 .   ? 54.005  13.498  13.443  1.00 4.90  ? 790  HOH B O   1 
HETATM 9571  O O   . HOH K 4 .   ? 60.007  17.020  18.894  1.00 4.96  ? 791  HOH B O   1 
HETATM 9572  O O   . HOH K 4 .   ? 67.422  12.874  15.596  1.00 4.02  ? 792  HOH B O   1 
HETATM 9573  O O   . HOH K 4 .   ? 66.585  15.335  16.643  1.00 5.25  ? 793  HOH B O   1 
HETATM 9574  O O   . HOH K 4 .   ? 68.889  6.636   25.780  1.00 10.37 ? 794  HOH B O   1 
HETATM 9575  O O   . HOH K 4 .   ? 65.282  12.649  23.791  1.00 3.05  ? 795  HOH B O   1 
HETATM 9576  O O   . HOH K 4 .   ? 62.676  9.725   25.908  1.00 7.20  ? 796  HOH B O   1 
HETATM 9577  O O   . HOH K 4 .   ? 68.353  18.490  29.724  1.00 5.19  ? 797  HOH B O   1 
HETATM 9578  O O   . HOH K 4 .   ? 64.987  21.601  12.487  1.00 2.31  ? 798  HOH B O   1 
HETATM 9579  O O   . HOH K 4 .   ? 66.536  22.354  17.983  1.00 3.44  ? 799  HOH B O   1 
HETATM 9580  O O   . HOH K 4 .   ? 61.182  19.093  13.367  1.00 9.05  ? 800  HOH B O   1 
HETATM 9581  O O   . HOH K 4 .   ? 65.368  22.036  9.912   1.00 5.67  ? 801  HOH B O   1 
HETATM 9582  O O   . HOH K 4 .   ? 65.921  23.814  14.138  1.00 4.17  ? 802  HOH B O   1 
HETATM 9583  O O   . HOH K 4 .   ? 75.600  27.283  13.174  1.00 4.07  ? 803  HOH B O   1 
HETATM 9584  O O   . HOH K 4 .   ? 71.698  25.430  8.661   1.00 3.44  ? 804  HOH B O   1 
HETATM 9585  O O   . HOH K 4 .   ? 74.664  23.751  9.083   1.00 5.88  ? 805  HOH B O   1 
HETATM 9586  O O   . HOH K 4 .   ? 70.616  32.947  14.177  1.00 12.61 ? 806  HOH B O   1 
HETATM 9587  O O   . HOH K 4 .   ? 69.640  34.577  9.949   1.00 9.54  ? 807  HOH B O   1 
HETATM 9588  O O   . HOH K 4 .   ? 71.115  32.504  11.247  1.00 12.13 ? 808  HOH B O   1 
HETATM 9589  O O   . HOH K 4 .   ? 71.149  31.880  19.002  1.00 6.51  ? 809  HOH B O   1 
HETATM 9590  O O   . HOH K 4 .   ? 81.688  33.428  20.333  1.00 21.07 ? 810  HOH B O   1 
HETATM 9591  O O   . HOH K 4 .   ? 84.638  38.637  21.301  1.00 8.13  ? 811  HOH B O   1 
HETATM 9592  O O   . HOH K 4 .   ? 83.248  34.417  18.549  1.00 8.45  ? 812  HOH B O   1 
HETATM 9593  O O   . HOH K 4 .   ? 88.575  39.091  11.437  1.00 6.60  ? 813  HOH B O   1 
HETATM 9594  O O   . HOH K 4 .   ? 80.069  39.812  9.643   1.00 21.82 ? 814  HOH B O   1 
HETATM 9595  O O   . HOH K 4 .   ? 80.431  40.467  13.214  1.00 9.34  ? 815  HOH B O   1 
HETATM 9596  O O   . HOH K 4 .   ? 76.500  35.417  6.790   1.00 19.25 ? 816  HOH B O   1 
HETATM 9597  O O   . HOH K 4 .   ? 75.800  31.279  2.941   1.00 10.41 ? 817  HOH B O   1 
HETATM 9598  O O   . HOH K 4 .   ? 66.360  9.317   -7.461  1.00 10.47 ? 818  HOH B O   1 
HETATM 9599  O O   . HOH K 4 .   ? 73.258  5.350   -10.378 1.00 3.24  ? 819  HOH B O   1 
HETATM 9600  O O   . HOH K 4 .   ? 76.510  6.421   -9.371  1.00 12.03 ? 820  HOH B O   1 
HETATM 9601  O O   . HOH K 4 .   ? 79.229  6.435   -8.760  1.00 5.59  ? 821  HOH B O   1 
HETATM 9602  O O   . HOH K 4 .   ? 80.826  4.426   -12.834 1.00 14.65 ? 822  HOH B O   1 
HETATM 9603  O O   . HOH K 4 .   ? 79.819  6.037   -15.130 1.00 23.84 ? 823  HOH B O   1 
HETATM 9604  O O   . HOH K 4 .   ? 82.017  12.662  -7.053  1.00 8.54  ? 824  HOH B O   1 
HETATM 9605  O O   . HOH K 4 .   ? 79.138  18.325  -6.481  1.00 9.75  ? 825  HOH B O   1 
HETATM 9606  O O   . HOH K 4 .   ? 72.919  15.628  -5.628  1.00 10.49 ? 826  HOH B O   1 
HETATM 9607  O O   . HOH K 4 .   ? 72.300  14.013  -2.790  1.00 3.61  ? 827  HOH B O   1 
HETATM 9608  O O   . HOH K 4 .   ? 69.160  24.533  -8.648  1.00 19.40 ? 828  HOH B O   1 
HETATM 9609  O O   . HOH K 4 .   ? 84.067  22.022  6.603   1.00 3.03  ? 829  HOH B O   1 
HETATM 9610  O O   . HOH K 4 .   ? 83.536  13.973  2.312   1.00 13.40 ? 830  HOH B O   1 
HETATM 9611  O O   . HOH K 4 .   ? 82.232  11.047  3.145   1.00 8.42  ? 831  HOH B O   1 
HETATM 9612  O O   . HOH K 4 .   ? 82.401  9.300   1.160   1.00 9.88  ? 832  HOH B O   1 
HETATM 9613  O O   . HOH K 4 .   ? 82.880  14.802  5.620   1.00 9.04  ? 833  HOH B O   1 
HETATM 9614  O O   . HOH K 4 .   ? 85.059  15.165  8.521   1.00 11.28 ? 834  HOH B O   1 
HETATM 9615  O O   . HOH K 4 .   ? 81.695  18.183  14.828  1.00 4.75  ? 835  HOH B O   1 
HETATM 9616  O O   . HOH K 4 .   ? 77.859  18.710  20.454  1.00 3.20  ? 836  HOH B O   1 
HETATM 9617  O O   . HOH K 4 .   ? 90.106  23.316  18.777  1.00 4.61  ? 837  HOH B O   1 
HETATM 9618  O O   . HOH K 4 .   ? 76.037  33.044  20.488  1.00 3.44  ? 838  HOH B O   1 
HETATM 9619  O O   . HOH K 4 .   ? 73.401  31.310  29.080  1.00 13.20 ? 839  HOH B O   1 
HETATM 9620  O O   . HOH K 4 .   ? 78.290  31.662  32.735  1.00 4.38  ? 840  HOH B O   1 
HETATM 9621  O O   . HOH K 4 .   ? 79.975  32.325  34.911  1.00 14.17 ? 841  HOH B O   1 
HETATM 9622  O O   . HOH K 4 .   ? 89.126  37.338  32.626  1.00 2.60  ? 842  HOH B O   1 
HETATM 9623  O O   . HOH K 4 .   ? 81.636  20.304  35.175  1.00 4.86  ? 843  HOH B O   1 
HETATM 9624  O O   . HOH K 4 .   ? 83.824  21.807  36.376  1.00 10.30 ? 844  HOH B O   1 
HETATM 9625  O O   . HOH K 4 .   ? 85.254  22.454  40.055  1.00 4.78  ? 845  HOH B O   1 
HETATM 9626  O O   . HOH K 4 .   ? 85.454  39.403  41.261  1.00 7.29  ? 846  HOH B O   1 
HETATM 9627  O O   . HOH K 4 .   ? 88.791  39.885  41.781  1.00 4.39  ? 847  HOH B O   1 
HETATM 9628  O O   . HOH K 4 .   ? 87.732  40.010  44.259  1.00 9.83  ? 848  HOH B O   1 
HETATM 9629  O O   . HOH K 4 .   ? 90.211  33.361  31.008  1.00 15.35 ? 849  HOH B O   1 
HETATM 9630  O O   . HOH K 4 .   ? 88.289  31.855  29.565  1.00 3.12  ? 850  HOH B O   1 
HETATM 9631  O O   . HOH K 4 .   ? 94.302  24.295  28.049  1.00 3.58  ? 851  HOH B O   1 
HETATM 9632  O O   . HOH K 4 .   ? 95.825  18.587  24.564  1.00 3.71  ? 852  HOH B O   1 
HETATM 9633  O O   . HOH K 4 .   ? 88.292  11.678  23.473  1.00 2.93  ? 853  HOH B O   1 
HETATM 9634  O O   . HOH K 4 .   ? 81.492  -2.344  2.959   1.00 4.18  ? 854  HOH B O   1 
HETATM 9635  O O   . HOH K 4 .   ? 67.092  -15.819 -3.940  1.00 23.05 ? 855  HOH B O   1 
HETATM 9636  O O   . HOH K 4 .   ? 61.685  -9.957  -1.824  1.00 14.18 ? 856  HOH B O   1 
HETATM 9637  O O   . HOH K 4 .   ? 64.013  -13.526 -2.890  1.00 26.78 ? 857  HOH B O   1 
HETATM 9638  O O   . HOH K 4 .   ? 71.257  -7.679  -11.378 1.00 21.65 ? 858  HOH B O   1 
HETATM 9639  O O   . HOH K 4 .   ? 65.585  -15.336 4.881   1.00 12.55 ? 859  HOH B O   1 
HETATM 9640  O O   . HOH K 4 .   ? 58.359  -10.385 10.254  1.00 13.21 ? 860  HOH B O   1 
HETATM 9641  O O   . HOH K 4 .   ? 65.995  -14.240 11.564  1.00 16.64 ? 861  HOH B O   1 
HETATM 9642  O O   . HOH K 4 .   ? 66.996  -14.667 8.636   1.00 8.69  ? 862  HOH B O   1 
HETATM 9643  O O   . HOH K 4 .   ? 55.005  -9.632  3.077   1.00 17.33 ? 863  HOH B O   1 
HETATM 9644  O O   . HOH K 4 .   ? 52.020  2.982   -0.528  1.00 23.68 ? 864  HOH B O   1 
HETATM 9645  O O   . HOH K 4 .   ? 55.327  2.544   -5.068  1.00 10.80 ? 865  HOH B O   1 
HETATM 9646  O O   . HOH K 4 .   ? 59.141  5.462   -4.372  1.00 9.21  ? 866  HOH B O   1 
HETATM 9647  O O   . HOH K 4 .   ? 56.593  5.044   -5.362  1.00 10.19 ? 867  HOH B O   1 
HETATM 9648  O O   . HOH K 4 .   ? 60.240  5.047   -13.854 1.00 11.27 ? 868  HOH B O   1 
HETATM 9649  O O   . HOH K 4 .   ? 78.173  12.916  26.972  1.00 2.83  ? 869  HOH B O   1 
HETATM 9650  O O   . HOH K 4 .   ? 79.596  6.465   28.692  1.00 3.18  ? 870  HOH B O   1 
HETATM 9651  O O   . HOH K 4 .   ? 76.568  20.492  30.624  1.00 2.17  ? 871  HOH B O   1 
HETATM 9652  O O   . HOH K 4 .   ? 69.771  25.222  35.203  1.00 13.76 ? 872  HOH B O   1 
HETATM 9653  O O   . HOH K 4 .   ? 73.411  36.586  11.276  1.00 16.35 ? 873  HOH B O   1 
HETATM 9654  O O   . HOH K 4 .   ? 62.775  22.858  9.522   1.00 4.45  ? 874  HOH B O   1 
HETATM 9655  O O   . HOH K 4 .   ? 59.028  33.625  13.510  1.00 12.60 ? 875  HOH B O   1 
HETATM 9656  O O   . HOH K 4 .   ? 57.487  20.551  26.134  1.00 12.27 ? 876  HOH B O   1 
HETATM 9657  O O   . HOH K 4 .   ? 58.910  18.966  21.997  1.00 19.80 ? 877  HOH B O   1 
HETATM 9658  O O   . HOH K 4 .   ? 56.728  26.076  18.063  1.00 12.20 ? 878  HOH B O   1 
HETATM 9659  O O   . HOH K 4 .   ? 66.127  20.005  25.808  1.00 8.07  ? 879  HOH B O   1 
HETATM 9660  O O   . HOH K 4 .   ? 66.674  19.635  23.379  1.00 3.07  ? 880  HOH B O   1 
HETATM 9661  O O   . HOH K 4 .   ? 64.341  18.609  26.964  1.00 27.29 ? 881  HOH B O   1 
HETATM 9662  O O   . HOH K 4 .   ? 69.767  13.446  14.196  1.00 4.62  ? 882  HOH B O   1 
HETATM 9663  O O   . HOH K 4 .   ? 70.000  4.868   10.066  1.00 5.11  ? 883  HOH B O   1 
HETATM 9664  O O   . HOH K 4 .   ? 73.688  -2.460  18.859  1.00 8.89  ? 884  HOH B O   1 
HETATM 9665  O O   . HOH K 4 .   ? 75.107  4.984   28.903  1.00 4.70  ? 885  HOH B O   1 
HETATM 9666  O O   . HOH K 4 .   ? 74.157  3.047   27.146  1.00 8.74  ? 886  HOH B O   1 
HETATM 9667  O O   . HOH K 4 .   ? 77.753  4.401   29.473  1.00 4.19  ? 887  HOH B O   1 
HETATM 9668  O O   . HOH K 4 .   ? 95.590  13.343  30.287  1.00 6.16  ? 888  HOH B O   1 
HETATM 9669  O O   . HOH K 4 .   ? 96.813  17.069  32.614  1.00 3.65  ? 889  HOH B O   1 
HETATM 9670  O O   . HOH K 4 .   ? 96.895  12.132  40.631  1.00 17.42 ? 890  HOH B O   1 
HETATM 9671  O O   . HOH K 4 .   ? 100.955 13.070  34.778  1.00 2.98  ? 891  HOH B O   1 
HETATM 9672  O O   . HOH K 4 .   ? 95.262  22.851  45.878  1.00 17.29 ? 892  HOH B O   1 
HETATM 9673  O O   . HOH K 4 .   ? 88.054  16.586  43.413  1.00 11.43 ? 893  HOH B O   1 
HETATM 9674  O O   . HOH K 4 .   ? 88.846  14.111  45.249  1.00 12.07 ? 894  HOH B O   1 
HETATM 9675  O O   . HOH K 4 .   ? 83.570  20.958  42.988  1.00 18.07 ? 895  HOH B O   1 
HETATM 9676  O O   . HOH K 4 .   ? 75.437  7.887   27.916  1.00 3.32  ? 896  HOH B O   1 
HETATM 9677  O O   . HOH K 4 .   ? 87.514  5.013   41.402  1.00 9.97  ? 897  HOH B O   1 
HETATM 9678  O O   . HOH K 4 .   ? 84.963  5.576   42.359  1.00 2.89  ? 898  HOH B O   1 
HETATM 9679  O O   . HOH K 4 .   ? 77.023  11.732  40.135  1.00 5.56  ? 899  HOH B O   1 
HETATM 9680  O O   . HOH K 4 .   ? 78.835  12.708  43.668  1.00 5.91  ? 900  HOH B O   1 
HETATM 9681  O O   . HOH K 4 .   ? 88.558  -0.058  36.163  1.00 13.21 ? 901  HOH B O   1 
HETATM 9682  O O   . HOH K 4 .   ? 82.238  2.797   34.981  1.00 5.83  ? 902  HOH B O   1 
HETATM 9683  O O   . HOH K 4 .   ? 120.829 26.122  42.147  1.00 3.10  ? 903  HOH B O   1 
HETATM 9684  O O   . HOH K 4 .   ? 114.488 20.161  35.443  1.00 6.40  ? 904  HOH B O   1 
HETATM 9685  O O   . HOH K 4 .   ? 113.707 7.082   37.816  1.00 23.44 ? 905  HOH B O   1 
HETATM 9686  O O   . HOH K 4 .   ? 59.632  10.629  22.222  1.00 8.76  ? 906  HOH B O   1 
HETATM 9687  O O   . HOH K 4 .   ? 56.278  8.875   23.163  1.00 18.57 ? 907  HOH B O   1 
HETATM 9688  O O   . HOH K 4 .   ? 116.290 36.736  40.419  1.00 5.49  ? 908  HOH B O   1 
HETATM 9689  O O   . HOH K 4 .   ? 61.023  7.513   23.521  1.00 16.42 ? 909  HOH B O   1 
HETATM 9690  O O   . HOH K 4 .   ? 58.020  17.925  25.091  1.00 12.00 ? 910  HOH B O   1 
HETATM 9691  O O   . HOH K 4 .   ? 107.978 21.625  38.873  1.00 7.52  ? 911  HOH B O   1 
HETATM 9692  O O   . HOH K 4 .   ? 51.570  -4.794  0.131   1.00 18.31 ? 912  HOH B O   1 
HETATM 9693  O O   . HOH K 4 .   ? 51.811  1.749   -4.405  1.00 23.15 ? 913  HOH B O   1 
HETATM 9694  O O   . HOH K 4 .   ? 88.988  36.064  28.151  1.00 24.30 ? 914  HOH B O   1 
HETATM 9695  O O   . HOH K 4 .   ? 83.713  15.087  10.800  1.00 30.33 ? 915  HOH B O   1 
HETATM 9696  O O   . HOH K 4 .   ? 106.907 19.179  39.439  1.00 12.19 ? 916  HOH B O   1 
HETATM 9697  O O   . HOH K 4 .   ? 107.536 18.371  36.951  1.00 5.23  ? 917  HOH B O   1 
HETATM 9698  O O   . HOH K 4 .   ? 110.572 16.010  44.547  1.00 14.74 ? 918  HOH B O   1 
HETATM 9699  O O   . HOH K 4 .   ? 103.476 11.247  41.567  1.00 20.08 ? 919  HOH B O   1 
HETATM 9700  O O   . HOH K 4 .   ? 106.147 21.867  42.100  1.00 18.45 ? 920  HOH B O   1 
HETATM 9701  O O   . HOH K 4 .   ? 107.031 12.765  43.084  1.00 21.68 ? 921  HOH B O   1 
HETATM 9702  O O   . HOH K 4 .   ? 98.646  4.970   40.030  1.00 16.86 ? 922  HOH B O   1 
HETATM 9703  O O   . HOH K 4 .   ? 95.198  -8.401  32.781  1.00 9.97  ? 923  HOH B O   1 
HETATM 9704  O O   . HOH K 4 .   ? 93.610  -3.354  26.664  1.00 6.09  ? 924  HOH B O   1 
HETATM 9705  O O   . HOH K 4 .   ? 91.587  8.326   35.912  1.00 28.10 ? 925  HOH B O   1 
HETATM 9706  O O   . HOH K 4 .   ? 94.045  6.112   41.320  1.00 15.26 ? 926  HOH B O   1 
HETATM 9707  O O   . HOH K 4 .   ? 101.001 4.647   41.753  1.00 17.71 ? 927  HOH B O   1 
HETATM 9708  O O   . HOH K 4 .   ? 95.985  -1.154  23.457  1.00 7.22  ? 928  HOH B O   1 
HETATM 9709  O O   . HOH K 4 .   ? 82.167  0.449   28.071  1.00 14.28 ? 929  HOH B O   1 
HETATM 9710  O O   . HOH K 4 .   ? 83.552  -5.683  27.831  1.00 24.59 ? 930  HOH B O   1 
HETATM 9711  O O   . HOH K 4 .   ? 83.836  -7.841  26.173  1.00 16.08 ? 931  HOH B O   1 
HETATM 9712  O O   . HOH K 4 .   ? 86.363  -7.610  28.853  1.00 14.30 ? 932  HOH B O   1 
HETATM 9713  O O   . HOH K 4 .   ? 88.765  -5.877  33.474  1.00 43.20 ? 933  HOH B O   1 
HETATM 9714  O O   . HOH K 4 .   ? 83.576  -13.312 13.007  1.00 14.93 ? 934  HOH B O   1 
HETATM 9715  O O   . HOH K 4 .   ? 74.954  -14.319 6.475   1.00 10.89 ? 935  HOH B O   1 
HETATM 9716  O O   . HOH K 4 .   ? 75.799  -14.472 8.970   1.00 11.56 ? 936  HOH B O   1 
HETATM 9717  O O   . HOH K 4 .   ? 74.795  -15.869 11.019  1.00 14.38 ? 937  HOH B O   1 
HETATM 9718  O O   . HOH K 4 .   ? 73.007  -15.162 12.774  1.00 15.56 ? 938  HOH B O   1 
HETATM 9719  O O   . HOH K 4 .   ? 78.359  -14.696 0.718   1.00 9.99  ? 939  HOH B O   1 
HETATM 9720  O O   . HOH K 4 .   ? 80.871  -13.646 -0.334  1.00 12.57 ? 940  HOH B O   1 
HETATM 9721  O O   . HOH K 4 .   ? 78.151  -17.236 -0.115  1.00 31.19 ? 941  HOH B O   1 
HETATM 9722  O O   . HOH K 4 .   ? 77.140  -13.312 -1.171  1.00 8.45  ? 942  HOH B O   1 
HETATM 9723  O O   . HOH K 4 .   ? 77.133  -10.520 -1.436  1.00 5.89  ? 943  HOH B O   1 
HETATM 9724  O O   . HOH K 4 .   ? 81.449  -16.228 2.656   1.00 20.69 ? 944  HOH B O   1 
HETATM 9725  O O   . HOH K 4 .   ? 80.909  -0.570  0.665   1.00 5.66  ? 945  HOH B O   1 
HETATM 9726  O O   . HOH K 4 .   ? 85.959  -6.777  -11.928 1.00 25.47 ? 946  HOH B O   1 
HETATM 9727  O O   . HOH K 4 .   ? 84.205  -9.896  -13.670 1.00 41.00 ? 947  HOH B O   1 
HETATM 9728  O O   . HOH K 4 .   ? 80.524  -15.309 -9.884  1.00 39.89 ? 948  HOH B O   1 
HETATM 9729  O O   . HOH K 4 .   ? 85.249  -13.466 -6.121  1.00 32.48 ? 949  HOH B O   1 
HETATM 9730  O O   . HOH K 4 .   ? 90.476  -16.364 -4.295  1.00 31.43 ? 950  HOH B O   1 
HETATM 9731  O O   . HOH K 4 .   ? 106.205 -1.027  5.972   1.00 19.45 ? 951  HOH B O   1 
HETATM 9732  O O   . HOH K 4 .   ? 104.668 -3.895  -0.504  1.00 26.64 ? 952  HOH B O   1 
HETATM 9733  O O   . HOH K 4 .   ? 97.932  -1.197  -5.331  1.00 19.85 ? 953  HOH B O   1 
HETATM 9734  O O   . HOH K 4 .   ? 100.464 -0.903  -3.686  1.00 19.71 ? 954  HOH B O   1 
HETATM 9735  O O   . HOH K 4 .   ? 96.112  0.896   -5.761  1.00 17.45 ? 955  HOH B O   1 
HETATM 9736  O O   . HOH K 4 .   ? 93.105  3.807   -6.180  1.00 11.53 ? 956  HOH B O   1 
HETATM 9737  O O   . HOH K 4 .   ? 83.740  -3.006  -11.729 1.00 21.55 ? 957  HOH B O   1 
HETATM 9738  O O   . HOH K 4 .   ? 92.884  -3.696  -10.341 1.00 25.18 ? 958  HOH B O   1 
HETATM 9739  O O   . HOH K 4 .   ? 95.923  1.337   -8.406  1.00 21.14 ? 959  HOH B O   1 
HETATM 9740  O O   . HOH K 4 .   ? 97.423  3.327   -9.452  1.00 26.26 ? 960  HOH B O   1 
HETATM 9741  O O   . HOH K 4 .   ? 85.390  3.351   -14.613 1.00 35.15 ? 961  HOH B O   1 
HETATM 9742  O O   . HOH K 4 .   ? 80.390  4.341   -10.289 1.00 13.31 ? 962  HOH B O   1 
HETATM 9743  O O   . HOH K 4 .   ? 90.676  -1.662  -13.731 1.00 23.23 ? 963  HOH B O   1 
HETATM 9744  O O   . HOH K 4 .   ? 88.422  11.181  -6.411  1.00 20.79 ? 964  HOH B O   1 
HETATM 9745  O O   . HOH K 4 .   ? 89.986  8.872   -11.499 1.00 29.98 ? 965  HOH B O   1 
HETATM 9746  O O   . HOH K 4 .   ? 81.712  14.877  -5.431  1.00 13.31 ? 966  HOH B O   1 
HETATM 9747  O O   . HOH K 4 .   ? 81.246  11.461  -4.702  1.00 9.99  ? 967  HOH B O   1 
HETATM 9748  O O   . HOH K 4 .   ? 83.648  13.227  -11.236 1.00 28.73 ? 968  HOH B O   1 
HETATM 9749  O O   . HOH K 4 .   ? 84.742  12.775  -0.037  1.00 13.00 ? 969  HOH B O   1 
HETATM 9750  O O   . HOH K 4 .   ? 102.918 0.327   16.828  1.00 16.69 ? 970  HOH B O   1 
HETATM 9751  O O   . HOH K 4 .   ? 102.670 -0.171  19.354  1.00 19.24 ? 971  HOH B O   1 
HETATM 9752  O O   . HOH K 4 .   ? 100.154 -5.437  14.623  1.00 15.61 ? 972  HOH B O   1 
HETATM 9753  O O   . HOH K 4 .   ? 79.297  -0.768  25.290  1.00 8.32  ? 973  HOH B O   1 
HETATM 9754  O O   . HOH K 4 .   ? 76.187  1.272   26.744  1.00 6.41  ? 974  HOH B O   1 
HETATM 9755  O O   . HOH K 4 .   ? 78.438  2.322   28.105  1.00 5.19  ? 975  HOH B O   1 
HETATM 9756  O O   . HOH K 4 .   ? 72.925  0.700   23.683  1.00 18.35 ? 976  HOH B O   1 
HETATM 9757  O O   . HOH K 4 .   ? 69.837  3.995   25.763  1.00 11.87 ? 977  HOH B O   1 
HETATM 9758  O O   . HOH K 4 .   ? 72.428  2.443   29.322  1.00 40.74 ? 978  HOH B O   1 
HETATM 9759  O O   . HOH K 4 .   ? 70.788  -9.173  16.921  1.00 13.07 ? 979  HOH B O   1 
HETATM 9760  O O   . HOH K 4 .   ? 62.908  -13.438 13.209  1.00 9.26  ? 980  HOH B O   1 
HETATM 9761  O O   . HOH K 4 .   ? 68.360  -17.861 9.936   1.00 27.48 ? 981  HOH B O   1 
HETATM 9762  O O   . HOH K 4 .   ? 63.175  -14.781 8.785   1.00 20.25 ? 982  HOH B O   1 
HETATM 9763  O O   . HOH K 4 .   ? 65.093  -16.392 2.572   1.00 18.64 ? 983  HOH B O   1 
HETATM 9764  O O   . HOH K 4 .   ? 71.769  -18.123 7.783   1.00 9.91  ? 984  HOH B O   1 
HETATM 9765  O O   . HOH K 4 .   ? 58.710  6.611   -1.715  1.00 6.84  ? 985  HOH B O   1 
HETATM 9766  O O   . HOH K 4 .   ? 60.332  10.063  -3.879  1.00 21.94 ? 986  HOH B O   1 
HETATM 9767  O O   . HOH K 4 .   ? 59.683  7.731   -5.713  1.00 16.03 ? 987  HOH B O   1 
HETATM 9768  O O   . HOH K 4 .   ? 62.176  11.718  -5.313  1.00 8.85  ? 988  HOH B O   1 
HETATM 9769  O O   . HOH K 4 .   ? 60.889  15.316  -3.757  1.00 23.92 ? 989  HOH B O   1 
HETATM 9770  O O   . HOH K 4 .   ? 57.880  14.865  -0.430  1.00 20.50 ? 990  HOH B O   1 
HETATM 9771  O O   . HOH K 4 .   ? 55.123  12.370  -0.495  1.00 13.64 ? 991  HOH B O   1 
HETATM 9772  O O   . HOH K 4 .   ? 55.363  17.062  2.002   1.00 24.16 ? 992  HOH B O   1 
HETATM 9773  O O   . HOH K 4 .   ? 51.366  9.409   11.513  1.00 15.39 ? 993  HOH B O   1 
HETATM 9774  O O   . HOH K 4 .   ? 57.198  19.012  0.350   1.00 23.05 ? 994  HOH B O   1 
HETATM 9775  O O   . HOH K 4 .   ? 66.280  18.453  -0.998  1.00 9.25  ? 995  HOH B O   1 
HETATM 9776  O O   . HOH K 4 .   ? 68.921  19.113  -0.411  1.00 14.11 ? 996  HOH B O   1 
HETATM 9777  O O   . HOH K 4 .   ? 70.552  14.884  -5.158  1.00 11.05 ? 997  HOH B O   1 
HETATM 9778  O O   . HOH K 4 .   ? 62.295  21.330  12.001  1.00 4.83  ? 998  HOH B O   1 
HETATM 9779  O O   . HOH K 4 .   ? 59.377  19.272  15.179  1.00 11.67 ? 999  HOH B O   1 
HETATM 9780  O O   . HOH K 4 .   ? 57.645  26.607  6.172   1.00 12.35 ? 1000 HOH B O   1 
HETATM 9781  O O   . HOH K 4 .   ? 56.035  23.693  7.413   1.00 30.74 ? 1001 HOH B O   1 
HETATM 9782  O O   . HOH K 4 .   ? 54.972  20.793  11.534  1.00 25.71 ? 1002 HOH B O   1 
HETATM 9783  O O   . HOH K 4 .   ? 51.557  10.488  16.372  1.00 22.80 ? 1003 HOH B O   1 
HETATM 9784  O O   . HOH K 4 .   ? 51.679  15.253  12.810  1.00 18.75 ? 1004 HOH B O   1 
HETATM 9785  O O   . HOH K 4 .   ? 52.215  13.095  0.669   1.00 24.06 ? 1005 HOH B O   1 
HETATM 9786  O O   . HOH K 4 .   ? 57.089  23.639  16.631  1.00 20.09 ? 1006 HOH B O   1 
HETATM 9787  O O   . HOH K 4 .   ? 52.313  1.694   13.798  1.00 14.82 ? 1007 HOH B O   1 
HETATM 9788  O O   . HOH K 4 .   ? 52.332  -0.280  16.296  1.00 38.67 ? 1008 HOH B O   1 
HETATM 9789  O O   . HOH K 4 .   ? 54.032  -0.592  6.044   1.00 14.92 ? 1009 HOH B O   1 
HETATM 9790  O O   . HOH K 4 .   ? 55.139  -3.725  4.100   1.00 6.01  ? 1010 HOH B O   1 
HETATM 9791  O O   . HOH K 4 .   ? 53.322  -2.796  9.117   1.00 31.85 ? 1011 HOH B O   1 
HETATM 9792  O O   . HOH K 4 .   ? 53.922  -6.014  12.259  1.00 37.81 ? 1012 HOH B O   1 
HETATM 9793  O O   . HOH K 4 .   ? 68.027  6.878   28.336  1.00 18.53 ? 1013 HOH B O   1 
HETATM 9794  O O   . HOH K 4 .   ? 74.431  -2.101  24.626  1.00 20.94 ? 1014 HOH B O   1 
HETATM 9795  O O   . HOH K 4 .   ? 68.182  1.550   24.242  1.00 31.50 ? 1015 HOH B O   1 
HETATM 9796  O O   . HOH K 4 .   ? 52.403  5.992   23.485  1.00 7.78  ? 1016 HOH B O   1 
HETATM 9797  O O   . HOH K 4 .   ? 50.708  6.753   14.629  1.00 22.57 ? 1017 HOH B O   1 
HETATM 9798  O O   . HOH K 4 .   ? 47.766  3.761   19.401  1.00 35.34 ? 1018 HOH B O   1 
HETATM 9799  O O   . HOH K 4 .   ? 49.700  6.483   18.458  1.00 14.12 ? 1019 HOH B O   1 
HETATM 9800  O O   . HOH K 4 .   ? 52.594  7.986   21.230  1.00 24.96 ? 1020 HOH B O   1 
HETATM 9801  O O   . HOH K 4 .   ? 53.901  11.696  20.253  1.00 20.19 ? 1021 HOH B O   1 
HETATM 9802  O O   . HOH K 4 .   ? 58.327  20.235  19.511  1.00 24.58 ? 1022 HOH B O   1 
HETATM 9803  O O   . HOH K 4 .   ? 58.544  15.417  21.805  1.00 18.82 ? 1023 HOH B O   1 
HETATM 9804  O O   . HOH K 4 .   ? 65.127  10.752  26.755  1.00 22.00 ? 1024 HOH B O   1 
HETATM 9805  O O   . HOH K 4 .   ? 72.338  3.013   24.715  1.00 20.27 ? 1025 HOH B O   1 
HETATM 9806  O O   . HOH K 4 .   ? 75.170  18.261  31.470  1.00 3.48  ? 1026 HOH B O   1 
HETATM 9807  O O   . HOH K 4 .   ? 62.535  6.960   26.483  1.00 42.20 ? 1027 HOH B O   1 
HETATM 9808  O O   . HOH K 4 .   ? 65.087  11.462  29.177  1.00 16.08 ? 1028 HOH B O   1 
HETATM 9809  O O   . HOH K 4 .   ? 68.009  19.544  32.485  1.00 18.86 ? 1029 HOH B O   1 
HETATM 9810  O O   . HOH K 4 .   ? 66.786  21.870  32.889  1.00 10.98 ? 1030 HOH B O   1 
HETATM 9811  O O   . HOH K 4 .   ? 66.820  17.991  27.536  1.00 36.63 ? 1031 HOH B O   1 
HETATM 9812  O O   . HOH K 4 .   ? 67.769  32.769  16.945  1.00 9.93  ? 1032 HOH B O   1 
HETATM 9813  O O   . HOH K 4 .   ? 69.658  35.449  14.788  1.00 39.37 ? 1033 HOH B O   1 
HETATM 9814  O O   . HOH K 4 .   ? 70.656  37.124  10.952  1.00 29.77 ? 1034 HOH B O   1 
HETATM 9815  O O   . HOH K 4 .   ? 67.079  35.112  10.708  1.00 18.42 ? 1035 HOH B O   1 
HETATM 9816  O O   . HOH K 4 .   ? 73.585  37.841  13.703  1.00 25.38 ? 1036 HOH B O   1 
HETATM 9817  O O   . HOH K 4 .   ? 76.718  35.291  16.261  1.00 19.68 ? 1037 HOH B O   1 
HETATM 9818  O O   . HOH K 4 .   ? 79.218  32.945  17.981  1.00 10.42 ? 1038 HOH B O   1 
HETATM 9819  O O   . HOH K 4 .   ? 69.989  35.257  3.932   1.00 17.10 ? 1039 HOH B O   1 
HETATM 9820  O O   . HOH K 4 .   ? 73.573  34.188  4.263   1.00 22.03 ? 1040 HOH B O   1 
HETATM 9821  O O   . HOH K 4 .   ? 76.458  32.826  5.045   1.00 12.08 ? 1041 HOH B O   1 
HETATM 9822  O O   . HOH K 4 .   ? 76.889  40.446  15.242  1.00 39.10 ? 1042 HOH B O   1 
HETATM 9823  O O   . HOH K 4 .   ? 75.123  26.254  -6.132  1.00 21.37 ? 1043 HOH B O   1 
HETATM 9824  O O   . HOH K 4 .   ? 79.420  17.625  -3.918  1.00 8.16  ? 1044 HOH B O   1 
HETATM 9825  O O   . HOH K 4 .   ? 80.775  20.587  -3.100  1.00 14.91 ? 1045 HOH B O   1 
HETATM 9826  O O   . HOH K 4 .   ? 64.133  8.754   -8.729  1.00 10.70 ? 1046 HOH B O   1 
HETATM 9827  O O   . HOH K 4 .   ? 67.241  16.866  -11.326 1.00 24.32 ? 1047 HOH B O   1 
HETATM 9828  O O   . HOH K 4 .   ? 66.856  17.957  -8.967  1.00 12.66 ? 1048 HOH B O   1 
HETATM 9829  O O   . HOH K 4 .   ? 75.456  21.137  -9.613  1.00 10.28 ? 1049 HOH B O   1 
HETATM 9830  O O   . HOH K 4 .   ? 71.376  5.651   -12.456 1.00 17.15 ? 1050 HOH B O   1 
HETATM 9831  O O   . HOH K 4 .   ? 73.361  -8.971  -12.304 1.00 23.46 ? 1051 HOH B O   1 
HETATM 9832  O O   . HOH K 4 .   ? 84.089  8.114   -14.557 1.00 36.20 ? 1052 HOH B O   1 
HETATM 9833  O O   . HOH K 4 .   ? 69.263  31.747  -0.162  1.00 14.01 ? 1053 HOH B O   1 
HETATM 9834  O O   . HOH K 4 .   ? 67.442  31.640  -2.648  1.00 37.02 ? 1054 HOH B O   1 
HETATM 9835  O O   . HOH K 4 .   ? 63.037  28.089  -3.088  1.00 28.21 ? 1055 HOH B O   1 
HETATM 9836  O O   . HOH K 4 .   ? 63.375  34.265  13.565  1.00 23.35 ? 1056 HOH B O   1 
HETATM 9837  O O   . HOH K 4 .   ? 61.002  34.683  9.819   1.00 23.25 ? 1057 HOH B O   1 
HETATM 9838  O O   . HOH K 4 .   ? 62.021  18.644  -3.274  1.00 15.15 ? 1058 HOH B O   1 
HETATM 9839  O O   . HOH K 4 .   ? 81.792  18.341  -2.314  1.00 18.87 ? 1059 HOH B O   1 
HETATM 9840  O O   . HOH K 4 .   ? 86.058  20.652  2.847   1.00 10.30 ? 1060 HOH B O   1 
HETATM 9841  O O   . HOH K 4 .   ? 82.736  17.075  0.253   1.00 12.70 ? 1061 HOH B O   1 
HETATM 9842  O O   . HOH K 4 .   ? 81.879  16.059  12.424  1.00 3.36  ? 1062 HOH B O   1 
HETATM 9843  O O   . HOH K 4 .   ? 81.087  34.183  27.518  1.00 10.25 ? 1063 HOH B O   1 
HETATM 9844  O O   . HOH K 4 .   ? 82.725  36.525  29.546  1.00 2.55  ? 1064 HOH B O   1 
HETATM 9845  O O   . HOH K 4 .   ? 81.956  35.158  22.411  1.00 18.69 ? 1065 HOH B O   1 
HETATM 9846  O O   . HOH K 4 .   ? 77.213  24.680  35.223  1.00 2.29  ? 1066 HOH B O   1 
HETATM 9847  O O   . HOH K 4 .   ? 72.896  28.812  35.260  1.00 19.39 ? 1067 HOH B O   1 
HETATM 9848  O O   . HOH K 4 .   ? 82.403  36.720  34.060  1.00 18.02 ? 1068 HOH B O   1 
HETATM 9849  O O   . HOH K 4 .   ? 76.899  22.536  37.867  1.00 20.36 ? 1069 HOH B O   1 
HETATM 9850  O O   . HOH K 4 .   ? 76.958  27.311  36.909  1.00 15.17 ? 1070 HOH B O   1 
HETATM 9851  O O   . HOH K 4 .   ? 81.678  20.171  39.225  1.00 10.08 ? 1071 HOH B O   1 
HETATM 9852  O O   . HOH K 4 .   ? 79.617  21.370  36.977  1.00 8.30  ? 1072 HOH B O   1 
HETATM 9853  O O   . HOH K 4 .   ? 84.186  23.493  34.007  1.00 19.88 ? 1073 HOH B O   1 
HETATM 9854  O O   . HOH K 4 .   ? 85.939  26.803  44.202  1.00 10.76 ? 1074 HOH B O   1 
HETATM 9855  O O   . HOH K 4 .   ? 87.186  24.277  44.322  1.00 8.66  ? 1075 HOH B O   1 
HETATM 9856  O O   . HOH K 4 .   ? 82.764  22.614  38.658  1.00 14.89 ? 1076 HOH B O   1 
HETATM 9857  O O   . HOH K 4 .   ? 81.570  34.162  43.475  1.00 25.13 ? 1077 HOH B O   1 
HETATM 9858  O O   . HOH K 4 .   ? 82.930  39.234  42.616  1.00 16.54 ? 1078 HOH B O   1 
HETATM 9859  O O   . HOH K 4 .   ? 88.550  39.048  46.514  1.00 21.28 ? 1079 HOH B O   1 
HETATM 9860  O O   . HOH K 4 .   ? 112.005 34.510  41.271  1.00 12.69 ? 1080 HOH B O   1 
HETATM 9861  O O   . HOH K 4 .   ? 59.965  6.832   -19.633 1.00 34.29 ? 1081 HOH B O   1 
HETATM 9862  O O   . HOH K 4 .   ? 56.936  31.494  15.477  1.00 23.36 ? 1082 HOH B O   1 
HETATM 9863  O O   . HOH K 4 .   ? 57.262  21.363  22.046  1.00 42.58 ? 1083 HOH B O   1 
HETATM 9864  O O   . HOH K 4 .   ? 56.198  23.257  20.806  1.00 16.59 ? 1084 HOH B O   1 
HETATM 9865  O O   . HOH K 4 .   ? 70.881  19.346  33.496  1.00 15.06 ? 1085 HOH B O   1 
HETATM 9866  O O   . HOH K 4 .   ? 97.856  18.176  42.188  1.00 27.23 ? 1086 HOH B O   1 
HETATM 9867  O O   . HOH K 4 .   ? 89.767  18.305  44.838  1.00 18.03 ? 1087 HOH B O   1 
HETATM 9868  O O   . HOH K 4 .   ? 69.857  11.390  36.211  1.00 24.31 ? 1088 HOH B O   1 
HETATM 9869  O O   . HOH K 4 .   ? 67.775  14.028  31.952  1.00 21.93 ? 1089 HOH B O   1 
HETATM 9870  O O   . HOH K 4 .   ? 71.357  3.980   31.201  1.00 21.08 ? 1090 HOH B O   1 
HETATM 9871  O O   . HOH K 4 .   ? 76.097  14.060  40.941  1.00 8.83  ? 1091 HOH B O   1 
HETATM 9872  O O   . HOH K 4 .   ? 79.944  15.661  46.075  1.00 20.49 ? 1092 HOH B O   1 
HETATM 9873  O O   . HOH K 4 .   ? 83.271  18.641  45.492  1.00 34.95 ? 1093 HOH B O   1 
HETATM 9874  O O   . HOH K 4 .   ? 77.716  18.469  42.960  1.00 25.08 ? 1094 HOH B O   1 
HETATM 9875  O O   . HOH K 4 .   ? 71.122  12.529  39.379  1.00 21.56 ? 1095 HOH B O   1 
HETATM 9876  O O   . HOH K 4 .   ? 71.483  4.092   35.075  1.00 28.47 ? 1096 HOH B O   1 
HETATM 9877  O O   . HOH K 4 .   ? 77.714  5.462   47.230  1.00 26.31 ? 1097 HOH B O   1 
HETATM 9878  O O   . HOH K 4 .   ? 73.484  13.488  41.005  1.00 20.59 ? 1098 HOH B O   1 
HETATM 9879  O O   . HOH K 4 .   ? 71.626  5.868   38.129  1.00 13.77 ? 1099 HOH B O   1 
HETATM 9880  O O   . HOH K 4 .   ? 120.171 33.129  30.902  1.00 10.69 ? 1100 HOH B O   1 
HETATM 9881  O O   . HOH K 4 .   ? 53.761  14.728  19.917  1.00 22.64 ? 1101 HOH B O   1 
HETATM 9882  O O   . HOH K 4 .   ? 61.764  -12.020 -5.525  1.00 23.72 ? 1102 HOH B O   1 
HETATM 9883  O O   . HOH K 4 .   ? 80.201  24.919  -1.187  1.00 12.13 ? 1103 HOH B O   1 
HETATM 9884  O O   . HOH K 4 .   ? 78.599  41.857  11.755  1.00 26.31 ? 1104 HOH B O   1 
HETATM 9885  O O   . HOH K 4 .   ? 53.259  3.763   -3.170  1.00 26.59 ? 1105 HOH B O   1 
HETATM 9886  O O   . HOH K 4 .   ? 59.461  4.937   -11.422 1.00 13.34 ? 1106 HOH B O   1 
HETATM 9887  O O   . HOH K 4 .   ? 67.390  34.602  6.888   1.00 22.90 ? 1107 HOH B O   1 
HETATM 9888  O O   . HOH K 4 .   ? 74.701  37.359  8.890   1.00 29.18 ? 1108 HOH B O   1 
HETATM 9889  O O   . HOH K 4 .   ? 76.436  33.196  17.934  1.00 16.81 ? 1109 HOH B O   1 
HETATM 9890  O O   . HOH K 4 .   ? 66.064  34.781  13.478  1.00 28.26 ? 1110 HOH B O   1 
HETATM 9891  O O   . HOH K 4 .   ? 74.490  36.817  15.775  1.00 22.69 ? 1111 HOH B O   1 
HETATM 9892  O O   . HOH K 4 .   ? 78.987  39.942  17.029  1.00 23.05 ? 1112 HOH B O   1 
HETATM 9893  O O   . HOH K 4 .   ? 120.578 27.621  31.578  1.00 19.88 ? 1113 HOH B O   1 
HETATM 9894  O O   . HOH K 4 .   ? 125.474 25.628  39.258  1.00 4.84  ? 1114 HOH B O   1 
HETATM 9895  O O   . HOH K 4 .   ? 122.016 30.006  28.673  1.00 30.81 ? 1115 HOH B O   1 
HETATM 9896  O O   . HOH K 4 .   ? 57.418  28.589  25.135  1.00 3.69  ? 1116 HOH B O   1 
HETATM 9897  O O   . HOH K 4 .   ? 103.792 22.299  43.292  1.00 29.51 ? 1117 HOH B O   1 
HETATM 9898  O O   . HOH K 4 .   ? 112.801 25.758  43.385  1.00 13.33 ? 1118 HOH B O   1 
HETATM 9899  O O   . HOH K 4 .   ? 113.159 24.210  45.627  1.00 12.48 ? 1119 HOH B O   1 
HETATM 9900  O O   . HOH K 4 .   ? 114.050 13.122  42.987  1.00 23.59 ? 1120 HOH B O   1 
HETATM 9901  O O   . HOH K 4 .   ? 103.358 4.668   40.386  1.00 10.54 ? 1121 HOH B O   1 
HETATM 9902  O O   . HOH K 4 .   ? 104.355 8.706   42.919  1.00 43.69 ? 1122 HOH B O   1 
HETATM 9903  O O   . HOH K 4 .   ? 96.541  7.037   40.613  1.00 17.95 ? 1123 HOH B O   1 
HETATM 9904  O O   . HOH K 4 .   ? 96.682  2.825   40.491  1.00 21.54 ? 1124 HOH B O   1 
HETATM 9905  O O   . HOH K 4 .   ? 88.926  -1.669  38.662  1.00 36.21 ? 1125 HOH B O   1 
HETATM 9906  O O   . HOH K 4 .   ? 80.164  -1.553  27.716  1.00 25.24 ? 1126 HOH B O   1 
HETATM 9907  O O   . HOH K 4 .   ? 84.694  -14.323 15.353  1.00 17.56 ? 1127 HOH B O   1 
HETATM 9908  O O   . HOH K 4 .   ? 73.326  -18.134 9.992   1.00 19.40 ? 1128 HOH B O   1 
HETATM 9909  O O   . HOH K 4 .   ? 78.700  -18.010 10.848  1.00 19.93 ? 1129 HOH B O   1 
HETATM 9910  O O   . HOH K 4 .   ? 76.726  -16.989 12.511  1.00 22.65 ? 1130 HOH B O   1 
HETATM 9911  O O   . HOH K 4 .   ? 73.761  -17.009 6.215   1.00 26.53 ? 1131 HOH B O   1 
HETATM 9912  O O   . HOH K 4 .   ? 90.042  -15.135 4.964   1.00 26.84 ? 1132 HOH B O   1 
HETATM 9913  O O   . HOH K 4 .   ? 87.193  -17.171 2.175   1.00 19.75 ? 1133 HOH B O   1 
HETATM 9914  O O   . HOH K 4 .   ? 83.151  -14.635 -1.766  1.00 32.51 ? 1134 HOH B O   1 
HETATM 9915  O O   . HOH K 4 .   ? 78.139  -17.475 -6.504  1.00 29.09 ? 1135 HOH B O   1 
HETATM 9916  O O   . HOH K 4 .   ? 77.095  -17.151 -3.345  1.00 28.48 ? 1136 HOH B O   1 
HETATM 9917  O O   . HOH K 4 .   ? 96.171  -13.854 -0.440  1.00 33.58 ? 1137 HOH B O   1 
HETATM 9918  O O   . HOH K 4 .   ? 103.653 -2.428  13.556  1.00 25.32 ? 1138 HOH B O   1 
HETATM 9919  O O   . HOH K 4 .   ? 100.455 -1.753  19.856  1.00 14.80 ? 1139 HOH B O   1 
HETATM 9920  O O   . HOH K 4 .   ? 105.895 -3.582  10.313  1.00 24.08 ? 1140 HOH B O   1 
HETATM 9921  O O   . HOH K 4 .   ? 102.524 -9.663  1.602   1.00 28.25 ? 1141 HOH B O   1 
HETATM 9922  O O   . HOH K 4 .   ? 103.846 -10.853 3.891   1.00 45.93 ? 1142 HOH B O   1 
HETATM 9923  O O   . HOH K 4 .   ? 96.634  -1.101  -9.603  1.00 21.96 ? 1143 HOH B O   1 
HETATM 9924  O O   . HOH K 4 .   ? 90.403  3.911   -9.041  1.00 19.42 ? 1144 HOH B O   1 
HETATM 9925  O O   . HOH K 4 .   ? 87.633  -6.388  -9.716  1.00 22.99 ? 1145 HOH B O   1 
HETATM 9926  O O   . HOH K 4 .   ? 85.338  -0.718  -12.275 1.00 25.62 ? 1146 HOH B O   1 
HETATM 9927  O O   . HOH K 4 .   ? 81.101  -2.219  -12.932 1.00 13.85 ? 1147 HOH B O   1 
HETATM 9928  O O   . HOH K 4 .   ? 82.909  -6.692  -14.071 1.00 44.68 ? 1148 HOH B O   1 
HETATM 9929  O O   . HOH K 4 .   ? 96.791  3.912   -11.919 1.00 32.40 ? 1149 HOH B O   1 
HETATM 9930  O O   . HOH K 4 .   ? 87.210  10.965  -9.809  1.00 29.26 ? 1150 HOH B O   1 
HETATM 9931  O O   . HOH K 4 .   ? 78.053  0.750   30.155  1.00 16.74 ? 1151 HOH B O   1 
HETATM 9932  O O   . HOH K 4 .   ? 75.127  -6.713  20.257  1.00 26.05 ? 1152 HOH B O   1 
HETATM 9933  O O   . HOH K 4 .   ? 73.966  -8.545  18.927  1.00 31.54 ? 1153 HOH B O   1 
HETATM 9934  O O   . HOH K 4 .   ? 73.542  -3.456  21.665  1.00 37.71 ? 1154 HOH B O   1 
HETATM 9935  O O   . HOH K 4 .   ? 70.817  -0.986  22.536  1.00 32.36 ? 1155 HOH B O   1 
HETATM 9936  O O   . HOH K 4 .   ? 53.031  17.200  3.356   1.00 13.14 ? 1156 HOH B O   1 
HETATM 9937  O O   . HOH K 4 .   ? 51.751  17.583  11.291  1.00 22.89 ? 1157 HOH B O   1 
HETATM 9938  O O   . HOH K 4 .   ? 49.515  13.846  12.383  1.00 17.25 ? 1158 HOH B O   1 
HETATM 9939  O O   . HOH K 4 .   ? 56.208  21.682  18.522  1.00 41.28 ? 1159 HOH B O   1 
HETATM 9940  O O   . HOH K 4 .   ? 59.242  21.108  17.067  1.00 26.48 ? 1160 HOH B O   1 
HETATM 9941  O O   . HOH K 4 .   ? 52.456  19.897  12.467  1.00 24.93 ? 1161 HOH B O   1 
HETATM 9942  O O   . HOH K 4 .   ? 52.450  19.928  15.278  1.00 20.92 ? 1162 HOH B O   1 
HETATM 9943  O O   . HOH K 4 .   ? 55.598  17.504  17.455  1.00 15.07 ? 1163 HOH B O   1 
HETATM 9944  O O   . HOH K 4 .   ? 54.800  9.698   -1.623  1.00 26.40 ? 1164 HOH B O   1 
HETATM 9945  O O   . HOH K 4 .   ? 50.094  5.687   9.857   1.00 11.75 ? 1165 HOH B O   1 
HETATM 9946  O O   . HOH K 4 .   ? 52.943  -0.296  12.125  1.00 12.09 ? 1166 HOH B O   1 
HETATM 9947  O O   . HOH K 4 .   ? 56.282  -1.220  17.537  1.00 18.37 ? 1167 HOH B O   1 
HETATM 9948  O O   . HOH K 4 .   ? 54.241  -2.459  21.270  1.00 15.29 ? 1168 HOH B O   1 
HETATM 9949  O O   . HOH K 4 .   ? 55.824  -6.498  15.371  1.00 34.71 ? 1169 HOH B O   1 
HETATM 9950  O O   . HOH K 4 .   ? 56.164  -11.825 11.403  1.00 38.52 ? 1170 HOH B O   1 
HETATM 9951  O O   . HOH K 4 .   ? 57.051  -9.191  6.345   1.00 30.02 ? 1171 HOH B O   1 
HETATM 9952  O O   . HOH K 4 .   ? 65.995  3.957   24.984  1.00 10.33 ? 1172 HOH B O   1 
HETATM 9953  O O   . HOH K 4 .   ? 60.191  3.611   24.677  1.00 37.53 ? 1173 HOH B O   1 
HETATM 9954  O O   . HOH K 4 .   ? 54.630  19.912  16.905  1.00 32.03 ? 1174 HOH B O   1 
HETATM 9955  O O   . HOH K 4 .   ? 83.205  40.762  17.323  1.00 17.78 ? 1175 HOH B O   1 
HETATM 9956  O O   . HOH K 4 .   ? 79.498  35.779  6.604   1.00 27.28 ? 1176 HOH B O   1 
HETATM 9957  O O   . HOH K 4 .   ? 73.672  33.045  2.084   1.00 15.34 ? 1177 HOH B O   1 
HETATM 9958  O O   . HOH K 4 .   ? 71.547  33.494  0.467   1.00 17.74 ? 1178 HOH B O   1 
HETATM 9959  O O   . HOH K 4 .   ? 71.494  31.655  -2.963  1.00 20.66 ? 1179 HOH B O   1 
HETATM 9960  O O   . HOH K 4 .   ? 61.715  18.582  -5.829  1.00 22.93 ? 1180 HOH B O   1 
HETATM 9961  O O   . HOH K 4 .   ? 65.628  22.976  -5.760  1.00 24.30 ? 1181 HOH B O   1 
HETATM 9962  O O   . HOH K 4 .   ? 62.531  25.998  -4.708  1.00 39.98 ? 1182 HOH B O   1 
HETATM 9963  O O   . HOH K 4 .   ? 64.085  17.379  -9.032  1.00 29.84 ? 1183 HOH B O   1 
HETATM 9964  O O   . HOH K 4 .   ? 68.152  22.370  -7.067  1.00 19.73 ? 1184 HOH B O   1 
HETATM 9965  O O   . HOH K 4 .   ? 67.393  20.476  -9.440  1.00 19.31 ? 1185 HOH B O   1 
HETATM 9966  O O   . HOH K 4 .   ? 62.343  10.260  -7.481  1.00 27.25 ? 1186 HOH B O   1 
HETATM 9967  O O   . HOH K 4 .   ? 60.192  8.727   -8.029  1.00 24.98 ? 1187 HOH B O   1 
HETATM 9968  O O   . HOH K 4 .   ? 72.198  -3.692  -15.464 1.00 38.12 ? 1188 HOH B O   1 
HETATM 9969  O O   . HOH K 4 .   ? 84.549  12.947  -8.103  1.00 32.28 ? 1189 HOH B O   1 
HETATM 9970  O O   . HOH K 4 .   ? 77.288  19.383  -10.371 1.00 35.05 ? 1190 HOH B O   1 
HETATM 9971  O O   . HOH K 4 .   ? 66.606  26.001  -6.593  1.00 27.47 ? 1191 HOH B O   1 
HETATM 9972  O O   . HOH K 4 .   ? 71.219  31.799  27.713  1.00 15.78 ? 1192 HOH B O   1 
HETATM 9973  O O   . HOH K 4 .   ? 128.458 24.460  37.076  1.00 24.12 ? 1193 HOH B O   1 
HETATM 9974  O O   . HOH K 4 .   ? 75.229  31.167  32.501  1.00 9.33  ? 1194 HOH B O   1 
HETATM 9975  O O   . HOH K 4 .   ? 124.739 23.003  39.480  1.00 15.66 ? 1195 HOH B O   1 
HETATM 9976  O O   . HOH K 4 .   ? 75.206  30.776  35.181  1.00 21.84 ? 1196 HOH B O   1 
HETATM 9977  O O   . HOH K 4 .   ? 74.682  34.039  31.675  1.00 19.65 ? 1197 HOH B O   1 
HETATM 9978  O O   . HOH K 4 .   ? 81.313  35.925  25.509  1.00 20.37 ? 1198 HOH B O   1 
HETATM 9979  O O   . HOH K 4 .   ? 80.052  35.200  35.527  1.00 20.21 ? 1199 HOH B O   1 
HETATM 9980  O O   . HOH K 4 .   ? 81.232  24.834  39.250  1.00 15.89 ? 1200 HOH B O   1 
HETATM 9981  O O   . HOH K 4 .   ? 81.392  20.197  43.991  1.00 21.78 ? 1201 HOH B O   1 
HETATM 9982  O O   . HOH K 4 .   ? 79.346  20.612  40.075  1.00 17.65 ? 1202 HOH B O   1 
HETATM 9983  O O   . HOH K 4 .   ? 84.201  23.406  42.357  1.00 27.81 ? 1203 HOH B O   1 
HETATM 9984  O O   . HOH K 4 .   ? 77.218  30.087  36.626  1.00 17.52 ? 1204 HOH B O   1 
HETATM 9985  O O   . HOH K 4 .   ? 76.683  26.669  39.392  1.00 45.20 ? 1205 HOH B O   1 
HETATM 9986  O O   . HOH K 4 .   ? 65.561  -15.648 -1.452  1.00 28.30 ? 1206 HOH B O   1 
HETATM 9987  O O   . HOH K 4 .   ? 67.147  -15.733 0.687   1.00 10.42 ? 1207 HOH B O   1 
HETATM 9988  O O   . HOH K 4 .   ? 67.249  -18.307 -7.489  1.00 34.40 ? 1208 HOH B O   1 
HETATM 9989  O O   . HOH K 4 .   ? 67.395  -15.447 -11.076 1.00 34.17 ? 1209 HOH B O   1 
HETATM 9990  O O   . HOH K 4 .   ? 63.862  -16.610 6.563   1.00 34.58 ? 1210 HOH B O   1 
HETATM 9991  O O   . HOH K 4 .   ? 61.092  -14.453 0.562   1.00 22.57 ? 1211 HOH B O   1 
HETATM 9992  O O   . HOH K 4 .   ? 62.725  -16.562 1.378   1.00 20.86 ? 1212 HOH B O   1 
HETATM 9993  O O   . HOH K 4 .   ? 85.229  13.401  5.921   1.00 47.82 ? 1213 HOH B O   1 
HETATM 9994  O O   . HOH K 4 .   ? 72.615  -18.732 2.700   1.00 33.33 ? 1214 HOH B O   1 
HETATM 9995  O O   . HOH K 4 .   ? 52.467  -2.198  0.773   1.00 24.02 ? 1215 HOH B O   1 
HETATM 9996  O O   . HOH K 4 .   ? 64.504  6.898   -15.807 1.00 21.88 ? 1216 HOH B O   1 
HETATM 9997  O O   . HOH K 4 .   ? 71.200  8.551   -13.028 1.00 18.82 ? 1217 HOH B O   1 
HETATM 9998  O O   . HOH K 4 .   ? 72.531  9.146   -10.790 1.00 19.89 ? 1218 HOH B O   1 
HETATM 9999  O O   . HOH K 4 .   ? 62.454  -0.050  -18.957 1.00 11.22 ? 1219 HOH B O   1 
HETATM 10000 O O   . HOH K 4 .   ? 68.216  1.663   -16.833 1.00 30.51 ? 1220 HOH B O   1 
HETATM 10001 O O   . HOH K 4 .   ? 75.324  8.489   -11.155 1.00 29.08 ? 1221 HOH B O   1 
HETATM 10002 O O   . HOH K 4 .   ? 76.557  10.838  -12.920 1.00 20.77 ? 1222 HOH B O   1 
HETATM 10003 O O   . HOH K 4 .   ? 70.777  20.982  35.616  1.00 26.94 ? 1223 HOH B O   1 
HETATM 10004 O O   . HOH K 4 .   ? 72.164  21.625  38.289  1.00 35.14 ? 1224 HOH B O   1 
HETATM 10005 O O   . HOH K 4 .   ? 70.071  28.659  36.067  1.00 25.49 ? 1225 HOH B O   1 
HETATM 10006 O O   . HOH K 4 .   ? 124.237 27.288  30.876  1.00 20.89 ? 1226 HOH B O   1 
HETATM 10007 O O   . HOH K 4 .   ? 62.831  32.216  19.658  1.00 24.24 ? 1227 HOH B O   1 
HETATM 10008 O O   . HOH K 4 .   ? 59.214  27.713  2.759   1.00 38.62 ? 1228 HOH B O   1 
HETATM 10009 O O   . HOH K 4 .   ? 60.861  31.393  2.732   1.00 21.89 ? 1229 HOH B O   1 
HETATM 10010 O O   . HOH K 4 .   ? 61.873  33.793  1.458   1.00 27.45 ? 1230 HOH B O   1 
HETATM 10011 O O   . HOH K 4 .   ? 63.152  36.236  8.736   1.00 29.07 ? 1231 HOH B O   1 
HETATM 10012 O O   . HOH K 4 .   ? 94.653  16.946  44.075  1.00 24.93 ? 1232 HOH B O   1 
HETATM 10013 O O   . HOH K 4 .   ? 93.720  19.653  44.105  1.00 25.18 ? 1233 HOH B O   1 
HETATM 10014 O O   . HOH K 4 .   ? 91.392  15.149  46.360  1.00 20.45 ? 1234 HOH B O   1 
HETATM 10015 O O   . HOH K 4 .   ? 69.495  8.570   36.123  1.00 21.51 ? 1235 HOH B O   1 
HETATM 10016 O O   . HOH K 4 .   ? 69.879  16.880  37.768  1.00 35.21 ? 1236 HOH B O   1 
HETATM 10017 O O   . HOH K 4 .   ? 76.550  14.306  43.664  1.00 12.21 ? 1237 HOH B O   1 
HETATM 10018 O O   . HOH K 4 .   ? 73.362  5.351   40.072  1.00 16.46 ? 1238 HOH B O   1 
HETATM 10019 O O   . HOH K 4 .   ? 114.750 23.408  47.889  1.00 25.07 ? 1239 HOH B O   1 
HETATM 10020 O O   . HOH K 4 .   ? 97.260  20.032  44.823  1.00 39.58 ? 1240 HOH B O   1 
HETATM 10021 O O   . HOH K 4 .   ? 89.705  25.894  47.724  1.00 21.62 ? 1241 HOH B O   1 
HETATM 10022 O O   . HOH K 4 .   ? 87.963  24.005  46.928  1.00 24.51 ? 1242 HOH B O   1 
HETATM 10023 O O   . HOH K 4 .   ? 82.411  33.792  40.965  1.00 24.05 ? 1243 HOH B O   1 
HETATM 10024 O O   . HOH K 4 .   ? 80.832  23.175  -4.855  1.00 24.98 ? 1244 HOH B O   1 
HETATM 10025 O O   . HOH K 4 .   ? 112.881 9.687   38.341  1.00 21.42 ? 1245 HOH B O   1 
HETATM 10026 O O   . HOH K 4 .   ? 107.728 5.996   39.562  1.00 30.84 ? 1246 HOH B O   1 
HETATM 10027 O O   . HOH K 4 .   ? 105.373 2.012   39.835  1.00 42.46 ? 1247 HOH B O   1 
HETATM 10028 O O   . HOH K 4 .   ? 100.355 -2.208  38.991  1.00 26.78 ? 1248 HOH B O   1 
HETATM 10029 O O   . HOH K 4 .   ? 76.604  -11.678 19.240  1.00 24.15 ? 1249 HOH B O   1 
HETATM 10030 O O   . HOH K 4 .   ? 73.926  -15.746 15.386  1.00 38.62 ? 1250 HOH B O   1 
HETATM 10031 O O   . HOH K 4 .   ? 79.525  -5.506  25.030  1.00 28.10 ? 1251 HOH B O   1 
HETATM 10032 O O   . HOH K 4 .   ? 81.647  -7.419  24.158  1.00 21.76 ? 1252 HOH B O   1 
HETATM 10033 O O   . HOH K 4 .   ? 79.713  -9.402  24.331  1.00 38.08 ? 1253 HOH B O   1 
HETATM 10034 O O   . HOH K 4 .   ? 82.594  -12.904 -12.362 1.00 28.49 ? 1254 HOH B O   1 
HETATM 10035 O O   . HOH K 4 .   ? 83.293  -15.692 -6.434  1.00 36.69 ? 1255 HOH B O   1 
HETATM 10036 O O   . HOH K 4 .   ? 86.944  -16.181 -4.744  1.00 43.73 ? 1256 HOH B O   1 
HETATM 10037 O O   . HOH K 4 .   ? 73.699  -16.302 -9.596  1.00 28.31 ? 1257 HOH B O   1 
HETATM 10038 O O   . HOH K 4 .   ? 75.934  -9.458  -12.164 1.00 25.57 ? 1258 HOH B O   1 
HETATM 10039 O O   . HOH K 4 .   ? 76.811  -7.723  -14.555 1.00 32.96 ? 1259 HOH B O   1 
HETATM 10040 O O   . HOH K 4 .   ? 93.335  -7.094  -8.989  1.00 25.23 ? 1260 HOH B O   1 
HETATM 10041 O O   . HOH K 4 .   ? 89.301  -15.380 2.586   1.00 27.15 ? 1261 HOH B O   1 
HETATM 10042 O O   . HOH K 4 .   ? 93.819  -17.618 3.157   1.00 37.80 ? 1262 HOH B O   1 
HETATM 10043 O O   . HOH K 4 .   ? 97.339  -15.053 3.857   1.00 41.46 ? 1263 HOH B O   1 
HETATM 10044 O O   . HOH K 4 .   ? 97.400  -13.153 1.952   1.00 33.39 ? 1264 HOH B O   1 
HETATM 10045 O O   . HOH K 4 .   ? 99.626  -10.068 1.210   1.00 28.74 ? 1265 HOH B O   1 
HETATM 10046 O O   . HOH K 4 .   ? 100.412 -12.786 9.589   1.00 30.23 ? 1266 HOH B O   1 
HETATM 10047 O O   . HOH K 4 .   ? 93.402  6.260   -14.551 1.00 43.95 ? 1267 HOH B O   1 
HETATM 10048 O O   . HOH K 4 .   ? 89.877  0.301   -15.621 1.00 32.50 ? 1268 HOH B O   1 
HETATM 10049 O O   . HOH K 4 .   ? 88.098  -2.653  -12.597 1.00 41.95 ? 1269 HOH B O   1 
HETATM 10050 O O   . HOH K 4 .   ? 90.141  12.658  -7.876  1.00 32.49 ? 1270 HOH B O   1 
HETATM 10051 O O   . HOH K 4 .   ? 81.997  -3.521  30.236  1.00 26.86 ? 1271 HOH B O   1 
HETATM 10052 O O   . HOH K 4 .   ? 71.687  -4.208  18.556  1.00 36.32 ? 1272 HOH B O   1 
HETATM 10053 O O   . HOH K 4 .   ? 63.999  -8.422  17.620  1.00 35.10 ? 1273 HOH B O   1 
HETATM 10054 O O   . HOH K 4 .   ? 65.667  -13.197 17.165  1.00 27.26 ? 1274 HOH B O   1 
HETATM 10055 O O   . HOH K 4 .   ? 69.129  -13.478 15.493  1.00 28.86 ? 1275 HOH B O   1 
HETATM 10056 O O   . HOH K 4 .   ? 67.893  -11.723 17.176  1.00 25.73 ? 1276 HOH B O   1 
HETATM 10057 O O   . HOH K 4 .   ? 64.964  -14.542 14.911  1.00 29.31 ? 1277 HOH B O   1 
HETATM 10058 O O   . HOH K 4 .   ? 61.860  -16.178 12.574  1.00 40.51 ? 1278 HOH B O   1 
HETATM 10059 O O   . HOH K 4 .   ? 60.151  -13.832 10.111  1.00 28.33 ? 1279 HOH B O   1 
HETATM 10060 O O   . HOH K 4 .   ? 57.268  -11.486 14.264  1.00 38.09 ? 1280 HOH B O   1 
HETATM 10061 O O   . HOH K 4 .   ? 58.987  17.293  -0.636  1.00 39.17 ? 1281 HOH B O   1 
HETATM 10062 O O   . HOH K 4 .   ? 55.744  27.940  10.370  1.00 27.99 ? 1282 HOH B O   1 
HETATM 10063 O O   . HOH K 4 .   ? 51.424  12.062  11.451  1.00 33.20 ? 1283 HOH B O   1 
HETATM 10064 O O   . HOH K 4 .   ? 50.209  8.658   4.011   1.00 31.92 ? 1284 HOH B O   1 
HETATM 10065 O O   . HOH K 4 .   ? 50.928  4.967   1.240   1.00 28.04 ? 1285 HOH B O   1 
HETATM 10066 O O   . HOH K 4 .   ? 59.245  -7.113  18.329  1.00 36.74 ? 1286 HOH B O   1 
HETATM 10067 O O   . HOH K 4 .   ? 64.459  2.826   23.092  1.00 26.31 ? 1287 HOH B O   1 
HETATM 10068 O O   . HOH K 4 .   ? 62.431  1.439   24.012  1.00 22.52 ? 1288 HOH B O   1 
HETATM 10069 O O   . HOH K 4 .   ? 64.550  5.076   26.948  1.00 30.92 ? 1289 HOH B O   1 
HETATM 10070 O O   . HOH K 4 .   ? 68.764  3.970   29.296  1.00 28.86 ? 1290 HOH B O   1 
HETATM 10071 O O   . HOH K 4 .   ? 52.162  8.119   17.405  1.00 36.18 ? 1291 HOH B O   1 
HETATM 10072 O O   . HOH K 4 .   ? 58.242  17.530  16.821  1.00 30.85 ? 1292 HOH B O   1 
HETATM 10073 O O   . HOH K 4 .   ? 57.276  17.529  19.488  1.00 29.24 ? 1293 HOH B O   1 
HETATM 10074 O O   . HOH K 4 .   ? 73.130  33.489  17.716  1.00 35.10 ? 1294 HOH B O   1 
HETATM 10075 O O   . HOH K 4 .   ? 71.323  34.699  19.222  1.00 30.79 ? 1295 HOH B O   1 
HETATM 10076 O O   . HOH K 4 .   ? 75.403  35.619  21.136  1.00 33.23 ? 1296 HOH B O   1 
HETATM 10077 O O   . HOH K 4 .   ? 65.572  12.576  -10.749 1.00 31.72 ? 1297 HOH B O   1 
HETATM 10078 O O   . HOH K 4 .   ? 64.264  10.402  -10.844 1.00 27.57 ? 1298 HOH B O   1 
HETATM 10079 O O   . HOH K 4 .   ? 79.998  2.154   -14.361 1.00 25.17 ? 1299 HOH B O   1 
HETATM 10080 O O   . HOH K 4 .   ? 76.202  14.949  -11.696 1.00 28.40 ? 1300 HOH B O   1 
HETATM 10081 O O   . HOH K 4 .   ? 83.868  15.298  -3.816  1.00 36.46 ? 1301 HOH B O   1 
HETATM 10082 O O   . HOH K 4 .   ? 80.300  20.781  -8.219  1.00 33.38 ? 1302 HOH B O   1 
HETATM 10083 O O   . HOH K 4 .   ? 75.175  36.690  25.934  1.00 32.54 ? 1303 HOH B O   1 
HETATM 10084 O O   . HOH K 4 .   ? 79.886  36.224  29.210  1.00 36.87 ? 1304 HOH B O   1 
HETATM 10085 O O   . HOH K 4 .   ? 78.310  35.756  33.404  1.00 26.24 ? 1305 HOH B O   1 
HETATM 10086 O O   . HOH K 4 .   ? 78.840  32.024  37.197  1.00 26.93 ? 1306 HOH B O   1 
HETATM 10087 O O   . HOH K 4 .   ? 79.935  33.560  39.440  1.00 22.55 ? 1307 HOH B O   1 
HETATM 10088 O O   . HOH K 4 .   ? 83.470  25.163  44.094  1.00 24.34 ? 1308 HOH B O   1 
HETATM 10089 O O   . HOH K 4 .   ? 54.517  -6.524  3.735   1.00 27.40 ? 1309 HOH B O   1 
HETATM 10090 O O   . HOH K 4 .   ? 73.513  5.595   -14.801 1.00 22.21 ? 1310 HOH B O   1 
HETATM 10091 O O   . HOH K 4 .   ? 72.801  11.761  -11.980 1.00 27.93 ? 1311 HOH B O   1 
HETATM 10092 O O   . HOH K 4 .   ? 62.804  3.714   -21.489 1.00 44.01 ? 1312 HOH B O   1 
HETATM 10093 O O   . HOH K 4 .   ? 69.459  14.233  37.489  1.00 33.43 ? 1313 HOH B O   1 
HETATM 10094 O O   . HOH K 4 .   ? 66.658  17.370  33.437  1.00 39.43 ? 1314 HOH B O   1 
HETATM 10095 O O   . HOH K 4 .   ? 72.655  31.036  33.527  1.00 35.18 ? 1315 HOH B O   1 
HETATM 10096 O O   . HOH K 4 .   ? 127.103 22.203  36.335  1.00 28.30 ? 1316 HOH B O   1 
HETATM 10097 O O   . HOH K 4 .   ? 64.486  33.855  17.418  1.00 24.85 ? 1317 HOH B O   1 
HETATM 10098 O O   . HOH K 4 .   ? 55.961  31.529  18.606  1.00 34.35 ? 1318 HOH B O   1 
HETATM 10099 O O   . HOH K 4 .   ? 53.667  24.508  20.723  1.00 35.82 ? 1319 HOH B O   1 
HETATM 10100 O O   . HOH K 4 .   ? 74.926  -0.777  28.132  1.00 31.82 ? 1320 HOH B O   1 
HETATM 10101 O O   . HOH K 4 .   ? 95.206  13.233  42.335  1.00 37.24 ? 1321 HOH B O   1 
HETATM 10102 O O   . HOH K 4 .   ? 93.626  14.302  45.105  1.00 30.02 ? 1322 HOH B O   1 
HETATM 10103 O O   . HOH K 4 .   ? 87.286  19.505  45.502  1.00 30.41 ? 1323 HOH B O   1 
HETATM 10104 O O   . HOH K 4 .   ? 85.960  21.728  44.058  1.00 31.15 ? 1324 HOH B O   1 
HETATM 10105 O O   . HOH K 4 .   ? 74.478  17.462  41.651  1.00 35.33 ? 1325 HOH B O   1 
HETATM 10106 O O   . HOH K 4 .   ? 94.559  8.885   44.259  1.00 42.54 ? 1326 HOH B O   1 
HETATM 10107 O O   . HOH K 4 .   ? 71.444  6.105   42.476  1.00 24.39 ? 1327 HOH B O   1 
HETATM 10108 O O   . HOH K 4 .   ? 84.086  10.179  46.155  1.00 39.79 ? 1328 HOH B O   1 
HETATM 10109 O O   . HOH K 4 .   ? 84.611  -0.270  27.485  1.00 7.33  ? 1329 HOH B O   1 
HETATM 10110 O O   . HOH K 4 .   ? 84.466  -2.657  28.364  1.00 16.25 ? 1330 HOH B O   1 
HETATM 10111 O O   . HOH K 4 .   ? 109.751 12.189  42.302  1.00 34.47 ? 1331 HOH B O   1 
HETATM 10112 O O   . HOH K 4 .   ? 111.388 13.691  43.604  1.00 28.33 ? 1332 HOH B O   1 
HETATM 10113 O O   . HOH K 4 .   ? 109.561 7.518   40.541  1.00 18.19 ? 1333 HOH B O   1 
HETATM 10114 O O   . HOH K 4 .   ? 51.624  15.623  15.674  1.00 23.45 ? 1334 HOH B O   1 
HETATM 10115 O O   . HOH K 4 .   ? 100.321 8.652   -4.046  1.00 26.30 ? 1335 HOH B O   1 
HETATM 10116 O O   . HOH K 4 .   ? 78.280  22.818  41.179  1.00 37.03 ? 1336 HOH B O   1 
HETATM 10117 O O   . HOH K 4 .   ? 79.598  25.361  41.320  1.00 44.21 ? 1337 HOH B O   1 
HETATM 10118 O O   . HOH K 4 .   ? 83.883  23.966  46.884  1.00 38.00 ? 1338 HOH B O   1 
HETATM 10119 O O   . HOH K 4 .   ? 76.268  1.712   -16.069 1.00 28.02 ? 1339 HOH B O   1 
HETATM 10120 O O   . HOH K 4 .   ? 83.149  5.818   -13.186 1.00 31.22 ? 1340 HOH B O   1 
HETATM 10121 O O   . HOH K 4 .   ? 80.318  8.533   -15.707 1.00 34.83 ? 1341 HOH B O   1 
HETATM 10122 O O   . HOH K 4 .   ? 84.973  10.719  -11.365 1.00 33.27 ? 1342 HOH B O   1 
HETATM 10123 O O   . HOH K 4 .   ? 78.180  36.587  19.908  1.00 43.07 ? 1343 HOH B O   1 
HETATM 10124 O O   . HOH K 4 .   ? 88.037  -9.383  30.879  1.00 27.45 ? 1344 HOH B O   1 
HETATM 10125 O O   . HOH K 4 .   ? 99.091  -15.045 12.839  1.00 45.27 ? 1345 HOH B O   1 
HETATM 10126 O O   . HOH K 4 .   ? 55.840  16.150  21.262  1.00 33.42 ? 1346 HOH B O   1 
HETATM 10127 O O   . HOH K 4 .   ? 56.970  8.813   -3.141  1.00 38.22 ? 1347 HOH B O   1 
HETATM 10128 O O   . HOH K 4 .   ? 95.433  17.254  41.612  1.00 35.51 ? 1348 HOH B O   1 
HETATM 10129 O O   . HOH K 4 .   ? 100.537 14.103  41.245  1.00 29.28 ? 1349 HOH B O   1 
HETATM 10130 O O   . HOH K 4 .   ? 76.086  34.515  0.726   1.00 35.10 ? 1350 HOH B O   1 
HETATM 10131 O O   . HOH K 4 .   ? 119.668 17.627  45.857  1.00 33.36 ? 1351 HOH B O   1 
HETATM 10132 O O   . HOH K 4 .   ? 116.552 19.553  47.541  1.00 25.99 ? 1352 HOH B O   1 
HETATM 10133 O O   . HOH K 4 .   ? 85.584  -2.835  30.546  1.00 23.12 ? 1353 HOH B O   1 
HETATM 10134 O O   . HOH K 4 .   ? 76.094  -13.731 17.755  1.00 29.83 ? 1354 HOH B O   1 
HETATM 10135 O O   . HOH K 4 .   ? 76.077  -18.301 6.467   1.00 34.95 ? 1355 HOH B O   1 
HETATM 10136 O O   . HOH K 4 .   ? 93.142  -10.730 -6.267  1.00 32.37 ? 1356 HOH B O   1 
HETATM 10137 O O   . HOH K 4 .   ? 95.117  -12.111 -5.003  1.00 31.36 ? 1357 HOH B O   1 
HETATM 10138 O O   . HOH K 4 .   ? 53.608  -6.046  6.950   1.00 33.44 ? 1358 HOH B O   1 
HETATM 10139 O O   . HOH K 4 .   ? 52.964  -2.154  14.511  1.00 46.12 ? 1359 HOH B O   1 
HETATM 10140 O O   . HOH K 4 .   ? 63.725  14.599  24.924  1.00 7.18  ? 1360 HOH B O   1 
HETATM 10141 O O   . HOH K 4 .   ? 74.180  37.063  23.299  1.00 25.43 ? 1361 HOH B O   1 
HETATM 10142 O O   . HOH K 4 .   ? 71.488  34.656  26.198  1.00 32.03 ? 1362 HOH B O   1 
HETATM 10143 O O   . HOH K 4 .   ? 78.236  37.157  27.077  1.00 39.07 ? 1363 HOH B O   1 
HETATM 10144 O O   . HOH K 4 .   ? 67.673  -11.634 -12.588 1.00 40.61 ? 1364 HOH B O   1 
HETATM 10145 O O   . HOH K 4 .   ? 63.814  -14.212 -7.412  1.00 32.91 ? 1365 HOH B O   1 
HETATM 10146 O O   . HOH K 4 .   ? 57.089  -12.198 5.871   1.00 26.30 ? 1366 HOH B O   1 
HETATM 10147 O O   . HOH K 4 .   ? 71.699  31.421  36.373  1.00 31.28 ? 1367 HOH B O   1 
HETATM 10148 O O   . HOH K 4 .   ? 56.699  27.069  2.970   1.00 43.09 ? 1368 HOH B O   1 
HETATM 10149 O O   . HOH K 4 .   ? 57.139  29.141  6.936   1.00 28.81 ? 1369 HOH B O   1 
HETATM 10150 O O   . HOH K 4 .   ? 58.771  31.279  5.838   1.00 27.09 ? 1370 HOH B O   1 
HETATM 10151 O O   . HOH K 4 .   ? 53.124  27.396  18.814  1.00 37.73 ? 1371 HOH B O   1 
HETATM 10152 O O   . HOH K 4 .   ? 67.185  8.937   32.543  1.00 39.03 ? 1372 HOH B O   1 
HETATM 10153 O O   . HOH K 4 .   ? 86.232  11.919  47.117  1.00 39.77 ? 1373 HOH B O   1 
HETATM 10154 O O   . HOH K 4 .   ? 85.883  2.707   44.017  1.00 28.18 ? 1374 HOH B O   1 
HETATM 10155 O O   . HOH K 4 .   ? 88.903  4.093   43.676  1.00 32.90 ? 1375 HOH B O   1 
HETATM 10156 O O   . HOH K 4 .   ? 85.290  10.855  10.617  1.00 25.64 ? 1376 HOH B O   1 
HETATM 10157 O O   . HOH K 4 .   ? 107.751 3.261   40.149  1.00 49.77 ? 1377 HOH B O   1 
HETATM 10158 O O   . HOH K 4 .   ? 108.249 8.258   43.386  1.00 49.05 ? 1378 HOH B O   1 
HETATM 10159 O O   . HOH K 4 .   ? 87.968  9.059   5.739   1.00 21.16 ? 1379 HOH B O   1 
HETATM 10160 O O   . HOH K 4 .   ? 84.649  10.799  5.368   1.00 31.32 ? 1380 HOH B O   1 
HETATM 10161 O O   . HOH K 4 .   ? 71.673  0.419   25.820  1.00 31.01 ? 1381 HOH B O   1 
HETATM 10162 O O   . HOH K 4 .   ? 85.850  9.043   7.004   1.00 19.35 ? 1382 HOH B O   1 
HETATM 10163 O O   . HOH K 4 .   ? 69.282  -18.878 2.790   1.00 43.08 ? 1383 HOH B O   1 
HETATM 10164 O O   . HOH K 4 .   ? 118.720 36.009  38.057  1.00 14.82 ? 1384 HOH B O   1 
HETATM 10165 O O   . HOH K 4 .   ? 71.050  -1.336  -13.219 1.00 12.75 ? 1385 HOH B O   1 
HETATM 10166 O O   . HOH K 4 .   ? 70.514  0.790   -14.572 1.00 20.32 ? 1386 HOH B O   1 
HETATM 10167 O O   . HOH K 4 .   ? 85.587  8.590   9.876   1.00 21.22 ? 1387 HOH B O   1 
HETATM 10168 O O   . HOH K 4 .   ? 53.285  19.799  6.454   1.00 24.83 ? 1388 HOH B O   1 
HETATM 10169 O O   . HOH K 4 .   ? 85.322  13.243  10.429  1.00 28.69 ? 1389 HOH B O   1 
HETATM 10170 O O   . HOH K 4 .   ? 70.172  34.927  22.261  1.00 25.08 ? 1390 HOH B O   1 
HETATM 10171 O O   . HOH K 4 .   ? 110.855 9.874   39.799  1.00 23.87 ? 1391 HOH B O   1 
HETATM 10172 O O   . HOH K 4 .   ? 93.127  -12.439 32.390  1.00 34.90 ? 1392 HOH B O   1 
HETATM 10173 O O   . HOH K 4 .   ? 64.736  14.045  27.171  1.00 14.18 ? 1393 HOH B O   1 
HETATM 10174 O O   . HOH K 4 .   ? 70.570  -5.449  -12.414 1.00 32.28 ? 1394 HOH B O   1 
HETATM 10175 O O   . HOH K 4 .   ? 49.073  18.099  10.781  1.00 36.93 ? 1395 HOH B O   1 
HETATM 10176 O O   . HOH K 4 .   ? 61.814  37.134  18.944  1.00 37.41 ? 1396 HOH B O   1 
HETATM 10177 O O   . HOH K 4 .   ? 58.578  -17.148 3.077   1.00 36.00 ? 1397 HOH B O   1 
HETATM 10178 O O   . HOH K 4 .   ? 76.274  37.075  30.363  1.00 33.29 ? 1398 HOH B O   1 
HETATM 10179 O O   . HOH K 4 .   ? 98.597  -9.948  -2.560  1.00 37.52 ? 1399 HOH B O   1 
HETATM 10180 O O   . HOH K 4 .   ? 92.623  8.137   30.777  1.00 30.62 ? 1400 HOH B O   1 
HETATM 10181 O O   . HOH K 4 .   ? 61.650  -13.073 -1.579  1.00 44.59 ? 1401 HOH B O   1 
HETATM 10182 O O   . HOH K 4 .   ? 95.966  10.326  -6.536  1.00 45.95 ? 1402 HOH B O   1 
HETATM 10183 O O   . HOH K 4 .   ? 85.900  -1.430  36.249  1.00 35.62 ? 1403 HOH B O   1 
HETATM 10184 O O   . HOH K 4 .   ? 102.464 -2.141  -4.901  1.00 52.31 ? 1404 HOH B O   1 
HETATM 10185 O O   . HOH K 4 .   ? 90.987  5.981   43.439  1.00 41.60 ? 1405 HOH B O   1 
HETATM 10186 O O   . HOH K 4 .   ? 69.151  -0.500  -17.851 1.00 39.86 ? 1406 HOH B O   1 
HETATM 10187 O O   . HOH K 4 .   ? 99.752  9.481   42.777  1.00 35.26 ? 1407 HOH B O   1 
HETATM 10188 O O   . HOH K 4 .   ? 97.104  7.625   -9.165  1.00 38.08 ? 1408 HOH B O   1 
HETATM 10189 O O   . HOH K 4 .   ? 67.938  -4.954  -12.635 1.00 44.56 ? 1409 HOH B O   1 
HETATM 10190 O O   . HOH K 4 .   ? 102.878 -8.133  13.379  1.00 35.30 ? 1410 HOH B O   1 
HETATM 10191 O O   . HOH K 4 .   ? 87.345  -11.376 9.023   1.00 43.62 ? 1411 HOH B O   1 
HETATM 10192 O O   . HOH K 4 .   ? 68.155  36.490  18.597  1.00 35.78 ? 1412 HOH B O   1 
HETATM 10193 O O   . HOH K 4 .   ? 76.622  40.668  9.987   1.00 43.98 ? 1413 HOH B O   1 
HETATM 10194 O O   . HOH K 4 .   ? 58.490  33.570  7.922   1.00 53.20 ? 1414 HOH B O   1 
HETATM 10195 O O   . HOH K 4 .   ? 68.776  15.235  -12.785 1.00 32.89 ? 1415 HOH B O   1 
HETATM 10196 O O   . HOH K 4 .   ? 76.048  -17.660 -9.659  1.00 39.86 ? 1416 HOH B O   1 
HETATM 10197 O O   . HOH K 4 .   ? 75.999  -8.661  22.949  1.00 53.48 ? 1417 HOH B O   1 
HETATM 10198 O O   . HOH K 4 .   ? 86.606  -10.235 -10.631 1.00 49.11 ? 1418 HOH B O   1 
HETATM 10199 O O   . HOH K 4 .   ? 67.006  13.307  36.645  1.00 53.86 ? 1419 HOH B O   1 
HETATM 10200 O O   . HOH K 4 .   ? 76.223  29.722  39.720  1.00 38.26 ? 1420 HOH B O   1 
HETATM 10201 O O   . HOH K 4 .   ? 95.160  -16.474 0.792   1.00 44.07 ? 1421 HOH B O   1 
HETATM 10202 O O   . HOH K 4 .   ? 74.676  24.512  -8.659  1.00 36.99 ? 1422 HOH B O   1 
HETATM 10203 O O   . HOH K 4 .   ? 85.505  -10.104 29.824  1.00 35.39 ? 1423 HOH B O   1 
HETATM 10204 O O   . HOH K 4 .   ? 77.605  13.304  -14.287 1.00 42.53 ? 1424 HOH B O   1 
HETATM 10205 O O   . HOH K 4 .   ? 87.194  9.409   -13.439 1.00 44.72 ? 1425 HOH B O   1 
HETATM 10206 O O   . HOH K 4 .   ? 68.139  -2.970  -17.851 1.00 49.77 ? 1426 HOH B O   1 
HETATM 10207 O O   . HOH K 4 .   ? 96.062  -12.561 8.635   1.00 47.57 ? 1427 HOH B O   1 
HETATM 10208 O O   . HOH K 4 .   ? 93.891  -5.564  36.620  1.00 49.82 ? 1428 HOH B O   1 
HETATM 10209 O O   . HOH K 4 .   ? 113.868 9.127   41.802  1.00 47.26 ? 1429 HOH B O   1 
HETATM 10210 O O   . HOH K 4 .   ? 58.490  7.456   -12.145 1.00 54.95 ? 1430 HOH B O   1 
HETATM 10211 O O   . HOH K 4 .   ? 102.208 -2.617  15.674  1.00 33.86 ? 1431 HOH B O   1 
HETATM 10212 O O   . HOH K 4 .   ? 69.607  12.603  -12.717 1.00 36.31 ? 1432 HOH B O   1 
HETATM 10213 O O   . HOH K 4 .   ? 69.466  11.064  41.102  1.00 37.45 ? 1433 HOH B O   1 
HETATM 10214 O O   . HOH K 4 .   ? 68.222  -7.602  -15.236 1.00 48.48 ? 1434 HOH B O   1 
HETATM 10215 O O   . HOH K 4 .   ? 82.883  -9.639  27.889  1.00 42.98 ? 1435 HOH B O   1 
HETATM 10216 O O   . HOH K 4 .   ? 70.846  37.469  18.282  1.00 35.48 ? 1436 HOH B O   1 
HETATM 10217 O O   . HOH K 4 .   ? 79.441  -18.360 15.969  1.00 57.07 ? 1437 HOH B O   1 
HETATM 10218 O O   . HOH K 4 .   ? 75.338  20.876  40.078  1.00 51.46 ? 1438 HOH B O   1 
HETATM 10219 O O   . HOH K 4 .   ? 93.845  12.483  -8.293  1.00 44.40 ? 1439 HOH B O   1 
HETATM 10220 O O   . HOH K 4 .   ? 76.287  -17.286 1.599   1.00 28.76 ? 1440 HOH B O   1 
HETATM 10221 O O   . HOH K 4 .   ? 109.783 20.443  47.425  1.00 34.40 ? 1441 HOH B O   1 
HETATM 10222 O O   . HOH K 4 .   ? 121.982 18.769  44.442  1.00 42.53 ? 1442 HOH B O   1 
HETATM 10223 O O   . HOH K 4 .   ? 79.906  12.010  46.336  1.00 41.91 ? 1443 HOH B O   1 
HETATM 10224 O O   . HOH K 4 .   ? 86.364  27.547  46.715  1.00 39.19 ? 1444 HOH B O   1 
HETATM 10225 O O   . HOH K 4 .   ? 124.670 28.664  28.574  1.00 60.90 ? 1445 HOH B O   1 
HETATM 10226 O O   . HOH K 4 .   ? 73.477  -14.298 -11.520 1.00 38.88 ? 1446 HOH B O   1 
HETATM 10227 O O   . HOH K 4 .   ? 60.351  -3.412  23.546  1.00 38.79 ? 1447 HOH B O   1 
HETATM 10228 O O   . HOH K 4 .   ? 79.567  -4.216  -14.514 1.00 53.35 ? 1448 HOH B O   1 
HETATM 10229 O O   . HOH K 4 .   ? 73.473  -18.711 0.010   1.00 42.56 ? 1449 HOH B O   1 
HETATM 10230 O O   . HOH K 4 .   ? 67.117  11.674  33.075  1.00 48.26 ? 1450 HOH B O   1 
HETATM 10231 O O   . HOH K 4 .   ? 64.608  -16.187 -9.405  1.00 46.49 ? 1451 HOH B O   1 
HETATM 10232 O O   . HOH K 4 .   ? 65.446  14.641  30.061  1.00 34.86 ? 1452 HOH B O   1 
HETATM 10233 O O   . HOH K 4 .   ? 84.225  29.293  48.103  1.00 39.31 ? 1453 HOH B O   1 
HETATM 10234 O O   . HOH K 4 .   ? 58.744  6.894   -9.480  1.00 41.38 ? 1454 HOH B O   1 
HETATM 10235 O O   . HOH K 4 .   ? 79.607  -18.053 3.757   1.00 44.56 ? 1455 HOH B O   1 
HETATM 10236 O O   . HOH K 4 .   ? 77.636  32.152  41.144  1.00 35.62 ? 1456 HOH B O   1 
HETATM 10237 O O   . HOH K 4 .   ? 90.112  -7.288  -10.731 1.00 40.14 ? 1457 HOH B O   1 
HETATM 10238 O O   . HOH K 4 .   ? 79.472  -13.032 -11.987 1.00 54.60 ? 1458 HOH B O   1 
HETATM 10239 O O   . HOH K 4 .   ? 112.008 18.269  47.421  1.00 37.56 ? 1459 HOH B O   1 
HETATM 10240 O O   . HOH K 4 .   ? 68.357  19.327  -13.280 1.00 58.18 ? 1460 HOH B O   1 
HETATM 10241 O O   . HOH K 4 .   ? 72.114  -21.117 -1.608  1.00 31.27 ? 1461 HOH B O   1 
HETATM 10242 O O   . HOH K 4 .   ? 58.769  -0.974  22.005  1.00 37.73 ? 1462 HOH B O   1 
HETATM 10243 O O   . HOH K 4 .   ? 92.456  -17.725 0.452   1.00 47.52 ? 1463 HOH B O   1 
HETATM 10244 O O   . HOH K 4 .   ? 73.059  -10.932 21.181  1.00 53.55 ? 1464 HOH B O   1 
HETATM 10245 O O   . HOH K 4 .   ? 55.429  24.194  12.933  1.00 51.58 ? 1465 HOH B O   1 
HETATM 10246 O O   . HOH K 4 .   ? 73.349  35.261  28.516  1.00 41.93 ? 1466 HOH B O   1 
HETATM 10247 O O   . HOH K 4 .   ? 54.355  23.351  9.651   1.00 60.85 ? 1467 HOH B O   1 
HETATM 10248 O O   . HOH K 4 .   ? 74.643  40.452  12.769  1.00 43.57 ? 1468 HOH B O   1 
HETATM 10249 O O   . HOH K 4 .   ? 59.382  -11.762 18.617  1.00 37.19 ? 1469 HOH B O   1 
HETATM 10250 O O   . HOH K 4 .   ? 57.788  -15.163 -0.502  1.00 36.37 ? 1470 HOH B O   1 
HETATM 10251 O O   . HOH K 4 .   ? 70.619  -18.206 -5.882  1.00 41.68 ? 1471 HOH B O   1 
HETATM 10252 O O   . HOH K 4 .   ? 121.872 18.436  40.053  1.00 20.67 ? 1472 HOH B O   1 
HETATM 10253 O O   . HOH K 4 .   ? 57.164  -14.115 8.463   1.00 41.51 ? 1473 HOH B O   1 
HETATM 10254 O O   . HOH K 4 .   ? 71.724  -13.350 16.454  1.00 39.11 ? 1474 HOH B O   1 
HETATM 10255 O O   . HOH K 4 .   ? 50.280  -0.990  22.202  1.00 7.04  ? 1475 HOH B O   1 
HETATM 10256 O O   . HOH K 4 .   ? 64.469  36.263  18.491  1.00 44.78 ? 1476 HOH B O   1 
HETATM 10257 O O   . HOH K 4 .   ? 65.462  -7.712  -15.040 1.00 49.54 ? 1477 HOH B O   1 
HETATM 10258 O O   . HOH K 4 .   ? 57.818  10.241  -6.809  1.00 51.91 ? 1478 HOH B O   1 
HETATM 10259 O O   . HOH K 4 .   ? 80.226  12.411  -15.264 1.00 49.26 ? 1479 HOH B O   1 
HETATM 10260 O O   . HOH K 4 .   ? 76.876  -18.031 4.045   1.00 42.29 ? 1480 HOH B O   1 
HETATM 10261 O O   . HOH K 4 .   ? 101.302 -3.499  18.171  1.00 43.78 ? 1481 HOH B O   1 
HETATM 10262 O O   . HOH K 4 .   ? 83.658  18.884  -4.010  1.00 45.09 ? 1482 HOH B O   1 
HETATM 10263 O O   . HOH K 4 .   ? 81.118  1.114   44.590  1.00 52.10 ? 1483 HOH B O   1 
HETATM 10264 O O   . HOH K 4 .   ? 58.099  3.064   26.058  1.00 59.07 ? 1484 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PCA 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   CYS 3   3   3   CYS CYS A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  PHE 23  23  23  PHE PHE A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  PHE 54  54  54  PHE PHE A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  CYS 86  86  86  CYS CYS A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 TYR 142 142 142 TYR TYR A . n 
A 1 143 TRP 143 143 143 TRP TRP A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 TYR 155 155 155 TYR TYR A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 THR 161 161 161 THR THR A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 MET 171 171 171 MET MET A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 PHE 199 199 199 PHE PHE A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 PHE 207 207 207 PHE PHE A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ASN 214 214 214 ASN ASN A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 GLN 227 227 227 GLN GLN A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 TYR 236 236 236 TYR TYR A . n 
A 1 237 MET 237 237 237 MET MET A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 TRP 243 243 243 TRP TRP A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 PRO 252 252 252 PRO PRO A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 PRO 255 255 255 PRO PRO A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 PHE 264 264 264 PHE PHE A . n 
A 1 265 VAL 265 265 265 VAL VAL A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 ASN 267 267 267 ASN ASN A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 ASP 270 270 270 ASP ASP A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 ASN 279 279 279 ASN ASN A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 ASN 281 281 281 ASN ASN A . n 
A 1 282 THR 282 282 282 THR THR A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 TYR 285 285 285 TYR TYR A . n 
A 1 286 ARG 286 286 286 ARG ARG A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 ILE 290 290 290 ILE ILE A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 ARG 299 299 299 ARG ARG A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 GLY 301 301 301 GLY GLY A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 ASN 303 303 303 ASN ASN A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 PRO 305 305 305 PRO PRO A . n 
A 1 306 PHE 306 306 306 PHE PHE A . n 
A 1 307 ILE 307 307 307 ILE ILE A . n 
A 1 308 ASP 308 308 308 ASP ASP A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 ARG 311 311 311 ARG ARG A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 GLY 314 314 314 GLY GLY A . n 
A 1 315 PHE 315 315 315 PHE PHE A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 SER 321 321 321 SER SER A . n 
A 1 322 HIS 322 322 322 HIS HIS A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 ARG 325 325 325 ARG ARG A . n 
A 1 326 LEU 326 326 326 LEU LEU A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 ALA 329 329 329 ALA ALA A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 ARG 335 335 335 ARG ARG A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 SER 337 337 337 SER SER A . n 
A 1 338 TRP 338 338 338 TRP TRP A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 TRP 342 342 342 TRP TRP A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 VAL 344 344 344 VAL VAL A . n 
A 1 345 HIS 345 345 345 HIS HIS A . n 
A 1 346 ARG 346 346 346 ARG ARG A . n 
A 1 347 PHE 347 347 347 PHE PHE A . n 
A 1 348 ALA 348 348 348 ALA ALA A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 GLY 354 354 354 GLY GLY A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 LEU 357 357 357 LEU LEU A . n 
A 1 358 HIS 358 358 358 HIS HIS A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 THR 360 360 360 THR THR A . n 
A 1 361 ILE 361 361 361 ILE ILE A . n 
A 1 362 LYS 362 362 362 LYS LYS A . n 
A 1 363 GLY 363 363 363 GLY GLY A . n 
A 1 364 GLU 364 364 364 GLU GLU A . n 
A 1 365 LEU 365 365 365 LEU LEU A . n 
A 1 366 ASN 366 366 366 ASN ASN A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 ASP 368 368 368 ASP ASP A . n 
A 1 369 PHE 369 369 369 PHE PHE A . n 
A 1 370 ASP 370 370 370 ASP ASP A . n 
A 1 371 LEU 371 371 371 LEU LEU A . n 
A 1 372 SER 372 372 372 SER SER A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 GLU 375 375 375 GLU GLU A . n 
A 1 376 ASN 376 376 376 ASN ASN A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 LEU 379 379 379 LEU LEU A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 LYS 381 381 381 LYS LYS A . n 
A 1 382 ARG 382 382 382 ARG ARG A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 ILE 386 386 386 ILE ILE A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 ALA 389 389 389 ALA ALA A . n 
A 1 390 GLN 390 390 390 GLN GLN A . n 
A 1 391 ASN 391 391 391 ASN ASN A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ASN 393 393 393 ASN ASN A . n 
A 1 394 ASN 394 394 394 ASN ASN A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 LEU 400 400 400 LEU LEU A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 GLN 402 402 402 GLN GLN A . n 
A 1 403 ALA 403 403 403 ALA ALA A . n 
A 1 404 ILE 404 404 404 ILE ILE A . n 
A 1 405 GLN 405 405 405 GLN GLN A . n 
A 1 406 GLU 406 406 406 GLU GLU A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 SER 408 408 408 SER SER A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 THR 410 410 410 THR THR A . n 
A 1 411 HIS 411 411 411 HIS HIS A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 SER 413 413 413 SER SER A . n 
A 1 414 TYR 414 414 414 TYR TYR A . n 
A 1 415 PRO 415 415 415 PRO PRO A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 HIS 418 418 418 HIS HIS A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 THR 420 420 420 THR THR A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 GLY 423 423 423 GLY GLY A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 PHE 425 425 425 PHE PHE A . n 
A 1 426 ALA 426 426 426 ALA ALA A . n 
A 1 427 THR 427 427 427 THR THR A . n 
A 1 428 VAL 428 428 428 VAL VAL A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 LYS 430 430 430 LYS LYS A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
A 1 432 LEU 432 432 432 LEU LEU A . n 
A 1 433 ILE 433 433 433 ILE ILE A . n 
A 1 434 GLY 434 434 434 GLY GLY A . n 
A 1 435 LEU 435 435 435 LEU LEU A . n 
A 1 436 ASP 436 436 436 ASP ASP A . n 
A 1 437 ARG 437 437 437 ARG ARG A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 ASP 440 440 440 ASP ASP A . n 
A 1 441 CYS 441 441 441 CYS CYS A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 PRO 443 443 443 PRO PRO A . n 
A 1 444 ASP 444 444 444 ASP ASP A . n 
A 1 445 PRO 445 445 445 PRO PRO A . n 
A 1 446 VAL 446 446 446 VAL VAL A . n 
A 1 447 TYR 447 447 447 TYR TYR A . n 
A 1 448 PRO 448 448 448 PRO PRO A . n 
A 1 449 ASP 449 449 449 ASP ASP A . n 
A 1 450 ASP 450 450 450 ASP ASP A . n 
A 1 451 ASP 451 451 451 ASP ASP A . n 
A 1 452 GLY 452 452 452 GLY GLY A . n 
A 1 453 LEU 453 453 453 LEU LEU A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 LEU 455 455 455 LEU LEU A . n 
A 1 456 ILE 456 456 456 ILE ILE A . n 
A 1 457 ASP 457 457 457 ASP ASP A . n 
A 1 458 PHE 458 458 458 PHE PHE A . n 
A 1 459 ARG 459 459 459 ARG ARG A . n 
A 1 460 GLY 460 460 460 GLY GLY A . n 
A 1 461 SER 461 461 461 SER SER A . n 
A 1 462 CYS 462 462 462 CYS CYS A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 THR 464 464 464 THR THR A . n 
A 1 465 PHE 465 465 465 PHE PHE A . n 
A 1 466 GLU 466 466 466 GLU GLU A . n 
A 1 467 GLY 467 467 467 GLY GLY A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 ASN 470 470 470 ASN ASN A . n 
A 1 471 LYS 471 471 471 LYS LYS A . n 
A 1 472 LEU 472 472 472 LEU LEU A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 VAL 474 474 474 VAL VAL A . n 
A 1 475 ASN 475 475 475 ASN ASN A . n 
A 1 476 VAL 476 476 476 VAL VAL A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 PHE 478 478 478 PHE PHE A . n 
A 1 479 GLY 479 479 479 GLY GLY A . n 
A 1 480 ARG 480 480 480 ARG ARG A . n 
A 1 481 GLN 481 481 481 GLN GLN A . n 
A 1 482 MET 482 482 482 MET MET A . n 
A 1 483 LEU 483 483 483 LEU LEU A . n 
A 1 484 GLY 484 484 484 GLY GLY A . n 
A 1 485 ILE 485 485 485 ILE ILE A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 TYR 487 487 487 TYR TYR A . n 
A 1 488 ARG 488 488 488 ARG ARG A . n 
A 1 489 PHE 489 489 489 PHE PHE A . n 
A 1 490 ASP 490 490 490 ASP ASP A . n 
A 1 491 GLY 491 491 491 GLY GLY A . n 
A 1 492 ILE 492 492 492 ILE ILE A . n 
A 1 493 GLN 493 493 493 GLN GLN A . n 
A 1 494 GLY 494 494 494 GLY GLY A . n 
A 1 495 LEU 495 495 495 LEU LEU A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 GLY 498 498 498 GLY GLY A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 THR 500 500 500 THR THR A . n 
A 1 501 ILE 501 501 501 ILE ILE A . n 
A 1 502 THR 502 502 502 THR THR A . n 
A 1 503 VAL 503 503 503 VAL VAL A . n 
A 1 504 ARG 504 504 504 ARG ARG A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 LEU 506 506 506 LEU LEU A . n 
A 1 507 HIS 507 507 507 HIS HIS A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLU 509 509 509 GLU GLU A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 MET 511 511 511 MET MET A . n 
A 1 512 THR 512 512 512 THR THR A . n 
A 1 513 PHE 513 513 513 PHE PHE A . n 
A 1 514 ALA 514 514 514 ALA ALA A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 SER 517 517 517 SER SER A . n 
A 1 518 THR 518 518 518 THR THR A . n 
A 1 519 PHE 519 519 519 PHE PHE A . n 
A 1 520 GLU 520 520 520 GLU GLU A . n 
A 1 521 PHE 521 521 521 PHE PHE A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 LEU 523 523 523 LEU LEU A . n 
A 1 524 PHE 524 524 524 PHE PHE A . n 
A 1 525 THR 525 525 525 THR THR A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 VAL 528 528 528 VAL VAL A . n 
A 1 529 ILE 529 529 529 ILE ILE A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 PHE 532 532 532 PHE PHE A . n 
A 1 533 GLN 533 533 533 GLN GLN A . n 
A 1 534 ASP 534 534 534 ASP ASP A . n 
A 1 535 GLY 535 535 535 GLY GLY A . n 
A 1 536 THR 536 536 536 THR THR A . n 
A 1 537 PHE 537 537 537 PHE PHE A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 ILE 539 539 539 ILE ILE A . n 
A 1 540 ASP 540 540 540 ASP ASP A . n 
A 1 541 GLY 541 541 541 GLY GLY A . n 
A 1 542 PHE 542 542 542 PHE PHE A . n 
A 1 543 LYS 543 543 543 LYS LYS A . n 
A 1 544 CYS 544 544 544 CYS CYS A . n 
A 1 545 PRO 545 545 545 PRO PRO A . n 
A 1 546 GLY 546 546 546 GLY GLY A . n 
A 1 547 LEU 547 547 547 LEU LEU A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 TYR 549 549 549 TYR TYR A . n 
A 1 550 THR 550 550 550 THR THR A . n 
A 1 551 GLY 551 551 551 GLY GLY A . n 
A 1 552 VAL 552 552 552 VAL VAL A . n 
A 1 553 GLU 553 553 553 GLU GLU A . n 
A 1 554 ASN 554 554 554 ASN ASN A . n 
A 1 555 CYS 555 555 555 CYS CYS A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
B 1 1   PCA 1   1   1   PCA PCA B . n 
B 1 2   THR 2   2   2   THR THR B . n 
B 1 3   CYS 3   3   3   CYS CYS B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   THR 5   5   5   THR THR B . n 
B 1 6   SER 6   6   6   SER SER B . n 
B 1 7   ASP 7   7   7   ASP ASP B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   ALA 9   9   9   ALA ALA B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  THR 13  13  13  THR THR B . n 
B 1 14  PRO 14  14  14  PRO PRO B . n 
B 1 15  PRO 15  15  15  PRO PRO B . n 
B 1 16  ASN 16  16  16  ASN ASN B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  ASP 20  20  20  ASP ASP B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  ALA 22  22  22  ALA ALA B . n 
B 1 23  PHE 23  23  23  PHE PHE B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  VAL 27  27  27  VAL VAL B . n 
B 1 28  ALA 28  28  28  ALA ALA B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  ARG 32  32  32  ARG ARG B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  GLU 35  35  35  GLU GLU B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  THR 39  39  39  THR THR B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  CYS 41  41  41  CYS CYS B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  ASN 45  45  45  ASN ASN B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  ALA 51  51  51  ALA ALA B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  PHE 54  54  54  PHE PHE B . n 
B 1 55  HIS 55  55  55  HIS HIS B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  PRO 59  59  59  PRO PRO B . n 
B 1 60  HIS 60  60  60  HIS HIS B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  GLN 65  65  65  GLN GLN B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  ASP 67  67  67  ASP ASP B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  ASP 69  69  69  ASP ASP B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  ALA 73  73  73  ALA ALA B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  GLU 75  75  75  GLU GLU B . n 
B 1 76  ASP 76  76  76  ASP ASP B . n 
B 1 77  CYS 77  77  77  CYS CYS B . n 
B 1 78  ILE 78  78  78  ILE ILE B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  SER 84  84  84  SER SER B . n 
B 1 85  ILE 85  85  85  ILE ILE B . n 
B 1 86  CYS 86  86  86  CYS CYS B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  PRO 90  90  90  PRO PRO B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  GLY 92  92  92  GLY GLY B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  PRO 98  98  98  PRO PRO B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 VAL 103 103 103 VAL VAL B . n 
B 1 104 ASN 104 104 104 ASN ASN B . n 
B 1 105 PRO 105 105 105 PRO PRO B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 ALA 107 107 107 ALA ALA B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 PHE 109 109 109 PHE PHE B . n 
B 1 110 ALA 110 110 110 ALA ALA B . n 
B 1 111 ILE 111 111 111 ILE ILE B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 SER 114 114 114 SER SER B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 PRO 116 116 116 PRO PRO B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 PHE 118 118 118 PHE PHE B . n 
B 1 119 SER 119 119 119 SER SER B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 THR 121 121 121 THR THR B . n 
B 1 122 THR 122 122 122 THR THR B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 PRO 125 125 125 PRO PRO B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 PRO 127 127 127 PRO PRO B . n 
B 1 128 THR 128 128 128 THR THR B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 SER 131 131 131 SER SER B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 GLU 133 133 133 GLU GLU B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 GLN 137 137 137 GLN GLN B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 TYR 142 142 142 TYR TYR B . n 
B 1 143 TRP 143 143 143 TRP TRP B . n 
B 1 144 MET 144 144 144 MET MET B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ALA 147 147 147 ALA ALA B . n 
B 1 148 ARG 148 148 148 ARG ARG B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 MET 153 153 153 MET MET B . n 
B 1 154 GLN 154 154 154 GLN GLN B . n 
B 1 155 TYR 155 155 155 TYR TYR B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 THR 157 157 157 THR THR B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 ASP 159 159 159 ASP ASP B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 THR 161 161 161 THR THR B . n 
B 1 162 VAL 162 162 162 VAL VAL B . n 
B 1 163 THR 163 163 163 THR THR B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 ALA 165 165 165 ALA ALA B . n 
B 1 166 ALA 166 166 166 ALA ALA B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 LEU 168 168 168 LEU LEU B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 GLY 170 170 170 GLY GLY B . n 
B 1 171 MET 171 171 171 MET MET B . n 
B 1 172 GLU 172 172 172 GLU GLU B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 PHE 174 174 174 PHE PHE B . n 
B 1 175 PRO 175 175 175 PRO PRO B . n 
B 1 176 ASN 176 176 176 ASN ASN B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 SER 181 181 181 SER SER B . n 
B 1 182 ILE 182 182 182 ILE ILE B . n 
B 1 183 GLY 183 183 183 GLY GLY B . n 
B 1 184 SER 184 184 184 SER SER B . n 
B 1 185 ASP 185 185 185 ASP ASP B . n 
B 1 186 GLY 186 186 186 GLY GLY B . n 
B 1 187 THR 187 187 187 THR THR B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 ASP 189 189 189 ASP ASP B . n 
B 1 190 PRO 190 190 190 PRO PRO B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 SER 192 192 192 SER SER B . n 
B 1 193 GLN 193 193 193 GLN GLN B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 PHE 195 195 195 PHE PHE B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 PHE 199 199 199 PHE PHE B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 VAL 202 202 202 VAL VAL B . n 
B 1 203 GLU 203 203 203 GLU GLU B . n 
B 1 204 THR 204 204 204 THR THR B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 PRO 206 206 206 PRO PRO B . n 
B 1 207 PHE 207 207 207 PHE PHE B . n 
B 1 208 ILE 208 208 208 ILE ILE B . n 
B 1 209 SER 209 209 209 SER SER B . n 
B 1 210 GLN 210 210 210 GLN GLN B . n 
B 1 211 LEU 211 211 211 LEU LEU B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 ASN 214 214 214 ASN ASN B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 PHE 216 216 216 PHE PHE B . n 
B 1 217 THR 217 217 217 THR THR B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 ASP 219 219 219 ASP ASP B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 ILE 221 221 221 ILE ILE B . n 
B 1 222 THR 222 222 222 THR THR B . n 
B 1 223 VAL 223 223 223 VAL VAL B . n 
B 1 224 GLU 224 224 224 GLU GLU B . n 
B 1 225 PRO 225 225 225 PRO PRO B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 GLN 227 227 227 GLN GLN B . n 
B 1 228 GLU 228 228 228 GLU GLU B . n 
B 1 229 THR 229 229 229 THR THR B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 ALA 231 231 231 ALA ALA B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 VAL 234 234 234 VAL VAL B . n 
B 1 235 ASN 235 235 235 ASN ASN B . n 
B 1 236 TYR 236 236 236 TYR TYR B . n 
B 1 237 MET 237 237 237 MET MET B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 ASP 239 239 239 ASP ASP B . n 
B 1 240 PHE 240 240 240 PHE PHE B . n 
B 1 241 ASP 241 241 241 ASP ASP B . n 
B 1 242 GLU 242 242 242 GLU GLU B . n 
B 1 243 TRP 243 243 243 TRP TRP B . n 
B 1 244 LEU 244 244 244 LEU LEU B . n 
B 1 245 ASN 245 245 245 ASN ASN B . n 
B 1 246 ILE 246 246 246 ILE ILE B . n 
B 1 247 GLN 247 247 247 GLN GLN B . n 
B 1 248 ASN 248 248 248 ASN ASN B . n 
B 1 249 GLY 249 249 249 GLY GLY B . n 
B 1 250 GLY 250 250 250 GLY GLY B . n 
B 1 251 PRO 251 251 251 PRO PRO B . n 
B 1 252 PRO 252 252 252 PRO PRO B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 GLY 254 254 254 GLY GLY B . n 
B 1 255 PRO 255 255 255 PRO PRO B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 LEU 257 257 257 LEU LEU B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 ASP 260 260 260 ASP ASP B . n 
B 1 261 GLU 261 261 261 GLU GLU B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 ARG 263 263 263 ARG ARG B . n 
B 1 264 PHE 264 264 264 PHE PHE B . n 
B 1 265 VAL 265 265 265 VAL VAL B . n 
B 1 266 ARG 266 266 266 ARG ARG B . n 
B 1 267 ASN 267 267 267 ASN ASN B . n 
B 1 268 ALA 268 268 268 ALA ALA B . n 
B 1 269 ARG 269 269 269 ARG ARG B . n 
B 1 270 ASP 270 270 270 ASP ASP B . n 
B 1 271 LEU 271 271 271 LEU LEU B . n 
B 1 272 ALA 272 272 272 ALA ALA B . n 
B 1 273 ARG 273 273 273 ARG ARG B . n 
B 1 274 VAL 274 274 274 VAL VAL B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 PHE 276 276 276 PHE PHE B . n 
B 1 277 THR 277 277 277 THR THR B . n 
B 1 278 ASP 278 278 278 ASP ASP B . n 
B 1 279 ASN 279 279 279 ASN ASN B . n 
B 1 280 ILE 280 280 280 ILE ILE B . n 
B 1 281 ASN 281 281 281 ASN ASN B . n 
B 1 282 THR 282 282 282 THR THR B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 ALA 284 284 284 ALA ALA B . n 
B 1 285 TYR 285 285 285 TYR TYR B . n 
B 1 286 ARG 286 286 286 ARG ARG B . n 
B 1 287 GLY 287 287 287 GLY GLY B . n 
B 1 288 ALA 288 288 288 ALA ALA B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 ILE 290 290 290 ILE ILE B . n 
B 1 291 LEU 291 291 291 LEU LEU B . n 
B 1 292 LEU 292 292 292 LEU LEU B . n 
B 1 293 GLY 293 293 293 GLY GLY B . n 
B 1 294 LEU 294 294 294 LEU LEU B . n 
B 1 295 ASP 295 295 295 ASP ASP B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 ASN 298 298 298 ASN ASN B . n 
B 1 299 ARG 299 299 299 ARG ARG B . n 
B 1 300 ALA 300 300 300 ALA ALA B . n 
B 1 301 GLY 301 301 301 GLY GLY B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 ASN 303 303 303 ASN ASN B . n 
B 1 304 GLY 304 304 304 GLY GLY B . n 
B 1 305 PRO 305 305 305 PRO PRO B . n 
B 1 306 PHE 306 306 306 PHE PHE B . n 
B 1 307 ILE 307 307 307 ILE ILE B . n 
B 1 308 ASP 308 308 308 ASP ASP B . n 
B 1 309 ILE 309 309 309 ILE ILE B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 ARG 311 311 311 ARG ARG B . n 
B 1 312 GLN 312 312 312 GLN GLN B . n 
B 1 313 ALA 313 313 313 ALA ALA B . n 
B 1 314 GLY 314 314 314 GLY GLY B . n 
B 1 315 PHE 315 315 315 PHE PHE B . n 
B 1 316 VAL 316 316 316 VAL VAL B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 PHE 318 318 318 PHE PHE B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ILE 320 320 320 ILE ILE B . n 
B 1 321 SER 321 321 321 SER SER B . n 
B 1 322 HIS 322 322 322 HIS HIS B . n 
B 1 323 TYR 323 323 323 TYR TYR B . n 
B 1 324 PHE 324 324 324 PHE PHE B . n 
B 1 325 ARG 325 325 325 ARG ARG B . n 
B 1 326 LEU 326 326 326 LEU LEU B . n 
B 1 327 ILE 327 327 327 ILE ILE B . n 
B 1 328 GLY 328 328 328 GLY GLY B . n 
B 1 329 ALA 329 329 329 ALA ALA B . n 
B 1 330 ALA 330 330 330 ALA ALA B . n 
B 1 331 GLU 331 331 331 GLU GLU B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 ALA 333 333 333 ALA ALA B . n 
B 1 334 GLN 334 334 334 GLN GLN B . n 
B 1 335 ARG 335 335 335 ARG ARG B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 SER 337 337 337 SER SER B . n 
B 1 338 TRP 338 338 338 TRP TRP B . n 
B 1 339 TYR 339 339 339 TYR TYR B . n 
B 1 340 GLN 340 340 340 GLN GLN B . n 
B 1 341 LYS 341 341 341 LYS LYS B . n 
B 1 342 TRP 342 342 342 TRP TRP B . n 
B 1 343 GLN 343 343 343 GLN GLN B . n 
B 1 344 VAL 344 344 344 VAL VAL B . n 
B 1 345 HIS 345 345 345 HIS HIS B . n 
B 1 346 ARG 346 346 346 ARG ARG B . n 
B 1 347 PHE 347 347 347 PHE PHE B . n 
B 1 348 ALA 348 348 348 ALA ALA B . n 
B 1 349 ARG 349 349 349 ARG ARG B . n 
B 1 350 PRO 350 350 350 PRO PRO B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 ALA 352 352 352 ALA ALA B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 GLY 354 354 354 GLY GLY B . n 
B 1 355 GLY 355 355 355 GLY GLY B . n 
B 1 356 THR 356 356 356 THR THR B . n 
B 1 357 LEU 357 357 357 LEU LEU B . n 
B 1 358 HIS 358 358 358 HIS HIS B . n 
B 1 359 LEU 359 359 359 LEU LEU B . n 
B 1 360 THR 360 360 360 THR THR B . n 
B 1 361 ILE 361 361 361 ILE ILE B . n 
B 1 362 LYS 362 362 362 LYS LYS B . n 
B 1 363 GLY 363 363 363 GLY GLY B . n 
B 1 364 GLU 364 364 364 GLU GLU B . n 
B 1 365 LEU 365 365 365 LEU LEU B . n 
B 1 366 ASN 366 366 366 ASN ASN B . n 
B 1 367 ALA 367 367 367 ALA ALA B . n 
B 1 368 ASP 368 368 368 ASP ASP B . n 
B 1 369 PHE 369 369 369 PHE PHE B . n 
B 1 370 ASP 370 370 370 ASP ASP B . n 
B 1 371 LEU 371 371 371 LEU LEU B . n 
B 1 372 SER 372 372 372 SER SER B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 LEU 374 374 374 LEU LEU B . n 
B 1 375 GLU 375 375 375 GLU GLU B . n 
B 1 376 ASN 376 376 376 ASN ASN B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 GLU 378 378 378 GLU GLU B . n 
B 1 379 LEU 379 379 379 LEU LEU B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 LYS 381 381 381 LYS LYS B . n 
B 1 382 ARG 382 382 382 ARG ARG B . n 
B 1 383 VAL 383 383 383 VAL VAL B . n 
B 1 384 ALA 384 384 384 ALA ALA B . n 
B 1 385 ALA 385 385 385 ALA ALA B . n 
B 1 386 ILE 386 386 386 ILE ILE B . n 
B 1 387 ASN 387 387 387 ASN ASN B . n 
B 1 388 ALA 388 388 388 ALA ALA B . n 
B 1 389 ALA 389 389 389 ALA ALA B . n 
B 1 390 GLN 390 390 390 GLN GLN B . n 
B 1 391 ASN 391 391 391 ASN ASN B . n 
B 1 392 PRO 392 392 392 PRO PRO B . n 
B 1 393 ASN 393 393 393 ASN ASN B . n 
B 1 394 ASN 394 394 394 ASN ASN B . n 
B 1 395 GLU 395 395 395 GLU GLU B . n 
B 1 396 VAL 396 396 396 VAL VAL B . n 
B 1 397 THR 397 397 397 THR THR B . n 
B 1 398 TYR 398 398 398 TYR TYR B . n 
B 1 399 LEU 399 399 399 LEU LEU B . n 
B 1 400 LEU 400 400 400 LEU LEU B . n 
B 1 401 PRO 401 401 401 PRO PRO B . n 
B 1 402 GLN 402 402 402 GLN GLN B . n 
B 1 403 ALA 403 403 403 ALA ALA B . n 
B 1 404 ILE 404 404 404 ILE ILE B . n 
B 1 405 GLN 405 405 405 GLN GLN B . n 
B 1 406 GLU 406 406 406 GLU GLU B . n 
B 1 407 GLY 407 407 407 GLY GLY B . n 
B 1 408 SER 408 408 408 SER SER B . n 
B 1 409 PRO 409 409 409 PRO PRO B . n 
B 1 410 THR 410 410 410 THR THR B . n 
B 1 411 HIS 411 411 411 HIS HIS B . n 
B 1 412 PRO 412 412 412 PRO PRO B . n 
B 1 413 SER 413 413 413 SER SER B . n 
B 1 414 TYR 414 414 414 TYR TYR B . n 
B 1 415 PRO 415 415 415 PRO PRO B . n 
B 1 416 SER 416 416 416 SER SER B . n 
B 1 417 GLY 417 417 417 GLY GLY B . n 
B 1 418 HIS 418 418 418 HIS HIS B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 THR 420 420 420 THR THR B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 ASN 422 422 422 ASN ASN B . n 
B 1 423 GLY 423 423 423 GLY GLY B . n 
B 1 424 ALA 424 424 424 ALA ALA B . n 
B 1 425 PHE 425 425 425 PHE PHE B . n 
B 1 426 ALA 426 426 426 ALA ALA B . n 
B 1 427 THR 427 427 427 THR THR B . n 
B 1 428 VAL 428 428 428 VAL VAL B . n 
B 1 429 LEU 429 429 429 LEU LEU B . n 
B 1 430 LYS 430 430 430 LYS LYS B . n 
B 1 431 ALA 431 431 431 ALA ALA B . n 
B 1 432 LEU 432 432 432 LEU LEU B . n 
B 1 433 ILE 433 433 433 ILE ILE B . n 
B 1 434 GLY 434 434 434 GLY GLY B . n 
B 1 435 LEU 435 435 435 LEU LEU B . n 
B 1 436 ASP 436 436 436 ASP ASP B . n 
B 1 437 ARG 437 437 437 ARG ARG B . n 
B 1 438 GLY 438 438 438 GLY GLY B . n 
B 1 439 GLY 439 439 439 GLY GLY B . n 
B 1 440 ASP 440 440 440 ASP ASP B . n 
B 1 441 CYS 441 441 441 CYS CYS B . n 
B 1 442 TYR 442 442 442 TYR TYR B . n 
B 1 443 PRO 443 443 443 PRO PRO B . n 
B 1 444 ASP 444 444 444 ASP ASP B . n 
B 1 445 PRO 445 445 445 PRO PRO B . n 
B 1 446 VAL 446 446 446 VAL VAL B . n 
B 1 447 TYR 447 447 447 TYR TYR B . n 
B 1 448 PRO 448 448 448 PRO PRO B . n 
B 1 449 ASP 449 449 449 ASP ASP B . n 
B 1 450 ASP 450 450 450 ASP ASP B . n 
B 1 451 ASP 451 451 451 ASP ASP B . n 
B 1 452 GLY 452 452 452 GLY GLY B . n 
B 1 453 LEU 453 453 453 LEU LEU B . n 
B 1 454 LYS 454 454 454 LYS LYS B . n 
B 1 455 LEU 455 455 455 LEU LEU B . n 
B 1 456 ILE 456 456 456 ILE ILE B . n 
B 1 457 ASP 457 457 457 ASP ASP B . n 
B 1 458 PHE 458 458 458 PHE PHE B . n 
B 1 459 ARG 459 459 459 ARG ARG B . n 
B 1 460 GLY 460 460 460 GLY GLY B . n 
B 1 461 SER 461 461 461 SER SER B . n 
B 1 462 CYS 462 462 462 CYS CYS B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 THR 464 464 464 THR THR B . n 
B 1 465 PHE 465 465 465 PHE PHE B . n 
B 1 466 GLU 466 466 466 GLU GLU B . n 
B 1 467 GLY 467 467 467 GLY GLY B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 ILE 469 469 469 ILE ILE B . n 
B 1 470 ASN 470 470 470 ASN ASN B . n 
B 1 471 LYS 471 471 471 LYS LYS B . n 
B 1 472 LEU 472 472 472 LEU LEU B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 VAL 474 474 474 VAL VAL B . n 
B 1 475 ASN 475 475 475 ASN ASN B . n 
B 1 476 VAL 476 476 476 VAL VAL B . n 
B 1 477 ALA 477 477 477 ALA ALA B . n 
B 1 478 PHE 478 478 478 PHE PHE B . n 
B 1 479 GLY 479 479 479 GLY GLY B . n 
B 1 480 ARG 480 480 480 ARG ARG B . n 
B 1 481 GLN 481 481 481 GLN GLN B . n 
B 1 482 MET 482 482 482 MET MET B . n 
B 1 483 LEU 483 483 483 LEU LEU B . n 
B 1 484 GLY 484 484 484 GLY GLY B . n 
B 1 485 ILE 485 485 485 ILE ILE B . n 
B 1 486 HIS 486 486 486 HIS HIS B . n 
B 1 487 TYR 487 487 487 TYR TYR B . n 
B 1 488 ARG 488 488 488 ARG ARG B . n 
B 1 489 PHE 489 489 489 PHE PHE B . n 
B 1 490 ASP 490 490 490 ASP ASP B . n 
B 1 491 GLY 491 491 491 GLY GLY B . n 
B 1 492 ILE 492 492 492 ILE ILE B . n 
B 1 493 GLN 493 493 493 GLN GLN B . n 
B 1 494 GLY 494 494 494 GLY GLY B . n 
B 1 495 LEU 495 495 495 LEU LEU B . n 
B 1 496 LEU 496 496 496 LEU LEU B . n 
B 1 497 LEU 497 497 497 LEU LEU B . n 
B 1 498 GLY 498 498 498 GLY GLY B . n 
B 1 499 GLU 499 499 499 GLU GLU B . n 
B 1 500 THR 500 500 500 THR THR B . n 
B 1 501 ILE 501 501 501 ILE ILE B . n 
B 1 502 THR 502 502 502 THR THR B . n 
B 1 503 VAL 503 503 503 VAL VAL B . n 
B 1 504 ARG 504 504 504 ARG ARG B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 LEU 506 506 506 LEU LEU B . n 
B 1 507 HIS 507 507 507 HIS HIS B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLU 509 509 509 GLU GLU B . n 
B 1 510 LEU 510 510 510 LEU LEU B . n 
B 1 511 MET 511 511 511 MET MET B . n 
B 1 512 THR 512 512 512 THR THR B . n 
B 1 513 PHE 513 513 513 PHE PHE B . n 
B 1 514 ALA 514 514 514 ALA ALA B . n 
B 1 515 GLU 515 515 515 GLU GLU B . n 
B 1 516 GLU 516 516 516 GLU GLU B . n 
B 1 517 SER 517 517 517 SER SER B . n 
B 1 518 THR 518 518 518 THR THR B . n 
B 1 519 PHE 519 519 519 PHE PHE B . n 
B 1 520 GLU 520 520 520 GLU GLU B . n 
B 1 521 PHE 521 521 521 PHE PHE B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 LEU 523 523 523 LEU LEU B . n 
B 1 524 PHE 524 524 524 PHE PHE B . n 
B 1 525 THR 525 525 525 THR THR B . n 
B 1 526 GLY 526 526 526 GLY GLY B . n 
B 1 527 GLU 527 527 527 GLU GLU B . n 
B 1 528 VAL 528 528 528 VAL VAL B . n 
B 1 529 ILE 529 529 529 ILE ILE B . n 
B 1 530 LYS 530 530 530 LYS LYS B . n 
B 1 531 LEU 531 531 531 LEU LEU B . n 
B 1 532 PHE 532 532 532 PHE PHE B . n 
B 1 533 GLN 533 533 533 GLN GLN B . n 
B 1 534 ASP 534 534 534 ASP ASP B . n 
B 1 535 GLY 535 535 535 GLY GLY B . n 
B 1 536 THR 536 536 536 THR THR B . n 
B 1 537 PHE 537 537 537 PHE PHE B . n 
B 1 538 THR 538 538 538 THR THR B . n 
B 1 539 ILE 539 539 539 ILE ILE B . n 
B 1 540 ASP 540 540 540 ASP ASP B . n 
B 1 541 GLY 541 541 541 GLY GLY B . n 
B 1 542 PHE 542 542 542 PHE PHE B . n 
B 1 543 LYS 543 543 543 LYS LYS B . n 
B 1 544 CYS 544 544 544 CYS CYS B . n 
B 1 545 PRO 545 545 545 PRO PRO B . n 
B 1 546 GLY 546 546 546 GLY GLY B . n 
B 1 547 LEU 547 547 547 LEU LEU B . n 
B 1 548 VAL 548 548 548 VAL VAL B . n 
B 1 549 TYR 549 549 549 TYR TYR B . n 
B 1 550 THR 550 550 550 THR THR B . n 
B 1 551 GLY 551 551 551 GLY GLY B . n 
B 1 552 VAL 552 552 552 VAL VAL B . n 
B 1 553 GLU 553 553 553 GLU GLU B . n 
B 1 554 ASN 554 554 554 ASN ASN B . n 
B 1 555 CYS 555 555 555 CYS CYS B . n 
B 1 556 VAL 556 556 556 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 VO4 1   600  600  VO4 VO4 A . 
D 3 IOD 1   601  601  IOD IOD A . 
E 3 IOD 1   602  602  IOD IOD A . 
F 3 IOD 1   603  603  IOD IOD A . 
G 2 VO4 1   600  600  VO4 VO4 B . 
H 3 IOD 1   601  601  IOD IOD B . 
I 3 IOD 1   602  602  IOD IOD B . 
J 4 HOH 1   604  1    HOH HOH A . 
J 4 HOH 2   605  2    HOH HOH A . 
J 4 HOH 3   606  3    HOH HOH A . 
J 4 HOH 4   607  4    HOH HOH A . 
J 4 HOH 5   608  5    HOH HOH A . 
J 4 HOH 6   609  7    HOH HOH A . 
J 4 HOH 7   610  8    HOH HOH A . 
J 4 HOH 8   611  9    HOH HOH A . 
J 4 HOH 9   612  10   HOH HOH A . 
J 4 HOH 10  613  11   HOH HOH A . 
J 4 HOH 11  614  12   HOH HOH A . 
J 4 HOH 12  615  14   HOH HOH A . 
J 4 HOH 13  616  15   HOH HOH A . 
J 4 HOH 14  617  16   HOH HOH A . 
J 4 HOH 15  618  17   HOH HOH A . 
J 4 HOH 16  619  18   HOH HOH A . 
J 4 HOH 17  620  19   HOH HOH A . 
J 4 HOH 18  621  20   HOH HOH A . 
J 4 HOH 19  622  21   HOH HOH A . 
J 4 HOH 20  623  22   HOH HOH A . 
J 4 HOH 21  624  23   HOH HOH A . 
J 4 HOH 22  625  24   HOH HOH A . 
J 4 HOH 23  626  25   HOH HOH A . 
J 4 HOH 24  627  26   HOH HOH A . 
J 4 HOH 25  628  27   HOH HOH A . 
J 4 HOH 26  629  28   HOH HOH A . 
J 4 HOH 27  630  29   HOH HOH A . 
J 4 HOH 28  631  30   HOH HOH A . 
J 4 HOH 29  632  31   HOH HOH A . 
J 4 HOH 30  633  32   HOH HOH A . 
J 4 HOH 31  634  33   HOH HOH A . 
J 4 HOH 32  635  34   HOH HOH A . 
J 4 HOH 33  636  35   HOH HOH A . 
J 4 HOH 34  637  36   HOH HOH A . 
J 4 HOH 35  638  37   HOH HOH A . 
J 4 HOH 36  639  38   HOH HOH A . 
J 4 HOH 37  640  39   HOH HOH A . 
J 4 HOH 38  641  40   HOH HOH A . 
J 4 HOH 39  642  41   HOH HOH A . 
J 4 HOH 40  643  42   HOH HOH A . 
J 4 HOH 41  644  43   HOH HOH A . 
J 4 HOH 42  645  45   HOH HOH A . 
J 4 HOH 43  646  46   HOH HOH A . 
J 4 HOH 44  647  47   HOH HOH A . 
J 4 HOH 45  648  48   HOH HOH A . 
J 4 HOH 46  649  49   HOH HOH A . 
J 4 HOH 47  650  51   HOH HOH A . 
J 4 HOH 48  651  52   HOH HOH A . 
J 4 HOH 49  652  53   HOH HOH A . 
J 4 HOH 50  653  54   HOH HOH A . 
J 4 HOH 51  654  55   HOH HOH A . 
J 4 HOH 52  655  56   HOH HOH A . 
J 4 HOH 53  656  57   HOH HOH A . 
J 4 HOH 54  657  58   HOH HOH A . 
J 4 HOH 55  658  59   HOH HOH A . 
J 4 HOH 56  659  60   HOH HOH A . 
J 4 HOH 57  660  61   HOH HOH A . 
J 4 HOH 58  661  62   HOH HOH A . 
J 4 HOH 59  662  63   HOH HOH A . 
J 4 HOH 60  663  64   HOH HOH A . 
J 4 HOH 61  664  65   HOH HOH A . 
J 4 HOH 62  665  66   HOH HOH A . 
J 4 HOH 63  666  67   HOH HOH A . 
J 4 HOH 64  667  68   HOH HOH A . 
J 4 HOH 65  668  69   HOH HOH A . 
J 4 HOH 66  669  70   HOH HOH A . 
J 4 HOH 67  670  71   HOH HOH A . 
J 4 HOH 68  671  72   HOH HOH A . 
J 4 HOH 69  672  73   HOH HOH A . 
J 4 HOH 70  673  74   HOH HOH A . 
J 4 HOH 71  674  75   HOH HOH A . 
J 4 HOH 72  675  76   HOH HOH A . 
J 4 HOH 73  676  77   HOH HOH A . 
J 4 HOH 74  677  78   HOH HOH A . 
J 4 HOH 75  678  79   HOH HOH A . 
J 4 HOH 76  679  80   HOH HOH A . 
J 4 HOH 77  680  81   HOH HOH A . 
J 4 HOH 78  681  82   HOH HOH A . 
J 4 HOH 79  682  83   HOH HOH A . 
J 4 HOH 80  683  84   HOH HOH A . 
J 4 HOH 81  684  85   HOH HOH A . 
J 4 HOH 82  685  86   HOH HOH A . 
J 4 HOH 83  686  87   HOH HOH A . 
J 4 HOH 84  687  88   HOH HOH A . 
J 4 HOH 85  688  89   HOH HOH A . 
J 4 HOH 86  689  90   HOH HOH A . 
J 4 HOH 87  690  91   HOH HOH A . 
J 4 HOH 88  691  92   HOH HOH A . 
J 4 HOH 89  692  93   HOH HOH A . 
J 4 HOH 90  693  94   HOH HOH A . 
J 4 HOH 91  694  95   HOH HOH A . 
J 4 HOH 92  695  96   HOH HOH A . 
J 4 HOH 93  696  97   HOH HOH A . 
J 4 HOH 94  697  98   HOH HOH A . 
J 4 HOH 95  698  99   HOH HOH A . 
J 4 HOH 96  699  100  HOH HOH A . 
J 4 HOH 97  700  101  HOH HOH A . 
J 4 HOH 98  701  102  HOH HOH A . 
J 4 HOH 99  702  103  HOH HOH A . 
J 4 HOH 100 703  104  HOH HOH A . 
J 4 HOH 101 704  105  HOH HOH A . 
J 4 HOH 102 705  106  HOH HOH A . 
J 4 HOH 103 706  107  HOH HOH A . 
J 4 HOH 104 707  108  HOH HOH A . 
J 4 HOH 105 708  109  HOH HOH A . 
J 4 HOH 106 709  110  HOH HOH A . 
J 4 HOH 107 710  111  HOH HOH A . 
J 4 HOH 108 711  112  HOH HOH A . 
J 4 HOH 109 712  113  HOH HOH A . 
J 4 HOH 110 713  114  HOH HOH A . 
J 4 HOH 111 714  115  HOH HOH A . 
J 4 HOH 112 715  116  HOH HOH A . 
J 4 HOH 113 716  117  HOH HOH A . 
J 4 HOH 114 717  118  HOH HOH A . 
J 4 HOH 115 718  119  HOH HOH A . 
J 4 HOH 116 719  120  HOH HOH A . 
J 4 HOH 117 720  121  HOH HOH A . 
J 4 HOH 118 721  122  HOH HOH A . 
J 4 HOH 119 722  123  HOH HOH A . 
J 4 HOH 120 723  124  HOH HOH A . 
J 4 HOH 121 724  125  HOH HOH A . 
J 4 HOH 122 725  126  HOH HOH A . 
J 4 HOH 123 726  127  HOH HOH A . 
J 4 HOH 124 727  129  HOH HOH A . 
J 4 HOH 125 728  130  HOH HOH A . 
J 4 HOH 126 729  131  HOH HOH A . 
J 4 HOH 127 730  132  HOH HOH A . 
J 4 HOH 128 731  133  HOH HOH A . 
J 4 HOH 129 732  134  HOH HOH A . 
J 4 HOH 130 733  135  HOH HOH A . 
J 4 HOH 131 734  136  HOH HOH A . 
J 4 HOH 132 735  137  HOH HOH A . 
J 4 HOH 133 736  138  HOH HOH A . 
J 4 HOH 134 737  139  HOH HOH A . 
J 4 HOH 135 738  140  HOH HOH A . 
J 4 HOH 136 739  141  HOH HOH A . 
J 4 HOH 137 740  142  HOH HOH A . 
J 4 HOH 138 741  143  HOH HOH A . 
J 4 HOH 139 742  144  HOH HOH A . 
J 4 HOH 140 743  145  HOH HOH A . 
J 4 HOH 141 744  146  HOH HOH A . 
J 4 HOH 142 745  147  HOH HOH A . 
J 4 HOH 143 746  148  HOH HOH A . 
J 4 HOH 144 747  149  HOH HOH A . 
J 4 HOH 145 748  150  HOH HOH A . 
J 4 HOH 146 749  151  HOH HOH A . 
J 4 HOH 147 750  152  HOH HOH A . 
J 4 HOH 148 751  153  HOH HOH A . 
J 4 HOH 149 752  154  HOH HOH A . 
J 4 HOH 150 753  155  HOH HOH A . 
J 4 HOH 151 754  156  HOH HOH A . 
J 4 HOH 152 755  157  HOH HOH A . 
J 4 HOH 153 756  158  HOH HOH A . 
J 4 HOH 154 757  159  HOH HOH A . 
J 4 HOH 155 758  160  HOH HOH A . 
J 4 HOH 156 759  161  HOH HOH A . 
J 4 HOH 157 760  162  HOH HOH A . 
J 4 HOH 158 761  163  HOH HOH A . 
J 4 HOH 159 762  164  HOH HOH A . 
J 4 HOH 160 763  165  HOH HOH A . 
J 4 HOH 161 764  166  HOH HOH A . 
J 4 HOH 162 765  167  HOH HOH A . 
J 4 HOH 163 766  168  HOH HOH A . 
J 4 HOH 164 767  169  HOH HOH A . 
J 4 HOH 165 768  170  HOH HOH A . 
J 4 HOH 166 769  171  HOH HOH A . 
J 4 HOH 167 770  172  HOH HOH A . 
J 4 HOH 168 771  173  HOH HOH A . 
J 4 HOH 169 772  174  HOH HOH A . 
J 4 HOH 170 773  175  HOH HOH A . 
J 4 HOH 171 774  176  HOH HOH A . 
J 4 HOH 172 775  177  HOH HOH A . 
J 4 HOH 173 776  178  HOH HOH A . 
J 4 HOH 174 777  179  HOH HOH A . 
J 4 HOH 175 778  180  HOH HOH A . 
J 4 HOH 176 779  181  HOH HOH A . 
J 4 HOH 177 780  182  HOH HOH A . 
J 4 HOH 178 781  183  HOH HOH A . 
J 4 HOH 179 782  184  HOH HOH A . 
J 4 HOH 180 783  185  HOH HOH A . 
J 4 HOH 181 784  186  HOH HOH A . 
J 4 HOH 182 785  187  HOH HOH A . 
J 4 HOH 183 786  188  HOH HOH A . 
J 4 HOH 184 787  189  HOH HOH A . 
J 4 HOH 185 788  190  HOH HOH A . 
J 4 HOH 186 789  191  HOH HOH A . 
J 4 HOH 187 790  192  HOH HOH A . 
J 4 HOH 188 791  193  HOH HOH A . 
J 4 HOH 189 792  194  HOH HOH A . 
J 4 HOH 190 793  195  HOH HOH A . 
J 4 HOH 191 794  196  HOH HOH A . 
J 4 HOH 192 795  197  HOH HOH A . 
J 4 HOH 193 796  198  HOH HOH A . 
J 4 HOH 194 797  199  HOH HOH A . 
J 4 HOH 195 798  200  HOH HOH A . 
J 4 HOH 196 799  201  HOH HOH A . 
J 4 HOH 197 800  202  HOH HOH A . 
J 4 HOH 198 801  203  HOH HOH A . 
J 4 HOH 199 802  204  HOH HOH A . 
J 4 HOH 200 803  205  HOH HOH A . 
J 4 HOH 201 804  206  HOH HOH A . 
J 4 HOH 202 805  207  HOH HOH A . 
J 4 HOH 203 806  208  HOH HOH A . 
J 4 HOH 204 807  209  HOH HOH A . 
J 4 HOH 205 808  210  HOH HOH A . 
J 4 HOH 206 809  211  HOH HOH A . 
J 4 HOH 207 810  212  HOH HOH A . 
J 4 HOH 208 811  213  HOH HOH A . 
J 4 HOH 209 812  214  HOH HOH A . 
J 4 HOH 210 813  215  HOH HOH A . 
J 4 HOH 211 814  216  HOH HOH A . 
J 4 HOH 212 815  217  HOH HOH A . 
J 4 HOH 213 816  218  HOH HOH A . 
J 4 HOH 214 817  219  HOH HOH A . 
J 4 HOH 215 818  220  HOH HOH A . 
J 4 HOH 216 819  221  HOH HOH A . 
J 4 HOH 217 820  222  HOH HOH A . 
J 4 HOH 218 821  223  HOH HOH A . 
J 4 HOH 219 822  224  HOH HOH A . 
J 4 HOH 220 823  225  HOH HOH A . 
J 4 HOH 221 824  226  HOH HOH A . 
J 4 HOH 222 825  227  HOH HOH A . 
J 4 HOH 223 826  228  HOH HOH A . 
J 4 HOH 224 827  229  HOH HOH A . 
J 4 HOH 225 828  230  HOH HOH A . 
J 4 HOH 226 829  231  HOH HOH A . 
J 4 HOH 227 830  232  HOH HOH A . 
J 4 HOH 228 831  233  HOH HOH A . 
J 4 HOH 229 832  234  HOH HOH A . 
J 4 HOH 230 833  235  HOH HOH A . 
J 4 HOH 231 834  236  HOH HOH A . 
J 4 HOH 232 835  237  HOH HOH A . 
J 4 HOH 233 836  238  HOH HOH A . 
J 4 HOH 234 837  239  HOH HOH A . 
J 4 HOH 235 838  240  HOH HOH A . 
J 4 HOH 236 839  241  HOH HOH A . 
J 4 HOH 237 840  242  HOH HOH A . 
J 4 HOH 238 841  243  HOH HOH A . 
J 4 HOH 239 842  244  HOH HOH A . 
J 4 HOH 240 843  245  HOH HOH A . 
J 4 HOH 241 844  246  HOH HOH A . 
J 4 HOH 242 845  247  HOH HOH A . 
J 4 HOH 243 846  248  HOH HOH A . 
J 4 HOH 244 847  249  HOH HOH A . 
J 4 HOH 245 848  250  HOH HOH A . 
J 4 HOH 246 849  251  HOH HOH A . 
J 4 HOH 247 850  252  HOH HOH A . 
J 4 HOH 248 851  253  HOH HOH A . 
J 4 HOH 249 852  254  HOH HOH A . 
J 4 HOH 250 853  255  HOH HOH A . 
J 4 HOH 251 854  256  HOH HOH A . 
J 4 HOH 252 855  257  HOH HOH A . 
J 4 HOH 253 856  258  HOH HOH A . 
J 4 HOH 254 857  259  HOH HOH A . 
J 4 HOH 255 858  260  HOH HOH A . 
J 4 HOH 256 859  261  HOH HOH A . 
J 4 HOH 257 860  262  HOH HOH A . 
J 4 HOH 258 861  263  HOH HOH A . 
J 4 HOH 259 862  264  HOH HOH A . 
J 4 HOH 260 863  265  HOH HOH A . 
J 4 HOH 261 864  266  HOH HOH A . 
J 4 HOH 262 865  267  HOH HOH A . 
J 4 HOH 263 866  268  HOH HOH A . 
J 4 HOH 264 867  269  HOH HOH A . 
J 4 HOH 265 868  270  HOH HOH A . 
J 4 HOH 266 869  271  HOH HOH A . 
J 4 HOH 267 870  272  HOH HOH A . 
J 4 HOH 268 871  273  HOH HOH A . 
J 4 HOH 269 872  274  HOH HOH A . 
J 4 HOH 270 873  275  HOH HOH A . 
J 4 HOH 271 874  276  HOH HOH A . 
J 4 HOH 272 875  277  HOH HOH A . 
J 4 HOH 273 876  278  HOH HOH A . 
J 4 HOH 274 877  279  HOH HOH A . 
J 4 HOH 275 878  280  HOH HOH A . 
J 4 HOH 276 879  281  HOH HOH A . 
J 4 HOH 277 880  282  HOH HOH A . 
J 4 HOH 278 881  283  HOH HOH A . 
J 4 HOH 279 882  284  HOH HOH A . 
J 4 HOH 280 883  285  HOH HOH A . 
J 4 HOH 281 884  286  HOH HOH A . 
J 4 HOH 282 885  287  HOH HOH A . 
J 4 HOH 283 886  288  HOH HOH A . 
J 4 HOH 284 887  289  HOH HOH A . 
J 4 HOH 285 888  290  HOH HOH A . 
J 4 HOH 286 889  291  HOH HOH A . 
J 4 HOH 287 890  292  HOH HOH A . 
J 4 HOH 288 891  293  HOH HOH A . 
J 4 HOH 289 892  294  HOH HOH A . 
J 4 HOH 290 893  295  HOH HOH A . 
J 4 HOH 291 894  296  HOH HOH A . 
J 4 HOH 292 895  297  HOH HOH A . 
J 4 HOH 293 896  298  HOH HOH A . 
J 4 HOH 294 897  299  HOH HOH A . 
J 4 HOH 295 898  300  HOH HOH A . 
J 4 HOH 296 899  301  HOH HOH A . 
J 4 HOH 297 900  302  HOH HOH A . 
J 4 HOH 298 901  303  HOH HOH A . 
J 4 HOH 299 902  304  HOH HOH A . 
J 4 HOH 300 903  305  HOH HOH A . 
J 4 HOH 301 904  306  HOH HOH A . 
J 4 HOH 302 905  307  HOH HOH A . 
J 4 HOH 303 906  308  HOH HOH A . 
J 4 HOH 304 907  309  HOH HOH A . 
J 4 HOH 305 908  310  HOH HOH A . 
J 4 HOH 306 909  311  HOH HOH A . 
J 4 HOH 307 910  312  HOH HOH A . 
J 4 HOH 308 911  314  HOH HOH A . 
J 4 HOH 309 912  315  HOH HOH A . 
J 4 HOH 310 913  316  HOH HOH A . 
J 4 HOH 311 914  317  HOH HOH A . 
J 4 HOH 312 915  318  HOH HOH A . 
J 4 HOH 313 916  319  HOH HOH A . 
J 4 HOH 314 917  320  HOH HOH A . 
J 4 HOH 315 918  321  HOH HOH A . 
J 4 HOH 316 919  322  HOH HOH A . 
J 4 HOH 317 920  323  HOH HOH A . 
J 4 HOH 318 921  324  HOH HOH A . 
J 4 HOH 319 922  325  HOH HOH A . 
J 4 HOH 320 923  326  HOH HOH A . 
J 4 HOH 321 924  327  HOH HOH A . 
J 4 HOH 322 925  328  HOH HOH A . 
J 4 HOH 323 926  329  HOH HOH A . 
J 4 HOH 324 927  331  HOH HOH A . 
J 4 HOH 325 928  332  HOH HOH A . 
J 4 HOH 326 929  333  HOH HOH A . 
J 4 HOH 327 930  334  HOH HOH A . 
J 4 HOH 328 931  335  HOH HOH A . 
J 4 HOH 329 932  336  HOH HOH A . 
J 4 HOH 330 933  337  HOH HOH A . 
J 4 HOH 331 934  338  HOH HOH A . 
J 4 HOH 332 935  339  HOH HOH A . 
J 4 HOH 333 936  340  HOH HOH A . 
J 4 HOH 334 937  341  HOH HOH A . 
J 4 HOH 335 938  342  HOH HOH A . 
J 4 HOH 336 939  343  HOH HOH A . 
J 4 HOH 337 940  344  HOH HOH A . 
J 4 HOH 338 941  345  HOH HOH A . 
J 4 HOH 339 942  346  HOH HOH A . 
J 4 HOH 340 943  347  HOH HOH A . 
J 4 HOH 341 944  348  HOH HOH A . 
J 4 HOH 342 945  349  HOH HOH A . 
J 4 HOH 343 946  350  HOH HOH A . 
J 4 HOH 344 947  351  HOH HOH A . 
J 4 HOH 345 948  352  HOH HOH A . 
J 4 HOH 346 949  353  HOH HOH A . 
J 4 HOH 347 950  354  HOH HOH A . 
J 4 HOH 348 951  355  HOH HOH A . 
J 4 HOH 349 952  356  HOH HOH A . 
J 4 HOH 350 953  357  HOH HOH A . 
J 4 HOH 351 954  358  HOH HOH A . 
J 4 HOH 352 955  359  HOH HOH A . 
J 4 HOH 353 956  360  HOH HOH A . 
J 4 HOH 354 957  361  HOH HOH A . 
J 4 HOH 355 958  362  HOH HOH A . 
J 4 HOH 356 959  363  HOH HOH A . 
J 4 HOH 357 960  364  HOH HOH A . 
J 4 HOH 358 961  365  HOH HOH A . 
J 4 HOH 359 962  366  HOH HOH A . 
J 4 HOH 360 963  367  HOH HOH A . 
J 4 HOH 361 964  368  HOH HOH A . 
J 4 HOH 362 965  369  HOH HOH A . 
J 4 HOH 363 966  370  HOH HOH A . 
J 4 HOH 364 967  371  HOH HOH A . 
J 4 HOH 365 968  372  HOH HOH A . 
J 4 HOH 366 969  373  HOH HOH A . 
J 4 HOH 367 970  374  HOH HOH A . 
J 4 HOH 368 971  375  HOH HOH A . 
J 4 HOH 369 972  376  HOH HOH A . 
J 4 HOH 370 973  377  HOH HOH A . 
J 4 HOH 371 974  378  HOH HOH A . 
J 4 HOH 372 975  379  HOH HOH A . 
J 4 HOH 373 976  380  HOH HOH A . 
J 4 HOH 374 977  381  HOH HOH A . 
J 4 HOH 375 978  382  HOH HOH A . 
J 4 HOH 376 979  383  HOH HOH A . 
J 4 HOH 377 980  384  HOH HOH A . 
J 4 HOH 378 981  385  HOH HOH A . 
J 4 HOH 379 982  386  HOH HOH A . 
J 4 HOH 380 983  387  HOH HOH A . 
J 4 HOH 381 984  388  HOH HOH A . 
J 4 HOH 382 985  389  HOH HOH A . 
J 4 HOH 383 986  390  HOH HOH A . 
J 4 HOH 384 987  391  HOH HOH A . 
J 4 HOH 385 988  392  HOH HOH A . 
J 4 HOH 386 989  393  HOH HOH A . 
J 4 HOH 387 990  394  HOH HOH A . 
J 4 HOH 388 991  395  HOH HOH A . 
J 4 HOH 389 992  396  HOH HOH A . 
J 4 HOH 390 993  397  HOH HOH A . 
J 4 HOH 391 994  398  HOH HOH A . 
J 4 HOH 392 995  399  HOH HOH A . 
J 4 HOH 393 996  400  HOH HOH A . 
J 4 HOH 394 997  401  HOH HOH A . 
J 4 HOH 395 998  402  HOH HOH A . 
J 4 HOH 396 999  403  HOH HOH A . 
J 4 HOH 397 1000 404  HOH HOH A . 
J 4 HOH 398 1001 405  HOH HOH A . 
J 4 HOH 399 1002 406  HOH HOH A . 
J 4 HOH 400 1003 407  HOH HOH A . 
J 4 HOH 401 1004 408  HOH HOH A . 
J 4 HOH 402 1005 409  HOH HOH A . 
J 4 HOH 403 1006 410  HOH HOH A . 
J 4 HOH 404 1007 411  HOH HOH A . 
J 4 HOH 405 1008 412  HOH HOH A . 
J 4 HOH 406 1009 413  HOH HOH A . 
J 4 HOH 407 1010 414  HOH HOH A . 
J 4 HOH 408 1011 415  HOH HOH A . 
J 4 HOH 409 1012 416  HOH HOH A . 
J 4 HOH 410 1013 417  HOH HOH A . 
J 4 HOH 411 1014 418  HOH HOH A . 
J 4 HOH 412 1015 419  HOH HOH A . 
J 4 HOH 413 1016 420  HOH HOH A . 
J 4 HOH 414 1017 421  HOH HOH A . 
J 4 HOH 415 1018 422  HOH HOH A . 
J 4 HOH 416 1019 423  HOH HOH A . 
J 4 HOH 417 1020 424  HOH HOH A . 
J 4 HOH 418 1021 425  HOH HOH A . 
J 4 HOH 419 1022 426  HOH HOH A . 
J 4 HOH 420 1023 427  HOH HOH A . 
J 4 HOH 421 1024 428  HOH HOH A . 
J 4 HOH 422 1025 430  HOH HOH A . 
J 4 HOH 423 1026 431  HOH HOH A . 
J 4 HOH 424 1027 432  HOH HOH A . 
J 4 HOH 425 1028 433  HOH HOH A . 
J 4 HOH 426 1029 434  HOH HOH A . 
J 4 HOH 427 1030 435  HOH HOH A . 
J 4 HOH 428 1031 436  HOH HOH A . 
J 4 HOH 429 1032 437  HOH HOH A . 
J 4 HOH 430 1033 438  HOH HOH A . 
J 4 HOH 431 1034 439  HOH HOH A . 
J 4 HOH 432 1035 440  HOH HOH A . 
J 4 HOH 433 1036 441  HOH HOH A . 
J 4 HOH 434 1037 442  HOH HOH A . 
J 4 HOH 435 1038 443  HOH HOH A . 
J 4 HOH 436 1039 444  HOH HOH A . 
J 4 HOH 437 1040 445  HOH HOH A . 
J 4 HOH 438 1041 446  HOH HOH A . 
J 4 HOH 439 1042 447  HOH HOH A . 
J 4 HOH 440 1043 448  HOH HOH A . 
J 4 HOH 441 1044 449  HOH HOH A . 
J 4 HOH 442 1045 450  HOH HOH A . 
J 4 HOH 443 1046 451  HOH HOH A . 
J 4 HOH 444 1047 452  HOH HOH A . 
J 4 HOH 445 1048 453  HOH HOH A . 
J 4 HOH 446 1049 454  HOH HOH A . 
J 4 HOH 447 1050 455  HOH HOH A . 
J 4 HOH 448 1051 456  HOH HOH A . 
J 4 HOH 449 1052 457  HOH HOH A . 
J 4 HOH 450 1053 458  HOH HOH A . 
J 4 HOH 451 1054 459  HOH HOH A . 
J 4 HOH 452 1055 460  HOH HOH A . 
J 4 HOH 453 1056 461  HOH HOH A . 
J 4 HOH 454 1057 462  HOH HOH A . 
J 4 HOH 455 1058 463  HOH HOH A . 
J 4 HOH 456 1059 464  HOH HOH A . 
J 4 HOH 457 1060 465  HOH HOH A . 
J 4 HOH 458 1061 466  HOH HOH A . 
J 4 HOH 459 1062 467  HOH HOH A . 
J 4 HOH 460 1063 468  HOH HOH A . 
J 4 HOH 461 1064 469  HOH HOH A . 
J 4 HOH 462 1065 470  HOH HOH A . 
J 4 HOH 463 1066 471  HOH HOH A . 
J 4 HOH 464 1067 472  HOH HOH A . 
J 4 HOH 465 1068 473  HOH HOH A . 
J 4 HOH 466 1069 474  HOH HOH A . 
J 4 HOH 467 1070 475  HOH HOH A . 
J 4 HOH 468 1071 476  HOH HOH A . 
J 4 HOH 469 1072 477  HOH HOH A . 
J 4 HOH 470 1073 478  HOH HOH A . 
J 4 HOH 471 1074 479  HOH HOH A . 
J 4 HOH 472 1075 480  HOH HOH A . 
J 4 HOH 473 1076 481  HOH HOH A . 
J 4 HOH 474 1077 482  HOH HOH A . 
J 4 HOH 475 1078 483  HOH HOH A . 
J 4 HOH 476 1079 484  HOH HOH A . 
J 4 HOH 477 1080 485  HOH HOH A . 
J 4 HOH 478 1081 486  HOH HOH A . 
J 4 HOH 479 1082 487  HOH HOH A . 
J 4 HOH 480 1083 488  HOH HOH A . 
J 4 HOH 481 1084 489  HOH HOH A . 
J 4 HOH 482 1085 490  HOH HOH A . 
J 4 HOH 483 1086 491  HOH HOH A . 
J 4 HOH 484 1087 492  HOH HOH A . 
J 4 HOH 485 1088 493  HOH HOH A . 
J 4 HOH 486 1089 494  HOH HOH A . 
J 4 HOH 487 1090 495  HOH HOH A . 
J 4 HOH 488 1091 496  HOH HOH A . 
J 4 HOH 489 1092 497  HOH HOH A . 
J 4 HOH 490 1093 498  HOH HOH A . 
J 4 HOH 491 1094 499  HOH HOH A . 
J 4 HOH 492 1095 500  HOH HOH A . 
J 4 HOH 493 1096 501  HOH HOH A . 
J 4 HOH 494 1097 502  HOH HOH A . 
J 4 HOH 495 1098 503  HOH HOH A . 
J 4 HOH 496 1099 504  HOH HOH A . 
J 4 HOH 497 1100 505  HOH HOH A . 
J 4 HOH 498 1101 506  HOH HOH A . 
J 4 HOH 499 1102 507  HOH HOH A . 
J 4 HOH 500 1103 508  HOH HOH A . 
J 4 HOH 501 1104 509  HOH HOH A . 
J 4 HOH 502 1105 510  HOH HOH A . 
J 4 HOH 503 1106 511  HOH HOH A . 
J 4 HOH 504 1107 512  HOH HOH A . 
J 4 HOH 505 1108 513  HOH HOH A . 
J 4 HOH 506 1109 514  HOH HOH A . 
J 4 HOH 507 1110 515  HOH HOH A . 
J 4 HOH 508 1111 516  HOH HOH A . 
J 4 HOH 509 1112 517  HOH HOH A . 
J 4 HOH 510 1113 518  HOH HOH A . 
J 4 HOH 511 1114 519  HOH HOH A . 
J 4 HOH 512 1115 520  HOH HOH A . 
J 4 HOH 513 1116 521  HOH HOH A . 
J 4 HOH 514 1117 523  HOH HOH A . 
J 4 HOH 515 1118 524  HOH HOH A . 
J 4 HOH 516 1119 525  HOH HOH A . 
J 4 HOH 517 1120 526  HOH HOH A . 
J 4 HOH 518 1121 527  HOH HOH A . 
J 4 HOH 519 1122 528  HOH HOH A . 
J 4 HOH 520 1123 529  HOH HOH A . 
J 4 HOH 521 1124 530  HOH HOH A . 
J 4 HOH 522 1125 531  HOH HOH A . 
J 4 HOH 523 1126 532  HOH HOH A . 
J 4 HOH 524 1127 533  HOH HOH A . 
J 4 HOH 525 1128 534  HOH HOH A . 
J 4 HOH 526 1129 535  HOH HOH A . 
J 4 HOH 527 1130 536  HOH HOH A . 
J 4 HOH 528 1131 537  HOH HOH A . 
J 4 HOH 529 1132 538  HOH HOH A . 
J 4 HOH 530 1133 539  HOH HOH A . 
J 4 HOH 531 1134 541  HOH HOH A . 
J 4 HOH 532 1135 544  HOH HOH A . 
J 4 HOH 533 1136 545  HOH HOH A . 
J 4 HOH 534 1137 546  HOH HOH A . 
J 4 HOH 535 1138 547  HOH HOH A . 
J 4 HOH 536 1139 548  HOH HOH A . 
J 4 HOH 537 1140 549  HOH HOH A . 
J 4 HOH 538 1141 551  HOH HOH A . 
J 4 HOH 539 1142 552  HOH HOH A . 
J 4 HOH 540 1143 553  HOH HOH A . 
J 4 HOH 541 1144 555  HOH HOH A . 
J 4 HOH 542 1145 556  HOH HOH A . 
J 4 HOH 543 1146 557  HOH HOH A . 
J 4 HOH 544 1147 558  HOH HOH A . 
J 4 HOH 545 1148 559  HOH HOH A . 
J 4 HOH 546 1149 560  HOH HOH A . 
J 4 HOH 547 1150 561  HOH HOH A . 
J 4 HOH 548 1151 562  HOH HOH A . 
J 4 HOH 549 1152 563  HOH HOH A . 
J 4 HOH 550 1153 564  HOH HOH A . 
J 4 HOH 551 1154 565  HOH HOH A . 
J 4 HOH 552 1155 566  HOH HOH A . 
J 4 HOH 553 1156 567  HOH HOH A . 
J 4 HOH 554 1157 568  HOH HOH A . 
J 4 HOH 555 1158 569  HOH HOH A . 
J 4 HOH 556 1159 570  HOH HOH A . 
J 4 HOH 557 1160 571  HOH HOH A . 
J 4 HOH 558 1161 573  HOH HOH A . 
J 4 HOH 559 1162 574  HOH HOH A . 
J 4 HOH 560 1163 575  HOH HOH A . 
J 4 HOH 561 1164 576  HOH HOH A . 
J 4 HOH 562 1165 577  HOH HOH A . 
J 4 HOH 563 1166 578  HOH HOH A . 
J 4 HOH 564 1167 579  HOH HOH A . 
J 4 HOH 565 1168 580  HOH HOH A . 
J 4 HOH 566 1169 581  HOH HOH A . 
J 4 HOH 567 1170 582  HOH HOH A . 
J 4 HOH 568 1171 583  HOH HOH A . 
J 4 HOH 569 1172 584  HOH HOH A . 
J 4 HOH 570 1173 585  HOH HOH A . 
J 4 HOH 571 1174 586  HOH HOH A . 
J 4 HOH 572 1175 587  HOH HOH A . 
J 4 HOH 573 1176 588  HOH HOH A . 
J 4 HOH 574 1177 589  HOH HOH A . 
J 4 HOH 575 1178 590  HOH HOH A . 
J 4 HOH 576 1179 591  HOH HOH A . 
J 4 HOH 577 1180 592  HOH HOH A . 
J 4 HOH 578 1181 593  HOH HOH A . 
J 4 HOH 579 1182 594  HOH HOH A . 
J 4 HOH 580 1183 595  HOH HOH A . 
J 4 HOH 581 1184 596  HOH HOH A . 
J 4 HOH 582 1185 597  HOH HOH A . 
J 4 HOH 583 1186 598  HOH HOH A . 
J 4 HOH 584 1187 599  HOH HOH A . 
J 4 HOH 585 1188 601  HOH HOH A . 
J 4 HOH 586 1189 602  HOH HOH A . 
J 4 HOH 587 1190 603  HOH HOH A . 
J 4 HOH 588 1191 604  HOH HOH A . 
J 4 HOH 589 1192 605  HOH HOH A . 
J 4 HOH 590 1193 606  HOH HOH A . 
J 4 HOH 591 1194 607  HOH HOH A . 
J 4 HOH 592 1195 608  HOH HOH A . 
J 4 HOH 593 1196 609  HOH HOH A . 
J 4 HOH 594 1197 610  HOH HOH A . 
J 4 HOH 595 1198 611  HOH HOH A . 
J 4 HOH 596 1199 612  HOH HOH A . 
J 4 HOH 597 1200 613  HOH HOH A . 
J 4 HOH 598 1201 614  HOH HOH A . 
J 4 HOH 599 1202 615  HOH HOH A . 
J 4 HOH 600 1203 616  HOH HOH A . 
J 4 HOH 601 1204 617  HOH HOH A . 
J 4 HOH 602 1205 618  HOH HOH A . 
J 4 HOH 603 1206 619  HOH HOH A . 
J 4 HOH 604 1207 620  HOH HOH A . 
J 4 HOH 605 1208 621  HOH HOH A . 
J 4 HOH 606 1209 622  HOH HOH A . 
J 4 HOH 607 1210 623  HOH HOH A . 
J 4 HOH 608 1211 624  HOH HOH A . 
J 4 HOH 609 1212 625  HOH HOH A . 
J 4 HOH 610 1213 626  HOH HOH A . 
J 4 HOH 611 1214 627  HOH HOH A . 
J 4 HOH 612 1215 628  HOH HOH A . 
J 4 HOH 613 1216 629  HOH HOH A . 
J 4 HOH 614 1217 630  HOH HOH A . 
J 4 HOH 615 1218 631  HOH HOH A . 
J 4 HOH 616 1219 632  HOH HOH A . 
J 4 HOH 617 1220 633  HOH HOH A . 
J 4 HOH 618 1221 634  HOH HOH A . 
J 4 HOH 619 1222 635  HOH HOH A . 
J 4 HOH 620 1223 636  HOH HOH A . 
J 4 HOH 621 1224 637  HOH HOH A . 
J 4 HOH 622 1225 638  HOH HOH A . 
J 4 HOH 623 1226 639  HOH HOH A . 
J 4 HOH 624 1227 640  HOH HOH A . 
J 4 HOH 625 1228 641  HOH HOH A . 
J 4 HOH 626 1229 642  HOH HOH A . 
J 4 HOH 627 1230 643  HOH HOH A . 
J 4 HOH 628 1231 644  HOH HOH A . 
J 4 HOH 629 1232 645  HOH HOH A . 
J 4 HOH 630 1233 646  HOH HOH A . 
J 4 HOH 631 1234 647  HOH HOH A . 
J 4 HOH 632 1235 648  HOH HOH A . 
J 4 HOH 633 1236 649  HOH HOH A . 
J 4 HOH 634 1237 651  HOH HOH A . 
J 4 HOH 635 1238 652  HOH HOH A . 
J 4 HOH 636 1239 653  HOH HOH A . 
J 4 HOH 637 1240 654  HOH HOH A . 
J 4 HOH 638 1241 655  HOH HOH A . 
J 4 HOH 639 1242 656  HOH HOH A . 
J 4 HOH 640 1243 657  HOH HOH A . 
J 4 HOH 641 1244 658  HOH HOH A . 
J 4 HOH 642 1245 659  HOH HOH A . 
J 4 HOH 643 1246 660  HOH HOH A . 
J 4 HOH 644 1247 661  HOH HOH A . 
J 4 HOH 645 1248 662  HOH HOH A . 
J 4 HOH 646 1249 663  HOH HOH A . 
J 4 HOH 647 1250 664  HOH HOH A . 
J 4 HOH 648 1251 665  HOH HOH A . 
J 4 HOH 649 1252 666  HOH HOH A . 
J 4 HOH 650 1253 668  HOH HOH A . 
J 4 HOH 651 1254 669  HOH HOH A . 
J 4 HOH 652 1255 670  HOH HOH A . 
J 4 HOH 653 1256 671  HOH HOH A . 
J 4 HOH 654 1257 672  HOH HOH A . 
J 4 HOH 655 1258 673  HOH HOH A . 
J 4 HOH 656 1259 674  HOH HOH A . 
J 4 HOH 657 1260 675  HOH HOH A . 
J 4 HOH 658 1261 676  HOH HOH A . 
J 4 HOH 659 1262 677  HOH HOH A . 
J 4 HOH 660 1263 678  HOH HOH A . 
J 4 HOH 661 1264 679  HOH HOH A . 
J 4 HOH 662 1265 680  HOH HOH A . 
J 4 HOH 663 1266 681  HOH HOH A . 
J 4 HOH 664 1267 682  HOH HOH A . 
J 4 HOH 665 1268 683  HOH HOH A . 
J 4 HOH 666 1269 685  HOH HOH A . 
J 4 HOH 667 1270 686  HOH HOH A . 
J 4 HOH 668 1271 687  HOH HOH A . 
J 4 HOH 669 1272 690  HOH HOH A . 
J 4 HOH 670 1273 691  HOH HOH A . 
J 4 HOH 671 1274 692  HOH HOH A . 
J 4 HOH 672 1275 693  HOH HOH A . 
J 4 HOH 673 1276 694  HOH HOH A . 
J 4 HOH 674 1277 695  HOH HOH A . 
J 4 HOH 675 1278 696  HOH HOH A . 
J 4 HOH 676 1279 697  HOH HOH A . 
J 4 HOH 677 1280 698  HOH HOH A . 
J 4 HOH 678 1281 699  HOH HOH A . 
J 4 HOH 679 1282 700  HOH HOH A . 
J 4 HOH 680 1283 701  HOH HOH A . 
J 4 HOH 681 1284 702  HOH HOH A . 
J 4 HOH 682 1285 703  HOH HOH A . 
J 4 HOH 683 1286 705  HOH HOH A . 
J 4 HOH 684 1287 706  HOH HOH A . 
J 4 HOH 685 1288 707  HOH HOH A . 
J 4 HOH 686 1289 708  HOH HOH A . 
J 4 HOH 687 1290 709  HOH HOH A . 
J 4 HOH 688 1291 710  HOH HOH A . 
J 4 HOH 689 1292 711  HOH HOH A . 
J 4 HOH 690 1293 712  HOH HOH A . 
J 4 HOH 691 1294 713  HOH HOH A . 
J 4 HOH 692 1295 714  HOH HOH A . 
J 4 HOH 693 1296 715  HOH HOH A . 
J 4 HOH 694 1297 716  HOH HOH A . 
J 4 HOH 695 1298 717  HOH HOH A . 
J 4 HOH 696 1299 718  HOH HOH A . 
J 4 HOH 697 1300 719  HOH HOH A . 
J 4 HOH 698 1301 720  HOH HOH A . 
J 4 HOH 699 1302 721  HOH HOH A . 
J 4 HOH 700 1303 722  HOH HOH A . 
J 4 HOH 701 1304 723  HOH HOH A . 
J 4 HOH 702 1305 724  HOH HOH A . 
J 4 HOH 703 1306 725  HOH HOH A . 
J 4 HOH 704 1307 726  HOH HOH A . 
J 4 HOH 705 1308 727  HOH HOH A . 
J 4 HOH 706 1309 728  HOH HOH A . 
J 4 HOH 707 1310 729  HOH HOH A . 
J 4 HOH 708 1311 730  HOH HOH A . 
J 4 HOH 709 1312 731  HOH HOH A . 
J 4 HOH 710 1313 732  HOH HOH A . 
J 4 HOH 711 1314 733  HOH HOH A . 
J 4 HOH 712 1315 734  HOH HOH A . 
J 4 HOH 713 1316 735  HOH HOH A . 
J 4 HOH 714 1317 736  HOH HOH A . 
J 4 HOH 715 1318 737  HOH HOH A . 
J 4 HOH 716 1319 738  HOH HOH A . 
J 4 HOH 717 1320 739  HOH HOH A . 
J 4 HOH 718 1321 740  HOH HOH A . 
J 4 HOH 719 1322 741  HOH HOH A . 
J 4 HOH 720 1323 742  HOH HOH A . 
J 4 HOH 721 1324 743  HOH HOH A . 
J 4 HOH 722 1325 744  HOH HOH A . 
J 4 HOH 723 1326 745  HOH HOH A . 
J 4 HOH 724 1327 747  HOH HOH A . 
J 4 HOH 725 1328 748  HOH HOH A . 
J 4 HOH 726 1329 749  HOH HOH A . 
J 4 HOH 727 1330 750  HOH HOH A . 
J 4 HOH 728 1331 751  HOH HOH A . 
J 4 HOH 729 1332 752  HOH HOH A . 
J 4 HOH 730 1333 753  HOH HOH A . 
J 4 HOH 731 1334 754  HOH HOH A . 
J 4 HOH 732 1335 755  HOH HOH A . 
J 4 HOH 733 1336 756  HOH HOH A . 
J 4 HOH 734 1337 757  HOH HOH A . 
J 4 HOH 735 1338 758  HOH HOH A . 
J 4 HOH 736 1339 760  HOH HOH A . 
J 4 HOH 737 1340 761  HOH HOH A . 
J 4 HOH 738 1341 762  HOH HOH A . 
J 4 HOH 739 1342 763  HOH HOH A . 
J 4 HOH 740 1343 764  HOH HOH A . 
J 4 HOH 741 1344 765  HOH HOH A . 
J 4 HOH 742 1345 766  HOH HOH A . 
J 4 HOH 743 1346 767  HOH HOH A . 
J 4 HOH 744 1347 769  HOH HOH A . 
J 4 HOH 745 1348 770  HOH HOH A . 
J 4 HOH 746 1349 771  HOH HOH A . 
J 4 HOH 747 1350 772  HOH HOH A . 
J 4 HOH 748 1351 773  HOH HOH A . 
J 4 HOH 749 1352 774  HOH HOH A . 
J 4 HOH 750 1353 863  HOH HOH A . 
J 4 HOH 751 1354 880  HOH HOH A . 
J 4 HOH 752 1355 934  HOH HOH A . 
J 4 HOH 753 1356 993  HOH HOH A . 
J 4 HOH 754 1357 1018 HOH HOH A . 
J 4 HOH 755 1358 1062 HOH HOH A . 
J 4 HOH 756 1359 1064 HOH HOH A . 
J 4 HOH 757 1360 1069 HOH HOH A . 
J 4 HOH 758 1361 1071 HOH HOH A . 
J 4 HOH 759 1362 1126 HOH HOH A . 
J 4 HOH 760 1363 1222 HOH HOH A . 
J 4 HOH 761 1364 1258 HOH HOH A . 
J 4 HOH 762 1365 1266 HOH HOH A . 
J 4 HOH 763 1366 1340 HOH HOH A . 
J 4 HOH 764 1367 1404 HOH HOH A . 
J 4 HOH 765 1368 1405 HOH HOH A . 
J 4 HOH 766 1369 1408 HOH HOH A . 
J 4 HOH 767 1370 1413 HOH HOH A . 
J 4 HOH 768 1371 1414 HOH HOH A . 
J 4 HOH 769 1372 1505 HOH HOH A . 
J 4 HOH 770 1373 1513 HOH HOH A . 
J 4 HOH 771 1374 1518 HOH HOH A . 
J 4 HOH 772 1375 1553 HOH HOH A . 
J 4 HOH 773 1376 1554 HOH HOH A . 
J 4 HOH 774 1377 1555 HOH HOH A . 
J 4 HOH 775 1378 1556 HOH HOH A . 
J 4 HOH 776 1379 1561 HOH HOH A . 
J 4 HOH 777 1380 1564 HOH HOH A . 
J 4 HOH 778 1381 1566 HOH HOH A . 
J 4 HOH 779 1382 1567 HOH HOH A . 
J 4 HOH 780 1383 1568 HOH HOH A . 
J 4 HOH 781 1384 1571 HOH HOH A . 
J 4 HOH 782 1385 1576 HOH HOH A . 
J 4 HOH 783 1386 1577 HOH HOH A . 
J 4 HOH 784 1387 1578 HOH HOH A . 
J 4 HOH 785 1388 1579 HOH HOH A . 
J 4 HOH 786 1389 1580 HOH HOH A . 
J 4 HOH 787 1390 1585 HOH HOH A . 
J 4 HOH 788 1391 1586 HOH HOH A . 
J 4 HOH 789 1392 1587 HOH HOH A . 
J 4 HOH 790 1393 1589 HOH HOH A . 
J 4 HOH 791 1394 1590 HOH HOH A . 
J 4 HOH 792 1395 1593 HOH HOH A . 
J 4 HOH 793 1396 1594 HOH HOH A . 
J 4 HOH 794 1397 1596 HOH HOH A . 
J 4 HOH 795 1398 1597 HOH HOH A . 
J 4 HOH 796 1399 1598 HOH HOH A . 
J 4 HOH 797 1400 1599 HOH HOH A . 
J 4 HOH 798 1401 1600 HOH HOH A . 
J 4 HOH 799 1402 1601 HOH HOH A . 
J 4 HOH 800 1403 1602 HOH HOH A . 
J 4 HOH 801 1404 1607 HOH HOH A . 
J 4 HOH 802 1405 1610 HOH HOH A . 
J 4 HOH 803 1406 1613 HOH HOH A . 
J 4 HOH 804 1407 1616 HOH HOH A . 
J 4 HOH 805 1408 1617 HOH HOH A . 
J 4 HOH 806 1409 1618 HOH HOH A . 
J 4 HOH 807 1410 1619 HOH HOH A . 
J 4 HOH 808 1411 1621 HOH HOH A . 
J 4 HOH 809 1412 1622 HOH HOH A . 
J 4 HOH 810 1413 1623 HOH HOH A . 
J 4 HOH 811 1414 1625 HOH HOH A . 
J 4 HOH 812 1415 1626 HOH HOH A . 
J 4 HOH 813 1416 1628 HOH HOH A . 
J 4 HOH 814 1417 1629 HOH HOH A . 
J 4 HOH 815 1418 1630 HOH HOH A . 
J 4 HOH 816 1419 1633 HOH HOH A . 
J 4 HOH 817 1420 1634 HOH HOH A . 
J 4 HOH 818 1421 1637 HOH HOH A . 
J 4 HOH 819 1422 1639 HOH HOH A . 
J 4 HOH 820 1423 1640 HOH HOH A . 
J 4 HOH 821 1424 1641 HOH HOH A . 
J 4 HOH 822 1425 1647 HOH HOH A . 
J 4 HOH 823 1426 1649 HOH HOH A . 
J 4 HOH 824 1427 1651 HOH HOH A . 
J 4 HOH 825 1428 1652 HOH HOH A . 
J 4 HOH 826 1429 1656 HOH HOH A . 
J 4 HOH 827 1430 1660 HOH HOH A . 
J 4 HOH 828 1431 1662 HOH HOH A . 
J 4 HOH 829 1432 1663 HOH HOH A . 
J 4 HOH 830 1433 1664 HOH HOH A . 
J 4 HOH 831 1434 1665 HOH HOH A . 
J 4 HOH 832 1435 1666 HOH HOH A . 
J 4 HOH 833 1436 1667 HOH HOH A . 
J 4 HOH 834 1437 1668 HOH HOH A . 
J 4 HOH 835 1438 1670 HOH HOH A . 
J 4 HOH 836 1439 1671 HOH HOH A . 
J 4 HOH 837 1440 1672 HOH HOH A . 
J 4 HOH 838 1441 1678 HOH HOH A . 
J 4 HOH 839 1442 1681 HOH HOH A . 
J 4 HOH 840 1443 1683 HOH HOH A . 
J 4 HOH 841 1444 1684 HOH HOH A . 
J 4 HOH 842 1445 1687 HOH HOH A . 
J 4 HOH 843 1446 1688 HOH HOH A . 
J 4 HOH 844 1447 1695 HOH HOH A . 
J 4 HOH 845 1448 1699 HOH HOH A . 
J 4 HOH 846 1449 1700 HOH HOH A . 
J 4 HOH 847 1450 1701 HOH HOH A . 
J 4 HOH 848 1451 1702 HOH HOH A . 
J 4 HOH 849 1452 1705 HOH HOH A . 
J 4 HOH 850 1453 1706 HOH HOH A . 
J 4 HOH 851 1454 1707 HOH HOH A . 
J 4 HOH 852 1455 1710 HOH HOH A . 
J 4 HOH 853 1456 1711 HOH HOH A . 
J 4 HOH 854 1457 1715 HOH HOH A . 
J 4 HOH 855 1458 1716 HOH HOH A . 
J 4 HOH 856 1459 1717 HOH HOH A . 
J 4 HOH 857 1460 1718 HOH HOH A . 
J 4 HOH 858 1461 1719 HOH HOH A . 
J 4 HOH 859 1462 1721 HOH HOH A . 
J 4 HOH 860 1463 1722 HOH HOH A . 
J 4 HOH 861 1464 1724 HOH HOH A . 
J 4 HOH 862 1465 1725 HOH HOH A . 
J 4 HOH 863 1466 1726 HOH HOH A . 
J 4 HOH 864 1467 1728 HOH HOH A . 
J 4 HOH 865 1468 1729 HOH HOH A . 
J 4 HOH 866 1469 1730 HOH HOH A . 
J 4 HOH 867 1470 1732 HOH HOH A . 
J 4 HOH 868 1471 1734 HOH HOH A . 
J 4 HOH 869 1472 1738 HOH HOH A . 
J 4 HOH 870 1473 1739 HOH HOH A . 
J 4 HOH 871 1474 1740 HOH HOH A . 
J 4 HOH 872 1475 1749 HOH HOH A . 
J 4 HOH 873 1476 1750 HOH HOH A . 
J 4 HOH 874 1477 1752 HOH HOH A . 
J 4 HOH 875 1478 1753 HOH HOH A . 
J 4 HOH 876 1479 1754 HOH HOH A . 
J 4 HOH 877 1480 1755 HOH HOH A . 
K 4 HOH 1   603  6    HOH HOH B . 
K 4 HOH 2   604  13   HOH HOH B . 
K 4 HOH 3   605  44   HOH HOH B . 
K 4 HOH 4   606  50   HOH HOH B . 
K 4 HOH 5   607  128  HOH HOH B . 
K 4 HOH 6   608  313  HOH HOH B . 
K 4 HOH 7   609  330  HOH HOH B . 
K 4 HOH 8   610  429  HOH HOH B . 
K 4 HOH 9   611  522  HOH HOH B . 
K 4 HOH 10  612  540  HOH HOH B . 
K 4 HOH 11  613  542  HOH HOH B . 
K 4 HOH 12  614  543  HOH HOH B . 
K 4 HOH 13  615  550  HOH HOH B . 
K 4 HOH 14  616  554  HOH HOH B . 
K 4 HOH 15  617  572  HOH HOH B . 
K 4 HOH 16  618  600  HOH HOH B . 
K 4 HOH 17  619  650  HOH HOH B . 
K 4 HOH 18  620  667  HOH HOH B . 
K 4 HOH 19  621  684  HOH HOH B . 
K 4 HOH 20  622  688  HOH HOH B . 
K 4 HOH 21  623  689  HOH HOH B . 
K 4 HOH 22  624  704  HOH HOH B . 
K 4 HOH 23  625  746  HOH HOH B . 
K 4 HOH 24  626  759  HOH HOH B . 
K 4 HOH 25  627  768  HOH HOH B . 
K 4 HOH 26  628  775  HOH HOH B . 
K 4 HOH 27  629  776  HOH HOH B . 
K 4 HOH 28  630  777  HOH HOH B . 
K 4 HOH 29  631  778  HOH HOH B . 
K 4 HOH 30  632  779  HOH HOH B . 
K 4 HOH 31  633  780  HOH HOH B . 
K 4 HOH 32  634  781  HOH HOH B . 
K 4 HOH 33  635  782  HOH HOH B . 
K 4 HOH 34  636  783  HOH HOH B . 
K 4 HOH 35  637  784  HOH HOH B . 
K 4 HOH 36  638  785  HOH HOH B . 
K 4 HOH 37  639  786  HOH HOH B . 
K 4 HOH 38  640  787  HOH HOH B . 
K 4 HOH 39  641  788  HOH HOH B . 
K 4 HOH 40  642  789  HOH HOH B . 
K 4 HOH 41  643  790  HOH HOH B . 
K 4 HOH 42  644  791  HOH HOH B . 
K 4 HOH 43  645  792  HOH HOH B . 
K 4 HOH 44  646  793  HOH HOH B . 
K 4 HOH 45  647  794  HOH HOH B . 
K 4 HOH 46  648  795  HOH HOH B . 
K 4 HOH 47  649  796  HOH HOH B . 
K 4 HOH 48  650  797  HOH HOH B . 
K 4 HOH 49  651  798  HOH HOH B . 
K 4 HOH 50  652  799  HOH HOH B . 
K 4 HOH 51  653  800  HOH HOH B . 
K 4 HOH 52  654  801  HOH HOH B . 
K 4 HOH 53  655  802  HOH HOH B . 
K 4 HOH 54  656  803  HOH HOH B . 
K 4 HOH 55  657  804  HOH HOH B . 
K 4 HOH 56  658  805  HOH HOH B . 
K 4 HOH 57  659  806  HOH HOH B . 
K 4 HOH 58  660  807  HOH HOH B . 
K 4 HOH 59  661  808  HOH HOH B . 
K 4 HOH 60  662  809  HOH HOH B . 
K 4 HOH 61  663  810  HOH HOH B . 
K 4 HOH 62  664  811  HOH HOH B . 
K 4 HOH 63  665  812  HOH HOH B . 
K 4 HOH 64  666  813  HOH HOH B . 
K 4 HOH 65  667  814  HOH HOH B . 
K 4 HOH 66  668  815  HOH HOH B . 
K 4 HOH 67  669  816  HOH HOH B . 
K 4 HOH 68  670  817  HOH HOH B . 
K 4 HOH 69  671  818  HOH HOH B . 
K 4 HOH 70  672  819  HOH HOH B . 
K 4 HOH 71  673  820  HOH HOH B . 
K 4 HOH 72  674  821  HOH HOH B . 
K 4 HOH 73  675  822  HOH HOH B . 
K 4 HOH 74  676  823  HOH HOH B . 
K 4 HOH 75  677  824  HOH HOH B . 
K 4 HOH 76  678  825  HOH HOH B . 
K 4 HOH 77  679  826  HOH HOH B . 
K 4 HOH 78  680  827  HOH HOH B . 
K 4 HOH 79  681  828  HOH HOH B . 
K 4 HOH 80  682  829  HOH HOH B . 
K 4 HOH 81  683  830  HOH HOH B . 
K 4 HOH 82  684  831  HOH HOH B . 
K 4 HOH 83  685  832  HOH HOH B . 
K 4 HOH 84  686  833  HOH HOH B . 
K 4 HOH 85  687  834  HOH HOH B . 
K 4 HOH 86  688  835  HOH HOH B . 
K 4 HOH 87  689  836  HOH HOH B . 
K 4 HOH 88  690  837  HOH HOH B . 
K 4 HOH 89  691  838  HOH HOH B . 
K 4 HOH 90  692  839  HOH HOH B . 
K 4 HOH 91  693  840  HOH HOH B . 
K 4 HOH 92  694  841  HOH HOH B . 
K 4 HOH 93  695  842  HOH HOH B . 
K 4 HOH 94  696  843  HOH HOH B . 
K 4 HOH 95  697  844  HOH HOH B . 
K 4 HOH 96  698  845  HOH HOH B . 
K 4 HOH 97  699  846  HOH HOH B . 
K 4 HOH 98  700  847  HOH HOH B . 
K 4 HOH 99  701  848  HOH HOH B . 
K 4 HOH 100 702  849  HOH HOH B . 
K 4 HOH 101 703  850  HOH HOH B . 
K 4 HOH 102 704  851  HOH HOH B . 
K 4 HOH 103 705  852  HOH HOH B . 
K 4 HOH 104 706  853  HOH HOH B . 
K 4 HOH 105 707  854  HOH HOH B . 
K 4 HOH 106 708  855  HOH HOH B . 
K 4 HOH 107 709  856  HOH HOH B . 
K 4 HOH 108 710  857  HOH HOH B . 
K 4 HOH 109 711  858  HOH HOH B . 
K 4 HOH 110 712  859  HOH HOH B . 
K 4 HOH 111 713  860  HOH HOH B . 
K 4 HOH 112 714  861  HOH HOH B . 
K 4 HOH 113 715  862  HOH HOH B . 
K 4 HOH 114 716  864  HOH HOH B . 
K 4 HOH 115 717  865  HOH HOH B . 
K 4 HOH 116 718  866  HOH HOH B . 
K 4 HOH 117 719  867  HOH HOH B . 
K 4 HOH 118 720  868  HOH HOH B . 
K 4 HOH 119 721  869  HOH HOH B . 
K 4 HOH 120 722  870  HOH HOH B . 
K 4 HOH 121 723  871  HOH HOH B . 
K 4 HOH 122 724  872  HOH HOH B . 
K 4 HOH 123 725  873  HOH HOH B . 
K 4 HOH 124 726  874  HOH HOH B . 
K 4 HOH 125 727  875  HOH HOH B . 
K 4 HOH 126 728  876  HOH HOH B . 
K 4 HOH 127 729  877  HOH HOH B . 
K 4 HOH 128 730  878  HOH HOH B . 
K 4 HOH 129 731  879  HOH HOH B . 
K 4 HOH 130 732  881  HOH HOH B . 
K 4 HOH 131 733  882  HOH HOH B . 
K 4 HOH 132 734  883  HOH HOH B . 
K 4 HOH 133 735  884  HOH HOH B . 
K 4 HOH 134 736  885  HOH HOH B . 
K 4 HOH 135 737  886  HOH HOH B . 
K 4 HOH 136 738  887  HOH HOH B . 
K 4 HOH 137 739  888  HOH HOH B . 
K 4 HOH 138 740  889  HOH HOH B . 
K 4 HOH 139 741  890  HOH HOH B . 
K 4 HOH 140 742  891  HOH HOH B . 
K 4 HOH 141 743  892  HOH HOH B . 
K 4 HOH 142 744  893  HOH HOH B . 
K 4 HOH 143 745  894  HOH HOH B . 
K 4 HOH 144 746  895  HOH HOH B . 
K 4 HOH 145 747  896  HOH HOH B . 
K 4 HOH 146 748  897  HOH HOH B . 
K 4 HOH 147 749  898  HOH HOH B . 
K 4 HOH 148 750  899  HOH HOH B . 
K 4 HOH 149 751  900  HOH HOH B . 
K 4 HOH 150 752  901  HOH HOH B . 
K 4 HOH 151 753  902  HOH HOH B . 
K 4 HOH 152 754  903  HOH HOH B . 
K 4 HOH 153 755  904  HOH HOH B . 
K 4 HOH 154 756  905  HOH HOH B . 
K 4 HOH 155 757  906  HOH HOH B . 
K 4 HOH 156 758  907  HOH HOH B . 
K 4 HOH 157 759  908  HOH HOH B . 
K 4 HOH 158 760  909  HOH HOH B . 
K 4 HOH 159 761  910  HOH HOH B . 
K 4 HOH 160 762  911  HOH HOH B . 
K 4 HOH 161 763  912  HOH HOH B . 
K 4 HOH 162 764  913  HOH HOH B . 
K 4 HOH 163 765  914  HOH HOH B . 
K 4 HOH 164 766  915  HOH HOH B . 
K 4 HOH 165 767  916  HOH HOH B . 
K 4 HOH 166 768  917  HOH HOH B . 
K 4 HOH 167 769  918  HOH HOH B . 
K 4 HOH 168 770  919  HOH HOH B . 
K 4 HOH 169 771  920  HOH HOH B . 
K 4 HOH 170 772  921  HOH HOH B . 
K 4 HOH 171 773  922  HOH HOH B . 
K 4 HOH 172 774  923  HOH HOH B . 
K 4 HOH 173 775  924  HOH HOH B . 
K 4 HOH 174 776  925  HOH HOH B . 
K 4 HOH 175 777  926  HOH HOH B . 
K 4 HOH 176 778  927  HOH HOH B . 
K 4 HOH 177 779  928  HOH HOH B . 
K 4 HOH 178 780  929  HOH HOH B . 
K 4 HOH 179 781  930  HOH HOH B . 
K 4 HOH 180 782  931  HOH HOH B . 
K 4 HOH 181 783  932  HOH HOH B . 
K 4 HOH 182 784  933  HOH HOH B . 
K 4 HOH 183 785  935  HOH HOH B . 
K 4 HOH 184 786  936  HOH HOH B . 
K 4 HOH 185 787  937  HOH HOH B . 
K 4 HOH 186 788  938  HOH HOH B . 
K 4 HOH 187 789  939  HOH HOH B . 
K 4 HOH 188 790  940  HOH HOH B . 
K 4 HOH 189 791  941  HOH HOH B . 
K 4 HOH 190 792  942  HOH HOH B . 
K 4 HOH 191 793  943  HOH HOH B . 
K 4 HOH 192 794  944  HOH HOH B . 
K 4 HOH 193 795  945  HOH HOH B . 
K 4 HOH 194 796  946  HOH HOH B . 
K 4 HOH 195 797  947  HOH HOH B . 
K 4 HOH 196 798  948  HOH HOH B . 
K 4 HOH 197 799  949  HOH HOH B . 
K 4 HOH 198 800  950  HOH HOH B . 
K 4 HOH 199 801  951  HOH HOH B . 
K 4 HOH 200 802  952  HOH HOH B . 
K 4 HOH 201 803  953  HOH HOH B . 
K 4 HOH 202 804  954  HOH HOH B . 
K 4 HOH 203 805  955  HOH HOH B . 
K 4 HOH 204 806  956  HOH HOH B . 
K 4 HOH 205 807  957  HOH HOH B . 
K 4 HOH 206 808  958  HOH HOH B . 
K 4 HOH 207 809  959  HOH HOH B . 
K 4 HOH 208 810  960  HOH HOH B . 
K 4 HOH 209 811  961  HOH HOH B . 
K 4 HOH 210 812  962  HOH HOH B . 
K 4 HOH 211 813  963  HOH HOH B . 
K 4 HOH 212 814  964  HOH HOH B . 
K 4 HOH 213 815  965  HOH HOH B . 
K 4 HOH 214 816  966  HOH HOH B . 
K 4 HOH 215 817  967  HOH HOH B . 
K 4 HOH 216 818  968  HOH HOH B . 
K 4 HOH 217 819  969  HOH HOH B . 
K 4 HOH 218 820  970  HOH HOH B . 
K 4 HOH 219 821  971  HOH HOH B . 
K 4 HOH 220 822  972  HOH HOH B . 
K 4 HOH 221 823  973  HOH HOH B . 
K 4 HOH 222 824  974  HOH HOH B . 
K 4 HOH 223 825  975  HOH HOH B . 
K 4 HOH 224 826  976  HOH HOH B . 
K 4 HOH 225 827  977  HOH HOH B . 
K 4 HOH 226 828  978  HOH HOH B . 
K 4 HOH 227 829  979  HOH HOH B . 
K 4 HOH 228 830  980  HOH HOH B . 
K 4 HOH 229 831  981  HOH HOH B . 
K 4 HOH 230 832  982  HOH HOH B . 
K 4 HOH 231 833  983  HOH HOH B . 
K 4 HOH 232 834  984  HOH HOH B . 
K 4 HOH 233 835  985  HOH HOH B . 
K 4 HOH 234 836  986  HOH HOH B . 
K 4 HOH 235 837  987  HOH HOH B . 
K 4 HOH 236 838  988  HOH HOH B . 
K 4 HOH 237 839  989  HOH HOH B . 
K 4 HOH 238 840  990  HOH HOH B . 
K 4 HOH 239 841  991  HOH HOH B . 
K 4 HOH 240 842  992  HOH HOH B . 
K 4 HOH 241 843  994  HOH HOH B . 
K 4 HOH 242 844  995  HOH HOH B . 
K 4 HOH 243 845  996  HOH HOH B . 
K 4 HOH 244 846  997  HOH HOH B . 
K 4 HOH 245 847  998  HOH HOH B . 
K 4 HOH 246 848  999  HOH HOH B . 
K 4 HOH 247 849  1000 HOH HOH B . 
K 4 HOH 248 850  1001 HOH HOH B . 
K 4 HOH 249 851  1002 HOH HOH B . 
K 4 HOH 250 852  1003 HOH HOH B . 
K 4 HOH 251 853  1004 HOH HOH B . 
K 4 HOH 252 854  1005 HOH HOH B . 
K 4 HOH 253 855  1006 HOH HOH B . 
K 4 HOH 254 856  1007 HOH HOH B . 
K 4 HOH 255 857  1008 HOH HOH B . 
K 4 HOH 256 858  1009 HOH HOH B . 
K 4 HOH 257 859  1010 HOH HOH B . 
K 4 HOH 258 860  1011 HOH HOH B . 
K 4 HOH 259 861  1012 HOH HOH B . 
K 4 HOH 260 862  1013 HOH HOH B . 
K 4 HOH 261 863  1014 HOH HOH B . 
K 4 HOH 262 864  1015 HOH HOH B . 
K 4 HOH 263 865  1016 HOH HOH B . 
K 4 HOH 264 866  1017 HOH HOH B . 
K 4 HOH 265 867  1019 HOH HOH B . 
K 4 HOH 266 868  1020 HOH HOH B . 
K 4 HOH 267 869  1021 HOH HOH B . 
K 4 HOH 268 870  1022 HOH HOH B . 
K 4 HOH 269 871  1023 HOH HOH B . 
K 4 HOH 270 872  1024 HOH HOH B . 
K 4 HOH 271 873  1025 HOH HOH B . 
K 4 HOH 272 874  1026 HOH HOH B . 
K 4 HOH 273 875  1027 HOH HOH B . 
K 4 HOH 274 876  1028 HOH HOH B . 
K 4 HOH 275 877  1029 HOH HOH B . 
K 4 HOH 276 878  1030 HOH HOH B . 
K 4 HOH 277 879  1031 HOH HOH B . 
K 4 HOH 278 880  1032 HOH HOH B . 
K 4 HOH 279 881  1033 HOH HOH B . 
K 4 HOH 280 882  1034 HOH HOH B . 
K 4 HOH 281 883  1035 HOH HOH B . 
K 4 HOH 282 884  1036 HOH HOH B . 
K 4 HOH 283 885  1037 HOH HOH B . 
K 4 HOH 284 886  1038 HOH HOH B . 
K 4 HOH 285 887  1039 HOH HOH B . 
K 4 HOH 286 888  1040 HOH HOH B . 
K 4 HOH 287 889  1041 HOH HOH B . 
K 4 HOH 288 890  1042 HOH HOH B . 
K 4 HOH 289 891  1043 HOH HOH B . 
K 4 HOH 290 892  1044 HOH HOH B . 
K 4 HOH 291 893  1045 HOH HOH B . 
K 4 HOH 292 894  1046 HOH HOH B . 
K 4 HOH 293 895  1047 HOH HOH B . 
K 4 HOH 294 896  1048 HOH HOH B . 
K 4 HOH 295 897  1049 HOH HOH B . 
K 4 HOH 296 898  1050 HOH HOH B . 
K 4 HOH 297 899  1051 HOH HOH B . 
K 4 HOH 298 900  1052 HOH HOH B . 
K 4 HOH 299 901  1053 HOH HOH B . 
K 4 HOH 300 902  1054 HOH HOH B . 
K 4 HO