data_1QIR
# 
_entry.id   1QIR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.382 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1QIR         pdb_00001qir 10.2210/pdb1qir/pdb 
PDBE  EBI-1803     ?            ?                   
WWPDB D_1290001803 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1QIS unspecified 'ASPARTATE AMINOTRANSFERASE FROM ESCHERICHIA COLI, C191F MUTATION, WITH BOUND MALEATE' 
PDB 1QIT unspecified 'ASPARTATE AMINOTRANSFERASE FROM ESCHERICHIA COLI, C191W MUTATION, WITH BOUND MALEATE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QIR 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jeffery, C.J.' 1 
'Gloss, L.M.'   2 
'Petsko, G.A.'  3 
'Ringe, D.'     4 
# 
_citation.id                        primary 
_citation.title                     
;The Role of Residues Outside the Active Site in Catalysis: Structural Basis for Function of C191 Mutants of E. Coli Aspartate Aminotransferase
;
_citation.journal_abbrev            'Protein Eng.' 
_citation.journal_volume            13 
_citation.page_first                105 
_citation.page_last                 ? 
_citation.year                      2000 
_citation.journal_id_ASTM           PRENE9 
_citation.country                   UK 
_citation.journal_id_ISSN           0269-2139 
_citation.journal_id_CSD            0859 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10708649 
_citation.pdbx_database_id_DOI      10.1093/PROTEIN/13.2.105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jeffery, C.J.' 1 ? 
primary 'Gloss, L.M.'   2 ? 
primary 'Petsko, G.A.'  3 ? 
primary 'Ringe, D.'     4 ? 
# 
_cell.entry_id           1QIR 
_cell.length_a           157.180 
_cell.length_b           85.400 
_cell.length_c           78.510 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QIR 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ASPARTATE AMINOTRANSFERASE' 43679.246 1  2.6.1.1 YES 'COMPLETE SUBUNIT' 
'PYRIDOXAL PHOSPHATE COFACTOR COVALENTLY BOUND TO LYS258 VIA SCHIFF BASE LINKAGE' 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"     247.142   1  ?       ?   ?                  ? 
3 non-polymer syn 'MALEIC ACID'                116.072   1  ?       ?   ?                  ? 
4 water       nat water                        18.015    79 ?       ?   ?                  ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQE
LLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD
ALINSLNEAQAGDVVLFHGYCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR
MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQE
LLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFD
ALINSLNEAQAGDVVLFHGYCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV
ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQR
MRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   GLU n 
1 4   ASN n 
1 5   ILE n 
1 6   THR n 
1 7   ALA n 
1 8   ALA n 
1 9   PRO n 
1 10  ALA n 
1 11  ASP n 
1 12  PRO n 
1 13  ILE n 
1 14  LEU n 
1 15  GLY n 
1 16  LEU n 
1 17  ALA n 
1 18  ASP n 
1 19  LEU n 
1 20  PHE n 
1 21  ARG n 
1 22  ALA n 
1 23  ASP n 
1 24  GLU n 
1 25  ARG n 
1 26  PRO n 
1 27  GLY n 
1 28  LYS n 
1 29  ILE n 
1 30  ASN n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  GLY n 
1 35  VAL n 
1 36  TYR n 
1 37  LYS n 
1 38  ASP n 
1 39  GLU n 
1 40  THR n 
1 41  GLY n 
1 42  LYS n 
1 43  THR n 
1 44  PRO n 
1 45  VAL n 
1 46  LEU n 
1 47  THR n 
1 48  SER n 
1 49  VAL n 
1 50  LYS n 
1 51  LYS n 
1 52  ALA n 
1 53  GLU n 
1 54  GLN n 
1 55  TYR n 
1 56  LEU n 
1 57  LEU n 
1 58  GLU n 
1 59  ASN n 
1 60  GLU n 
1 61  THR n 
1 62  THR n 
1 63  LYS n 
1 64  ASN n 
1 65  TYR n 
1 66  LEU n 
1 67  GLY n 
1 68  ILE n 
1 69  ASP n 
1 70  GLY n 
1 71  ILE n 
1 72  PRO n 
1 73  GLU n 
1 74  PHE n 
1 75  GLY n 
1 76  ARG n 
1 77  CYS n 
1 78  THR n 
1 79  GLN n 
1 80  GLU n 
1 81  LEU n 
1 82  LEU n 
1 83  PHE n 
1 84  GLY n 
1 85  LYS n 
1 86  GLY n 
1 87  SER n 
1 88  ALA n 
1 89  LEU n 
1 90  ILE n 
1 91  ASN n 
1 92  ASP n 
1 93  LYS n 
1 94  ARG n 
1 95  ALA n 
1 96  ARG n 
1 97  THR n 
1 98  ALA n 
1 99  GLN n 
1 100 THR n 
1 101 PRO n 
1 102 GLY n 
1 103 GLY n 
1 104 THR n 
1 105 GLY n 
1 106 ALA n 
1 107 LEU n 
1 108 ARG n 
1 109 VAL n 
1 110 ALA n 
1 111 ALA n 
1 112 ASP n 
1 113 PHE n 
1 114 LEU n 
1 115 ALA n 
1 116 LYS n 
1 117 ASN n 
1 118 THR n 
1 119 SER n 
1 120 VAL n 
1 121 LYS n 
1 122 ARG n 
1 123 VAL n 
1 124 TRP n 
1 125 VAL n 
1 126 SER n 
1 127 ASN n 
1 128 PRO n 
1 129 SER n 
1 130 TRP n 
1 131 PRO n 
1 132 ASN n 
1 133 HIS n 
1 134 LYS n 
1 135 SER n 
1 136 VAL n 
1 137 PHE n 
1 138 ASN n 
1 139 SER n 
1 140 ALA n 
1 141 GLY n 
1 142 LEU n 
1 143 GLU n 
1 144 VAL n 
1 145 ARG n 
1 146 GLU n 
1 147 TYR n 
1 148 ALA n 
1 149 TYR n 
1 150 TYR n 
1 151 ASP n 
1 152 ALA n 
1 153 GLU n 
1 154 ASN n 
1 155 HIS n 
1 156 THR n 
1 157 LEU n 
1 158 ASP n 
1 159 PHE n 
1 160 ASP n 
1 161 ALA n 
1 162 LEU n 
1 163 ILE n 
1 164 ASN n 
1 165 SER n 
1 166 LEU n 
1 167 ASN n 
1 168 GLU n 
1 169 ALA n 
1 170 GLN n 
1 171 ALA n 
1 172 GLY n 
1 173 ASP n 
1 174 VAL n 
1 175 VAL n 
1 176 LEU n 
1 177 PHE n 
1 178 HIS n 
1 179 GLY n 
1 180 TYR n 
1 181 CYS n 
1 182 HIS n 
1 183 ASN n 
1 184 PRO n 
1 185 THR n 
1 186 GLY n 
1 187 ILE n 
1 188 ASP n 
1 189 PRO n 
1 190 THR n 
1 191 LEU n 
1 192 GLU n 
1 193 GLN n 
1 194 TRP n 
1 195 GLN n 
1 196 THR n 
1 197 LEU n 
1 198 ALA n 
1 199 GLN n 
1 200 LEU n 
1 201 SER n 
1 202 VAL n 
1 203 GLU n 
1 204 LYS n 
1 205 GLY n 
1 206 TRP n 
1 207 LEU n 
1 208 PRO n 
1 209 LEU n 
1 210 PHE n 
1 211 ASP n 
1 212 PHE n 
1 213 ALA n 
1 214 TYR n 
1 215 GLN n 
1 216 GLY n 
1 217 PHE n 
1 218 ALA n 
1 219 ARG n 
1 220 GLY n 
1 221 LEU n 
1 222 GLU n 
1 223 GLU n 
1 224 ASP n 
1 225 ALA n 
1 226 GLU n 
1 227 GLY n 
1 228 LEU n 
1 229 ARG n 
1 230 ALA n 
1 231 PHE n 
1 232 ALA n 
1 233 ALA n 
1 234 MET n 
1 235 HIS n 
1 236 LYS n 
1 237 GLU n 
1 238 LEU n 
1 239 ILE n 
1 240 VAL n 
1 241 ALA n 
1 242 SER n 
1 243 SER n 
1 244 TYR n 
1 245 SER n 
1 246 LYS n 
1 247 ASN n 
1 248 PHE n 
1 249 GLY n 
1 250 LEU n 
1 251 TYR n 
1 252 ASN n 
1 253 GLU n 
1 254 ARG n 
1 255 VAL n 
1 256 GLY n 
1 257 ALA n 
1 258 CYS n 
1 259 THR n 
1 260 LEU n 
1 261 VAL n 
1 262 ALA n 
1 263 ALA n 
1 264 ASP n 
1 265 SER n 
1 266 GLU n 
1 267 THR n 
1 268 VAL n 
1 269 ASP n 
1 270 ARG n 
1 271 ALA n 
1 272 PHE n 
1 273 SER n 
1 274 GLN n 
1 275 MET n 
1 276 LYS n 
1 277 ALA n 
1 278 ALA n 
1 279 ILE n 
1 280 ARG n 
1 281 ALA n 
1 282 ASN n 
1 283 TYR n 
1 284 SER n 
1 285 ASN n 
1 286 PRO n 
1 287 PRO n 
1 288 ALA n 
1 289 HIS n 
1 290 GLY n 
1 291 ALA n 
1 292 SER n 
1 293 VAL n 
1 294 VAL n 
1 295 ALA n 
1 296 THR n 
1 297 ILE n 
1 298 LEU n 
1 299 SER n 
1 300 ASN n 
1 301 ASP n 
1 302 ALA n 
1 303 LEU n 
1 304 ARG n 
1 305 ALA n 
1 306 ILE n 
1 307 TRP n 
1 308 GLU n 
1 309 GLN n 
1 310 GLU n 
1 311 LEU n 
1 312 THR n 
1 313 ASP n 
1 314 MET n 
1 315 ARG n 
1 316 GLN n 
1 317 ARG n 
1 318 ILE n 
1 319 GLN n 
1 320 ARG n 
1 321 MET n 
1 322 ARG n 
1 323 GLN n 
1 324 LEU n 
1 325 PHE n 
1 326 VAL n 
1 327 ASN n 
1 328 THR n 
1 329 LEU n 
1 330 GLN n 
1 331 GLU n 
1 332 LYS n 
1 333 GLY n 
1 334 ALA n 
1 335 ASN n 
1 336 ARG n 
1 337 ASP n 
1 338 PHE n 
1 339 SER n 
1 340 PHE n 
1 341 ILE n 
1 342 ILE n 
1 343 LYS n 
1 344 GLN n 
1 345 ASN n 
1 346 GLY n 
1 347 MET n 
1 348 PHE n 
1 349 SER n 
1 350 PHE n 
1 351 SER n 
1 352 GLY n 
1 353 LEU n 
1 354 THR n 
1 355 LYS n 
1 356 GLU n 
1 357 GLN n 
1 358 VAL n 
1 359 LEU n 
1 360 ARG n 
1 361 LEU n 
1 362 ARG n 
1 363 GLU n 
1 364 GLU n 
1 365 PHE n 
1 366 GLY n 
1 367 VAL n 
1 368 TYR n 
1 369 ALA n 
1 370 VAL n 
1 371 ALA n 
1 372 SER n 
1 373 GLY n 
1 374 ARG n 
1 375 VAL n 
1 376 ASN n 
1 377 VAL n 
1 378 ALA n 
1 379 GLY n 
1 380 MET n 
1 381 THR n 
1 382 PRO n 
1 383 ASP n 
1 384 ASN n 
1 385 MET n 
1 386 ALA n 
1 387 PRO n 
1 388 LEU n 
1 389 CYS n 
1 390 GLU n 
1 391 ALA n 
1 392 ILE n 
1 393 VAL n 
1 394 ALA n 
1 395 VAL n 
1 396 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AAT_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P00509 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QIR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 396 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00509 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  396 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       5 
_struct_ref_seq.pdbx_auth_seq_align_end       409 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1QIR 
_struct_ref_seq_dif.mon_id                       TYR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      180 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P00509 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          191 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            191 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                      'C6 H15 N2 O2 1' 147.195 
MAE non-polymer         . 'MALEIC ACID'            ?                      'C4 H4 O4'       116.072 
MET 'L-peptide linking' y METHIONINE               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QIR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.0 
_exptl_crystal.density_percent_sol   59 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN SOLUTION: 6MG/ML PROTEIN, 20 MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, 10 UM PLP, 5 MM EDTA, RESERVOIR SOLUTION: 20MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, AND 45-50% AMMONIUM SULFATE
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           297.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1QIR 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   34520 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         80.0 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1QIR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     34520 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               1000000 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    80 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.09 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ASA 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3075 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             79 
_refine_hist.number_atoms_total               3177 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015  ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.064  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.949 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.502  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?      ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?      ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARHCSDX.PRO 
_pdbx_xplor_file.topol_file       TOPHCSDX.PRO 
# 
_struct.entry_id                  1QIR 
_struct.title                     'ASPARTATE AMINOTRANSFERASE FROM ESCHERICHIA COLI, C191Y MUTATION, WITH BOUND MALEATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QIR 
_struct_keywords.pdbx_keywords   AMINOTRANSFERASE 
_struct_keywords.text            'AMINOTRANSFERASE, TRANSFERASE(AMINOTRANSFERASE), PYRIDOXAL PHOSPHATE, MALEATE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'BIOLOGICAL_UNIT: ACTIVE AS A DIMER' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 13  ? ALA A 22  ? ILE A 17  ALA A 26  1 ? 10 
HELX_P HELX_P2  2  LEU A 46  ? GLU A 60  ? LEU A 50  GLU A 64  1 ? 15 
HELX_P HELX_P3  3  ILE A 71  ? GLY A 84  ? ILE A 76  GLY A 89  1 ? 14 
HELX_P HELX_P4  4  SER A 87  ? ASP A 92  ? SER A 92  ASP A 97  1 ? 6  
HELX_P HELX_P5  5  GLY A 102 ? THR A 118 ? GLY A 107 THR A 123 1 ? 17 
HELX_P HELX_P6  6  PRO A 131 ? ALA A 140 ? PRO A 141 ALA A 150 1 ? 10 
HELX_P HELX_P7  7  ASP A 158 ? ASN A 167 ? ASP A 169 ASN A 178 1 ? 10 
HELX_P HELX_P8  8  THR A 190 ? GLY A 205 ? THR A 201 GLY A 216 1 ? 16 
HELX_P HELX_P9  9  ALA A 225 ? ALA A 233 ? ALA A 237 ALA A 245 1 ? 9  
HELX_P HELX_P10 10 LEU A 250 ? GLU A 253 ? LEU A 262 GLU A 265 5 ? 4  
HELX_P HELX_P11 11 ASP A 264 ? ALA A 281 ? ASP A 276 ALA A 293 1 ? 18 
HELX_P HELX_P12 12 PRO A 287 ? ASN A 300 ? PRO A 299 ASN A 312 1 ? 14 
HELX_P HELX_P13 13 ASN A 300 ? LYS A 332 ? ASN A 312 LYS A 344 1 ? 33 
HELX_P HELX_P14 14 PHE A 338 ? GLN A 344 ? PHE A 350 GLN A 356 5 ? 7  
HELX_P HELX_P15 15 THR A 354 ? GLY A 366 ? THR A 366 GLY A 378 1 ? 13 
HELX_P HELX_P16 16 ALA A 378 ? MET A 380 ? ALA A 390 MET A 392 5 ? 3  
HELX_P HELX_P17 17 ASN A 384 ? ALA A 394 ? ASN A 396 ALA A 407 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           LYS 
_struct_conn.ptnr1_label_seq_id            246 
_struct_conn.ptnr1_label_atom_id           NZ 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           PLP 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C4A 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            LYS 
_struct_conn.ptnr1_auth_seq_id             258 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            PLP 
_struct_conn.ptnr2_auth_seq_id             410 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.315 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 127 A . ? ASN 137 A PRO 128 A ? PRO 138 A 1 -0.34 
2 ASN 183 A . ? ASN 194 A PRO 184 A ? PRO 195 A 1 1.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 95  ? PRO A 101 ? ALA A 100 PRO A 106 
A 2 VAL A 255 ? VAL A 261 ? VAL A 267 VAL A 273 
A 3 LEU A 238 ? SER A 243 ? LEU A 250 SER A 255 
A 4 LEU A 207 ? PHE A 212 ? LEU A 218 PHE A 223 
A 5 VAL A 174 ? HIS A 178 ? VAL A 185 HIS A 189 
B 1 ARG A 122 ? SER A 126 ? ARG A 129 SER A 136 
B 2 GLU A 143 ? TYR A 147 ? GLU A 154 TYR A 158 
C 1 PHE A 348 ? PHE A 350 ? PHE A 360 PHE A 362 
C 2 ARG A 374 ? ASN A 376 ? ARG A 386 ASN A 388 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 96  ? O ARG A 101 N LEU A 260 ? N LEU A 272 
A 2 3 O ALA A 257 ? O ALA A 269 N SER A 242 ? N SER A 254 
A 3 4 O ILE A 239 ? O ILE A 251 N PHE A 210 ? N PHE A 221 
A 4 5 O LEU A 207 ? O LEU A 218 N VAL A 175 ? N VAL A 186 
B 1 2 O VAL A 123 ? O VAL A 133 N GLU A 143 ? N GLU A 154 
C 1 2 O SER A 349 ? O SER A 361 N VAL A 375 ? N VAL A 387 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PLP 410 ? 15 'BINDING SITE FOR RESIDUE PLP A 410' 
AC2 Software A MAE 411 ? 8  'BINDING SITE FOR RESIDUE MAE A 411' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 TYR A 65  ? TYR A 70   . ? 1_555 ? 
2  AC1 15 GLY A 102 ? GLY A 107  . ? 1_555 ? 
3  AC1 15 GLY A 103 ? GLY A 108  . ? 1_555 ? 
4  AC1 15 THR A 104 ? THR A 109  . ? 1_555 ? 
5  AC1 15 TRP A 130 ? TRP A 140  . ? 1_555 ? 
6  AC1 15 ASN A 183 ? ASN A 194  . ? 1_555 ? 
7  AC1 15 ASP A 211 ? ASP A 222  . ? 1_555 ? 
8  AC1 15 ALA A 213 ? ALA A 224  . ? 1_555 ? 
9  AC1 15 TYR A 214 ? TYR A 225  . ? 1_555 ? 
10 AC1 15 SER A 243 ? SER A 255  . ? 1_555 ? 
11 AC1 15 SER A 245 ? SER A 257  . ? 1_555 ? 
12 AC1 15 LYS A 246 ? LYS A 258  . ? 1_555 ? 
13 AC1 15 ARG A 254 ? ARG A 266  . ? 1_555 ? 
14 AC1 15 MAE C .   ? MAE A 411  . ? 1_555 ? 
15 AC1 15 HOH D .   ? HOH A 2079 . ? 1_555 ? 
16 AC2 8  ILE A 13  ? ILE A 17   . ? 1_555 ? 
17 AC2 8  GLY A 34  ? GLY A 38   . ? 1_555 ? 
18 AC2 8  TRP A 130 ? TRP A 140  . ? 1_555 ? 
19 AC2 8  ASN A 183 ? ASN A 194  . ? 1_555 ? 
20 AC2 8  ARG A 280 ? ARG A 292  . ? 1_555 ? 
21 AC2 8  ARG A 374 ? ARG A 386  . ? 1_555 ? 
22 AC2 8  PLP B .   ? PLP A 410  . ? 1_555 ? 
23 AC2 8  HOH D .   ? HOH A 2079 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1QIR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QIR 
_atom_sites.fract_transf_matrix[1][1]   0.006362 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011710 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012737 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . MET A 1 1   ? 41.241 -15.799 -14.991 1.00 18.95  ? 5    MET A N    1 
ATOM   2    C CA   . MET A 1 1   ? 41.376 -14.843 -13.867 1.00 18.50  ? 5    MET A CA   1 
ATOM   3    C C    . MET A 1 1   ? 40.903 -15.407 -12.510 1.00 20.49  ? 5    MET A C    1 
ATOM   4    O O    . MET A 1 1   ? 41.559 -15.194 -11.491 1.00 21.49  ? 5    MET A O    1 
ATOM   5    C CB   . MET A 1 1   ? 40.594 -13.570 -14.193 1.00 25.21  ? 5    MET A CB   1 
ATOM   6    C CG   . MET A 1 1   ? 40.961 -12.358 -13.361 1.00 32.98  ? 5    MET A CG   1 
ATOM   7    S SD   . MET A 1 1   ? 42.572 -11.764 -13.825 1.00 47.21  ? 5    MET A SD   1 
ATOM   8    C CE   . MET A 1 1   ? 42.306 -11.469 -15.550 1.00 43.74  ? 5    MET A CE   1 
ATOM   9    H H1   . MET A 1 1   ? 40.281 -16.199 -15.005 1.00 0.00   ? 5    MET A H1   1 
ATOM   10   H H2   . MET A 1 1   ? 41.420 -15.293 -15.882 1.00 0.00   ? 5    MET A H2   1 
ATOM   11   H H3   . MET A 1 1   ? 41.951 -16.546 -14.902 1.00 0.00   ? 5    MET A H3   1 
ATOM   12   N N    . PHE A 1 2   ? 39.835 -16.211 -12.523 1.00 21.90  ? 6    PHE A N    1 
ATOM   13   C CA   . PHE A 1 2   ? 39.251 -16.741 -11.274 1.00 22.32  ? 6    PHE A CA   1 
ATOM   14   C C    . PHE A 1 2   ? 39.580 -18.168 -10.840 1.00 25.43  ? 6    PHE A C    1 
ATOM   15   O O    . PHE A 1 2   ? 39.080 -18.642 -9.815  1.00 25.26  ? 6    PHE A O    1 
ATOM   16   C CB   . PHE A 1 2   ? 37.724 -16.631 -11.324 1.00 19.83  ? 6    PHE A CB   1 
ATOM   17   C CG   . PHE A 1 2   ? 37.217 -15.319 -11.831 1.00 18.84  ? 6    PHE A CG   1 
ATOM   18   C CD1  . PHE A 1 2   ? 37.755 -14.119 -11.379 1.00 17.02  ? 6    PHE A CD1  1 
ATOM   19   C CD2  . PHE A 1 2   ? 36.183 -15.279 -12.764 1.00 15.45  ? 6    PHE A CD2  1 
ATOM   20   C CE1  . PHE A 1 2   ? 37.270 -12.894 -11.849 1.00 18.94  ? 6    PHE A CE1  1 
ATOM   21   C CE2  . PHE A 1 2   ? 35.692 -14.065 -13.239 1.00 16.08  ? 6    PHE A CE2  1 
ATOM   22   C CZ   . PHE A 1 2   ? 36.235 -12.870 -12.782 1.00 17.87  ? 6    PHE A CZ   1 
ATOM   23   H H    . PHE A 1 2   ? 39.432 -16.455 -13.382 1.00 0.00   ? 6    PHE A H    1 
ATOM   24   N N    . GLU A 1 3   ? 40.440 -18.827 -11.606 1.00 27.20  ? 7    GLU A N    1 
ATOM   25   C CA   . GLU A 1 3   ? 40.838 -20.216 -11.384 1.00 29.48  ? 7    GLU A CA   1 
ATOM   26   C C    . GLU A 1 3   ? 41.377 -20.558 -10.001 1.00 29.46  ? 7    GLU A C    1 
ATOM   27   O O    . GLU A 1 3   ? 41.077 -21.629 -9.466  1.00 27.06  ? 7    GLU A O    1 
ATOM   28   C CB   . GLU A 1 3   ? 41.890 -20.626 -12.419 1.00 30.31  ? 7    GLU A CB   1 
ATOM   29   C CG   . GLU A 1 3   ? 41.471 -20.445 -13.870 1.00 33.31  ? 7    GLU A CG   1 
ATOM   30   C CD   . GLU A 1 3   ? 42.050 -19.187 -14.507 1.00 33.87  ? 7    GLU A CD   1 
ATOM   31   O OE1  . GLU A 1 3   ? 41.841 -18.091 -13.954 1.00 37.04  ? 7    GLU A OE1  1 
ATOM   32   O OE2  . GLU A 1 3   ? 42.712 -19.305 -15.560 1.00 37.73  ? 7    GLU A OE2  1 
ATOM   33   H H    . GLU A 1 3   ? 40.812 -18.320 -12.340 1.00 0.00   ? 7    GLU A H    1 
ATOM   34   N N    . ASN A 1 4   ? 42.219 -19.680 -9.462  1.00 28.80  ? 8    ASN A N    1 
ATOM   35   C CA   . ASN A 1 4   ? 42.831 -19.909 -8.157  1.00 31.53  ? 8    ASN A CA   1 
ATOM   36   C C    . ASN A 1 4   ? 42.146 -19.171 -7.021  1.00 30.53  ? 8    ASN A C    1 
ATOM   37   O O    . ASN A 1 4   ? 42.770 -18.978 -5.981  1.00 32.27  ? 8    ASN A O    1 
ATOM   38   C CB   . ASN A 1 4   ? 44.292 -19.436 -8.103  1.00 35.40  ? 8    ASN A CB   1 
ATOM   39   C CG   . ASN A 1 4   ? 45.155 -19.972 -9.221  1.00 37.05  ? 8    ASN A CG   1 
ATOM   40   O OD1  . ASN A 1 4   ? 45.136 -21.157 -9.547  1.00 40.24  ? 8    ASN A OD1  1 
ATOM   41   N ND2  . ASN A 1 4   ? 46.002 -19.089 -9.752  1.00 38.98  ? 8    ASN A ND2  1 
ATOM   42   H H    . ASN A 1 4   ? 42.432 -18.859 -9.953  1.00 0.00   ? 8    ASN A H    1 
ATOM   43   H HD21 . ASN A 1 4   ? 46.011 -18.177 -9.394  1.00 0.00   ? 8    ASN A HD21 1 
ATOM   44   H HD22 . ASN A 1 4   ? 46.583 -19.391 -10.481 1.00 0.00   ? 8    ASN A HD22 1 
ATOM   45   N N    . ILE A 1 5   ? 40.930 -18.670 -7.205  1.00 28.45  ? 9    ILE A N    1 
ATOM   46   C CA   . ILE A 1 5   ? 40.318 -17.958 -6.094  1.00 25.14  ? 9    ILE A CA   1 
ATOM   47   C C    . ILE A 1 5   ? 39.892 -18.995 -5.078  1.00 26.75  ? 9    ILE A C    1 
ATOM   48   O O    . ILE A 1 5   ? 39.320 -20.015 -5.442  1.00 26.66  ? 9    ILE A O    1 
ATOM   49   C CB   . ILE A 1 5   ? 39.103 -17.113 -6.526  1.00 23.46  ? 9    ILE A CB   1 
ATOM   50   C CG1  . ILE A 1 5   ? 39.552 -16.009 -7.477  1.00 18.88  ? 9    ILE A CG1  1 
ATOM   51   C CG2  . ILE A 1 5   ? 38.423 -16.485 -5.306  1.00 20.54  ? 9    ILE A CG2  1 
ATOM   52   C CD1  . ILE A 1 5   ? 38.431 -15.111 -7.951  1.00 22.25  ? 9    ILE A CD1  1 
ATOM   53   H H    . ILE A 1 5   ? 40.461 -18.776 -8.058  1.00 0.00   ? 9    ILE A H    1 
ATOM   54   N N    . THR A 1 6   ? 40.306 -18.831 -3.830  1.00 28.96  ? 10   THR A N    1 
ATOM   55   C CA   . THR A 1 6   ? 39.847 -19.797 -2.852  1.00 31.61  ? 10   THR A CA   1 
ATOM   56   C C    . THR A 1 6   ? 38.517 -19.355 -2.342  1.00 31.59  ? 10   THR A C    1 
ATOM   57   O O    . THR A 1 6   ? 38.166 -18.177 -2.376  1.00 31.38  ? 10   THR A O    1 
ATOM   58   C CB   . THR A 1 6   ? 40.710 -19.928 -1.606  1.00 34.76  ? 10   THR A CB   1 
ATOM   59   O OG1  . THR A 1 6   ? 40.914 -18.635 -1.037  1.00 36.76  ? 10   THR A OG1  1 
ATOM   60   C CG2  . THR A 1 6   ? 42.000 -20.623 -1.891  1.00 38.59  ? 10   THR A CG2  1 
ATOM   61   H H    . THR A 1 6   ? 40.895 -18.091 -3.577  1.00 0.00   ? 10   THR A H    1 
ATOM   62   H HG1  . THR A 1 6   ? 41.453 -18.713 -0.247  1.00 0.00   ? 10   THR A HG1  1 
ATOM   63   N N    . ALA A 1 7   ? 37.803 -20.343 -1.845  1.00 29.43  ? 11   ALA A N    1 
ATOM   64   C CA   . ALA A 1 7   ? 36.509 -20.162 -1.249  1.00 29.97  ? 11   ALA A CA   1 
ATOM   65   C C    . ALA A 1 7   ? 36.672 -19.446 0.084   1.00 28.59  ? 11   ALA A C    1 
ATOM   66   O O    . ALA A 1 7   ? 37.569 -19.794 0.857   1.00 31.09  ? 11   ALA A O    1 
ATOM   67   C CB   . ALA A 1 7   ? 35.883 -21.508 -1.029  1.00 29.74  ? 11   ALA A CB   1 
ATOM   68   H H    . ALA A 1 7   ? 38.173 -21.250 -1.884  1.00 0.00   ? 11   ALA A H    1 
ATOM   69   N N    . ALA A 1 8   ? 35.853 -18.430 0.307   1.00 25.87  ? 12   ALA A N    1 
ATOM   70   C CA   . ALA A 1 8   ? 35.863 -17.702 1.559   1.00 24.84  ? 12   ALA A CA   1 
ATOM   71   C C    . ALA A 1 8   ? 35.285 -18.608 2.637   1.00 27.22  ? 12   ALA A C    1 
ATOM   72   O O    . ALA A 1 8   ? 34.456 -19.479 2.352   1.00 26.97  ? 12   ALA A O    1 
ATOM   73   C CB   . ALA A 1 8   ? 34.993 -16.467 1.437   1.00 23.00  ? 12   ALA A CB   1 
ATOM   74   H H    . ALA A 1 8   ? 35.223 -18.165 -0.395  1.00 0.00   ? 12   ALA A H    1 
ATOM   75   N N    . PRO A 1 9   ? 35.729 -18.444 3.896   1.00 30.85  ? 13   PRO A N    1 
ATOM   76   C CA   . PRO A 1 9   ? 35.215 -19.249 4.999   1.00 32.97  ? 13   PRO A CA   1 
ATOM   77   C C    . PRO A 1 9   ? 33.818 -18.715 5.276   1.00 33.19  ? 13   PRO A C    1 
ATOM   78   O O    . PRO A 1 9   ? 33.612 -17.504 5.177   1.00 33.69  ? 13   PRO A O    1 
ATOM   79   C CB   . PRO A 1 9   ? 36.213 -18.953 6.131   1.00 34.03  ? 13   PRO A CB   1 
ATOM   80   C CG   . PRO A 1 9   ? 36.819 -17.614 5.746   1.00 37.20  ? 13   PRO A CG   1 
ATOM   81   C CD   . PRO A 1 9   ? 36.966 -17.733 4.273   1.00 33.29  ? 13   PRO A CD   1 
ATOM   82   N N    . ALA A 1 10  ? 32.845 -19.567 5.591   1.00 33.73  ? 14   ALA A N    1 
ATOM   83   C CA   . ALA A 1 10  ? 31.503 -19.039 5.810   1.00 34.24  ? 14   ALA A CA   1 
ATOM   84   C C    . ALA A 1 10  ? 31.449 -18.069 6.977   1.00 31.38  ? 14   ALA A C    1 
ATOM   85   O O    . ALA A 1 10  ? 32.229 -18.161 7.926   1.00 32.13  ? 14   ALA A O    1 
ATOM   86   C CB   . ALA A 1 10  ? 30.476 -20.152 6.003   1.00 34.29  ? 14   ALA A CB   1 
ATOM   87   H H    . ALA A 1 10  ? 33.026 -20.526 5.674   1.00 0.00   ? 14   ALA A H    1 
ATOM   88   N N    . ASP A 1 11  ? 30.576 -17.079 6.835   1.00 30.51  ? 15   ASP A N    1 
ATOM   89   C CA   . ASP A 1 11  ? 30.373 -16.054 7.838   1.00 25.71  ? 15   ASP A CA   1 
ATOM   90   C C    . ASP A 1 11  ? 29.869 -16.749 9.105   1.00 21.80  ? 15   ASP A C    1 
ATOM   91   O O    . ASP A 1 11  ? 28.936 -17.567 9.039   1.00 26.52  ? 15   ASP A O    1 
ATOM   92   C CB   . ASP A 1 11  ? 29.343 -15.060 7.316   1.00 24.36  ? 15   ASP A CB   1 
ATOM   93   C CG   . ASP A 1 11  ? 29.263 -13.819 8.157   1.00 22.72  ? 15   ASP A CG   1 
ATOM   94   O OD1  . ASP A 1 11  ? 28.511 -13.829 9.148   1.00 22.89  ? 15   ASP A OD1  1 
ATOM   95   O OD2  . ASP A 1 11  ? 29.965 -12.841 7.836   1.00 22.80  ? 15   ASP A OD2  1 
ATOM   96   H H    . ASP A 1 11  ? 30.044 -17.043 6.013   1.00 0.00   ? 15   ASP A H    1 
ATOM   97   N N    . PRO A 1 12  ? 30.484 -16.462 10.266  1.00 18.56  ? 16   PRO A N    1 
ATOM   98   C CA   . PRO A 1 12  ? 30.071 -17.091 11.519  1.00 20.28  ? 16   PRO A CA   1 
ATOM   99   C C    . PRO A 1 12  ? 28.610 -16.890 11.929  1.00 21.07  ? 16   PRO A C    1 
ATOM   100  O O    . PRO A 1 12  ? 28.013 -17.754 12.581  1.00 24.22  ? 16   PRO A O    1 
ATOM   101  C CB   . PRO A 1 12  ? 31.039 -16.511 12.546  1.00 16.88  ? 16   PRO A CB   1 
ATOM   102  C CG   . PRO A 1 12  ? 31.462 -15.215 11.951  1.00 18.92  ? 16   PRO A CG   1 
ATOM   103  C CD   . PRO A 1 12  ? 31.620 -15.547 10.493  1.00 17.98  ? 16   PRO A CD   1 
ATOM   104  N N    . ILE A 1 13  ? 28.029 -15.761 11.547  1.00 23.03  ? 17   ILE A N    1 
ATOM   105  C CA   . ILE A 1 13  ? 26.644 -15.488 11.891  1.00 23.34  ? 17   ILE A CA   1 
ATOM   106  C C    . ILE A 1 13  ? 25.720 -15.824 10.723  1.00 26.42  ? 17   ILE A C    1 
ATOM   107  O O    . ILE A 1 13  ? 24.798 -16.630 10.865  1.00 29.35  ? 17   ILE A O    1 
ATOM   108  C CB   . ILE A 1 13  ? 26.462 -14.013 12.291  1.00 20.12  ? 17   ILE A CB   1 
ATOM   109  C CG1  . ILE A 1 13  ? 27.322 -13.692 13.503  1.00 15.96  ? 17   ILE A CG1  1 
ATOM   110  C CG2  . ILE A 1 13  ? 25.018 -13.739 12.637  1.00 18.84  ? 17   ILE A CG2  1 
ATOM   111  C CD1  . ILE A 1 13  ? 27.422 -12.230 13.762  1.00 20.76  ? 17   ILE A CD1  1 
ATOM   112  H H    . ILE A 1 13  ? 28.539 -15.105 11.028  1.00 0.00   ? 17   ILE A H    1 
ATOM   113  N N    . LEU A 1 14  ? 26.021 -15.264 9.553   1.00 30.11  ? 18   LEU A N    1 
ATOM   114  C CA   . LEU A 1 14  ? 25.196 -15.464 8.362   1.00 33.17  ? 18   LEU A CA   1 
ATOM   115  C C    . LEU A 1 14  ? 25.217 -16.838 7.650   1.00 33.88  ? 18   LEU A C    1 
ATOM   116  O O    . LEU A 1 14  ? 24.218 -17.221 7.037   1.00 37.31  ? 18   LEU A O    1 
ATOM   117  C CB   . LEU A 1 14  ? 25.426 -14.323 7.350   1.00 33.56  ? 18   LEU A CB   1 
ATOM   118  C CG   . LEU A 1 14  ? 25.027 -12.882 7.715   1.00 34.92  ? 18   LEU A CG   1 
ATOM   119  C CD1  . LEU A 1 14  ? 25.294 -11.979 6.533   1.00 34.06  ? 18   LEU A CD1  1 
ATOM   120  C CD2  . LEU A 1 14  ? 23.566 -12.778 8.107   1.00 41.80  ? 18   LEU A CD2  1 
ATOM   121  H H    . LEU A 1 14  ? 26.804 -14.697 9.498   1.00 0.00   ? 18   LEU A H    1 
ATOM   122  N N    . GLY A 1 15  ? 26.325 -17.580 7.739   1.00 32.74  ? 19   GLY A N    1 
ATOM   123  C CA   . GLY A 1 15  ? 26.390 -18.889 7.094   1.00 34.53  ? 19   GLY A CA   1 
ATOM   124  C C    . GLY A 1 15  ? 25.657 -19.955 7.889   1.00 35.12  ? 19   GLY A C    1 
ATOM   125  O O    . GLY A 1 15  ? 25.413 -21.076 7.433   1.00 35.55  ? 19   GLY A O    1 
ATOM   126  H H    . GLY A 1 15  ? 27.091 -17.236 8.240   1.00 0.00   ? 19   GLY A H    1 
ATOM   127  N N    . LEU A 1 16  ? 25.331 -19.572 9.114   1.00 37.94  ? 20   LEU A N    1 
ATOM   128  C CA   . LEU A 1 16  ? 24.616 -20.397 10.064  1.00 37.82  ? 20   LEU A CA   1 
ATOM   129  C C    . LEU A 1 16  ? 23.166 -20.513 9.609   1.00 38.79  ? 20   LEU A C    1 
ATOM   130  O O    . LEU A 1 16  ? 22.521 -21.548 9.786   1.00 41.52  ? 20   LEU A O    1 
ATOM   131  C CB   . LEU A 1 16  ? 24.686 -19.706 11.418  1.00 37.18  ? 20   LEU A CB   1 
ATOM   132  C CG   . LEU A 1 16  ? 24.274 -20.448 12.668  1.00 36.97  ? 20   LEU A CG   1 
ATOM   133  C CD1  . LEU A 1 16  ? 25.152 -21.674 12.861  1.00 34.32  ? 20   LEU A CD1  1 
ATOM   134  C CD2  . LEU A 1 16  ? 24.433 -19.491 13.829  1.00 38.51  ? 20   LEU A CD2  1 
ATOM   135  H H    . LEU A 1 16  ? 25.590 -18.674 9.407   1.00 0.00   ? 20   LEU A H    1 
ATOM   136  N N    . ALA A 1 17  ? 22.660 -19.427 9.031   1.00 38.68  ? 21   ALA A N    1 
ATOM   137  C CA   . ALA A 1 17  ? 21.297 -19.383 8.534   1.00 41.67  ? 21   ALA A CA   1 
ATOM   138  C C    . ALA A 1 17  ? 21.140 -20.348 7.365   1.00 44.72  ? 21   ALA A C    1 
ATOM   139  O O    . ALA A 1 17  ? 20.076 -20.938 7.183   1.00 43.91  ? 21   ALA A O    1 
ATOM   140  C CB   . ALA A 1 17  ? 20.945 -17.966 8.101   1.00 44.52  ? 21   ALA A CB   1 
ATOM   141  H H    . ALA A 1 17  ? 23.226 -18.633 8.937   1.00 0.00   ? 21   ALA A H    1 
ATOM   142  N N    . ASP A 1 18  ? 22.209 -20.521 6.589   1.00 48.92  ? 22   ASP A N    1 
ATOM   143  C CA   . ASP A 1 18  ? 22.190 -21.432 5.443   1.00 53.17  ? 22   ASP A CA   1 
ATOM   144  C C    . ASP A 1 18  ? 22.106 -22.886 5.902   1.00 52.96  ? 22   ASP A C    1 
ATOM   145  O O    . ASP A 1 18  ? 21.363 -23.681 5.330   1.00 55.23  ? 22   ASP A O    1 
ATOM   146  C CB   . ASP A 1 18  ? 23.453 -21.265 4.579   1.00 57.22  ? 22   ASP A CB   1 
ATOM   147  C CG   . ASP A 1 18  ? 23.654 -19.845 4.081   1.00 64.16  ? 22   ASP A CG   1 
ATOM   148  O OD1  . ASP A 1 18  ? 22.730 -19.024 4.222   1.00 69.07  ? 22   ASP A OD1  1 
ATOM   149  O OD2  . ASP A 1 18  ? 24.747 -19.564 3.541   1.00 65.30  ? 22   ASP A OD2  1 
ATOM   150  H H    . ASP A 1 18  ? 23.030 -20.025 6.791   1.00 0.00   ? 22   ASP A H    1 
ATOM   151  N N    . LEU A 1 19  ? 22.903 -23.225 6.915   1.00 52.36  ? 23   LEU A N    1 
ATOM   152  C CA   . LEU A 1 19  ? 22.951 -24.578 7.471   1.00 52.98  ? 23   LEU A CA   1 
ATOM   153  C C    . LEU A 1 19  ? 21.589 -24.976 8.001   1.00 54.59  ? 23   LEU A C    1 
ATOM   154  O O    . LEU A 1 19  ? 21.123 -26.101 7.804   1.00 55.26  ? 23   LEU A O    1 
ATOM   155  C CB   . LEU A 1 19  ? 23.946 -24.643 8.632   1.00 51.01  ? 23   LEU A CB   1 
ATOM   156  C CG   . LEU A 1 19  ? 25.445 -24.517 8.393   1.00 48.31  ? 23   LEU A CG   1 
ATOM   157  C CD1  . LEU A 1 19  ? 26.112 -24.255 9.724   1.00 47.57  ? 23   LEU A CD1  1 
ATOM   158  C CD2  . LEU A 1 19  ? 25.995 -25.783 7.759   1.00 46.50  ? 23   LEU A CD2  1 
ATOM   159  H H    . LEU A 1 19  ? 23.479 -22.535 7.306   1.00 0.00   ? 23   LEU A H    1 
ATOM   160  N N    . PHE A 1 20  ? 20.991 -24.040 8.729   1.00 57.47  ? 24   PHE A N    1 
ATOM   161  C CA   . PHE A 1 20  ? 19.682 -24.211 9.330   1.00 60.74  ? 24   PHE A CA   1 
ATOM   162  C C    . PHE A 1 20  ? 18.624 -24.462 8.259   1.00 64.27  ? 24   PHE A C    1 
ATOM   163  O O    . PHE A 1 20  ? 17.691 -25.235 8.482   1.00 64.46  ? 24   PHE A O    1 
ATOM   164  C CB   . PHE A 1 20  ? 19.318 -22.963 10.133  1.00 57.89  ? 24   PHE A CB   1 
ATOM   165  C CG   . PHE A 1 20  ? 18.086 -23.123 10.965  1.00 57.74  ? 24   PHE A CG   1 
ATOM   166  C CD1  . PHE A 1 20  ? 18.150 -23.757 12.199  1.00 57.99  ? 24   PHE A CD1  1 
ATOM   167  C CD2  . PHE A 1 20  ? 16.856 -22.651 10.516  1.00 59.35  ? 24   PHE A CD2  1 
ATOM   168  C CE1  . PHE A 1 20  ? 17.015 -23.927 12.975  1.00 56.81  ? 24   PHE A CE1  1 
ATOM   169  C CE2  . PHE A 1 20  ? 15.709 -22.813 11.283  1.00 58.00  ? 24   PHE A CE2  1 
ATOM   170  C CZ   . PHE A 1 20  ? 15.787 -23.455 12.519  1.00 56.49  ? 24   PHE A CZ   1 
ATOM   171  H H    . PHE A 1 20  ? 21.457 -23.189 8.862   1.00 0.00   ? 24   PHE A H    1 
ATOM   172  N N    . ARG A 1 21  ? 18.750 -23.775 7.120   1.00 68.49  ? 25   ARG A N    1 
ATOM   173  C CA   . ARG A 1 21  ? 17.803 -23.945 6.015   1.00 72.41  ? 25   ARG A CA   1 
ATOM   174  C C    . ARG A 1 21  ? 17.988 -25.333 5.420   1.00 71.96  ? 25   ARG A C    1 
ATOM   175  O O    . ARG A 1 21  ? 17.021 -26.008 5.075   1.00 72.76  ? 25   ARG A O    1 
ATOM   176  C CB   . ARG A 1 21  ? 18.019 -22.935 4.872   1.00 78.18  ? 25   ARG A CB   1 
ATOM   177  C CG   . ARG A 1 21  ? 17.834 -21.440 5.159   1.00 86.08  ? 25   ARG A CG   1 
ATOM   178  C CD   . ARG A 1 21  ? 16.675 -21.075 6.095   1.00 93.09  ? 25   ARG A CD   1 
ATOM   179  N NE   . ARG A 1 21  ? 15.356 -21.605 5.741   1.00 99.70  ? 25   ARG A NE   1 
ATOM   180  C CZ   . ARG A 1 21  ? 14.507 -21.053 4.870   1.00 100.00 ? 25   ARG A CZ   1 
ATOM   181  N NH1  . ARG A 1 21  ? 14.821 -19.939 4.213   1.00 100.00 ? 25   ARG A NH1  1 
ATOM   182  N NH2  . ARG A 1 21  ? 13.294 -21.574 4.718   1.00 100.00 ? 25   ARG A NH2  1 
ATOM   183  H H    . ARG A 1 21  ? 19.495 -23.146 7.021   1.00 0.00   ? 25   ARG A H    1 
ATOM   184  H HE   . ARG A 1 21  ? 15.070 -22.434 6.178   1.00 0.00   ? 25   ARG A HE   1 
ATOM   185  H HH11 . ARG A 1 21  ? 15.705 -19.497 4.364   1.00 0.00   ? 25   ARG A HH11 1 
ATOM   186  H HH12 . ARG A 1 21  ? 14.170 -19.544 3.566   1.00 0.00   ? 25   ARG A HH12 1 
ATOM   187  H HH21 . ARG A 1 21  ? 13.024 -22.374 5.254   1.00 0.00   ? 25   ARG A HH21 1 
ATOM   188  H HH22 . ARG A 1 21  ? 12.653 -21.166 4.068   1.00 0.00   ? 25   ARG A HH22 1 
ATOM   189  N N    . ALA A 1 22  ? 19.247 -25.721 5.242   1.00 72.18  ? 26   ALA A N    1 
ATOM   190  C CA   . ALA A 1 22  ? 19.581 -27.021 4.671   1.00 73.50  ? 26   ALA A CA   1 
ATOM   191  C C    . ALA A 1 22  ? 19.191 -28.182 5.581   1.00 74.26  ? 26   ALA A C    1 
ATOM   192  O O    . ALA A 1 22  ? 19.257 -29.343 5.174   1.00 74.77  ? 26   ALA A O    1 
ATOM   193  C CB   . ALA A 1 22  ? 21.076 -27.080 4.368   1.00 75.07  ? 26   ALA A CB   1 
ATOM   194  H H    . ALA A 1 22  ? 19.969 -25.122 5.515   1.00 0.00   ? 26   ALA A H    1 
ATOM   195  N N    . ASP A 1 23  ? 18.759 -27.856 6.798   1.00 75.25  ? 27   ASP A N    1 
ATOM   196  C CA   . ASP A 1 23  ? 18.380 -28.842 7.812   1.00 75.75  ? 27   ASP A CA   1 
ATOM   197  C C    . ASP A 1 23  ? 16.950 -29.388 7.633   1.00 75.69  ? 27   ASP A C    1 
ATOM   198  O O    . ASP A 1 23  ? 15.979 -28.637 7.695   1.00 74.92  ? 27   ASP A O    1 
ATOM   199  C CB   . ASP A 1 23  ? 18.555 -28.200 9.197   1.00 75.24  ? 27   ASP A CB   1 
ATOM   200  C CG   . ASP A 1 23  ? 18.809 -29.213 10.309  1.00 74.83  ? 27   ASP A CG   1 
ATOM   201  O OD1  . ASP A 1 23  ? 18.760 -30.437 10.065  1.00 76.10  ? 27   ASP A OD1  1 
ATOM   202  O OD2  . ASP A 1 23  ? 19.055 -28.748 11.443  1.00 74.24  ? 27   ASP A OD2  1 
ATOM   203  H H    . ASP A 1 23  ? 18.700 -26.912 7.047   1.00 0.00   ? 27   ASP A H    1 
ATOM   204  N N    . GLU A 1 24  ? 16.838 -30.706 7.462   1.00 76.49  ? 28   GLU A N    1 
ATOM   205  C CA   . GLU A 1 24  ? 15.548 -31.377 7.237   1.00 77.96  ? 28   GLU A CA   1 
ATOM   206  C C    . GLU A 1 24  ? 14.779 -31.791 8.489   1.00 75.75  ? 28   GLU A C    1 
ATOM   207  O O    . GLU A 1 24  ? 13.637 -32.239 8.396   1.00 75.83  ? 28   GLU A O    1 
ATOM   208  C CB   . GLU A 1 24  ? 15.747 -32.638 6.380   1.00 82.97  ? 28   GLU A CB   1 
ATOM   209  C CG   . GLU A 1 24  ? 16.478 -32.445 5.049   1.00 90.25  ? 28   GLU A CG   1 
ATOM   210  C CD   . GLU A 1 24  ? 15.597 -31.887 3.925   1.00 94.68  ? 28   GLU A CD   1 
ATOM   211  O OE1  . GLU A 1 24  ? 14.819 -30.937 4.168   1.00 96.97  ? 28   GLU A OE1  1 
ATOM   212  O OE2  . GLU A 1 24  ? 15.710 -32.389 2.784   1.00 97.39  ? 28   GLU A OE2  1 
ATOM   213  H H    . GLU A 1 24  ? 17.653 -31.250 7.491   1.00 0.00   ? 28   GLU A H    1 
ATOM   214  N N    . ARG A 1 25  ? 15.394 -31.624 9.658   1.00 72.48  ? 29   ARG A N    1 
ATOM   215  C CA   . ARG A 1 25  ? 14.753 -32.040 10.904  1.00 69.42  ? 29   ARG A CA   1 
ATOM   216  C C    . ARG A 1 25  ? 13.609 -31.147 11.363  1.00 68.10  ? 29   ARG A C    1 
ATOM   217  O O    . ARG A 1 25  ? 13.686 -29.917 11.279  1.00 69.72  ? 29   ARG A O    1 
ATOM   218  C CB   . ARG A 1 25  ? 15.746 -32.118 12.030  1.00 67.84  ? 29   ARG A CB   1 
ATOM   219  C CG   . ARG A 1 25  ? 16.918 -33.010 11.835  1.00 67.02  ? 29   ARG A CG   1 
ATOM   220  C CD   . ARG A 1 25  ? 17.896 -32.245 12.622  1.00 67.98  ? 29   ARG A CD   1 
ATOM   221  N NE   . ARG A 1 25  ? 19.111 -32.906 13.033  1.00 68.87  ? 29   ARG A NE   1 
ATOM   222  C CZ   . ARG A 1 25  ? 20.257 -32.248 13.142  1.00 66.63  ? 29   ARG A CZ   1 
ATOM   223  N NH1  . ARG A 1 25  ? 20.323 -30.947 12.844  1.00 64.17  ? 29   ARG A NH1  1 
ATOM   224  N NH2  . ARG A 1 25  ? 21.304 -32.847 13.654  1.00 69.19  ? 29   ARG A NH2  1 
ATOM   225  H H    . ARG A 1 25  ? 16.285 -31.216 9.683   1.00 0.00   ? 29   ARG A H    1 
ATOM   226  H HE   . ARG A 1 25  ? 19.090 -33.864 13.237  1.00 0.00   ? 29   ARG A HE   1 
ATOM   227  H HH11 . ARG A 1 25  ? 19.510 -30.454 12.536  1.00 0.00   ? 29   ARG A HH11 1 
ATOM   228  H HH12 . ARG A 1 25  ? 21.193 -30.463 12.932  1.00 0.00   ? 29   ARG A HH12 1 
ATOM   229  H HH21 . ARG A 1 25  ? 21.240 -33.796 13.962  1.00 0.00   ? 29   ARG A HH21 1 
ATOM   230  H HH22 . ARG A 1 25  ? 22.167 -32.349 13.735  1.00 0.00   ? 29   ARG A HH22 1 
ATOM   231  N N    . PRO A 1 26  ? 12.583 -31.751 11.978  1.00 67.02  ? 30   PRO A N    1 
ATOM   232  C CA   . PRO A 1 26  ? 11.397 -31.046 12.465  1.00 63.64  ? 30   PRO A CA   1 
ATOM   233  C C    . PRO A 1 26  ? 11.618 -29.964 13.529  1.00 59.27  ? 30   PRO A C    1 
ATOM   234  O O    . PRO A 1 26  ? 11.373 -28.781 13.282  1.00 59.91  ? 30   PRO A O    1 
ATOM   235  C CB   . PRO A 1 26  ? 10.533 -32.176 13.017  1.00 66.05  ? 30   PRO A CB   1 
ATOM   236  C CG   . PRO A 1 26  ? 10.966 -33.370 12.208  1.00 66.90  ? 30   PRO A CG   1 
ATOM   237  C CD   . PRO A 1 26  ? 12.451 -33.202 12.218  1.00 67.95  ? 30   PRO A CD   1 
ATOM   238  N N    . GLY A 1 27  ? 12.092 -30.369 14.700  1.00 54.40  ? 31   GLY A N    1 
ATOM   239  C CA   . GLY A 1 27  ? 12.281 -29.426 15.790  1.00 48.29  ? 31   GLY A CA   1 
ATOM   240  C C    . GLY A 1 27  ? 13.598 -28.672 15.871  1.00 43.01  ? 31   GLY A C    1 
ATOM   241  O O    . GLY A 1 27  ? 14.139 -28.543 16.971  1.00 42.10  ? 31   GLY A O    1 
ATOM   242  H H    . GLY A 1 27  ? 12.323 -31.312 14.834  1.00 0.00   ? 31   GLY A H    1 
ATOM   243  N N    . LYS A 1 28  ? 14.130 -28.192 14.741  1.00 38.08  ? 32   LYS A N    1 
ATOM   244  C CA   . LYS A 1 28  ? 15.376 -27.426 14.799  1.00 36.19  ? 32   LYS A CA   1 
ATOM   245  C C    . LYS A 1 28  ? 15.037 -26.075 15.400  1.00 34.61  ? 32   LYS A C    1 
ATOM   246  O O    . LYS A 1 28  ? 13.966 -25.524 15.142  1.00 36.88  ? 32   LYS A O    1 
ATOM   247  C CB   . LYS A 1 28  ? 16.049 -27.206 13.436  1.00 33.30  ? 32   LYS A CB   1 
ATOM   248  C CG   . LYS A 1 28  ? 15.346 -27.746 12.227  1.00 33.18  ? 32   LYS A CG   1 
ATOM   249  C CD   . LYS A 1 28  ? 14.925 -26.598 11.368  1.00 31.32  ? 32   LYS A CD   1 
ATOM   250  C CE   . LYS A 1 28  ? 14.936 -26.955 9.918   1.00 32.53  ? 32   LYS A CE   1 
ATOM   251  N NZ   . LYS A 1 28  ? 14.620 -25.752 9.121   1.00 31.76  ? 32   LYS A NZ   1 
ATOM   252  H H    . LYS A 1 28  ? 13.668 -28.356 13.894  1.00 0.00   ? 32   LYS A H    1 
ATOM   253  H HZ1  . LYS A 1 28  ? 15.332 -25.017 9.309   1.00 0.00   ? 32   LYS A HZ1  1 
ATOM   254  H HZ2  . LYS A 1 28  ? 14.630 -25.994 8.110   1.00 0.00   ? 32   LYS A HZ2  1 
ATOM   255  H HZ3  . LYS A 1 28  ? 13.678 -25.398 9.385   1.00 0.00   ? 32   LYS A HZ3  1 
ATOM   256  N N    . ILE A 1 29  ? 15.965 -25.519 16.168  1.00 29.50  ? 33   ILE A N    1 
ATOM   257  C CA   . ILE A 1 29  ? 15.723 -24.232 16.800  1.00 25.98  ? 33   ILE A CA   1 
ATOM   258  C C    . ILE A 1 29  ? 16.862 -23.305 16.376  1.00 27.31  ? 33   ILE A C    1 
ATOM   259  O O    . ILE A 1 29  ? 18.020 -23.709 16.381  1.00 29.24  ? 33   ILE A O    1 
ATOM   260  C CB   . ILE A 1 29  ? 15.654 -24.411 18.338  1.00 24.52  ? 33   ILE A CB   1 
ATOM   261  C CG1  . ILE A 1 29  ? 14.607 -25.475 18.690  1.00 24.88  ? 33   ILE A CG1  1 
ATOM   262  C CG2  . ILE A 1 29  ? 15.281 -23.116 19.010  1.00 23.84  ? 33   ILE A CG2  1 
ATOM   263  C CD1  . ILE A 1 29  ? 14.616 -25.898 20.140  1.00 22.23  ? 33   ILE A CD1  1 
ATOM   264  H H    . ILE A 1 29  ? 16.812 -25.974 16.329  1.00 0.00   ? 33   ILE A H    1 
ATOM   265  N N    . ASN A 1 30  ? 16.528 -22.086 15.952  1.00 26.83  ? 34   ASN A N    1 
ATOM   266  C CA   . ASN A 1 30  ? 17.547 -21.136 15.498  1.00 26.32  ? 34   ASN A CA   1 
ATOM   267  C C    . ASN A 1 30  ? 17.707 -19.985 16.466  1.00 24.91  ? 34   ASN A C    1 
ATOM   268  O O    . ASN A 1 30  ? 16.869 -19.095 16.587  1.00 25.20  ? 34   ASN A O    1 
ATOM   269  C CB   . ASN A 1 30  ? 17.262 -20.679 14.059  1.00 27.41  ? 34   ASN A CB   1 
ATOM   270  C CG   . ASN A 1 30  ? 18.070 -19.456 13.624  1.00 31.74  ? 34   ASN A CG   1 
ATOM   271  O OD1  . ASN A 1 30  ? 17.515 -18.550 12.997  1.00 36.65  ? 34   ASN A OD1  1 
ATOM   272  N ND2  . ASN A 1 30  ? 19.376 -19.437 13.887  1.00 32.67  ? 34   ASN A ND2  1 
ATOM   273  H H    . ASN A 1 30  ? 15.585 -21.820 15.944  1.00 0.00   ? 34   ASN A H    1 
ATOM   274  H HD21 . ASN A 1 30  ? 19.778 -20.203 14.347  1.00 0.00   ? 34   ASN A HD21 1 
ATOM   275  H HD22 . ASN A 1 30  ? 19.886 -18.649 13.607  1.00 0.00   ? 34   ASN A HD22 1 
ATOM   276  N N    . LEU A 1 31  ? 18.829 -20.060 17.158  1.00 22.61  ? 35   LEU A N    1 
ATOM   277  C CA   . LEU A 1 31  ? 19.246 -19.130 18.180  1.00 19.41  ? 35   LEU A CA   1 
ATOM   278  C C    . LEU A 1 31  ? 20.473 -18.392 17.663  1.00 17.96  ? 35   LEU A C    1 
ATOM   279  O O    . LEU A 1 31  ? 21.259 -17.865 18.445  1.00 17.71  ? 35   LEU A O    1 
ATOM   280  C CB   . LEU A 1 31  ? 19.623 -19.949 19.408  1.00 23.46  ? 35   LEU A CB   1 
ATOM   281  C CG   . LEU A 1 31  ? 18.682 -20.166 20.586  1.00 28.18  ? 35   LEU A CG   1 
ATOM   282  C CD1  . LEU A 1 31  ? 17.268 -20.554 20.176  1.00 25.23  ? 35   LEU A CD1  1 
ATOM   283  C CD2  . LEU A 1 31  ? 19.298 -21.230 21.466  1.00 25.18  ? 35   LEU A CD2  1 
ATOM   284  H H    . LEU A 1 31  ? 19.413 -20.817 16.956  1.00 0.00   ? 35   LEU A H    1 
ATOM   285  N N    . GLY A 1 32  ? 20.591 -18.330 16.337  1.00 15.50  ? 36   GLY A N    1 
ATOM   286  C CA   . GLY A 1 32  ? 21.736 -17.715 15.680  1.00 18.48  ? 36   GLY A CA   1 
ATOM   287  C C    . GLY A 1 32  ? 21.719 -16.216 15.430  1.00 21.70  ? 36   GLY A C    1 
ATOM   288  O O    . GLY A 1 32  ? 22.195 -15.441 16.266  1.00 22.25  ? 36   GLY A O    1 
ATOM   289  H H    . GLY A 1 32  ? 19.879 -18.707 15.783  1.00 0.00   ? 36   GLY A H    1 
ATOM   290  N N    . ILE A 1 33  ? 21.246 -15.800 14.256  1.00 18.68  ? 37   ILE A N    1 
ATOM   291  C CA   . ILE A 1 33  ? 21.214 -14.380 13.895  1.00 16.82  ? 37   ILE A CA   1 
ATOM   292  C C    . ILE A 1 33  ? 20.358 -13.515 14.853  1.00 14.97  ? 37   ILE A C    1 
ATOM   293  O O    . ILE A 1 33  ? 19.390 -13.992 15.425  1.00 16.02  ? 37   ILE A O    1 
ATOM   294  C CB   . ILE A 1 33  ? 20.783 -14.245 12.402  1.00 18.21  ? 37   ILE A CB   1 
ATOM   295  C CG1  . ILE A 1 33  ? 20.765 -12.792 11.950  1.00 19.55  ? 37   ILE A CG1  1 
ATOM   296  C CG2  . ILE A 1 33  ? 19.473 -14.942 12.171  1.00 25.52  ? 37   ILE A CG2  1 
ATOM   297  C CD1  . ILE A 1 33  ? 22.054 -12.335 11.349  1.00 24.51  ? 37   ILE A CD1  1 
ATOM   298  H H    . ILE A 1 33  ? 20.917 -16.472 13.623  1.00 0.00   ? 37   ILE A H    1 
ATOM   299  N N    . GLY A 1 34  ? 20.765 -12.259 15.054  1.00 12.36  ? 38   GLY A N    1 
ATOM   300  C CA   . GLY A 1 34  ? 20.077 -11.341 15.957  1.00 13.08  ? 38   GLY A CA   1 
ATOM   301  C C    . GLY A 1 34  ? 18.810 -10.714 15.408  1.00 14.66  ? 38   GLY A C    1 
ATOM   302  O O    . GLY A 1 34  ? 18.742 -9.508  15.156  1.00 13.51  ? 38   GLY A O    1 
ATOM   303  H H    . GLY A 1 34  ? 21.552 -11.940 14.569  1.00 0.00   ? 38   GLY A H    1 
ATOM   304  N N    . VAL A 1 35  ? 17.825 -11.566 15.162  1.00 15.70  ? 39   VAL A N    1 
ATOM   305  C CA   . VAL A 1 35  ? 16.534 -11.149 14.648  1.00 17.88  ? 39   VAL A CA   1 
ATOM   306  C C    . VAL A 1 35  ? 15.501 -11.504 15.706  1.00 17.32  ? 39   VAL A C    1 
ATOM   307  O O    . VAL A 1 35  ? 15.554 -12.583 16.300  1.00 15.06  ? 39   VAL A O    1 
ATOM   308  C CB   . VAL A 1 35  ? 16.216 -11.856 13.308  1.00 14.50  ? 39   VAL A CB   1 
ATOM   309  C CG1  . VAL A 1 35  ? 14.759 -11.691 12.952  1.00 18.07  ? 39   VAL A CG1  1 
ATOM   310  C CG2  . VAL A 1 35  ? 17.070 -11.286 12.201  1.00 13.42  ? 39   VAL A CG2  1 
ATOM   311  H H    . VAL A 1 35  ? 17.962 -12.518 15.339  1.00 0.00   ? 39   VAL A H    1 
ATOM   312  N N    . TYR A 1 36  ? 14.654 -10.529 16.025  1.00 16.09  ? 40   TYR A N    1 
ATOM   313  C CA   . TYR A 1 36  ? 13.596 -10.706 17.011  1.00 15.79  ? 40   TYR A CA   1 
ATOM   314  C C    . TYR A 1 36  ? 12.510 -11.640 16.523  1.00 16.64  ? 40   TYR A C    1 
ATOM   315  O O    . TYR A 1 36  ? 12.158 -11.646 15.344  1.00 16.96  ? 40   TYR A O    1 
ATOM   316  C CB   . TYR A 1 36  ? 12.945 -9.360  17.354  1.00 18.25  ? 40   TYR A CB   1 
ATOM   317  C CG   . TYR A 1 36  ? 11.751 -9.466  18.295  1.00 21.61  ? 40   TYR A CG   1 
ATOM   318  C CD1  . TYR A 1 36  ? 11.936 -9.638  19.668  1.00 23.21  ? 40   TYR A CD1  1 
ATOM   319  C CD2  . TYR A 1 36  ? 10.433 -9.411  17.813  1.00 20.12  ? 40   TYR A CD2  1 
ATOM   320  C CE1  . TYR A 1 36  ? 10.853 -9.754  20.535  1.00 26.26  ? 40   TYR A CE1  1 
ATOM   321  C CE2  . TYR A 1 36  ? 9.342  -9.529  18.680  1.00 25.16  ? 40   TYR A CE2  1 
ATOM   322  C CZ   . TYR A 1 36  ? 9.570  -9.701  20.037  1.00 25.38  ? 40   TYR A CZ   1 
ATOM   323  O OH   . TYR A 1 36  ? 8.529  -9.838  20.914  1.00 28.78  ? 40   TYR A OH   1 
ATOM   324  H H    . TYR A 1 36  ? 14.751 -9.664  15.582  1.00 0.00   ? 40   TYR A H    1 
ATOM   325  H HH   . TYR A 1 36  ? 8.868  -9.941  21.806  1.00 0.00   ? 40   TYR A HH   1 
ATOM   326  N N    . LYS A 1 37  ? 11.978 -12.421 17.455  1.00 17.33  ? 41   LYS A N    1 
ATOM   327  C CA   . LYS A 1 37  ? 10.889 -13.347 17.173  1.00 19.12  ? 41   LYS A CA   1 
ATOM   328  C C    . LYS A 1 37  ? 9.785  -13.089 18.206  1.00 17.73  ? 41   LYS A C    1 
ATOM   329  O O    . LYS A 1 37  ? 10.105 -12.750 19.342  1.00 14.08  ? 41   LYS A O    1 
ATOM   330  C CB   . LYS A 1 37  ? 11.416 -14.776 17.277  1.00 22.11  ? 41   LYS A CB   1 
ATOM   331  C CG   . LYS A 1 37  ? 11.201 -15.525 16.019  1.00 28.59  ? 41   LYS A CG   1 
ATOM   332  C CD   . LYS A 1 37  ? 12.341 -16.393 15.668  1.00 35.45  ? 41   LYS A CD   1 
ATOM   333  C CE   . LYS A 1 37  ? 12.902 -15.813 14.422  1.00 43.55  ? 41   LYS A CE   1 
ATOM   334  N NZ   . LYS A 1 37  ? 13.548 -16.776 13.544  1.00 50.88  ? 41   LYS A NZ   1 
ATOM   335  H H    . LYS A 1 37  ? 12.331 -12.373 18.368  1.00 0.00   ? 41   LYS A H    1 
ATOM   336  H HZ1  . LYS A 1 37  ? 12.859 -17.501 13.259  1.00 0.00   ? 41   LYS A HZ1  1 
ATOM   337  H HZ2  . LYS A 1 37  ? 13.908 -16.288 12.699  1.00 0.00   ? 41   LYS A HZ2  1 
ATOM   338  H HZ3  . LYS A 1 37  ? 14.338 -17.227 14.047  1.00 0.00   ? 41   LYS A HZ3  1 
ATOM   339  N N    . ASP A 1 38  ? 8.508  -13.133 17.800  1.00 20.85  ? 42   ASP A N    1 
ATOM   340  C CA   . ASP A 1 38  ? 7.395  -12.932 18.752  1.00 20.31  ? 42   ASP A CA   1 
ATOM   341  C C    . ASP A 1 38  ? 7.071  -14.287 19.414  1.00 21.05  ? 42   ASP A C    1 
ATOM   342  O O    . ASP A 1 38  ? 7.723  -15.275 19.081  1.00 20.20  ? 42   ASP A O    1 
ATOM   343  C CB   . ASP A 1 38  ? 6.140  -12.320 18.075  1.00 22.74  ? 42   ASP A CB   1 
ATOM   344  C CG   . ASP A 1 38  ? 5.591  -13.158 16.905  1.00 23.95  ? 42   ASP A CG   1 
ATOM   345  O OD1  . ASP A 1 38  ? 5.883  -14.361 16.805  1.00 24.54  ? 42   ASP A OD1  1 
ATOM   346  O OD2  . ASP A 1 38  ? 4.838  -12.577 16.087  1.00 27.57  ? 42   ASP A OD2  1 
ATOM   347  H H    . ASP A 1 38  ? 8.299  -13.309 16.865  1.00 0.00   ? 42   ASP A H    1 
ATOM   348  N N    . GLU A 1 39  ? 6.090  -14.354 20.329  1.00 22.82  ? 43   GLU A N    1 
ATOM   349  C CA   . GLU A 1 39  ? 5.760  -15.635 21.004  1.00 25.96  ? 43   GLU A CA   1 
ATOM   350  C C    . GLU A 1 39  ? 5.531  -16.849 20.112  1.00 24.55  ? 43   GLU A C    1 
ATOM   351  O O    . GLU A 1 39  ? 5.571  -17.983 20.585  1.00 26.08  ? 43   GLU A O    1 
ATOM   352  C CB   . GLU A 1 39  ? 4.535  -15.572 21.971  1.00 32.66  ? 43   GLU A CB   1 
ATOM   353  C CG   . GLU A 1 39  ? 3.699  -14.285 22.139  1.00 47.74  ? 43   GLU A CG   1 
ATOM   354  C CD   . GLU A 1 39  ? 2.455  -14.138 21.213  1.00 55.85  ? 43   GLU A CD   1 
ATOM   355  O OE1  . GLU A 1 39  ? 2.605  -13.753 20.030  1.00 58.91  ? 43   GLU A OE1  1 
ATOM   356  O OE2  . GLU A 1 39  ? 1.310  -14.326 21.692  1.00 58.06  ? 43   GLU A OE2  1 
ATOM   357  H H    . GLU A 1 39  ? 5.591  -13.541 20.549  1.00 0.00   ? 43   GLU A H    1 
ATOM   358  N N    . THR A 1 40  ? 5.244  -16.613 18.839  1.00 28.06  ? 44   THR A N    1 
ATOM   359  C CA   . THR A 1 40  ? 4.950  -17.695 17.907  1.00 27.91  ? 44   THR A CA   1 
ATOM   360  C C    . THR A 1 40  ? 6.127  -18.070 17.014  1.00 26.50  ? 44   THR A C    1 
ATOM   361  O O    . THR A 1 40  ? 6.010  -18.944 16.157  1.00 28.34  ? 44   THR A O    1 
ATOM   362  C CB   . THR A 1 40  ? 3.742  -17.304 17.036  1.00 30.39  ? 44   THR A CB   1 
ATOM   363  O OG1  . THR A 1 40  ? 4.040  -16.075 16.366  1.00 30.47  ? 44   THR A OG1  1 
ATOM   364  C CG2  . THR A 1 40  ? 2.492  -17.110 17.906  1.00 33.37  ? 44   THR A CG2  1 
ATOM   365  H H    . THR A 1 40  ? 5.219  -15.690 18.514  1.00 0.00   ? 44   THR A H    1 
ATOM   366  H HG1  . THR A 1 40  ? 3.290  -15.808 15.830  1.00 0.00   ? 44   THR A HG1  1 
ATOM   367  N N    . GLY A 1 41  ? 7.247  -17.376 17.194  1.00 22.48  ? 45   GLY A N    1 
ATOM   368  C CA   . GLY A 1 41  ? 8.433  -17.657 16.403  1.00 22.30  ? 45   GLY A CA   1 
ATOM   369  C C    . GLY A 1 41  ? 8.429  -17.026 15.020  1.00 20.03  ? 45   GLY A C    1 
ATOM   370  O O    . GLY A 1 41  ? 9.074  -17.527 14.100  1.00 21.91  ? 45   GLY A O    1 
ATOM   371  H H    . GLY A 1 41  ? 7.265  -16.669 17.861  1.00 0.00   ? 45   GLY A H    1 
ATOM   372  N N    . LYS A 1 42  ? 7.700  -15.922 14.882  1.00 21.07  ? 46   LYS A N    1 
ATOM   373  C CA   . LYS A 1 42  ? 7.599  -15.194 13.622  1.00 22.42  ? 46   LYS A CA   1 
ATOM   374  C C    . LYS A 1 42  ? 8.333  -13.875 13.814  1.00 16.52  ? 46   LYS A C    1 
ATOM   375  O O    . LYS A 1 42  ? 8.530  -13.429 14.943  1.00 17.46  ? 46   LYS A O    1 
ATOM   376  C CB   . LYS A 1 42  ? 6.136  -14.863 13.301  1.00 31.84  ? 46   LYS A CB   1 
ATOM   377  C CG   . LYS A 1 42  ? 5.270  -16.002 12.763  1.00 45.69  ? 46   LYS A CG   1 
ATOM   378  C CD   . LYS A 1 42  ? 3.757  -15.868 13.125  1.00 56.16  ? 46   LYS A CD   1 
ATOM   379  C CE   . LYS A 1 42  ? 3.122  -14.489 12.840  1.00 62.01  ? 46   LYS A CE   1 
ATOM   380  N NZ   . LYS A 1 42  ? 2.897  -13.679 14.093  1.00 63.93  ? 46   LYS A NZ   1 
ATOM   381  H H    . LYS A 1 42  ? 7.214  -15.586 15.661  1.00 0.00   ? 46   LYS A H    1 
ATOM   382  H HZ1  . LYS A 1 42  ? 3.810  -13.523 14.566  1.00 0.00   ? 46   LYS A HZ1  1 
ATOM   383  H HZ2  . LYS A 1 42  ? 2.472  -12.763 13.844  1.00 0.00   ? 46   LYS A HZ2  1 
ATOM   384  H HZ3  . LYS A 1 42  ? 2.260  -14.197 14.731  1.00 0.00   ? 46   LYS A HZ3  1 
ATOM   385  N N    . THR A 1 43  ? 8.674  -13.233 12.708  1.00 15.66  ? 47   THR A N    1 
ATOM   386  C CA   . THR A 1 43  ? 9.334  -11.939 12.749  1.00 18.06  ? 47   THR A CA   1 
ATOM   387  C C    . THR A 1 43  ? 8.442  -11.039 11.900  1.00 18.91  ? 47   THR A C    1 
ATOM   388  O O    . THR A 1 43  ? 8.725  -10.787 10.723  1.00 17.35  ? 47   THR A O    1 
ATOM   389  C CB   . THR A 1 43  ? 10.775 -11.995 12.177  1.00 19.19  ? 47   THR A CB   1 
ATOM   390  O OG1  . THR A 1 43  ? 11.556 -12.884 12.981  1.00 18.89  ? 47   THR A OG1  1 
ATOM   391  C CG2  . THR A 1 43  ? 11.415 -10.603 12.197  1.00 13.67  ? 47   THR A CG2  1 
ATOM   392  H H    . THR A 1 43  ? 8.477  -13.640 11.839  1.00 0.00   ? 47   THR A H    1 
ATOM   393  H HG1  . THR A 1 43  ? 12.443 -12.948 12.623  1.00 0.00   ? 47   THR A HG1  1 
ATOM   394  N N    . PRO A 1 44  ? 7.304  -10.603 12.465  1.00 16.70  ? 48   PRO A N    1 
ATOM   395  C CA   . PRO A 1 44  ? 6.360  -9.735  11.765  1.00 18.92  ? 48   PRO A CA   1 
ATOM   396  C C    . PRO A 1 44  ? 6.889  -8.359  11.449  1.00 19.09  ? 48   PRO A C    1 
ATOM   397  O O    . PRO A 1 44  ? 7.859  -7.902  12.052  1.00 19.82  ? 48   PRO A O    1 
ATOM   398  C CB   . PRO A 1 44  ? 5.212  -9.627  12.760  1.00 19.78  ? 48   PRO A CB   1 
ATOM   399  C CG   . PRO A 1 44  ? 5.922  -9.712  14.083  1.00 20.97  ? 48   PRO A CG   1 
ATOM   400  C CD   . PRO A 1 44  ? 6.825  -10.888 13.828  1.00 18.82  ? 48   PRO A CD   1 
ATOM   401  N N    . VAL A 1 45  ? 6.314  -7.720  10.441  1.00 15.29  ? 49   VAL A N    1 
ATOM   402  C CA   . VAL A 1 45  ? 6.719  -6.362  10.173  1.00 15.05  ? 49   VAL A CA   1 
ATOM   403  C C    . VAL A 1 45  ? 5.810  -5.605  11.151  1.00 14.84  ? 49   VAL A C    1 
ATOM   404  O O    . VAL A 1 45  ? 4.674  -6.015  11.387  1.00 16.81  ? 49   VAL A O    1 
ATOM   405  C CB   . VAL A 1 45  ? 6.570  -5.951  8.657   1.00 13.06  ? 49   VAL A CB   1 
ATOM   406  C CG1  . VAL A 1 45  ? 5.912  -7.051  7.830   1.00 12.43  ? 49   VAL A CG1  1 
ATOM   407  C CG2  . VAL A 1 45  ? 5.830  -4.649  8.521   1.00 9.24   ? 49   VAL A CG2  1 
ATOM   408  H H    . VAL A 1 45  ? 5.617  -8.172  9.923   1.00 0.00   ? 49   VAL A H    1 
ATOM   409  N N    . LEU A 1 46  ? 6.384  -4.630  11.850  1.00 12.94  ? 50   LEU A N    1 
ATOM   410  C CA   . LEU A 1 46  ? 5.657  -3.843  12.836  1.00 12.27  ? 50   LEU A CA   1 
ATOM   411  C C    . LEU A 1 46  ? 4.424  -3.152  12.249  1.00 15.63  ? 50   LEU A C    1 
ATOM   412  O O    . LEU A 1 46  ? 4.372  -2.821  11.063  1.00 13.96  ? 50   LEU A O    1 
ATOM   413  C CB   . LEU A 1 46  ? 6.580  -2.811  13.534  1.00 10.75  ? 50   LEU A CB   1 
ATOM   414  C CG   . LEU A 1 46  ? 7.893  -3.192  14.258  1.00 14.06  ? 50   LEU A CG   1 
ATOM   415  C CD1  . LEU A 1 46  ? 8.380  -2.043  15.123  1.00 9.35   ? 50   LEU A CD1  1 
ATOM   416  C CD2  . LEU A 1 46  ? 7.716  -4.406  15.118  1.00 14.65  ? 50   LEU A CD2  1 
ATOM   417  H H    . LEU A 1 46  ? 7.331  -4.435  11.692  1.00 0.00   ? 50   LEU A H    1 
ATOM   418  N N    . THR A 1 47  ? 3.389  -3.056  13.075  1.00 15.02  ? 51   THR A N    1 
ATOM   419  C CA   . THR A 1 47  ? 2.134  -2.428  12.718  1.00 12.92  ? 51   THR A CA   1 
ATOM   420  C C    . THR A 1 47  ? 2.386  -0.956  12.402  1.00 11.20  ? 51   THR A C    1 
ATOM   421  O O    . THR A 1 47  ? 1.848  -0.421  11.433  1.00 12.63  ? 51   THR A O    1 
ATOM   422  C CB   . THR A 1 47  ? 1.133  -2.666  13.863  1.00 12.14  ? 51   THR A CB   1 
ATOM   423  O OG1  . THR A 1 47  ? 0.752  -4.044  13.816  1.00 16.26  ? 51   THR A OG1  1 
ATOM   424  C CG2  . THR A 1 47  ? -0.081 -1.766  13.764  1.00 9.94   ? 51   THR A CG2  1 
ATOM   425  H H    . THR A 1 47  ? 3.476  -3.456  13.960  1.00 0.00   ? 51   THR A H    1 
ATOM   426  H HG1  . THR A 1 47  ? 0.130  -4.229  14.523  1.00 0.00   ? 51   THR A HG1  1 
ATOM   427  N N    . SER A 1 48  ? 3.258  -0.317  13.177  1.00 12.58  ? 52   SER A N    1 
ATOM   428  C CA   . SER A 1 48  ? 3.592  1.071   12.891  1.00 13.02  ? 52   SER A CA   1 
ATOM   429  C C    . SER A 1 48  ? 4.278  1.197   11.527  1.00 11.41  ? 52   SER A C    1 
ATOM   430  O O    . SER A 1 48  ? 4.089  2.208   10.845  1.00 11.97  ? 52   SER A O    1 
ATOM   431  C CB   . SER A 1 48  ? 4.500  1.626   13.964  1.00 8.48   ? 52   SER A CB   1 
ATOM   432  O OG   . SER A 1 48  ? 5.627  0.786   14.077  1.00 12.97  ? 52   SER A OG   1 
ATOM   433  H H    . SER A 1 48  ? 3.674  -0.785  13.928  1.00 0.00   ? 52   SER A H    1 
ATOM   434  H HG   . SER A 1 48  ? 6.214  1.117   14.760  1.00 0.00   ? 52   SER A HG   1 
ATOM   435  N N    . VAL A 1 49  ? 5.112  0.225   11.136  1.00 15.21  ? 53   VAL A N    1 
ATOM   436  C CA   . VAL A 1 49  ? 5.750  0.358   9.824   1.00 12.53  ? 53   VAL A CA   1 
ATOM   437  C C    . VAL A 1 49  ? 4.801  0.030   8.660   1.00 11.31  ? 53   VAL A C    1 
ATOM   438  O O    . VAL A 1 49  ? 4.874  0.692   7.623   1.00 12.69  ? 53   VAL A O    1 
ATOM   439  C CB   . VAL A 1 49  ? 7.161  -0.363  9.695   1.00 15.12  ? 53   VAL A CB   1 
ATOM   440  C CG1  . VAL A 1 49  ? 7.820  -0.563  11.055  1.00 7.00   ? 53   VAL A CG1  1 
ATOM   441  C CG2  . VAL A 1 49  ? 7.083  -1.629  8.884   1.00 9.88   ? 53   VAL A CG2  1 
ATOM   442  H H    . VAL A 1 49  ? 5.280  -0.552  11.709  1.00 0.00   ? 53   VAL A H    1 
ATOM   443  N N    . LYS A 1 50  ? 3.886  -0.933  8.852   1.00 11.29  ? 54   LYS A N    1 
ATOM   444  C CA   . LYS A 1 50  ? 2.884  -1.267  7.827   1.00 11.07  ? 54   LYS A CA   1 
ATOM   445  C C    . LYS A 1 50  ? 2.054  -0.014  7.538   1.00 10.28  ? 54   LYS A C    1 
ATOM   446  O O    . LYS A 1 50  ? 1.690  0.246   6.390   1.00 12.79  ? 54   LYS A O    1 
ATOM   447  C CB   . LYS A 1 50  ? 1.922  -2.379  8.297   1.00 6.59   ? 54   LYS A CB   1 
ATOM   448  C CG   . LYS A 1 50  ? 2.346  -3.819  8.017   1.00 5.89   ? 54   LYS A CG   1 
ATOM   449  C CD   . LYS A 1 50  ? 2.402  -4.127  6.539   1.00 7.51   ? 54   LYS A CD   1 
ATOM   450  C CE   . LYS A 1 50  ? 2.628  -5.603  6.319   1.00 6.74   ? 54   LYS A CE   1 
ATOM   451  N NZ   . LYS A 1 50  ? 2.967  -5.859  4.902   1.00 6.54   ? 54   LYS A NZ   1 
ATOM   452  H H    . LYS A 1 50  ? 3.879  -1.417  9.701   1.00 0.00   ? 54   LYS A H    1 
ATOM   453  H HZ1  . LYS A 1 50  ? 3.832  -5.337  4.654   1.00 0.00   ? 54   LYS A HZ1  1 
ATOM   454  H HZ2  . LYS A 1 50  ? 3.123  -6.877  4.761   1.00 0.00   ? 54   LYS A HZ2  1 
ATOM   455  H HZ3  . LYS A 1 50  ? 2.184  -5.541  4.296   1.00 0.00   ? 54   LYS A HZ3  1 
ATOM   456  N N    . LYS A 1 51  ? 1.711  0.728   8.592   1.00 10.09  ? 55   LYS A N    1 
ATOM   457  C CA   . LYS A 1 51  ? 0.924  1.947   8.430   1.00 13.53  ? 55   LYS A CA   1 
ATOM   458  C C    . LYS A 1 51  ? 1.696  3.014   7.682   1.00 14.13  ? 55   LYS A C    1 
ATOM   459  O O    . LYS A 1 51  ? 1.137  3.701   6.826   1.00 11.46  ? 55   LYS A O    1 
ATOM   460  C CB   . LYS A 1 51  ? 0.447  2.495   9.775   1.00 15.31  ? 55   LYS A CB   1 
ATOM   461  C CG   . LYS A 1 51  ? -0.608 1.635   10.425  1.00 26.24  ? 55   LYS A CG   1 
ATOM   462  C CD   . LYS A 1 51  ? -1.161 2.303   11.656  1.00 35.07  ? 55   LYS A CD   1 
ATOM   463  C CE   . LYS A 1 51  ? -2.022 3.499   11.298  1.00 42.16  ? 55   LYS A CE   1 
ATOM   464  N NZ   . LYS A 1 51  ? -2.457 4.229   12.522  1.00 47.67  ? 55   LYS A NZ   1 
ATOM   465  H H    . LYS A 1 51  ? 1.998  0.454   9.487   1.00 0.00   ? 55   LYS A H    1 
ATOM   466  H HZ1  . LYS A 1 51  ? -1.620 4.561   13.042  1.00 0.00   ? 55   LYS A HZ1  1 
ATOM   467  H HZ2  . LYS A 1 51  ? -3.042 5.044   12.250  1.00 0.00   ? 55   LYS A HZ2  1 
ATOM   468  H HZ3  . LYS A 1 51  ? -3.011 3.590   13.128  1.00 0.00   ? 55   LYS A HZ3  1 
ATOM   469  N N    . ALA A 1 52  ? 2.968  3.198   8.031   1.00 13.86  ? 56   ALA A N    1 
ATOM   470  C CA   . ALA A 1 52  ? 3.767  4.187   7.323   1.00 13.71  ? 56   ALA A CA   1 
ATOM   471  C C    . ALA A 1 52  ? 3.918  3.768   5.858   1.00 8.70   ? 56   ALA A C    1 
ATOM   472  O O    . ALA A 1 52  ? 3.875  4.613   4.969   1.00 13.97  ? 56   ALA A O    1 
ATOM   473  C CB   . ALA A 1 52  ? 5.134  4.356   7.981   1.00 16.62  ? 56   ALA A CB   1 
ATOM   474  H H    . ALA A 1 52  ? 3.363  2.668   8.755   1.00 0.00   ? 56   ALA A H    1 
ATOM   475  N N    . GLU A 1 53  ? 4.013  2.463   5.602   1.00 10.76  ? 57   GLU A N    1 
ATOM   476  C CA   . GLU A 1 53  ? 4.160  2.009   4.225   1.00 11.90  ? 57   GLU A CA   1 
ATOM   477  C C    . GLU A 1 53  ? 2.928  2.316   3.381   1.00 13.70  ? 57   GLU A C    1 
ATOM   478  O O    . GLU A 1 53  ? 3.046  2.690   2.210   1.00 13.18  ? 57   GLU A O    1 
ATOM   479  C CB   . GLU A 1 53  ? 4.508  0.522   4.157   1.00 12.30  ? 57   GLU A CB   1 
ATOM   480  C CG   . GLU A 1 53  ? 5.843  0.182   4.779   1.00 12.59  ? 57   GLU A CG   1 
ATOM   481  C CD   . GLU A 1 53  ? 6.228  -1.259  4.573   1.00 14.72  ? 57   GLU A CD   1 
ATOM   482  O OE1  . GLU A 1 53  ? 5.523  -2.139  5.106   1.00 13.55  ? 57   GLU A OE1  1 
ATOM   483  O OE2  . GLU A 1 53  ? 7.228  -1.508  3.872   1.00 19.60  ? 57   GLU A OE2  1 
ATOM   484  H H    . GLU A 1 53  ? 3.955  1.817   6.330   1.00 0.00   ? 57   GLU A H    1 
ATOM   485  N N    . GLN A 1 54  ? 1.751  2.177   3.988   1.00 17.11  ? 58   GLN A N    1 
ATOM   486  C CA   . GLN A 1 54  ? 0.484  2.456   3.309   1.00 19.94  ? 58   GLN A CA   1 
ATOM   487  C C    . GLN A 1 54  ? 0.494  3.932   2.940   1.00 13.61  ? 58   GLN A C    1 
ATOM   488  O O    . GLN A 1 54  ? 0.141  4.307   1.829   1.00 15.99  ? 58   GLN A O    1 
ATOM   489  C CB   . GLN A 1 54  ? -0.710 2.144   4.231   1.00 25.01  ? 58   GLN A CB   1 
ATOM   490  C CG   . GLN A 1 54  ? -2.098 2.417   3.620   1.00 36.59  ? 58   GLN A CG   1 
ATOM   491  C CD   . GLN A 1 54  ? -2.529 1.395   2.568   1.00 44.68  ? 58   GLN A CD   1 
ATOM   492  O OE1  . GLN A 1 54  ? -2.834 0.241   2.889   1.00 51.07  ? 58   GLN A OE1  1 
ATOM   493  N NE2  . GLN A 1 54  ? -2.600 1.828   1.308   1.00 46.52  ? 58   GLN A NE2  1 
ATOM   494  H H    . GLN A 1 54  ? 1.734  1.883   4.923   1.00 0.00   ? 58   GLN A H    1 
ATOM   495  H HE21 . GLN A 1 54  ? -2.376 2.764   1.124   1.00 0.00   ? 58   GLN A HE21 1 
ATOM   496  H HE22 . GLN A 1 54  ? -2.874 1.190   0.617   1.00 0.00   ? 58   GLN A HE22 1 
ATOM   497  N N    . TYR A 1 55  ? 0.905  4.756   3.893   1.00 12.67  ? 59   TYR A N    1 
ATOM   498  C CA   . TYR A 1 55  ? 1.005  6.190   3.698   1.00 16.63  ? 59   TYR A CA   1 
ATOM   499  C C    . TYR A 1 55  ? 1.960  6.536   2.560   1.00 16.23  ? 59   TYR A C    1 
ATOM   500  O O    . TYR A 1 55  ? 1.705  7.446   1.772   1.00 14.51  ? 59   TYR A O    1 
ATOM   501  C CB   . TYR A 1 55  ? 1.498  6.829   4.988   1.00 18.28  ? 59   TYR A CB   1 
ATOM   502  C CG   . TYR A 1 55  ? 1.688  8.315   4.908   1.00 28.61  ? 59   TYR A CG   1 
ATOM   503  C CD1  . TYR A 1 55  ? 0.646  9.181   5.222   1.00 35.78  ? 59   TYR A CD1  1 
ATOM   504  C CD2  . TYR A 1 55  ? 2.912  8.867   4.524   1.00 31.11  ? 59   TYR A CD2  1 
ATOM   505  C CE1  . TYR A 1 55  ? 0.808  10.556  5.158   1.00 38.96  ? 59   TYR A CE1  1 
ATOM   506  C CE2  . TYR A 1 55  ? 3.088  10.242  4.455   1.00 34.33  ? 59   TYR A CE2  1 
ATOM   507  C CZ   . TYR A 1 55  ? 2.029  11.080  4.773   1.00 38.01  ? 59   TYR A CZ   1 
ATOM   508  O OH   . TYR A 1 55  ? 2.180  12.443  4.705   1.00 41.25  ? 59   TYR A OH   1 
ATOM   509  H H    . TYR A 1 55  ? 1.156  4.379   4.762   1.00 0.00   ? 59   TYR A H    1 
ATOM   510  H HH   . TYR A 1 55  ? 3.073  12.657  4.425   1.00 0.00   ? 59   TYR A HH   1 
ATOM   511  N N    . LEU A 1 56  ? 3.065  5.802   2.479   1.00 17.35  ? 60   LEU A N    1 
ATOM   512  C CA   . LEU A 1 56  ? 4.063  6.055   1.441   1.00 17.59  ? 60   LEU A CA   1 
ATOM   513  C C    . LEU A 1 56  ? 3.486  5.727   0.072   1.00 15.25  ? 60   LEU A C    1 
ATOM   514  O O    . LEU A 1 56  ? 3.588  6.513   -0.868  1.00 15.37  ? 60   LEU A O    1 
ATOM   515  C CB   . LEU A 1 56  ? 5.343  5.241   1.721   1.00 15.89  ? 60   LEU A CB   1 
ATOM   516  C CG   . LEU A 1 56  ? 6.540  5.970   2.374   1.00 17.89  ? 60   LEU A CG   1 
ATOM   517  C CD1  . LEU A 1 56  ? 6.106  7.085   3.307   1.00 21.60  ? 60   LEU A CD1  1 
ATOM   518  C CD2  . LEU A 1 56  ? 7.427  4.970   3.101   1.00 15.85  ? 60   LEU A CD2  1 
ATOM   519  H H    . LEU A 1 56  ? 3.206  5.071   3.113   1.00 0.00   ? 60   LEU A H    1 
ATOM   520  N N    . LEU A 1 57  ? 2.782  4.605   0.019   1.00 14.19  ? 61   LEU A N    1 
ATOM   521  C CA   . LEU A 1 57  ? 2.139  4.125   -1.189  1.00 18.45  ? 61   LEU A CA   1 
ATOM   522  C C    . LEU A 1 57  ? 1.094  5.132   -1.686  1.00 19.18  ? 61   LEU A C    1 
ATOM   523  O O    . LEU A 1 57  ? 0.928  5.323   -2.889  1.00 17.20  ? 61   LEU A O    1 
ATOM   524  C CB   . LEU A 1 57  ? 1.475  2.794   -0.877  1.00 17.66  ? 61   LEU A CB   1 
ATOM   525  C CG   . LEU A 1 57  ? 0.865  2.037   -2.033  1.00 17.75  ? 61   LEU A CG   1 
ATOM   526  C CD1  . LEU A 1 57  ? 1.950  1.611   -2.986  1.00 21.23  ? 61   LEU A CD1  1 
ATOM   527  C CD2  . LEU A 1 57  ? 0.147  0.841   -1.485  1.00 21.74  ? 61   LEU A CD2  1 
ATOM   528  H H    . LEU A 1 57  ? 2.681  4.085   0.840   1.00 0.00   ? 61   LEU A H    1 
ATOM   529  N N    . GLU A 1 58  ? 0.384  5.762   -0.751  1.00 22.54  ? 62   GLU A N    1 
ATOM   530  C CA   . GLU A 1 58  ? -0.633 6.745   -1.114  1.00 26.23  ? 62   GLU A CA   1 
ATOM   531  C C    . GLU A 1 58  ? 0.025  8.051   -1.541  1.00 23.83  ? 62   GLU A C    1 
ATOM   532  O O    . GLU A 1 58  ? -0.319 8.621   -2.577  1.00 26.12  ? 62   GLU A O    1 
ATOM   533  C CB   . GLU A 1 58  ? -1.571 7.125   0.063   1.00 33.94  ? 62   GLU A CB   1 
ATOM   534  C CG   . GLU A 1 58  ? -2.029 6.049   1.060   1.00 47.40  ? 62   GLU A CG   1 
ATOM   535  C CD   . GLU A 1 58  ? -3.313 5.305   0.666   1.00 56.18  ? 62   GLU A CD   1 
ATOM   536  O OE1  . GLU A 1 58  ? -3.347 4.707   -0.431  1.00 62.56  ? 62   GLU A OE1  1 
ATOM   537  O OE2  . GLU A 1 58  ? -4.264 5.268   1.482   1.00 58.07  ? 62   GLU A OE2  1 
ATOM   538  H H    . GLU A 1 58  ? 0.556  5.570   0.193   1.00 0.00   ? 62   GLU A H    1 
ATOM   539  N N    . ASN A 1 59  ? 1.038  8.470   -0.782  1.00 22.12  ? 63   ASN A N    1 
ATOM   540  C CA   . ASN A 1 59  ? 1.653  9.782   -0.997  1.00 22.89  ? 63   ASN A CA   1 
ATOM   541  C C    . ASN A 1 59  ? 2.897  10.064  -1.842  1.00 24.32  ? 63   ASN A C    1 
ATOM   542  O O    . ASN A 1 59  ? 3.178  11.238  -2.126  1.00 25.02  ? 63   ASN A O    1 
ATOM   543  C CB   . ASN A 1 59  ? 1.777  10.477  0.353   1.00 25.49  ? 63   ASN A CB   1 
ATOM   544  C CG   . ASN A 1 59  ? 0.447  10.571  1.073   1.00 30.99  ? 63   ASN A CG   1 
ATOM   545  O OD1  . ASN A 1 59  ? 0.047  9.652   1.795   1.00 35.44  ? 63   ASN A OD1  1 
ATOM   546  N ND2  . ASN A 1 59  ? -0.270 11.664  0.853   1.00 30.82  ? 63   ASN A ND2  1 
ATOM   547  H H    . ASN A 1 59  ? 1.386  7.878   -0.090  1.00 0.00   ? 63   ASN A H    1 
ATOM   548  H HD21 . ASN A 1 59  ? 0.090  12.344  0.246   1.00 0.00   ? 63   ASN A HD21 1 
ATOM   549  H HD22 . ASN A 1 59  ? -1.134 11.746  1.309   1.00 0.00   ? 63   ASN A HD22 1 
ATOM   550  N N    . GLU A 1 60  ? 3.654  9.031   -2.218  1.00 21.11  ? 64   GLU A N    1 
ATOM   551  C CA   . GLU A 1 60  ? 4.848  9.226   -3.040  1.00 18.70  ? 64   GLU A CA   1 
ATOM   552  C C    . GLU A 1 60  ? 4.463  9.579   -4.455  1.00 15.95  ? 64   GLU A C    1 
ATOM   553  O O    . GLU A 1 60  ? 3.678  8.891   -5.104  1.00 19.63  ? 64   GLU A O    1 
ATOM   554  C CB   . GLU A 1 60  ? 5.747  7.995   -3.066  1.00 16.15  ? 64   GLU A CB   1 
ATOM   555  C CG   . GLU A 1 60  ? 6.542  7.711   -1.806  1.00 21.65  ? 64   GLU A CG   1 
ATOM   556  C CD   . GLU A 1 60  ? 7.481  6.507   -1.958  1.00 21.69  ? 64   GLU A CD   1 
ATOM   557  O OE1  . GLU A 1 60  ? 7.272  5.674   -2.863  1.00 21.09  ? 64   GLU A OE1  1 
ATOM   558  O OE2  . GLU A 1 60  ? 8.437  6.400   -1.164  1.00 24.07  ? 64   GLU A OE2  1 
ATOM   559  H H    . GLU A 1 60  ? 3.390  8.130   -1.954  1.00 0.00   ? 64   GLU A H    1 
ATOM   560  N N    . THR A 1 61  ? 5.178  10.572  -4.944  1.00 14.20  ? 66   THR A N    1 
ATOM   561  C CA   . THR A 1 61  ? 5.016  11.183  -6.244  1.00 18.75  ? 66   THR A CA   1 
ATOM   562  C C    . THR A 1 61  ? 6.144  10.828  -7.200  1.00 14.86  ? 66   THR A C    1 
ATOM   563  O O    . THR A 1 61  ? 5.967  10.784  -8.423  1.00 12.72  ? 66   THR A O    1 
ATOM   564  C CB   . THR A 1 61  ? 4.983  12.697  -5.962  1.00 17.79  ? 66   THR A CB   1 
ATOM   565  O OG1  . THR A 1 61  ? 3.652  13.040  -5.587  1.00 31.01  ? 66   THR A OG1  1 
ATOM   566  C CG2  . THR A 1 61  ? 5.518  13.550  -7.100  1.00 29.18  ? 66   THR A CG2  1 
ATOM   567  H H    . THR A 1 61  ? 5.890  10.929  -4.373  1.00 0.00   ? 66   THR A H    1 
ATOM   568  H HG1  . THR A 1 61  ? 3.603  13.980  -5.401  1.00 0.00   ? 66   THR A HG1  1 
ATOM   569  N N    . THR A 1 62  ? 7.252  10.391  -6.619  1.00 14.47  ? 67   THR A N    1 
ATOM   570  C CA   . THR A 1 62  ? 8.429  10.088  -7.410  1.00 14.31  ? 67   THR A CA   1 
ATOM   571  C C    . THR A 1 62  ? 9.399  9.151   -6.702  1.00 13.51  ? 67   THR A C    1 
ATOM   572  O O    . THR A 1 62  ? 9.343  8.983   -5.484  1.00 14.72  ? 67   THR A O    1 
ATOM   573  C CB   . THR A 1 62  ? 9.164  11.418  -7.721  1.00 17.14  ? 67   THR A CB   1 
ATOM   574  O OG1  . THR A 1 62  ? 10.142 11.212  -8.742  1.00 15.80  ? 67   THR A OG1  1 
ATOM   575  C CG2  . THR A 1 62  ? 9.841  11.967  -6.452  1.00 15.20  ? 67   THR A CG2  1 
ATOM   576  H H    . THR A 1 62  ? 7.280  10.271  -5.647  1.00 0.00   ? 67   THR A H    1 
ATOM   577  H HG1  . THR A 1 62  ? 10.592 12.039  -8.927  1.00 0.00   ? 67   THR A HG1  1 
ATOM   578  N N    . LYS A 1 63  ? 10.237 8.491   -7.497  1.00 14.70  ? 68   LYS A N    1 
ATOM   579  C CA   . LYS A 1 63  ? 11.289 7.624   -6.975  1.00 15.47  ? 68   LYS A CA   1 
ATOM   580  C C    . LYS A 1 63  ? 12.619 8.280   -7.322  1.00 16.01  ? 68   LYS A C    1 
ATOM   581  O O    . LYS A 1 63  ? 13.656 7.629   -7.303  1.00 19.57  ? 68   LYS A O    1 
ATOM   582  C CB   . LYS A 1 63  ? 11.278 6.235   -7.609  1.00 11.21  ? 68   LYS A CB   1 
ATOM   583  C CG   . LYS A 1 63  ? 10.136 5.361   -7.200  1.00 10.58  ? 68   LYS A CG   1 
ATOM   584  C CD   . LYS A 1 63  ? 10.041 5.191   -5.719  1.00 8.98   ? 68   LYS A CD   1 
ATOM   585  C CE   . LYS A 1 63  ? 9.035  4.113   -5.484  1.00 7.55   ? 68   LYS A CE   1 
ATOM   586  N NZ   . LYS A 1 63  ? 8.962  3.748   -4.072  1.00 7.42   ? 68   LYS A NZ   1 
ATOM   587  H H    . LYS A 1 63  ? 10.147 8.591   -8.468  1.00 0.00   ? 68   LYS A H    1 
ATOM   588  H HZ1  . LYS A 1 63  ? 8.746  4.591   -3.506  1.00 0.00   ? 68   LYS A HZ1  1 
ATOM   589  H HZ2  . LYS A 1 63  ? 8.222  3.030   -3.933  1.00 0.00   ? 68   LYS A HZ2  1 
ATOM   590  H HZ3  . LYS A 1 63  ? 9.880  3.363   -3.771  1.00 0.00   ? 68   LYS A HZ3  1 
ATOM   591  N N    . ASN A 1 64  ? 12.582 9.567   -7.653  1.00 14.23  ? 69   ASN A N    1 
ATOM   592  C CA   . ASN A 1 64  ? 13.791 10.292  -8.012  1.00 15.39  ? 69   ASN A CA   1 
ATOM   593  C C    . ASN A 1 64  ? 14.826 10.216  -6.889  1.00 14.35  ? 69   ASN A C    1 
ATOM   594  O O    . ASN A 1 64  ? 14.489 10.223  -5.707  1.00 12.84  ? 69   ASN A O    1 
ATOM   595  C CB   . ASN A 1 64  ? 13.462 11.750  -8.334  1.00 13.10  ? 69   ASN A CB   1 
ATOM   596  C CG   . ASN A 1 64  ? 14.641 12.507  -8.911  1.00 18.70  ? 69   ASN A CG   1 
ATOM   597  O OD1  . ASN A 1 64  ? 15.697 11.935  -9.204  1.00 15.51  ? 69   ASN A OD1  1 
ATOM   598  N ND2  . ASN A 1 64  ? 14.463 13.801  -9.096  1.00 21.36  ? 69   ASN A ND2  1 
ATOM   599  H H    . ASN A 1 64  ? 11.727 10.044  -7.654  1.00 0.00   ? 69   ASN A H    1 
ATOM   600  H HD21 . ASN A 1 64  ? 13.597 14.192  -8.855  1.00 0.00   ? 69   ASN A HD21 1 
ATOM   601  H HD22 . ASN A 1 64  ? 15.208 14.318  -9.468  1.00 0.00   ? 69   ASN A HD22 1 
ATOM   602  N N    . TYR A 1 65  ? 16.091 10.137  -7.288  1.00 17.87  ? 70   TYR A N    1 
ATOM   603  C CA   . TYR A 1 65  ? 17.237 10.044  -6.378  1.00 12.58  ? 70   TYR A CA   1 
ATOM   604  C C    . TYR A 1 65  ? 17.232 10.986  -5.199  1.00 10.50  ? 70   TYR A C    1 
ATOM   605  O O    . TYR A 1 65  ? 16.943 12.175  -5.342  1.00 12.37  ? 70   TYR A O    1 
ATOM   606  C CB   . TYR A 1 65  ? 18.539 10.390  -7.103  1.00 11.67  ? 70   TYR A CB   1 
ATOM   607  C CG   . TYR A 1 65  ? 19.031 9.419   -8.122  1.00 8.70   ? 70   TYR A CG   1 
ATOM   608  C CD1  . TYR A 1 65  ? 19.473 8.145   -7.760  1.00 6.89   ? 70   TYR A CD1  1 
ATOM   609  C CD2  . TYR A 1 65  ? 19.111 9.787   -9.461  1.00 8.69   ? 70   TYR A CD2  1 
ATOM   610  C CE1  . TYR A 1 65  ? 19.977 7.273   -8.704  1.00 4.99   ? 70   TYR A CE1  1 
ATOM   611  C CE2  . TYR A 1 65  ? 19.612 8.924   -10.414 1.00 9.09   ? 70   TYR A CE2  1 
ATOM   612  C CZ   . TYR A 1 65  ? 20.043 7.674   -10.029 1.00 5.40   ? 70   TYR A CZ   1 
ATOM   613  O OH   . TYR A 1 65  ? 20.522 6.837   -10.997 1.00 8.32   ? 70   TYR A OH   1 
ATOM   614  H H    . TYR A 1 65  ? 16.270 10.132  -8.251  1.00 0.00   ? 70   TYR A H    1 
ATOM   615  H HH   . TYR A 1 65  ? 20.777 5.999   -10.604 1.00 0.00   ? 70   TYR A HH   1 
ATOM   616  N N    . LEU A 1 66  ? 17.601 10.448  -4.044  1.00 10.87  ? 71   LEU A N    1 
ATOM   617  C CA   . LEU A 1 66  ? 17.762 11.249  -2.844  1.00 12.43  ? 71   LEU A CA   1 
ATOM   618  C C    . LEU A 1 66  ? 19.151 11.862  -2.997  1.00 16.69  ? 71   LEU A C    1 
ATOM   619  O O    . LEU A 1 66  ? 19.869 11.558  -3.948  1.00 13.13  ? 71   LEU A O    1 
ATOM   620  C CB   . LEU A 1 66  ? 17.773 10.357  -1.603  1.00 18.35  ? 71   LEU A CB   1 
ATOM   621  C CG   . LEU A 1 66  ? 16.530 9.535   -1.272  1.00 17.18  ? 71   LEU A CG   1 
ATOM   622  C CD1  . LEU A 1 66  ? 16.727 8.736   0.020   1.00 11.74  ? 71   LEU A CD1  1 
ATOM   623  C CD2  . LEU A 1 66  ? 15.369 10.488  -1.137  1.00 16.10  ? 71   LEU A CD2  1 
ATOM   624  H H    . LEU A 1 66  ? 17.771 9.484   -4.001  1.00 0.00   ? 71   LEU A H    1 
ATOM   625  N N    . GLY A 1 67  ? 19.520 12.736  -2.069  1.00 15.87  ? 72   GLY A N    1 
ATOM   626  C CA   . GLY A 1 67  ? 20.849 13.311  -2.108  1.00 14.63  ? 72   GLY A CA   1 
ATOM   627  C C    . GLY A 1 67  ? 21.773 12.238  -1.564  1.00 14.88  ? 72   GLY A C    1 
ATOM   628  O O    . GLY A 1 67  ? 21.303 11.241  -1.017  1.00 18.48  ? 72   GLY A O    1 
ATOM   629  H H    . GLY A 1 67  ? 18.897 12.992  -1.357  1.00 0.00   ? 72   GLY A H    1 
ATOM   630  N N    . ILE A 1 68  ? 23.075 12.414  -1.749  1.00 15.33  ? 73   ILE A N    1 
ATOM   631  C CA   . ILE A 1 68  ? 24.069 11.462  -1.275  1.00 11.01  ? 73   ILE A CA   1 
ATOM   632  C C    . ILE A 1 68  ? 23.858 11.186  0.200   1.00 8.64   ? 73   ILE A C    1 
ATOM   633  O O    . ILE A 1 68  ? 24.039 10.067  0.673   1.00 10.41  ? 73   ILE A O    1 
ATOM   634  C CB   . ILE A 1 68  ? 25.483 12.023  -1.508  1.00 12.39  ? 73   ILE A CB   1 
ATOM   635  C CG1  . ILE A 1 68  ? 25.710 12.179  -3.004  1.00 15.64  ? 73   ILE A CG1  1 
ATOM   636  C CG2  . ILE A 1 68  ? 26.536 11.127  -0.891  1.00 9.46   ? 73   ILE A CG2  1 
ATOM   637  C CD1  . ILE A 1 68  ? 26.983 12.860  -3.353  1.00 21.14  ? 73   ILE A CD1  1 
ATOM   638  H H    . ILE A 1 68  ? 23.373 13.220  -2.220  1.00 0.00   ? 73   ILE A H    1 
ATOM   639  N N    . ASP A 1 69  ? 23.455 12.215  0.926   1.00 11.77  ? 74   ASP A N    1 
ATOM   640  C CA   . ASP A 1 69  ? 23.215 12.055  2.341   1.00 13.97  ? 74   ASP A CA   1 
ATOM   641  C C    . ASP A 1 69  ? 21.799 11.615  2.744   1.00 12.82  ? 74   ASP A C    1 
ATOM   642  O O    . ASP A 1 69  ? 21.536 11.388  3.917   1.00 13.61  ? 74   ASP A O    1 
ATOM   643  C CB   . ASP A 1 69  ? 23.686 13.294  3.121   1.00 14.19  ? 74   ASP A CB   1 
ATOM   644  C CG   . ASP A 1 69  ? 23.099 14.606  2.605   1.00 19.90  ? 74   ASP A CG   1 
ATOM   645  O OD1  . ASP A 1 69  ? 22.750 14.726  1.422   1.00 21.33  ? 74   ASP A OD1  1 
ATOM   646  O OD2  . ASP A 1 69  ? 23.013 15.536  3.440   1.00 24.87  ? 74   ASP A OD2  1 
ATOM   647  H H    . ASP A 1 69  ? 23.330 13.068  0.470   1.00 0.00   ? 74   ASP A H    1 
ATOM   648  N N    . GLY A 1 70  ? 20.901 11.442  1.776   1.00 14.98  ? 75   GLY A N    1 
ATOM   649  C CA   . GLY A 1 70  ? 19.555 10.973  2.100   1.00 17.44  ? 75   GLY A CA   1 
ATOM   650  C C    . GLY A 1 70  ? 18.458 11.992  2.368   1.00 17.55  ? 75   GLY A C    1 
ATOM   651  O O    . GLY A 1 70  ? 18.520 13.132  1.923   1.00 19.33  ? 75   GLY A O    1 
ATOM   652  H H    . GLY A 1 70  ? 21.144 11.651  0.858   1.00 0.00   ? 75   GLY A H    1 
ATOM   653  N N    . ILE A 1 71  ? 17.478 11.557  3.166   1.00 17.42  ? 76   ILE A N    1 
ATOM   654  C CA   . ILE A 1 71  ? 16.286 12.321  3.553   1.00 14.99  ? 76   ILE A CA   1 
ATOM   655  C C    . ILE A 1 71  ? 16.693 13.195  4.754   1.00 14.49  ? 76   ILE A C    1 
ATOM   656  O O    . ILE A 1 71  ? 17.016 12.678  5.833   1.00 17.71  ? 76   ILE A O    1 
ATOM   657  C CB   . ILE A 1 71  ? 15.145 11.330  3.953   1.00 14.23  ? 76   ILE A CB   1 
ATOM   658  C CG1  . ILE A 1 71  ? 14.774 10.474  2.763   1.00 10.05  ? 76   ILE A CG1  1 
ATOM   659  C CG2  . ILE A 1 71  ? 13.891 12.045  4.387   1.00 12.82  ? 76   ILE A CG2  1 
ATOM   660  C CD1  . ILE A 1 71  ? 14.086 9.219   3.148   1.00 8.72   ? 76   ILE A CD1  1 
ATOM   661  H H    . ILE A 1 71  ? 17.565 10.652  3.528   1.00 0.00   ? 76   ILE A H    1 
ATOM   662  N N    . PRO A 1 72  ? 16.669 14.527  4.599   1.00 17.82  ? 77   PRO A N    1 
ATOM   663  C CA   . PRO A 1 72  ? 17.048 15.473  5.648   1.00 16.06  ? 77   PRO A CA   1 
ATOM   664  C C    . PRO A 1 72  ? 16.356 15.262  6.990   1.00 16.46  ? 77   PRO A C    1 
ATOM   665  O O    . PRO A 1 72  ? 16.990 15.339  8.041   1.00 17.53  ? 77   PRO A O    1 
ATOM   666  C CB   . PRO A 1 72  ? 16.660 16.817  5.053   1.00 17.02  ? 77   PRO A CB   1 
ATOM   667  C CG   . PRO A 1 72  ? 16.846 16.599  3.599   1.00 17.09  ? 77   PRO A CG   1 
ATOM   668  C CD   . PRO A 1 72  ? 16.188 15.258  3.407   1.00 16.64  ? 77   PRO A CD   1 
ATOM   669  N N    . GLU A 1 73  ? 15.067 14.968  6.932   1.00 18.06  ? 78   GLU A N    1 
ATOM   670  C CA   . GLU A 1 73  ? 14.247 14.763  8.119   1.00 18.20  ? 78   GLU A CA   1 
ATOM   671  C C    . GLU A 1 73  ? 14.710 13.493  8.827   1.00 16.25  ? 78   GLU A C    1 
ATOM   672  O O    . GLU A 1 73  ? 14.603 13.386  10.055  1.00 16.12  ? 78   GLU A O    1 
ATOM   673  C CB   . GLU A 1 73  ? 12.763 14.645  7.723   1.00 25.35  ? 78   GLU A CB   1 
ATOM   674  C CG   . GLU A 1 73  ? 12.182 15.834  6.906   1.00 36.71  ? 78   GLU A CG   1 
ATOM   675  C CD   . GLU A 1 73  ? 12.438 15.766  5.383   1.00 41.24  ? 78   GLU A CD   1 
ATOM   676  O OE1  . GLU A 1 73  ? 12.448 14.660  4.793   1.00 45.92  ? 78   GLU A OE1  1 
ATOM   677  O OE2  . GLU A 1 73  ? 12.590 16.844  4.770   1.00 47.08  ? 78   GLU A OE2  1 
ATOM   678  H H    . GLU A 1 73  ? 14.657 14.875  6.048   1.00 0.00   ? 78   GLU A H    1 
ATOM   679  N N    . PHE A 1 74  ? 15.161 12.505  8.051   1.00 13.61  ? 79   PHE A N    1 
ATOM   680  C CA   . PHE A 1 74  ? 15.647 11.269  8.645   1.00 13.43  ? 79   PHE A CA   1 
ATOM   681  C C    . PHE A 1 74  ? 16.861 11.622  9.500   1.00 13.60  ? 79   PHE A C    1 
ATOM   682  O O    . PHE A 1 74  ? 16.948 11.235  10.666  1.00 15.38  ? 79   PHE A O    1 
ATOM   683  C CB   . PHE A 1 74  ? 16.005 10.267  7.553   1.00 15.55  ? 79   PHE A CB   1 
ATOM   684  C CG   . PHE A 1 74  ? 16.725 9.055   8.049   1.00 15.60  ? 79   PHE A CG   1 
ATOM   685  C CD1  . PHE A 1 74  ? 16.028 7.975   8.581   1.00 13.79  ? 79   PHE A CD1  1 
ATOM   686  C CD2  . PHE A 1 74  ? 18.110 8.981   7.958   1.00 16.37  ? 79   PHE A CD2  1 
ATOM   687  C CE1  . PHE A 1 74  ? 16.701 6.837   9.011   1.00 12.47  ? 79   PHE A CE1  1 
ATOM   688  C CE2  . PHE A 1 74  ? 18.792 7.855   8.383   1.00 13.81  ? 79   PHE A CE2  1 
ATOM   689  C CZ   . PHE A 1 74  ? 18.090 6.777   8.912   1.00 16.76  ? 79   PHE A CZ   1 
ATOM   690  H H    . PHE A 1 74  ? 15.162 12.613  7.077   1.00 0.00   ? 79   PHE A H    1 
ATOM   691  N N    . GLY A 1 75  ? 17.763 12.414  8.923   1.00 18.41  ? 80   GLY A N    1 
ATOM   692  C CA   . GLY A 1 75  ? 18.962 12.845  9.625   1.00 18.09  ? 80   GLY A CA   1 
ATOM   693  C C    . GLY A 1 75  ? 18.665 13.639  10.887  1.00 18.81  ? 80   GLY A C    1 
ATOM   694  O O    . GLY A 1 75  ? 19.309 13.421  11.914  1.00 20.09  ? 80   GLY A O    1 
ATOM   695  H H    . GLY A 1 75  ? 17.614 12.717  8.003   1.00 0.00   ? 80   GLY A H    1 
ATOM   696  N N    . ARG A 1 76  ? 17.701 14.562  10.810  1.00 16.46  ? 81   ARG A N    1 
ATOM   697  C CA   . ARG A 1 76  ? 17.310 15.389  11.953  1.00 19.47  ? 81   ARG A CA   1 
ATOM   698  C C    . ARG A 1 76  ? 16.750 14.522  13.079  1.00 16.33  ? 81   ARG A C    1 
ATOM   699  O O    . ARG A 1 76  ? 17.085 14.722  14.254  1.00 17.28  ? 81   ARG A O    1 
ATOM   700  C CB   . ARG A 1 76  ? 16.278 16.452  11.536  1.00 31.85  ? 81   ARG A CB   1 
ATOM   701  C CG   . ARG A 1 76  ? 16.880 17.648  10.795  1.00 47.33  ? 81   ARG A CG   1 
ATOM   702  C CD   . ARG A 1 76  ? 16.146 17.952  9.482   1.00 59.14  ? 81   ARG A CD   1 
ATOM   703  N NE   . ARG A 1 76  ? 14.960 18.800  9.618   1.00 69.84  ? 81   ARG A NE   1 
ATOM   704  C CZ   . ARG A 1 76  ? 14.041 18.944  8.659   1.00 76.18  ? 81   ARG A CZ   1 
ATOM   705  N NH1  . ARG A 1 76  ? 14.168 18.285  7.509   1.00 76.93  ? 81   ARG A NH1  1 
ATOM   706  N NH2  . ARG A 1 76  ? 13.035 19.804  8.802   1.00 79.18  ? 81   ARG A NH2  1 
ATOM   707  H H    . ARG A 1 76  ? 17.231 14.681  9.961   1.00 0.00   ? 81   ARG A H    1 
ATOM   708  H HE   . ARG A 1 76  ? 14.831 19.289  10.457  1.00 0.00   ? 81   ARG A HE   1 
ATOM   709  H HH11 . ARG A 1 76  ? 14.947 17.678  7.354   1.00 0.00   ? 81   ARG A HH11 1 
ATOM   710  H HH12 . ARG A 1 76  ? 13.477 18.396  6.795   1.00 0.00   ? 81   ARG A HH12 1 
ATOM   711  H HH21 . ARG A 1 76  ? 12.961 20.352  9.635   1.00 0.00   ? 81   ARG A HH21 1 
ATOM   712  H HH22 . ARG A 1 76  ? 12.354 19.901  8.076   1.00 0.00   ? 81   ARG A HH22 1 
ATOM   713  N N    . CYS A 1 77  ? 15.887 13.572  12.723  1.00 17.51  ? 82   CYS A N    1 
ATOM   714  C CA   . CYS A 1 77  ? 15.302 12.670  13.710  1.00 19.95  ? 82   CYS A CA   1 
ATOM   715  C C    . CYS A 1 77  ? 16.349 11.786  14.394  1.00 18.17  ? 82   CYS A C    1 
ATOM   716  O O    . CYS A 1 77  ? 16.202 11.464  15.569  1.00 18.09  ? 82   CYS A O    1 
ATOM   717  C CB   . CYS A 1 77  ? 14.207 11.792  13.076  1.00 26.32  ? 82   CYS A CB   1 
ATOM   718  S SG   . CYS A 1 77  ? 12.679 12.653  12.596  1.00 26.11  ? 82   CYS A SG   1 
ATOM   719  H H    . CYS A 1 77  ? 15.652 13.474  11.780  1.00 0.00   ? 82   CYS A H    1 
ATOM   720  N N    . THR A 1 78  ? 17.385 11.387  13.649  1.00 21.06  ? 83   THR A N    1 
ATOM   721  C CA   . THR A 1 78  ? 18.466 10.544  14.178  1.00 17.71  ? 83   THR A CA   1 
ATOM   722  C C    . THR A 1 78  ? 19.243 11.312  15.224  1.00 14.48  ? 83   THR A C    1 
ATOM   723  O O    . THR A 1 78  ? 19.495 10.812  16.324  1.00 14.63  ? 83   THR A O    1 
ATOM   724  C CB   . THR A 1 78  ? 19.439 10.104  13.064  1.00 17.42  ? 83   THR A CB   1 
ATOM   725  O OG1  . THR A 1 78  ? 18.703 9.371   12.083  1.00 18.00  ? 83   THR A OG1  1 
ATOM   726  C CG2  . THR A 1 78  ? 20.563 9.220   13.626  1.00 17.03  ? 83   THR A CG2  1 
ATOM   727  H H    . THR A 1 78  ? 17.427 11.675  12.714  1.00 0.00   ? 83   THR A H    1 
ATOM   728  H HG1  . THR A 1 78  ? 19.291 9.094   11.377  1.00 0.00   ? 83   THR A HG1  1 
ATOM   729  N N    . GLN A 1 79  ? 19.611 12.539  14.876  1.00 17.06  ? 84   GLN A N    1 
ATOM   730  C CA   . GLN A 1 79  ? 20.351 13.375  15.797  1.00 16.13  ? 84   GLN A CA   1 
ATOM   731  C C    . GLN A 1 79  ? 19.604 13.565  17.099  1.00 18.31  ? 84   GLN A C    1 
ATOM   732  O O    . GLN A 1 79  ? 20.203 13.497  18.168  1.00 15.06  ? 84   GLN A O    1 
ATOM   733  C CB   . GLN A 1 79  ? 20.702 14.704  15.153  1.00 19.46  ? 84   GLN A CB   1 
ATOM   734  C CG   . GLN A 1 79  ? 21.893 14.522  14.265  1.00 18.89  ? 84   GLN A CG   1 
ATOM   735  C CD   . GLN A 1 79  ? 22.349 15.776  13.598  1.00 19.82  ? 84   GLN A CD   1 
ATOM   736  O OE1  . GLN A 1 79  ? 22.827 15.737  12.470  1.00 22.22  ? 84   GLN A OE1  1 
ATOM   737  N NE2  . GLN A 1 79  ? 22.250 16.902  14.294  1.00 23.89  ? 84   GLN A NE2  1 
ATOM   738  H H    . GLN A 1 79  ? 19.374 12.884  13.991  1.00 0.00   ? 84   GLN A H    1 
ATOM   739  H HE21 . GLN A 1 79  ? 21.893 16.882  15.206  1.00 0.00   ? 84   GLN A HE21 1 
ATOM   740  H HE22 . GLN A 1 79  ? 22.545 17.727  13.855  1.00 0.00   ? 84   GLN A HE22 1 
ATOM   741  N N    . GLU A 1 80  ? 18.301 13.813  17.019  1.00 18.84  ? 85   GLU A N    1 
ATOM   742  C CA   . GLU A 1 80  ? 17.531 13.963  18.237  1.00 20.57  ? 85   GLU A CA   1 
ATOM   743  C C    . GLU A 1 80  ? 17.444 12.655  19.005  1.00 18.70  ? 85   GLU A C    1 
ATOM   744  O O    . GLU A 1 80  ? 17.388 12.669  20.232  1.00 18.32  ? 85   GLU A O    1 
ATOM   745  C CB   . GLU A 1 80  ? 16.135 14.467  17.949  1.00 23.41  ? 85   GLU A CB   1 
ATOM   746  C CG   . GLU A 1 80  ? 16.088 15.912  17.589  1.00 40.81  ? 85   GLU A CG   1 
ATOM   747  C CD   . GLU A 1 80  ? 14.674 16.378  17.431  1.00 48.45  ? 85   GLU A CD   1 
ATOM   748  O OE1  . GLU A 1 80  ? 13.884 16.181  18.379  1.00 53.10  ? 85   GLU A OE1  1 
ATOM   749  O OE2  . GLU A 1 80  ? 14.357 16.920  16.355  1.00 54.15  ? 85   GLU A OE2  1 
ATOM   750  H H    . GLU A 1 80  ? 17.865 13.888  16.145  1.00 0.00   ? 85   GLU A H    1 
ATOM   751  N N    . LEU A 1 81  ? 17.366 11.528  18.299  1.00 19.74  ? 86   LEU A N    1 
ATOM   752  C CA   . LEU A 1 81  ? 17.292 10.252  19.006  1.00 20.89  ? 86   LEU A CA   1 
ATOM   753  C C    . LEU A 1 81  ? 18.597 9.992   19.729  1.00 19.47  ? 86   LEU A C    1 
ATOM   754  O O    . LEU A 1 81  ? 18.605 9.557   20.878  1.00 21.92  ? 86   LEU A O    1 
ATOM   755  C CB   . LEU A 1 81  ? 17.021 9.082   18.057  1.00 17.33  ? 86   LEU A CB   1 
ATOM   756  C CG   . LEU A 1 81  ? 15.697 8.321   18.142  1.00 22.60  ? 86   LEU A CG   1 
ATOM   757  C CD1  . LEU A 1 81  ? 15.900 6.963   17.506  1.00 27.39  ? 86   LEU A CD1  1 
ATOM   758  C CD2  . LEU A 1 81  ? 15.214 8.147   19.575  1.00 22.33  ? 86   LEU A CD2  1 
ATOM   759  H H    . LEU A 1 81  ? 17.368 11.555  17.321  1.00 0.00   ? 86   LEU A H    1 
ATOM   760  N N    . LEU A 1 82  ? 19.704 10.282  19.059  1.00 20.36  ? 87   LEU A N    1 
ATOM   761  C CA   . LEU A 1 82  ? 21.019 10.034  19.641  1.00 20.32  ? 87   LEU A CA   1 
ATOM   762  C C    . LEU A 1 82  ? 21.455 10.987  20.734  1.00 19.52  ? 87   LEU A C    1 
ATOM   763  O O    . LEU A 1 82  ? 21.847 10.559  21.816  1.00 19.14  ? 87   LEU A O    1 
ATOM   764  C CB   . LEU A 1 82  ? 22.094 10.089  18.564  1.00 14.91  ? 87   LEU A CB   1 
ATOM   765  C CG   . LEU A 1 82  ? 22.016 9.157   17.373  1.00 15.90  ? 87   LEU A CG   1 
ATOM   766  C CD1  . LEU A 1 82  ? 22.983 9.648   16.312  1.00 12.99  ? 87   LEU A CD1  1 
ATOM   767  C CD2  . LEU A 1 82  ? 22.339 7.740   17.791  1.00 14.68  ? 87   LEU A CD2  1 
ATOM   768  H H    . LEU A 1 82  ? 19.638 10.699  18.185  1.00 0.00   ? 87   LEU A H    1 
ATOM   769  N N    . PHE A 1 83  ? 21.352 12.281  20.445  1.00 20.61  ? 88   PHE A N    1 
ATOM   770  C CA   . PHE A 1 83  ? 21.844 13.313  21.350  1.00 25.16  ? 88   PHE A CA   1 
ATOM   771  C C    . PHE A 1 83  ? 20.889 14.004  22.279  1.00 30.48  ? 88   PHE A C    1 
ATOM   772  O O    . PHE A 1 83  ? 21.308 14.616  23.263  1.00 33.13  ? 88   PHE A O    1 
ATOM   773  C CB   . PHE A 1 83  ? 22.549 14.392  20.537  1.00 21.37  ? 88   PHE A CB   1 
ATOM   774  C CG   . PHE A 1 83  ? 23.612 13.856  19.639  1.00 19.86  ? 88   PHE A CG   1 
ATOM   775  C CD1  . PHE A 1 83  ? 24.616 13.039  20.146  1.00 18.24  ? 88   PHE A CD1  1 
ATOM   776  C CD2  . PHE A 1 83  ? 23.598 14.130  18.275  1.00 21.55  ? 88   PHE A CD2  1 
ATOM   777  C CE1  . PHE A 1 83  ? 25.588 12.496  19.308  1.00 18.84  ? 88   PHE A CE1  1 
ATOM   778  C CE2  . PHE A 1 83  ? 24.566 13.592  17.426  1.00 20.25  ? 88   PHE A CE2  1 
ATOM   779  C CZ   . PHE A 1 83  ? 25.563 12.772  17.945  1.00 17.85  ? 88   PHE A CZ   1 
ATOM   780  H H    . PHE A 1 83  ? 20.934 12.531  19.605  1.00 0.00   ? 88   PHE A H    1 
ATOM   781  N N    . GLY A 1 84  ? 19.606 13.918  21.996  1.00 32.20  ? 89   GLY A N    1 
ATOM   782  C CA   . GLY A 1 84  ? 18.690 14.635  22.841  1.00 34.67  ? 89   GLY A CA   1 
ATOM   783  C C    . GLY A 1 84  ? 18.160 15.765  22.006  1.00 35.88  ? 89   GLY A C    1 
ATOM   784  O O    . GLY A 1 84  ? 18.851 16.367  21.178  1.00 34.69  ? 89   GLY A O    1 
ATOM   785  H H    . GLY A 1 84  ? 19.287 13.386  21.237  1.00 0.00   ? 89   GLY A H    1 
ATOM   786  N N    . LYS A 1 85  ? 16.932 16.098  22.341  1.00 40.98  ? 90   LYS A N    1 
ATOM   787  C CA   . LYS A 1 85  ? 16.117 17.103  21.692  1.00 48.41  ? 90   LYS A CA   1 
ATOM   788  C C    . LYS A 1 85  ? 16.692 18.530  21.697  1.00 47.20  ? 90   LYS A C    1 
ATOM   789  O O    . LYS A 1 85  ? 16.755 19.175  20.647  1.00 46.46  ? 90   LYS A O    1 
ATOM   790  C CB   . LYS A 1 85  ? 14.735 17.016  22.345  1.00 58.82  ? 90   LYS A CB   1 
ATOM   791  C CG   . LYS A 1 85  ? 14.295 15.523  22.509  1.00 68.85  ? 90   LYS A CG   1 
ATOM   792  C CD   . LYS A 1 85  ? 13.575 15.204  23.838  1.00 75.94  ? 90   LYS A CD   1 
ATOM   793  C CE   . LYS A 1 85  ? 14.463 15.393  25.082  1.00 80.73  ? 90   LYS A CE   1 
ATOM   794  N NZ   . LYS A 1 85  ? 15.586 14.410  25.225  1.00 81.37  ? 90   LYS A NZ   1 
ATOM   795  H H    . LYS A 1 85  ? 16.577 15.624  23.121  1.00 0.00   ? 90   LYS A H    1 
ATOM   796  H HZ1  . LYS A 1 85  ? 16.212 14.475  24.396  1.00 0.00   ? 90   LYS A HZ1  1 
ATOM   797  H HZ2  . LYS A 1 85  ? 16.127 14.621  26.087  1.00 0.00   ? 90   LYS A HZ2  1 
ATOM   798  H HZ3  . LYS A 1 85  ? 15.191 13.451  25.288  1.00 0.00   ? 90   LYS A HZ3  1 
ATOM   799  N N    . GLY A 1 86  ? 17.112 19.018  22.863  1.00 45.10  ? 91   GLY A N    1 
ATOM   800  C CA   . GLY A 1 86  ? 17.680 20.353  22.937  1.00 44.42  ? 91   GLY A CA   1 
ATOM   801  C C    . GLY A 1 86  ? 19.189 20.274  23.050  1.00 42.75  ? 91   GLY A C    1 
ATOM   802  O O    . GLY A 1 86  ? 19.809 21.066  23.754  1.00 44.26  ? 91   GLY A O    1 
ATOM   803  H H    . GLY A 1 86  ? 17.039 18.473  23.674  1.00 0.00   ? 91   GLY A H    1 
ATOM   804  N N    . SER A 1 87  ? 19.782 19.326  22.330  1.00 41.23  ? 92   SER A N    1 
ATOM   805  C CA   . SER A 1 87  ? 21.224 19.123  22.369  1.00 39.43  ? 92   SER A CA   1 
ATOM   806  C C    . SER A 1 87  ? 22.045 20.278  21.819  1.00 38.16  ? 92   SER A C    1 
ATOM   807  O O    . SER A 1 87  ? 21.636 20.956  20.877  1.00 37.81  ? 92   SER A O    1 
ATOM   808  C CB   . SER A 1 87  ? 21.600 17.855  21.611  1.00 38.55  ? 92   SER A CB   1 
ATOM   809  O OG   . SER A 1 87  ? 22.976 17.560  21.793  1.00 42.04  ? 92   SER A OG   1 
ATOM   810  H H    . SER A 1 87  ? 19.238 18.748  21.756  1.00 0.00   ? 92   SER A H    1 
ATOM   811  H HG   . SER A 1 87  ? 23.215 16.785  21.282  1.00 0.00   ? 92   SER A HG   1 
ATOM   812  N N    . ALA A 1 88  ? 23.214 20.484  22.417  1.00 36.09  ? 93   ALA A N    1 
ATOM   813  C CA   . ALA A 1 88  ? 24.127 21.530  21.987  1.00 35.37  ? 93   ALA A CA   1 
ATOM   814  C C    . ALA A 1 88  ? 24.754 21.162  20.646  1.00 34.30  ? 93   ALA A C    1 
ATOM   815  O O    . ALA A 1 88  ? 25.077 22.042  19.856  1.00 35.01  ? 93   ALA A O    1 
ATOM   816  C CB   . ALA A 1 88  ? 25.216 21.742  23.034  1.00 38.72  ? 93   ALA A CB   1 
ATOM   817  H H    . ALA A 1 88  ? 23.468 19.910  23.170  1.00 0.00   ? 93   ALA A H    1 
ATOM   818  N N    . LEU A 1 89  ? 24.945 19.867  20.389  1.00 32.17  ? 94   LEU A N    1 
ATOM   819  C CA   . LEU A 1 89  ? 25.524 19.454  19.109  1.00 31.26  ? 94   LEU A CA   1 
ATOM   820  C C    . LEU A 1 89  ? 24.569 19.834  18.008  1.00 28.94  ? 94   LEU A C    1 
ATOM   821  O O    . LEU A 1 89  ? 24.976 20.163  16.895  1.00 31.95  ? 94   LEU A O    1 
ATOM   822  C CB   . LEU A 1 89  ? 25.735 17.945  19.030  1.00 31.85  ? 94   LEU A CB   1 
ATOM   823  C CG   . LEU A 1 89  ? 26.876 17.355  19.821  1.00 33.24  ? 94   LEU A CG   1 
ATOM   824  C CD1  . LEU A 1 89  ? 26.432 17.177  21.249  1.00 38.47  ? 94   LEU A CD1  1 
ATOM   825  C CD2  . LEU A 1 89  ? 27.245 16.024  19.217  1.00 36.35  ? 94   LEU A CD2  1 
ATOM   826  H H    . LEU A 1 89  ? 24.690 19.196  21.055  1.00 0.00   ? 94   LEU A H    1 
ATOM   827  N N    . ILE A 1 90  ? 23.286 19.729  18.323  1.00 27.04  ? 95   ILE A N    1 
ATOM   828  C CA   . ILE A 1 90  ? 22.235 20.037  17.383  1.00 29.62  ? 95   ILE A CA   1 
ATOM   829  C C    . ILE A 1 90  ? 22.084 21.541  17.172  1.00 31.92  ? 95   ILE A C    1 
ATOM   830  O O    . ILE A 1 90  ? 22.066 22.014  16.034  1.00 33.58  ? 95   ILE A O    1 
ATOM   831  C CB   . ILE A 1 90  ? 20.898 19.411  17.857  1.00 29.43  ? 95   ILE A CB   1 
ATOM   832  C CG1  . ILE A 1 90  ? 21.023 17.887  17.883  1.00 27.98  ? 95   ILE A CG1  1 
ATOM   833  C CG2  . ILE A 1 90  ? 19.750 19.849  16.962  1.00 27.70  ? 95   ILE A CG2  1 
ATOM   834  C CD1  . ILE A 1 90  ? 19.771 17.161  18.312  1.00 23.76  ? 95   ILE A CD1  1 
ATOM   835  H H    . ILE A 1 90  ? 23.041 19.434  19.225  1.00 0.00   ? 95   ILE A H    1 
ATOM   836  N N    . ASN A 1 91  ? 22.050 22.292  18.270  1.00 35.37  ? 96   ASN A N    1 
ATOM   837  C CA   . ASN A 1 91  ? 21.887 23.746  18.209  1.00 38.71  ? 96   ASN A CA   1 
ATOM   838  C C    . ASN A 1 91  ? 23.105 24.488  17.613  1.00 37.34  ? 96   ASN A C    1 
ATOM   839  O O    . ASN A 1 91  ? 22.943 25.519  16.952  1.00 38.82  ? 96   ASN A O    1 
ATOM   840  C CB   . ASN A 1 91  ? 21.596 24.310  19.611  1.00 42.61  ? 96   ASN A CB   1 
ATOM   841  C CG   . ASN A 1 91  ? 20.269 23.820  20.216  1.00 47.14  ? 96   ASN A CG   1 
ATOM   842  O OD1  . ASN A 1 91  ? 19.836 24.348  21.244  1.00 51.93  ? 96   ASN A OD1  1 
ATOM   843  N ND2  . ASN A 1 91  ? 19.633 22.803  19.625  1.00 49.72  ? 96   ASN A ND2  1 
ATOM   844  H H    . ASN A 1 91  ? 22.148 21.860  19.141  1.00 0.00   ? 96   ASN A H    1 
ATOM   845  H HD21 . ASN A 1 91  ? 19.992 22.370  18.825  1.00 0.00   ? 96   ASN A HD21 1 
ATOM   846  H HD22 . ASN A 1 91  ? 18.791 22.519  20.038  1.00 0.00   ? 96   ASN A HD22 1 
ATOM   847  N N    . ASP A 1 92  ? 24.312 23.977  17.871  1.00 34.07  ? 97   ASP A N    1 
ATOM   848  C CA   . ASP A 1 92  ? 25.550 24.585  17.378  1.00 31.36  ? 97   ASP A CA   1 
ATOM   849  C C    . ASP A 1 92  ? 25.916 24.144  15.964  1.00 29.01  ? 97   ASP A C    1 
ATOM   850  O O    . ASP A 1 92  ? 26.919 24.596  15.407  1.00 30.88  ? 97   ASP A O    1 
ATOM   851  C CB   . ASP A 1 92  ? 26.723 24.265  18.319  1.00 34.75  ? 97   ASP A CB   1 
ATOM   852  C CG   . ASP A 1 92  ? 26.630 24.981  19.660  1.00 37.36  ? 97   ASP A CG   1 
ATOM   853  O OD1  . ASP A 1 92  ? 25.967 26.035  19.754  1.00 39.25  ? 97   ASP A OD1  1 
ATOM   854  O OD2  . ASP A 1 92  ? 27.255 24.475  20.617  1.00 40.00  ? 97   ASP A OD2  1 
ATOM   855  H H    . ASP A 1 92  ? 24.360 23.157  18.398  1.00 0.00   ? 97   ASP A H    1 
ATOM   856  N N    . LYS A 1 93  ? 25.133 23.209  15.423  1.00 25.06  ? 98   LYS A N    1 
ATOM   857  C CA   . LYS A 1 93  ? 25.324 22.665  14.071  1.00 25.77  ? 98   LYS A CA   1 
ATOM   858  C C    . LYS A 1 93  ? 26.673 21.982  13.920  1.00 23.42  ? 98   LYS A C    1 
ATOM   859  O O    . LYS A 1 93  ? 27.353 22.101  12.897  1.00 19.31  ? 98   LYS A O    1 
ATOM   860  C CB   . LYS A 1 93  ? 25.152 23.759  13.018  1.00 31.95  ? 98   LYS A CB   1 
ATOM   861  C CG   . LYS A 1 93  ? 23.788 24.412  13.047  1.00 43.90  ? 98   LYS A CG   1 
ATOM   862  C CD   . LYS A 1 93  ? 23.690 25.512  12.010  1.00 51.83  ? 98   LYS A CD   1 
ATOM   863  C CE   . LYS A 1 93  ? 24.622 26.672  12.326  1.00 59.97  ? 98   LYS A CE   1 
ATOM   864  N NZ   . LYS A 1 93  ? 24.406 27.802  11.376  1.00 65.33  ? 98   LYS A NZ   1 
ATOM   865  H H    . LYS A 1 93  ? 24.388 22.859  15.955  1.00 0.00   ? 98   LYS A H    1 
ATOM   866  H HZ1  . LYS A 1 93  ? 23.422 28.131  11.448  1.00 0.00   ? 98   LYS A HZ1  1 
ATOM   867  H HZ2  . LYS A 1 93  ? 25.051 28.582  11.613  1.00 0.00   ? 98   LYS A HZ2  1 
ATOM   868  H HZ3  . LYS A 1 93  ? 24.594 27.479  10.406  1.00 0.00   ? 98   LYS A HZ3  1 
ATOM   869  N N    . ARG A 1 94  ? 27.018 21.232  14.960  1.00 21.65  ? 99   ARG A N    1 
ATOM   870  C CA   . ARG A 1 94  ? 28.262 20.498  15.067  1.00 22.09  ? 99   ARG A CA   1 
ATOM   871  C C    . ARG A 1 94  ? 28.211 19.080  14.508  1.00 21.78  ? 99   ARG A C    1 
ATOM   872  O O    . ARG A 1 94  ? 29.246 18.444  14.339  1.00 24.58  ? 99   ARG A O    1 
ATOM   873  C CB   . ARG A 1 94  ? 28.671 20.449  16.537  1.00 21.15  ? 99   ARG A CB   1 
ATOM   874  C CG   . ARG A 1 94  ? 29.171 21.782  17.059  1.00 23.50  ? 99   ARG A CG   1 
ATOM   875  C CD   . ARG A 1 94  ? 29.740 21.659  18.455  1.00 23.90  ? 99   ARG A CD   1 
ATOM   876  N NE   . ARG A 1 94  ? 30.715 20.579  18.524  1.00 21.37  ? 99   ARG A NE   1 
ATOM   877  C CZ   . ARG A 1 94  ? 30.903 19.816  19.597  1.00 21.21  ? 99   ARG A CZ   1 
ATOM   878  N NH1  . ARG A 1 94  ? 30.194 20.031  20.700  1.00 23.38  ? 99   ARG A NH1  1 
ATOM   879  N NH2  . ARG A 1 94  ? 31.730 18.786  19.541  1.00 18.22  ? 99   ARG A NH2  1 
ATOM   880  H H    . ARG A 1 94  ? 26.388 21.176  15.707  1.00 0.00   ? 99   ARG A H    1 
ATOM   881  H HE   . ARG A 1 94  ? 31.273 20.421  17.743  1.00 0.00   ? 99   ARG A HE   1 
ATOM   882  H HH11 . ARG A 1 94  ? 29.516 20.765  20.733  1.00 0.00   ? 99   ARG A HH11 1 
ATOM   883  H HH12 . ARG A 1 94  ? 30.341 19.453  21.503  1.00 0.00   ? 99   ARG A HH12 1 
ATOM   884  H HH21 . ARG A 1 94  ? 32.214 18.581  18.690  1.00 0.00   ? 99   ARG A HH21 1 
ATOM   885  H HH22 . ARG A 1 94  ? 31.872 18.212  20.348  1.00 0.00   ? 99   ARG A HH22 1 
ATOM   886  N N    . ALA A 1 95  ? 27.011 18.612  14.180  1.00 20.93  ? 100  ALA A N    1 
ATOM   887  C CA   . ALA A 1 95  ? 26.819 17.256  13.667  1.00 19.47  ? 100  ALA A CA   1 
ATOM   888  C C    . ALA A 1 95  ? 26.218 17.202  12.260  1.00 19.02  ? 100  ALA A C    1 
ATOM   889  O O    . ALA A 1 95  ? 25.389 18.038  11.908  1.00 19.24  ? 100  ALA A O    1 
ATOM   890  C CB   . ALA A 1 95  ? 25.927 16.483  14.622  1.00 16.26  ? 100  ALA A CB   1 
ATOM   891  H H    . ALA A 1 95  ? 26.229 19.193  14.285  1.00 0.00   ? 100  ALA A H    1 
ATOM   892  N N    . ARG A 1 96  ? 26.651 16.233  11.453  1.00 17.48  ? 101  ARG A N    1 
ATOM   893  C CA   . ARG A 1 96  ? 26.083 16.054  10.115  1.00 17.17  ? 101  ARG A CA   1 
ATOM   894  C C    . ARG A 1 96  ? 25.801 14.567  9.956   1.00 18.59  ? 101  ARG A C    1 
ATOM   895  O O    . ARG A 1 96  ? 26.642 13.747  10.321  1.00 17.46  ? 101  ARG A O    1 
ATOM   896  C CB   . ARG A 1 96  ? 27.056 16.479  9.003   1.00 18.53  ? 101  ARG A CB   1 
ATOM   897  C CG   . ARG A 1 96  ? 27.383 17.964  8.919   1.00 23.39  ? 101  ARG A CG   1 
ATOM   898  C CD   . ARG A 1 96  ? 26.151 18.826  8.645   1.00 30.47  ? 101  ARG A CD   1 
ATOM   899  N NE   . ARG A 1 96  ? 25.508 18.536  7.367   1.00 35.69  ? 101  ARG A NE   1 
ATOM   900  C CZ   . ARG A 1 96  ? 25.931 18.982  6.183   1.00 42.33  ? 101  ARG A CZ   1 
ATOM   901  N NH1  . ARG A 1 96  ? 27.010 19.754  6.087   1.00 45.18  ? 101  ARG A NH1  1 
ATOM   902  N NH2  . ARG A 1 96  ? 25.286 18.635  5.076   1.00 43.82  ? 101  ARG A NH2  1 
ATOM   903  H H    . ARG A 1 96  ? 27.351 15.624  11.756  1.00 0.00   ? 101  ARG A H    1 
ATOM   904  H HE   . ARG A 1 96  ? 24.708 17.971  7.376   1.00 0.00   ? 101  ARG A HE   1 
ATOM   905  H HH11 . ARG A 1 96  ? 27.522 20.009  6.906   1.00 0.00   ? 101  ARG A HH11 1 
ATOM   906  H HH12 . ARG A 1 96  ? 27.312 20.078  5.191   1.00 0.00   ? 101  ARG A HH12 1 
ATOM   907  H HH21 . ARG A 1 96  ? 24.485 18.039  5.131   1.00 0.00   ? 101  ARG A HH21 1 
ATOM   908  H HH22 . ARG A 1 96  ? 25.603 18.968  4.188   1.00 0.00   ? 101  ARG A HH22 1 
ATOM   909  N N    . THR A 1 97  ? 24.613 14.192  9.482   1.00 15.19  ? 102  THR A N    1 
ATOM   910  C CA   . THR A 1 97  ? 24.380 12.761  9.283   1.00 12.40  ? 102  THR A CA   1 
ATOM   911  C C    . THR A 1 97  ? 24.011 12.342  7.867   1.00 10.25  ? 102  THR A C    1 
ATOM   912  O O    . THR A 1 97  ? 23.426 13.110  7.110   1.00 10.52  ? 102  THR A O    1 
ATOM   913  C CB   . THR A 1 97  ? 23.420 12.111  10.372  1.00 15.92  ? 102  THR A CB   1 
ATOM   914  O OG1  . THR A 1 97  ? 22.323 11.420  9.758   1.00 24.69  ? 102  THR A OG1  1 
ATOM   915  C CG2  . THR A 1 97  ? 22.903 13.120  11.347  1.00 8.96   ? 102  THR A CG2  1 
ATOM   916  H H    . THR A 1 97  ? 23.918 14.850  9.272   1.00 0.00   ? 102  THR A H    1 
ATOM   917  H HG1  . THR A 1 97  ? 21.765 11.034  10.437  1.00 0.00   ? 102  THR A HG1  1 
ATOM   918  N N    . ALA A 1 98  ? 24.538 11.189  7.466   1.00 10.19  ? 103  ALA A N    1 
ATOM   919  C CA   . ALA A 1 98  ? 24.246 10.627  6.156   1.00 7.46   ? 103  ALA A CA   1 
ATOM   920  C C    . ALA A 1 98  ? 23.449 9.355   6.413   1.00 9.28   ? 103  ALA A C    1 
ATOM   921  O O    . ALA A 1 98  ? 23.759 8.609   7.336   1.00 8.64   ? 103  ALA A O    1 
ATOM   922  C CB   . ALA A 1 98  ? 25.534 10.288  5.410   1.00 8.53   ? 103  ALA A CB   1 
ATOM   923  H H    . ALA A 1 98  ? 25.137 10.703  8.067   1.00 0.00   ? 103  ALA A H    1 
ATOM   924  N N    . GLN A 1 99  ? 22.363 9.173   5.668   1.00 11.00  ? 104  GLN A N    1 
ATOM   925  C CA   . GLN A 1 99  ? 21.540 7.969   5.766   1.00 11.27  ? 104  GLN A CA   1 
ATOM   926  C C    . GLN A 1 99  ? 22.367 6.905   5.015   1.00 9.22   ? 104  GLN A C    1 
ATOM   927  O O    . GLN A 1 99  ? 22.859 7.193   3.932   1.00 13.42  ? 104  GLN A O    1 
ATOM   928  C CB   . GLN A 1 99  ? 20.205 8.255   5.069   1.00 12.91  ? 104  GLN A CB   1 
ATOM   929  C CG   . GLN A 1 99  ? 19.272 7.082   4.857   1.00 10.87  ? 104  GLN A CG   1 
ATOM   930  C CD   . GLN A 1 99  ? 18.344 7.326   3.689   1.00 8.51   ? 104  GLN A CD   1 
ATOM   931  O OE1  . GLN A 1 99  ? 17.951 6.394   2.987   1.00 14.13  ? 104  GLN A OE1  1 
ATOM   932  N NE2  . GLN A 1 99  ? 18.010 8.587   3.442   1.00 7.51   ? 104  GLN A NE2  1 
ATOM   933  H H    . GLN A 1 99  ? 22.111 9.866   5.029   1.00 0.00   ? 104  GLN A H    1 
ATOM   934  H HE21 . GLN A 1 99  ? 18.348 9.316   4.001   1.00 0.00   ? 104  GLN A HE21 1 
ATOM   935  H HE22 . GLN A 1 99  ? 17.416 8.744   2.679   1.00 0.00   ? 104  GLN A HE22 1 
ATOM   936  N N    . THR A 1 100 ? 22.480 5.688   5.545   1.00 10.88  ? 105  THR A N    1 
ATOM   937  C CA   . THR A 1 100 ? 23.312 4.640   4.918   1.00 12.02  ? 105  THR A CA   1 
ATOM   938  C C    . THR A 1 100 ? 22.591 3.283   4.813   1.00 13.89  ? 105  THR A C    1 
ATOM   939  O O    . THR A 1 100 ? 21.539 3.100   5.448   1.00 12.44  ? 105  THR A O    1 
ATOM   940  C CB   . THR A 1 100 ? 24.571 4.440   5.782   1.00 11.69  ? 105  THR A CB   1 
ATOM   941  O OG1  . THR A 1 100 ? 24.151 4.006   7.082   1.00 13.24  ? 105  THR A OG1  1 
ATOM   942  C CG2  . THR A 1 100 ? 25.350 5.759   5.947   1.00 9.66   ? 105  THR A CG2  1 
ATOM   943  H H    . THR A 1 100 ? 21.995 5.475   6.356   1.00 0.00   ? 105  THR A H    1 
ATOM   944  H HG1  . THR A 1 100 ? 24.920 3.832   7.622   1.00 0.00   ? 105  THR A HG1  1 
ATOM   945  N N    . PRO A 1 101 ? 23.118 2.311   4.011   1.00 10.77  ? 106  PRO A N    1 
ATOM   946  C CA   . PRO A 1 101 ? 22.428 1.025   3.946   1.00 11.83  ? 106  PRO A CA   1 
ATOM   947  C C    . PRO A 1 101 ? 22.709 0.194   5.202   1.00 12.98  ? 106  PRO A C    1 
ATOM   948  O O    . PRO A 1 101 ? 23.639 -0.611  5.229   1.00 12.77  ? 106  PRO A O    1 
ATOM   949  C CB   . PRO A 1 101 ? 23.024 0.350   2.704   1.00 8.49   ? 106  PRO A CB   1 
ATOM   950  C CG   . PRO A 1 101 ? 23.626 1.474   1.913   1.00 11.89  ? 106  PRO A CG   1 
ATOM   951  C CD   . PRO A 1 101 ? 24.178 2.376   2.983   1.00 9.09   ? 106  PRO A CD   1 
ATOM   952  N N    . GLY A 1 102 ? 21.931 0.429   6.260   1.00 7.40   ? 107  GLY A N    1 
ATOM   953  C CA   . GLY A 1 102 ? 22.119 -0.280  7.514   1.00 6.17   ? 107  GLY A CA   1 
ATOM   954  C C    . GLY A 1 102 ? 23.244 0.302   8.354   1.00 9.63   ? 107  GLY A C    1 
ATOM   955  O O    . GLY A 1 102 ? 23.848 1.313   7.988   1.00 13.43  ? 107  GLY A O    1 
ATOM   956  H H    . GLY A 1 102 ? 21.213 1.092   6.192   1.00 0.00   ? 107  GLY A H    1 
ATOM   957  N N    . GLY A 1 103 ? 23.478 -0.307  9.513   1.00 10.02  ? 108  GLY A N    1 
ATOM   958  C CA   . GLY A 1 103 ? 24.535 0.126   10.408  1.00 9.63   ? 108  GLY A CA   1 
ATOM   959  C C    . GLY A 1 103 ? 25.883 -0.283  9.843   1.00 10.90  ? 108  GLY A C    1 
ATOM   960  O O    . GLY A 1 103 ? 26.881 0.404   10.055  1.00 13.59  ? 108  GLY A O    1 
ATOM   961  H H    . GLY A 1 103 ? 22.925 -1.064  9.762   1.00 0.00   ? 108  GLY A H    1 
ATOM   962  N N    . THR A 1 104 ? 25.911 -1.437  9.174   1.00 11.30  ? 109  THR A N    1 
ATOM   963  C CA   . THR A 1 104 ? 27.122 -1.962  8.551   1.00 12.16  ? 109  THR A CA   1 
ATOM   964  C C    . THR A 1 104 ? 27.609 -0.954  7.513   1.00 13.50  ? 109  THR A C    1 
ATOM   965  O O    . THR A 1 104 ? 28.787 -0.610  7.470   1.00 11.90  ? 109  THR A O    1 
ATOM   966  C CB   . THR A 1 104 ? 26.864 -3.356  7.887   1.00 11.14  ? 109  THR A CB   1 
ATOM   967  O OG1  . THR A 1 104 ? 26.411 -4.290  8.878   1.00 11.19  ? 109  THR A OG1  1 
ATOM   968  C CG2  . THR A 1 104 ? 28.136 -3.892  7.230   1.00 15.17  ? 109  THR A CG2  1 
ATOM   969  H H    . THR A 1 104 ? 25.081 -1.946  9.095   1.00 0.00   ? 109  THR A H    1 
ATOM   970  H HG1  . THR A 1 104 ? 26.248 -5.143  8.468   1.00 0.00   ? 109  THR A HG1  1 
ATOM   971  N N    . GLY A 1 105 ? 26.672 -0.472  6.698   1.00 14.78  ? 110  GLY A N    1 
ATOM   972  C CA   . GLY A 1 105 ? 26.987 0.521   5.690   1.00 9.90   ? 110  GLY A CA   1 
ATOM   973  C C    . GLY A 1 105 ? 27.542 1.790   6.316   1.00 13.10  ? 110  GLY A C    1 
ATOM   974  O O    . GLY A 1 105 ? 28.374 2.467   5.709   1.00 14.80  ? 110  GLY A O    1 
ATOM   975  H H    . GLY A 1 105 ? 25.749 -0.792  6.783   1.00 0.00   ? 110  GLY A H    1 
ATOM   976  N N    . ALA A 1 106 ? 27.066 2.124   7.517   1.00 12.74  ? 111  ALA A N    1 
ATOM   977  C CA   . ALA A 1 106 ? 27.537 3.308   8.231   1.00 14.61  ? 111  ALA A CA   1 
ATOM   978  C C    . ALA A 1 106 ? 28.948 3.108   8.777   1.00 12.24  ? 111  ALA A C    1 
ATOM   979  O O    . ALA A 1 106 ? 29.744 4.043   8.826   1.00 12.27  ? 111  ALA A O    1 
ATOM   980  C CB   . ALA A 1 106 ? 26.588 3.648   9.365   1.00 9.32   ? 111  ALA A CB   1 
ATOM   981  H H    . ALA A 1 106 ? 26.380 1.559   7.931   1.00 0.00   ? 111  ALA A H    1 
ATOM   982  N N    . LEU A 1 107 ? 29.215 1.900   9.263   1.00 15.32  ? 112  LEU A N    1 
ATOM   983  C CA   . LEU A 1 107 ? 30.536 1.554   9.770   1.00 14.14  ? 112  LEU A CA   1 
ATOM   984  C C    . LEU A 1 107 ? 31.511 1.591   8.594   1.00 16.80  ? 112  LEU A C    1 
ATOM   985  O O    . LEU A 1 107 ? 32.619 2.115   8.719   1.00 18.79  ? 112  LEU A O    1 
ATOM   986  C CB   . LEU A 1 107 ? 30.536 0.159   10.398  1.00 12.47  ? 112  LEU A CB   1 
ATOM   987  C CG   . LEU A 1 107 ? 29.865 0.007   11.758  1.00 12.52  ? 112  LEU A CG   1 
ATOM   988  C CD1  . LEU A 1 107 ? 29.702 -1.470  12.049  1.00 16.60  ? 112  LEU A CD1  1 
ATOM   989  C CD2  . LEU A 1 107 ? 30.707 0.682   12.837  1.00 15.69  ? 112  LEU A CD2  1 
ATOM   990  H H    . LEU A 1 107 ? 28.513 1.221   9.263   1.00 0.00   ? 112  LEU A H    1 
ATOM   991  N N    . ARG A 1 108 ? 31.085 1.057   7.448   1.00 14.21  ? 113  ARG A N    1 
ATOM   992  C CA   . ARG A 1 108 ? 31.945 1.055   6.276   1.00 11.94  ? 113  ARG A CA   1 
ATOM   993  C C    . ARG A 1 108 ? 32.269 2.470   5.788   1.00 16.93  ? 113  ARG A C    1 
ATOM   994  O O    . ARG A 1 108 ? 33.424 2.784   5.480   1.00 14.73  ? 113  ARG A O    1 
ATOM   995  C CB   . ARG A 1 108 ? 31.332 0.231   5.147   1.00 13.13  ? 113  ARG A CB   1 
ATOM   996  C CG   . ARG A 1 108 ? 32.215 0.154   3.925   1.00 18.09  ? 113  ARG A CG   1 
ATOM   997  C CD   . ARG A 1 108 ? 33.565 -0.466  4.245   1.00 20.40  ? 113  ARG A CD   1 
ATOM   998  N NE   . ARG A 1 108 ? 34.407 -0.447  3.059   1.00 26.14  ? 113  ARG A NE   1 
ATOM   999  C CZ   . ARG A 1 108 ? 34.495 -1.442  2.175   1.00 29.36  ? 113  ARG A CZ   1 
ATOM   1000 N NH1  . ARG A 1 108 ? 33.810 -2.578  2.329   1.00 25.27  ? 113  ARG A NH1  1 
ATOM   1001 N NH2  . ARG A 1 108 ? 35.197 -1.263  1.068   1.00 33.94  ? 113  ARG A NH2  1 
ATOM   1002 H H    . ARG A 1 108 ? 30.185 0.692   7.390   1.00 0.00   ? 113  ARG A H    1 
ATOM   1003 H HE   . ARG A 1 108 ? 34.949 0.353   2.895   1.00 0.00   ? 113  ARG A HE   1 
ATOM   1004 H HH11 . ARG A 1 108 ? 33.212 -2.703  3.120   1.00 0.00   ? 113  ARG A HH11 1 
ATOM   1005 H HH12 . ARG A 1 108 ? 33.897 -3.306  1.650   1.00 0.00   ? 113  ARG A HH12 1 
ATOM   1006 H HH21 . ARG A 1 108 ? 35.654 -0.389  0.903   1.00 0.00   ? 113  ARG A HH21 1 
ATOM   1007 H HH22 . ARG A 1 108 ? 35.270 -2.001  0.398   1.00 0.00   ? 113  ARG A HH22 1 
ATOM   1008 N N    . VAL A 1 109 ? 31.240 3.311   5.712   1.00 13.03  ? 114  VAL A N    1 
ATOM   1009 C CA   . VAL A 1 109 ? 31.385 4.693   5.270   1.00 13.56  ? 114  VAL A CA   1 
ATOM   1010 C C    . VAL A 1 109 ? 32.339 5.454   6.187   1.00 11.74  ? 114  VAL A C    1 
ATOM   1011 O O    . VAL A 1 109 ? 33.162 6.248   5.724   1.00 14.71  ? 114  VAL A O    1 
ATOM   1012 C CB   . VAL A 1 109 ? 29.994 5.373   5.193   1.00 16.35  ? 114  VAL A CB   1 
ATOM   1013 C CG1  . VAL A 1 109 ? 30.108 6.891   5.153   1.00 17.47  ? 114  VAL A CG1  1 
ATOM   1014 C CG2  . VAL A 1 109 ? 29.279 4.871   3.963   1.00 18.94  ? 114  VAL A CG2  1 
ATOM   1015 H H    . VAL A 1 109 ? 30.355 2.987   5.973   1.00 0.00   ? 114  VAL A H    1 
ATOM   1016 N N    . ALA A 1 110 ? 32.247 5.167   7.482   1.00 12.92  ? 115  ALA A N    1 
ATOM   1017 C CA   . ALA A 1 110 ? 33.107 5.785   8.476   1.00 12.96  ? 115  ALA A CA   1 
ATOM   1018 C C    . ALA A 1 110 ? 34.552 5.325   8.253   1.00 15.24  ? 115  ALA A C    1 
ATOM   1019 O O    . ALA A 1 110 ? 35.476 6.136   8.297   1.00 14.43  ? 115  ALA A O    1 
ATOM   1020 C CB   . ALA A 1 110 ? 32.645 5.388   9.880   1.00 13.63  ? 115  ALA A CB   1 
ATOM   1021 H H    . ALA A 1 110 ? 31.580 4.511   7.772   1.00 0.00   ? 115  ALA A H    1 
ATOM   1022 N N    . ALA A 1 111 ? 34.725 4.024   8.018   1.00 15.00  ? 116  ALA A N    1 
ATOM   1023 C CA   . ALA A 1 111 ? 36.035 3.424   7.779   1.00 15.36  ? 116  ALA A CA   1 
ATOM   1024 C C    . ALA A 1 111 ? 36.747 4.038   6.575   1.00 18.41  ? 116  ALA A C    1 
ATOM   1025 O O    . ALA A 1 111 ? 37.931 4.360   6.645   1.00 17.79  ? 116  ALA A O    1 
ATOM   1026 C CB   . ALA A 1 111 ? 35.878 1.916   7.567   1.00 15.87  ? 116  ALA A CB   1 
ATOM   1027 H H    . ALA A 1 111 ? 33.934 3.451   7.991   1.00 0.00   ? 116  ALA A H    1 
ATOM   1028 N N    . ASP A 1 112 ? 36.025 4.126   5.461   1.00 14.26  ? 117  ASP A N    1 
ATOM   1029 C CA   . ASP A 1 112 ? 36.545 4.688   4.223   1.00 15.17  ? 117  ASP A CA   1 
ATOM   1030 C C    . ASP A 1 112 ? 36.904 6.145   4.368   1.00 17.24  ? 117  ASP A C    1 
ATOM   1031 O O    . ASP A 1 112 ? 37.841 6.634   3.742   1.00 16.14  ? 117  ASP A O    1 
ATOM   1032 C CB   . ASP A 1 112 ? 35.504 4.583   3.115   1.00 17.31  ? 117  ASP A CB   1 
ATOM   1033 C CG   . ASP A 1 112 ? 35.411 3.201   2.523   1.00 21.92  ? 117  ASP A CG   1 
ATOM   1034 O OD1  . ASP A 1 112 ? 36.310 2.373   2.759   1.00 20.92  ? 117  ASP A OD1  1 
ATOM   1035 O OD2  . ASP A 1 112 ? 34.420 2.966   1.800   1.00 27.67  ? 117  ASP A OD2  1 
ATOM   1036 H H    . ASP A 1 112 ? 35.103 3.809   5.478   1.00 0.00   ? 117  ASP A H    1 
ATOM   1037 N N    . PHE A 1 113 ? 36.066 6.855   5.108   1.00 16.95  ? 118  PHE A N    1 
ATOM   1038 C CA   . PHE A 1 113 ? 36.260 8.268   5.343   1.00 16.77  ? 118  PHE A CA   1 
ATOM   1039 C C    . PHE A 1 113 ? 37.542 8.493   6.150   1.00 15.11  ? 118  PHE A C    1 
ATOM   1040 O O    . PHE A 1 113 ? 38.411 9.267   5.744   1.00 15.02  ? 118  PHE A O    1 
ATOM   1041 C CB   . PHE A 1 113 ? 35.021 8.830   6.046   1.00 11.09  ? 118  PHE A CB   1 
ATOM   1042 C CG   . PHE A 1 113 ? 35.258 10.120  6.731   1.00 10.95  ? 118  PHE A CG   1 
ATOM   1043 C CD1  . PHE A 1 113 ? 35.382 11.299  6.007   1.00 9.88   ? 118  PHE A CD1  1 
ATOM   1044 C CD2  . PHE A 1 113 ? 35.369 10.162  8.114   1.00 8.31   ? 118  PHE A CD2  1 
ATOM   1045 C CE1  . PHE A 1 113 ? 35.616 12.503  6.655   1.00 10.47  ? 118  PHE A CE1  1 
ATOM   1046 C CE2  . PHE A 1 113 ? 35.602 11.349  8.769   1.00 10.06  ? 118  PHE A CE2  1 
ATOM   1047 C CZ   . PHE A 1 113 ? 35.728 12.531  8.042   1.00 9.37   ? 118  PHE A CZ   1 
ATOM   1048 H H    . PHE A 1 113 ? 35.296 6.405   5.513   1.00 0.00   ? 118  PHE A H    1 
ATOM   1049 N N    . LEU A 1 114 ? 37.653 7.793   7.276   1.00 15.22  ? 119  LEU A N    1 
ATOM   1050 C CA   . LEU A 1 114 ? 38.823 7.875   8.139   1.00 17.24  ? 119  LEU A CA   1 
ATOM   1051 C C    . LEU A 1 114 ? 40.104 7.439   7.406   1.00 19.80  ? 119  LEU A C    1 
ATOM   1052 O O    . LEU A 1 114 ? 41.146 8.074   7.535   1.00 21.15  ? 119  LEU A O    1 
ATOM   1053 C CB   . LEU A 1 114 ? 38.599 7.034   9.403   1.00 16.46  ? 119  LEU A CB   1 
ATOM   1054 C CG   . LEU A 1 114 ? 37.478 7.516   10.322  1.00 18.59  ? 119  LEU A CG   1 
ATOM   1055 C CD1  . LEU A 1 114 ? 37.229 6.463   11.379  1.00 19.09  ? 119  LEU A CD1  1 
ATOM   1056 C CD2  . LEU A 1 114 ? 37.840 8.853   10.969  1.00 19.69  ? 119  LEU A CD2  1 
ATOM   1057 H H    . LEU A 1 114 ? 36.922 7.197   7.522   1.00 0.00   ? 119  LEU A H    1 
ATOM   1058 N N    . ALA A 1 115 ? 40.002 6.362   6.635   1.00 20.73  ? 120  ALA A N    1 
ATOM   1059 C CA   . ALA A 1 115 ? 41.131 5.839   5.876   1.00 22.28  ? 120  ALA A CA   1 
ATOM   1060 C C    . ALA A 1 115 ? 41.647 6.793   4.808   1.00 26.03  ? 120  ALA A C    1 
ATOM   1061 O O    . ALA A 1 115 ? 42.860 6.855   4.555   1.00 30.83  ? 120  ALA A O    1 
ATOM   1062 C CB   . ALA A 1 115 ? 40.754 4.516   5.210   1.00 18.94  ? 120  ALA A CB   1 
ATOM   1063 H H    . ALA A 1 115 ? 39.133 5.922   6.568   1.00 0.00   ? 120  ALA A H    1 
ATOM   1064 N N    . LYS A 1 116 ? 40.742 7.514   4.148   1.00 27.32  ? 121  LYS A N    1 
ATOM   1065 C CA   . LYS A 1 116 ? 41.187 8.405   3.081   1.00 27.80  ? 121  LYS A CA   1 
ATOM   1066 C C    . LYS A 1 116 ? 41.357 9.881   3.431   1.00 27.03  ? 121  LYS A C    1 
ATOM   1067 O O    . LYS A 1 116 ? 42.042 10.607  2.705   1.00 30.80  ? 121  LYS A O    1 
ATOM   1068 C CB   . LYS A 1 116 ? 40.315 8.211   1.813   1.00 32.53  ? 121  LYS A CB   1 
ATOM   1069 C CG   . LYS A 1 116 ? 39.358 9.369   1.386   1.00 41.88  ? 121  LYS A CG   1 
ATOM   1070 C CD   . LYS A 1 116 ? 37.872 8.927   1.403   1.00 44.98  ? 121  LYS A CD   1 
ATOM   1071 C CE   . LYS A 1 116 ? 36.942 9.742   0.478   1.00 42.27  ? 121  LYS A CE   1 
ATOM   1072 N NZ   . LYS A 1 116 ? 36.723 11.159  0.893   1.00 32.77  ? 121  LYS A NZ   1 
ATOM   1073 H H    . LYS A 1 116 ? 39.792 7.452   4.379   1.00 0.00   ? 121  LYS A H    1 
ATOM   1074 H HZ1  . LYS A 1 116 ? 37.635 11.659  0.920   1.00 0.00   ? 121  LYS A HZ1  1 
ATOM   1075 H HZ2  . LYS A 1 116 ? 36.089 11.628  0.214   1.00 0.00   ? 121  LYS A HZ2  1 
ATOM   1076 H HZ3  . LYS A 1 116 ? 36.292 11.180  1.839   1.00 0.00   ? 121  LYS A HZ3  1 
ATOM   1077 N N    . ASN A 1 117 ? 40.930 10.255  4.636   1.00 21.93  ? 122  ASN A N    1 
ATOM   1078 C CA   . ASN A 1 117 ? 40.967 11.652  5.047   1.00 22.05  ? 122  ASN A CA   1 
ATOM   1079 C C    . ASN A 1 117 ? 41.631 12.014  6.360   1.00 23.58  ? 122  ASN A C    1 
ATOM   1080 O O    . ASN A 1 117 ? 41.663 13.192  6.736   1.00 23.12  ? 122  ASN A O    1 
ATOM   1081 C CB   . ASN A 1 117 ? 39.558 12.198  5.081   1.00 20.04  ? 122  ASN A CB   1 
ATOM   1082 C CG   . ASN A 1 117 ? 38.940 12.266  3.715   1.00 20.93  ? 122  ASN A CG   1 
ATOM   1083 O OD1  . ASN A 1 117 ? 39.271 13.143  2.914   1.00 22.56  ? 122  ASN A OD1  1 
ATOM   1084 N ND2  . ASN A 1 117 ? 38.043 11.336  3.426   1.00 13.27  ? 122  ASN A ND2  1 
ATOM   1085 H H    . ASN A 1 117 ? 40.588 9.580   5.259   1.00 0.00   ? 122  ASN A H    1 
ATOM   1086 H HD21 . ASN A 1 117 ? 37.829 10.654  4.096   1.00 0.00   ? 122  ASN A HD21 1 
ATOM   1087 H HD22 . ASN A 1 117 ? 37.632 11.383  2.549   1.00 0.00   ? 122  ASN A HD22 1 
ATOM   1088 N N    . THR A 1 118 ? 42.011 11.017  7.142   1.00 24.85  ? 123  THR A N    1 
ATOM   1089 C CA   . THR A 1 118 ? 42.667 11.316  8.398   1.00 23.78  ? 123  THR A CA   1 
ATOM   1090 C C    . THR A 1 118 ? 43.922 10.485  8.493   1.00 25.75  ? 123  THR A C    1 
ATOM   1091 O O    . THR A 1 118 ? 44.261 9.738   7.575   1.00 21.90  ? 123  THR A O    1 
ATOM   1092 C CB   . THR A 1 118 ? 41.754 11.022  9.621   1.00 19.07  ? 123  THR A CB   1 
ATOM   1093 O OG1  . THR A 1 118 ? 41.648 9.610   9.788   1.00 17.40  ? 123  THR A OG1  1 
ATOM   1094 C CG2  . THR A 1 118 ? 40.353 11.630  9.449   1.00 19.46  ? 123  THR A CG2  1 
ATOM   1095 H H    . THR A 1 118 ? 41.851 10.088  6.875   1.00 0.00   ? 123  THR A H    1 
ATOM   1096 H HG1  . THR A 1 118 ? 41.075 9.416   10.533  1.00 0.00   ? 123  THR A HG1  1 
ATOM   1097 N N    . SER A 1 119 ? 44.621 10.656  9.608   1.00 29.11  ? 124  SER A N    1 
ATOM   1098 C CA   . SER A 1 119 ? 45.854 9.935   9.875   1.00 30.10  ? 124  SER A CA   1 
ATOM   1099 C C    . SER A 1 119 ? 45.614 8.674   10.715  1.00 29.43  ? 124  SER A C    1 
ATOM   1100 O O    . SER A 1 119 ? 46.525 8.175   11.372  1.00 32.48  ? 124  SER A O    1 
ATOM   1101 C CB   . SER A 1 119 ? 46.858 10.860  10.576  1.00 27.55  ? 124  SER A CB   1 
ATOM   1102 O OG   . SER A 1 119 ? 46.399 11.267  11.858  1.00 33.78  ? 124  SER A OG   1 
ATOM   1103 H H    . SER A 1 119 ? 44.302 11.294  10.280  1.00 0.00   ? 124  SER A H    1 
ATOM   1104 H HG   . SER A 1 119 ? 47.052 11.841  12.264  1.00 0.00   ? 124  SER A HG   1 
ATOM   1105 N N    . VAL A 1 120 ? 44.388 8.151   10.677  1.00 23.03  ? 125  VAL A N    1 
ATOM   1106 C CA   . VAL A 1 120 ? 44.060 6.951   11.441  1.00 18.99  ? 125  VAL A CA   1 
ATOM   1107 C C    . VAL A 1 120 ? 44.556 5.698   10.730  1.00 18.31  ? 125  VAL A C    1 
ATOM   1108 O O    . VAL A 1 120 ? 44.502 5.612   9.508   1.00 21.34  ? 125  VAL A O    1 
ATOM   1109 C CB   . VAL A 1 120 ? 42.534 6.854   11.692  1.00 19.38  ? 125  VAL A CB   1 
ATOM   1110 C CG1  . VAL A 1 120 ? 42.147 5.472   12.225  1.00 19.68  ? 125  VAL A CG1  1 
ATOM   1111 C CG2  . VAL A 1 120 ? 42.113 7.928   12.664  1.00 22.50  ? 125  VAL A CG2  1 
ATOM   1112 H H    . VAL A 1 120 ? 43.694 8.573   10.130  1.00 0.00   ? 125  VAL A H    1 
ATOM   1113 N N    . LYS A 1 121 ? 45.133 4.774   11.489  1.00 21.51  ? 126  LYS A N    1 
ATOM   1114 C CA   . LYS A 1 121 ? 45.622 3.514   10.929  1.00 27.15  ? 126  LYS A CA   1 
ATOM   1115 C C    . LYS A 1 121 ? 45.181 2.344   11.792  1.00 23.30  ? 126  LYS A C    1 
ATOM   1116 O O    . LYS A 1 121 ? 45.186 1.205   11.341  1.00 25.69  ? 126  LYS A O    1 
ATOM   1117 C CB   . LYS A 1 121 ? 47.168 3.464   10.811  1.00 35.86  ? 126  LYS A CB   1 
ATOM   1118 C CG   . LYS A 1 121 ? 47.972 4.727   11.188  1.00 49.14  ? 126  LYS A CG   1 
ATOM   1119 C CD   . LYS A 1 121 ? 48.173 4.869   12.703  1.00 60.95  ? 126  LYS A CD   1 
ATOM   1120 C CE   . LYS A 1 121 ? 48.892 6.169   13.100  1.00 67.08  ? 126  LYS A CE   1 
ATOM   1121 N NZ   . LYS A 1 121 ? 47.979 7.210   13.692  1.00 68.30  ? 126  LYS A NZ   1 
ATOM   1122 H H    . LYS A 1 121 ? 45.233 4.940   12.450  1.00 0.00   ? 126  LYS A H    1 
ATOM   1123 H HZ1  . LYS A 1 121 ? 47.236 7.449   13.007  1.00 0.00   ? 126  LYS A HZ1  1 
ATOM   1124 H HZ2  . LYS A 1 121 ? 47.540 6.833   14.556  1.00 0.00   ? 126  LYS A HZ2  1 
ATOM   1125 H HZ3  . LYS A 1 121 ? 48.527 8.063   13.924  1.00 0.00   ? 126  LYS A HZ3  1 
ATOM   1126 N N    . ARG A 1 122 ? 44.724 2.651   13.000  1.00 23.95  ? 129  ARG A N    1 
ATOM   1127 C CA   . ARG A 1 122 ? 44.347 1.632   13.960  1.00 23.75  ? 129  ARG A CA   1 
ATOM   1128 C C    . ARG A 1 122 ? 42.970 1.843   14.570  1.00 22.36  ? 129  ARG A C    1 
ATOM   1129 O O    . ARG A 1 122 ? 42.652 2.944   15.008  1.00 23.05  ? 129  ARG A O    1 
ATOM   1130 C CB   . ARG A 1 122 ? 45.369 1.663   15.092  1.00 31.53  ? 129  ARG A CB   1 
ATOM   1131 C CG   . ARG A 1 122 ? 45.988 0.347   15.431  1.00 42.79  ? 129  ARG A CG   1 
ATOM   1132 C CD   . ARG A 1 122 ? 47.478 0.493   15.651  1.00 51.55  ? 129  ARG A CD   1 
ATOM   1133 N NE   . ARG A 1 122 ? 48.074 -0.830  15.741  1.00 63.39  ? 129  ARG A NE   1 
ATOM   1134 C CZ   . ARG A 1 122 ? 48.362 -1.597  14.689  1.00 67.87  ? 129  ARG A CZ   1 
ATOM   1135 N NH1  . ARG A 1 122 ? 48.145 -1.172  13.442  1.00 70.20  ? 129  ARG A NH1  1 
ATOM   1136 N NH2  . ARG A 1 122 ? 48.726 -2.853  14.882  1.00 70.30  ? 129  ARG A NH2  1 
ATOM   1137 H H    . ARG A 1 122 ? 44.637 3.593   13.255  1.00 0.00   ? 129  ARG A H    1 
ATOM   1138 H HE   . ARG A 1 122 ? 48.277 -1.185  16.632  1.00 0.00   ? 129  ARG A HE   1 
ATOM   1139 H HH11 . ARG A 1 122 ? 47.759 -0.264  13.277  1.00 0.00   ? 129  ARG A HH11 1 
ATOM   1140 H HH12 . ARG A 1 122 ? 48.368 -1.766  12.669  1.00 0.00   ? 129  ARG A HH12 1 
ATOM   1141 H HH21 . ARG A 1 122 ? 48.782 -3.218  15.811  1.00 0.00   ? 129  ARG A HH21 1 
ATOM   1142 H HH22 . ARG A 1 122 ? 48.943 -3.436  14.100  1.00 0.00   ? 129  ARG A HH22 1 
ATOM   1143 N N    . VAL A 1 123 ? 42.173 0.779   14.616  1.00 19.05  ? 133  VAL A N    1 
ATOM   1144 C CA   . VAL A 1 123 ? 40.843 0.813   15.226  1.00 19.16  ? 133  VAL A CA   1 
ATOM   1145 C C    . VAL A 1 123 ? 40.830 -0.235  16.345  1.00 14.67  ? 133  VAL A C    1 
ATOM   1146 O O    . VAL A 1 123 ? 41.209 -1.383  16.123  1.00 15.82  ? 133  VAL A O    1 
ATOM   1147 C CB   . VAL A 1 123 ? 39.713 0.463   14.207  1.00 20.31  ? 133  VAL A CB   1 
ATOM   1148 C CG1  . VAL A 1 123 ? 38.369 0.360   14.927  1.00 19.65  ? 133  VAL A CG1  1 
ATOM   1149 C CG2  . VAL A 1 123 ? 39.630 1.509   13.107  1.00 17.30  ? 133  VAL A CG2  1 
ATOM   1150 H H    . VAL A 1 123 ? 42.492 -0.059  14.250  1.00 0.00   ? 133  VAL A H    1 
ATOM   1151 N N    . TRP A 1 124 ? 40.440 0.186   17.546  1.00 16.01  ? 134  TRP A N    1 
ATOM   1152 C CA   . TRP A 1 124 ? 40.356 -0.704  18.703  1.00 17.37  ? 134  TRP A CA   1 
ATOM   1153 C C    . TRP A 1 124 ? 38.926 -1.179  18.898  1.00 18.25  ? 134  TRP A C    1 
ATOM   1154 O O    . TRP A 1 124 ? 38.006 -0.377  19.022  1.00 16.51  ? 134  TRP A O    1 
ATOM   1155 C CB   . TRP A 1 124 ? 40.839 0.000   19.968  1.00 19.38  ? 134  TRP A CB   1 
ATOM   1156 C CG   . TRP A 1 124 ? 42.302 0.281   19.916  1.00 20.97  ? 134  TRP A CG   1 
ATOM   1157 C CD1  . TRP A 1 124 ? 42.922 1.257   19.197  1.00 21.66  ? 134  TRP A CD1  1 
ATOM   1158 C CD2  . TRP A 1 124 ? 43.337 -0.452  20.570  1.00 23.24  ? 134  TRP A CD2  1 
ATOM   1159 N NE1  . TRP A 1 124 ? 44.266 1.170   19.359  1.00 20.96  ? 134  TRP A NE1  1 
ATOM   1160 C CE2  . TRP A 1 124 ? 44.559 0.136   20.197  1.00 22.43  ? 134  TRP A CE2  1 
ATOM   1161 C CE3  . TRP A 1 124 ? 43.341 -1.552  21.434  1.00 24.69  ? 134  TRP A CE3  1 
ATOM   1162 C CZ2  . TRP A 1 124 ? 45.808 -0.348  20.670  1.00 23.09  ? 134  TRP A CZ2  1 
ATOM   1163 C CZ3  . TRP A 1 124 ? 44.557 -2.030  21.899  1.00 23.94  ? 134  TRP A CZ3  1 
ATOM   1164 C CH2  . TRP A 1 124 ? 45.780 -1.427  21.515  1.00 23.70  ? 134  TRP A CH2  1 
ATOM   1165 H H    . TRP A 1 124 ? 40.182 1.116   17.657  1.00 0.00   ? 134  TRP A H    1 
ATOM   1166 H HE1  . TRP A 1 124 ? 44.921 1.716   18.897  1.00 0.00   ? 134  TRP A HE1  1 
ATOM   1167 N N    . VAL A 1 125 ? 38.760 -2.494  18.919  1.00 16.44  ? 135  VAL A N    1 
ATOM   1168 C CA   . VAL A 1 125 ? 37.458 -3.140  19.062  1.00 18.82  ? 135  VAL A CA   1 
ATOM   1169 C C    . VAL A 1 125 ? 37.528 -4.037  20.298  1.00 21.32  ? 135  VAL A C    1 
ATOM   1170 O O    . VAL A 1 125 ? 38.584 -4.583  20.604  1.00 23.35  ? 135  VAL A O    1 
ATOM   1171 C CB   . VAL A 1 125 ? 37.168 -3.994  17.801  1.00 17.14  ? 135  VAL A CB   1 
ATOM   1172 C CG1  . VAL A 1 125 ? 35.778 -4.534  17.826  1.00 23.47  ? 135  VAL A CG1  1 
ATOM   1173 C CG2  . VAL A 1 125 ? 37.384 -3.171  16.544  1.00 15.92  ? 135  VAL A CG2  1 
ATOM   1174 H H    . VAL A 1 125 ? 39.547 -3.065  18.833  1.00 0.00   ? 135  VAL A H    1 
ATOM   1175 N N    . SER A 1 126 ? 36.426 -4.185  21.025  1.00 18.87  ? 136  SER A N    1 
ATOM   1176 C CA   . SER A 1 126 ? 36.469 -5.030  22.217  1.00 15.82  ? 136  SER A CA   1 
ATOM   1177 C C    . SER A 1 126 ? 36.650 -6.508  21.927  1.00 15.22  ? 136  SER A C    1 
ATOM   1178 O O    . SER A 1 126 ? 36.526 -6.955  20.790  1.00 16.17  ? 136  SER A O    1 
ATOM   1179 C CB   . SER A 1 126 ? 35.207 -4.851  23.054  1.00 18.08  ? 136  SER A CB   1 
ATOM   1180 O OG   . SER A 1 126 ? 34.066 -5.142  22.277  1.00 17.81  ? 136  SER A OG   1 
ATOM   1181 H H    . SER A 1 126 ? 35.595 -3.735  20.766  1.00 0.00   ? 136  SER A H    1 
ATOM   1182 H HG   . SER A 1 126 ? 33.312 -4.743  22.706  1.00 0.00   ? 136  SER A HG   1 
ATOM   1183 N N    . ASN A 1 127 ? 37.012 -7.238  22.976  1.00 16.17  ? 137  ASN A N    1 
ATOM   1184 C CA   . ASN A 1 127 ? 37.174 -8.681  22.910  1.00 20.86  ? 137  ASN A CA   1 
ATOM   1185 C C    . ASN A 1 127 ? 36.228 -9.272  23.960  1.00 17.64  ? 137  ASN A C    1 
ATOM   1186 O O    . ASN A 1 127 ? 36.398 -9.022  25.159  1.00 17.27  ? 137  ASN A O    1 
ATOM   1187 C CB   . ASN A 1 127 ? 38.628 -9.088  23.200  1.00 26.15  ? 137  ASN A CB   1 
ATOM   1188 C CG   . ASN A 1 127 ? 38.843 -10.590 23.154  1.00 29.14  ? 137  ASN A CG   1 
ATOM   1189 O OD1  . ASN A 1 127 ? 39.397 -11.184 24.088  1.00 37.89  ? 137  ASN A OD1  1 
ATOM   1190 N ND2  . ASN A 1 127 ? 38.420 -11.221 22.063  1.00 29.70  ? 137  ASN A ND2  1 
ATOM   1191 H H    . ASN A 1 127 ? 37.176 -6.787  23.831  1.00 0.00   ? 137  ASN A H    1 
ATOM   1192 H HD21 . ASN A 1 127 ? 37.998 -10.699 21.349  1.00 0.00   ? 137  ASN A HD21 1 
ATOM   1193 H HD22 . ASN A 1 127 ? 38.549 -12.191 22.018  1.00 0.00   ? 137  ASN A HD22 1 
ATOM   1194 N N    . PRO A 1 128 ? 35.150 -9.936  23.514  1.00 16.54  ? 138  PRO A N    1 
ATOM   1195 C CA   . PRO A 1 128 ? 34.768 -10.156 22.113  1.00 14.37  ? 138  PRO A CA   1 
ATOM   1196 C C    . PRO A 1 128 ? 33.960 -8.991  21.566  1.00 13.36  ? 138  PRO A C    1 
ATOM   1197 O O    . PRO A 1 128 ? 33.639 -8.055  22.290  1.00 16.81  ? 138  PRO A O    1 
ATOM   1198 C CB   . PRO A 1 128 ? 33.887 -11.392 22.200  1.00 12.64  ? 138  PRO A CB   1 
ATOM   1199 C CG   . PRO A 1 128 ? 33.198 -11.207 23.512  1.00 11.11  ? 138  PRO A CG   1 
ATOM   1200 C CD   . PRO A 1 128 ? 34.363 -10.817 24.399  1.00 16.95  ? 138  PRO A CD   1 
ATOM   1201 N N    . SER A 1 129 ? 33.659 -9.046  20.273  1.00 17.05  ? 139  SER A N    1 
ATOM   1202 C CA   . SER A 1 129 ? 32.829 -8.026  19.629  1.00 18.77  ? 139  SER A CA   1 
ATOM   1203 C C    . SER A 1 129 ? 32.049 -8.665  18.472  1.00 19.34  ? 139  SER A C    1 
ATOM   1204 O O    . SER A 1 129 ? 32.166 -9.863  18.245  1.00 21.01  ? 139  SER A O    1 
ATOM   1205 C CB   . SER A 1 129 ? 33.704 -6.871  19.133  1.00 17.88  ? 139  SER A CB   1 
ATOM   1206 O OG   . SER A 1 129 ? 32.900 -5.748  18.802  1.00 16.30  ? 139  SER A OG   1 
ATOM   1207 H H    . SER A 1 129 ? 34.003 -9.789  19.735  1.00 0.00   ? 139  SER A H    1 
ATOM   1208 H HG   . SER A 1 129 ? 33.440 -5.017  18.499  1.00 0.00   ? 139  SER A HG   1 
ATOM   1209 N N    . TRP A 1 130 ? 31.141 -7.894  17.867  1.00 17.66  ? 140  TRP A N    1 
ATOM   1210 C CA   . TRP A 1 130 ? 30.373 -8.344  16.697  1.00 16.64  ? 140  TRP A CA   1 
ATOM   1211 C C    . TRP A 1 130 ? 31.434 -8.860  15.721  1.00 20.60  ? 140  TRP A C    1 
ATOM   1212 O O    . TRP A 1 130 ? 32.309 -8.090  15.340  1.00 20.42  ? 140  TRP A O    1 
ATOM   1213 C CB   . TRP A 1 130 ? 29.686 -7.121  16.073  1.00 12.38  ? 140  TRP A CB   1 
ATOM   1214 C CG   . TRP A 1 130 ? 28.763 -7.450  14.942  1.00 12.46  ? 140  TRP A CG   1 
ATOM   1215 C CD1  . TRP A 1 130 ? 27.891 -8.487  14.901  1.00 13.24  ? 140  TRP A CD1  1 
ATOM   1216 C CD2  . TRP A 1 130 ? 28.591 -6.735  13.702  1.00 10.69  ? 140  TRP A CD2  1 
ATOM   1217 N NE1  . TRP A 1 130 ? 27.196 -8.466  13.740  1.00 13.84  ? 140  TRP A NE1  1 
ATOM   1218 C CE2  . TRP A 1 130 ? 27.596 -7.410  12.974  1.00 10.54  ? 140  TRP A CE2  1 
ATOM   1219 C CE3  . TRP A 1 130 ? 29.184 -5.592  13.144  1.00 10.58  ? 140  TRP A CE3  1 
ATOM   1220 C CZ2  . TRP A 1 130 ? 27.164 -6.978  11.688  1.00 9.22   ? 140  TRP A CZ2  1 
ATOM   1221 C CZ3  . TRP A 1 130 ? 28.765 -5.162  11.882  1.00 7.85   ? 140  TRP A CZ3  1 
ATOM   1222 C CH2  . TRP A 1 130 ? 27.759 -5.859  11.168  1.00 7.83   ? 140  TRP A CH2  1 
ATOM   1223 H H    . TRP A 1 130 ? 30.979 -6.994  18.219  1.00 0.00   ? 140  TRP A H    1 
ATOM   1224 H HE1  . TRP A 1 130 ? 26.496 -9.111  13.670  1.00 0.00   ? 140  TRP A HE1  1 
ATOM   1225 N N    . PRO A 1 131 ? 31.365 -10.141 15.280  1.00 22.46  ? 141  PRO A N    1 
ATOM   1226 C CA   . PRO A 1 131 ? 32.379 -10.672 14.359  1.00 20.43  ? 141  PRO A CA   1 
ATOM   1227 C C    . PRO A 1 131 ? 32.705 -9.910  13.055  1.00 21.27  ? 141  PRO A C    1 
ATOM   1228 O O    . PRO A 1 131 ? 33.833 -10.003 12.545  1.00 20.45  ? 141  PRO A O    1 
ATOM   1229 C CB   . PRO A 1 131 ? 31.886 -12.083 14.074  1.00 19.97  ? 141  PRO A CB   1 
ATOM   1230 C CG   . PRO A 1 131 ? 31.188 -12.455 15.343  1.00 21.16  ? 141  PRO A CG   1 
ATOM   1231 C CD   . PRO A 1 131 ? 30.394 -11.198 15.636  1.00 23.10  ? 141  PRO A CD   1 
ATOM   1232 N N    . ASN A 1 132 ? 31.752 -9.131  12.546  1.00 16.31  ? 142  ASN A N    1 
ATOM   1233 C CA   . ASN A 1 132 ? 31.949 -8.390  11.300  1.00 12.34  ? 142  ASN A CA   1 
ATOM   1234 C C    . ASN A 1 132 ? 32.704 -7.048  11.437  1.00 11.42  ? 142  ASN A C    1 
ATOM   1235 O O    . ASN A 1 132 ? 32.953 -6.385  10.438  1.00 13.60  ? 142  ASN A O    1 
ATOM   1236 C CB   . ASN A 1 132 ? 30.602 -8.201  10.577  1.00 12.12  ? 142  ASN A CB   1 
ATOM   1237 C CG   . ASN A 1 132 ? 30.756 -7.886  9.085   1.00 13.07  ? 142  ASN A CG   1 
ATOM   1238 O OD1  . ASN A 1 132 ? 31.562 -8.500  8.371   1.00 19.09  ? 142  ASN A OD1  1 
ATOM   1239 N ND2  . ASN A 1 132 ? 29.951 -6.949  8.591   1.00 10.71  ? 142  ASN A ND2  1 
ATOM   1240 H H    . ASN A 1 132 ? 30.898 -9.051  13.020  1.00 0.00   ? 142  ASN A H    1 
ATOM   1241 H HD21 . ASN A 1 132 ? 29.313 -6.516  9.195   1.00 0.00   ? 142  ASN A HD21 1 
ATOM   1242 H HD22 . ASN A 1 132 ? 30.031 -6.730  7.639   1.00 0.00   ? 142  ASN A HD22 1 
ATOM   1243 N N    . HIS A 1 133 ? 33.075 -6.653  12.655  1.00 13.46  ? 143  HIS A N    1 
ATOM   1244 C CA   . HIS A 1 133 ? 33.799 -5.394  12.825  1.00 14.40  ? 143  HIS A CA   1 
ATOM   1245 C C    . HIS A 1 133 ? 35.171 -5.406  12.194  1.00 16.36  ? 143  HIS A C    1 
ATOM   1246 O O    . HIS A 1 133 ? 35.556 -4.479  11.480  1.00 16.87  ? 143  HIS A O    1 
ATOM   1247 C CB   . HIS A 1 133 ? 33.982 -5.075  14.301  1.00 12.69  ? 143  HIS A CB   1 
ATOM   1248 C CG   . HIS A 1 133 ? 32.817 -4.350  14.896  1.00 11.29  ? 143  HIS A CG   1 
ATOM   1249 N ND1  . HIS A 1 133 ? 32.489 -4.458  16.221  1.00 9.83   ? 143  HIS A ND1  1 
ATOM   1250 C CD2  . HIS A 1 133 ? 31.919 -3.523  14.331  1.00 9.19   ? 143  HIS A CD2  1 
ATOM   1251 C CE1  . HIS A 1 133 ? 31.416 -3.723  16.454  1.00 9.12   ? 143  HIS A CE1  1 
ATOM   1252 N NE2  . HIS A 1 133 ? 31.061 -3.155  15.331  1.00 7.98   ? 143  HIS A NE2  1 
ATOM   1253 H H    . HIS A 1 133 ? 32.862 -7.205  13.435  1.00 0.00   ? 143  HIS A H    1 
ATOM   1254 H HD1  . HIS A 1 133 ? 32.971 -4.990  16.885  1.00 0.00   ? 143  HIS A HD1  1 
ATOM   1255 H HE2  . HIS A 1 133 ? 30.457 -2.433  15.226  1.00 0.00   ? 143  HIS A HE2  1 
ATOM   1256 N N    . LYS A 1 134 ? 35.911 -6.460  12.506  1.00 18.86  ? 144  LYS A N    1 
ATOM   1257 C CA   . LYS A 1 134 ? 37.263 -6.626  12.017  1.00 20.08  ? 144  LYS A CA   1 
ATOM   1258 C C    . LYS A 1 134 ? 37.319 -6.540  10.509  1.00 17.15  ? 144  LYS A C    1 
ATOM   1259 O O    . LYS A 1 134 ? 38.114 -5.815  9.922   1.00 18.13  ? 144  LYS A O    1 
ATOM   1260 C CB   . LYS A 1 134 ? 37.796 -7.983  12.462  1.00 22.86  ? 144  LYS A CB   1 
ATOM   1261 C CG   . LYS A 1 134 ? 39.274 -8.135  12.193  1.00 33.45  ? 144  LYS A CG   1 
ATOM   1262 C CD   . LYS A 1 134 ? 39.784 -9.539  12.434  1.00 42.13  ? 144  LYS A CD   1 
ATOM   1263 C CE   . LYS A 1 134 ? 41.276 -9.600  12.125  1.00 43.51  ? 144  LYS A CE   1 
ATOM   1264 N NZ   . LYS A 1 134 ? 42.079 -8.818  13.113  1.00 53.08  ? 144  LYS A NZ   1 
ATOM   1265 H H    . LYS A 1 134 ? 35.528 -7.152  13.085  1.00 0.00   ? 144  LYS A H    1 
ATOM   1266 H HZ1  . LYS A 1 134 ? 41.923 -9.202  14.067  1.00 0.00   ? 144  LYS A HZ1  1 
ATOM   1267 H HZ2  . LYS A 1 134 ? 43.088 -8.887  12.871  1.00 0.00   ? 144  LYS A HZ2  1 
ATOM   1268 H HZ3  . LYS A 1 134 ? 41.785 -7.820  13.089  1.00 0.00   ? 144  LYS A HZ3  1 
ATOM   1269 N N    . SER A 1 135 ? 36.392 -7.262  9.917   1.00 15.81  ? 145  SER A N    1 
ATOM   1270 C CA   . SER A 1 135 ? 36.204 -7.404  8.498   1.00 16.00  ? 145  SER A CA   1 
ATOM   1271 C C    . SER A 1 135 ? 35.887 -6.064  7.763   1.00 16.29  ? 145  SER A C    1 
ATOM   1272 O O    . SER A 1 135 ? 36.453 -5.791  6.697   1.00 15.15  ? 145  SER A O    1 
ATOM   1273 C CB   . SER A 1 135 ? 35.118 -8.485  8.390   1.00 21.45  ? 145  SER A CB   1 
ATOM   1274 O OG   . SER A 1 135 ? 34.730 -8.836  7.085   1.00 33.97  ? 145  SER A OG   1 
ATOM   1275 H H    . SER A 1 135 ? 35.771 -7.743  10.503  1.00 0.00   ? 145  SER A H    1 
ATOM   1276 H HG   . SER A 1 135 ? 34.047 -9.509  7.125   1.00 0.00   ? 145  SER A HG   1 
ATOM   1277 N N    . VAL A 1 136 ? 35.043 -5.212  8.358   1.00 12.99  ? 146  VAL A N    1 
ATOM   1278 C CA   . VAL A 1 136 ? 34.688 -3.910  7.759   1.00 15.85  ? 146  VAL A CA   1 
ATOM   1279 C C    . VAL A 1 136 ? 35.886 -2.959  7.788   1.00 14.74  ? 146  VAL A C    1 
ATOM   1280 O O    . VAL A 1 136 ? 36.235 -2.331  6.787   1.00 12.61  ? 146  VAL A O    1 
ATOM   1281 C CB   . VAL A 1 136 ? 33.458 -3.250  8.491   1.00 13.57  ? 146  VAL A CB   1 
ATOM   1282 C CG1  . VAL A 1 136 ? 33.348 -1.777  8.157   1.00 15.70  ? 146  VAL A CG1  1 
ATOM   1283 C CG2  . VAL A 1 136 ? 32.176 -3.954  8.095   1.00 14.47  ? 146  VAL A CG2  1 
ATOM   1284 H H    . VAL A 1 136 ? 34.652 -5.461  9.221   1.00 0.00   ? 146  VAL A H    1 
ATOM   1285 N N    . PHE A 1 137 ? 36.542 -2.898  8.939   1.00 13.54  ? 147  PHE A N    1 
ATOM   1286 C CA   . PHE A 1 137 ? 37.703 -2.034  9.093   1.00 15.34  ? 147  PHE A CA   1 
ATOM   1287 C C    . PHE A 1 137 ? 38.883 -2.535  8.275   1.00 13.99  ? 147  PHE A C    1 
ATOM   1288 O O    . PHE A 1 137 ? 39.571 -1.729  7.649   1.00 17.78  ? 147  PHE A O    1 
ATOM   1289 C CB   . PHE A 1 137 ? 38.040 -1.872  10.562  1.00 13.52  ? 147  PHE A CB   1 
ATOM   1290 C CG   . PHE A 1 137 ? 36.944 -1.217  11.319  1.00 16.20  ? 147  PHE A CG   1 
ATOM   1291 C CD1  . PHE A 1 137 ? 36.417 -0.012  10.861  1.00 20.03  ? 147  PHE A CD1  1 
ATOM   1292 C CD2  . PHE A 1 137 ? 36.386 -1.813  12.440  1.00 18.51  ? 147  PHE A CD2  1 
ATOM   1293 C CE1  . PHE A 1 137 ? 35.352 0.582   11.494  1.00 22.89  ? 147  PHE A CE1  1 
ATOM   1294 C CE2  . PHE A 1 137 ? 35.314 -1.226  13.089  1.00 21.49  ? 147  PHE A CE2  1 
ATOM   1295 C CZ   . PHE A 1 137 ? 34.792 -0.019  12.612  1.00 16.77  ? 147  PHE A CZ   1 
ATOM   1296 H H    . PHE A 1 137 ? 36.242 -3.445  9.694   1.00 0.00   ? 147  PHE A H    1 
ATOM   1297 N N    . ASN A 1 138 ? 39.071 -3.853  8.217   1.00 17.00  ? 148  ASN A N    1 
ATOM   1298 C CA   . ASN A 1 138 ? 40.160 -4.419  7.422   1.00 17.97  ? 148  ASN A CA   1 
ATOM   1299 C C    . ASN A 1 138 ? 39.907 -4.107  5.949   1.00 22.54  ? 148  ASN A C    1 
ATOM   1300 O O    . ASN A 1 138 ? 40.846 -4.060  5.163   1.00 18.82  ? 148  ASN A O    1 
ATOM   1301 C CB   . ASN A 1 138 ? 40.256 -5.944  7.570   1.00 20.27  ? 148  ASN A CB   1 
ATOM   1302 C CG   . ASN A 1 138 ? 41.002 -6.394  8.815   1.00 19.76  ? 148  ASN A CG   1 
ATOM   1303 O OD1  . ASN A 1 138 ? 41.634 -5.605  9.523   1.00 22.26  ? 148  ASN A OD1  1 
ATOM   1304 N ND2  . ASN A 1 138 ? 40.933 -7.696  9.085   1.00 22.79  ? 148  ASN A ND2  1 
ATOM   1305 H H    . ASN A 1 138 ? 38.448 -4.433  8.686   1.00 0.00   ? 148  ASN A H    1 
ATOM   1306 H HD21 . ASN A 1 138 ? 40.419 -8.273  8.482   1.00 0.00   ? 148  ASN A HD21 1 
ATOM   1307 H HD22 . ASN A 1 138 ? 41.403 -8.023  9.880   1.00 0.00   ? 148  ASN A HD22 1 
ATOM   1308 N N    . SER A 1 139 ? 38.636 -4.004  5.555   1.00 21.51  ? 149  SER A N    1 
ATOM   1309 C CA   . SER A 1 139 ? 38.307 -3.704  4.162   1.00 21.57  ? 149  SER A CA   1 
ATOM   1310 C C    . SER A 1 139 ? 38.721 -2.308  3.747   1.00 15.97  ? 149  SER A C    1 
ATOM   1311 O O    . SER A 1 139 ? 39.007 -2.066  2.577   1.00 18.36  ? 149  SER A O    1 
ATOM   1312 C CB   . SER A 1 139 ? 36.809 -3.867  3.893   1.00 24.55  ? 149  SER A CB   1 
ATOM   1313 O OG   . SER A 1 139 ? 36.465 -5.232  3.754   1.00 33.82  ? 149  SER A OG   1 
ATOM   1314 H H    . SER A 1 139 ? 37.915 -4.129  6.207   1.00 0.00   ? 149  SER A H    1 
ATOM   1315 H HG   . SER A 1 139 ? 35.522 -5.308  3.592   1.00 0.00   ? 149  SER A HG   1 
ATOM   1316 N N    . ALA A 1 140 ? 38.692 -1.381  4.697   1.00 16.89  ? 150  ALA A N    1 
ATOM   1317 C CA   . ALA A 1 140 ? 39.067 -0.001  4.416   1.00 21.19  ? 150  ALA A CA   1 
ATOM   1318 C C    . ALA A 1 140 ? 40.571 0.230   4.518   1.00 23.23  ? 150  ALA A C    1 
ATOM   1319 O O    . ALA A 1 140 ? 41.065 1.314   4.197   1.00 24.68  ? 150  ALA A O    1 
ATOM   1320 C CB   . ALA A 1 140 ? 38.337 0.942   5.353   1.00 16.52  ? 150  ALA A CB   1 
ATOM   1321 H H    . ALA A 1 140 ? 38.414 -1.630  5.603   1.00 0.00   ? 150  ALA A H    1 
ATOM   1322 N N    . GLY A 1 141 ? 41.284 -0.791  4.985   1.00 23.23  ? 151  GLY A N    1 
ATOM   1323 C CA   . GLY A 1 141 ? 42.724 -0.708  5.128   1.00 23.48  ? 151  GLY A CA   1 
ATOM   1324 C C    . GLY A 1 141 ? 43.232 -0.410  6.533   1.00 24.60  ? 151  GLY A C    1 
ATOM   1325 O O    . GLY A 1 141 ? 44.436 -0.264  6.728   1.00 29.83  ? 151  GLY A O    1 
ATOM   1326 H H    . GLY A 1 141 ? 40.830 -1.619  5.245   1.00 0.00   ? 151  GLY A H    1 
ATOM   1327 N N    . LEU A 1 142 ? 42.335 -0.355  7.516   1.00 24.58  ? 152  LEU A N    1 
ATOM   1328 C CA   . LEU A 1 142 ? 42.730 -0.070  8.899   1.00 24.67  ? 152  LEU A CA   1 
ATOM   1329 C C    . LEU A 1 142 ? 43.038 -1.359  9.646   1.00 24.38  ? 152  LEU A C    1 
ATOM   1330 O O    . LEU A 1 142 ? 42.522 -2.417  9.282   1.00 25.92  ? 152  LEU A O    1 
ATOM   1331 C CB   . LEU A 1 142 ? 41.598 0.655   9.628   1.00 21.83  ? 152  LEU A CB   1 
ATOM   1332 C CG   . LEU A 1 142 ? 41.385 2.154   9.414   1.00 25.96  ? 152  LEU A CG   1 
ATOM   1333 C CD1  . LEU A 1 142 ? 42.035 2.646   8.137   1.00 27.14  ? 152  LEU A CD1  1 
ATOM   1334 C CD2  . LEU A 1 142 ? 39.903 2.452   9.419   1.00 26.27  ? 152  LEU A CD2  1 
ATOM   1335 H H    . LEU A 1 142 ? 41.389 -0.507  7.310   1.00 0.00   ? 152  LEU A H    1 
ATOM   1336 N N    . GLU A 1 143 ? 43.913 -1.326  10.648  1.00 24.52  ? 154  GLU A N    1 
ATOM   1337 C CA   . GLU A 1 143 ? 44.109 -2.584  11.352  1.00 28.09  ? 154  GLU A CA   1 
ATOM   1338 C C    . GLU A 1 143 ? 43.312 -2.551  12.630  1.00 25.34  ? 154  GLU A C    1 
ATOM   1339 O O    . GLU A 1 143 ? 42.985 -1.492  13.168  1.00 23.59  ? 154  GLU A O    1 
ATOM   1340 C CB   . GLU A 1 143 ? 45.587 -2.978  11.564  1.00 36.04  ? 154  GLU A CB   1 
ATOM   1341 C CG   . GLU A 1 143 ? 45.838 -4.523  11.800  1.00 49.76  ? 154  GLU A CG   1 
ATOM   1342 C CD   . GLU A 1 143 ? 44.979 -5.505  10.947  1.00 52.10  ? 154  GLU A CD   1 
ATOM   1343 O OE1  . GLU A 1 143 ? 45.261 -5.717  9.745   1.00 52.98  ? 154  GLU A OE1  1 
ATOM   1344 O OE2  . GLU A 1 143 ? 44.059 -6.137  11.515  1.00 46.80  ? 154  GLU A OE2  1 
ATOM   1345 H H    . GLU A 1 143 ? 44.395 -0.517  10.898  1.00 0.00   ? 154  GLU A H    1 
ATOM   1346 N N    . VAL A 1 144 ? 42.918 -3.739  13.045  1.00 21.22  ? 155  VAL A N    1 
ATOM   1347 C CA   . VAL A 1 144 ? 42.110 -3.903  14.220  1.00 23.18  ? 155  VAL A CA   1 
ATOM   1348 C C    . VAL A 1 144 ? 42.874 -4.513  15.367  1.00 24.11  ? 155  VAL A C    1 
ATOM   1349 O O    . VAL A 1 144 ? 43.467 -5.583  15.250  1.00 28.01  ? 155  VAL A O    1 
ATOM   1350 C CB   . VAL A 1 144 ? 40.882 -4.747  13.882  1.00 20.80  ? 155  VAL A CB   1 
ATOM   1351 C CG1  . VAL A 1 144 ? 40.070 -5.020  15.127  1.00 20.53  ? 155  VAL A CG1  1 
ATOM   1352 C CG2  . VAL A 1 144 ? 40.054 -4.034  12.833  1.00 17.22  ? 155  VAL A CG2  1 
ATOM   1353 H H    . VAL A 1 144 ? 43.172 -4.534  12.539  1.00 0.00   ? 155  VAL A H    1 
ATOM   1354 N N    . ARG A 1 145 ? 42.843 -3.795  16.478  1.00 25.95  ? 156  ARG A N    1 
ATOM   1355 C CA   . ARG A 1 145 ? 43.506 -4.185  17.698  1.00 30.20  ? 156  ARG A CA   1 
ATOM   1356 C C    . ARG A 1 145 ? 42.429 -4.462  18.736  1.00 26.99  ? 156  ARG A C    1 
ATOM   1357 O O    . ARG A 1 145 ? 41.373 -3.834  18.721  1.00 27.80  ? 156  ARG A O    1 
ATOM   1358 C CB   . ARG A 1 145 ? 44.418 -3.058  18.146  1.00 36.74  ? 156  ARG A CB   1 
ATOM   1359 C CG   . ARG A 1 145 ? 45.768 -3.092  17.490  1.00 47.71  ? 156  ARG A CG   1 
ATOM   1360 C CD   . ARG A 1 145 ? 46.777 -3.111  18.600  1.00 59.79  ? 156  ARG A CD   1 
ATOM   1361 N NE   . ARG A 1 145 ? 48.113 -3.520  18.199  1.00 68.04  ? 156  ARG A NE   1 
ATOM   1362 C CZ   . ARG A 1 145 ? 49.221 -2.962  18.679  1.00 73.11  ? 156  ARG A CZ   1 
ATOM   1363 N NH1  . ARG A 1 145 ? 49.146 -1.966  19.563  1.00 74.09  ? 156  ARG A NH1  1 
ATOM   1364 N NH2  . ARG A 1 145 ? 50.407 -3.424  18.316  1.00 77.67  ? 156  ARG A NH2  1 
ATOM   1365 H H    . ARG A 1 145 ? 42.347 -2.955  16.477  1.00 0.00   ? 156  ARG A H    1 
ATOM   1366 H HE   . ARG A 1 145 ? 48.204 -4.241  17.542  1.00 0.00   ? 156  ARG A HE   1 
ATOM   1367 H HH11 . ARG A 1 145 ? 48.258 -1.628  19.875  1.00 0.00   ? 156  ARG A HH11 1 
ATOM   1368 H HH12 . ARG A 1 145 ? 49.986 -1.555  19.919  1.00 0.00   ? 156  ARG A HH12 1 
ATOM   1369 H HH21 . ARG A 1 145 ? 50.470 -4.193  17.680  1.00 0.00   ? 156  ARG A HH21 1 
ATOM   1370 H HH22 . ARG A 1 145 ? 51.239 -3.003  18.678  1.00 0.00   ? 156  ARG A HH22 1 
ATOM   1371 N N    . GLU A 1 146 ? 42.711 -5.374  19.658  1.00 25.84  ? 157  GLU A N    1 
ATOM   1372 C CA   . GLU A 1 146 ? 41.717 -5.742  20.653  1.00 24.44  ? 157  GLU A CA   1 
ATOM   1373 C C    . GLU A 1 146 ? 41.903 -5.239  22.067  1.00 23.41  ? 157  GLU A C    1 
ATOM   1374 O O    . GLU A 1 146 ? 43.022 -5.224  22.576  1.00 27.74  ? 157  GLU A O    1 
ATOM   1375 C CB   . GLU A 1 146 ? 41.599 -7.265  20.723  1.00 29.46  ? 157  GLU A CB   1 
ATOM   1376 C CG   . GLU A 1 146 ? 40.999 -7.917  19.501  1.00 32.64  ? 157  GLU A CG   1 
ATOM   1377 C CD   . GLU A 1 146 ? 40.606 -9.364  19.754  1.00 37.80  ? 157  GLU A CD   1 
ATOM   1378 O OE1  . GLU A 1 146 ? 41.503 -10.189 20.032  1.00 43.01  ? 157  GLU A OE1  1 
ATOM   1379 O OE2  . GLU A 1 146 ? 39.397 -9.667  19.668  1.00 43.31  ? 157  GLU A OE2  1 
ATOM   1380 H H    . GLU A 1 146 ? 43.593 -5.801  19.670  1.00 0.00   ? 157  GLU A H    1 
ATOM   1381 N N    . TYR A 1 147 ? 40.829 -4.760  22.693  1.00 22.08  ? 158  TYR A N    1 
ATOM   1382 C CA   . TYR A 1 147 ? 40.966 -4.377  24.095  1.00 19.82  ? 158  TYR A CA   1 
ATOM   1383 C C    . TYR A 1 147 ? 40.136 -5.308  24.959  1.00 22.21  ? 158  TYR A C    1 
ATOM   1384 O O    . TYR A 1 147 ? 39.088 -5.806  24.536  1.00 23.73  ? 158  TYR A O    1 
ATOM   1385 C CB   . TYR A 1 147 ? 40.636 -2.910  24.367  1.00 19.92  ? 158  TYR A CB   1 
ATOM   1386 C CG   . TYR A 1 147 ? 39.233 -2.488  24.075  1.00 22.82  ? 158  TYR A CG   1 
ATOM   1387 C CD1  . TYR A 1 147 ? 38.199 -2.724  24.985  1.00 21.42  ? 158  TYR A CD1  1 
ATOM   1388 C CD2  . TYR A 1 147 ? 38.945 -1.756  22.930  1.00 21.90  ? 158  TYR A CD2  1 
ATOM   1389 C CE1  . TYR A 1 147 ? 36.927 -2.230  24.758  1.00 22.94  ? 158  TYR A CE1  1 
ATOM   1390 C CE2  . TYR A 1 147 ? 37.684 -1.260  22.697  1.00 22.07  ? 158  TYR A CE2  1 
ATOM   1391 C CZ   . TYR A 1 147 ? 36.683 -1.496  23.613  1.00 24.11  ? 158  TYR A CZ   1 
ATOM   1392 O OH   . TYR A 1 147 ? 35.433 -0.969  23.403  1.00 23.89  ? 158  TYR A OH   1 
ATOM   1393 H H    . TYR A 1 147 ? 39.970 -4.667  22.232  1.00 0.00   ? 158  TYR A H    1 
ATOM   1394 H HH   . TYR A 1 147 ? 35.443 -0.446  22.602  1.00 0.00   ? 158  TYR A HH   1 
ATOM   1395 N N    . ALA A 1 148 ? 40.667 -5.588  26.145  1.00 21.17  ? 159  ALA A N    1 
ATOM   1396 C CA   . ALA A 1 148 ? 40.029 -6.467  27.099  1.00 20.29  ? 159  ALA A CA   1 
ATOM   1397 C C    . ALA A 1 148 ? 38.684 -5.909  27.456  1.00 20.89  ? 159  ALA A C    1 
ATOM   1398 O O    . ALA A 1 148 ? 38.492 -4.692  27.566  1.00 19.18  ? 159  ALA A O    1 
ATOM   1399 C CB   . ALA A 1 148 ? 40.876 -6.627  28.354  1.00 19.19  ? 159  ALA A CB   1 
ATOM   1400 H H    . ALA A 1 148 ? 41.524 -5.181  26.373  1.00 0.00   ? 159  ALA A H    1 
ATOM   1401 N N    . TYR A 1 149 ? 37.789 -6.818  27.787  1.00 18.07  ? 160  TYR A N    1 
ATOM   1402 C CA   . TYR A 1 149 ? 36.445 -6.423  28.055  1.00 18.11  ? 160  TYR A CA   1 
ATOM   1403 C C    . TYR A 1 149 ? 35.745 -7.347  29.023  1.00 18.50  ? 160  TYR A C    1 
ATOM   1404 O O    . TYR A 1 149 ? 35.550 -7.027  30.190  1.00 19.62  ? 160  TYR A O    1 
ATOM   1405 C CB   . TYR A 1 149 ? 35.714 -6.433  26.714  1.00 18.47  ? 160  TYR A CB   1 
ATOM   1406 C CG   . TYR A 1 149 ? 34.413 -5.728  26.755  1.00 17.29  ? 160  TYR A CG   1 
ATOM   1407 C CD1  . TYR A 1 149 ? 34.369 -4.343  26.828  1.00 17.74  ? 160  TYR A CD1  1 
ATOM   1408 C CD2  . TYR A 1 149 ? 33.223 -6.436  26.857  1.00 20.66  ? 160  TYR A CD2  1 
ATOM   1409 C CE1  . TYR A 1 149 ? 33.177 -3.678  27.021  1.00 20.04  ? 160  TYR A CE1  1 
ATOM   1410 C CE2  . TYR A 1 149 ? 32.019 -5.785  27.052  1.00 18.31  ? 160  TYR A CE2  1 
ATOM   1411 C CZ   . TYR A 1 149 ? 32.006 -4.408  27.140  1.00 21.41  ? 160  TYR A CZ   1 
ATOM   1412 O OH   . TYR A 1 149 ? 30.834 -3.751  27.408  1.00 22.46  ? 160  TYR A OH   1 
ATOM   1413 H H    . TYR A 1 149 ? 38.043 -7.763  27.849  1.00 0.00   ? 160  TYR A H    1 
ATOM   1414 H HH   . TYR A 1 149 ? 30.127 -4.377  27.306  1.00 0.00   ? 160  TYR A HH   1 
ATOM   1415 N N    . TYR A 1 150 ? 35.496 -8.555  28.553  1.00 23.01  ? 161  TYR A N    1 
ATOM   1416 C CA   . TYR A 1 150 ? 34.757 -9.516  29.330  1.00 25.92  ? 161  TYR A CA   1 
ATOM   1417 C C    . TYR A 1 150 ? 35.557 -10.524 30.137  1.00 30.02  ? 161  TYR A C    1 
ATOM   1418 O O    . TYR A 1 150 ? 36.550 -11.092 29.678  1.00 32.16  ? 161  TYR A O    1 
ATOM   1419 C CB   . TYR A 1 150 ? 33.755 -10.173 28.387  1.00 29.87  ? 161  TYR A CB   1 
ATOM   1420 C CG   . TYR A 1 150 ? 32.950 -11.324 28.914  1.00 28.01  ? 161  TYR A CG   1 
ATOM   1421 C CD1  . TYR A 1 150 ? 31.758 -11.118 29.616  1.00 29.81  ? 161  TYR A CD1  1 
ATOM   1422 C CD2  . TYR A 1 150 ? 33.293 -12.627 28.571  1.00 32.70  ? 161  TYR A CD2  1 
ATOM   1423 C CE1  . TYR A 1 150 ? 30.928 -12.188 29.944  1.00 30.97  ? 161  TYR A CE1  1 
ATOM   1424 C CE2  . TYR A 1 150 ? 32.477 -13.697 28.891  1.00 32.83  ? 161  TYR A CE2  1 
ATOM   1425 C CZ   . TYR A 1 150 ? 31.297 -13.473 29.571  1.00 33.98  ? 161  TYR A CZ   1 
ATOM   1426 O OH   . TYR A 1 150 ? 30.505 -14.561 29.851  1.00 41.67  ? 161  TYR A OH   1 
ATOM   1427 H H    . TYR A 1 150 ? 35.822 -8.815  27.666  1.00 0.00   ? 161  TYR A H    1 
ATOM   1428 H HH   . TYR A 1 150 ? 30.915 -15.361 29.513  1.00 0.00   ? 161  TYR A HH   1 
ATOM   1429 N N    . ASP A 1 151 ? 35.119 -10.678 31.380  1.00 31.06  ? 162  ASP A N    1 
ATOM   1430 C CA   . ASP A 1 151 ? 35.685 -11.595 32.356  1.00 33.11  ? 162  ASP A CA   1 
ATOM   1431 C C    . ASP A 1 151 ? 34.767 -12.816 32.278  1.00 34.46  ? 162  ASP A C    1 
ATOM   1432 O O    . ASP A 1 151 ? 33.648 -12.797 32.790  1.00 34.02  ? 162  ASP A O    1 
ATOM   1433 C CB   . ASP A 1 151 ? 35.612 -10.910 33.724  1.00 35.32  ? 162  ASP A CB   1 
ATOM   1434 C CG   . ASP A 1 151 ? 36.155 -11.756 34.866  1.00 38.30  ? 162  ASP A CG   1 
ATOM   1435 O OD1  . ASP A 1 151 ? 36.539 -12.928 34.675  1.00 38.39  ? 162  ASP A OD1  1 
ATOM   1436 O OD2  . ASP A 1 151 ? 36.172 -11.205 35.986  1.00 42.86  ? 162  ASP A OD2  1 
ATOM   1437 H H    . ASP A 1 151 ? 34.359 -10.136 31.650  1.00 0.00   ? 162  ASP A H    1 
ATOM   1438 N N    . ALA A 1 152 ? 35.239 -13.851 31.587  1.00 34.98  ? 163  ALA A N    1 
ATOM   1439 C CA   . ALA A 1 152 ? 34.474 -15.080 31.365  1.00 38.16  ? 163  ALA A CA   1 
ATOM   1440 C C    . ALA A 1 152 ? 34.204 -15.935 32.592  1.00 41.64  ? 163  ALA A C    1 
ATOM   1441 O O    . ALA A 1 152 ? 33.244 -16.706 32.614  1.00 45.64  ? 163  ALA A O    1 
ATOM   1442 C CB   . ALA A 1 152 ? 35.151 -15.919 30.298  1.00 33.63  ? 163  ALA A CB   1 
ATOM   1443 H H    . ALA A 1 152 ? 36.141 -13.785 31.210  1.00 0.00   ? 163  ALA A H    1 
ATOM   1444 N N    . GLU A 1 153 ? 35.058 -15.829 33.602  1.00 46.15  ? 164  GLU A N    1 
ATOM   1445 C CA   . GLU A 1 153 ? 34.863 -16.616 34.810  1.00 49.83  ? 164  GLU A CA   1 
ATOM   1446 C C    . GLU A 1 153 ? 33.731 -16.007 35.608  1.00 50.48  ? 164  GLU A C    1 
ATOM   1447 O O    . GLU A 1 153 ? 32.739 -16.676 35.911  1.00 52.51  ? 164  GLU A O    1 
ATOM   1448 C CB   . GLU A 1 153 ? 36.141 -16.655 35.655  1.00 54.81  ? 164  GLU A CB   1 
ATOM   1449 C CG   . GLU A 1 153 ? 37.244 -17.523 35.061  1.00 62.15  ? 164  GLU A CG   1 
ATOM   1450 C CD   . GLU A 1 153 ? 38.555 -17.464 35.841  1.00 65.44  ? 164  GLU A CD   1 
ATOM   1451 O OE1  . GLU A 1 153 ? 38.623 -18.037 36.952  1.00 69.57  ? 164  GLU A OE1  1 
ATOM   1452 O OE2  . GLU A 1 153 ? 39.524 -16.871 35.319  1.00 67.14  ? 164  GLU A OE2  1 
ATOM   1453 H H    . GLU A 1 153 ? 35.820 -15.216 33.536  1.00 0.00   ? 164  GLU A H    1 
ATOM   1454 N N    . ASN A 1 154 ? 33.830 -14.701 35.828  1.00 51.55  ? 165  ASN A N    1 
ATOM   1455 C CA   . ASN A 1 154 ? 32.838 -13.978 36.611  1.00 53.24  ? 165  ASN A CA   1 
ATOM   1456 C C    . ASN A 1 154 ? 31.623 -13.483 35.797  1.00 49.37  ? 165  ASN A C    1 
ATOM   1457 O O    . ASN A 1 154 ? 30.595 -13.125 36.377  1.00 49.64  ? 165  ASN A O    1 
ATOM   1458 C CB   . ASN A 1 154 ? 33.526 -12.812 37.349  1.00 60.03  ? 165  ASN A CB   1 
ATOM   1459 C CG   . ASN A 1 154 ? 34.738 -13.257 38.184  1.00 65.83  ? 165  ASN A CG   1 
ATOM   1460 O OD1  . ASN A 1 154 ? 34.964 -14.457 38.403  1.00 69.99  ? 165  ASN A OD1  1 
ATOM   1461 N ND2  . ASN A 1 154 ? 35.528 -12.292 38.655  1.00 69.48  ? 165  ASN A ND2  1 
ATOM   1462 H H    . ASN A 1 154 ? 34.589 -14.209 35.450  1.00 0.00   ? 165  ASN A H    1 
ATOM   1463 H HD21 . ASN A 1 154 ? 35.301 -11.361 38.448  1.00 0.00   ? 165  ASN A HD21 1 
ATOM   1464 H HD22 . ASN A 1 154 ? 36.305 -12.555 39.190  1.00 0.00   ? 165  ASN A HD22 1 
ATOM   1465 N N    . HIS A 1 155 ? 31.725 -13.557 34.464  1.00 43.47  ? 166  HIS A N    1 
ATOM   1466 C CA   . HIS A 1 155 ? 30.693 -13.109 33.513  1.00 40.18  ? 166  HIS A CA   1 
ATOM   1467 C C    . HIS A 1 155 ? 30.382 -11.646 33.795  1.00 38.35  ? 166  HIS A C    1 
ATOM   1468 O O    . HIS A 1 155 ? 29.226 -11.245 33.916  1.00 38.25  ? 166  HIS A O    1 
ATOM   1469 C CB   . HIS A 1 155 ? 29.408 -13.943 33.607  1.00 37.32  ? 166  HIS A CB   1 
ATOM   1470 C CG   . HIS A 1 155 ? 29.654 -15.405 33.848  1.00 32.87  ? 166  HIS A CG   1 
ATOM   1471 N ND1  . HIS A 1 155 ? 29.912 -16.283 32.823  1.00 34.74  ? 166  HIS A ND1  1 
ATOM   1472 C CD2  . HIS A 1 155 ? 29.684 -16.115 34.991  1.00 32.04  ? 166  HIS A CD2  1 
ATOM   1473 C CE1  . HIS A 1 155 ? 30.103 -17.488 33.336  1.00 32.35  ? 166  HIS A CE1  1 
ATOM   1474 N NE2  . HIS A 1 155 ? 29.971 -17.412 34.637  1.00 33.43  ? 166  HIS A NE2  1 
ATOM   1475 H H    . HIS A 1 155 ? 32.544 -13.950 34.099  1.00 0.00   ? 166  HIS A H    1 
ATOM   1476 H HD1  . HIS A 1 155 ? 29.950 -16.061 31.869  1.00 0.00   ? 166  HIS A HD1  1 
ATOM   1477 H HE2  . HIS A 1 155 ? 30.063 -18.162 35.260  1.00 0.00   ? 166  HIS A HE2  1 
ATOM   1478 N N    . THR A 1 156 ? 31.444 -10.854 33.873  1.00 34.40  ? 167  THR A N    1 
ATOM   1479 C CA   . THR A 1 156 ? 31.315 -9.444  34.177  1.00 32.20  ? 167  THR A CA   1 
ATOM   1480 C C    . THR A 1 156 ? 32.205 -8.630  33.269  1.00 27.72  ? 167  THR A C    1 
ATOM   1481 O O    . THR A 1 156 ? 32.939 -9.161  32.441  1.00 25.44  ? 167  THR A O    1 
ATOM   1482 C CB   . THR A 1 156 ? 31.769 -9.148  35.614  1.00 36.66  ? 167  THR A CB   1 
ATOM   1483 O OG1  . THR A 1 156 ? 33.019 -9.802  35.850  1.00 40.61  ? 167  THR A OG1  1 
ATOM   1484 C CG2  . THR A 1 156 ? 30.739 -9.618  36.623  1.00 41.10  ? 167  THR A CG2  1 
ATOM   1485 H H    . THR A 1 156 ? 32.336 -11.230 33.724  1.00 0.00   ? 167  THR A H    1 
ATOM   1486 H HG1  . THR A 1 156 ? 33.314 -9.624  36.746  1.00 0.00   ? 167  THR A HG1  1 
ATOM   1487 N N    . LEU A 1 157 ? 32.097 -7.320  33.412  1.00 27.22  ? 168  LEU A N    1 
ATOM   1488 C CA   . LEU A 1 157 ? 32.937 -6.407  32.667  1.00 28.08  ? 168  LEU A CA   1 
ATOM   1489 C C    . LEU A 1 157 ? 34.203 -6.231  33.497  1.00 28.61  ? 168  LEU A C    1 
ATOM   1490 O O    . LEU A 1 157 ? 34.131 -5.824  34.656  1.00 27.96  ? 168  LEU A O    1 
ATOM   1491 C CB   . LEU A 1 157 ? 32.209 -5.077  32.493  1.00 26.51  ? 168  LEU A CB   1 
ATOM   1492 C CG   . LEU A 1 157 ? 32.976 -3.864  31.991  1.00 25.79  ? 168  LEU A CG   1 
ATOM   1493 C CD1  . LEU A 1 157 ? 33.560 -4.104  30.608  1.00 25.05  ? 168  LEU A CD1  1 
ATOM   1494 C CD2  . LEU A 1 157 ? 32.001 -2.714  31.961  1.00 26.36  ? 168  LEU A CD2  1 
ATOM   1495 H H    . LEU A 1 157 ? 31.432 -6.954  34.033  1.00 0.00   ? 168  LEU A H    1 
ATOM   1496 N N    . ASP A 1 158 ? 35.340 -6.630  32.928  1.00 28.72  ? 169  ASP A N    1 
ATOM   1497 C CA   . ASP A 1 158 ? 36.637 -6.508  33.593  1.00 30.20  ? 169  ASP A CA   1 
ATOM   1498 C C    . ASP A 1 158 ? 37.149 -5.108  33.253  1.00 30.09  ? 169  ASP A C    1 
ATOM   1499 O O    . ASP A 1 158 ? 37.977 -4.930  32.358  1.00 28.71  ? 169  ASP A O    1 
ATOM   1500 C CB   . ASP A 1 158 ? 37.589 -7.593  33.054  1.00 34.68  ? 169  ASP A CB   1 
ATOM   1501 C CG   . ASP A 1 158 ? 38.773 -7.882  33.984  1.00 38.03  ? 169  ASP A CG   1 
ATOM   1502 O OD1  . ASP A 1 158 ? 39.067 -7.073  34.887  1.00 39.15  ? 169  ASP A OD1  1 
ATOM   1503 O OD2  . ASP A 1 158 ? 39.418 -8.937  33.782  1.00 40.57  ? 169  ASP A OD2  1 
ATOM   1504 H H    . ASP A 1 158 ? 35.293 -7.048  32.053  1.00 0.00   ? 169  ASP A H    1 
ATOM   1505 N N    . PHE A 1 159 ? 36.645 -4.119  33.984  1.00 30.00  ? 170  PHE A N    1 
ATOM   1506 C CA   . PHE A 1 159 ? 36.984 -2.733  33.729  1.00 30.96  ? 170  PHE A CA   1 
ATOM   1507 C C    . PHE A 1 159 ? 38.457 -2.351  33.822  1.00 31.09  ? 170  PHE A C    1 
ATOM   1508 O O    . PHE A 1 159 ? 38.947 -1.584  32.991  1.00 29.73  ? 170  PHE A O    1 
ATOM   1509 C CB   . PHE A 1 159 ? 36.131 -1.807  34.593  1.00 30.59  ? 170  PHE A CB   1 
ATOM   1510 C CG   . PHE A 1 159 ? 35.946 -0.463  33.994  1.00 31.40  ? 170  PHE A CG   1 
ATOM   1511 C CD1  . PHE A 1 159 ? 35.298 -0.321  32.768  1.00 31.76  ? 170  PHE A CD1  1 
ATOM   1512 C CD2  . PHE A 1 159 ? 36.449 0.660   34.620  1.00 30.03  ? 170  PHE A CD2  1 
ATOM   1513 C CE1  . PHE A 1 159 ? 35.164 0.923   32.179  1.00 28.25  ? 170  PHE A CE1  1 
ATOM   1514 C CE2  . PHE A 1 159 ? 36.324 1.911   34.046  1.00 31.48  ? 170  PHE A CE2  1 
ATOM   1515 C CZ   . PHE A 1 159 ? 35.680 2.045   32.819  1.00 33.09  ? 170  PHE A CZ   1 
ATOM   1516 H H    . PHE A 1 159 ? 36.028 -4.334  34.714  1.00 0.00   ? 170  PHE A H    1 
ATOM   1517 N N    . ASP A 1 160 ? 39.161 -2.852  34.833  1.00 32.98  ? 171  ASP A N    1 
ATOM   1518 C CA   . ASP A 1 160 ? 40.581 -2.545  34.947  1.00 35.81  ? 171  ASP A CA   1 
ATOM   1519 C C    . ASP A 1 160 ? 41.349 -3.082  33.753  1.00 31.50  ? 171  ASP A C    1 
ATOM   1520 O O    . ASP A 1 160 ? 42.232 -2.405  33.226  1.00 32.20  ? 171  ASP A O    1 
ATOM   1521 C CB   . ASP A 1 160 ? 41.145 -3.040  36.269  1.00 43.33  ? 171  ASP A CB   1 
ATOM   1522 C CG   . ASP A 1 160 ? 40.916 -2.051  37.377  1.00 50.14  ? 171  ASP A CG   1 
ATOM   1523 O OD1  . ASP A 1 160 ? 41.662 -1.048  37.412  1.00 56.80  ? 171  ASP A OD1  1 
ATOM   1524 O OD2  . ASP A 1 160 ? 39.962 -2.240  38.156  1.00 52.73  ? 171  ASP A OD2  1 
ATOM   1525 H H    . ASP A 1 160 ? 38.726 -3.426  35.497  1.00 0.00   ? 171  ASP A H    1 
ATOM   1526 N N    . ALA A 1 161 ? 41.006 -4.291  33.321  1.00 27.53  ? 172  ALA A N    1 
ATOM   1527 C CA   . ALA A 1 161 ? 41.659 -4.882  32.160  1.00 27.02  ? 172  ALA A CA   1 
ATOM   1528 C C    . ALA A 1 161 ? 41.338 -4.054  30.908  1.00 30.04  ? 172  ALA A C    1 
ATOM   1529 O O    . ALA A 1 161 ? 42.195 -3.880  30.040  1.00 32.46  ? 172  ALA A O    1 
ATOM   1530 C CB   . ALA A 1 161 ? 41.207 -6.329  31.975  1.00 24.89  ? 172  ALA A CB   1 
ATOM   1531 H H    . ALA A 1 161 ? 40.302 -4.789  33.787  1.00 0.00   ? 172  ALA A H    1 
ATOM   1532 N N    . LEU A 1 162 ? 40.103 -3.549  30.822  1.00 30.81  ? 173  LEU A N    1 
ATOM   1533 C CA   . LEU A 1 162 ? 39.654 -2.710  29.700  1.00 28.67  ? 173  LEU A CA   1 
ATOM   1534 C C    . LEU A 1 162 ? 40.586 -1.496  29.631  1.00 29.42  ? 173  LEU A C    1 
ATOM   1535 O O    . LEU A 1 162 ? 41.228 -1.230  28.611  1.00 28.32  ? 173  LEU A O    1 
ATOM   1536 C CB   . LEU A 1 162 ? 38.210 -2.241  29.977  1.00 32.28  ? 173  LEU A CB   1 
ATOM   1537 C CG   . LEU A 1 162 ? 37.244 -1.384  29.127  1.00 32.33  ? 173  LEU A CG   1 
ATOM   1538 C CD1  . LEU A 1 162 ? 37.920 -0.242  28.410  1.00 35.45  ? 173  LEU A CD1  1 
ATOM   1539 C CD2  . LEU A 1 162 ? 36.509 -2.248  28.157  1.00 33.99  ? 173  LEU A CD2  1 
ATOM   1540 H H    . LEU A 1 162 ? 39.473 -3.740  31.546  1.00 0.00   ? 173  LEU A H    1 
ATOM   1541 N N    . ILE A 1 163 ? 40.681 -0.803  30.763  1.00 30.35  ? 174  ILE A N    1 
ATOM   1542 C CA   . ILE A 1 163 ? 41.506 0.391   30.925  1.00 33.22  ? 174  ILE A CA   1 
ATOM   1543 C C    . ILE A 1 163 ? 42.987 0.153   30.585  1.00 33.84  ? 174  ILE A C    1 
ATOM   1544 O O    . ILE A 1 163 ? 43.556 0.884   29.774  1.00 35.26  ? 174  ILE A O    1 
ATOM   1545 C CB   . ILE A 1 163 ? 41.425 0.933   32.384  1.00 32.52  ? 174  ILE A CB   1 
ATOM   1546 C CG1  . ILE A 1 163 ? 39.988 1.270   32.768  1.00 31.39  ? 174  ILE A CG1  1 
ATOM   1547 C CG2  . ILE A 1 163 ? 42.312 2.157   32.552  1.00 34.19  ? 174  ILE A CG2  1 
ATOM   1548 C CD1  . ILE A 1 163 ? 39.318 2.301   31.884  1.00 29.06  ? 174  ILE A CD1  1 
ATOM   1549 H H    . ILE A 1 163 ? 40.177 -1.122  31.534  1.00 0.00   ? 174  ILE A H    1 
ATOM   1550 N N    . ASN A 1 164 ? 43.593 -0.870  31.197  1.00 34.56  ? 175  ASN A N    1 
ATOM   1551 C CA   . ASN A 1 164 ? 45.009 -1.191  30.977  1.00 37.82  ? 175  ASN A CA   1 
ATOM   1552 C C    . ASN A 1 164 ? 45.299 -1.588  29.529  1.00 38.70  ? 175  ASN A C    1 
ATOM   1553 O O    . ASN A 1 164 ? 46.427 -1.441  29.060  1.00 43.11  ? 175  ASN A O    1 
ATOM   1554 C CB   . ASN A 1 164 ? 45.481 -2.374  31.838  1.00 42.38  ? 175  ASN A CB   1 
ATOM   1555 C CG   . ASN A 1 164 ? 45.360 -2.150  33.335  1.00 47.86  ? 175  ASN A CG   1 
ATOM   1556 O OD1  . ASN A 1 164 ? 45.017 -1.069  33.822  1.00 48.04  ? 175  ASN A OD1  1 
ATOM   1557 N ND2  . ASN A 1 164 ? 45.658 -3.213  34.079  1.00 52.93  ? 175  ASN A ND2  1 
ATOM   1558 H H    . ASN A 1 164 ? 43.070 -1.427  31.800  1.00 0.00   ? 175  ASN A H    1 
ATOM   1559 H HD21 . ASN A 1 164 ? 45.926 -4.040  33.627  1.00 0.00   ? 175  ASN A HD21 1 
ATOM   1560 H HD22 . ASN A 1 164 ? 45.596 -3.123  35.053  1.00 0.00   ? 175  ASN A HD22 1 
ATOM   1561 N N    . SER A 1 165 ? 44.333 -2.247  28.889  1.00 34.89  ? 176  SER A N    1 
ATOM   1562 C CA   . SER A 1 165 ? 44.491 -2.677  27.501  1.00 36.27  ? 176  SER A CA   1 
ATOM   1563 C C    . SER A 1 165 ? 44.520 -1.450  26.627  1.00 35.61  ? 176  SER A C    1 
ATOM   1564 O O    . SER A 1 165 ? 45.334 -1.319  25.708  1.00 32.30  ? 176  SER A O    1 
ATOM   1565 C CB   . SER A 1 165 ? 43.296 -3.521  27.051  1.00 37.73  ? 176  SER A CB   1 
ATOM   1566 O OG   . SER A 1 165 ? 43.231 -4.770  27.701  1.00 44.22  ? 176  SER A OG   1 
ATOM   1567 H H    . SER A 1 165 ? 43.496 -2.435  29.359  1.00 0.00   ? 176  SER A H    1 
ATOM   1568 H HG   . SER A 1 165 ? 42.579 -5.308  27.257  1.00 0.00   ? 176  SER A HG   1 
ATOM   1569 N N    . LEU A 1 166 ? 43.625 -0.531  26.955  1.00 33.36  ? 177  LEU A N    1 
ATOM   1570 C CA   . LEU A 1 166 ? 43.466 0.684   26.189  1.00 35.95  ? 177  LEU A CA   1 
ATOM   1571 C C    . LEU A 1 166 ? 44.628 1.653   26.331  1.00 38.94  ? 177  LEU A C    1 
ATOM   1572 O O    . LEU A 1 166 ? 44.747 2.615   25.564  1.00 39.67  ? 177  LEU A O    1 
ATOM   1573 C CB   . LEU A 1 166 ? 42.127 1.338   26.542  1.00 30.86  ? 177  LEU A CB   1 
ATOM   1574 C CG   . LEU A 1 166 ? 41.142 1.588   25.381  1.00 31.02  ? 177  LEU A CG   1 
ATOM   1575 C CD1  . LEU A 1 166 ? 41.433 0.763   24.124  1.00 23.08  ? 177  LEU A CD1  1 
ATOM   1576 C CD2  . LEU A 1 166 ? 39.752 1.313   25.896  1.00 27.14  ? 177  LEU A CD2  1 
ATOM   1577 H H    . LEU A 1 166 ? 43.062 -0.674  27.743  1.00 0.00   ? 177  LEU A H    1 
ATOM   1578 N N    . ASN A 1 167 ? 45.514 1.372   27.283  1.00 42.82  ? 178  ASN A N    1 
ATOM   1579 C CA   . ASN A 1 167 ? 46.685 2.212   27.472  1.00 44.49  ? 178  ASN A CA   1 
ATOM   1580 C C    . ASN A 1 167 ? 47.705 2.074   26.339  1.00 42.38  ? 178  ASN A C    1 
ATOM   1581 O O    . ASN A 1 167 ? 48.591 2.912   26.205  1.00 42.40  ? 178  ASN A O    1 
ATOM   1582 C CB   . ASN A 1 167 ? 47.310 1.985   28.847  1.00 50.36  ? 178  ASN A CB   1 
ATOM   1583 C CG   . ASN A 1 167 ? 46.700 2.872   29.898  1.00 58.40  ? 178  ASN A CG   1 
ATOM   1584 O OD1  . ASN A 1 167 ? 46.115 2.407   30.870  1.00 64.33  ? 178  ASN A OD1  1 
ATOM   1585 N ND2  . ASN A 1 167 ? 46.785 4.185   29.675  1.00 63.09  ? 178  ASN A ND2  1 
ATOM   1586 H H    . ASN A 1 167 ? 45.379 0.598   27.868  1.00 0.00   ? 178  ASN A H    1 
ATOM   1587 H HD21 . ASN A 1 167 ? 47.230 4.497   28.860  1.00 0.00   ? 178  ASN A HD21 1 
ATOM   1588 H HD22 . ASN A 1 167 ? 46.395 4.788   30.342  1.00 0.00   ? 178  ASN A HD22 1 
ATOM   1589 N N    . GLU A 1 168 ? 47.587 1.010   25.542  1.00 41.86  ? 179  GLU A N    1 
ATOM   1590 C CA   . GLU A 1 168 ? 48.473 0.806   24.390  1.00 44.51  ? 179  GLU A CA   1 
ATOM   1591 C C    . GLU A 1 168 ? 47.965 1.632   23.208  1.00 40.50  ? 179  GLU A C    1 
ATOM   1592 O O    . GLU A 1 168 ? 48.597 1.669   22.153  1.00 38.34  ? 179  GLU A O    1 
ATOM   1593 C CB   . GLU A 1 168 ? 48.484 -0.666  23.962  1.00 53.10  ? 179  GLU A CB   1 
ATOM   1594 C CG   . GLU A 1 168 ? 49.799 -1.400  24.143  1.00 65.95  ? 179  GLU A CG   1 
ATOM   1595 C CD   . GLU A 1 168 ? 49.905 -2.607  23.222  1.00 73.08  ? 179  GLU A CD   1 
ATOM   1596 O OE1  . GLU A 1 168 ? 49.323 -3.664  23.548  1.00 76.30  ? 179  GLU A OE1  1 
ATOM   1597 O OE2  . GLU A 1 168 ? 50.554 -2.480  22.162  1.00 77.93  ? 179  GLU A OE2  1 
ATOM   1598 H H    . GLU A 1 168 ? 46.891 0.347   25.730  1.00 0.00   ? 179  GLU A H    1 
ATOM   1599 N N    . ALA A 1 169 ? 46.774 2.210   23.361  1.00 37.23  ? 180  ALA A N    1 
ATOM   1600 C CA   . ALA A 1 169 ? 46.168 3.017   22.310  1.00 34.83  ? 180  ALA A CA   1 
ATOM   1601 C C    . ALA A 1 169 ? 46.766 4.409   22.296  1.00 33.51  ? 180  ALA A C    1 
ATOM   1602 O O    . ALA A 1 169 ? 46.785 5.105   23.309  1.00 35.92  ? 180  ALA A O    1 
ATOM   1603 C CB   . ALA A 1 169 ? 44.659 3.097   22.497  1.00 33.23  ? 180  ALA A CB   1 
ATOM   1604 H H    . ALA A 1 169 ? 46.285 2.087   24.199  1.00 0.00   ? 180  ALA A H    1 
ATOM   1605 N N    . GLN A 1 170 ? 47.224 4.811   21.120  1.00 30.67  ? 181  GLN A N    1 
ATOM   1606 C CA   . GLN A 1 170 ? 47.859 6.102   20.914  1.00 31.00  ? 181  GLN A CA   1 
ATOM   1607 C C    . GLN A 1 170 ? 46.915 7.254   20.649  1.00 30.47  ? 181  GLN A C    1 
ATOM   1608 O O    . GLN A 1 170 ? 45.719 7.053   20.439  1.00 32.02  ? 181  GLN A O    1 
ATOM   1609 C CB   . GLN A 1 170 ? 48.845 5.967   19.770  1.00 35.30  ? 181  GLN A CB   1 
ATOM   1610 C CG   . GLN A 1 170 ? 49.960 5.073   20.188  1.00 43.69  ? 181  GLN A CG   1 
ATOM   1611 C CD   . GLN A 1 170 ? 50.861 4.656   19.076  1.00 49.65  ? 181  GLN A CD   1 
ATOM   1612 O OE1  . GLN A 1 170 ? 51.145 5.419   18.151  1.00 53.69  ? 181  GLN A OE1  1 
ATOM   1613 N NE2  . GLN A 1 170 ? 51.371 3.440   19.187  1.00 52.59  ? 181  GLN A NE2  1 
ATOM   1614 H H    . GLN A 1 170 ? 47.135 4.207   20.355  1.00 0.00   ? 181  GLN A H    1 
ATOM   1615 H HE21 . GLN A 1 170 ? 51.132 2.903   19.971  1.00 0.00   ? 181  GLN A HE21 1 
ATOM   1616 H HE22 . GLN A 1 170 ? 51.969 3.127   18.477  1.00 0.00   ? 181  GLN A HE22 1 
ATOM   1617 N N    . ALA A 1 171 ? 47.450 8.470   20.713  1.00 27.52  ? 182  ALA A N    1 
ATOM   1618 C CA   . ALA A 1 171 ? 46.653 9.653   20.438  1.00 24.96  ? 182  ALA A CA   1 
ATOM   1619 C C    . ALA A 1 171 ? 46.416 9.593   18.936  1.00 26.19  ? 182  ALA A C    1 
ATOM   1620 O O    . ALA A 1 171 ? 47.354 9.411   18.163  1.00 27.75  ? 182  ALA A O    1 
ATOM   1621 C CB   . ALA A 1 171 ? 47.434 10.915  20.807  1.00 22.41  ? 182  ALA A CB   1 
ATOM   1622 H H    . ALA A 1 171 ? 48.396 8.570   20.949  1.00 0.00   ? 182  ALA A H    1 
ATOM   1623 N N    . GLY A 1 172 ? 45.160 9.691   18.523  1.00 23.59  ? 183  GLY A N    1 
ATOM   1624 C CA   . GLY A 1 172 ? 44.862 9.612   17.105  1.00 20.60  ? 183  GLY A CA   1 
ATOM   1625 C C    . GLY A 1 172 ? 44.287 8.261   16.710  1.00 19.06  ? 183  GLY A C    1 
ATOM   1626 O O    . GLY A 1 172 ? 44.011 8.035   15.535  1.00 18.92  ? 183  GLY A O    1 
ATOM   1627 H H    . GLY A 1 172 ? 44.441 9.782   19.172  1.00 0.00   ? 183  GLY A H    1 
ATOM   1628 N N    . ASP A 1 173 ? 44.190 7.337   17.666  1.00 15.73  ? 184  ASP A N    1 
ATOM   1629 C CA   . ASP A 1 173 ? 43.617 6.014   17.408  1.00 18.20  ? 184  ASP A CA   1 
ATOM   1630 C C    . ASP A 1 173 ? 42.097 6.054   17.536  1.00 16.65  ? 184  ASP A C    1 
ATOM   1631 O O    . ASP A 1 173 ? 41.568 6.835   18.318  1.00 16.95  ? 184  ASP A O    1 
ATOM   1632 C CB   . ASP A 1 173 ? 44.130 4.996   18.435  1.00 14.22  ? 184  ASP A CB   1 
ATOM   1633 C CG   . ASP A 1 173 ? 45.419 4.308   18.016  1.00 15.66  ? 184  ASP A CG   1 
ATOM   1634 O OD1  . ASP A 1 173 ? 45.971 4.633   16.949  1.00 17.94  ? 184  ASP A OD1  1 
ATOM   1635 O OD2  . ASP A 1 173 ? 45.867 3.431   18.781  1.00 15.97  ? 184  ASP A OD2  1 
ATOM   1636 H H    . ASP A 1 173 ? 44.509 7.547   18.568  1.00 0.00   ? 184  ASP A H    1 
ATOM   1637 N N    . VAL A 1 174 ? 41.400 5.218   16.767  1.00 19.98  ? 185  VAL A N    1 
ATOM   1638 C CA   . VAL A 1 174 ? 39.944 5.151   16.868  1.00 19.95  ? 185  VAL A CA   1 
ATOM   1639 C C    . VAL A 1 174 ? 39.611 4.063   17.872  1.00 16.72  ? 185  VAL A C    1 
ATOM   1640 O O    . VAL A 1 174 ? 40.221 2.999   17.853  1.00 17.55  ? 185  VAL A O    1 
ATOM   1641 C CB   . VAL A 1 174 ? 39.266 4.770   15.521  1.00 22.61  ? 185  VAL A CB   1 
ATOM   1642 C CG1  . VAL A 1 174 ? 37.786 4.436   15.733  1.00 22.39  ? 185  VAL A CG1  1 
ATOM   1643 C CG2  . VAL A 1 174 ? 39.393 5.887   14.529  1.00 26.11  ? 185  VAL A CG2  1 
ATOM   1644 H H    . VAL A 1 174 ? 41.868 4.643   16.127  1.00 0.00   ? 185  VAL A H    1 
ATOM   1645 N N    . VAL A 1 175 ? 38.750 4.366   18.836  1.00 17.96  ? 186  VAL A N    1 
ATOM   1646 C CA   . VAL A 1 175 ? 38.349 3.327   19.776  1.00 14.81  ? 186  VAL A CA   1 
ATOM   1647 C C    . VAL A 1 175 ? 36.855 3.118   19.548  1.00 15.83  ? 186  VAL A C    1 
ATOM   1648 O O    . VAL A 1 175 ? 36.091 4.073   19.588  1.00 16.71  ? 186  VAL A O    1 
ATOM   1649 C CB   . VAL A 1 175 ? 38.610 3.709   21.251  1.00 16.68  ? 186  VAL A CB   1 
ATOM   1650 C CG1  . VAL A 1 175 ? 38.091 2.604   22.155  1.00 14.67  ? 186  VAL A CG1  1 
ATOM   1651 C CG2  . VAL A 1 175 ? 40.101 3.916   21.502  1.00 11.09  ? 186  VAL A CG2  1 
ATOM   1652 H H    . VAL A 1 175 ? 38.391 5.271   18.923  1.00 0.00   ? 186  VAL A H    1 
ATOM   1653 N N    . LEU A 1 176 ? 36.466 1.893   19.209  1.00 14.80  ? 187  LEU A N    1 
ATOM   1654 C CA   . LEU A 1 176 ? 35.058 1.585   18.965  1.00 16.97  ? 187  LEU A CA   1 
ATOM   1655 C C    . LEU A 1 176 ? 34.312 1.188   20.219  1.00 12.94  ? 187  LEU A C    1 
ATOM   1656 O O    . LEU A 1 176 ? 34.718 0.263   20.915  1.00 11.83  ? 187  LEU A O    1 
ATOM   1657 C CB   . LEU A 1 176 ? 34.899 0.442   17.952  1.00 15.75  ? 187  LEU A CB   1 
ATOM   1658 C CG   . LEU A 1 176 ? 33.494 0.241   17.343  1.00 19.79  ? 187  LEU A CG   1 
ATOM   1659 C CD1  . LEU A 1 176 ? 33.642 -0.110  15.890  1.00 19.58  ? 187  LEU A CD1  1 
ATOM   1660 C CD2  . LEU A 1 176 ? 32.642 -0.810  18.058  1.00 22.98  ? 187  LEU A CD2  1 
ATOM   1661 H H    . LEU A 1 176 ? 37.145 1.216   19.115  1.00 0.00   ? 187  LEU A H    1 
ATOM   1662 N N    . PHE A 1 177 ? 33.248 1.918   20.543  1.00 15.82  ? 188  PHE A N    1 
ATOM   1663 C CA   . PHE A 1 177 ? 32.422 1.542   21.694  1.00 15.91  ? 188  PHE A CA   1 
ATOM   1664 C C    . PHE A 1 177 ? 31.051 1.135   21.176  1.00 16.81  ? 188  PHE A C    1 
ATOM   1665 O O    . PHE A 1 177 ? 30.642 1.571   20.104  1.00 14.27  ? 188  PHE A O    1 
ATOM   1666 C CB   . PHE A 1 177 ? 32.222 2.711   22.667  1.00 17.75  ? 188  PHE A CB   1 
ATOM   1667 C CG   . PHE A 1 177 ? 33.471 3.164   23.338  1.00 21.15  ? 188  PHE A CG   1 
ATOM   1668 C CD1  . PHE A 1 177 ? 34.020 2.439   24.391  1.00 20.52  ? 188  PHE A CD1  1 
ATOM   1669 C CD2  . PHE A 1 177 ? 34.124 4.305   22.897  1.00 25.40  ? 188  PHE A CD2  1 
ATOM   1670 C CE1  . PHE A 1 177 ? 35.204 2.841   24.989  1.00 22.09  ? 188  PHE A CE1  1 
ATOM   1671 C CE2  . PHE A 1 177 ? 35.311 4.722   23.484  1.00 30.23  ? 188  PHE A CE2  1 
ATOM   1672 C CZ   . PHE A 1 177 ? 35.855 3.988   24.533  1.00 27.05  ? 188  PHE A CZ   1 
ATOM   1673 H H    . PHE A 1 177 ? 33.018 2.720   20.044  1.00 0.00   ? 188  PHE A H    1 
ATOM   1674 N N    . HIS A 1 178 ? 30.415 0.192   21.861  1.00 17.01  ? 189  HIS A N    1 
ATOM   1675 C CA   . HIS A 1 178 ? 29.057 -0.208  21.495  1.00 17.38  ? 189  HIS A CA   1 
ATOM   1676 C C    . HIS A 1 178 ? 28.155 0.741   22.284  1.00 17.57  ? 189  HIS A C    1 
ATOM   1677 O O    . HIS A 1 178 ? 28.518 1.142   23.388  1.00 18.30  ? 189  HIS A O    1 
ATOM   1678 C CB   . HIS A 1 178 ? 28.752 -1.647  21.945  1.00 17.31  ? 189  HIS A CB   1 
ATOM   1679 C CG   . HIS A 1 178 ? 29.475 -2.707  21.150  1.00 21.00  ? 189  HIS A CG   1 
ATOM   1680 N ND1  . HIS A 1 178 ? 28.850 -3.861  20.737  1.00 17.58  ? 189  HIS A ND1  1 
ATOM   1681 C CD2  . HIS A 1 178 ? 30.739 -2.761  20.683  1.00 17.37  ? 189  HIS A CD2  1 
ATOM   1682 C CE1  . HIS A 1 178 ? 29.704 -4.582  20.033  1.00 19.36  ? 189  HIS A CE1  1 
ATOM   1683 N NE2  . HIS A 1 178 ? 30.845 -3.940  19.988  1.00 18.59  ? 189  HIS A NE2  1 
ATOM   1684 H H    . HIS A 1 178 ? 30.859 -0.240  22.620  1.00 0.00   ? 189  HIS A H    1 
ATOM   1685 H HD1  . HIS A 1 178 ? 27.924 -4.117  20.932  1.00 0.00   ? 189  HIS A HD1  1 
ATOM   1686 H HE2  . HIS A 1 178 ? 31.651 -4.247  19.526  1.00 0.00   ? 189  HIS A HE2  1 
ATOM   1687 N N    . GLY A 1 179 ? 27.013 1.131   21.714  1.00 19.54  ? 190  GLY A N    1 
ATOM   1688 C CA   . GLY A 1 179 ? 26.099 2.021   22.428  1.00 20.92  ? 190  GLY A CA   1 
ATOM   1689 C C    . GLY A 1 179 ? 25.676 1.486   23.802  1.00 24.85  ? 190  GLY A C    1 
ATOM   1690 O O    . GLY A 1 179 ? 26.095 2.043   24.825  1.00 29.61  ? 190  GLY A O    1 
ATOM   1691 H H    . GLY A 1 179 ? 26.773 0.812   20.824  1.00 0.00   ? 190  GLY A H    1 
ATOM   1692 N N    . TYR A 1 180 ? 24.837 0.434   23.788  1.00 23.58  ? 191  TYR A N    1 
ATOM   1693 C CA   . TYR A 1 180 ? 24.274 -0.339  24.938  1.00 24.97  ? 191  TYR A CA   1 
ATOM   1694 C C    . TYR A 1 180 ? 23.833 -1.709  24.323  1.00 23.07  ? 191  TYR A C    1 
ATOM   1695 O O    . TYR A 1 180 ? 23.508 -1.755  23.142  1.00 25.09  ? 191  TYR A O    1 
ATOM   1696 C CB   . TYR A 1 180 ? 23.059 0.320   25.624  1.00 25.42  ? 191  TYR A CB   1 
ATOM   1697 C CG   . TYR A 1 180 ? 23.346 0.892   27.006  1.00 32.24  ? 191  TYR A CG   1 
ATOM   1698 C CD1  . TYR A 1 180 ? 23.331 0.089   28.157  1.00 37.91  ? 191  TYR A CD1  1 
ATOM   1699 C CD2  . TYR A 1 180 ? 23.655 2.241   27.159  1.00 36.52  ? 191  TYR A CD2  1 
ATOM   1700 C CE1  . TYR A 1 180 ? 23.630 0.631   29.426  1.00 41.04  ? 191  TYR A CE1  1 
ATOM   1701 C CE2  . TYR A 1 180 ? 23.949 2.787   28.400  1.00 40.27  ? 191  TYR A CE2  1 
ATOM   1702 C CZ   . TYR A 1 180 ? 23.940 1.984   29.528  1.00 43.21  ? 191  TYR A CZ   1 
ATOM   1703 O OH   . TYR A 1 180 ? 24.259 2.553   30.740  1.00 47.65  ? 191  TYR A OH   1 
ATOM   1704 H H    . TYR A 1 180 ? 24.561 0.142   22.894  1.00 0.00   ? 191  TYR A H    1 
ATOM   1705 H HH   . TYR A 1 180 ? 24.456 3.485   30.622  1.00 0.00   ? 191  TYR A HH   1 
ATOM   1706 N N    . CYS A 1 181 ? 23.647 -2.748  25.150  1.00 19.75  ? 192  CYS A N    1 
ATOM   1707 C CA   . CYS A 1 181 ? 23.343 -4.119  24.683  1.00 18.27  ? 192  CYS A CA   1 
ATOM   1708 C C    . CYS A 1 181 ? 24.562 -4.544  23.879  1.00 20.88  ? 192  CYS A C    1 
ATOM   1709 O O    . CYS A 1 181 ? 24.506 -4.692  22.657  1.00 19.09  ? 192  CYS A O    1 
ATOM   1710 C CB   . CYS A 1 181 ? 22.084 -4.214  23.805  1.00 21.16  ? 192  CYS A CB   1 
ATOM   1711 S SG   . CYS A 1 181 ? 20.572 -3.716  24.593  1.00 16.22  ? 192  CYS A SG   1 
ATOM   1712 H H    . CYS A 1 181 ? 23.682 -2.564  26.104  1.00 0.00   ? 192  CYS A H    1 
ATOM   1713 N N    . HIS A 1 182 ? 25.689 -4.657  24.579  1.00 17.57  ? 193  HIS A N    1 
ATOM   1714 C CA   . HIS A 1 182 ? 26.940 -5.057  23.952  1.00 17.29  ? 193  HIS A CA   1 
ATOM   1715 C C    . HIS A 1 182 ? 26.766 -6.394  23.239  1.00 11.32  ? 193  HIS A C    1 
ATOM   1716 O O    . HIS A 1 182 ? 26.260 -7.337  23.820  1.00 15.10  ? 193  HIS A O    1 
ATOM   1717 C CB   . HIS A 1 182 ? 28.038 -5.186  25.020  1.00 18.74  ? 193  HIS A CB   1 
ATOM   1718 C CG   . HIS A 1 182 ? 29.389 -5.499  24.443  1.00 18.16  ? 193  HIS A CG   1 
ATOM   1719 N ND1  . HIS A 1 182 ? 29.795 -6.788  24.197  1.00 15.67  ? 193  HIS A ND1  1 
ATOM   1720 C CD2  . HIS A 1 182 ? 30.375 -4.688  24.018  1.00 14.77  ? 193  HIS A CD2  1 
ATOM   1721 C CE1  . HIS A 1 182 ? 30.986 -6.753  23.624  1.00 16.04  ? 193  HIS A CE1  1 
ATOM   1722 N NE2  . HIS A 1 182 ? 31.354 -5.504  23.506  1.00 13.77  ? 193  HIS A NE2  1 
ATOM   1723 H H    . HIS A 1 182 ? 25.668 -4.477  25.541  1.00 0.00   ? 193  HIS A H    1 
ATOM   1724 H HD1  . HIS A 1 182 ? 29.290 -7.602  24.401  1.00 0.00   ? 193  HIS A HD1  1 
ATOM   1725 H HE2  . HIS A 1 182 ? 32.188 -5.198  23.115  1.00 0.00   ? 193  HIS A HE2  1 
ATOM   1726 N N    . ASN A 1 183 ? 27.139 -6.437  21.961  1.00 13.10  ? 194  ASN A N    1 
ATOM   1727 C CA   . ASN A 1 183 ? 27.065 -7.639  21.119  1.00 13.64  ? 194  ASN A CA   1 
ATOM   1728 C C    . ASN A 1 183 ? 28.517 -8.133  21.046  1.00 14.07  ? 194  ASN A C    1 
ATOM   1729 O O    . ASN A 1 183 ? 29.319 -7.509  20.345  1.00 14.53  ? 194  ASN A O    1 
ATOM   1730 C CB   . ASN A 1 183 ? 26.494 -7.172  19.767  1.00 12.34  ? 194  ASN A CB   1 
ATOM   1731 C CG   . ASN A 1 183 ? 26.378 -8.260  18.682  1.00 18.01  ? 194  ASN A CG   1 
ATOM   1732 O OD1  . ASN A 1 183 ? 25.894 -7.954  17.584  1.00 21.36  ? 194  ASN A OD1  1 
ATOM   1733 N ND2  . ASN A 1 183 ? 26.827 -9.489  18.932  1.00 14.63  ? 194  ASN A ND2  1 
ATOM   1734 H H    . ASN A 1 183 ? 27.487 -5.613  21.559  1.00 0.00   ? 194  ASN A H    1 
ATOM   1735 H HD21 . ASN A 1 183 ? 27.225 -9.713  19.787  1.00 0.00   ? 194  ASN A HD21 1 
ATOM   1736 H HD22 . ASN A 1 183 ? 26.734 -10.143 18.210  1.00 0.00   ? 194  ASN A HD22 1 
ATOM   1737 N N    . PRO A 1 184 ? 28.774 -9.386  21.464  1.00 14.41  ? 195  PRO A N    1 
ATOM   1738 C CA   . PRO A 1 184 ? 27.821 -10.399 21.983  1.00 14.68  ? 195  PRO A CA   1 
ATOM   1739 C C    . PRO A 1 184 ? 27.553 -10.646 23.455  1.00 14.83  ? 195  PRO A C    1 
ATOM   1740 O O    . PRO A 1 184 ? 26.691 -11.466 23.774  1.00 17.80  ? 195  PRO A O    1 
ATOM   1741 C CB   . PRO A 1 184 ? 28.392 -11.656 21.380  1.00 15.27  ? 195  PRO A CB   1 
ATOM   1742 C CG   . PRO A 1 184 ? 29.893 -11.456 21.660  1.00 13.93  ? 195  PRO A CG   1 
ATOM   1743 C CD   . PRO A 1 184 ? 30.131 -9.953  21.419  1.00 16.07  ? 195  PRO A CD   1 
ATOM   1744 N N    . THR A 1 185 ? 28.214 -9.942  24.361  1.00 18.05  ? 196  THR A N    1 
ATOM   1745 C CA   . THR A 1 185 ? 28.068 -10.236 25.797  1.00 17.83  ? 196  THR A CA   1 
ATOM   1746 C C    . THR A 1 185 ? 26.834 -9.768  26.584  1.00 18.34  ? 196  THR A C    1 
ATOM   1747 O O    . THR A 1 185 ? 26.413 -10.429 27.532  1.00 17.76  ? 196  THR A O    1 
ATOM   1748 C CB   . THR A 1 185 ? 29.321 -9.775  26.553  1.00 19.08  ? 196  THR A CB   1 
ATOM   1749 O OG1  . THR A 1 185 ? 29.372 -8.346  26.543  1.00 19.27  ? 196  THR A OG1  1 
ATOM   1750 C CG2  . THR A 1 185 ? 30.578 -10.311 25.862  1.00 18.12  ? 196  THR A CG2  1 
ATOM   1751 H H    . THR A 1 185 ? 28.802 -9.214  24.070  1.00 0.00   ? 196  THR A H    1 
ATOM   1752 H HG1  . THR A 1 185 ? 30.150 -8.046  27.018  1.00 0.00   ? 196  THR A HG1  1 
ATOM   1753 N N    . GLY A 1 186 ? 26.271 -8.630  26.192  1.00 17.58  ? 197  GLY A N    1 
ATOM   1754 C CA   . GLY A 1 186 ? 25.127 -8.085  26.898  1.00 15.33  ? 197  GLY A CA   1 
ATOM   1755 C C    . GLY A 1 186 ? 25.613 -7.355  28.136  1.00 17.16  ? 197  GLY A C    1 
ATOM   1756 O O    . GLY A 1 186 ? 24.822 -6.804  28.900  1.00 18.08  ? 197  GLY A O    1 
ATOM   1757 H H    . GLY A 1 186 ? 26.676 -8.153  25.449  1.00 0.00   ? 197  GLY A H    1 
ATOM   1758 N N    . ILE A 1 187 ? 26.929 -7.353  28.336  1.00 18.63  ? 198  ILE A N    1 
ATOM   1759 C CA   . ILE A 1 187 ? 27.532 -6.684  29.479  1.00 19.63  ? 198  ILE A CA   1 
ATOM   1760 C C    . ILE A 1 187 ? 27.905 -5.261  29.061  1.00 19.67  ? 198  ILE A C    1 
ATOM   1761 O O    . ILE A 1 187 ? 28.624 -5.077  28.086  1.00 21.10  ? 198  ILE A O    1 
ATOM   1762 C CB   . ILE A 1 187 ? 28.778 -7.463  29.963  1.00 21.54  ? 198  ILE A CB   1 
ATOM   1763 C CG1  . ILE A 1 187 ? 28.379 -8.872  30.412  1.00 20.17  ? 198  ILE A CG1  1 
ATOM   1764 C CG2  . ILE A 1 187 ? 29.469 -6.713  31.081  1.00 19.14  ? 198  ILE A CG2  1 
ATOM   1765 C CD1  . ILE A 1 187 ? 27.467 -8.929  31.629  1.00 27.10  ? 198  ILE A CD1  1 
ATOM   1766 H H    . ILE A 1 187 ? 27.528 -7.793  27.702  1.00 0.00   ? 198  ILE A H    1 
ATOM   1767 N N    . ASP A 1 188 ? 27.399 -4.275  29.788  1.00 19.62  ? 199  ASP A N    1 
ATOM   1768 C CA   . ASP A 1 188 ? 27.651 -2.865  29.478  1.00 20.32  ? 199  ASP A CA   1 
ATOM   1769 C C    . ASP A 1 188 ? 28.183 -2.091  30.658  1.00 19.01  ? 199  ASP A C    1 
ATOM   1770 O O    . ASP A 1 188 ? 27.897 -2.437  31.808  1.00 24.20  ? 199  ASP A O    1 
ATOM   1771 C CB   . ASP A 1 188 ? 26.352 -2.186  29.030  1.00 23.18  ? 199  ASP A CB   1 
ATOM   1772 C CG   . ASP A 1 188 ? 25.757 -2.790  27.782  1.00 21.86  ? 199  ASP A CG   1 
ATOM   1773 O OD1  . ASP A 1 188 ? 26.498 -2.921  26.780  1.00 26.33  ? 199  ASP A OD1  1 
ATOM   1774 O OD2  . ASP A 1 188 ? 24.552 -3.097  27.796  1.00 24.52  ? 199  ASP A OD2  1 
ATOM   1775 H H    . ASP A 1 188 ? 26.837 -4.496  30.559  1.00 0.00   ? 199  ASP A H    1 
ATOM   1776 N N    . PRO A 1 189 ? 28.940 -1.009  30.402  1.00 18.97  ? 200  PRO A N    1 
ATOM   1777 C CA   . PRO A 1 189 ? 29.465 -0.195  31.493  1.00 20.77  ? 200  PRO A CA   1 
ATOM   1778 C C    . PRO A 1 189 ? 28.361 0.570   32.221  1.00 25.01  ? 200  PRO A C    1 
ATOM   1779 O O    . PRO A 1 189 ? 27.338 0.874   31.620  1.00 30.18  ? 200  PRO A O    1 
ATOM   1780 C CB   . PRO A 1 189 ? 30.388 0.796   30.778  1.00 21.94  ? 200  PRO A CB   1 
ATOM   1781 C CG   . PRO A 1 189 ? 30.824 0.062   29.565  1.00 24.90  ? 200  PRO A CG   1 
ATOM   1782 C CD   . PRO A 1 189 ? 29.564 -0.633  29.116  1.00 20.22  ? 200  PRO A CD   1 
ATOM   1783 N N    . THR A 1 190 ? 28.545 0.840   33.515  1.00 26.82  ? 201  THR A N    1 
ATOM   1784 C CA   . THR A 1 190 ? 27.592 1.636   34.311  1.00 26.04  ? 201  THR A CA   1 
ATOM   1785 C C    . THR A 1 190 ? 27.769 3.072   33.775  1.00 23.92  ? 201  THR A C    1 
ATOM   1786 O O    . THR A 1 190 ? 28.695 3.301   33.002  1.00 26.08  ? 201  THR A O    1 
ATOM   1787 C CB   . THR A 1 190 ? 27.982 1.605   35.819  1.00 27.93  ? 201  THR A CB   1 
ATOM   1788 O OG1  . THR A 1 190 ? 29.323 2.082   35.965  1.00 31.64  ? 201  THR A OG1  1 
ATOM   1789 C CG2  . THR A 1 190 ? 27.897 0.190   36.395  1.00 24.44  ? 201  THR A CG2  1 
ATOM   1790 H H    . THR A 1 190 ? 29.347 0.498   33.955  1.00 0.00   ? 201  THR A H    1 
ATOM   1791 H HG1  . THR A 1 190 ? 29.571 2.075   36.892  1.00 0.00   ? 201  THR A HG1  1 
ATOM   1792 N N    . LEU A 1 191 ? 26.901 4.024   34.126  1.00 27.19  ? 202  LEU A N    1 
ATOM   1793 C CA   . LEU A 1 191 ? 27.132 5.389   33.620  1.00 32.20  ? 202  LEU A CA   1 
ATOM   1794 C C    . LEU A 1 191 ? 28.446 5.955   34.171  1.00 32.12  ? 202  LEU A C    1 
ATOM   1795 O O    . LEU A 1 191 ? 29.119 6.729   33.490  1.00 33.15  ? 202  LEU A O    1 
ATOM   1796 C CB   . LEU A 1 191 ? 25.983 6.355   33.950  1.00 33.76  ? 202  LEU A CB   1 
ATOM   1797 C CG   . LEU A 1 191 ? 25.487 7.280   32.817  1.00 38.35  ? 202  LEU A CG   1 
ATOM   1798 C CD1  . LEU A 1 191 ? 25.050 8.561   33.462  1.00 40.32  ? 202  LEU A CD1  1 
ATOM   1799 C CD2  . LEU A 1 191 ? 26.531 7.572   31.734  1.00 39.14  ? 202  LEU A CD2  1 
ATOM   1800 H H    . LEU A 1 191 ? 26.135 3.823   34.702  1.00 0.00   ? 202  LEU A H    1 
ATOM   1801 N N    . GLU A 1 192 ? 28.755 5.640   35.432  1.00 33.30  ? 203  GLU A N    1 
ATOM   1802 C CA   . GLU A 1 192 ? 30.003 6.099   36.032  1.00 35.83  ? 203  GLU A CA   1 
ATOM   1803 C C    . GLU A 1 192 ? 31.166 5.611   35.186  1.00 31.00  ? 203  GLU A C    1 
ATOM   1804 O O    . GLU A 1 192 ? 32.087 6.376   34.889  1.00 33.63  ? 203  GLU A O    1 
ATOM   1805 C CB   . GLU A 1 192 ? 30.151 5.643   37.500  1.00 43.84  ? 203  GLU A CB   1 
ATOM   1806 C CG   . GLU A 1 192 ? 29.388 6.541   38.469  1.00 58.60  ? 203  GLU A CG   1 
ATOM   1807 C CD   . GLU A 1 192 ? 29.721 6.334   39.946  1.00 64.51  ? 203  GLU A CD   1 
ATOM   1808 O OE1  . GLU A 1 192 ? 30.895 6.076   40.302  1.00 66.62  ? 203  GLU A OE1  1 
ATOM   1809 O OE2  . GLU A 1 192 ? 28.787 6.490   40.759  1.00 69.56  ? 203  GLU A OE2  1 
ATOM   1810 H H    . GLU A 1 192 ? 28.136 5.092   35.959  1.00 0.00   ? 203  GLU A H    1 
ATOM   1811 N N    . GLN A 1 193 ? 31.113 4.346   34.777  1.00 25.98  ? 204  GLN A N    1 
ATOM   1812 C CA   . GLN A 1 193 ? 32.173 3.804   33.940  1.00 23.24  ? 204  GLN A CA   1 
ATOM   1813 C C    . GLN A 1 193 ? 32.207 4.506   32.602  1.00 24.18  ? 204  GLN A C    1 
ATOM   1814 O O    . GLN A 1 193 ? 33.280 4.684   32.020  1.00 22.13  ? 204  GLN A O    1 
ATOM   1815 C CB   . GLN A 1 193 ? 32.031 2.298   33.775  1.00 25.11  ? 204  GLN A CB   1 
ATOM   1816 C CG   . GLN A 1 193 ? 32.481 1.592   35.018  1.00 29.15  ? 204  GLN A CG   1 
ATOM   1817 C CD   . GLN A 1 193 ? 32.131 0.143   35.045  1.00 30.79  ? 204  GLN A CD   1 
ATOM   1818 O OE1  . GLN A 1 193 ? 31.094 -0.280  34.532  1.00 35.03  ? 204  GLN A OE1  1 
ATOM   1819 N NE2  . GLN A 1 193 ? 32.980 -0.643  35.684  1.00 36.26  ? 204  GLN A NE2  1 
ATOM   1820 H H    . GLN A 1 193 ? 30.356 3.781   35.035  1.00 0.00   ? 204  GLN A H    1 
ATOM   1821 H HE21 . GLN A 1 193 ? 33.773 -0.239  36.094  1.00 0.00   ? 204  GLN A HE21 1 
ATOM   1822 H HE22 . GLN A 1 193 ? 32.780 -1.601  35.720  1.00 0.00   ? 204  GLN A HE22 1 
ATOM   1823 N N    . TRP A 1 194 ? 31.039 4.905   32.099  1.00 22.62  ? 205  TRP A N    1 
ATOM   1824 C CA   . TRP A 1 194 ? 31.029 5.628   30.842  1.00 24.11  ? 205  TRP A CA   1 
ATOM   1825 C C    . TRP A 1 194 ? 31.681 7.001   30.994  1.00 24.95  ? 205  TRP A C    1 
ATOM   1826 O O    . TRP A 1 194 ? 32.390 7.428   30.092  1.00 21.47  ? 205  TRP A O    1 
ATOM   1827 C CB   . TRP A 1 194 ? 29.628 5.765   30.251  1.00 24.07  ? 205  TRP A CB   1 
ATOM   1828 C CG   . TRP A 1 194 ? 29.117 4.533   29.542  1.00 21.45  ? 205  TRP A CG   1 
ATOM   1829 C CD1  . TRP A 1 194 ? 28.030 3.795   29.898  1.00 25.04  ? 205  TRP A CD1  1 
ATOM   1830 C CD2  . TRP A 1 194 ? 29.600 3.955   28.313  1.00 23.19  ? 205  TRP A CD2  1 
ATOM   1831 N NE1  . TRP A 1 194 ? 27.795 2.824   28.975  1.00 22.54  ? 205  TRP A NE1  1 
ATOM   1832 C CE2  . TRP A 1 194 ? 28.736 2.890   27.989  1.00 21.78  ? 205  TRP A CE2  1 
ATOM   1833 C CE3  . TRP A 1 194 ? 30.672 4.244   27.457  1.00 23.10  ? 205  TRP A CE3  1 
ATOM   1834 C CZ2  . TRP A 1 194 ? 28.908 2.094   26.824  1.00 23.95  ? 205  TRP A CZ2  1 
ATOM   1835 C CZ3  . TRP A 1 194 ? 30.847 3.466   26.308  1.00 25.63  ? 205  TRP A CZ3  1 
ATOM   1836 C CH2  . TRP A 1 194 ? 29.963 2.399   26.001  1.00 27.33  ? 205  TRP A CH2  1 
ATOM   1837 H H    . TRP A 1 194 ? 30.202 4.719   32.571  1.00 0.00   ? 205  TRP A H    1 
ATOM   1838 H HE1  . TRP A 1 194 ? 27.060 2.178   29.019  1.00 0.00   ? 205  TRP A HE1  1 
ATOM   1839 N N    . GLN A 1 195 ? 31.446 7.698   32.110  1.00 26.56  ? 206  GLN A N    1 
ATOM   1840 C CA   . GLN A 1 195 ? 32.082 9.013   32.292  1.00 30.99  ? 206  GLN A CA   1 
ATOM   1841 C C    . GLN A 1 195 ? 33.593 8.850   32.442  1.00 27.42  ? 206  GLN A C    1 
ATOM   1842 O O    . GLN A 1 195 ? 34.362 9.700   31.996  1.00 30.52  ? 206  GLN A O    1 
ATOM   1843 C CB   . GLN A 1 195 ? 31.543 9.761   33.521  1.00 34.90  ? 206  GLN A CB   1 
ATOM   1844 C CG   . GLN A 1 195 ? 30.155 10.349  33.368  1.00 43.55  ? 206  GLN A CG   1 
ATOM   1845 C CD   . GLN A 1 195 ? 29.344 10.187  34.626  1.00 50.41  ? 206  GLN A CD   1 
ATOM   1846 O OE1  . GLN A 1 195 ? 29.891 9.995   35.719  1.00 56.20  ? 206  GLN A OE1  1 
ATOM   1847 N NE2  . GLN A 1 195 ? 28.027 10.239  34.493  1.00 52.55  ? 206  GLN A NE2  1 
ATOM   1848 H H    . GLN A 1 195 ? 30.873 7.333   32.811  1.00 0.00   ? 206  GLN A H    1 
ATOM   1849 H HE21 . GLN A 1 195 ? 27.653 10.378  33.598  1.00 0.00   ? 206  GLN A HE21 1 
ATOM   1850 H HE22 . GLN A 1 195 ? 27.479 10.136  35.299  1.00 0.00   ? 206  GLN A HE22 1 
ATOM   1851 N N    . THR A 1 196 ? 34.008 7.783   33.120  1.00 27.15  ? 207  THR A N    1 
ATOM   1852 C CA   . THR A 1 196 ? 35.422 7.512   33.325  1.00 27.08  ? 207  THR A CA   1 
ATOM   1853 C C    . THR A 1 196 ? 36.066 7.321   31.954  1.00 26.41  ? 207  THR A C    1 
ATOM   1854 O O    . THR A 1 196 ? 37.085 7.941   31.639  1.00 27.52  ? 207  THR A O    1 
ATOM   1855 C CB   . THR A 1 196 ? 35.600 6.276   34.239  1.00 29.17  ? 207  THR A CB   1 
ATOM   1856 O OG1  . THR A 1 196 ? 35.000 6.564   35.507  1.00 28.63  ? 207  THR A OG1  1 
ATOM   1857 C CG2  . THR A 1 196 ? 37.076 5.946   34.442  1.00 28.85  ? 207  THR A CG2  1 
ATOM   1858 H H    . THR A 1 196 ? 33.345 7.160   33.479  1.00 0.00   ? 207  THR A H    1 
ATOM   1859 H HG1  . THR A 1 196 ? 35.089 5.803   36.085  1.00 0.00   ? 207  THR A HG1  1 
ATOM   1860 N N    . LEU A 1 197 ? 35.410 6.523   31.116  1.00 26.59  ? 208  LEU A N    1 
ATOM   1861 C CA   . LEU A 1 197 ? 35.872 6.283   29.761  1.00 22.91  ? 208  LEU A CA   1 
ATOM   1862 C C    . LEU A 1 197 ? 35.903 7.569   28.934  1.00 24.74  ? 208  LEU A C    1 
ATOM   1863 O O    . LEU A 1 197 ? 36.811 7.766   28.132  1.00 27.49  ? 208  LEU A O    1 
ATOM   1864 C CB   . LEU A 1 197 ? 34.981 5.236   29.086  1.00 24.70  ? 208  LEU A CB   1 
ATOM   1865 C CG   . LEU A 1 197 ? 35.188 3.829   29.627  1.00 23.42  ? 208  LEU A CG   1 
ATOM   1866 C CD1  . LEU A 1 197 ? 34.134 2.880   29.095  1.00 21.59  ? 208  LEU A CD1  1 
ATOM   1867 C CD2  . LEU A 1 197 ? 36.573 3.373   29.232  1.00 25.43  ? 208  LEU A CD2  1 
ATOM   1868 H H    . LEU A 1 197 ? 34.586 6.097   31.422  1.00 0.00   ? 208  LEU A H    1 
ATOM   1869 N N    . ALA A 1 198 ? 34.911 8.437   29.126  1.00 24.30  ? 209  ALA A N    1 
ATOM   1870 C CA   . ALA A 1 198 ? 34.848 9.684   28.370  1.00 24.13  ? 209  ALA A CA   1 
ATOM   1871 C C    . ALA A 1 198 ? 35.989 10.627  28.710  1.00 27.91  ? 209  ALA A C    1 
ATOM   1872 O O    . ALA A 1 198 ? 36.516 11.307  27.822  1.00 27.31  ? 209  ALA A O    1 
ATOM   1873 C CB   . ALA A 1 198 ? 33.514 10.390  28.607  1.00 25.56  ? 209  ALA A CB   1 
ATOM   1874 H H    . ALA A 1 198 ? 34.225 8.241   29.795  1.00 0.00   ? 209  ALA A H    1 
ATOM   1875 N N    . GLN A 1 199 ? 36.350 10.708  29.992  1.00 28.56  ? 210  GLN A N    1 
ATOM   1876 C CA   . GLN A 1 199 ? 37.437 11.597  30.378  1.00 32.68  ? 210  GLN A CA   1 
ATOM   1877 C C    . GLN A 1 199 ? 38.764 10.997  29.924  1.00 32.46  ? 210  GLN A C    1 
ATOM   1878 O O    . GLN A 1 199 ? 39.627 11.707  29.403  1.00 33.60  ? 210  GLN A O    1 
ATOM   1879 C CB   . GLN A 1 199 ? 37.418 11.924  31.883  1.00 39.26  ? 210  GLN A CB   1 
ATOM   1880 C CG   . GLN A 1 199 ? 37.884 10.831  32.833  1.00 48.81  ? 210  GLN A CG   1 
ATOM   1881 C CD   . GLN A 1 199 ? 37.304 10.963  34.236  1.00 52.16  ? 210  GLN A CD   1 
ATOM   1882 O OE1  . GLN A 1 199 ? 37.811 10.362  35.189  1.00 50.81  ? 210  GLN A OE1  1 
ATOM   1883 N NE2  . GLN A 1 199 ? 36.217 11.722  34.367  1.00 55.00  ? 210  GLN A NE2  1 
ATOM   1884 H H    . GLN A 1 199 ? 35.895 10.166  30.667  1.00 0.00   ? 210  GLN A H    1 
ATOM   1885 H HE21 . GLN A 1 199 ? 35.808 12.168  33.598  1.00 0.00   ? 210  GLN A HE21 1 
ATOM   1886 H HE22 . GLN A 1 199 ? 35.855 11.808  35.274  1.00 0.00   ? 210  GLN A HE22 1 
ATOM   1887 N N    . LEU A 1 200 ? 38.895 9.681   30.052  1.00 29.70  ? 211  LEU A N    1 
ATOM   1888 C CA   . LEU A 1 200 ? 40.107 9.010   29.621  1.00 28.59  ? 211  LEU A CA   1 
ATOM   1889 C C    . LEU A 1 200 ? 40.400 9.235   28.126  1.00 29.29  ? 211  LEU A C    1 
ATOM   1890 O O    . LEU A 1 200 ? 41.510 9.629   27.779  1.00 28.89  ? 211  LEU A O    1 
ATOM   1891 C CB   . LEU A 1 200 ? 40.019 7.518   29.945  1.00 31.10  ? 211  LEU A CB   1 
ATOM   1892 C CG   . LEU A 1 200 ? 41.266 6.652   29.774  1.00 32.87  ? 211  LEU A CG   1 
ATOM   1893 C CD1  . LEU A 1 200 ? 42.395 7.169   30.651  1.00 33.29  ? 211  LEU A CD1  1 
ATOM   1894 C CD2  . LEU A 1 200 ? 40.915 5.221   30.143  1.00 29.56  ? 211  LEU A CD2  1 
ATOM   1895 H H    . LEU A 1 200 ? 38.160 9.161   30.432  1.00 0.00   ? 211  LEU A H    1 
ATOM   1896 N N    . SER A 1 201 ? 39.411 9.030   27.251  1.00 28.63  ? 212  SER A N    1 
ATOM   1897 C CA   . SER A 1 201 ? 39.639 9.213   25.811  1.00 28.09  ? 212  SER A CA   1 
ATOM   1898 C C    . SER A 1 201 ? 39.941 10.642  25.401  1.00 25.64  ? 212  SER A C    1 
ATOM   1899 O O    . SER A 1 201 ? 40.659 10.879  24.422  1.00 24.89  ? 212  SER A O    1 
ATOM   1900 C CB   . SER A 1 201 ? 38.456 8.689   24.976  1.00 29.88  ? 212  SER A CB   1 
ATOM   1901 O OG   . SER A 1 201 ? 37.226 9.221   25.410  1.00 36.41  ? 212  SER A OG   1 
ATOM   1902 H H    . SER A 1 201 ? 38.527 8.763   27.574  1.00 0.00   ? 212  SER A H    1 
ATOM   1903 H HG   . SER A 1 201 ? 36.524 8.895   24.845  1.00 0.00   ? 212  SER A HG   1 
ATOM   1904 N N    . VAL A 1 202 ? 39.377 11.599  26.126  1.00 26.12  ? 213  VAL A N    1 
ATOM   1905 C CA   . VAL A 1 202 ? 39.598 12.998  25.800  1.00 31.71  ? 213  VAL A CA   1 
ATOM   1906 C C    . VAL A 1 202 ? 41.033 13.372  26.158  1.00 32.32  ? 213  VAL A C    1 
ATOM   1907 O O    . VAL A 1 202 ? 41.702 14.120  25.446  1.00 32.12  ? 213  VAL A O    1 
ATOM   1908 C CB   . VAL A 1 202 ? 38.573 13.907  26.535  1.00 32.57  ? 213  VAL A CB   1 
ATOM   1909 C CG1  . VAL A 1 202 ? 38.949 14.167  27.984  1.00 39.62  ? 213  VAL A CG1  1 
ATOM   1910 C CG2  . VAL A 1 202 ? 38.404 15.181  25.772  1.00 39.00  ? 213  VAL A CG2  1 
ATOM   1911 H H    . VAL A 1 202 ? 38.809 11.361  26.888  1.00 0.00   ? 213  VAL A H    1 
ATOM   1912 N N    . GLU A 1 203 ? 41.521 12.700  27.189  1.00 31.49  ? 214  GLU A N    1 
ATOM   1913 C CA   . GLU A 1 203 ? 42.847 12.876  27.729  1.00 32.99  ? 214  GLU A CA   1 
ATOM   1914 C C    . GLU A 1 203 ? 43.910 12.155  26.877  1.00 28.91  ? 214  GLU A C    1 
ATOM   1915 O O    . GLU A 1 203 ? 44.980 12.707  26.614  1.00 31.18  ? 214  GLU A O    1 
ATOM   1916 C CB   . GLU A 1 203 ? 42.780 12.317  29.127  1.00 36.47  ? 214  GLU A CB   1 
ATOM   1917 C CG   . GLU A 1 203 ? 43.755 12.799  30.121  1.00 45.96  ? 214  GLU A CG   1 
ATOM   1918 C CD   . GLU A 1 203 ? 43.595 11.973  31.366  1.00 54.38  ? 214  GLU A CD   1 
ATOM   1919 O OE1  . GLU A 1 203 ? 42.658 12.248  32.146  1.00 56.05  ? 214  GLU A OE1  1 
ATOM   1920 O OE2  . GLU A 1 203 ? 44.346 10.987  31.503  1.00 57.81  ? 214  GLU A OE2  1 
ATOM   1921 H H    . GLU A 1 203 ? 40.941 12.034  27.614  1.00 0.00   ? 214  GLU A H    1 
ATOM   1922 N N    . LYS A 1 204 ? 43.609 10.934  26.429  1.00 28.17  ? 215  LYS A N    1 
ATOM   1923 C CA   . LYS A 1 204 ? 44.557 10.165  25.611  1.00 24.27  ? 215  LYS A CA   1 
ATOM   1924 C C    . LYS A 1 204 ? 44.517 10.482  24.111  1.00 22.03  ? 215  LYS A C    1 
ATOM   1925 O O    . LYS A 1 204 ? 45.280 9.905   23.334  1.00 20.89  ? 215  LYS A O    1 
ATOM   1926 C CB   . LYS A 1 204 ? 44.348 8.661   25.808  1.00 26.44  ? 215  LYS A CB   1 
ATOM   1927 C CG   . LYS A 1 204 ? 44.590 8.164   27.217  1.00 34.72  ? 215  LYS A CG   1 
ATOM   1928 C CD   . LYS A 1 204 ? 46.048 7.814   27.429  1.00 46.29  ? 215  LYS A CD   1 
ATOM   1929 C CE   . LYS A 1 204 ? 46.303 7.308   28.837  1.00 50.31  ? 215  LYS A CE   1 
ATOM   1930 N NZ   . LYS A 1 204 ? 46.247 8.410   29.839  1.00 57.48  ? 215  LYS A NZ   1 
ATOM   1931 H H    . LYS A 1 204 ? 42.732 10.556  26.622  1.00 0.00   ? 215  LYS A H    1 
ATOM   1932 H HZ1  . LYS A 1 204 ? 45.306 8.853   29.815  1.00 0.00   ? 215  LYS A HZ1  1 
ATOM   1933 H HZ2  . LYS A 1 204 ? 46.424 8.025   30.789  1.00 0.00   ? 215  LYS A HZ2  1 
ATOM   1934 H HZ3  . LYS A 1 204 ? 46.971 9.122   29.612  1.00 0.00   ? 215  LYS A HZ3  1 
ATOM   1935 N N    . GLY A 1 205 ? 43.574 11.331  23.701  1.00 21.09  ? 216  GLY A N    1 
ATOM   1936 C CA   . GLY A 1 205 ? 43.470 11.722  22.298  1.00 21.05  ? 216  GLY A CA   1 
ATOM   1937 C C    . GLY A 1 205 ? 42.847 10.733  21.315  1.00 20.94  ? 216  GLY A C    1 
ATOM   1938 O O    . GLY A 1 205 ? 43.120 10.789  20.114  1.00 23.18  ? 216  GLY A O    1 
ATOM   1939 H H    . GLY A 1 205 ? 42.938 11.698  24.350  1.00 0.00   ? 216  GLY A H    1 
ATOM   1940 N N    . TRP A 1 206 ? 41.986 9.857   21.820  1.00 20.84  ? 217  TRP A N    1 
ATOM   1941 C CA   . TRP A 1 206 ? 41.302 8.854   21.003  1.00 18.32  ? 217  TRP A CA   1 
ATOM   1942 C C    . TRP A 1 206 ? 40.101 9.450   20.283  1.00 20.59  ? 217  TRP A C    1 
ATOM   1943 O O    . TRP A 1 206 ? 39.540 10.435  20.752  1.00 21.68  ? 217  TRP A O    1 
ATOM   1944 C CB   . TRP A 1 206 ? 40.742 7.751   21.901  1.00 18.50  ? 217  TRP A CB   1 
ATOM   1945 C CG   . TRP A 1 206 ? 41.749 7.100   22.787  1.00 23.69  ? 217  TRP A CG   1 
ATOM   1946 C CD1  . TRP A 1 206 ? 43.086 7.006   22.559  1.00 27.00  ? 217  TRP A CD1  1 
ATOM   1947 C CD2  . TRP A 1 206 ? 41.513 6.427   24.040  1.00 25.24  ? 217  TRP A CD2  1 
ATOM   1948 N NE1  . TRP A 1 206 ? 43.688 6.327   23.571  1.00 27.36  ? 217  TRP A NE1  1 
ATOM   1949 C CE2  . TRP A 1 206 ? 42.756 5.955   24.496  1.00 26.51  ? 217  TRP A CE2  1 
ATOM   1950 C CE3  . TRP A 1 206 ? 40.368 6.180   24.812  1.00 24.97  ? 217  TRP A CE3  1 
ATOM   1951 C CZ2  . TRP A 1 206 ? 42.901 5.236   25.718  1.00 29.43  ? 217  TRP A CZ2  1 
ATOM   1952 C CZ3  . TRP A 1 206 ? 40.498 5.477   26.011  1.00 26.18  ? 217  TRP A CZ3  1 
ATOM   1953 C CH2  . TRP A 1 206 ? 41.765 5.010   26.454  1.00 29.51  ? 217  TRP A CH2  1 
ATOM   1954 H H    . TRP A 1 206 ? 41.804 9.884   22.782  1.00 0.00   ? 217  TRP A H    1 
ATOM   1955 H HE1  . TRP A 1 206 ? 44.648 6.136   23.622  1.00 0.00   ? 217  TRP A HE1  1 
ATOM   1956 N N    . LEU A 1 207 ? 39.747 8.882   19.129  1.00 19.79  ? 218  LEU A N    1 
ATOM   1957 C CA   . LEU A 1 207 ? 38.543 9.302   18.409  1.00 15.08  ? 218  LEU A CA   1 
ATOM   1958 C C    . LEU A 1 207 ? 37.511 8.192   18.643  1.00 15.39  ? 218  LEU A C    1 
ATOM   1959 O O    . LEU A 1 207 ? 37.699 7.064   18.170  1.00 15.81  ? 218  LEU A O    1 
ATOM   1960 C CB   . LEU A 1 207 ? 38.794 9.468   16.903  1.00 16.41  ? 218  LEU A CB   1 
ATOM   1961 C CG   . LEU A 1 207 ? 37.565 9.851   16.059  1.00 16.92  ? 218  LEU A CG   1 
ATOM   1962 C CD1  . LEU A 1 207 ? 37.177 11.299  16.315  1.00 19.72  ? 218  LEU A CD1  1 
ATOM   1963 C CD2  . LEU A 1 207 ? 37.863 9.643   14.589  1.00 20.97  ? 218  LEU A CD2  1 
ATOM   1964 H H    . LEU A 1 207 ? 40.293 8.173   18.750  1.00 0.00   ? 218  LEU A H    1 
ATOM   1965 N N    . PRO A 1 208 ? 36.420 8.485   19.377  1.00 14.98  ? 219  PRO A N    1 
ATOM   1966 C CA   . PRO A 1 208 ? 35.398 7.479   19.642  1.00 13.55  ? 219  PRO A CA   1 
ATOM   1967 C C    . PRO A 1 208 ? 34.519 7.227   18.435  1.00 14.27  ? 219  PRO A C    1 
ATOM   1968 O O    . PRO A 1 208 ? 34.127 8.162   17.737  1.00 13.07  ? 219  PRO A O    1 
ATOM   1969 C CB   . PRO A 1 208 ? 34.556 8.096   20.754  1.00 10.16  ? 219  PRO A CB   1 
ATOM   1970 C CG   . PRO A 1 208 ? 35.347 9.232   21.261  1.00 13.72  ? 219  PRO A CG   1 
ATOM   1971 C CD   . PRO A 1 208 ? 36.068 9.746   20.055  1.00 12.31  ? 219  PRO A CD   1 
ATOM   1972 N N    . LEU A 1 209 ? 34.248 5.953   18.185  1.00 16.74  ? 220  LEU A N    1 
ATOM   1973 C CA   . LEU A 1 209 ? 33.375 5.526   17.104  1.00 18.05  ? 220  LEU A CA   1 
ATOM   1974 C C    . LEU A 1 209 ? 32.368 4.643   17.821  1.00 17.82  ? 220  LEU A C    1 
ATOM   1975 O O    . LEU A 1 209 ? 32.747 3.635   18.414  1.00 20.09  ? 220  LEU A O    1 
ATOM   1976 C CB   . LEU A 1 209 ? 34.133 4.691   16.078  1.00 12.51  ? 220  LEU A CB   1 
ATOM   1977 C CG   . LEU A 1 209 ? 33.600 4.705   14.640  1.00 14.27  ? 220  LEU A CG   1 
ATOM   1978 C CD1  . LEU A 1 209 ? 34.443 3.807   13.766  1.00 20.41  ? 220  LEU A CD1  1 
ATOM   1979 C CD2  . LEU A 1 209 ? 32.146 4.287   14.565  1.00 21.51  ? 220  LEU A CD2  1 
ATOM   1980 H H    . LEU A 1 209 ? 34.649 5.269   18.757  1.00 0.00   ? 220  LEU A H    1 
ATOM   1981 N N    . PHE A 1 210 ? 31.109 5.062   17.854  1.00 16.33  ? 221  PHE A N    1 
ATOM   1982 C CA   . PHE A 1 210 ? 30.085 4.252   18.505  1.00 14.37  ? 221  PHE A CA   1 
ATOM   1983 C C    . PHE A 1 210 ? 29.282 3.420   17.504  1.00 12.79  ? 221  PHE A C    1 
ATOM   1984 O O    . PHE A 1 210 ? 28.901 3.930   16.454  1.00 16.91  ? 221  PHE A O    1 
ATOM   1985 C CB   . PHE A 1 210 ? 29.098 5.144   19.257  1.00 15.65  ? 221  PHE A CB   1 
ATOM   1986 C CG   . PHE A 1 210 ? 29.538 5.521   20.632  1.00 20.46  ? 221  PHE A CG   1 
ATOM   1987 C CD1  . PHE A 1 210 ? 30.400 6.595   20.834  1.00 21.33  ? 221  PHE A CD1  1 
ATOM   1988 C CD2  . PHE A 1 210 ? 29.072 4.818   21.738  1.00 21.67  ? 221  PHE A CD2  1 
ATOM   1989 C CE1  . PHE A 1 210 ? 30.789 6.968   22.113  1.00 21.72  ? 221  PHE A CE1  1 
ATOM   1990 C CE2  . PHE A 1 210 ? 29.452 5.177   23.023  1.00 18.89  ? 221  PHE A CE2  1 
ATOM   1991 C CZ   . PHE A 1 210 ? 30.314 6.259   23.212  1.00 21.59  ? 221  PHE A CZ   1 
ATOM   1992 H H    . PHE A 1 210 ? 30.862 5.915   17.445  1.00 0.00   ? 221  PHE A H    1 
ATOM   1993 N N    . ASP A 1 211 ? 29.121 2.125   17.784  1.00 13.71  ? 222  ASP A N    1 
ATOM   1994 C CA   . ASP A 1 211 ? 28.269 1.251   16.967  1.00 14.12  ? 222  ASP A CA   1 
ATOM   1995 C C    . ASP A 1 211 ? 27.014 1.160   17.848  1.00 13.39  ? 222  ASP A C    1 
ATOM   1996 O O    . ASP A 1 211 ? 27.053 0.549   18.905  1.00 16.41  ? 222  ASP A O    1 
ATOM   1997 C CB   . ASP A 1 211 ? 28.893 -0.148  16.774  1.00 14.18  ? 222  ASP A CB   1 
ATOM   1998 C CG   . ASP A 1 211 ? 28.122 -1.010  15.767  1.00 13.79  ? 222  ASP A CG   1 
ATOM   1999 O OD1  . ASP A 1 211 ? 26.933 -0.732  15.500  1.00 16.61  ? 222  ASP A OD1  1 
ATOM   2000 O OD2  . ASP A 1 211 ? 28.709 -1.968  15.237  1.00 11.71  ? 222  ASP A OD2  1 
ATOM   2001 H H    . ASP A 1 211 ? 29.575 1.733   18.549  1.00 0.00   ? 222  ASP A H    1 
ATOM   2002 N N    . PHE A 1 212 ? 25.936 1.822   17.429  1.00 16.11  ? 223  PHE A N    1 
ATOM   2003 C CA   . PHE A 1 212 ? 24.656 1.900   18.166  1.00 16.90  ? 223  PHE A CA   1 
ATOM   2004 C C    . PHE A 1 212 ? 23.603 1.159   17.331  1.00 15.61  ? 223  PHE A C    1 
ATOM   2005 O O    . PHE A 1 212 ? 22.998 1.753   16.440  1.00 17.35  ? 223  PHE A O    1 
ATOM   2006 C CB   . PHE A 1 212 ? 24.264 3.381   18.225  1.00 20.06  ? 223  PHE A CB   1 
ATOM   2007 C CG   . PHE A 1 212 ? 23.707 3.876   19.545  1.00 24.74  ? 223  PHE A CG   1 
ATOM   2008 C CD1  . PHE A 1 212 ? 23.086 3.046   20.490  1.00 30.40  ? 223  PHE A CD1  1 
ATOM   2009 C CD2  . PHE A 1 212 ? 23.748 5.247   19.794  1.00 31.90  ? 223  PHE A CD2  1 
ATOM   2010 C CE1  . PHE A 1 212 ? 22.513 3.607   21.661  1.00 34.37  ? 223  PHE A CE1  1 
ATOM   2011 C CE2  . PHE A 1 212 ? 23.188 5.797   20.929  1.00 31.47  ? 223  PHE A CE2  1 
ATOM   2012 C CZ   . PHE A 1 212 ? 22.565 4.988   21.872  1.00 31.64  ? 223  PHE A CZ   1 
ATOM   2013 H H    . PHE A 1 212 ? 25.998 2.292   16.578  1.00 0.00   ? 223  PHE A H    1 
ATOM   2014 N N    . ALA A 1 213 ? 23.363 -0.109  17.646  1.00 15.23  ? 224  ALA A N    1 
ATOM   2015 C CA   . ALA A 1 213 ? 22.422 -0.939  16.888  1.00 14.45  ? 224  ALA A CA   1 
ATOM   2016 C C    . ALA A 1 213 ? 21.220 -1.445  17.674  1.00 13.86  ? 224  ALA A C    1 
ATOM   2017 O O    . ALA A 1 213 ? 20.323 -2.074  17.103  1.00 13.74  ? 224  ALA A O    1 
ATOM   2018 C CB   . ALA A 1 213 ? 23.159 -2.130  16.301  1.00 10.67  ? 224  ALA A CB   1 
ATOM   2019 H H    . ALA A 1 213 ? 23.830 -0.503  18.412  1.00 0.00   ? 224  ALA A H    1 
ATOM   2020 N N    . TYR A 1 214 ? 21.199 -1.172  18.974  1.00 12.55  ? 225  TYR A N    1 
ATOM   2021 C CA   . TYR A 1 214 ? 20.136 -1.649  19.841  1.00 11.67  ? 225  TYR A CA   1 
ATOM   2022 C C    . TYR A 1 214 ? 19.567 -0.579  20.743  1.00 10.36  ? 225  TYR A C    1 
ATOM   2023 O O    . TYR A 1 214 ? 19.269 -0.844  21.912  1.00 16.18  ? 225  TYR A O    1 
ATOM   2024 C CB   . TYR A 1 214 ? 20.671 -2.792  20.699  1.00 14.72  ? 225  TYR A CB   1 
ATOM   2025 C CG   . TYR A 1 214 ? 20.873 -4.062  19.930  1.00 18.46  ? 225  TYR A CG   1 
ATOM   2026 C CD1  . TYR A 1 214 ? 19.779 -4.799  19.493  1.00 16.66  ? 225  TYR A CD1  1 
ATOM   2027 C CD2  . TYR A 1 214 ? 22.152 -4.519  19.594  1.00 17.66  ? 225  TYR A CD2  1 
ATOM   2028 C CE1  . TYR A 1 214 ? 19.939 -5.948  18.743  1.00 21.34  ? 225  TYR A CE1  1 
ATOM   2029 C CE2  . TYR A 1 214 ? 22.322 -5.678  18.837  1.00 18.07  ? 225  TYR A CE2  1 
ATOM   2030 C CZ   . TYR A 1 214 ? 21.207 -6.381  18.416  1.00 21.48  ? 225  TYR A CZ   1 
ATOM   2031 O OH   . TYR A 1 214 ? 21.328 -7.512  17.648  1.00 26.06  ? 225  TYR A OH   1 
ATOM   2032 H H    . TYR A 1 214 ? 21.920 -0.633  19.360  1.00 0.00   ? 225  TYR A H    1 
ATOM   2033 H HH   . TYR A 1 214 ? 22.256 -7.701  17.491  1.00 0.00   ? 225  TYR A HH   1 
ATOM   2034 N N    . GLN A 1 215 ? 19.421 0.631   20.212  1.00 13.63  ? 226  GLN A N    1 
ATOM   2035 C CA   . GLN A 1 215 ? 18.886 1.714   21.018  1.00 13.72  ? 226  GLN A CA   1 
ATOM   2036 C C    . GLN A 1 215 ? 17.441 1.382   21.347  1.00 17.04  ? 226  GLN A C    1 
ATOM   2037 O O    . GLN A 1 215 ? 16.624 1.170   20.456  1.00 15.30  ? 226  GLN A O    1 
ATOM   2038 C CB   . GLN A 1 215 ? 18.974 3.060   20.301  1.00 13.58  ? 226  GLN A CB   1 
ATOM   2039 C CG   . GLN A 1 215 ? 18.771 4.215   21.272  1.00 15.21  ? 226  GLN A CG   1 
ATOM   2040 C CD   . GLN A 1 215 ? 18.819 5.601   20.652  1.00 13.02  ? 226  GLN A CD   1 
ATOM   2041 O OE1  . GLN A 1 215 ? 18.696 6.595   21.367  1.00 17.34  ? 226  GLN A OE1  1 
ATOM   2042 N NE2  . GLN A 1 215 ? 18.985 5.689   19.334  1.00 15.36  ? 226  GLN A NE2  1 
ATOM   2043 H H    . GLN A 1 215 ? 19.674 0.791   19.279  1.00 0.00   ? 226  GLN A H    1 
ATOM   2044 H HE21 . GLN A 1 215 ? 19.074 4.889   18.778  1.00 0.00   ? 226  GLN A HE21 1 
ATOM   2045 H HE22 . GLN A 1 215 ? 19.013 6.594   18.959  1.00 0.00   ? 226  GLN A HE22 1 
ATOM   2046 N N    . GLY A 1 216 ? 17.146 1.296   22.636  1.00 16.57  ? 227  GLY A N    1 
ATOM   2047 C CA   . GLY A 1 216 ? 15.799 0.983   23.058  1.00 12.95  ? 227  GLY A CA   1 
ATOM   2048 C C    . GLY A 1 216 ? 15.596 -0.434  23.562  1.00 13.34  ? 227  GLY A C    1 
ATOM   2049 O O    . GLY A 1 216 ? 14.529 -0.736  24.087  1.00 14.01  ? 227  GLY A O    1 
ATOM   2050 H H    . GLY A 1 216 ? 17.849 1.462   23.292  1.00 0.00   ? 227  GLY A H    1 
ATOM   2051 N N    . PHE A 1 217 ? 16.595 -1.308  23.429  1.00 15.58  ? 228  PHE A N    1 
ATOM   2052 C CA   . PHE A 1 217 ? 16.424 -2.684  23.907  1.00 16.21  ? 228  PHE A CA   1 
ATOM   2053 C C    . PHE A 1 217 ? 16.854 -3.009  25.322  1.00 15.94  ? 228  PHE A C    1 
ATOM   2054 O O    . PHE A 1 217 ? 16.654 -4.138  25.777  1.00 16.91  ? 228  PHE A O    1 
ATOM   2055 C CB   . PHE A 1 217 ? 17.090 -3.686  22.979  1.00 18.16  ? 228  PHE A CB   1 
ATOM   2056 C CG   . PHE A 1 217 ? 16.292 -4.002  21.773  1.00 16.99  ? 228  PHE A CG   1 
ATOM   2057 C CD1  . PHE A 1 217 ? 16.439 -3.241  20.625  1.00 14.04  ? 228  PHE A CD1  1 
ATOM   2058 C CD2  . PHE A 1 217 ? 15.431 -5.095  21.750  1.00 19.05  ? 228  PHE A CD2  1 
ATOM   2059 C CE1  . PHE A 1 217 ? 15.754 -3.559  19.469  1.00 15.52  ? 228  PHE A CE1  1 
ATOM   2060 C CE2  . PHE A 1 217 ? 14.737 -5.426  20.595  1.00 17.48  ? 228  PHE A CE2  1 
ATOM   2061 C CZ   . PHE A 1 217 ? 14.901 -4.656  19.450  1.00 18.61  ? 228  PHE A CZ   1 
ATOM   2062 H H    . PHE A 1 217 ? 17.439 -1.032  23.017  1.00 0.00   ? 228  PHE A H    1 
ATOM   2063 N N    . ALA A 1 218 ? 17.492 -2.061  26.000  1.00 16.25  ? 229  ALA A N    1 
ATOM   2064 C CA   . ALA A 1 218 ? 17.936 -2.300  27.363  1.00 18.48  ? 229  ALA A CA   1 
ATOM   2065 C C    . ALA A 1 218 ? 16.962 -1.695  28.389  1.00 20.46  ? 229  ALA A C    1 
ATOM   2066 O O    . ALA A 1 218 ? 16.286 -2.435  29.098  1.00 22.18  ? 229  ALA A O    1 
ATOM   2067 C CB   . ALA A 1 218 ? 19.367 -1.782  27.553  1.00 13.99  ? 229  ALA A CB   1 
ATOM   2068 H H    . ALA A 1 218 ? 17.659 -1.197  25.576  1.00 0.00   ? 229  ALA A H    1 
ATOM   2069 N N    . ARG A 1 219 ? 16.855 -0.367  28.426  1.00 24.90  ? 230  ARG A N    1 
ATOM   2070 C CA   . ARG A 1 219 ? 15.929 0.307   29.348  1.00 28.89  ? 230  ARG A CA   1 
ATOM   2071 C C    . ARG A 1 219 ? 14.924 1.210   28.635  1.00 28.07  ? 230  ARG A C    1 
ATOM   2072 O O    . ARG A 1 219 ? 13.790 1.370   29.086  1.00 32.56  ? 230  ARG A O    1 
ATOM   2073 C CB   . ARG A 1 219 ? 16.671 1.170   30.373  1.00 34.31  ? 230  ARG A CB   1 
ATOM   2074 C CG   . ARG A 1 219 ? 17.131 0.460   31.634  1.00 47.38  ? 230  ARG A CG   1 
ATOM   2075 C CD   . ARG A 1 219 ? 18.436 1.087   32.103  1.00 57.76  ? 230  ARG A CD   1 
ATOM   2076 N NE   . ARG A 1 219 ? 19.407 1.039   31.012  1.00 67.97  ? 230  ARG A NE   1 
ATOM   2077 C CZ   . ARG A 1 219 ? 20.086 2.085   30.543  1.00 70.99  ? 230  ARG A CZ   1 
ATOM   2078 N NH1  . ARG A 1 219 ? 19.943 3.301   31.074  1.00 72.40  ? 230  ARG A NH1  1 
ATOM   2079 N NH2  . ARG A 1 219 ? 20.823 1.937   29.454  1.00 69.20  ? 230  ARG A NH2  1 
ATOM   2080 H H    . ARG A 1 219 ? 17.395 0.167   27.814  1.00 0.00   ? 230  ARG A H    1 
ATOM   2081 H HE   . ARG A 1 219 ? 19.574 0.171   30.588  1.00 0.00   ? 230  ARG A HE   1 
ATOM   2082 H HH11 . ARG A 1 219 ? 19.317 3.447   31.839  1.00 0.00   ? 230  ARG A HH11 1 
ATOM   2083 H HH12 . ARG A 1 219 ? 20.463 4.070   30.702  1.00 0.00   ? 230  ARG A HH12 1 
ATOM   2084 H HH21 . ARG A 1 219 ? 20.865 1.050   28.995  1.00 0.00   ? 230  ARG A HH21 1 
ATOM   2085 H HH22 . ARG A 1 219 ? 21.337 2.713   29.089  1.00 0.00   ? 230  ARG A HH22 1 
ATOM   2086 N N    . GLY A 1 220 ? 15.367 1.840   27.552  1.00 25.79  ? 231  GLY A N    1 
ATOM   2087 C CA   . GLY A 1 220 ? 14.507 2.746   26.816  1.00 22.16  ? 231  GLY A CA   1 
ATOM   2088 C C    . GLY A 1 220 ? 15.369 3.607   25.920  1.00 23.37  ? 231  GLY A C    1 
ATOM   2089 O O    . GLY A 1 220 ? 16.572 3.694   26.134  1.00 24.46  ? 231  GLY A O    1 
ATOM   2090 H H    . GLY A 1 220 ? 16.287 1.687   27.248  1.00 0.00   ? 231  GLY A H    1 
ATOM   2091 N N    . LEU A 1 221 ? 14.742 4.325   24.993  1.00 23.37  ? 233  LEU A N    1 
ATOM   2092 C CA   . LEU A 1 221 ? 15.457 5.157   24.012  1.00 24.94  ? 233  LEU A CA   1 
ATOM   2093 C C    . LEU A 1 221 ? 16.450 6.188   24.539  1.00 25.33  ? 233  LEU A C    1 
ATOM   2094 O O    . LEU A 1 221 ? 17.575 6.297   24.044  1.00 28.16  ? 233  LEU A O    1 
ATOM   2095 C CB   . LEU A 1 221 ? 14.458 5.896   23.118  1.00 23.22  ? 233  LEU A CB   1 
ATOM   2096 C CG   . LEU A 1 221 ? 13.545 5.118   22.170  1.00 25.94  ? 233  LEU A CG   1 
ATOM   2097 C CD1  . LEU A 1 221 ? 12.475 6.076   21.734  1.00 29.28  ? 233  LEU A CD1  1 
ATOM   2098 C CD2  . LEU A 1 221 ? 14.294 4.556   20.964  1.00 23.45  ? 233  LEU A CD2  1 
ATOM   2099 H H    . LEU A 1 221 ? 13.763 4.298   24.965  1.00 0.00   ? 233  LEU A H    1 
ATOM   2100 N N    . GLU A 1 222 ? 15.986 6.997   25.479  1.00 23.11  ? 234  GLU A N    1 
ATOM   2101 C CA   . GLU A 1 222 ? 16.780 8.055   26.060  1.00 24.19  ? 234  GLU A CA   1 
ATOM   2102 C C    . GLU A 1 222 ? 17.799 7.516   27.063  1.00 25.48  ? 234  GLU A C    1 
ATOM   2103 O O    . GLU A 1 222 ? 18.896 8.048   27.191  1.00 26.36  ? 234  GLU A O    1 
ATOM   2104 C CB   . GLU A 1 222 ? 15.830 9.082   26.683  1.00 28.29  ? 234  GLU A CB   1 
ATOM   2105 C CG   . GLU A 1 222 ? 14.809 9.644   25.672  1.00 34.73  ? 234  GLU A CG   1 
ATOM   2106 C CD   . GLU A 1 222 ? 15.445 10.560  24.625  1.00 41.33  ? 234  GLU A CD   1 
ATOM   2107 O OE1  . GLU A 1 222 ? 16.019 11.596  25.023  1.00 41.85  ? 234  GLU A OE1  1 
ATOM   2108 O OE2  . GLU A 1 222 ? 15.372 10.255  23.413  1.00 43.92  ? 234  GLU A OE2  1 
ATOM   2109 H H    . GLU A 1 222 ? 15.068 6.866   25.796  1.00 0.00   ? 234  GLU A H    1 
ATOM   2110 N N    . GLU A 1 223 ? 17.453 6.401   27.694  1.00 25.01  ? 235  GLU A N    1 
ATOM   2111 C CA   . GLU A 1 223 ? 18.306 5.772   28.687  1.00 28.23  ? 235  GLU A CA   1 
ATOM   2112 C C    . GLU A 1 223 ? 19.480 5.025   28.072  1.00 26.72  ? 235  GLU A C    1 
ATOM   2113 O O    . GLU A 1 223 ? 20.591 5.026   28.609  1.00 25.17  ? 235  GLU A O    1 
ATOM   2114 C CB   . GLU A 1 223 ? 17.467 4.830   29.543  1.00 33.46  ? 235  GLU A CB   1 
ATOM   2115 C CG   . GLU A 1 223 ? 16.393 5.557   30.343  1.00 44.33  ? 235  GLU A CG   1 
ATOM   2116 C CD   . GLU A 1 223 ? 14.993 5.411   29.769  1.00 51.23  ? 235  GLU A CD   1 
ATOM   2117 O OE1  . GLU A 1 223 ? 14.762 5.883   28.641  1.00 55.83  ? 235  GLU A OE1  1 
ATOM   2118 O OE2  . GLU A 1 223 ? 14.116 4.856   30.467  1.00 58.92  ? 235  GLU A OE2  1 
ATOM   2119 H H    . GLU A 1 223 ? 16.597 5.982   27.470  1.00 0.00   ? 235  GLU A H    1 
ATOM   2120 N N    . ASP A 1 224 ? 19.230 4.410   26.925  1.00 23.54  ? 236  ASP A N    1 
ATOM   2121 C CA   . ASP A 1 224 ? 20.257 3.657   26.240  1.00 21.87  ? 236  ASP A CA   1 
ATOM   2122 C C    . ASP A 1 224 ? 21.274 4.549   25.567  1.00 21.69  ? 236  ASP A C    1 
ATOM   2123 O O    . ASP A 1 224 ? 22.325 4.076   25.138  1.00 23.48  ? 236  ASP A O    1 
ATOM   2124 C CB   . ASP A 1 224 ? 19.622 2.707   25.233  1.00 16.40  ? 236  ASP A CB   1 
ATOM   2125 C CG   . ASP A 1 224 ? 18.826 1.603   25.899  1.00 11.76  ? 236  ASP A CG   1 
ATOM   2126 O OD1  . ASP A 1 224 ? 18.702 1.590   27.145  1.00 13.30  ? 236  ASP A OD1  1 
ATOM   2127 O OD2  . ASP A 1 224 ? 18.329 0.740   25.156  1.00 13.48  ? 236  ASP A OD2  1 
ATOM   2128 H H    . ASP A 1 224 ? 18.341 4.485   26.529  1.00 0.00   ? 236  ASP A H    1 
ATOM   2129 N N    . ALA A 1 225 ? 20.945 5.831   25.450  1.00 21.09  ? 237  ALA A N    1 
ATOM   2130 C CA   . ALA A 1 225 ? 21.851 6.782   24.837  1.00 21.02  ? 237  ALA A CA   1 
ATOM   2131 C C    . ALA A 1 225 ? 22.776 7.487   25.838  1.00 25.12  ? 237  ALA A C    1 
ATOM   2132 O O    . ALA A 1 225 ? 23.581 8.329   25.442  1.00 24.18  ? 237  ALA A O    1 
ATOM   2133 C CB   . ALA A 1 225 ? 21.062 7.813   24.018  1.00 13.69  ? 237  ALA A CB   1 
ATOM   2134 H H    . ALA A 1 225 ? 20.077 6.144   25.779  1.00 0.00   ? 237  ALA A H    1 
ATOM   2135 N N    . GLU A 1 226 ? 22.699 7.099   27.114  1.00 28.73  ? 238  GLU A N    1 
ATOM   2136 C CA   . GLU A 1 226 ? 23.519 7.707   28.173  1.00 32.01  ? 238  GLU A CA   1 
ATOM   2137 C C    . GLU A 1 226 ? 25.036 7.737   28.008  1.00 28.71  ? 238  GLU A C    1 
ATOM   2138 O O    . GLU A 1 226 ? 25.662 8.782   28.210  1.00 30.44  ? 238  GLU A O    1 
ATOM   2139 C CB   . GLU A 1 226 ? 23.132 7.143   29.544  1.00 36.63  ? 238  GLU A CB   1 
ATOM   2140 C CG   . GLU A 1 226 ? 21.825 7.743   29.991  1.00 44.50  ? 238  GLU A CG   1 
ATOM   2141 C CD   . GLU A 1 226 ? 21.293 7.211   31.295  1.00 51.21  ? 238  GLU A CD   1 
ATOM   2142 O OE1  . GLU A 1 226 ? 21.856 6.246   31.861  1.00 53.06  ? 238  GLU A OE1  1 
ATOM   2143 O OE2  . GLU A 1 226 ? 20.277 7.778   31.740  1.00 56.65  ? 238  GLU A OE2  1 
ATOM   2144 H H    . GLU A 1 226 ? 22.074 6.384   27.354  1.00 0.00   ? 238  GLU A H    1 
ATOM   2145 N N    . GLY A 1 227 ? 25.628 6.577   27.739  1.00 26.36  ? 239  GLY A N    1 
ATOM   2146 C CA   . GLY A 1 227 ? 27.062 6.512   27.532  1.00 21.24  ? 239  GLY A CA   1 
ATOM   2147 C C    . GLY A 1 227 ? 27.496 7.426   26.403  1.00 22.66  ? 239  GLY A C    1 
ATOM   2148 O O    . GLY A 1 227 ? 28.436 8.202   26.565  1.00 23.05  ? 239  GLY A O    1 
ATOM   2149 H H    . GLY A 1 227 ? 25.091 5.759   27.679  1.00 0.00   ? 239  GLY A H    1 
ATOM   2150 N N    . LEU A 1 228 ? 26.805 7.343   25.266  1.00 21.53  ? 240  LEU A N    1 
ATOM   2151 C CA   . LEU A 1 228 ? 27.105 8.177   24.098  1.00 21.87  ? 240  LEU A CA   1 
ATOM   2152 C C    . LEU A 1 228 ? 26.966 9.676   24.366  1.00 20.48  ? 240  LEU A C    1 
ATOM   2153 O O    . LEU A 1 228 ? 27.731 10.477  23.831  1.00 20.22  ? 240  LEU A O    1 
ATOM   2154 C CB   . LEU A 1 228 ? 26.208 7.793   22.905  1.00 22.41  ? 240  LEU A CB   1 
ATOM   2155 C CG   . LEU A 1 228 ? 26.199 8.721   21.673  1.00 24.51  ? 240  LEU A CG   1 
ATOM   2156 C CD1  . LEU A 1 228 ? 27.570 8.772   21.048  1.00 22.73  ? 240  LEU A CD1  1 
ATOM   2157 C CD2  . LEU A 1 228 ? 25.176 8.267   20.653  1.00 23.89  ? 240  LEU A CD2  1 
ATOM   2158 H H    . LEU A 1 228 ? 26.066 6.701   25.212  1.00 0.00   ? 240  LEU A H    1 
ATOM   2159 N N    . ARG A 1 229 ? 25.996 10.052  25.198  1.00 21.42  ? 241  ARG A N    1 
ATOM   2160 C CA   . ARG A 1 229 ? 25.789 11.466  25.499  1.00 20.57  ? 241  ARG A CA   1 
ATOM   2161 C C    . ARG A 1 229 ? 26.835 11.947  26.490  1.00 20.55  ? 241  ARG A C    1 
ATOM   2162 O O    . ARG A 1 229 ? 27.255 13.106  26.449  1.00 21.94  ? 241  ARG A O    1 
ATOM   2163 C CB   . ARG A 1 229 ? 24.368 11.733  26.013  1.00 24.31  ? 241  ARG A CB   1 
ATOM   2164 C CG   . ARG A 1 229 ? 23.320 11.606  24.914  1.00 25.09  ? 241  ARG A CG   1 
ATOM   2165 C CD   . ARG A 1 229 ? 21.893 11.654  25.451  1.00 30.99  ? 241  ARG A CD   1 
ATOM   2166 N NE   . ARG A 1 229 ? 20.948 11.238  24.417  1.00 34.94  ? 241  ARG A NE   1 
ATOM   2167 C CZ   . ARG A 1 229 ? 19.621 11.250  24.526  1.00 31.22  ? 241  ARG A CZ   1 
ATOM   2168 N NH1  . ARG A 1 229 ? 19.026 11.668  25.638  1.00 35.13  ? 241  ARG A NH1  1 
ATOM   2169 N NH2  . ARG A 1 229 ? 18.884 10.810  23.517  1.00 25.24  ? 241  ARG A NH2  1 
ATOM   2170 H H    . ARG A 1 229 ? 25.425 9.376   25.617  1.00 0.00   ? 241  ARG A H    1 
ATOM   2171 H HE   . ARG A 1 229 ? 21.320 10.914  23.582  1.00 0.00   ? 241  ARG A HE   1 
ATOM   2172 H HH11 . ARG A 1 229 ? 19.572 11.982  26.415  1.00 0.00   ? 241  ARG A HH11 1 
ATOM   2173 H HH12 . ARG A 1 229 ? 18.028 11.667  25.698  1.00 0.00   ? 241  ARG A HH12 1 
ATOM   2174 H HH21 . ARG A 1 229 ? 19.327 10.475  22.685  1.00 0.00   ? 241  ARG A HH21 1 
ATOM   2175 H HH22 . ARG A 1 229 ? 17.886 10.814  23.587  1.00 0.00   ? 241  ARG A HH22 1 
ATOM   2176 N N    . ALA A 1 230 ? 27.238 11.053  27.389  1.00 22.65  ? 242  ALA A N    1 
ATOM   2177 C CA   . ALA A 1 230 ? 28.268 11.360  28.362  1.00 22.45  ? 242  ALA A CA   1 
ATOM   2178 C C    . ALA A 1 230 ? 29.493 11.766  27.547  1.00 21.84  ? 242  ALA A C    1 
ATOM   2179 O O    . ALA A 1 230 ? 30.149 12.761  27.852  1.00 25.25  ? 242  ALA A O    1 
ATOM   2180 C CB   . ALA A 1 230 ? 28.571 10.116  29.207  1.00 18.00  ? 242  ALA A CB   1 
ATOM   2181 H H    . ALA A 1 230 ? 26.838 10.162  27.378  1.00 0.00   ? 242  ALA A H    1 
ATOM   2182 N N    . PHE A 1 231 ? 29.747 11.014  26.474  1.00 23.59  ? 243  PHE A N    1 
ATOM   2183 C CA   . PHE A 1 231 ? 30.871 11.255  25.565  1.00 22.89  ? 243  PHE A CA   1 
ATOM   2184 C C    . PHE A 1 231 ? 30.736 12.517  24.724  1.00 22.75  ? 243  PHE A C    1 
ATOM   2185 O O    . PHE A 1 231 ? 31.696 13.271  24.550  1.00 19.68  ? 243  PHE A O    1 
ATOM   2186 C CB   . PHE A 1 231 ? 31.027 10.078  24.600  1.00 21.97  ? 243  PHE A CB   1 
ATOM   2187 C CG   . PHE A 1 231 ? 32.038 9.067   25.029  1.00 22.62  ? 243  PHE A CG   1 
ATOM   2188 C CD1  . PHE A 1 231 ? 31.777 8.214   26.093  1.00 21.69  ? 243  PHE A CD1  1 
ATOM   2189 C CD2  . PHE A 1 231 ? 33.254 8.954   24.358  1.00 18.97  ? 243  PHE A CD2  1 
ATOM   2190 C CE1  . PHE A 1 231 ? 32.706 7.262   26.487  1.00 16.84  ? 243  PHE A CE1  1 
ATOM   2191 C CE2  . PHE A 1 231 ? 34.194 8.005   24.741  1.00 19.63  ? 243  PHE A CE2  1 
ATOM   2192 C CZ   . PHE A 1 231 ? 33.921 7.152   25.812  1.00 19.67  ? 243  PHE A CZ   1 
ATOM   2193 H H    . PHE A 1 231 ? 29.148 10.263  26.282  1.00 0.00   ? 243  PHE A H    1 
ATOM   2194 N N    . ALA A 1 232 ? 29.551 12.696  24.150  1.00 22.95  ? 244  ALA A N    1 
ATOM   2195 C CA   . ALA A 1 232 ? 29.247 13.832  23.295  1.00 23.92  ? 244  ALA A CA   1 
ATOM   2196 C C    . ALA A 1 232 ? 29.424 15.148  24.033  1.00 25.68  ? 244  ALA A C    1 
ATOM   2197 O O    . ALA A 1 232 ? 29.855 16.148  23.459  1.00 28.74  ? 244  ALA A O    1 
ATOM   2198 C CB   . ALA A 1 232 ? 27.818 13.715  22.775  1.00 21.84  ? 244  ALA A CB   1 
ATOM   2199 H H    . ALA A 1 232 ? 28.849 12.041  24.328  1.00 0.00   ? 244  ALA A H    1 
ATOM   2200 N N    . ALA A 1 233 ? 29.120 15.114  25.324  1.00 26.17  ? 245  ALA A N    1 
ATOM   2201 C CA   . ALA A 1 233 ? 29.210 16.275  26.192  1.00 27.26  ? 245  ALA A CA   1 
ATOM   2202 C C    . ALA A 1 233 ? 30.630 16.781  26.357  1.00 28.78  ? 245  ALA A C    1 
ATOM   2203 O O    . ALA A 1 233 ? 30.833 17.951  26.693  1.00 30.74  ? 245  ALA A O    1 
ATOM   2204 C CB   . ALA A 1 233 ? 28.634 15.941  27.559  1.00 26.98  ? 245  ALA A CB   1 
ATOM   2205 H H    . ALA A 1 233 ? 28.829 14.263  25.710  1.00 0.00   ? 245  ALA A H    1 
ATOM   2206 N N    . MET A 1 234 ? 31.623 15.921  26.155  1.00 30.00  ? 246  MET A N    1 
ATOM   2207 C CA   . MET A 1 234 ? 32.976 16.411  26.326  1.00 31.13  ? 246  MET A CA   1 
ATOM   2208 C C    . MET A 1 234 ? 33.950 16.219  25.194  1.00 30.64  ? 246  MET A C    1 
ATOM   2209 O O    . MET A 1 234 ? 35.110 16.619  25.290  1.00 32.77  ? 246  MET A O    1 
ATOM   2210 C CB   . MET A 1 234 ? 33.577 15.958  27.649  1.00 39.28  ? 246  MET A CB   1 
ATOM   2211 C CG   . MET A 1 234 ? 33.987 14.529  27.781  1.00 45.24  ? 246  MET A CG   1 
ATOM   2212 S SD   . MET A 1 234 ? 34.514 14.490  29.478  1.00 55.71  ? 246  MET A SD   1 
ATOM   2213 C CE   . MET A 1 234 ? 32.916 14.418  30.293  1.00 53.41  ? 246  MET A CE   1 
ATOM   2214 H H    . MET A 1 234 ? 31.450 14.991  25.903  1.00 0.00   ? 246  MET A H    1 
ATOM   2215 N N    . HIS A 1 235 ? 33.483 15.623  24.113  1.00 28.37  ? 247  HIS A N    1 
ATOM   2216 C CA   . HIS A 1 235 ? 34.351 15.439  22.980  1.00 24.48  ? 247  HIS A CA   1 
ATOM   2217 C C    . HIS A 1 235 ? 34.027 16.420  21.893  1.00 25.87  ? 247  HIS A C    1 
ATOM   2218 O O    . HIS A 1 235 ? 32.861 16.719  21.662  1.00 30.82  ? 247  HIS A O    1 
ATOM   2219 C CB   . HIS A 1 235 ? 34.188 14.046  22.417  1.00 24.00  ? 247  HIS A CB   1 
ATOM   2220 C CG   . HIS A 1 235 ? 34.929 13.005  23.195  1.00 22.47  ? 247  HIS A CG   1 
ATOM   2221 N ND1  . HIS A 1 235 ? 36.044 12.389  22.696  1.00 22.70  ? 247  HIS A ND1  1 
ATOM   2222 C CD2  . HIS A 1 235 ? 34.699 12.483  24.415  1.00 21.38  ? 247  HIS A CD2  1 
ATOM   2223 C CE1  . HIS A 1 235 ? 36.483 11.519  23.591  1.00 22.88  ? 247  HIS A CE1  1 
ATOM   2224 N NE2  . HIS A 1 235 ? 35.691 11.560  24.629  1.00 26.46  ? 247  HIS A NE2  1 
ATOM   2225 H H    . HIS A 1 235 ? 32.555 15.310  24.080  1.00 0.00   ? 247  HIS A H    1 
ATOM   2226 H HD1  . HIS A 1 235 ? 36.454 12.557  21.822  1.00 0.00   ? 247  HIS A HD1  1 
ATOM   2227 H HE2  . HIS A 1 235 ? 35.790 11.015  25.438  1.00 0.00   ? 247  HIS A HE2  1 
ATOM   2228 N N    . LYS A 1 236 ? 35.066 16.919  21.231  1.00 23.61  ? 248  LYS A N    1 
ATOM   2229 C CA   . LYS A 1 236 ? 34.859 17.840  20.133  1.00 22.53  ? 248  LYS A CA   1 
ATOM   2230 C C    . LYS A 1 236 ? 34.597 17.074  18.847  1.00 20.37  ? 248  LYS A C    1 
ATOM   2231 O O    . LYS A 1 236 ? 34.019 17.615  17.912  1.00 22.01  ? 248  LYS A O    1 
ATOM   2232 C CB   . LYS A 1 236 ? 36.044 18.798  19.944  1.00 27.79  ? 248  LYS A CB   1 
ATOM   2233 C CG   . LYS A 1 236 ? 36.043 19.942  20.955  1.00 36.96  ? 248  LYS A CG   1 
ATOM   2234 C CD   . LYS A 1 236 ? 36.829 21.178  20.513  1.00 44.24  ? 248  LYS A CD   1 
ATOM   2235 C CE   . LYS A 1 236 ? 38.329 21.048  20.721  1.00 49.82  ? 248  LYS A CE   1 
ATOM   2236 N NZ   . LYS A 1 236 ? 38.983 22.367  20.442  1.00 53.50  ? 248  LYS A NZ   1 
ATOM   2237 H H    . LYS A 1 236 ? 35.977 16.662  21.485  1.00 0.00   ? 248  LYS A H    1 
ATOM   2238 H HZ1  . LYS A 1 236 ? 38.600 23.087  21.088  1.00 0.00   ? 248  LYS A HZ1  1 
ATOM   2239 H HZ2  . LYS A 1 236 ? 40.010 22.282  20.586  1.00 0.00   ? 248  LYS A HZ2  1 
ATOM   2240 H HZ3  . LYS A 1 236 ? 38.792 22.647  19.459  1.00 0.00   ? 248  LYS A HZ3  1 
ATOM   2241 N N    . GLU A 1 237 ? 35.016 15.812  18.808  1.00 18.03  ? 249  GLU A N    1 
ATOM   2242 C CA   . GLU A 1 237 ? 34.812 14.990  17.623  1.00 20.30  ? 249  GLU A CA   1 
ATOM   2243 C C    . GLU A 1 237 ? 34.425 13.557  17.967  1.00 22.25  ? 249  GLU A C    1 
ATOM   2244 O O    . GLU A 1 237 ? 34.857 13.015  18.983  1.00 22.56  ? 249  GLU A O    1 
ATOM   2245 C CB   . GLU A 1 237 ? 36.068 14.980  16.756  1.00 20.42  ? 249  GLU A CB   1 
ATOM   2246 C CG   . GLU A 1 237 ? 36.576 16.353  16.344  1.00 18.60  ? 249  GLU A CG   1 
ATOM   2247 C CD   . GLU A 1 237 ? 37.940 16.281  15.687  1.00 17.41  ? 249  GLU A CD   1 
ATOM   2248 O OE1  . GLU A 1 237 ? 38.760 15.456  16.135  1.00 23.09  ? 249  GLU A OE1  1 
ATOM   2249 O OE2  . GLU A 1 237 ? 38.183 17.029  14.722  1.00 16.24  ? 249  GLU A OE2  1 
ATOM   2250 H H    . GLU A 1 237 ? 35.469 15.427  19.587  1.00 0.00   ? 249  GLU A H    1 
ATOM   2251 N N    . LEU A 1 238 ? 33.599 12.960  17.110  1.00 22.97  ? 250  LEU A N    1 
ATOM   2252 C CA   . LEU A 1 238 ? 33.139 11.586  17.282  1.00 22.49  ? 250  LEU A CA   1 
ATOM   2253 C C    . LEU A 1 238 ? 32.277 11.175  16.109  1.00 19.06  ? 250  LEU A C    1 
ATOM   2254 O O    . LEU A 1 238 ? 31.791 12.023  15.362  1.00 18.29  ? 250  LEU A O    1 
ATOM   2255 C CB   . LEU A 1 238 ? 32.359 11.394  18.609  1.00 23.64  ? 250  LEU A CB   1 
ATOM   2256 C CG   . LEU A 1 238 ? 31.024 12.014  19.036  1.00 25.52  ? 250  LEU A CG   1 
ATOM   2257 C CD1  . LEU A 1 238 ? 29.843 11.122  18.682  1.00 30.15  ? 250  LEU A CD1  1 
ATOM   2258 C CD2  . LEU A 1 238 ? 31.041 12.196  20.546  1.00 29.15  ? 250  LEU A CD2  1 
ATOM   2259 H H    . LEU A 1 238 ? 33.287 13.468  16.332  1.00 0.00   ? 250  LEU A H    1 
ATOM   2260 N N    . ILE A 1 239 ? 32.206 9.877   15.855  1.00 18.47  ? 251  ILE A N    1 
ATOM   2261 C CA   . ILE A 1 239 ? 31.321 9.422   14.807  1.00 20.09  ? 251  ILE A CA   1 
ATOM   2262 C C    . ILE A 1 239 ? 30.463 8.295   15.353  1.00 20.00  ? 251  ILE A C    1 
ATOM   2263 O O    . ILE A 1 239 ? 30.890 7.547   16.234  1.00 21.90  ? 251  ILE A O    1 
ATOM   2264 C CB   . ILE A 1 239 ? 32.040 9.034   13.442  1.00 19.79  ? 251  ILE A CB   1 
ATOM   2265 C CG1  . ILE A 1 239 ? 31.896 7.560   13.159  1.00 18.14  ? 251  ILE A CG1  1 
ATOM   2266 C CG2  . ILE A 1 239 ? 33.485 9.482   13.378  1.00 19.51  ? 251  ILE A CG2  1 
ATOM   2267 C CD1  . ILE A 1 239 ? 31.020 7.315   12.027  1.00 22.24  ? 251  ILE A CD1  1 
ATOM   2268 H H    . ILE A 1 239 ? 32.742 9.235   16.366  1.00 0.00   ? 251  ILE A H    1 
ATOM   2269 N N    . VAL A 1 240 ? 29.194 8.301   14.967  1.00 18.92  ? 252  VAL A N    1 
ATOM   2270 C CA   . VAL A 1 240 ? 28.286 7.257   15.398  1.00 15.34  ? 252  VAL A CA   1 
ATOM   2271 C C    . VAL A 1 240 ? 27.570 6.634   14.213  1.00 10.64  ? 252  VAL A C    1 
ATOM   2272 O O    . VAL A 1 240 ? 27.183 7.298   13.261  1.00 13.88  ? 252  VAL A O    1 
ATOM   2273 C CB   . VAL A 1 240 ? 27.339 7.719   16.576  1.00 14.31  ? 252  VAL A CB   1 
ATOM   2274 C CG1  . VAL A 1 240 ? 26.930 9.153   16.425  1.00 20.00  ? 252  VAL A CG1  1 
ATOM   2275 C CG2  . VAL A 1 240 ? 26.124 6.804   16.693  1.00 13.72  ? 252  VAL A CG2  1 
ATOM   2276 H H    . VAL A 1 240 ? 28.856 9.004   14.387  1.00 0.00   ? 252  VAL A H    1 
ATOM   2277 N N    . ALA A 1 241 ? 27.657 5.315   14.206  1.00 9.36   ? 253  ALA A N    1 
ATOM   2278 C CA   . ALA A 1 241 ? 27.091 4.480   13.179  1.00 10.56  ? 253  ALA A CA   1 
ATOM   2279 C C    . ALA A 1 241 ? 25.924 3.819   13.860  1.00 13.53  ? 253  ALA A C    1 
ATOM   2280 O O    . ALA A 1 241 ? 26.106 3.017   14.779  1.00 15.93  ? 253  ALA A O    1 
ATOM   2281 C CB   . ALA A 1 241 ? 28.098 3.438   12.747  1.00 13.60  ? 253  ALA A CB   1 
ATOM   2282 H H    . ALA A 1 241 ? 28.135 4.884   14.938  1.00 0.00   ? 253  ALA A H    1 
ATOM   2283 N N    . SER A 1 242 ? 24.718 4.260   13.521  1.00 18.31  ? 254  SER A N    1 
ATOM   2284 C CA   . SER A 1 242 ? 23.535 3.670   14.123  1.00 16.93  ? 254  SER A CA   1 
ATOM   2285 C C    . SER A 1 242 ? 22.710 2.864   13.137  1.00 12.83  ? 254  SER A C    1 
ATOM   2286 O O    . SER A 1 242 ? 22.801 3.037   11.918  1.00 12.28  ? 254  SER A O    1 
ATOM   2287 C CB   . SER A 1 242 ? 22.696 4.724   14.853  1.00 18.11  ? 254  SER A CB   1 
ATOM   2288 O OG   . SER A 1 242 ? 22.344 5.796   14.013  1.00 13.40  ? 254  SER A OG   1 
ATOM   2289 H H    . SER A 1 242 ? 24.611 4.999   12.901  1.00 0.00   ? 254  SER A H    1 
ATOM   2290 H HG   . SER A 1 242 ? 21.825 6.434   14.508  1.00 0.00   ? 254  SER A HG   1 
ATOM   2291 N N    . SER A 1 243 ? 21.932 1.949   13.697  1.00 13.43  ? 255  SER A N    1 
ATOM   2292 C CA   . SER A 1 243 ? 21.088 1.055   12.926  1.00 10.76  ? 255  SER A CA   1 
ATOM   2293 C C    . SER A 1 243 ? 19.660 1.083   13.435  1.00 12.28  ? 255  SER A C    1 
ATOM   2294 O O    . SER A 1 243 ? 19.415 1.232   14.631  1.00 10.10  ? 255  SER A O    1 
ATOM   2295 C CB   . SER A 1 243 ? 21.611 -0.377  13.046  1.00 12.67  ? 255  SER A CB   1 
ATOM   2296 O OG   . SER A 1 243 ? 20.763 -1.300  12.391  1.00 10.46  ? 255  SER A OG   1 
ATOM   2297 H H    . SER A 1 243 ? 21.918 1.872   14.672  1.00 0.00   ? 255  SER A H    1 
ATOM   2298 H HG   . SER A 1 243 ? 21.114 -2.187  12.496  1.00 0.00   ? 255  SER A HG   1 
ATOM   2299 N N    . TYR A 1 244 ? 18.723 0.957   12.505  1.00 13.91  ? 256  TYR A N    1 
ATOM   2300 C CA   . TYR A 1 244 ? 17.302 0.907   12.834  1.00 12.97  ? 256  TYR A CA   1 
ATOM   2301 C C    . TYR A 1 244 ? 16.762 -0.445  12.425  1.00 11.79  ? 256  TYR A C    1 
ATOM   2302 O O    . TYR A 1 244 ? 15.557 -0.639  12.361  1.00 9.68   ? 256  TYR A O    1 
ATOM   2303 C CB   . TYR A 1 244 ? 16.526 1.966   12.076  1.00 10.66  ? 256  TYR A CB   1 
ATOM   2304 C CG   . TYR A 1 244 ? 16.812 3.362   12.511  1.00 15.09  ? 256  TYR A CG   1 
ATOM   2305 C CD1  . TYR A 1 244 ? 16.298 3.865   13.706  1.00 12.98  ? 256  TYR A CD1  1 
ATOM   2306 C CD2  . TYR A 1 244 ? 17.553 4.211   11.705  1.00 12.67  ? 256  TYR A CD2  1 
ATOM   2307 C CE1  . TYR A 1 244 ? 16.510 5.183   14.075  1.00 18.30  ? 256  TYR A CE1  1 
ATOM   2308 C CE2  . TYR A 1 244 ? 17.772 5.524   12.060  1.00 19.70  ? 256  TYR A CE2  1 
ATOM   2309 C CZ   . TYR A 1 244 ? 17.247 6.007   13.242  1.00 19.46  ? 256  TYR A CZ   1 
ATOM   2310 O OH   . TYR A 1 244 ? 17.427 7.326   13.572  1.00 19.35  ? 256  TYR A OH   1 
ATOM   2311 H H    . TYR A 1 244 ? 18.995 0.890   11.568  1.00 0.00   ? 256  TYR A H    1 
ATOM   2312 H HH   . TYR A 1 244 ? 17.962 7.740   12.896  1.00 0.00   ? 256  TYR A HH   1 
ATOM   2313 N N    . SER A 1 245 ? 17.663 -1.371  12.117  1.00 12.47  ? 257  SER A N    1 
ATOM   2314 C CA   . SER A 1 245 ? 17.267 -2.710  11.694  1.00 13.18  ? 257  SER A CA   1 
ATOM   2315 C C    . SER A 1 245 ? 16.531 -3.480  12.773  1.00 11.36  ? 257  SER A C    1 
ATOM   2316 O O    . SER A 1 245 ? 15.526 -4.135  12.506  1.00 13.63  ? 257  SER A O    1 
ATOM   2317 C CB   . SER A 1 245 ? 18.492 -3.530  11.285  1.00 12.14  ? 257  SER A CB   1 
ATOM   2318 O OG   . SER A 1 245 ? 18.957 -3.143  10.012  1.00 13.89  ? 257  SER A OG   1 
ATOM   2319 H H    . SER A 1 245 ? 18.616 -1.156  12.174  1.00 0.00   ? 257  SER A H    1 
ATOM   2320 H HG   . SER A 1 245 ? 19.730 -3.664  9.780   1.00 0.00   ? 257  SER A HG   1 
ATOM   2321 N N    . LYS A 1 246 ? 17.044 -3.402  14.001  1.00 12.49  ? 258  LYS A N    1 
ATOM   2322 C CA   . LYS A 1 246 ? 16.476 -4.116  15.117  1.00 11.55  ? 258  LYS A CA   1 
ATOM   2323 C C    . LYS A 1 246 ? 15.367 -3.377  15.860  1.00 10.69  ? 258  LYS A C    1 
ATOM   2324 O O    . LYS A 1 246 ? 14.348 -3.988  16.200  1.00 12.18  ? 258  LYS A O    1 
ATOM   2325 C CB   . LYS A 1 246 ? 17.598 -4.536  16.068  1.00 13.54  ? 258  LYS A CB   1 
ATOM   2326 C CG   . LYS A 1 246 ? 18.538 -5.601  15.487  1.00 15.72  ? 258  LYS A CG   1 
ATOM   2327 C CD   . LYS A 1 246 ? 19.983 -5.108  15.337  1.00 18.57  ? 258  LYS A CD   1 
ATOM   2328 C CE   . LYS A 1 246 ? 20.852 -6.188  14.702  1.00 19.43  ? 258  LYS A CE   1 
ATOM   2329 N NZ   . LYS A 1 246 ? 22.279 -5.838  14.905  1.00 20.77  ? 258  LYS A NZ   1 
ATOM   2330 H H    . LYS A 1 246 ? 17.832 -2.839  14.149  1.00 0.00   ? 258  LYS A H    1 
ATOM   2331 H HZ1  . LYS A 1 246 ? 22.395 -5.012  15.526  1.00 0.00   ? 258  LYS A HZ1  1 
ATOM   2332 N N    . ASN A 1 247 ? 15.529 -2.079  16.086  1.00 11.32  ? 259  ASN A N    1 
ATOM   2333 C CA   . ASN A 1 247 ? 14.492 -1.348  16.812  1.00 11.65  ? 259  ASN A CA   1 
ATOM   2334 C C    . ASN A 1 247 ? 13.239 -0.975  15.991  1.00 12.28  ? 259  ASN A C    1 
ATOM   2335 O O    . ASN A 1 247 ? 12.224 -0.586  16.560  1.00 13.76  ? 259  ASN A O    1 
ATOM   2336 C CB   . ASN A 1 247 ? 15.057 -0.156  17.619  1.00 12.32  ? 259  ASN A CB   1 
ATOM   2337 C CG   . ASN A 1 247 ? 15.784 0.854   16.790  1.00 7.27   ? 259  ASN A CG   1 
ATOM   2338 O OD1  . ASN A 1 247 ? 15.752 0.834   15.566  1.00 14.45  ? 259  ASN A OD1  1 
ATOM   2339 N ND2  . ASN A 1 247 ? 16.443 1.799   17.471  1.00 9.79   ? 259  ASN A ND2  1 
ATOM   2340 H H    . ASN A 1 247 ? 16.333 -1.617  15.767  1.00 0.00   ? 259  ASN A H    1 
ATOM   2341 H HD21 . ASN A 1 247 ? 16.413 1.779   18.449  1.00 0.00   ? 259  ASN A HD21 1 
ATOM   2342 H HD22 . ASN A 1 247 ? 16.931 2.476   16.958  1.00 0.00   ? 259  ASN A HD22 1 
ATOM   2343 N N    . PHE A 1 248 ? 13.302 -1.138  14.670  1.00 10.08  ? 260  PHE A N    1 
ATOM   2344 C CA   . PHE A 1 248 ? 12.141 -0.899  13.810  1.00 9.51   ? 260  PHE A CA   1 
ATOM   2345 C C    . PHE A 1 248 ? 11.757 -2.176  13.058  1.00 12.54  ? 260  PHE A C    1 
ATOM   2346 O O    . PHE A 1 248 ? 10.843 -2.153  12.234  1.00 12.96  ? 260  PHE A O    1 
ATOM   2347 C CB   . PHE A 1 248 ? 12.392 0.206   12.776  1.00 8.54   ? 260  PHE A CB   1 
ATOM   2348 C CG   . PHE A 1 248 ? 12.156 1.603   13.285  1.00 10.49  ? 260  PHE A CG   1 
ATOM   2349 C CD1  . PHE A 1 248 ? 13.097 2.227   14.096  1.00 10.06  ? 260  PHE A CD1  1 
ATOM   2350 C CD2  . PHE A 1 248 ? 11.013 2.317   12.918  1.00 12.61  ? 260  PHE A CD2  1 
ATOM   2351 C CE1  . PHE A 1 248 ? 12.917 3.531   14.533  1.00 12.83  ? 260  PHE A CE1  1 
ATOM   2352 C CE2  . PHE A 1 248 ? 10.821 3.629   13.350  1.00 15.67  ? 260  PHE A CE2  1 
ATOM   2353 C CZ   . PHE A 1 248 ? 11.780 4.241   14.162  1.00 13.80  ? 260  PHE A CZ   1 
ATOM   2354 H H    . PHE A 1 248 ? 14.146 -1.424  14.262  1.00 0.00   ? 260  PHE A H    1 
ATOM   2355 N N    . GLY A 1 249 ? 12.457 -3.282  13.332  1.00 11.11  ? 261  GLY A N    1 
ATOM   2356 C CA   . GLY A 1 249 ? 12.173 -4.532  12.641  1.00 7.55   ? 261  GLY A CA   1 
ATOM   2357 C C    . GLY A 1 249 ? 12.300 -4.363  11.137  1.00 9.85   ? 261  GLY A C    1 
ATOM   2358 O O    . GLY A 1 249 ? 11.645 -5.053  10.359  1.00 10.76  ? 261  GLY A O    1 
ATOM   2359 H H    . GLY A 1 249 ? 13.171 -3.254  14.003  1.00 0.00   ? 261  GLY A H    1 
ATOM   2360 N N    . LEU A 1 250 ? 13.164 -3.433  10.741  1.00 10.79  ? 262  LEU A N    1 
ATOM   2361 C CA   . LEU A 1 250 ? 13.392 -3.108  9.341   1.00 7.21   ? 262  LEU A CA   1 
ATOM   2362 C C    . LEU A 1 250 ? 14.627 -3.746  8.700   1.00 11.17  ? 262  LEU A C    1 
ATOM   2363 O O    . LEU A 1 250 ? 15.126 -3.267  7.681   1.00 9.26   ? 262  LEU A O    1 
ATOM   2364 C CB   . LEU A 1 250 ? 13.422 -1.583  9.172   1.00 13.02  ? 262  LEU A CB   1 
ATOM   2365 C CG   . LEU A 1 250 ? 12.067 -0.877  9.059   1.00 10.09  ? 262  LEU A CG   1 
ATOM   2366 C CD1  . LEU A 1 250 ? 12.270 0.621   9.004   1.00 8.61   ? 262  LEU A CD1  1 
ATOM   2367 C CD2  . LEU A 1 250 ? 11.367 -1.359  7.796   1.00 15.60  ? 262  LEU A CD2  1 
ATOM   2368 H H    . LEU A 1 250 ? 13.676 -2.946  11.420  1.00 0.00   ? 262  LEU A H    1 
ATOM   2369 N N    . TYR A 1 251 ? 15.053 -4.873  9.265   1.00 13.14  ? 263  TYR A N    1 
ATOM   2370 C CA   . TYR A 1 251 ? 16.219 -5.642  8.819   1.00 8.16   ? 263  TYR A CA   1 
ATOM   2371 C C    . TYR A 1 251 ? 16.617 -5.571  7.337   1.00 10.15  ? 263  TYR A C    1 
ATOM   2372 O O    . TYR A 1 251 ? 17.694 -5.072  7.011   1.00 12.49  ? 263  TYR A O    1 
ATOM   2373 C CB   . TYR A 1 251 ? 16.054 -7.121  9.214   1.00 8.11   ? 263  TYR A CB   1 
ATOM   2374 C CG   . TYR A 1 251 ? 15.637 -7.353  10.651  1.00 12.36  ? 263  TYR A CG   1 
ATOM   2375 C CD1  . TYR A 1 251 ? 16.549 -7.221  11.699  1.00 9.35   ? 263  TYR A CD1  1 
ATOM   2376 C CD2  . TYR A 1 251 ? 14.321 -7.696  10.970  1.00 10.22  ? 263  TYR A CD2  1 
ATOM   2377 C CE1  . TYR A 1 251 ? 16.162 -7.421  13.023  1.00 14.93  ? 263  TYR A CE1  1 
ATOM   2378 C CE2  . TYR A 1 251 ? 13.925 -7.900  12.290  1.00 11.20  ? 263  TYR A CE2  1 
ATOM   2379 C CZ   . TYR A 1 251 ? 14.849 -7.758  13.309  1.00 12.62  ? 263  TYR A CZ   1 
ATOM   2380 O OH   . TYR A 1 251 ? 14.479 -7.923  14.621  1.00 12.69  ? 263  TYR A OH   1 
ATOM   2381 H H    . TYR A 1 251 ? 14.547 -5.203  10.036  1.00 0.00   ? 263  TYR A H    1 
ATOM   2382 H HH   . TYR A 1 251 ? 13.550 -8.159  14.670  1.00 0.00   ? 263  TYR A HH   1 
ATOM   2383 N N    . ASN A 1 252 ? 15.735 -6.020  6.442   1.00 8.41   ? 264  ASN A N    1 
ATOM   2384 C CA   . ASN A 1 252 ? 16.069 -6.046  5.016   1.00 7.66   ? 264  ASN A CA   1 
ATOM   2385 C C    . ASN A 1 252 ? 15.902 -4.780  4.198   1.00 7.57   ? 264  ASN A C    1 
ATOM   2386 O O    . ASN A 1 252 ? 16.152 -4.789  2.989   1.00 8.51   ? 264  ASN A O    1 
ATOM   2387 C CB   . ASN A 1 252 ? 15.361 -7.205  4.304   1.00 7.14   ? 264  ASN A CB   1 
ATOM   2388 C CG   . ASN A 1 252 ? 13.853 -7.037  4.232   1.00 11.67  ? 264  ASN A CG   1 
ATOM   2389 O OD1  . ASN A 1 252 ? 13.304 -5.958  4.459   1.00 10.22  ? 264  ASN A OD1  1 
ATOM   2390 N ND2  . ASN A 1 252 ? 13.175 -8.122  3.886   1.00 9.82   ? 264  ASN A ND2  1 
ATOM   2391 H H    . ASN A 1 252 ? 14.855 -6.331  6.741   1.00 0.00   ? 264  ASN A H    1 
ATOM   2392 H HD21 . ASN A 1 252 ? 13.673 -8.946  3.702   1.00 0.00   ? 264  ASN A HD21 1 
ATOM   2393 H HD22 . ASN A 1 252 ? 12.199 -8.054  3.828   1.00 0.00   ? 264  ASN A HD22 1 
ATOM   2394 N N    . GLU A 1 253 ? 15.484 -3.696  4.841   1.00 8.58   ? 265  GLU A N    1 
ATOM   2395 C CA   . GLU A 1 253 ? 15.298 -2.436  4.142   1.00 9.78   ? 265  GLU A CA   1 
ATOM   2396 C C    . GLU A 1 253 ? 16.583 -1.603  4.196   1.00 11.97  ? 265  GLU A C    1 
ATOM   2397 O O    . GLU A 1 253 ? 16.690 -0.582  3.518   1.00 8.90   ? 265  GLU A O    1 
ATOM   2398 C CB   . GLU A 1 253 ? 14.119 -1.638  4.722   1.00 15.11  ? 265  GLU A CB   1 
ATOM   2399 C CG   . GLU A 1 253 ? 12.671 -1.936  4.182   1.00 15.64  ? 265  GLU A CG   1 
ATOM   2400 C CD   . GLU A 1 253 ? 12.539 -2.479  2.740   1.00 17.59  ? 265  GLU A CD   1 
ATOM   2401 O OE1  . GLU A 1 253 ? 13.327 -2.136  1.829   1.00 17.43  ? 265  GLU A OE1  1 
ATOM   2402 O OE2  . GLU A 1 253 ? 11.563 -3.233  2.528   1.00 18.14  ? 265  GLU A OE2  1 
ATOM   2403 H H    . GLU A 1 253 ? 15.293 -3.755  5.795   1.00 0.00   ? 265  GLU A H    1 
ATOM   2404 N N    . ARG A 1 254 ? 17.506 -2.017  5.068   1.00 8.03   ? 266  ARG A N    1 
ATOM   2405 C CA   . ARG A 1 254 ? 18.815 -1.387  5.231   1.00 10.91  ? 266  ARG A CA   1 
ATOM   2406 C C    . ARG A 1 254 ? 18.715 0.076   5.621   1.00 9.36   ? 266  ARG A C    1 
ATOM   2407 O O    . ARG A 1 254 ? 18.972 0.982   4.827   1.00 9.67   ? 266  ARG A O    1 
ATOM   2408 C CB   . ARG A 1 254 ? 19.621 -1.544  3.950   1.00 7.55   ? 266  ARG A CB   1 
ATOM   2409 C CG   . ARG A 1 254 ? 19.627 -2.971  3.428   1.00 11.86  ? 266  ARG A CG   1 
ATOM   2410 C CD   . ARG A 1 254 ? 20.753 -3.761  4.047   1.00 17.91  ? 266  ARG A CD   1 
ATOM   2411 N NE   . ARG A 1 254 ? 20.502 -4.079  5.436   1.00 17.84  ? 266  ARG A NE   1 
ATOM   2412 C CZ   . ARG A 1 254 ? 21.398 -4.032  6.410   1.00 12.20  ? 266  ARG A CZ   1 
ATOM   2413 N NH1  . ARG A 1 254 ? 22.655 -3.682  6.177   1.00 11.17  ? 266  ARG A NH1  1 
ATOM   2414 N NH2  . ARG A 1 254 ? 21.001 -4.290  7.641   1.00 20.40  ? 266  ARG A NH2  1 
ATOM   2415 H H    . ARG A 1 254 ? 17.298 -2.788  5.636   1.00 0.00   ? 266  ARG A H    1 
ATOM   2416 H HE   . ARG A 1 254 ? 19.593 -4.352  5.680   1.00 0.00   ? 266  ARG A HE   1 
ATOM   2417 H HH11 . ARG A 1 254 ? 22.950 -3.444  5.252   1.00 0.00   ? 266  ARG A HH11 1 
ATOM   2418 H HH12 . ARG A 1 254 ? 23.310 -3.654  6.932   1.00 0.00   ? 266  ARG A HH12 1 
ATOM   2419 H HH21 . ARG A 1 254 ? 20.048 -4.516  7.844   1.00 0.00   ? 266  ARG A HH21 1 
ATOM   2420 H HH22 . ARG A 1 254 ? 21.682 -4.242  8.358   1.00 0.00   ? 266  ARG A HH22 1 
ATOM   2421 N N    . VAL A 1 255 ? 18.437 0.296   6.895   1.00 12.53  ? 267  VAL A N    1 
ATOM   2422 C CA   . VAL A 1 255 ? 18.249 1.632   7.419   1.00 11.56  ? 267  VAL A CA   1 
ATOM   2423 C C    . VAL A 1 255 ? 19.252 1.915   8.521   1.00 8.71   ? 267  VAL A C    1 
ATOM   2424 O O    . VAL A 1 255 ? 19.255 1.262   9.561   1.00 8.18   ? 267  VAL A O    1 
ATOM   2425 C CB   . VAL A 1 255 ? 16.823 1.790   7.990   1.00 9.43   ? 267  VAL A CB   1 
ATOM   2426 C CG1  . VAL A 1 255 ? 16.483 3.254   8.117   1.00 10.74  ? 267  VAL A CG1  1 
ATOM   2427 C CG2  . VAL A 1 255 ? 15.811 1.059   7.112   1.00 9.89   ? 267  VAL A CG2  1 
ATOM   2428 H H    . VAL A 1 255 ? 18.356 -0.468  7.503   1.00 0.00   ? 267  VAL A H    1 
ATOM   2429 N N    . GLY A 1 256 ? 20.102 2.905   8.288   1.00 13.44  ? 268  GLY A N    1 
ATOM   2430 C CA   . GLY A 1 256 ? 21.085 3.263   9.285   1.00 10.15  ? 268  GLY A CA   1 
ATOM   2431 C C    . GLY A 1 256 ? 21.602 4.657   9.047   1.00 7.06   ? 268  GLY A C    1 
ATOM   2432 O O    . GLY A 1 256 ? 21.251 5.309   8.065   1.00 9.09   ? 268  GLY A O    1 
ATOM   2433 H H    . GLY A 1 256 ? 20.065 3.393   7.439   1.00 0.00   ? 268  GLY A H    1 
ATOM   2434 N N    . ALA A 1 257 ? 22.463 5.103   9.944   1.00 10.92  ? 269  ALA A N    1 
ATOM   2435 C CA   . ALA A 1 257 ? 23.021 6.430   9.841   1.00 12.79  ? 269  ALA A CA   1 
ATOM   2436 C C    . ALA A 1 257 ? 24.448 6.505   10.318  1.00 10.65  ? 269  ALA A C    1 
ATOM   2437 O O    . ALA A 1 257 ? 24.863 5.775   11.215  1.00 8.69   ? 269  ALA A O    1 
ATOM   2438 C CB   . ALA A 1 257 ? 22.184 7.409   10.640  1.00 9.70   ? 269  ALA A CB   1 
ATOM   2439 H H    . ALA A 1 257 ? 22.735 4.538   10.689  1.00 0.00   ? 269  ALA A H    1 
ATOM   2440 N N    . CYS A 1 258 ? 25.215 7.348   9.645   1.00 13.03  ? 270  CYS A N    1 
ATOM   2441 C CA   . CYS A 1 258 ? 26.571 7.606   10.061  1.00 14.22  ? 270  CYS A CA   1 
ATOM   2442 C C    . CYS A 1 258 ? 26.605 9.095   10.389  1.00 11.77  ? 270  CYS A C    1 
ATOM   2443 O O    . CYS A 1 258 ? 26.473 9.920   9.486   1.00 12.61  ? 270  CYS A O    1 
ATOM   2444 C CB   . CYS A 1 258 ? 27.573 7.299   8.949   1.00 14.70  ? 270  CYS A CB   1 
ATOM   2445 S SG   . CYS A 1 258 ? 29.246 7.656   9.507   1.00 16.14  ? 270  CYS A SG   1 
ATOM   2446 H H    . CYS A 1 258 ? 24.862 7.803   8.855   1.00 0.00   ? 270  CYS A H    1 
ATOM   2447 N N    . THR A 1 259 ? 26.625 9.450   11.674  1.00 12.06  ? 271  THR A N    1 
ATOM   2448 C CA   . THR A 1 259 ? 26.717 10.868  12.006  1.00 17.44  ? 271  THR A CA   1 
ATOM   2449 C C    . THR A 1 259 ? 28.098 11.235  12.502  1.00 17.84  ? 271  THR A C    1 
ATOM   2450 O O    . THR A 1 259 ? 28.715 10.545  13.294  1.00 24.03  ? 271  THR A O    1 
ATOM   2451 C CB   . THR A 1 259 ? 25.550 11.436  12.903  1.00 17.36  ? 271  THR A CB   1 
ATOM   2452 O OG1  . THR A 1 259 ? 26.071 12.087  14.066  1.00 24.49  ? 271  THR A OG1  1 
ATOM   2453 C CG2  . THR A 1 259 ? 24.588 10.389  13.286  1.00 13.87  ? 271  THR A CG2  1 
ATOM   2454 H H    . THR A 1 259 ? 26.539 8.797   12.384  1.00 0.00   ? 271  THR A H    1 
ATOM   2455 H HG1  . THR A 1 259 ? 25.348 12.429  14.596  1.00 0.00   ? 271  THR A HG1  1 
ATOM   2456 N N    . LEU A 1 260 ? 28.546 12.356  11.976  1.00 18.74  ? 272  LEU A N    1 
ATOM   2457 C CA   . LEU A 1 260 ? 29.863 12.906  12.175  1.00 16.21  ? 272  LEU A CA   1 
ATOM   2458 C C    . LEU A 1 260 ? 29.816 14.208  12.976  1.00 13.29  ? 272  LEU A C    1 
ATOM   2459 O O    . LEU A 1 260 ? 29.092 15.117  12.583  1.00 20.38  ? 272  LEU A O    1 
ATOM   2460 C CB   . LEU A 1 260 ? 30.335 13.199  10.757  1.00 15.55  ? 272  LEU A CB   1 
ATOM   2461 C CG   . LEU A 1 260 ? 31.686 13.726  10.377  1.00 20.99  ? 272  LEU A CG   1 
ATOM   2462 C CD1  . LEU A 1 260 ? 32.690 12.672  10.775  1.00 19.61  ? 272  LEU A CD1  1 
ATOM   2463 C CD2  . LEU A 1 260 ? 31.718 13.972  8.865   1.00 18.64  ? 272  LEU A CD2  1 
ATOM   2464 H H    . LEU A 1 260 ? 27.938 12.858  11.406  1.00 0.00   ? 272  LEU A H    1 
ATOM   2465 N N    . VAL A 1 261 ? 30.496 14.294  14.123  1.00 17.20  ? 273  VAL A N    1 
ATOM   2466 C CA   . VAL A 1 261 ? 30.504 15.576  14.851  1.00 17.84  ? 273  VAL A CA   1 
ATOM   2467 C C    . VAL A 1 261 ? 31.934 16.113  14.967  1.00 19.96  ? 273  VAL A C    1 
ATOM   2468 O O    . VAL A 1 261 ? 32.880 15.343  15.086  1.00 19.16  ? 273  VAL A O    1 
ATOM   2469 C CB   . VAL A 1 261 ? 29.743 15.536  16.253  1.00 21.21  ? 273  VAL A CB   1 
ATOM   2470 C CG1  . VAL A 1 261 ? 29.144 14.172  16.528  1.00 18.50  ? 273  VAL A CG1  1 
ATOM   2471 C CG2  . VAL A 1 261 ? 30.630 16.008  17.412  1.00 14.92  ? 273  VAL A CG2  1 
ATOM   2472 H H    . VAL A 1 261 ? 30.985 13.526  14.466  1.00 0.00   ? 273  VAL A H    1 
ATOM   2473 N N    . ALA A 1 262 ? 32.078 17.417  14.755  1.00 19.55  ? 274  ALA A N    1 
ATOM   2474 C CA   . ALA A 1 262 ? 33.369 18.092  14.824  1.00 18.99  ? 274  ALA A CA   1 
ATOM   2475 C C    . ALA A 1 262 ? 33.221 19.263  15.784  1.00 21.85  ? 274  ALA A C    1 
ATOM   2476 O O    . ALA A 1 262 ? 32.120 19.529  16.281  1.00 19.00  ? 274  ALA A O    1 
ATOM   2477 C CB   . ALA A 1 262 ? 33.793 18.593  13.445  1.00 15.75  ? 274  ALA A CB   1 
ATOM   2478 H H    . ALA A 1 262 ? 31.285 17.950  14.542  1.00 0.00   ? 274  ALA A H    1 
ATOM   2479 N N    . ALA A 1 263 ? 34.306 20.009  15.981  1.00 23.60  ? 275  ALA A N    1 
ATOM   2480 C CA   . ALA A 1 263 ? 34.328 21.132  16.917  1.00 25.71  ? 275  ALA A CA   1 
ATOM   2481 C C    . ALA A 1 263 ? 33.341 22.264  16.642  1.00 27.60  ? 275  ALA A C    1 
ATOM   2482 O O    . ALA A 1 263 ? 32.840 22.889  17.579  1.00 25.96  ? 275  ALA A O    1 
ATOM   2483 C CB   . ALA A 1 263 ? 35.734 21.678  17.007  1.00 28.47  ? 275  ALA A CB   1 
ATOM   2484 H H    . ALA A 1 263 ? 35.122 19.797  15.481  1.00 0.00   ? 275  ALA A H    1 
ATOM   2485 N N    . ASP A 1 264 ? 33.111 22.556  15.366  1.00 26.74  ? 276  ASP A N    1 
ATOM   2486 C CA   . ASP A 1 264 ? 32.180 23.594  14.968  1.00 26.70  ? 276  ASP A CA   1 
ATOM   2487 C C    . ASP A 1 264 ? 31.529 23.241  13.642  1.00 24.89  ? 276  ASP A C    1 
ATOM   2488 O O    . ASP A 1 264 ? 31.888 22.253  12.995  1.00 20.74  ? 276  ASP A O    1 
ATOM   2489 C CB   . ASP A 1 264 ? 32.851 24.980  14.899  1.00 30.80  ? 276  ASP A CB   1 
ATOM   2490 C CG   . ASP A 1 264 ? 34.150 24.983  14.100  1.00 32.33  ? 276  ASP A CG   1 
ATOM   2491 O OD1  . ASP A 1 264 ? 34.100 24.824  12.868  1.00 35.11  ? 276  ASP A OD1  1 
ATOM   2492 O OD2  . ASP A 1 264 ? 35.213 25.174  14.730  1.00 41.40  ? 276  ASP A OD2  1 
ATOM   2493 H H    . ASP A 1 264 ? 33.587 22.053  14.672  1.00 0.00   ? 276  ASP A H    1 
ATOM   2494 N N    . SER A 1 265 ? 30.591 24.088  13.236  1.00 25.41  ? 277  SER A N    1 
ATOM   2495 C CA   . SER A 1 265 ? 29.825 23.905  12.018  1.00 27.19  ? 277  SER A CA   1 
ATOM   2496 C C    . SER A 1 265 ? 30.641 23.862  10.723  1.00 26.76  ? 277  SER A C    1 
ATOM   2497 O O    . SER A 1 265 ? 30.478 22.952  9.906   1.00 23.32  ? 277  SER A O    1 
ATOM   2498 C CB   . SER A 1 265 ? 28.734 24.986  11.972  1.00 28.89  ? 277  SER A CB   1 
ATOM   2499 O OG   . SER A 1 265 ? 28.551 25.540  10.679  1.00 37.71  ? 277  SER A OG   1 
ATOM   2500 H H    . SER A 1 265 ? 30.404 24.876  13.787  1.00 0.00   ? 277  SER A H    1 
ATOM   2501 H HG   . SER A 1 265 ? 27.858 26.203  10.711  1.00 0.00   ? 277  SER A HG   1 
ATOM   2502 N N    . GLU A 1 266 ? 31.566 24.808  10.589  1.00 28.17  ? 278  GLU A N    1 
ATOM   2503 C CA   . GLU A 1 266 ? 32.425 24.948  9.415   1.00 29.14  ? 278  GLU A CA   1 
ATOM   2504 C C    . GLU A 1 266 ? 33.297 23.709  9.186   1.00 24.41  ? 278  GLU A C    1 
ATOM   2505 O O    . GLU A 1 266 ? 33.434 23.224  8.061   1.00 23.76  ? 278  GLU A O    1 
ATOM   2506 C CB   . GLU A 1 266 ? 33.282 26.211  9.614   1.00 39.58  ? 278  GLU A CB   1 
ATOM   2507 C CG   . GLU A 1 266 ? 34.038 26.743  8.400   1.00 52.05  ? 278  GLU A CG   1 
ATOM   2508 C CD   . GLU A 1 266 ? 35.405 26.095  8.202   1.00 61.81  ? 278  GLU A CD   1 
ATOM   2509 O OE1  . GLU A 1 266 ? 36.130 25.864  9.199   1.00 63.99  ? 278  GLU A OE1  1 
ATOM   2510 O OE2  . GLU A 1 266 ? 35.753 25.829  7.033   1.00 66.60  ? 278  GLU A OE2  1 
ATOM   2511 H H    . GLU A 1 266 ? 31.678 25.445  11.325  1.00 0.00   ? 278  GLU A H    1 
ATOM   2512 N N    . THR A 1 267 ? 33.819 23.164  10.280  1.00 22.99  ? 279  THR A N    1 
ATOM   2513 C CA   . THR A 1 267 ? 34.689 21.996  10.238  1.00 21.18  ? 279  THR A CA   1 
ATOM   2514 C C    . THR A 1 267 ? 33.902 20.745  9.894   1.00 19.22  ? 279  THR A C    1 
ATOM   2515 O O    . THR A 1 267 ? 34.284 20.006  8.977   1.00 20.71  ? 279  THR A O    1 
ATOM   2516 C CB   . THR A 1 267 ? 35.415 21.810  11.589  1.00 21.71  ? 279  THR A CB   1 
ATOM   2517 O OG1  . THR A 1 267 ? 36.147 23.008  11.883  1.00 27.89  ? 279  THR A OG1  1 
ATOM   2518 C CG2  . THR A 1 267 ? 36.383 20.631  11.526  1.00 19.81  ? 279  THR A CG2  1 
ATOM   2519 H H    . THR A 1 267 ? 33.603 23.560  11.149  1.00 0.00   ? 279  THR A H    1 
ATOM   2520 H HG1  . THR A 1 267 ? 36.588 22.916  12.731  1.00 0.00   ? 279  THR A HG1  1 
ATOM   2521 N N    . VAL A 1 268 ? 32.768 20.535  10.567  1.00 17.13  ? 280  VAL A N    1 
ATOM   2522 C CA   . VAL A 1 268 ? 31.982 19.340  10.299  1.00 17.12  ? 280  VAL A CA   1 
ATOM   2523 C C    . VAL A 1 268 ? 31.479 19.314  8.871   1.00 16.61  ? 280  VAL A C    1 
ATOM   2524 O O    . VAL A 1 268 ? 31.460 18.256  8.246   1.00 16.84  ? 280  VAL A O    1 
ATOM   2525 C CB   . VAL A 1 268 ? 30.797 19.130  11.289  1.00 16.38  ? 280  VAL A CB   1 
ATOM   2526 C CG1  . VAL A 1 268 ? 29.650 20.104  11.045  1.00 18.46  ? 280  VAL A CG1  1 
ATOM   2527 C CG2  . VAL A 1 268 ? 30.301 17.700  11.170  1.00 15.92  ? 280  VAL A CG2  1 
ATOM   2528 H H    . VAL A 1 268 ? 32.464 21.185  11.234  1.00 0.00   ? 280  VAL A H    1 
ATOM   2529 N N    . ASP A 1 269 ? 31.137 20.484  8.338   1.00 19.51  ? 281  ASP A N    1 
ATOM   2530 C CA   . ASP A 1 269 ? 30.652 20.578  6.970   1.00 21.88  ? 281  ASP A CA   1 
ATOM   2531 C C    . ASP A 1 269 ? 31.749 20.226  5.962   1.00 22.73  ? 281  ASP A C    1 
ATOM   2532 O O    . ASP A 1 269 ? 31.502 19.499  5.003   1.00 23.54  ? 281  ASP A O    1 
ATOM   2533 C CB   . ASP A 1 269 ? 30.123 21.989  6.688   1.00 25.74  ? 281  ASP A CB   1 
ATOM   2534 C CG   . ASP A 1 269 ? 28.829 22.313  7.441   1.00 28.21  ? 281  ASP A CG   1 
ATOM   2535 O OD1  . ASP A 1 269 ? 28.305 21.459  8.189   1.00 30.21  ? 281  ASP A OD1  1 
ATOM   2536 O OD2  . ASP A 1 269 ? 28.342 23.449  7.261   1.00 32.92  ? 281  ASP A OD2  1 
ATOM   2537 H H    . ASP A 1 269 ? 31.221 21.297  8.876   1.00 0.00   ? 281  ASP A H    1 
ATOM   2538 N N    . ARG A 1 270 ? 32.953 20.758  6.181   1.00 21.87  ? 282  ARG A N    1 
ATOM   2539 C CA   . ARG A 1 270 ? 34.090 20.513  5.301   1.00 18.47  ? 282  ARG A CA   1 
ATOM   2540 C C    . ARG A 1 270 ? 34.444 19.023  5.364   1.00 15.17  ? 282  ARG A C    1 
ATOM   2541 O O    . ARG A 1 270 ? 34.739 18.389  4.346   1.00 16.88  ? 282  ARG A O    1 
ATOM   2542 C CB   . ARG A 1 270 ? 35.251 21.431  5.730   1.00 20.71  ? 282  ARG A CB   1 
ATOM   2543 C CG   . ARG A 1 270 ? 36.591 21.226  5.049   1.00 29.65  ? 282  ARG A CG   1 
ATOM   2544 C CD   . ARG A 1 270 ? 37.502 22.466  5.197   1.00 32.71  ? 282  ARG A CD   1 
ATOM   2545 N NE   . ARG A 1 270 ? 37.497 23.099  6.522   1.00 32.30  ? 282  ARG A NE   1 
ATOM   2546 C CZ   . ARG A 1 270 ? 38.111 22.632  7.614   1.00 32.20  ? 282  ARG A CZ   1 
ATOM   2547 N NH1  . ARG A 1 270 ? 38.802 21.496  7.599   1.00 32.32  ? 282  ARG A NH1  1 
ATOM   2548 N NH2  . ARG A 1 270 ? 38.054 23.326  8.740   1.00 32.47  ? 282  ARG A NH2  1 
ATOM   2549 H H    . ARG A 1 270 ? 33.076 21.330  6.967   1.00 0.00   ? 282  ARG A H    1 
ATOM   2550 H HE   . ARG A 1 270 ? 37.000 23.937  6.619   1.00 0.00   ? 282  ARG A HE   1 
ATOM   2551 H HH11 . ARG A 1 270 ? 38.875 20.962  6.757   1.00 0.00   ? 282  ARG A HH11 1 
ATOM   2552 H HH12 . ARG A 1 270 ? 39.249 21.175  8.434   1.00 0.00   ? 282  ARG A HH12 1 
ATOM   2553 H HH21 . ARG A 1 270 ? 37.553 24.191  8.768   1.00 0.00   ? 282  ARG A HH21 1 
ATOM   2554 H HH22 . ARG A 1 270 ? 38.509 22.984  9.562   1.00 0.00   ? 282  ARG A HH22 1 
ATOM   2555 N N    . ALA A 1 271 ? 34.322 18.460  6.561   1.00 15.27  ? 283  ALA A N    1 
ATOM   2556 C CA   . ALA A 1 271 ? 34.590 17.051  6.778   1.00 18.98  ? 283  ALA A CA   1 
ATOM   2557 C C    . ALA A 1 271 ? 33.490 16.199  6.134   1.00 21.68  ? 283  ALA A C    1 
ATOM   2558 O O    . ALA A 1 271 ? 33.767 15.126  5.597   1.00 20.56  ? 283  ALA A O    1 
ATOM   2559 C CB   . ALA A 1 271 ? 34.678 16.757  8.272   1.00 20.55  ? 283  ALA A CB   1 
ATOM   2560 H H    . ALA A 1 271 ? 34.023 19.009  7.310   1.00 0.00   ? 283  ALA A H    1 
ATOM   2561 N N    . PHE A 1 272 ? 32.257 16.715  6.133   1.00 20.58  ? 284  PHE A N    1 
ATOM   2562 C CA   . PHE A 1 272 ? 31.129 15.992  5.562   1.00 16.28  ? 284  PHE A CA   1 
ATOM   2563 C C    . PHE A 1 272 ? 31.196 15.908  4.046   1.00 14.76  ? 284  PHE A C    1 
ATOM   2564 O O    . PHE A 1 272 ? 30.691 14.950  3.457   1.00 18.50  ? 284  PHE A O    1 
ATOM   2565 C CB   . PHE A 1 272 ? 29.797 16.606  5.992   1.00 17.93  ? 284  PHE A CB   1 
ATOM   2566 C CG   . PHE A 1 272 ? 28.653 15.650  5.898   1.00 14.45  ? 284  PHE A CG   1 
ATOM   2567 C CD1  . PHE A 1 272 ? 28.711 14.427  6.559   1.00 17.44  ? 284  PHE A CD1  1 
ATOM   2568 C CD2  . PHE A 1 272 ? 27.532 15.947  5.135   1.00 15.50  ? 284  PHE A CD2  1 
ATOM   2569 C CE1  . PHE A 1 272 ? 27.680 13.517  6.463   1.00 16.83  ? 284  PHE A CE1  1 
ATOM   2570 C CE2  . PHE A 1 272 ? 26.487 15.046  5.027   1.00 16.07  ? 284  PHE A CE2  1 
ATOM   2571 C CZ   . PHE A 1 272 ? 26.561 13.824  5.692   1.00 17.77  ? 284  PHE A CZ   1 
ATOM   2572 H H    . PHE A 1 272 ? 32.118 17.609  6.500   1.00 0.00   ? 284  PHE A H    1 
ATOM   2573 N N    . SER A 1 273 ? 31.776 16.924  3.410   1.00 13.61  ? 285  SER A N    1 
ATOM   2574 C CA   . SER A 1 273 ? 31.908 16.886  1.966   1.00 15.32  ? 285  SER A CA   1 
ATOM   2575 C C    . SER A 1 273 ? 32.765 15.672  1.574   1.00 14.01  ? 285  SER A C    1 
ATOM   2576 O O    . SER A 1 273 ? 32.536 15.069  0.526   1.00 14.32  ? 285  SER A O    1 
ATOM   2577 C CB   . SER A 1 273 ? 32.493 18.198  1.419   1.00 15.57  ? 285  SER A CB   1 
ATOM   2578 O OG   . SER A 1 273 ? 33.824 18.392  1.844   1.00 21.71  ? 285  SER A OG   1 
ATOM   2579 H H    . SER A 1 273 ? 32.118 17.691  3.915   1.00 0.00   ? 285  SER A H    1 
ATOM   2580 H HG   . SER A 1 273 ? 34.156 19.220  1.491   1.00 0.00   ? 285  SER A HG   1 
ATOM   2581 N N    . GLN A 1 274 ? 33.736 15.298  2.415   1.00 14.73  ? 286  GLN A N    1 
ATOM   2582 C CA   . GLN A 1 274 ? 34.570 14.130  2.109   1.00 14.15  ? 286  GLN A CA   1 
ATOM   2583 C C    . GLN A 1 274 ? 33.822 12.840  2.406   1.00 12.88  ? 286  GLN A C    1 
ATOM   2584 O O    . GLN A 1 274 ? 34.033 11.822  1.738   1.00 12.01  ? 286  GLN A O    1 
ATOM   2585 C CB   . GLN A 1 274 ? 35.906 14.140  2.865   1.00 11.35  ? 286  GLN A CB   1 
ATOM   2586 C CG   . GLN A 1 274 ? 36.853 15.276  2.481   1.00 11.06  ? 286  GLN A CG   1 
ATOM   2587 C CD   . GLN A 1 274 ? 37.417 15.223  1.061   1.00 15.20  ? 286  GLN A CD   1 
ATOM   2588 O OE1  . GLN A 1 274 ? 38.075 16.170  0.629   1.00 21.05  ? 286  GLN A OE1  1 
ATOM   2589 N NE2  . GLN A 1 274 ? 37.192 14.129  0.328   1.00 17.76  ? 286  GLN A NE2  1 
ATOM   2590 H H    . GLN A 1 274 ? 33.891 15.806  3.239   1.00 0.00   ? 286  GLN A H    1 
ATOM   2591 H HE21 . GLN A 1 274 ? 36.683 13.378  0.692   1.00 0.00   ? 286  GLN A HE21 1 
ATOM   2592 H HE22 . GLN A 1 274 ? 37.560 14.124  -0.580  1.00 0.00   ? 286  GLN A HE22 1 
ATOM   2593 N N    . MET A 1 275 ? 32.954 12.864  3.416   1.00 15.41  ? 287  MET A N    1 
ATOM   2594 C CA   . MET A 1 275 ? 32.187 11.668  3.701   1.00 13.27  ? 287  MET A CA   1 
ATOM   2595 C C    . MET A 1 275 ? 31.270 11.396  2.514   1.00 11.71  ? 287  MET A C    1 
ATOM   2596 O O    . MET A 1 275 ? 31.105 10.253  2.096   1.00 12.87  ? 287  MET A O    1 
ATOM   2597 C CB   . MET A 1 275 ? 31.390 11.804  4.990   1.00 13.27  ? 287  MET A CB   1 
ATOM   2598 C CG   . MET A 1 275 ? 30.703 10.520  5.332   1.00 20.00  ? 287  MET A CG   1 
ATOM   2599 S SD   . MET A 1 275 ? 30.141 10.550  6.975   1.00 22.77  ? 287  MET A SD   1 
ATOM   2600 C CE   . MET A 1 275 ? 31.586 10.013  7.763   1.00 24.06  ? 287  MET A CE   1 
ATOM   2601 H H    . MET A 1 275 ? 32.835 13.674  3.955   1.00 0.00   ? 287  MET A H    1 
ATOM   2602 N N    . LYS A 1 276 ? 30.693 12.461  1.966   1.00 12.78  ? 288  LYS A N    1 
ATOM   2603 C CA   . LYS A 1 276 ? 29.819 12.327  0.817   1.00 12.09  ? 288  LYS A CA   1 
ATOM   2604 C C    . LYS A 1 276 ? 30.515 11.822  -0.426  1.00 13.25  ? 288  LYS A C    1 
ATOM   2605 O O    . LYS A 1 276 ? 29.920 11.092  -1.220  1.00 17.44  ? 288  LYS A O    1 
ATOM   2606 C CB   . LYS A 1 276 ? 29.117 13.638  0.545   1.00 15.37  ? 288  LYS A CB   1 
ATOM   2607 C CG   . LYS A 1 276 ? 28.038 13.824  1.543   1.00 15.53  ? 288  LYS A CG   1 
ATOM   2608 C CD   . LYS A 1 276 ? 27.635 15.224  1.631   1.00 14.98  ? 288  LYS A CD   1 
ATOM   2609 C CE   . LYS A 1 276 ? 27.124 15.695  0.320   1.00 18.44  ? 288  LYS A CE   1 
ATOM   2610 N NZ   . LYS A 1 276 ? 26.723 17.087  0.539   1.00 24.61  ? 288  LYS A NZ   1 
ATOM   2611 H H    . LYS A 1 276 ? 30.874 13.347  2.333   1.00 0.00   ? 288  LYS A H    1 
ATOM   2612 H HZ1  . LYS A 1 276 ? 27.547 17.639  0.852   1.00 0.00   ? 288  LYS A HZ1  1 
ATOM   2613 H HZ2  . LYS A 1 276 ? 26.354 17.485  -0.348  1.00 0.00   ? 288  LYS A HZ2  1 
ATOM   2614 H HZ3  . LYS A 1 276 ? 25.984 17.123  1.270   1.00 0.00   ? 288  LYS A HZ3  1 
ATOM   2615 N N    . ALA A 1 277 ? 31.759 12.241  -0.622  1.00 13.60  ? 289  ALA A N    1 
ATOM   2616 C CA   . ALA A 1 277 ? 32.522 11.771  -1.768  1.00 11.15  ? 289  ALA A CA   1 
ATOM   2617 C C    . ALA A 1 277 ? 32.755 10.268  -1.600  1.00 10.70  ? 289  ALA A C    1 
ATOM   2618 O O    . ALA A 1 277 ? 32.728 9.520   -2.576  1.00 13.66  ? 289  ALA A O    1 
ATOM   2619 C CB   . ALA A 1 277 ? 33.858 12.517  -1.864  1.00 9.91   ? 289  ALA A CB   1 
ATOM   2620 H H    . ALA A 1 277 ? 32.166 12.867  0.012   1.00 0.00   ? 289  ALA A H    1 
ATOM   2621 N N    . ALA A 1 278 ? 32.956 9.832   -0.354  1.00 9.07   ? 290  ALA A N    1 
ATOM   2622 C CA   . ALA A 1 278 ? 33.171 8.418   -0.061  1.00 10.40  ? 290  ALA A CA   1 
ATOM   2623 C C    . ALA A 1 278 ? 31.919 7.576   -0.355  1.00 11.18  ? 290  ALA A C    1 
ATOM   2624 O O    . ALA A 1 278 ? 32.016 6.436   -0.822  1.00 12.30  ? 290  ALA A O    1 
ATOM   2625 C CB   . ALA A 1 278 ? 33.596 8.238   1.401   1.00 7.97   ? 290  ALA A CB   1 
ATOM   2626 H H    . ALA A 1 278 ? 32.955 10.478  0.382   1.00 0.00   ? 290  ALA A H    1 
ATOM   2627 N N    . ILE A 1 279 ? 30.745 8.154   -0.103  1.00 12.25  ? 291  ILE A N    1 
ATOM   2628 C CA   . ILE A 1 279 ? 29.471 7.471   -0.338  1.00 10.43  ? 291  ILE A CA   1 
ATOM   2629 C C    . ILE A 1 279 ? 29.221 7.350   -1.839  1.00 9.35   ? 291  ILE A C    1 
ATOM   2630 O O    . ILE A 1 279 ? 28.819 6.294   -2.336  1.00 13.54  ? 291  ILE A O    1 
ATOM   2631 C CB   . ILE A 1 279 ? 28.305 8.253   0.311   1.00 9.22   ? 291  ILE A CB   1 
ATOM   2632 C CG1  . ILE A 1 279 ? 28.435 8.220   1.827   1.00 10.92  ? 291  ILE A CG1  1 
ATOM   2633 C CG2  . ILE A 1 279 ? 26.973 7.669   -0.127  1.00 10.68  ? 291  ILE A CG2  1 
ATOM   2634 C CD1  . ILE A 1 279 ? 27.716 9.355   2.521   1.00 12.49  ? 291  ILE A CD1  1 
ATOM   2635 H H    . ILE A 1 279 ? 30.735 9.069   0.247   1.00 0.00   ? 291  ILE A H    1 
ATOM   2636 N N    . ARG A 1 280 ? 29.460 8.451   -2.547  1.00 9.43   ? 292  ARG A N    1 
ATOM   2637 C CA   . ARG A 1 280 ? 29.288 8.491   -3.985  1.00 6.98   ? 292  ARG A CA   1 
ATOM   2638 C C    . ARG A 1 280 ? 30.114 7.406   -4.681  1.00 11.91  ? 292  ARG A C    1 
ATOM   2639 O O    . ARG A 1 280 ? 29.647 6.788   -5.644  1.00 17.39  ? 292  ARG A O    1 
ATOM   2640 C CB   . ARG A 1 280 ? 29.650 9.880   -4.504  1.00 11.25  ? 292  ARG A CB   1 
ATOM   2641 C CG   . ARG A 1 280 ? 29.625 10.045  -6.016  1.00 12.28  ? 292  ARG A CG   1 
ATOM   2642 C CD   . ARG A 1 280 ? 28.252 9.799   -6.614  1.00 13.04  ? 292  ARG A CD   1 
ATOM   2643 N NE   . ARG A 1 280 ? 28.164 10.403  -7.945  1.00 13.25  ? 292  ARG A NE   1 
ATOM   2644 C CZ   . ARG A 1 280 ? 27.349 9.994   -8.914  1.00 11.42  ? 292  ARG A CZ   1 
ATOM   2645 N NH1  . ARG A 1 280 ? 26.535 8.961   -8.720  1.00 13.56  ? 292  ARG A NH1  1 
ATOM   2646 N NH2  . ARG A 1 280 ? 27.326 10.640  -10.070 1.00 13.01  ? 292  ARG A NH2  1 
ATOM   2647 H H    . ARG A 1 280 ? 29.769 9.253   -2.081  1.00 0.00   ? 292  ARG A H    1 
ATOM   2648 H HE   . ARG A 1 280 ? 28.747 11.166  -8.141  1.00 0.00   ? 292  ARG A HE   1 
ATOM   2649 H HH11 . ARG A 1 280 ? 26.537 8.484   -7.843  1.00 0.00   ? 292  ARG A HH11 1 
ATOM   2650 H HH12 . ARG A 1 280 ? 25.925 8.659   -9.453  1.00 0.00   ? 292  ARG A HH12 1 
ATOM   2651 H HH21 . ARG A 1 280 ? 27.920 11.432  -10.211 1.00 0.00   ? 292  ARG A HH21 1 
ATOM   2652 H HH22 . ARG A 1 280 ? 26.715 10.335  -10.800 1.00 0.00   ? 292  ARG A HH22 1 
ATOM   2653 N N    . ALA A 1 281 ? 31.320 7.134   -4.182  1.00 15.57  ? 293  ALA A N    1 
ATOM   2654 C CA   . ALA A 1 281 ? 32.172 6.113   -4.810  1.00 13.23  ? 293  ALA A CA   1 
ATOM   2655 C C    . ALA A 1 281 ? 31.886 4.686   -4.348  1.00 12.58  ? 293  ALA A C    1 
ATOM   2656 O O    . ALA A 1 281 ? 32.558 3.741   -4.765  1.00 16.13  ? 293  ALA A O    1 
ATOM   2657 C CB   . ALA A 1 281 ? 33.643 6.455   -4.599  1.00 10.47  ? 293  ALA A CB   1 
ATOM   2658 H H    . ALA A 1 281 ? 31.638 7.615   -3.390  1.00 0.00   ? 293  ALA A H    1 
ATOM   2659 N N    . ASN A 1 282 ? 30.888 4.539   -3.484  1.00 9.38   ? 294  ASN A N    1 
ATOM   2660 C CA   . ASN A 1 282 ? 30.499 3.235   -2.973  1.00 9.50   ? 294  ASN A CA   1 
ATOM   2661 C C    . ASN A 1 282 ? 29.149 2.817   -3.566  1.00 11.74  ? 294  ASN A C    1 
ATOM   2662 O O    . ASN A 1 282 ? 29.098 2.070   -4.542  1.00 11.65  ? 294  ASN A O    1 
ATOM   2663 C CB   . ASN A 1 282 ? 30.461 3.295   -1.438  1.00 4.92   ? 294  ASN A CB   1 
ATOM   2664 C CG   . ASN A 1 282 ? 30.193 1.952   -0.790  1.00 5.91   ? 294  ASN A CG   1 
ATOM   2665 O OD1  . ASN A 1 282 ? 29.803 0.990   -1.450  1.00 12.85  ? 294  ASN A OD1  1 
ATOM   2666 N ND2  . ASN A 1 282 ? 30.376 1.886   0.523   1.00 7.13   ? 294  ASN A ND2  1 
ATOM   2667 H H    . ASN A 1 282 ? 30.405 5.331   -3.179  1.00 0.00   ? 294  ASN A H    1 
ATOM   2668 H HD21 . ASN A 1 282 ? 30.669 2.694   0.995   1.00 0.00   ? 294  ASN A HD21 1 
ATOM   2669 H HD22 . ASN A 1 282 ? 30.210 1.029   0.968   1.00 0.00   ? 294  ASN A HD22 1 
ATOM   2670 N N    . TYR A 1 283 ? 28.061 3.358   -3.022  1.00 14.70  ? 295  TYR A N    1 
ATOM   2671 C CA   . TYR A 1 283 ? 26.724 3.008   -3.501  1.00 10.21  ? 295  TYR A CA   1 
ATOM   2672 C C    . TYR A 1 283 ? 25.931 4.206   -4.051  1.00 12.02  ? 295  TYR A C    1 
ATOM   2673 O O    . TYR A 1 283 ? 24.740 4.099   -4.350  1.00 15.71  ? 295  TYR A O    1 
ATOM   2674 C CB   . TYR A 1 283 ? 25.944 2.307   -2.388  1.00 8.53   ? 295  TYR A CB   1 
ATOM   2675 C CG   . TYR A 1 283 ? 25.847 3.125   -1.130  1.00 9.30   ? 295  TYR A CG   1 
ATOM   2676 C CD1  . TYR A 1 283 ? 24.887 4.123   -1.008  1.00 11.42  ? 295  TYR A CD1  1 
ATOM   2677 C CD2  . TYR A 1 283 ? 26.746 2.946   -0.077  1.00 8.45   ? 295  TYR A CD2  1 
ATOM   2678 C CE1  . TYR A 1 283 ? 24.821 4.930   0.115   1.00 9.75   ? 295  TYR A CE1  1 
ATOM   2679 C CE2  . TYR A 1 283 ? 26.688 3.753   1.061   1.00 10.69  ? 295  TYR A CE2  1 
ATOM   2680 C CZ   . TYR A 1 283 ? 25.721 4.743   1.143   1.00 11.74  ? 295  TYR A CZ   1 
ATOM   2681 O OH   . TYR A 1 283 ? 25.640 5.566   2.239   1.00 12.24  ? 295  TYR A OH   1 
ATOM   2682 H H    . TYR A 1 283 ? 28.147 4.009   -2.295  1.00 0.00   ? 295  TYR A H    1 
ATOM   2683 H HH   . TYR A 1 283 ? 24.921 6.193   2.126   1.00 0.00   ? 295  TYR A HH   1 
ATOM   2684 N N    . SER A 1 284 ? 26.604 5.347   -4.165  1.00 9.19   ? 296  SER A N    1 
ATOM   2685 C CA   . SER A 1 284 ? 26.035 6.579   -4.708  1.00 7.34   ? 296  SER A CA   1 
ATOM   2686 C C    . SER A 1 284 ? 25.085 7.425   -3.834  1.00 11.51  ? 296  SER A C    1 
ATOM   2687 O O    . SER A 1 284 ? 25.396 8.580   -3.519  1.00 11.14  ? 296  SER A O    1 
ATOM   2688 C CB   . SER A 1 284 ? 25.466 6.321   -6.106  1.00 5.03   ? 296  SER A CB   1 
ATOM   2689 O OG   . SER A 1 284 ? 25.267 7.537   -6.790  1.00 10.95  ? 296  SER A OG   1 
ATOM   2690 H H    . SER A 1 284 ? 27.538 5.364   -3.870  1.00 0.00   ? 296  SER A H    1 
ATOM   2691 H HG   . SER A 1 284 ? 24.914 7.360   -7.665  1.00 0.00   ? 296  SER A HG   1 
ATOM   2692 N N    . ASN A 1 285 ? 23.912 6.890   -3.487  1.00 11.31  ? 297  ASN A N    1 
ATOM   2693 C CA   . ASN A 1 285 ? 22.947 7.581   -2.631  1.00 11.99  ? 297  ASN A CA   1 
ATOM   2694 C C    . ASN A 1 285 ? 22.182 6.450   -1.913  1.00 11.93  ? 297  ASN A C    1 
ATOM   2695 O O    . ASN A 1 285 ? 22.130 5.325   -2.424  1.00 8.47   ? 297  ASN A O    1 
ATOM   2696 C CB   . ASN A 1 285 ? 22.028 8.534   -3.436  1.00 13.29  ? 297  ASN A CB   1 
ATOM   2697 C CG   . ASN A 1 285 ? 21.676 8.005   -4.815  1.00 11.02  ? 297  ASN A CG   1 
ATOM   2698 O OD1  . ASN A 1 285 ? 22.251 8.422   -5.837  1.00 19.22  ? 297  ASN A OD1  1 
ATOM   2699 N ND2  . ASN A 1 285 ? 20.734 7.087   -4.861  1.00 9.00   ? 297  ASN A ND2  1 
ATOM   2700 H H    . ASN A 1 285 ? 23.690 5.998   -3.825  1.00 0.00   ? 297  ASN A H    1 
ATOM   2701 H HD21 . ASN A 1 285 ? 20.319 6.802   -4.020  1.00 0.00   ? 297  ASN A HD21 1 
ATOM   2702 H HD22 . ASN A 1 285 ? 20.487 6.725   -5.737  1.00 0.00   ? 297  ASN A HD22 1 
ATOM   2703 N N    . PRO A 1 286 ? 21.577 6.679   -0.726  1.00 9.05   ? 298  PRO A N    1 
ATOM   2704 C CA   . PRO A 1 286 ? 20.921 5.587   -0.032  1.00 10.43  ? 298  PRO A CA   1 
ATOM   2705 C C    . PRO A 1 286 ? 19.455 5.168   -0.440  1.00 8.95   ? 298  PRO A C    1 
ATOM   2706 O O    . PRO A 1 286 ? 18.721 5.957   -1.058  1.00 13.13  ? 298  PRO A O    1 
ATOM   2707 C CB   . PRO A 1 286 ? 20.999 6.005   1.419   1.00 7.38   ? 298  PRO A CB   1 
ATOM   2708 C CG   . PRO A 1 286 ? 20.826 7.538   1.341   1.00 6.82   ? 298  PRO A CG   1 
ATOM   2709 C CD   . PRO A 1 286 ? 21.227 7.980   -0.084  1.00 9.61   ? 298  PRO A CD   1 
ATOM   2710 N N    . PRO A 1 287 ? 19.045 3.921   -0.109  1.00 9.84   ? 299  PRO A N    1 
ATOM   2711 C CA   . PRO A 1 287 ? 17.686 3.481   -0.456  1.00 8.62   ? 299  PRO A CA   1 
ATOM   2712 C C    . PRO A 1 287 ? 16.625 4.197   0.380   1.00 10.76  ? 299  PRO A C    1 
ATOM   2713 O O    . PRO A 1 287 ? 16.701 4.227   1.606   1.00 13.31  ? 299  PRO A O    1 
ATOM   2714 C CB   . PRO A 1 287 ? 17.722 1.975   -0.208  1.00 7.58   ? 299  PRO A CB   1 
ATOM   2715 C CG   . PRO A 1 287 ? 18.678 1.828   0.914   1.00 5.51   ? 299  PRO A CG   1 
ATOM   2716 C CD   . PRO A 1 287 ? 19.746 2.893   0.688   1.00 9.78   ? 299  PRO A CD   1 
ATOM   2717 N N    . ALA A 1 288 ? 15.655 4.789   -0.305  1.00 9.94   ? 300  ALA A N    1 
ATOM   2718 C CA   . ALA A 1 288 ? 14.605 5.572   0.337   1.00 11.39  ? 300  ALA A CA   1 
ATOM   2719 C C    . ALA A 1 288 ? 13.572 4.851   1.188   1.00 8.15   ? 300  ALA A C    1 
ATOM   2720 O O    . ALA A 1 288 ? 13.238 5.320   2.270   1.00 12.05  ? 300  ALA A O    1 
ATOM   2721 C CB   . ALA A 1 288 ? 13.886 6.410   -0.705  1.00 10.46  ? 300  ALA A CB   1 
ATOM   2722 H H    . ALA A 1 288 ? 15.645 4.695   -1.280  1.00 0.00   ? 300  ALA A H    1 
ATOM   2723 N N    . HIS A 1 289 ? 13.099 3.700   0.724   1.00 8.96   ? 301  HIS A N    1 
ATOM   2724 C CA   . HIS A 1 289 ? 12.036 3.018   1.444   1.00 10.62  ? 301  HIS A CA   1 
ATOM   2725 C C    . HIS A 1 289 ? 12.089 2.909   2.961   1.00 9.90   ? 301  HIS A C    1 
ATOM   2726 O O    . HIS A 1 289 ? 11.240 3.493   3.636   1.00 14.86  ? 301  HIS A O    1 
ATOM   2727 C CB   . HIS A 1 289 ? 11.688 1.661   0.838   1.00 9.99   ? 301  HIS A CB   1 
ATOM   2728 C CG   . HIS A 1 289 ? 10.330 1.183   1.269   1.00 15.25  ? 301  HIS A CG   1 
ATOM   2729 N ND1  . HIS A 1 289 ? 9.175  1.755   0.791   1.00 12.55  ? 301  HIS A ND1  1 
ATOM   2730 C CD2  . HIS A 1 289 ? 9.962  0.272   2.186   1.00 14.29  ? 301  HIS A CD2  1 
ATOM   2731 C CE1  . HIS A 1 289 ? 8.143  1.211   1.410   1.00 17.24  ? 301  HIS A CE1  1 
ATOM   2732 N NE2  . HIS A 1 289 ? 8.593  0.318   2.254   1.00 16.42  ? 301  HIS A NE2  1 
ATOM   2733 H H    . HIS A 1 289 ? 13.466 3.313   -0.098  1.00 0.00   ? 301  HIS A H    1 
ATOM   2734 H HD1  . HIS A 1 289 ? 9.119  2.453   0.106   1.00 0.00   ? 301  HIS A HD1  1 
ATOM   2735 H HE2  . HIS A 1 289 ? 8.034  -0.186  2.845   1.00 0.00   ? 301  HIS A HE2  1 
ATOM   2736 N N    . GLY A 1 290 ? 13.044 2.155   3.496   1.00 9.39   ? 302  GLY A N    1 
ATOM   2737 C CA   . GLY A 1 290 ? 13.116 1.998   4.939   1.00 9.42   ? 302  GLY A CA   1 
ATOM   2738 C C    . GLY A 1 290 ? 13.276 3.282   5.726   1.00 10.48  ? 302  GLY A C    1 
ATOM   2739 O O    . GLY A 1 290 ? 12.686 3.433   6.800   1.00 13.40  ? 302  GLY A O    1 
ATOM   2740 H H    . GLY A 1 290 ? 13.699 1.707   2.921   1.00 0.00   ? 302  GLY A H    1 
ATOM   2741 N N    . ALA A 1 291 ? 14.081 4.199   5.200   1.00 10.62  ? 303  ALA A N    1 
ATOM   2742 C CA   . ALA A 1 291 ? 14.340 5.463   5.870   1.00 11.63  ? 303  ALA A CA   1 
ATOM   2743 C C    . ALA A 1 291 ? 13.180 6.445   5.835   1.00 7.53   ? 303  ALA A C    1 
ATOM   2744 O O    . ALA A 1 291 ? 13.057 7.278   6.737   1.00 9.59   ? 303  ALA A O    1 
ATOM   2745 C CB   . ALA A 1 291 ? 15.583 6.107   5.310   1.00 7.79   ? 303  ALA A CB   1 
ATOM   2746 H H    . ALA A 1 291 ? 14.508 4.019   4.336   1.00 0.00   ? 303  ALA A H    1 
ATOM   2747 N N    . SER A 1 292 ? 12.377 6.423   4.774   1.00 11.99  ? 304  SER A N    1 
ATOM   2748 C CA   . SER A 1 292 ? 11.229 7.311   4.758   1.00 14.88  ? 304  SER A CA   1 
ATOM   2749 C C    . SER A 1 292 ? 10.199 6.685   5.708   1.00 15.08  ? 304  SER A C    1 
ATOM   2750 O O    . SER A 1 292 ? 9.413  7.406   6.318   1.00 17.31  ? 304  SER A O    1 
ATOM   2751 C CB   . SER A 1 292 ? 10.683 7.546   3.343   1.00 15.26  ? 304  SER A CB   1 
ATOM   2752 O OG   . SER A 1 292 ? 10.514 6.338   2.639   1.00 27.88  ? 304  SER A OG   1 
ATOM   2753 H H    . SER A 1 292 ? 12.543 5.807   4.036   1.00 0.00   ? 304  SER A H    1 
ATOM   2754 H HG   . SER A 1 292 ? 10.170 6.522   1.762   1.00 0.00   ? 304  SER A HG   1 
ATOM   2755 N N    . VAL A 1 293 ? 10.220 5.352   5.844   1.00 13.61  ? 305  VAL A N    1 
ATOM   2756 C CA   . VAL A 1 293 ? 9.328  4.693   6.800   1.00 10.24  ? 305  VAL A CA   1 
ATOM   2757 C C    . VAL A 1 293 ? 9.693  5.214   8.205   1.00 15.57  ? 305  VAL A C    1 
ATOM   2758 O O    . VAL A 1 293 ? 8.824  5.681   8.943   1.00 14.48  ? 305  VAL A O    1 
ATOM   2759 C CB   . VAL A 1 293 ? 9.441  3.124   6.768   1.00 11.56  ? 305  VAL A CB   1 
ATOM   2760 C CG1  . VAL A 1 293 ? 8.812  2.509   8.025   1.00 9.96   ? 305  VAL A CG1  1 
ATOM   2761 C CG2  . VAL A 1 293 ? 8.752  2.561   5.551   1.00 8.14   ? 305  VAL A CG2  1 
ATOM   2762 H H    . VAL A 1 293 ? 10.837 4.815   5.305   1.00 0.00   ? 305  VAL A H    1 
ATOM   2763 N N    . VAL A 1 294 ? 10.988 5.179   8.542   1.00 12.39  ? 306  VAL A N    1 
ATOM   2764 C CA   . VAL A 1 294 ? 11.475 5.660   9.844   1.00 8.91   ? 306  VAL A CA   1 
ATOM   2765 C C    . VAL A 1 294 ? 11.211 7.154   10.046  1.00 8.57   ? 306  VAL A C    1 
ATOM   2766 O O    . VAL A 1 294 ? 10.809 7.582   11.137  1.00 9.40   ? 306  VAL A O    1 
ATOM   2767 C CB   . VAL A 1 294 ? 13.006 5.358   10.040  1.00 8.84   ? 306  VAL A CB   1 
ATOM   2768 C CG1  . VAL A 1 294 ? 13.594 6.173   11.198  1.00 6.98   ? 306  VAL A CG1  1 
ATOM   2769 C CG2  . VAL A 1 294 ? 13.207 3.887   10.312  1.00 11.54  ? 306  VAL A CG2  1 
ATOM   2770 H H    . VAL A 1 294 ? 11.634 4.830   7.896   1.00 0.00   ? 306  VAL A H    1 
ATOM   2771 N N    . ALA A 1 295 ? 11.422 7.950   9.003   1.00 8.64   ? 307  ALA A N    1 
ATOM   2772 C CA   . ALA A 1 295 ? 11.176 9.380   9.120   1.00 10.67  ? 307  ALA A CA   1 
ATOM   2773 C C    . ALA A 1 295 ? 9.685  9.662   9.389   1.00 12.57  ? 307  ALA A C    1 
ATOM   2774 O O    . ALA A 1 295 ? 9.354  10.433  10.285  1.00 13.85  ? 307  ALA A O    1 
ATOM   2775 C CB   . ALA A 1 295 ? 11.657 10.109  7.851   1.00 9.65   ? 307  ALA A CB   1 
ATOM   2776 H H    . ALA A 1 295 ? 11.721 7.568   8.156   1.00 0.00   ? 307  ALA A H    1 
ATOM   2777 N N    . THR A 1 296 ? 8.809  8.959   8.664   1.00 15.28  ? 308  THR A N    1 
ATOM   2778 C CA   . THR A 1 296 ? 7.348  9.074   8.783   1.00 14.06  ? 308  THR A CA   1 
ATOM   2779 C C    . THR A 1 296 ? 6.848  8.718   10.187  1.00 11.89  ? 308  THR A C    1 
ATOM   2780 O O    . THR A 1 296 ? 6.095  9.472   10.809  1.00 11.30  ? 308  THR A O    1 
ATOM   2781 C CB   . THR A 1 296 ? 6.679  8.172   7.706   1.00 12.03  ? 308  THR A CB   1 
ATOM   2782 O OG1  . THR A 1 296 ? 7.043  8.666   6.411   1.00 15.95  ? 308  THR A OG1  1 
ATOM   2783 C CG2  . THR A 1 296 ? 5.155  8.142   7.835   1.00 17.19  ? 308  THR A CG2  1 
ATOM   2784 H H    . THR A 1 296 ? 9.174  8.318   8.026   1.00 0.00   ? 308  THR A H    1 
ATOM   2785 H HG1  . THR A 1 296 ? 6.646  8.112   5.736   1.00 0.00   ? 308  THR A HG1  1 
ATOM   2786 N N    . ILE A 1 297 ? 7.320  7.595   10.708  1.00 11.87  ? 309  ILE A N    1 
ATOM   2787 C CA   . ILE A 1 297 ? 6.922  7.159   12.033  1.00 10.82  ? 309  ILE A CA   1 
ATOM   2788 C C    . ILE A 1 297 ? 7.422  8.123   13.098  1.00 16.70  ? 309  ILE A C    1 
ATOM   2789 O O    . ILE A 1 297 ? 6.672  8.527   13.988  1.00 16.82  ? 309  ILE A O    1 
ATOM   2790 C CB   . ILE A 1 297 ? 7.472  5.764   12.346  1.00 12.67  ? 309  ILE A CB   1 
ATOM   2791 C CG1  . ILE A 1 297 ? 6.796  4.719   11.472  1.00 11.70  ? 309  ILE A CG1  1 
ATOM   2792 C CG2  . ILE A 1 297 ? 7.234  5.417   13.793  1.00 10.38  ? 309  ILE A CG2  1 
ATOM   2793 C CD1  . ILE A 1 297 ? 7.287  3.324   11.744  1.00 5.05   ? 309  ILE A CD1  1 
ATOM   2794 H H    . ILE A 1 297 ? 7.955  7.057   10.194  1.00 0.00   ? 309  ILE A H    1 
ATOM   2795 N N    . LEU A 1 298 ? 8.677  8.540   12.970  1.00 17.54  ? 310  LEU A N    1 
ATOM   2796 C CA   . LEU A 1 298 ? 9.277  9.437   13.951  1.00 17.99  ? 310  LEU A CA   1 
ATOM   2797 C C    . LEU A 1 298 ? 8.689  10.845  13.941  1.00 18.92  ? 310  LEU A C    1 
ATOM   2798 O O    . LEU A 1 298 ? 8.601  11.495  14.982  1.00 20.62  ? 310  LEU A O    1 
ATOM   2799 C CB   . LEU A 1 298 ? 10.793 9.482   13.746  1.00 22.75  ? 310  LEU A CB   1 
ATOM   2800 C CG   . LEU A 1 298 ? 11.665 8.835   14.835  1.00 25.77  ? 310  LEU A CG   1 
ATOM   2801 C CD1  . LEU A 1 298 ? 10.911 7.776   15.629  1.00 26.27  ? 310  LEU A CD1  1 
ATOM   2802 C CD2  . LEU A 1 298 ? 12.914 8.265   14.192  1.00 22.79  ? 310  LEU A CD2  1 
ATOM   2803 H H    . LEU A 1 298 ? 9.200  8.245   12.199  1.00 0.00   ? 310  LEU A H    1 
ATOM   2804 N N    . SER A 1 299 ? 8.221  11.273  12.774  1.00 19.44  ? 311  SER A N    1 
ATOM   2805 C CA   . SER A 1 299 ? 7.643  12.598  12.608  1.00 23.27  ? 311  SER A CA   1 
ATOM   2806 C C    . SER A 1 299 ? 6.166  12.701  12.966  1.00 26.24  ? 311  SER A C    1 
ATOM   2807 O O    . SER A 1 299 ? 5.663  13.794  13.212  1.00 29.59  ? 311  SER A O    1 
ATOM   2808 C CB   . SER A 1 299 ? 7.821  13.067  11.166  1.00 23.54  ? 311  SER A CB   1 
ATOM   2809 O OG   . SER A 1 299 ? 9.159  13.448  10.909  1.00 36.89  ? 311  SER A OG   1 
ATOM   2810 H H    . SER A 1 299 ? 8.254  10.669  12.005  1.00 0.00   ? 311  SER A H    1 
ATOM   2811 H HG   . SER A 1 299 ? 9.242  13.731  9.996   1.00 0.00   ? 311  SER A HG   1 
ATOM   2812 N N    . ASN A 1 300 ? 5.479  11.564  12.986  1.00 28.42  ? 312  ASN A N    1 
ATOM   2813 C CA   . ASN A 1 300 ? 4.048  11.522  13.272  1.00 24.68  ? 312  ASN A CA   1 
ATOM   2814 C C    . ASN A 1 300 ? 3.805  11.061  14.715  1.00 24.38  ? 312  ASN A C    1 
ATOM   2815 O O    . ASN A 1 300 ? 4.212  9.962   15.082  1.00 22.54  ? 312  ASN A O    1 
ATOM   2816 C CB   . ASN A 1 300 ? 3.400  10.569  12.259  1.00 24.44  ? 312  ASN A CB   1 
ATOM   2817 C CG   . ASN A 1 300 ? 1.901  10.520  12.366  1.00 27.11  ? 312  ASN A CG   1 
ATOM   2818 O OD1  . ASN A 1 300 ? 1.185  10.954  11.461  1.00 28.11  ? 312  ASN A OD1  1 
ATOM   2819 N ND2  . ASN A 1 300 ? 1.407  9.930   13.440  1.00 24.41  ? 312  ASN A ND2  1 
ATOM   2820 H H    . ASN A 1 300 ? 5.950  10.723  12.804  1.00 0.00   ? 312  ASN A H    1 
ATOM   2821 H HD21 . ASN A 1 300 ? 2.037  9.572   14.095  1.00 0.00   ? 312  ASN A HD21 1 
ATOM   2822 H HD22 . ASN A 1 300 ? 0.434  9.876   13.536  1.00 0.00   ? 312  ASN A HD22 1 
ATOM   2823 N N    . ASP A 1 301 ? 3.107  11.878  15.508  1.00 24.84  ? 313  ASP A N    1 
ATOM   2824 C CA   . ASP A 1 301 ? 2.839  11.547  16.915  1.00 22.66  ? 313  ASP A CA   1 
ATOM   2825 C C    . ASP A 1 301 ? 2.107  10.235  17.191  1.00 17.87  ? 313  ASP A C    1 
ATOM   2826 O O    . ASP A 1 301 ? 2.439  9.532   18.144  1.00 19.38  ? 313  ASP A O    1 
ATOM   2827 C CB   . ASP A 1 301 ? 2.069  12.676  17.620  1.00 33.96  ? 313  ASP A CB   1 
ATOM   2828 C CG   . ASP A 1 301 ? 2.927  13.899  17.920  1.00 44.06  ? 313  ASP A CG   1 
ATOM   2829 O OD1  . ASP A 1 301 ? 4.162  13.777  18.070  1.00 50.61  ? 313  ASP A OD1  1 
ATOM   2830 O OD2  . ASP A 1 301 ? 2.333  14.992  18.029  1.00 50.74  ? 313  ASP A OD2  1 
ATOM   2831 H H    . ASP A 1 301 ? 2.765  12.720  15.141  1.00 0.00   ? 313  ASP A H    1 
ATOM   2832 N N    . ALA A 1 302 ? 1.082  9.934   16.399  1.00 13.60  ? 314  ALA A N    1 
ATOM   2833 C CA   . ALA A 1 302 ? 0.312  8.715   16.613  1.00 14.52  ? 314  ALA A CA   1 
ATOM   2834 C C    . ALA A 1 302 ? 1.117  7.493   16.240  1.00 15.73  ? 314  ALA A C    1 
ATOM   2835 O O    . ALA A 1 302 ? 1.173  6.499   16.971  1.00 16.41  ? 314  ALA A O    1 
ATOM   2836 C CB   . ALA A 1 302 ? -0.968 8.759   15.797  1.00 17.06  ? 314  ALA A CB   1 
ATOM   2837 H H    . ALA A 1 302 ? 0.846  10.537  15.663  1.00 0.00   ? 314  ALA A H    1 
ATOM   2838 N N    . LEU A 1 303 ? 1.750  7.591   15.082  1.00 13.41  ? 315  LEU A N    1 
ATOM   2839 C CA   . LEU A 1 303 ? 2.570  6.528   14.543  1.00 16.65  ? 315  LEU A CA   1 
ATOM   2840 C C    . LEU A 1 303 ? 3.775  6.245   15.446  1.00 15.12  ? 315  LEU A C    1 
ATOM   2841 O O    . LEU A 1 303 ? 4.170  5.089   15.610  1.00 17.33  ? 315  LEU A O    1 
ATOM   2842 C CB   . LEU A 1 303 ? 2.994  6.918   13.132  1.00 21.21  ? 315  LEU A CB   1 
ATOM   2843 C CG   . LEU A 1 303 ? 2.703  5.981   11.958  1.00 23.61  ? 315  LEU A CG   1 
ATOM   2844 C CD1  . LEU A 1 303 ? 1.352  5.268   12.055  1.00 18.65  ? 315  LEU A CD1  1 
ATOM   2845 C CD2  . LEU A 1 303 ? 2.781  6.828   10.705  1.00 22.01  ? 315  LEU A CD2  1 
ATOM   2846 H H    . LEU A 1 303 ? 1.653  8.410   14.576  1.00 0.00   ? 315  LEU A H    1 
ATOM   2847 N N    . ARG A 1 304 ? 4.323  7.293   16.064  1.00 15.50  ? 316  ARG A N    1 
ATOM   2848 C CA   . ARG A 1 304 ? 5.462  7.131   16.963  1.00 12.69  ? 316  ARG A CA   1 
ATOM   2849 C C    . ARG A 1 304 ? 5.040  6.456   18.258  1.00 13.00  ? 316  ARG A C    1 
ATOM   2850 O O    . ARG A 1 304 ? 5.780  5.646   18.810  1.00 11.13  ? 316  ARG A O    1 
ATOM   2851 C CB   . ARG A 1 304 ? 6.109  8.474   17.304  1.00 11.64  ? 316  ARG A CB   1 
ATOM   2852 C CG   . ARG A 1 304 ? 7.386  8.269   18.084  1.00 20.35  ? 316  ARG A CG   1 
ATOM   2853 C CD   . ARG A 1 304 ? 7.819  9.492   18.825  1.00 26.03  ? 316  ARG A CD   1 
ATOM   2854 N NE   . ARG A 1 304 ? 9.158  9.890   18.420  1.00 36.37  ? 316  ARG A NE   1 
ATOM   2855 C CZ   . ARG A 1 304 ? 10.249 9.775   19.175  1.00 36.22  ? 316  ARG A CZ   1 
ATOM   2856 N NH1  . ARG A 1 304 ? 10.197 9.255   20.399  1.00 37.95  ? 316  ARG A NH1  1 
ATOM   2857 N NH2  . ARG A 1 304 ? 11.390 10.272  18.734  1.00 39.11  ? 316  ARG A NH2  1 
ATOM   2858 H H    . ARG A 1 304 ? 3.939  8.180   15.925  1.00 0.00   ? 316  ARG A H    1 
ATOM   2859 H HE   . ARG A 1 304 ? 9.269  10.270  17.524  1.00 0.00   ? 316  ARG A HE   1 
ATOM   2860 H HH11 . ARG A 1 304 ? 9.322  8.951   20.766  1.00 0.00   ? 316  ARG A HH11 1 
ATOM   2861 H HH12 . ARG A 1 304 ? 11.029 9.177   20.949  1.00 0.00   ? 316  ARG A HH12 1 
ATOM   2862 H HH21 . ARG A 1 304 ? 11.426 10.726  17.844  1.00 0.00   ? 316  ARG A HH21 1 
ATOM   2863 H HH22 . ARG A 1 304 ? 12.218 10.193  19.290  1.00 0.00   ? 316  ARG A HH22 1 
ATOM   2864 N N    . ALA A 1 305 ? 3.865  6.841   18.757  1.00 15.55  ? 317  ALA A N    1 
ATOM   2865 C CA   . ALA A 1 305 ? 3.311  6.292   19.991  1.00 12.97  ? 317  ALA A CA   1 
ATOM   2866 C C    . ALA A 1 305 ? 3.161  4.783   19.848  1.00 11.79  ? 317  ALA A C    1 
ATOM   2867 O O    . ALA A 1 305 ? 3.503  4.023   20.759  1.00 13.29  ? 317  ALA A O    1 
ATOM   2868 C CB   . ALA A 1 305 ? 1.945  6.920   20.275  1.00 14.82  ? 317  ALA A CB   1 
ATOM   2869 H H    . ALA A 1 305 ? 3.352  7.518   18.270  1.00 0.00   ? 317  ALA A H    1 
ATOM   2870 N N    . ILE A 1 306 ? 2.638  4.363   18.698  1.00 9.96   ? 318  ILE A N    1 
ATOM   2871 C CA   . ILE A 1 306 ? 2.433  2.953   18.397  1.00 11.68  ? 318  ILE A CA   1 
ATOM   2872 C C    . ILE A 1 306 ? 3.779  2.203   18.316  1.00 13.08  ? 318  ILE A C    1 
ATOM   2873 O O    . ILE A 1 306 ? 3.943  1.168   18.965  1.00 12.85  ? 318  ILE A O    1 
ATOM   2874 C CB   . ILE A 1 306 ? 1.549  2.789   17.100  1.00 11.69  ? 318  ILE A CB   1 
ATOM   2875 C CG1  . ILE A 1 306 ? 0.132  3.334   17.371  1.00 15.08  ? 318  ILE A CG1  1 
ATOM   2876 C CG2  . ILE A 1 306 ? 1.463  1.322   16.681  1.00 8.16   ? 318  ILE A CG2  1 
ATOM   2877 C CD1  . ILE A 1 306 ? -0.697 3.624   16.124  1.00 15.26  ? 318  ILE A CD1  1 
ATOM   2878 H H    . ILE A 1 306 ? 2.387  5.030   18.026  1.00 0.00   ? 318  ILE A H    1 
ATOM   2879 N N    . TRP A 1 307 ? 4.767  2.783   17.627  1.00 17.35  ? 319  TRP A N    1 
ATOM   2880 C CA   . TRP A 1 307 ? 6.089  2.158   17.490  1.00 12.83  ? 319  TRP A CA   1 
ATOM   2881 C C    . TRP A 1 307 ? 6.795  1.978   18.838  1.00 6.95   ? 319  TRP A C    1 
ATOM   2882 O O    . TRP A 1 307 ? 7.298  0.896   19.135  1.00 9.03   ? 319  TRP A O    1 
ATOM   2883 C CB   . TRP A 1 307 ? 6.984  2.974   16.536  1.00 14.67  ? 319  TRP A CB   1 
ATOM   2884 C CG   . TRP A 1 307 ? 8.482  2.662   16.687  1.00 15.19  ? 319  TRP A CG   1 
ATOM   2885 C CD1  . TRP A 1 307 ? 9.116  1.476   16.405  1.00 15.82  ? 319  TRP A CD1  1 
ATOM   2886 C CD2  . TRP A 1 307 ? 9.490  3.527   17.234  1.00 13.19  ? 319  TRP A CD2  1 
ATOM   2887 N NE1  . TRP A 1 307 ? 10.432 1.557   16.759  1.00 15.36  ? 319  TRP A NE1  1 
ATOM   2888 C CE2  . TRP A 1 307 ? 10.696 2.796   17.272  1.00 16.44  ? 319  TRP A CE2  1 
ATOM   2889 C CE3  . TRP A 1 307 ? 9.479  4.842   17.706  1.00 15.52  ? 319  TRP A CE3  1 
ATOM   2890 C CZ2  . TRP A 1 307 ? 11.909 3.351   17.766  1.00 16.43  ? 319  TRP A CZ2  1 
ATOM   2891 C CZ3  . TRP A 1 307 ? 10.664 5.391   18.193  1.00 19.47  ? 319  TRP A CZ3  1 
ATOM   2892 C CH2  . TRP A 1 307 ? 11.866 4.640   18.223  1.00 18.29  ? 319  TRP A CH2  1 
ATOM   2893 H H    . TRP A 1 307 ? 4.604  3.652   17.206  1.00 0.00   ? 319  TRP A H    1 
ATOM   2894 H HE1  . TRP A 1 307 ? 11.079 0.849   16.649  1.00 0.00   ? 319  TRP A HE1  1 
ATOM   2895 N N    . GLU A 1 308 ? 6.801  3.030   19.653  1.00 9.05   ? 320  GLU A N    1 
ATOM   2896 C CA   . GLU A 1 308 ? 7.442  2.967   20.960  1.00 14.43  ? 320  GLU A CA   1 
ATOM   2897 C C    . GLU A 1 308 ? 6.871  1.863   21.822  1.00 15.02  ? 320  GLU A C    1 
ATOM   2898 O O    . GLU A 1 308 ? 7.565  1.314   22.683  1.00 14.97  ? 320  GLU A O    1 
ATOM   2899 C CB   . GLU A 1 308 ? 7.310  4.288   21.701  1.00 18.83  ? 320  GLU A CB   1 
ATOM   2900 C CG   . GLU A 1 308 ? 8.180  5.381   21.148  1.00 30.73  ? 320  GLU A CG   1 
ATOM   2901 C CD   . GLU A 1 308 ? 8.468  6.453   22.176  1.00 35.94  ? 320  GLU A CD   1 
ATOM   2902 O OE1  . GLU A 1 308 ? 8.752  6.100   23.341  1.00 34.74  ? 320  GLU A OE1  1 
ATOM   2903 O OE2  . GLU A 1 308 ? 8.411  7.645   21.817  1.00 40.32  ? 320  GLU A OE2  1 
ATOM   2904 H H    . GLU A 1 308 ? 6.360  3.853   19.370  1.00 0.00   ? 320  GLU A H    1 
ATOM   2905 N N    . GLN A 1 309 ? 5.583  1.583   21.642  1.00 15.75  ? 321  GLN A N    1 
ATOM   2906 C CA   . GLN A 1 309 ? 4.941  0.537   22.414  1.00 13.83  ? 321  GLN A CA   1 
ATOM   2907 C C    . GLN A 1 309 ? 5.350  -0.821  21.857  1.00 7.91   ? 321  GLN A C    1 
ATOM   2908 O O    . GLN A 1 309 ? 5.532  -1.763  22.613  1.00 9.78   ? 321  GLN A O    1 
ATOM   2909 C CB   . GLN A 1 309 ? 3.415  0.711   22.429  1.00 14.94  ? 321  GLN A CB   1 
ATOM   2910 C CG   . GLN A 1 309 ? 2.698  -0.292  23.327  1.00 19.77  ? 321  GLN A CG   1 
ATOM   2911 C CD   . GLN A 1 309 ? 3.283  -0.364  24.730  1.00 19.69  ? 321  GLN A CD   1 
ATOM   2912 O OE1  . GLN A 1 309 ? 3.398  0.646   25.424  1.00 20.38  ? 321  GLN A OE1  1 
ATOM   2913 N NE2  . GLN A 1 309 ? 3.649  -1.569  25.160  1.00 20.45  ? 321  GLN A NE2  1 
ATOM   2914 H H    . GLN A 1 309 ? 5.063  2.087   20.981  1.00 0.00   ? 321  GLN A H    1 
ATOM   2915 H HE21 . GLN A 1 309 ? 3.515  -2.320  24.550  1.00 0.00   ? 321  GLN A HE21 1 
ATOM   2916 H HE22 . GLN A 1 309 ? 4.033  -1.652  26.057  1.00 0.00   ? 321  GLN A HE22 1 
ATOM   2917 N N    . GLU A 1 310 ? 5.486  -0.911  20.534  1.00 9.55   ? 322  GLU A N    1 
ATOM   2918 C CA   . GLU A 1 310 ? 5.908  -2.153  19.907  1.00 12.63  ? 322  GLU A CA   1 
ATOM   2919 C C    . GLU A 1 310 ? 7.334  -2.467  20.311  1.00 12.58  ? 322  GLU A C    1 
ATOM   2920 O O    . GLU A 1 310 ? 7.706  -3.633  20.459  1.00 15.65  ? 322  GLU A O    1 
ATOM   2921 C CB   . GLU A 1 310 ? 5.796  -2.063  18.395  1.00 11.00  ? 322  GLU A CB   1 
ATOM   2922 C CG   . GLU A 1 310 ? 4.369  -1.946  17.940  1.00 12.92  ? 322  GLU A CG   1 
ATOM   2923 C CD   . GLU A 1 310 ? 4.240  -1.928  16.450  1.00 7.98   ? 322  GLU A CD   1 
ATOM   2924 O OE1  . GLU A 1 310 ? 4.565  -0.887  15.852  1.00 12.85  ? 322  GLU A OE1  1 
ATOM   2925 O OE2  . GLU A 1 310 ? 3.809  -2.957  15.893  1.00 17.09  ? 322  GLU A OE2  1 
ATOM   2926 H H    . GLU A 1 310 ? 5.305  -0.126  19.978  1.00 0.00   ? 322  GLU A H    1 
ATOM   2927 N N    . LEU A 1 311 ? 8.142  -1.420  20.459  1.00 17.47  ? 323  LEU A N    1 
ATOM   2928 C CA   . LEU A 1 311 ? 9.519  -1.599  20.890  1.00 14.45  ? 323  LEU A CA   1 
ATOM   2929 C C    . LEU A 1 311 ? 9.484  -1.993  22.370  1.00 13.73  ? 323  LEU A C    1 
ATOM   2930 O O    . LEU A 1 311 ? 10.256 -2.850  22.795  1.00 12.47  ? 323  LEU A O    1 
ATOM   2931 C CB   . LEU A 1 311 ? 10.349 -0.323  20.624  1.00 16.02  ? 323  LEU A CB   1 
ATOM   2932 C CG   . LEU A 1 311 ? 11.806 -0.145  21.102  1.00 17.39  ? 323  LEU A CG   1 
ATOM   2933 C CD1  . LEU A 1 311 ? 12.754 -1.238  20.623  1.00 12.79  ? 323  LEU A CD1  1 
ATOM   2934 C CD2  . LEU A 1 311 ? 12.274 1.207   20.604  1.00 17.80  ? 323  LEU A CD2  1 
ATOM   2935 H H    . LEU A 1 311 ? 7.803  -0.520  20.311  1.00 0.00   ? 323  LEU A H    1 
ATOM   2936 N N    . THR A 1 312 ? 8.545  -1.428  23.134  1.00 13.49  ? 324  THR A N    1 
ATOM   2937 C CA   . THR A 1 312 ? 8.439  -1.795  24.546  1.00 11.57  ? 324  THR A CA   1 
ATOM   2938 C C    . THR A 1 312 ? 8.031  -3.257  24.671  1.00 14.72  ? 324  THR A C    1 
ATOM   2939 O O    . THR A 1 312 ? 8.484  -3.952  25.590  1.00 19.40  ? 324  THR A O    1 
ATOM   2940 C CB   . THR A 1 312 ? 7.447  -0.904  25.308  1.00 8.09   ? 324  THR A CB   1 
ATOM   2941 O OG1  . THR A 1 312 ? 7.984  0.417   25.362  1.00 13.81  ? 324  THR A OG1  1 
ATOM   2942 C CG2  . THR A 1 312 ? 7.220  -1.429  26.738  1.00 6.84   ? 324  THR A CG2  1 
ATOM   2943 H H    . THR A 1 312 ? 7.925  -0.777  22.747  1.00 0.00   ? 324  THR A H    1 
ATOM   2944 H HG1  . THR A 1 312 ? 7.373  0.993   25.826  1.00 0.00   ? 324  THR A HG1  1 
ATOM   2945 N N    . ASP A 1 313 ? 7.205  -3.737  23.743  1.00 16.06  ? 325  ASP A N    1 
ATOM   2946 C CA   . ASP A 1 313 ? 6.794  -5.134  23.790  1.00 17.98  ? 325  ASP A CA   1 
ATOM   2947 C C    . ASP A 1 313 ? 7.970  -6.057  23.457  1.00 16.48  ? 325  ASP A C    1 
ATOM   2948 O O    . ASP A 1 313 ? 8.123  -7.098  24.088  1.00 17.95  ? 325  ASP A O    1 
ATOM   2949 C CB   . ASP A 1 313 ? 5.620  -5.430  22.834  1.00 20.15  ? 325  ASP A CB   1 
ATOM   2950 C CG   . ASP A 1 313 ? 4.335  -4.663  23.182  1.00 23.70  ? 325  ASP A CG   1 
ATOM   2951 O OD1  . ASP A 1 313 ? 4.093  -4.312  24.358  1.00 19.93  ? 325  ASP A OD1  1 
ATOM   2952 O OD2  . ASP A 1 313 ? 3.554  -4.440  22.235  1.00 23.63  ? 325  ASP A OD2  1 
ATOM   2953 H H    . ASP A 1 313 ? 6.891  -3.162  23.018  1.00 0.00   ? 325  ASP A H    1 
ATOM   2954 N N    . MET A 1 314 ? 8.780  -5.689  22.459  1.00 17.82  ? 326  MET A N    1 
ATOM   2955 C CA   . MET A 1 314 ? 9.933  -6.509  22.078  1.00 16.88  ? 326  MET A CA   1 
ATOM   2956 C C    . MET A 1 314 ? 10.875 -6.667  23.252  1.00 13.47  ? 326  MET A C    1 
ATOM   2957 O O    . MET A 1 314 ? 11.267 -7.779  23.612  1.00 13.47  ? 326  MET A O    1 
ATOM   2958 C CB   . MET A 1 314 ? 10.695 -5.889  20.910  1.00 16.77  ? 326  MET A CB   1 
ATOM   2959 C CG   . MET A 1 314 ? 9.912  -5.864  19.625  1.00 19.84  ? 326  MET A CG   1 
ATOM   2960 S SD   . MET A 1 314 ? 10.915 -5.489  18.192  1.00 25.29  ? 326  MET A SD   1 
ATOM   2961 C CE   . MET A 1 314 ? 11.012 -3.708  18.298  1.00 21.88  ? 326  MET A CE   1 
ATOM   2962 H H    . MET A 1 314 ? 8.602  -4.853  21.982  1.00 0.00   ? 326  MET A H    1 
ATOM   2963 N N    . ARG A 1 315 ? 11.216 -5.534  23.851  1.00 14.54  ? 327  ARG A N    1 
ATOM   2964 C CA   . ARG A 1 315 ? 12.102 -5.519  24.991  1.00 17.35  ? 327  ARG A CA   1 
ATOM   2965 C C    . ARG A 1 315 ? 11.584 -6.393  26.127  1.00 20.54  ? 327  ARG A C    1 
ATOM   2966 O O    . ARG A 1 315 ? 12.271 -7.320  26.559  1.00 24.30  ? 327  ARG A O    1 
ATOM   2967 C CB   . ARG A 1 315 ? 12.317 -4.090  25.485  1.00 16.25  ? 327  ARG A CB   1 
ATOM   2968 C CG   . ARG A 1 315 ? 13.093 -4.024  26.782  1.00 19.02  ? 327  ARG A CG   1 
ATOM   2969 C CD   . ARG A 1 315 ? 13.461 -2.597  27.124  1.00 19.55  ? 327  ARG A CD   1 
ATOM   2970 N NE   . ARG A 1 315 ? 12.314 -1.836  27.601  1.00 26.93  ? 327  ARG A NE   1 
ATOM   2971 C CZ   . ARG A 1 315 ? 11.780 -0.784  26.979  1.00 25.14  ? 327  ARG A CZ   1 
ATOM   2972 N NH1  . ARG A 1 315 ? 12.264 -0.329  25.823  1.00 24.35  ? 327  ARG A NH1  1 
ATOM   2973 N NH2  . ARG A 1 315 ? 10.768 -0.148  27.543  1.00 29.65  ? 327  ARG A NH2  1 
ATOM   2974 H H    . ARG A 1 315 ? 10.854 -4.690  23.515  1.00 0.00   ? 327  ARG A H    1 
ATOM   2975 H HE   . ARG A 1 315 ? 11.900 -2.117  28.444  1.00 0.00   ? 327  ARG A HE   1 
ATOM   2976 H HH11 . ARG A 1 315 ? 13.048 -0.779  25.397  1.00 0.00   ? 327  ARG A HH11 1 
ATOM   2977 H HH12 . ARG A 1 315 ? 11.841 0.462   25.382  1.00 0.00   ? 327  ARG A HH12 1 
ATOM   2978 H HH21 . ARG A 1 315 ? 10.413 -0.458  28.425  1.00 0.00   ? 327  ARG A HH21 1 
ATOM   2979 H HH22 . ARG A 1 315 ? 10.358 0.642   27.087  1.00 0.00   ? 327  ARG A HH22 1 
ATOM   2980 N N    . GLN A 1 316 ? 10.347 -6.159  26.558  1.00 22.72  ? 328  GLN A N    1 
ATOM   2981 C CA   . GLN A 1 316 ? 9.807  -6.933  27.678  1.00 21.06  ? 328  GLN A CA   1 
ATOM   2982 C C    . GLN A 1 316 ? 9.689  -8.409  27.417  1.00 20.46  ? 328  GLN A C    1 
ATOM   2983 O O    . GLN A 1 316 ? 9.838  -9.210  28.348  1.00 22.74  ? 328  GLN A O    1 
ATOM   2984 C CB   . GLN A 1 316 ? 8.470  -6.377  28.145  1.00 24.72  ? 328  GLN A CB   1 
ATOM   2985 C CG   . GLN A 1 316 ? 8.660  -4.979  28.633  1.00 29.32  ? 328  GLN A CG   1 
ATOM   2986 C CD   . GLN A 1 316 ? 7.423  -4.347  29.195  1.00 34.80  ? 328  GLN A CD   1 
ATOM   2987 O OE1  . GLN A 1 316 ? 7.518  -3.481  30.061  1.00 42.22  ? 328  GLN A OE1  1 
ATOM   2988 N NE2  . GLN A 1 316 ? 6.248  -4.718  28.681  1.00 31.94  ? 328  GLN A NE2  1 
ATOM   2989 H H    . GLN A 1 316 ? 9.800  -5.476  26.120  1.00 0.00   ? 328  GLN A H    1 
ATOM   2990 H HE21 . GLN A 1 316 ? 6.217  -5.379  27.959  1.00 0.00   ? 328  GLN A HE21 1 
ATOM   2991 H HE22 . GLN A 1 316 ? 5.444  -4.303  29.058  1.00 0.00   ? 328  GLN A HE22 1 
ATOM   2992 N N    . ARG A 1 317 ? 9.381  -8.778  26.175  1.00 18.38  ? 329  ARG A N    1 
ATOM   2993 C CA   . ARG A 1 317 ? 9.265  -10.186 25.861  1.00 19.45  ? 329  ARG A CA   1 
ATOM   2994 C C    . ARG A 1 317 ? 10.618 -10.870 25.977  1.00 22.85  ? 329  ARG A C    1 
ATOM   2995 O O    . ARG A 1 317 ? 10.694 -12.008 26.445  1.00 20.31  ? 329  ARG A O    1 
ATOM   2996 C CB   . ARG A 1 317 ? 8.689  -10.438 24.473  1.00 17.50  ? 329  ARG A CB   1 
ATOM   2997 C CG   . ARG A 1 317 ? 8.477  -11.942 24.264  1.00 18.36  ? 329  ARG A CG   1 
ATOM   2998 C CD   . ARG A 1 317 ? 7.941  -12.348 22.905  1.00 18.29  ? 329  ARG A CD   1 
ATOM   2999 N NE   . ARG A 1 317 ? 8.952  -12.957 22.040  1.00 18.98  ? 329  ARG A NE   1 
ATOM   3000 C CZ   . ARG A 1 317 ? 9.527  -14.148 22.222  1.00 19.37  ? 329  ARG A CZ   1 
ATOM   3001 N NH1  . ARG A 1 317 ? 9.256  -14.899 23.283  1.00 16.12  ? 329  ARG A NH1  1 
ATOM   3002 N NH2  . ARG A 1 317 ? 10.424 -14.579 21.344  1.00 20.50  ? 329  ARG A NH2  1 
ATOM   3003 H H    . ARG A 1 317 ? 9.247  -8.102  25.481  1.00 0.00   ? 329  ARG A H    1 
ATOM   3004 H HE   . ARG A 1 317 ? 9.234  -12.441 21.257  1.00 0.00   ? 329  ARG A HE   1 
ATOM   3005 H HH11 . ARG A 1 317 ? 8.607  -14.582 23.974  1.00 0.00   ? 329  ARG A HH11 1 
ATOM   3006 H HH12 . ARG A 1 317 ? 9.703  -15.787 23.391  1.00 0.00   ? 329  ARG A HH12 1 
ATOM   3007 H HH21 . ARG A 1 317 ? 10.674 -14.019 20.558  1.00 0.00   ? 329  ARG A HH21 1 
ATOM   3008 H HH22 . ARG A 1 317 ? 10.857 -15.470 21.470  1.00 0.00   ? 329  ARG A HH22 1 
ATOM   3009 N N    . ILE A 1 318 ? 11.683 -10.188 25.556  1.00 22.81  ? 330  ILE A N    1 
ATOM   3010 C CA   . ILE A 1 318 ? 13.010 -10.781 25.643  1.00 22.70  ? 330  ILE A CA   1 
ATOM   3011 C C    . ILE A 1 318 ? 13.358 -11.005 27.113  1.00 23.77  ? 330  ILE A C    1 
ATOM   3012 O O    . ILE A 1 318 ? 13.858 -12.067 27.481  1.00 25.51  ? 330  ILE A O    1 
ATOM   3013 C CB   . ILE A 1 318 ? 14.108 -9.882  25.005  1.00 22.77  ? 330  ILE A CB   1 
ATOM   3014 C CG1  . ILE A 1 318 ? 13.822 -9.627  23.528  1.00 17.34  ? 330  ILE A CG1  1 
ATOM   3015 C CG2  . ILE A 1 318 ? 15.457 -10.571 25.113  1.00 25.66  ? 330  ILE A CG2  1 
ATOM   3016 C CD1  . ILE A 1 318 ? 14.641 -8.487  22.946  1.00 19.06  ? 330  ILE A CD1  1 
ATOM   3017 H H    . ILE A 1 318 ? 11.571 -9.285  25.194  1.00 0.00   ? 330  ILE A H    1 
ATOM   3018 N N    . GLN A 1 319 ? 13.029 -10.020 27.947  1.00 24.75  ? 331  GLN A N    1 
ATOM   3019 C CA   . GLN A 1 319 ? 13.306 -10.074 29.382  1.00 27.96  ? 331  GLN A CA   1 
ATOM   3020 C C    . GLN A 1 319 ? 12.615 -11.251 30.056  1.00 26.45  ? 331  GLN A C    1 
ATOM   3021 O O    . GLN A 1 319 ? 13.151 -11.857 30.987  1.00 25.42  ? 331  GLN A O    1 
ATOM   3022 C CB   . GLN A 1 319 ? 12.881 -8.764  30.035  1.00 33.83  ? 331  GLN A CB   1 
ATOM   3023 C CG   . GLN A 1 319 ? 13.677 -7.599  29.507  1.00 47.16  ? 331  GLN A CG   1 
ATOM   3024 C CD   . GLN A 1 319 ? 13.472 -6.338  30.293  1.00 52.11  ? 331  GLN A CD   1 
ATOM   3025 O OE1  . GLN A 1 319 ? 13.321 -5.264  29.720  1.00 54.95  ? 331  GLN A OE1  1 
ATOM   3026 N NE2  . GLN A 1 319 ? 13.490 -6.450  31.617  1.00 57.39  ? 331  GLN A NE2  1 
ATOM   3027 H H    . GLN A 1 319 ? 12.577 -9.232  27.581  1.00 0.00   ? 331  GLN A H    1 
ATOM   3028 H HE21 . GLN A 1 319 ? 13.636 -7.331  32.021  1.00 0.00   ? 331  GLN A HE21 1 
ATOM   3029 H HE22 . GLN A 1 319 ? 13.354 -5.634  32.142  1.00 0.00   ? 331  GLN A HE22 1 
ATOM   3030 N N    . ARG A 1 320 ? 11.406 -11.539 29.587  1.00 25.20  ? 332  ARG A N    1 
ATOM   3031 C CA   . ARG A 1 320 ? 10.607 -12.645 30.077  1.00 25.98  ? 332  ARG A CA   1 
ATOM   3032 C C    . ARG A 1 320 ? 11.266 -13.973 29.669  1.00 23.16  ? 332  ARG A C    1 
ATOM   3033 O O    . ARG A 1 320 ? 11.238 -14.947 30.423  1.00 24.83  ? 332  ARG A O    1 
ATOM   3034 C CB   . ARG A 1 320 ? 9.214  -12.571 29.463  1.00 31.86  ? 332  ARG A CB   1 
ATOM   3035 C CG   . ARG A 1 320 ? 8.118  -11.912 30.280  1.00 43.51  ? 332  ARG A CG   1 
ATOM   3036 C CD   . ARG A 1 320 ? 6.793  -12.124 29.544  1.00 54.36  ? 332  ARG A CD   1 
ATOM   3037 N NE   . ARG A 1 320 ? 6.686  -13.480 28.995  1.00 67.04  ? 332  ARG A NE   1 
ATOM   3038 C CZ   . ARG A 1 320 ? 6.127  -14.517 29.625  1.00 73.83  ? 332  ARG A CZ   1 
ATOM   3039 N NH1  . ARG A 1 320 ? 5.601  -14.378 30.842  1.00 77.54  ? 332  ARG A NH1  1 
ATOM   3040 N NH2  . ARG A 1 320 ? 6.115  -15.717 29.053  1.00 74.66  ? 332  ARG A NH2  1 
ATOM   3041 H H    . ARG A 1 320 ? 11.040 -10.979 28.871  1.00 0.00   ? 332  ARG A H    1 
ATOM   3042 H HE   . ARG A 1 320 ? 7.049  -13.642 28.099  1.00 0.00   ? 332  ARG A HE   1 
ATOM   3043 H HH11 . ARG A 1 320 ? 5.619  -13.490 31.301  1.00 0.00   ? 332  ARG A HH11 1 
ATOM   3044 H HH12 . ARG A 1 320 ? 5.187  -15.166 31.297  1.00 0.00   ? 332  ARG A HH12 1 
ATOM   3045 H HH21 . ARG A 1 320 ? 6.526  -15.844 28.150  1.00 0.00   ? 332  ARG A HH21 1 
ATOM   3046 H HH22 . ARG A 1 320 ? 5.697  -16.492 29.526  1.00 0.00   ? 332  ARG A HH22 1 
ATOM   3047 N N    . MET A 1 321 ? 11.837 -14.003 28.461  1.00 22.62  ? 333  MET A N    1 
ATOM   3048 C CA   . MET A 1 321 ? 12.496 -15.202 27.929  1.00 19.94  ? 333  MET A CA   1 
ATOM   3049 C C    . MET A 1 321 ? 13.817 -15.529 28.625  1.00 20.17  ? 333  MET A C    1 
ATOM   3050 O O    . MET A 1 321 ? 14.195 -16.693 28.726  1.00 22.55  ? 333  MET A O    1 
ATOM   3051 C CB   . MET A 1 321 ? 12.695 -15.089 26.408  1.00 21.15  ? 333  MET A CB   1 
ATOM   3052 C CG   . MET A 1 321 ? 11.396 -15.063 25.625  1.00 20.70  ? 333  MET A CG   1 
ATOM   3053 S SD   . MET A 1 321 ? 10.502 -16.599 25.800  1.00 26.49  ? 333  MET A SD   1 
ATOM   3054 C CE   . MET A 1 321 ? 9.324  -16.152 27.033  1.00 16.89  ? 333  MET A CE   1 
ATOM   3055 H H    . MET A 1 321 ? 11.817 -13.192 27.912  1.00 0.00   ? 333  MET A H    1 
ATOM   3056 N N    . ARG A 1 322 ? 14.544 -14.494 29.033  1.00 19.55  ? 334  ARG A N    1 
ATOM   3057 C CA   . ARG A 1 322 ? 15.795 -14.694 29.751  1.00 22.88  ? 334  ARG A CA   1 
ATOM   3058 C C    . ARG A 1 322 ? 15.502 -15.470 31.008  1.00 24.88  ? 334  ARG A C    1 
ATOM   3059 O O    . ARG A 1 322 ? 16.125 -16.490 31.297  1.00 26.44  ? 334  ARG A O    1 
ATOM   3060 C CB   . ARG A 1 322 ? 16.384 -13.366 30.187  1.00 20.00  ? 334  ARG A CB   1 
ATOM   3061 C CG   . ARG A 1 322 ? 17.170 -12.723 29.148  1.00 25.31  ? 334  ARG A CG   1 
ATOM   3062 C CD   . ARG A 1 322 ? 17.833 -11.496 29.649  1.00 23.26  ? 334  ARG A CD   1 
ATOM   3063 N NE   . ARG A 1 322 ? 18.506 -10.929 28.503  1.00 25.30  ? 334  ARG A NE   1 
ATOM   3064 C CZ   . ARG A 1 322 ? 19.656 -11.383 28.023  1.00 27.69  ? 334  ARG A CZ   1 
ATOM   3065 N NH1  . ARG A 1 322 ? 20.289 -12.395 28.618  1.00 29.12  ? 334  ARG A NH1  1 
ATOM   3066 N NH2  . ARG A 1 322 ? 20.094 -10.927 26.863  1.00 27.77  ? 334  ARG A NH2  1 
ATOM   3067 H H    . ARG A 1 322 ? 14.230 -13.584 28.857  1.00 0.00   ? 334  ARG A H    1 
ATOM   3068 H HE   . ARG A 1 322 ? 18.091 -10.165 28.052  1.00 0.00   ? 334  ARG A HE   1 
ATOM   3069 H HH11 . ARG A 1 322 ? 19.905 -12.826 29.435  1.00 0.00   ? 334  ARG A HH11 1 
ATOM   3070 H HH12 . ARG A 1 322 ? 21.155 -12.725 28.244  1.00 0.00   ? 334  ARG A HH12 1 
ATOM   3071 H HH21 . ARG A 1 322 ? 19.560 -10.248 26.360  1.00 0.00   ? 334  ARG A HH21 1 
ATOM   3072 H HH22 . ARG A 1 322 ? 20.959 -11.261 26.489  1.00 0.00   ? 334  ARG A HH22 1 
ATOM   3073 N N    . GLN A 1 323 ? 14.558 -14.933 31.772  1.00 29.01  ? 335  GLN A N    1 
ATOM   3074 C CA   . GLN A 1 323 ? 14.121 -15.517 33.031  1.00 31.09  ? 335  GLN A CA   1 
ATOM   3075 C C    . GLN A 1 323 ? 13.652 -16.962 32.863  1.00 27.36  ? 335  GLN A C    1 
ATOM   3076 O O    . GLN A 1 323 ? 13.998 -17.835 33.653  1.00 24.41  ? 335  GLN A O    1 
ATOM   3077 C CB   . GLN A 1 323 ? 12.977 -14.681 33.569  1.00 43.57  ? 335  GLN A CB   1 
ATOM   3078 C CG   . GLN A 1 323 ? 13.094 -14.330 35.015  1.00 59.81  ? 335  GLN A CG   1 
ATOM   3079 C CD   . GLN A 1 323 ? 12.355 -13.064 35.305  1.00 71.88  ? 335  GLN A CD   1 
ATOM   3080 O OE1  . GLN A 1 323 ? 11.304 -12.803 34.719  1.00 76.76  ? 335  GLN A OE1  1 
ATOM   3081 N NE2  . GLN A 1 323 ? 12.915 -12.240 36.176  1.00 78.34  ? 335  GLN A NE2  1 
ATOM   3082 H H    . GLN A 1 323 ? 14.129 -14.104 31.471  1.00 0.00   ? 335  GLN A H    1 
ATOM   3083 H HE21 . GLN A 1 323 ? 13.771 -12.498 36.579  1.00 0.00   ? 335  GLN A HE21 1 
ATOM   3084 H HE22 . GLN A 1 323 ? 12.448 -11.403 36.382  1.00 0.00   ? 335  GLN A HE22 1 
ATOM   3085 N N    . LEU A 1 324 ? 12.804 -17.176 31.860  1.00 24.65  ? 336  LEU A N    1 
ATOM   3086 C CA   . LEU A 1 324 ? 12.258 -18.491 31.540  1.00 24.25  ? 336  LEU A CA   1 
ATOM   3087 C C    . LEU A 1 324 ? 13.412 -19.454 31.269  1.00 24.09  ? 336  LEU A C    1 
ATOM   3088 O O    . LEU A 1 324 ? 13.387 -20.602 31.715  1.00 24.78  ? 336  LEU A O    1 
ATOM   3089 C CB   . LEU A 1 324 ? 11.371 -18.386 30.292  1.00 25.74  ? 336  LEU A CB   1 
ATOM   3090 C CG   . LEU A 1 324 ? 10.221 -19.315 29.879  1.00 29.50  ? 336  LEU A CG   1 
ATOM   3091 C CD1  . LEU A 1 324 ? 10.056 -20.574 30.724  1.00 29.83  ? 336  LEU A CD1  1 
ATOM   3092 C CD2  . LEU A 1 324 ? 8.974  -18.483 29.937  1.00 38.59  ? 336  LEU A CD2  1 
ATOM   3093 H H    . LEU A 1 324 ? 12.540 -16.412 31.307  1.00 0.00   ? 336  LEU A H    1 
ATOM   3094 N N    . PHE A 1 325 ? 14.424 -18.965 30.545  1.00 26.60  ? 337  PHE A N    1 
ATOM   3095 C CA   . PHE A 1 325 ? 15.619 -19.747 30.173  1.00 25.01  ? 337  PHE A CA   1 
ATOM   3096 C C    . PHE A 1 325 ? 16.418 -20.186 31.416  1.00 21.22  ? 337  PHE A C    1 
ATOM   3097 O O    . PHE A 1 325 ? 16.650 -21.384 31.604  1.00 21.49  ? 337  PHE A O    1 
ATOM   3098 C CB   . PHE A 1 325 ? 16.484 -18.942 29.162  1.00 26.98  ? 337  PHE A CB   1 
ATOM   3099 C CG   . PHE A 1 325 ? 17.744 -19.650 28.654  1.00 28.03  ? 337  PHE A CG   1 
ATOM   3100 C CD1  . PHE A 1 325 ? 17.702 -20.907 28.034  1.00 27.16  ? 337  PHE A CD1  1 
ATOM   3101 C CD2  . PHE A 1 325 ? 18.971 -18.982 28.700  1.00 31.27  ? 337  PHE A CD2  1 
ATOM   3102 C CE1  . PHE A 1 325 ? 18.870 -21.473 27.459  1.00 26.70  ? 337  PHE A CE1  1 
ATOM   3103 C CE2  . PHE A 1 325 ? 20.129 -19.537 28.134  1.00 31.30  ? 337  PHE A CE2  1 
ATOM   3104 C CZ   . PHE A 1 325 ? 20.085 -20.777 27.512  1.00 27.26  ? 337  PHE A CZ   1 
ATOM   3105 H H    . PHE A 1 325 ? 14.371 -18.032 30.258  1.00 0.00   ? 337  PHE A H    1 
ATOM   3106 N N    . VAL A 1 326 ? 16.755 -19.252 32.309  1.00 23.66  ? 338  VAL A N    1 
ATOM   3107 C CA   . VAL A 1 326 ? 17.510 -19.633 33.509  1.00 27.31  ? 338  VAL A CA   1 
ATOM   3108 C C    . VAL A 1 326 ? 16.721 -20.547 34.459  1.00 28.33  ? 338  VAL A C    1 
ATOM   3109 O O    . VAL A 1 326 ? 17.302 -21.444 35.077  1.00 32.91  ? 338  VAL A O    1 
ATOM   3110 C CB   . VAL A 1 326 ? 18.045 -18.409 34.318  1.00 23.29  ? 338  VAL A CB   1 
ATOM   3111 C CG1  . VAL A 1 326 ? 18.838 -17.475 33.423  1.00 26.68  ? 338  VAL A CG1  1 
ATOM   3112 C CG2  . VAL A 1 326 ? 16.931 -17.680 35.030  1.00 28.34  ? 338  VAL A CG2  1 
ATOM   3113 H H    . VAL A 1 326 ? 16.493 -18.320 32.169  1.00 0.00   ? 338  VAL A H    1 
ATOM   3114 N N    . ASN A 1 327 ? 15.405 -20.336 34.549  1.00 29.45  ? 339  ASN A N    1 
ATOM   3115 C CA   . ASN A 1 327 ? 14.553 -21.149 35.419  1.00 28.38  ? 339  ASN A CA   1 
ATOM   3116 C C    . ASN A 1 327 ? 14.439 -22.564 34.879  1.00 26.64  ? 339  ASN A C    1 
ATOM   3117 O O    . ASN A 1 327 ? 14.563 -23.536 35.621  1.00 27.42  ? 339  ASN A O    1 
ATOM   3118 C CB   . ASN A 1 327 ? 13.139 -20.562 35.525  1.00 30.41  ? 339  ASN A CB   1 
ATOM   3119 C CG   . ASN A 1 327 ? 13.064 -19.329 36.402  1.00 34.45  ? 339  ASN A CG   1 
ATOM   3120 O OD1  . ASN A 1 327 ? 12.091 -18.577 36.328  1.00 41.30  ? 339  ASN A OD1  1 
ATOM   3121 N ND2  . ASN A 1 327 ? 14.063 -19.118 37.254  1.00 36.28  ? 339  ASN A ND2  1 
ATOM   3122 H H    . ASN A 1 327 ? 15.001 -19.625 34.012  1.00 0.00   ? 339  ASN A H    1 
ATOM   3123 H HD21 . ASN A 1 327 ? 14.819 -19.735 37.321  1.00 0.00   ? 339  ASN A HD21 1 
ATOM   3124 H HD22 . ASN A 1 327 ? 13.998 -18.311 37.806  1.00 0.00   ? 339  ASN A HD22 1 
ATOM   3125 N N    . THR A 1 328 ? 14.157 -22.663 33.585  1.00 24.72  ? 340  THR A N    1 
ATOM   3126 C CA   . THR A 1 328 ? 14.000 -23.949 32.934  1.00 25.22  ? 340  THR A CA   1 
ATOM   3127 C C    . THR A 1 328 ? 15.316 -24.704 32.922  1.00 28.88  ? 340  THR A C    1 
ATOM   3128 O O    . THR A 1 328 ? 15.326 -25.939 32.949  1.00 30.59  ? 340  THR A O    1 
ATOM   3129 C CB   . THR A 1 328 ? 13.510 -23.804 31.493  1.00 23.66  ? 340  THR A CB   1 
ATOM   3130 O OG1  . THR A 1 328 ? 12.416 -22.885 31.455  1.00 28.20  ? 340  THR A OG1  1 
ATOM   3131 C CG2  . THR A 1 328 ? 13.045 -25.151 30.968  1.00 24.04  ? 340  THR A CG2  1 
ATOM   3132 H H    . THR A 1 328 ? 14.068 -21.844 33.063  1.00 0.00   ? 340  THR A H    1 
ATOM   3133 H HG1  . THR A 1 328 ? 12.109 -22.784 30.551  1.00 0.00   ? 340  THR A HG1  1 
ATOM   3134 N N    . LEU A 1 329 ? 16.430 -23.977 32.852  1.00 31.40  ? 341  LEU A N    1 
ATOM   3135 C CA   . LEU A 1 329 ? 17.718 -24.656 32.854  1.00 34.55  ? 341  LEU A CA   1 
ATOM   3136 C C    . LEU A 1 329 ? 17.852 -25.352 34.209  1.00 38.79  ? 341  LEU A C    1 
ATOM   3137 O O    . LEU A 1 329 ? 18.218 -26.524 34.275  1.00 40.01  ? 341  LEU A O    1 
ATOM   3138 C CB   . LEU A 1 329 ? 18.881 -23.687 32.573  1.00 30.66  ? 341  LEU A CB   1 
ATOM   3139 C CG   . LEU A 1 329 ? 19.183 -23.478 31.078  1.00 28.50  ? 341  LEU A CG   1 
ATOM   3140 C CD1  . LEU A 1 329 ? 20.131 -22.312 30.883  1.00 28.91  ? 341  LEU A CD1  1 
ATOM   3141 C CD2  . LEU A 1 329 ? 19.768 -24.745 30.469  1.00 30.13  ? 341  LEU A CD2  1 
ATOM   3142 H H    . LEU A 1 329 ? 16.382 -23.001 32.816  1.00 0.00   ? 341  LEU A H    1 
ATOM   3143 N N    . GLN A 1 330 ? 17.457 -24.648 35.268  1.00 44.26  ? 342  GLN A N    1 
ATOM   3144 C CA   . GLN A 1 330 ? 17.492 -25.201 36.612  1.00 50.26  ? 342  GLN A CA   1 
ATOM   3145 C C    . GLN A 1 330 ? 16.578 -26.414 36.729  1.00 52.70  ? 342  GLN A C    1 
ATOM   3146 O O    . GLN A 1 330 ? 16.954 -27.435 37.306  1.00 55.76  ? 342  GLN A O    1 
ATOM   3147 C CB   . GLN A 1 330 ? 17.017 -24.174 37.624  1.00 54.24  ? 342  GLN A CB   1 
ATOM   3148 C CG   . GLN A 1 330 ? 18.083 -23.319 38.232  1.00 65.73  ? 342  GLN A CG   1 
ATOM   3149 C CD   . GLN A 1 330 ? 17.478 -22.360 39.204  1.00 74.49  ? 342  GLN A CD   1 
ATOM   3150 O OE1  . GLN A 1 330 ? 16.857 -22.766 40.188  1.00 79.55  ? 342  GLN A OE1  1 
ATOM   3151 N NE2  . GLN A 1 330 ? 17.590 -21.074 38.911  1.00 77.19  ? 342  GLN A NE2  1 
ATOM   3152 H H    . GLN A 1 330 ? 17.131 -23.733 35.136  1.00 0.00   ? 342  GLN A H    1 
ATOM   3153 H HE21 . GLN A 1 330 ? 18.055 -20.822 38.086  1.00 0.00   ? 342  GLN A HE21 1 
ATOM   3154 H HE22 . GLN A 1 330 ? 17.201 -20.425 39.534  1.00 0.00   ? 342  GLN A HE22 1 
ATOM   3155 N N    . GLU A 1 331 ? 15.352 -26.284 36.233  1.00 54.37  ? 343  GLU A N    1 
ATOM   3156 C CA   . GLU A 1 331 ? 14.405 -27.384 36.327  1.00 58.57  ? 343  GLU A CA   1 
ATOM   3157 C C    . GLU A 1 331 ? 14.790 -28.602 35.494  1.00 57.81  ? 343  GLU A C    1 
ATOM   3158 O O    . GLU A 1 331 ? 14.476 -29.739 35.857  1.00 59.72  ? 343  GLU A O    1 
ATOM   3159 C CB   . GLU A 1 331 ? 12.995 -26.888 36.006  1.00 64.59  ? 343  GLU A CB   1 
ATOM   3160 C CG   . GLU A 1 331 ? 12.424 -26.080 37.161  1.00 76.34  ? 343  GLU A CG   1 
ATOM   3161 C CD   . GLU A 1 331 ? 11.707 -24.817 36.730  1.00 83.03  ? 343  GLU A CD   1 
ATOM   3162 O OE1  . GLU A 1 331 ? 10.671 -24.928 36.042  1.00 87.20  ? 343  GLU A OE1  1 
ATOM   3163 O OE2  . GLU A 1 331 ? 12.160 -23.720 37.122  1.00 86.21  ? 343  GLU A OE2  1 
ATOM   3164 H H    . GLU A 1 331 ? 15.089 -25.454 35.790  1.00 0.00   ? 343  GLU A H    1 
ATOM   3165 N N    . LYS A 1 332 ? 15.542 -28.361 34.424  1.00 57.17  ? 344  LYS A N    1 
ATOM   3166 C CA   . LYS A 1 332 ? 15.990 -29.420 33.527  1.00 57.03  ? 344  LYS A CA   1 
ATOM   3167 C C    . LYS A 1 332 ? 17.309 -30.094 33.919  1.00 58.66  ? 344  LYS A C    1 
ATOM   3168 O O    . LYS A 1 332 ? 17.847 -30.896 33.160  1.00 58.63  ? 344  LYS A O    1 
ATOM   3169 C CB   . LYS A 1 332 ? 16.087 -28.879 32.097  1.00 56.45  ? 344  LYS A CB   1 
ATOM   3170 C CG   . LYS A 1 332 ? 14.935 -29.266 31.158  1.00 55.00  ? 344  LYS A CG   1 
ATOM   3171 C CD   . LYS A 1 332 ? 13.609 -29.486 31.872  1.00 58.52  ? 344  LYS A CD   1 
ATOM   3172 C CE   . LYS A 1 332 ? 12.479 -29.567 30.866  1.00 59.13  ? 344  LYS A CE   1 
ATOM   3173 N NZ   . LYS A 1 332 ? 12.276 -28.220 30.277  1.00 62.91  ? 344  LYS A NZ   1 
ATOM   3174 H H    . LYS A 1 332 ? 15.816 -27.440 34.242  1.00 0.00   ? 344  LYS A H    1 
ATOM   3175 H HZ1  . LYS A 1 332 ? 13.148 -27.909 29.804  1.00 0.00   ? 344  LYS A HZ1  1 
ATOM   3176 H HZ2  . LYS A 1 332 ? 11.502 -28.259 29.585  1.00 0.00   ? 344  LYS A HZ2  1 
ATOM   3177 H HZ3  . LYS A 1 332 ? 12.032 -27.548 31.032  1.00 0.00   ? 344  LYS A HZ3  1 
ATOM   3178 N N    . GLY A 1 333 ? 17.858 -29.746 35.077  1.00 60.14  ? 345  GLY A N    1 
ATOM   3179 C CA   . GLY A 1 333 ? 19.097 -30.385 35.489  1.00 62.83  ? 345  GLY A CA   1 
ATOM   3180 C C    . GLY A 1 333 ? 20.417 -29.755 35.072  1.00 65.25  ? 345  GLY A C    1 
ATOM   3181 O O    . GLY A 1 333 ? 21.438 -30.445 35.083  1.00 64.99  ? 345  GLY A O    1 
ATOM   3182 H H    . GLY A 1 333 ? 17.439 -29.067 35.645  1.00 0.00   ? 345  GLY A H    1 
ATOM   3183 N N    . ALA A 1 334 ? 20.383 -28.517 34.574  1.00 68.79  ? 346  ALA A N    1 
ATOM   3184 C CA   . ALA A 1 334 ? 21.610 -27.819 34.220  1.00 72.23  ? 346  ALA A CA   1 
ATOM   3185 C C    . ALA A 1 334 ? 22.112 -27.465 35.587  1.00 76.87  ? 346  ALA A C    1 
ATOM   3186 O O    . ALA A 1 334 ? 21.520 -26.635 36.290  1.00 78.59  ? 346  ALA A O    1 
ATOM   3187 C CB   . ALA A 1 334 ? 21.327 -26.562 33.408  1.00 70.71  ? 346  ALA A CB   1 
ATOM   3188 H H    . ALA A 1 334 ? 19.518 -28.080 34.444  1.00 0.00   ? 346  ALA A H    1 
ATOM   3189 N N    . ASN A 1 335 ? 23.157 -28.179 35.987  1.00 81.48  ? 347  ASN A N    1 
ATOM   3190 C CA   . ASN A 1 335 ? 23.757 -28.039 37.298  1.00 86.11  ? 347  ASN A CA   1 
ATOM   3191 C C    . ASN A 1 335 ? 24.729 -26.884 37.454  1.00 84.64  ? 347  ASN A C    1 
ATOM   3192 O O    . ASN A 1 335 ? 25.409 -26.750 38.474  1.00 86.26  ? 347  ASN A O    1 
ATOM   3193 C CB   . ASN A 1 335 ? 24.363 -29.381 37.770  1.00 93.15  ? 347  ASN A CB   1 
ATOM   3194 C CG   . ASN A 1 335 ? 25.361 -30.013 36.785  1.00 97.42  ? 347  ASN A CG   1 
ATOM   3195 O OD1  . ASN A 1 335 ? 25.615 -29.531 35.679  1.00 97.56  ? 347  ASN A OD1  1 
ATOM   3196 N ND2  . ASN A 1 335 ? 25.938 -31.141 37.227  1.00 100.00 ? 347  ASN A ND2  1 
ATOM   3197 H H    . ASN A 1 335 ? 23.535 -28.830 35.360  1.00 0.00   ? 347  ASN A H    1 
ATOM   3198 H HD21 . ASN A 1 335 ? 25.693 -31.474 38.116  1.00 0.00   ? 347  ASN A HD21 1 
ATOM   3199 H HD22 . ASN A 1 335 ? 26.583 -31.587 36.640  1.00 0.00   ? 347  ASN A HD22 1 
ATOM   3200 N N    . ARG A 1 336 ? 24.735 -26.019 36.450  1.00 81.17  ? 348  ARG A N    1 
ATOM   3201 C CA   . ARG A 1 336 ? 25.569 -24.838 36.451  1.00 76.17  ? 348  ARG A CA   1 
ATOM   3202 C C    . ARG A 1 336 ? 24.611 -23.683 36.635  1.00 71.85  ? 348  ARG A C    1 
ATOM   3203 O O    . ARG A 1 336 ? 23.444 -23.748 36.237  1.00 71.38  ? 348  ARG A O    1 
ATOM   3204 C CB   . ARG A 1 336 ? 26.336 -24.732 35.132  1.00 79.04  ? 348  ARG A CB   1 
ATOM   3205 C CG   . ARG A 1 336 ? 27.414 -23.644 35.058  1.00 82.14  ? 348  ARG A CG   1 
ATOM   3206 C CD   . ARG A 1 336 ? 26.926 -22.489 34.194  1.00 86.07  ? 348  ARG A CD   1 
ATOM   3207 N NE   . ARG A 1 336 ? 27.877 -22.000 33.189  1.00 89.63  ? 348  ARG A NE   1 
ATOM   3208 C CZ   . ARG A 1 336 ? 28.422 -22.729 32.210  1.00 89.00  ? 348  ARG A CZ   1 
ATOM   3209 N NH1  . ARG A 1 336 ? 28.152 -24.025 32.075  1.00 90.08  ? 348  ARG A NH1  1 
ATOM   3210 N NH2  . ARG A 1 336 ? 29.180 -22.135 31.299  1.00 87.84  ? 348  ARG A NH2  1 
ATOM   3211 H H    . ARG A 1 336 ? 24.163 -26.176 35.672  1.00 0.00   ? 348  ARG A H    1 
ATOM   3212 H HE   . ARG A 1 336 ? 28.137 -21.056 33.236  1.00 0.00   ? 348  ARG A HE   1 
ATOM   3213 H HH11 . ARG A 1 336 ? 27.527 -24.483 32.706  1.00 0.00   ? 348  ARG A HH11 1 
ATOM   3214 H HH12 . ARG A 1 336 ? 28.575 -24.543 31.332  1.00 0.00   ? 348  ARG A HH12 1 
ATOM   3215 H HH21 . ARG A 1 336 ? 29.339 -21.149 31.348  1.00 0.00   ? 348  ARG A HH21 1 
ATOM   3216 H HH22 . ARG A 1 336 ? 29.591 -22.672 30.562  1.00 0.00   ? 348  ARG A HH22 1 
ATOM   3217 N N    . ASP A 1 337 ? 25.094 -22.666 37.327  1.00 66.79  ? 349  ASP A N    1 
ATOM   3218 C CA   . ASP A 1 337 ? 24.300 -21.493 37.589  1.00 61.59  ? 349  ASP A CA   1 
ATOM   3219 C C    . ASP A 1 337 ? 24.388 -20.552 36.401  1.00 55.25  ? 349  ASP A C    1 
ATOM   3220 O O    . ASP A 1 337 ? 25.444 -19.994 36.101  1.00 56.34  ? 349  ASP A O    1 
ATOM   3221 C CB   . ASP A 1 337 ? 24.785 -20.832 38.871  1.00 65.81  ? 349  ASP A CB   1 
ATOM   3222 C CG   . ASP A 1 337 ? 23.903 -19.694 39.307  1.00 70.66  ? 349  ASP A CG   1 
ATOM   3223 O OD1  . ASP A 1 337 ? 22.720 -19.939 39.626  1.00 75.28  ? 349  ASP A OD1  1 
ATOM   3224 O OD2  . ASP A 1 337 ? 24.411 -18.557 39.328  1.00 73.78  ? 349  ASP A OD2  1 
ATOM   3225 H H    . ASP A 1 337 ? 26.012 -22.710 37.667  1.00 0.00   ? 349  ASP A H    1 
ATOM   3226 N N    . PHE A 1 338 ? 23.275 -20.459 35.685  1.00 46.38  ? 350  PHE A N    1 
ATOM   3227 C CA   . PHE A 1 338 ? 23.158 -19.621 34.506  1.00 37.49  ? 350  PHE A CA   1 
ATOM   3228 C C    . PHE A 1 338 ? 22.484 -18.283 34.792  1.00 33.31  ? 350  PHE A C    1 
ATOM   3229 O O    . PHE A 1 338 ? 22.106 -17.559 33.874  1.00 34.27  ? 350  PHE A O    1 
ATOM   3230 C CB   . PHE A 1 338 ? 22.368 -20.375 33.441  1.00 33.00  ? 350  PHE A CB   1 
ATOM   3231 C CG   . PHE A 1 338 ? 23.178 -21.381 32.685  1.00 29.07  ? 350  PHE A CG   1 
ATOM   3232 C CD1  . PHE A 1 338 ? 23.847 -20.998 31.533  1.00 27.96  ? 350  PHE A CD1  1 
ATOM   3233 C CD2  . PHE A 1 338 ? 23.233 -22.718 33.079  1.00 23.58  ? 350  PHE A CD2  1 
ATOM   3234 C CE1  . PHE A 1 338 ? 24.552 -21.913 30.775  1.00 24.55  ? 350  PHE A CE1  1 
ATOM   3235 C CE2  . PHE A 1 338 ? 23.942 -23.656 32.324  1.00 21.71  ? 350  PHE A CE2  1 
ATOM   3236 C CZ   . PHE A 1 338 ? 24.600 -23.250 31.169  1.00 26.65  ? 350  PHE A CZ   1 
ATOM   3237 H H    . PHE A 1 338 ? 22.495 -20.981 35.966  1.00 0.00   ? 350  PHE A H    1 
ATOM   3238 N N    . SER A 1 339 ? 22.406 -17.927 36.068  1.00 33.23  ? 351  SER A N    1 
ATOM   3239 C CA   . SER A 1 339 ? 21.744 -16.690 36.473  1.00 35.63  ? 351  SER A CA   1 
ATOM   3240 C C    . SER A 1 339 ? 22.393 -15.384 36.025  1.00 35.38  ? 351  SER A C    1 
ATOM   3241 O O    . SER A 1 339 ? 21.765 -14.319 36.104  1.00 36.56  ? 351  SER A O    1 
ATOM   3242 C CB   . SER A 1 339 ? 21.497 -16.706 37.979  1.00 37.77  ? 351  SER A CB   1 
ATOM   3243 O OG   . SER A 1 339 ? 20.755 -17.879 38.274  1.00 45.33  ? 351  SER A OG   1 
ATOM   3244 H H    . SER A 1 339 ? 22.800 -18.503 36.756  1.00 0.00   ? 351  SER A H    1 
ATOM   3245 H HG   . SER A 1 339 ? 20.594 -17.927 39.219  1.00 0.00   ? 351  SER A HG   1 
ATOM   3246 N N    . PHE A 1 340 ? 23.651 -15.454 35.588  1.00 34.39  ? 352  PHE A N    1 
ATOM   3247 C CA   . PHE A 1 340 ? 24.338 -14.274 35.081  1.00 30.58  ? 352  PHE A CA   1 
ATOM   3248 C C    . PHE A 1 340 ? 23.572 -13.793 33.849  1.00 28.36  ? 352  PHE A C    1 
ATOM   3249 O O    . PHE A 1 340 ? 23.586 -12.612 33.516  1.00 28.02  ? 352  PHE A O    1 
ATOM   3250 C CB   . PHE A 1 340 ? 25.814 -14.585 34.743  1.00 29.05  ? 352  PHE A CB   1 
ATOM   3251 C CG   . PHE A 1 340 ? 26.019 -15.779 33.850  1.00 25.86  ? 352  PHE A CG   1 
ATOM   3252 C CD1  . PHE A 1 340 ? 26.060 -15.636 32.463  1.00 22.51  ? 352  PHE A CD1  1 
ATOM   3253 C CD2  . PHE A 1 340 ? 26.202 -17.046 34.400  1.00 24.51  ? 352  PHE A CD2  1 
ATOM   3254 C CE1  . PHE A 1 340 ? 26.281 -16.743 31.637  1.00 23.02  ? 352  PHE A CE1  1 
ATOM   3255 C CE2  . PHE A 1 340 ? 26.423 -18.157 33.584  1.00 25.24  ? 352  PHE A CE2  1 
ATOM   3256 C CZ   . PHE A 1 340 ? 26.462 -18.009 32.198  1.00 22.05  ? 352  PHE A CZ   1 
ATOM   3257 H H    . PHE A 1 340 ? 24.115 -16.316 35.615  1.00 0.00   ? 352  PHE A H    1 
ATOM   3258 N N    . ILE A 1 341 ? 22.885 -14.730 33.197  1.00 29.05  ? 353  ILE A N    1 
ATOM   3259 C CA   . ILE A 1 341 ? 22.072 -14.442 32.020  1.00 29.77  ? 353  ILE A CA   1 
ATOM   3260 C C    . ILE A 1 341 ? 20.990 -13.392 32.285  1.00 29.28  ? 353  ILE A C    1 
ATOM   3261 O O    . ILE A 1 341 ? 20.673 -12.578 31.414  1.00 28.76  ? 353  ILE A O    1 
ATOM   3262 C CB   . ILE A 1 341 ? 21.478 -15.758 31.455  1.00 29.03  ? 353  ILE A CB   1 
ATOM   3263 C CG1  . ILE A 1 341 ? 22.609 -16.524 30.767  1.00 30.91  ? 353  ILE A CG1  1 
ATOM   3264 C CG2  . ILE A 1 341 ? 20.310 -15.483 30.490  1.00 29.31  ? 353  ILE A CG2  1 
ATOM   3265 C CD1  . ILE A 1 341 ? 22.348 -17.951 30.556  1.00 32.11  ? 353  ILE A CD1  1 
ATOM   3266 H H    . ILE A 1 341 ? 22.935 -15.654 33.515  1.00 0.00   ? 353  ILE A H    1 
ATOM   3267 N N    . ILE A 1 342 ? 20.468 -13.384 33.506  1.00 31.46  ? 354  ILE A N    1 
ATOM   3268 C CA   . ILE A 1 342 ? 19.446 -12.423 33.912  1.00 34.04  ? 354  ILE A CA   1 
ATOM   3269 C C    . ILE A 1 342 ? 19.978 -10.990 33.901  1.00 36.12  ? 354  ILE A C    1 
ATOM   3270 O O    . ILE A 1 342 ? 19.229 -10.027 33.725  1.00 34.90  ? 354  ILE A O    1 
ATOM   3271 C CB   . ILE A 1 342 ? 18.952 -12.757 35.345  1.00 35.57  ? 354  ILE A CB   1 
ATOM   3272 C CG1  . ILE A 1 342 ? 18.154 -14.052 35.332  1.00 37.78  ? 354  ILE A CG1  1 
ATOM   3273 C CG2  . ILE A 1 342 ? 18.105 -11.627 35.918  1.00 37.16  ? 354  ILE A CG2  1 
ATOM   3274 C CD1  . ILE A 1 342 ? 16.922 -13.978 34.470  1.00 39.35  ? 354  ILE A CD1  1 
ATOM   3275 H H    . ILE A 1 342 ? 20.780 -14.049 34.154  1.00 0.00   ? 354  ILE A H    1 
ATOM   3276 N N    . LYS A 1 343 ? 21.296 -10.876 34.010  1.00 38.38  ? 355  LYS A N    1 
ATOM   3277 C CA   . LYS A 1 343 ? 21.973 -9.589  34.083  1.00 41.08  ? 355  LYS A CA   1 
ATOM   3278 C C    . LYS A 1 343 ? 22.412 -8.927  32.782  1.00 37.00  ? 355  LYS A C    1 
ATOM   3279 O O    . LYS A 1 343 ? 22.819 -7.762  32.778  1.00 34.65  ? 355  LYS A O    1 
ATOM   3280 C CB   . LYS A 1 343 ? 23.145 -9.734  35.046  1.00 49.28  ? 355  LYS A CB   1 
ATOM   3281 C CG   . LYS A 1 343 ? 22.646 -10.131 36.423  1.00 61.62  ? 355  LYS A CG   1 
ATOM   3282 C CD   . LYS A 1 343 ? 23.763 -10.394 37.397  1.00 72.74  ? 355  LYS A CD   1 
ATOM   3283 C CE   . LYS A 1 343 ? 23.515 -9.652  38.697  1.00 78.47  ? 355  LYS A CE   1 
ATOM   3284 N NZ   . LYS A 1 343 ? 23.666 -8.179  38.505  1.00 83.22  ? 355  LYS A NZ   1 
ATOM   3285 H H    . LYS A 1 343 ? 21.832 -11.692 34.052  1.00 0.00   ? 355  LYS A H    1 
ATOM   3286 H HZ1  . LYS A 1 343 ? 22.982 -7.850  37.794  1.00 0.00   ? 355  LYS A HZ1  1 
ATOM   3287 H HZ2  . LYS A 1 343 ? 23.491 -7.692  39.407  1.00 0.00   ? 355  LYS A HZ2  1 
ATOM   3288 H HZ3  . LYS A 1 343 ? 24.631 -7.970  38.179  1.00 0.00   ? 355  LYS A HZ3  1 
ATOM   3289 N N    . GLN A 1 344 ? 22.259 -9.649  31.677  1.00 30.92  ? 356  GLN A N    1 
ATOM   3290 C CA   . GLN A 1 344 ? 22.639 -9.152  30.360  1.00 28.25  ? 356  GLN A CA   1 
ATOM   3291 C C    . GLN A 1 344 ? 21.501 -8.369  29.699  1.00 26.47  ? 356  GLN A C    1 
ATOM   3292 O O    . GLN A 1 344 ? 20.337 -8.558  30.037  1.00 28.55  ? 356  GLN A O    1 
ATOM   3293 C CB   . GLN A 1 344 ? 23.124 -10.321 29.493  1.00 26.21  ? 356  GLN A CB   1 
ATOM   3294 C CG   . GLN A 1 344 ? 24.377 -10.953 30.117  1.00 28.01  ? 356  GLN A CG   1 
ATOM   3295 C CD   . GLN A 1 344 ? 24.887 -12.228 29.460  1.00 30.59  ? 356  GLN A CD   1 
ATOM   3296 O OE1  . GLN A 1 344 ? 24.304 -12.756 28.510  1.00 33.85  ? 356  GLN A OE1  1 
ATOM   3297 N NE2  . GLN A 1 344 ? 25.997 -12.733 29.986  1.00 33.15  ? 356  GLN A NE2  1 
ATOM   3298 H H    . GLN A 1 344 ? 21.876 -10.548 31.750  1.00 0.00   ? 356  GLN A H    1 
ATOM   3299 H HE21 . GLN A 1 344 ? 26.409 -12.268 30.744  1.00 0.00   ? 356  GLN A HE21 1 
ATOM   3300 H HE22 . GLN A 1 344 ? 26.359 -13.554 29.592  1.00 0.00   ? 356  GLN A HE22 1 
ATOM   3301 N N    . ASN A 1 345 ? 21.863 -7.437  28.817  1.00 24.51  ? 357  ASN A N    1 
ATOM   3302 C CA   . ASN A 1 345 ? 20.895 -6.603  28.101  1.00 22.66  ? 357  ASN A CA   1 
ATOM   3303 C C    . ASN A 1 345 ? 20.860 -6.966  26.629  1.00 22.20  ? 357  ASN A C    1 
ATOM   3304 O O    . ASN A 1 345 ? 21.877 -7.327  26.045  1.00 25.17  ? 357  ASN A O    1 
ATOM   3305 C CB   . ASN A 1 345 ? 21.290 -5.128  28.134  1.00 21.58  ? 357  ASN A CB   1 
ATOM   3306 C CG   . ASN A 1 345 ? 21.354 -4.549  29.520  1.00 23.76  ? 357  ASN A CG   1 
ATOM   3307 O OD1  . ASN A 1 345 ? 22.204 -3.696  29.795  1.00 32.32  ? 357  ASN A OD1  1 
ATOM   3308 N ND2  . ASN A 1 345 ? 20.419 -4.925  30.382  1.00 24.50  ? 357  ASN A ND2  1 
ATOM   3309 H H    . ASN A 1 345 ? 22.815 -7.307  28.636  1.00 0.00   ? 357  ASN A H    1 
ATOM   3310 H HD21 . ASN A 1 345 ? 19.724 -5.554  30.097  1.00 0.00   ? 357  ASN A HD21 1 
ATOM   3311 H HD22 . ASN A 1 345 ? 20.463 -4.550  31.286  1.00 0.00   ? 357  ASN A HD22 1 
ATOM   3312 N N    . GLY A 1 346 ? 19.710 -6.750  26.002  1.00 18.77  ? 358  GLY A N    1 
ATOM   3313 C CA   . GLY A 1 346 ? 19.612 -7.021  24.584  1.00 15.56  ? 358  GLY A CA   1 
ATOM   3314 C C    . GLY A 1 346 ? 19.070 -8.392  24.253  1.00 16.24  ? 358  GLY A C    1 
ATOM   3315 O O    . GLY A 1 346 ? 18.515 -9.079  25.100  1.00 18.91  ? 358  GLY A O    1 
ATOM   3316 H H    . GLY A 1 346 ? 18.933 -6.410  26.493  1.00 0.00   ? 358  GLY A H    1 
ATOM   3317 N N    . MET A 1 347 ? 19.265 -8.787  23.003  1.00 15.35  ? 359  MET A N    1 
ATOM   3318 C CA   . MET A 1 347 ? 18.797 -10.067 22.489  1.00 20.11  ? 359  MET A CA   1 
ATOM   3319 C C    . MET A 1 347 ? 19.730 -11.230 22.780  1.00 22.26  ? 359  MET A C    1 
ATOM   3320 O O    . MET A 1 347 ? 19.312 -12.385 22.685  1.00 24.53  ? 359  MET A O    1 
ATOM   3321 C CB   . MET A 1 347 ? 18.682 -10.017 20.971  1.00 18.47  ? 359  MET A CB   1 
ATOM   3322 C CG   . MET A 1 347 ? 17.729 -9.021  20.386  1.00 24.58  ? 359  MET A CG   1 
ATOM   3323 S SD   . MET A 1 347 ? 17.712 -9.220  18.590  1.00 27.55  ? 359  MET A SD   1 
ATOM   3324 C CE   . MET A 1 347 ? 16.567 -7.972  18.127  1.00 23.61  ? 359  MET A CE   1 
ATOM   3325 H H    . MET A 1 347 ? 19.749 -8.189  22.396  1.00 0.00   ? 359  MET A H    1 
ATOM   3326 N N    . PHE A 1 348 ? 20.979 -10.929 23.139  1.00 27.08  ? 360  PHE A N    1 
ATOM   3327 C CA   . PHE A 1 348 ? 21.979 -11.979 23.337  1.00 31.44  ? 360  PHE A CA   1 
ATOM   3328 C C    . PHE A 1 348 ? 22.561 -12.324 24.672  1.00 35.51  ? 360  PHE A C    1 
ATOM   3329 O O    . PHE A 1 348 ? 23.297 -11.551 25.277  1.00 34.47  ? 360  PHE A O    1 
ATOM   3330 C CB   . PHE A 1 348 ? 23.185 -11.777 22.436  1.00 26.24  ? 360  PHE A CB   1 
ATOM   3331 C CG   . PHE A 1 348 ? 22.859 -11.447 21.039  1.00 18.30  ? 360  PHE A CG   1 
ATOM   3332 C CD1  . PHE A 1 348 ? 22.265 -12.374 20.193  1.00 14.93  ? 360  PHE A CD1  1 
ATOM   3333 C CD2  . PHE A 1 348 ? 23.232 -10.214 20.528  1.00 17.69  ? 360  PHE A CD2  1 
ATOM   3334 C CE1  . PHE A 1 348 ? 22.056 -12.073 18.846  1.00 12.54  ? 360  PHE A CE1  1 
ATOM   3335 C CE2  . PHE A 1 348 ? 23.034 -9.900  19.197  1.00 13.92  ? 360  PHE A CE2  1 
ATOM   3336 C CZ   . PHE A 1 348 ? 22.449 -10.824 18.350  1.00 17.14  ? 360  PHE A CZ   1 
ATOM   3337 H H    . PHE A 1 348 ? 21.233 -9.992  23.272  1.00 0.00   ? 360  PHE A H    1 
ATOM   3338 N N    . SER A 1 349 ? 22.531 -13.629 24.871  1.00 37.22  ? 361  SER A N    1 
ATOM   3339 C CA   . SER A 1 349 ? 23.048 -14.279 26.045  1.00 38.34  ? 361  SER A CA   1 
ATOM   3340 C C    . SER A 1 349 ? 24.366 -14.933 25.629  1.00 34.79  ? 361  SER A C    1 
ATOM   3341 O O    . SER A 1 349 ? 24.420 -15.663 24.638  1.00 33.25  ? 361  SER A O    1 
ATOM   3342 C CB   . SER A 1 349 ? 22.036 -15.331 26.475  1.00 39.13  ? 361  SER A CB   1 
ATOM   3343 O OG   . SER A 1 349 ? 22.414 -16.020 27.640  1.00 45.42  ? 361  SER A OG   1 
ATOM   3344 H H    . SER A 1 349 ? 22.132 -14.193 24.177  1.00 0.00   ? 361  SER A H    1 
ATOM   3345 H HG   . SER A 1 349 ? 21.740 -16.666 27.863  1.00 0.00   ? 361  SER A HG   1 
ATOM   3346 N N    . PHE A 1 350 ? 25.452 -14.564 26.296  1.00 31.53  ? 362  PHE A N    1 
ATOM   3347 C CA   . PHE A 1 350 ? 26.728 -15.187 25.998  1.00 26.24  ? 362  PHE A CA   1 
ATOM   3348 C C    . PHE A 1 350 ? 26.690 -16.364 26.972  1.00 25.24  ? 362  PHE A C    1 
ATOM   3349 O O    . PHE A 1 350 ? 26.986 -16.211 28.155  1.00 23.68  ? 362  PHE A O    1 
ATOM   3350 C CB   . PHE A 1 350 ? 27.858 -14.224 26.317  1.00 28.47  ? 362  PHE A CB   1 
ATOM   3351 C CG   . PHE A 1 350 ? 29.037 -14.357 25.408  1.00 30.29  ? 362  PHE A CG   1 
ATOM   3352 C CD1  . PHE A 1 350 ? 28.872 -14.525 24.033  1.00 26.91  ? 362  PHE A CD1  1 
ATOM   3353 C CD2  . PHE A 1 350 ? 30.318 -14.270 25.924  1.00 29.51  ? 362  PHE A CD2  1 
ATOM   3354 C CE1  . PHE A 1 350 ? 29.974 -14.601 23.193  1.00 30.18  ? 362  PHE A CE1  1 
ATOM   3355 C CE2  . PHE A 1 350 ? 31.423 -14.344 25.103  1.00 28.51  ? 362  PHE A CE2  1 
ATOM   3356 C CZ   . PHE A 1 350 ? 31.259 -14.508 23.728  1.00 29.94  ? 362  PHE A CZ   1 
ATOM   3357 H H    . PHE A 1 350 ? 25.395 -13.873 26.987  1.00 0.00   ? 362  PHE A H    1 
ATOM   3358 N N    . SER A 1 351 ? 26.262 -17.520 26.464  1.00 24.62  ? 363  SER A N    1 
ATOM   3359 C CA   . SER A 1 351 ? 26.079 -18.735 27.264  1.00 25.63  ? 363  SER A CA   1 
ATOM   3360 C C    . SER A 1 351 ? 27.271 -19.359 27.962  1.00 27.37  ? 363  SER A C    1 
ATOM   3361 O O    . SER A 1 351 ? 27.103 -20.050 28.969  1.00 31.71  ? 363  SER A O    1 
ATOM   3362 C CB   . SER A 1 351 ? 25.431 -19.832 26.426  1.00 27.36  ? 363  SER A CB   1 
ATOM   3363 O OG   . SER A 1 351 ? 26.365 -20.428 25.540  1.00 22.87  ? 363  SER A OG   1 
ATOM   3364 H H    . SER A 1 351 ? 26.056 -17.553 25.507  1.00 0.00   ? 363  SER A H    1 
ATOM   3365 H HG   . SER A 1 351 ? 25.929 -21.110 25.025  1.00 0.00   ? 363  SER A HG   1 
ATOM   3366 N N    . GLY A 1 352 ? 28.460 -19.178 27.402  1.00 25.21  ? 364  GLY A N    1 
ATOM   3367 C CA   . GLY A 1 352 ? 29.632 -19.788 27.998  1.00 25.57  ? 364  GLY A CA   1 
ATOM   3368 C C    . GLY A 1 352 ? 29.742 -21.243 27.570  1.00 23.55  ? 364  GLY A C    1 
ATOM   3369 O O    . GLY A 1 352 ? 30.281 -22.070 28.299  1.00 24.50  ? 364  GLY A O    1 
ATOM   3370 H H    . GLY A 1 352 ? 28.545 -18.637 26.589  1.00 0.00   ? 364  GLY A H    1 
ATOM   3371 N N    . LEU A 1 353 ? 29.189 -21.567 26.404  1.00 22.90  ? 365  LEU A N    1 
ATOM   3372 C CA   . LEU A 1 353 ? 29.261 -22.926 25.888  1.00 23.00  ? 365  LEU A CA   1 
ATOM   3373 C C    . LEU A 1 353 ? 30.547 -22.998 25.059  1.00 22.26  ? 365  LEU A C    1 
ATOM   3374 O O    . LEU A 1 353 ? 30.943 -22.008 24.458  1.00 25.83  ? 365  LEU A O    1 
ATOM   3375 C CB   . LEU A 1 353 ? 28.027 -23.224 25.022  1.00 23.87  ? 365  LEU A CB   1 
ATOM   3376 C CG   . LEU A 1 353 ? 26.998 -24.291 25.421  1.00 25.29  ? 365  LEU A CG   1 
ATOM   3377 C CD1  . LEU A 1 353 ? 26.697 -24.319 26.910  1.00 26.25  ? 365  LEU A CD1  1 
ATOM   3378 C CD2  . LEU A 1 353 ? 25.744 -24.019 24.633  1.00 27.22  ? 365  LEU A CD2  1 
ATOM   3379 H H    . LEU A 1 353 ? 28.725 -20.880 25.882  1.00 0.00   ? 365  LEU A H    1 
ATOM   3380 N N    . THR A 1 354 ? 31.225 -24.143 25.074  1.00 24.31  ? 366  THR A N    1 
ATOM   3381 C CA   . THR A 1 354 ? 32.470 -24.317 24.314  1.00 22.64  ? 366  THR A CA   1 
ATOM   3382 C C    . THR A 1 354 ? 32.149 -24.496 22.825  1.00 23.72  ? 366  THR A C    1 
ATOM   3383 O O    . THR A 1 354 ? 31.012 -24.829 22.495  1.00 23.33  ? 366  THR A O    1 
ATOM   3384 C CB   . THR A 1 354 ? 33.210 -25.558 24.809  1.00 23.10  ? 366  THR A CB   1 
ATOM   3385 O OG1  . THR A 1 354 ? 32.372 -26.690 24.586  1.00 26.82  ? 366  THR A OG1  1 
ATOM   3386 C CG2  . THR A 1 354 ? 33.517 -25.446 26.305  1.00 24.09  ? 366  THR A CG2  1 
ATOM   3387 H H    . THR A 1 354 ? 30.881 -24.890 25.603  1.00 0.00   ? 366  THR A H    1 
ATOM   3388 H HG1  . THR A 1 354 ? 32.820 -27.487 24.879  1.00 0.00   ? 366  THR A HG1  1 
ATOM   3389 N N    . LYS A 1 355 ? 33.136 -24.320 21.937  1.00 26.30  ? 367  LYS A N    1 
ATOM   3390 C CA   . LYS A 1 355 ? 32.881 -24.490 20.491  1.00 30.31  ? 367  LYS A CA   1 
ATOM   3391 C C    . LYS A 1 355 ? 32.365 -25.898 20.139  1.00 26.17  ? 367  LYS A C    1 
ATOM   3392 O O    . LYS A 1 355 ? 31.585 -26.056 19.197  1.00 26.09  ? 367  LYS A O    1 
ATOM   3393 C CB   . LYS A 1 355 ? 34.122 -24.129 19.621  1.00 33.54  ? 367  LYS A CB   1 
ATOM   3394 C CG   . LYS A 1 355 ? 35.034 -25.312 19.204  1.00 50.30  ? 367  LYS A CG   1 
ATOM   3395 C CD   . LYS A 1 355 ? 36.197 -24.919 18.258  1.00 56.49  ? 367  LYS A CD   1 
ATOM   3396 C CE   . LYS A 1 355 ? 37.053 -26.134 17.853  1.00 59.04  ? 367  LYS A CE   1 
ATOM   3397 N NZ   . LYS A 1 355 ? 36.239 -27.223 17.216  1.00 62.45  ? 367  LYS A NZ   1 
ATOM   3398 H H    . LYS A 1 355 ? 34.033 -24.079 22.247  1.00 0.00   ? 367  LYS A H    1 
ATOM   3399 H HZ1  . LYS A 1 355 ? 35.773 -26.853 16.363  1.00 0.00   ? 367  LYS A HZ1  1 
ATOM   3400 H HZ2  . LYS A 1 355 ? 36.862 -28.014 16.956  1.00 0.00   ? 367  LYS A HZ2  1 
ATOM   3401 H HZ3  . LYS A 1 355 ? 35.519 -27.557 17.888  1.00 0.00   ? 367  LYS A HZ3  1 
ATOM   3402 N N    . GLU A 1 356 ? 32.777 -26.896 20.926  1.00 23.07  ? 368  GLU A N    1 
ATOM   3403 C CA   . GLU A 1 356 ? 32.372 -28.289 20.715  1.00 25.84  ? 368  GLU A CA   1 
ATOM   3404 C C    . GLU A 1 356 ? 30.959 -28.545 21.232  1.00 24.98  ? 368  GLU A C    1 
ATOM   3405 O O    . GLU A 1 356 ? 30.281 -29.468 20.775  1.00 26.25  ? 368  GLU A O    1 
ATOM   3406 C CB   . GLU A 1 356 ? 33.345 -29.279 21.386  1.00 30.25  ? 368  GLU A CB   1 
ATOM   3407 C CG   . GLU A 1 356 ? 34.789 -29.199 20.885  1.00 26.40  ? 368  GLU A CG   1 
ATOM   3408 C CD   . GLU A 1 356 ? 35.590 -28.084 21.546  1.00 24.63  ? 368  GLU A CD   1 
ATOM   3409 O OE1  . GLU A 1 356 ? 35.160 -27.570 22.604  1.00 21.84  ? 368  GLU A OE1  1 
ATOM   3410 O OE2  . GLU A 1 356 ? 36.658 -27.738 21.003  1.00 29.51  ? 368  GLU A OE2  1 
ATOM   3411 H H    . GLU A 1 356 ? 33.366 -26.681 21.678  1.00 0.00   ? 368  GLU A H    1 
ATOM   3412 N N    . GLN A 1 357 ? 30.569 -27.818 22.276  1.00 22.54  ? 369  GLN A N    1 
ATOM   3413 C CA   . GLN A 1 357 ? 29.224 -27.962 22.802  1.00 20.30  ? 369  GLN A CA   1 
ATOM   3414 C C    . GLN A 1 357 ? 28.303 -27.352 21.770  1.00 20.39  ? 369  GLN A C    1 
ATOM   3415 O O    . GLN A 1 357 ? 27.279 -27.941 21.417  1.00 20.78  ? 369  GLN A O    1 
ATOM   3416 C CB   . GLN A 1 357 ? 29.087 -27.293 24.163  1.00 15.20  ? 369  GLN A CB   1 
ATOM   3417 C CG   . GLN A 1 357 ? 29.629 -28.198 25.226  1.00 16.83  ? 369  GLN A CG   1 
ATOM   3418 C CD   . GLN A 1 357 ? 29.691 -27.576 26.578  1.00 18.95  ? 369  GLN A CD   1 
ATOM   3419 O OE1  . GLN A 1 357 ? 29.945 -26.379 26.732  1.00 18.74  ? 369  GLN A OE1  1 
ATOM   3420 N NE2  . GLN A 1 357 ? 29.506 -28.398 27.593  1.00 22.99  ? 369  GLN A NE2  1 
ATOM   3421 H H    . GLN A 1 357 ? 31.191 -27.183 22.688  1.00 0.00   ? 369  GLN A H    1 
ATOM   3422 H HE21 . GLN A 1 357 ? 29.356 -29.345 27.409  1.00 0.00   ? 369  GLN A HE21 1 
ATOM   3423 H HE22 . GLN A 1 357 ? 29.526 -28.021 28.497  1.00 0.00   ? 369  GLN A HE22 1 
ATOM   3424 N N    . VAL A 1 358 ? 28.712 -26.201 21.240  1.00 21.72  ? 370  VAL A N    1 
ATOM   3425 C CA   . VAL A 1 358 ? 27.942 -25.529 20.212  1.00 22.54  ? 370  VAL A CA   1 
ATOM   3426 C C    . VAL A 1 358 ? 27.832 -26.442 18.963  1.00 23.49  ? 370  VAL A C    1 
ATOM   3427 O O    . VAL A 1 358 ? 26.756 -26.557 18.378  1.00 25.53  ? 370  VAL A O    1 
ATOM   3428 C CB   . VAL A 1 358 ? 28.519 -24.101 19.930  1.00 17.46  ? 370  VAL A CB   1 
ATOM   3429 C CG1  . VAL A 1 358 ? 27.827 -23.463 18.752  1.00 18.28  ? 370  VAL A CG1  1 
ATOM   3430 C CG2  . VAL A 1 358 ? 28.303 -23.228 21.156  1.00 13.73  ? 370  VAL A CG2  1 
ATOM   3431 H H    . VAL A 1 358 ? 29.553 -25.807 21.543  1.00 0.00   ? 370  VAL A H    1 
ATOM   3432 N N    . LEU A 1 359 ? 28.919 -27.135 18.611  1.00 24.95  ? 371  LEU A N    1 
ATOM   3433 C CA   . LEU A 1 359 ? 28.902 -28.078 17.482  1.00 24.54  ? 371  LEU A CA   1 
ATOM   3434 C C    . LEU A 1 359 ? 27.942 -29.246 17.746  1.00 23.79  ? 371  LEU A C    1 
ATOM   3435 O O    . LEU A 1 359 ? 27.208 -29.666 16.849  1.00 20.79  ? 371  LEU A O    1 
ATOM   3436 C CB   . LEU A 1 359 ? 30.300 -28.663 17.238  1.00 28.15  ? 371  LEU A CB   1 
ATOM   3437 C CG   . LEU A 1 359 ? 31.115 -28.357 15.981  1.00 34.75  ? 371  LEU A CG   1 
ATOM   3438 C CD1  . LEU A 1 359 ? 30.365 -28.779 14.727  1.00 38.22  ? 371  LEU A CD1  1 
ATOM   3439 C CD2  . LEU A 1 359 ? 31.478 -26.887 15.937  1.00 41.40  ? 371  LEU A CD2  1 
ATOM   3440 H H    . LEU A 1 359 ? 29.743 -27.019 19.126  1.00 0.00   ? 371  LEU A H    1 
ATOM   3441 N N    . ARG A 1 360 ? 27.991 -29.803 18.959  1.00 21.19  ? 372  ARG A N    1 
ATOM   3442 C CA   . ARG A 1 360 ? 27.129 -30.933 19.305  1.00 23.86  ? 372  ARG A CA   1 
ATOM   3443 C C    . ARG A 1 360 ? 25.648 -30.560 19.310  1.00 25.03  ? 372  ARG A C    1 
ATOM   3444 O O    . ARG A 1 360 ? 24.816 -31.332 18.838  1.00 26.25  ? 372  ARG A O    1 
ATOM   3445 C CB   . ARG A 1 360 ? 27.516 -31.568 20.654  1.00 26.06  ? 372  ARG A CB   1 
ATOM   3446 C CG   . ARG A 1 360 ? 27.706 -33.097 20.572  1.00 28.30  ? 372  ARG A CG   1 
ATOM   3447 C CD   . ARG A 1 360 ? 26.616 -33.891 21.307  1.00 31.92  ? 372  ARG A CD   1 
ATOM   3448 N NE   . ARG A 1 360 ? 26.848 -33.935 22.746  1.00 32.54  ? 372  ARG A NE   1 
ATOM   3449 C CZ   . ARG A 1 360 ? 26.343 -34.855 23.571  1.00 31.47  ? 372  ARG A CZ   1 
ATOM   3450 N NH1  . ARG A 1 360 ? 25.568 -35.833 23.116  1.00 29.20  ? 372  ARG A NH1  1 
ATOM   3451 N NH2  . ARG A 1 360 ? 26.597 -34.787 24.870  1.00 32.35  ? 372  ARG A NH2  1 
ATOM   3452 H H    . ARG A 1 360 ? 28.603 -29.439 19.628  1.00 0.00   ? 372  ARG A H    1 
ATOM   3453 H HE   . ARG A 1 360 ? 27.414 -33.239 23.141  1.00 0.00   ? 372  ARG A HE   1 
ATOM   3454 H HH11 . ARG A 1 360 ? 25.354 -35.892 22.142  1.00 0.00   ? 372  ARG A HH11 1 
ATOM   3455 H HH12 . ARG A 1 360 ? 25.199 -36.512 23.750  1.00 0.00   ? 372  ARG A HH12 1 
ATOM   3456 H HH21 . ARG A 1 360 ? 27.165 -34.046 25.229  1.00 0.00   ? 372  ARG A HH21 1 
ATOM   3457 H HH22 . ARG A 1 360 ? 26.219 -35.474 25.490  1.00 0.00   ? 372  ARG A HH22 1 
ATOM   3458 N N    . LEU A 1 361 ? 25.321 -29.380 19.831  1.00 24.16  ? 373  LEU A N    1 
ATOM   3459 C CA   . LEU A 1 361 ? 23.928 -28.945 19.870  1.00 22.84  ? 373  LEU A CA   1 
ATOM   3460 C C    . LEU A 1 361 ? 23.266 -28.902 18.505  1.00 23.96  ? 373  LEU A C    1 
ATOM   3461 O O    . LEU A 1 361 ? 22.115 -29.303 18.347  1.00 26.90  ? 373  LEU A O    1 
ATOM   3462 C CB   . LEU A 1 361 ? 23.816 -27.566 20.508  1.00 16.88  ? 373  LEU A CB   1 
ATOM   3463 C CG   . LEU A 1 361 ? 23.727 -27.557 22.020  1.00 14.58  ? 373  LEU A CG   1 
ATOM   3464 C CD1  . LEU A 1 361 ? 23.836 -26.142 22.481  1.00 18.06  ? 373  LEU A CD1  1 
ATOM   3465 C CD2  . LEU A 1 361 ? 22.421 -28.168 22.483  1.00 16.41  ? 373  LEU A CD2  1 
ATOM   3466 H H    . LEU A 1 361 ? 26.022 -28.795 20.174  1.00 0.00   ? 373  LEU A H    1 
ATOM   3467 N N    . ARG A 1 362 ? 23.989 -28.385 17.526  1.00 24.05  ? 374  ARG A N    1 
ATOM   3468 C CA   . ARG A 1 362 ? 23.440 -28.259 16.199  1.00 28.91  ? 374  ARG A CA   1 
ATOM   3469 C C    . ARG A 1 362 ? 23.478 -29.549 15.387  1.00 32.05  ? 374  ARG A C    1 
ATOM   3470 O O    . ARG A 1 362 ? 22.506 -29.920 14.726  1.00 32.24  ? 374  ARG A O    1 
ATOM   3471 C CB   . ARG A 1 362 ? 24.104 -27.050 15.536  1.00 30.10  ? 374  ARG A CB   1 
ATOM   3472 C CG   . ARG A 1 362 ? 24.548 -27.208 14.144  1.00 32.90  ? 374  ARG A CG   1 
ATOM   3473 C CD   . ARG A 1 362 ? 25.982 -27.410 14.317  1.00 40.36  ? 374  ARG A CD   1 
ATOM   3474 N NE   . ARG A 1 362 ? 26.793 -27.059 13.176  1.00 43.08  ? 374  ARG A NE   1 
ATOM   3475 C CZ   . ARG A 1 362 ? 27.392 -25.887 13.018  1.00 43.92  ? 374  ARG A CZ   1 
ATOM   3476 N NH1  . ARG A 1 362 ? 27.254 -24.911 13.924  1.00 42.20  ? 374  ARG A NH1  1 
ATOM   3477 N NH2  . ARG A 1 362 ? 28.216 -25.741 12.002  1.00 47.49  ? 374  ARG A NH2  1 
ATOM   3478 H H    . ARG A 1 362 ? 24.907 -28.089 17.703  1.00 0.00   ? 374  ARG A H    1 
ATOM   3479 H HE   . ARG A 1 362 ? 26.910 -27.729 12.471  1.00 0.00   ? 374  ARG A HE   1 
ATOM   3480 H HH11 . ARG A 1 362 ? 26.692 -25.053 14.739  1.00 0.00   ? 374  ARG A HH11 1 
ATOM   3481 H HH12 . ARG A 1 362 ? 27.715 -24.035 13.784  1.00 0.00   ? 374  ARG A HH12 1 
ATOM   3482 H HH21 . ARG A 1 362 ? 28.375 -26.503 11.375  1.00 0.00   ? 374  ARG A HH21 1 
ATOM   3483 H HH22 . ARG A 1 362 ? 28.681 -24.868 11.858  1.00 0.00   ? 374  ARG A HH22 1 
ATOM   3484 N N    . GLU A 1 363 ? 24.534 -30.313 15.621  1.00 35.30  ? 375  GLU A N    1 
ATOM   3485 C CA   . GLU A 1 363 ? 24.764 -31.570 14.932  1.00 37.99  ? 375  GLU A CA   1 
ATOM   3486 C C    . GLU A 1 363 ? 23.933 -32.746 15.488  1.00 37.41  ? 375  GLU A C    1 
ATOM   3487 O O    . GLU A 1 363 ? 23.477 -33.596 14.721  1.00 40.64  ? 375  GLU A O    1 
ATOM   3488 C CB   . GLU A 1 363 ? 26.245 -31.885 15.002  1.00 44.89  ? 375  GLU A CB   1 
ATOM   3489 C CG   . GLU A 1 363 ? 26.857 -32.589 13.834  1.00 57.27  ? 375  GLU A CG   1 
ATOM   3490 C CD   . GLU A 1 363 ? 28.397 -32.268 13.808  1.00 65.44  ? 375  GLU A CD   1 
ATOM   3491 O OE1  . GLU A 1 363 ? 29.074 -32.667 14.721  1.00 68.40  ? 375  GLU A OE1  1 
ATOM   3492 O OE2  . GLU A 1 363 ? 28.770 -31.507 12.857  1.00 70.22  ? 375  GLU A OE2  1 
ATOM   3493 H H    . GLU A 1 363 ? 25.182 -30.017 16.293  1.00 0.00   ? 375  GLU A H    1 
ATOM   3494 N N    . GLU A 1 364 ? 23.687 -32.765 16.798  1.00 35.56  ? 376  GLU A N    1 
ATOM   3495 C CA   . GLU A 1 364 ? 22.911 -33.850 17.415  1.00 37.20  ? 376  GLU A CA   1 
ATOM   3496 C C    . GLU A 1 364 ? 21.491 -33.438 17.784  1.00 35.02  ? 376  GLU A C    1 
ATOM   3497 O O    . GLU A 1 364 ? 20.575 -34.270 17.813  1.00 33.62  ? 376  GLU A O    1 
ATOM   3498 C CB   . GLU A 1 364 ? 23.637 -34.380 18.670  1.00 44.48  ? 376  GLU A CB   1 
ATOM   3499 C CG   . GLU A 1 364 ? 22.894 -35.497 19.429  1.00 55.11  ? 376  GLU A CG   1 
ATOM   3500 C CD   . GLU A 1 364 ? 23.780 -36.283 20.404  1.00 60.67  ? 376  GLU A CD   1 
ATOM   3501 O OE1  . GLU A 1 364 ? 24.936 -36.602 20.049  1.00 65.12  ? 376  GLU A OE1  1 
ATOM   3502 O OE2  . GLU A 1 364 ? 23.305 -36.606 21.515  1.00 62.22  ? 376  GLU A OE2  1 
ATOM   3503 H H    . GLU A 1 364 ? 24.004 -32.018 17.327  1.00 0.00   ? 376  GLU A H    1 
ATOM   3504 N N    . PHE A 1 365 ? 21.309 -32.141 18.006  1.00 31.15  ? 377  PHE A N    1 
ATOM   3505 C CA   . PHE A 1 365 ? 20.026 -31.606 18.424  1.00 26.40  ? 377  PHE A CA   1 
ATOM   3506 C C    . PHE A 1 365 ? 19.389 -30.524 17.533  1.00 26.25  ? 377  PHE A C    1 
ATOM   3507 O O    . PHE A 1 365 ? 18.283 -30.069 17.813  1.00 29.75  ? 377  PHE A O    1 
ATOM   3508 C CB   . PHE A 1 365 ? 20.153 -31.077 19.859  1.00 28.13  ? 377  PHE A CB   1 
ATOM   3509 C CG   . PHE A 1 365 ? 20.641 -32.107 20.870  1.00 30.52  ? 377  PHE A CG   1 
ATOM   3510 C CD1  . PHE A 1 365 ? 22.004 -32.270 21.143  1.00 31.06  ? 377  PHE A CD1  1 
ATOM   3511 C CD2  . PHE A 1 365 ? 19.728 -32.875 21.592  1.00 32.08  ? 377  PHE A CD2  1 
ATOM   3512 C CE1  . PHE A 1 365 ? 22.443 -33.179 22.127  1.00 26.99  ? 377  PHE A CE1  1 
ATOM   3513 C CE2  . PHE A 1 365 ? 20.155 -33.782 22.573  1.00 30.39  ? 377  PHE A CE2  1 
ATOM   3514 C CZ   . PHE A 1 365 ? 21.514 -33.931 22.842  1.00 25.99  ? 377  PHE A CZ   1 
ATOM   3515 H H    . PHE A 1 365 ? 22.063 -31.527 17.884  1.00 0.00   ? 377  PHE A H    1 
ATOM   3516 N N    . GLY A 1 366 ? 20.062 -30.116 16.461  1.00 24.54  ? 378  GLY A N    1 
ATOM   3517 C CA   . GLY A 1 366 ? 19.480 -29.087 15.608  1.00 19.23  ? 378  GLY A CA   1 
ATOM   3518 C C    . GLY A 1 366 ? 19.237 -27.727 16.259  1.00 21.27  ? 378  GLY A C    1 
ATOM   3519 O O    . GLY A 1 366 ? 18.403 -26.957 15.784  1.00 21.66  ? 378  GLY A O    1 
ATOM   3520 H H    . GLY A 1 366 ? 20.938 -30.502 16.249  1.00 0.00   ? 378  GLY A H    1 
ATOM   3521 N N    . VAL A 1 367 ? 19.876 -27.472 17.399  1.00 19.91  ? 379  VAL A N    1 
ATOM   3522 C CA   . VAL A 1 367 ? 19.750 -26.178 18.064  1.00 17.90  ? 379  VAL A CA   1 
ATOM   3523 C C    . VAL A 1 367 ? 20.926 -25.385 17.508  1.00 20.58  ? 379  VAL A C    1 
ATOM   3524 O O    . VAL A 1 367 ? 22.059 -25.846 17.558  1.00 19.67  ? 379  VAL A O    1 
ATOM   3525 C CB   . VAL A 1 367 ? 19.844 -26.323 19.602  1.00 14.99  ? 379  VAL A CB   1 
ATOM   3526 C CG1  . VAL A 1 367 ? 19.855 -24.959 20.269  1.00 15.03  ? 379  VAL A CG1  1 
ATOM   3527 C CG2  . VAL A 1 367 ? 18.679 -27.143 20.113  1.00 10.42  ? 379  VAL A CG2  1 
ATOM   3528 H H    . VAL A 1 367 ? 20.441 -28.162 17.801  1.00 0.00   ? 379  VAL A H    1 
ATOM   3529 N N    . TYR A 1 368 ? 20.652 -24.202 16.970  1.00 20.46  ? 380  TYR A N    1 
ATOM   3530 C CA   . TYR A 1 368 ? 21.692 -23.384 16.341  1.00 19.18  ? 380  TYR A CA   1 
ATOM   3531 C C    . TYR A 1 368 ? 22.135 -22.112 17.072  1.00 17.92  ? 380  TYR A C    1 
ATOM   3532 O O    . TYR A 1 368 ? 21.356 -21.179 17.180  1.00 19.63  ? 380  TYR A O    1 
ATOM   3533 C CB   . TYR A 1 368 ? 21.226 -22.982 14.934  1.00 19.36  ? 380  TYR A CB   1 
ATOM   3534 C CG   . TYR A 1 368 ? 21.229 -24.107 13.935  1.00 19.81  ? 380  TYR A CG   1 
ATOM   3535 C CD1  . TYR A 1 368 ? 20.439 -25.242 14.124  1.00 15.23  ? 380  TYR A CD1  1 
ATOM   3536 C CD2  . TYR A 1 368 ? 22.073 -24.072 12.826  1.00 19.42  ? 380  TYR A CD2  1 
ATOM   3537 C CE1  . TYR A 1 368 ? 20.496 -26.308 13.245  1.00 19.83  ? 380  TYR A CE1  1 
ATOM   3538 C CE2  . TYR A 1 368 ? 22.138 -25.134 11.939  1.00 22.21  ? 380  TYR A CE2  1 
ATOM   3539 C CZ   . TYR A 1 368 ? 21.346 -26.251 12.160  1.00 22.72  ? 380  TYR A CZ   1 
ATOM   3540 O OH   . TYR A 1 368 ? 21.419 -27.329 11.313  1.00 24.91  ? 380  TYR A OH   1 
ATOM   3541 H H    . TYR A 1 368 ? 19.752 -23.848 17.035  1.00 0.00   ? 380  TYR A H    1 
ATOM   3542 H HH   . TYR A 1 368 ? 22.057 -27.154 10.618  1.00 0.00   ? 380  TYR A HH   1 
ATOM   3543 N N    . ALA A 1 369 ? 23.383 -22.078 17.542  1.00 12.94  ? 381  ALA A N    1 
ATOM   3544 C CA   . ALA A 1 369 ? 23.943 -20.901 18.211  1.00 12.42  ? 381  ALA A CA   1 
ATOM   3545 C C    . ALA A 1 369 ? 25.247 -20.566 17.485  1.00 12.33  ? 381  ALA A C    1 
ATOM   3546 O O    . ALA A 1 369 ? 25.789 -21.404 16.766  1.00 14.39  ? 381  ALA A O    1 
ATOM   3547 C CB   . ALA A 1 369 ? 24.242 -21.197 19.690  1.00 15.66  ? 381  ALA A CB   1 
ATOM   3548 H H    . ALA A 1 369 ? 23.947 -22.873 17.435  1.00 0.00   ? 381  ALA A H    1 
ATOM   3549 N N    . VAL A 1 370 ? 25.752 -19.351 17.676  1.00 15.33  ? 382  VAL A N    1 
ATOM   3550 C CA   . VAL A 1 370 ? 27.010 -18.922 17.052  1.00 15.10  ? 382  VAL A CA   1 
ATOM   3551 C C    . VAL A 1 370 ? 28.147 -19.687 17.783  1.00 16.72  ? 382  VAL A C    1 
ATOM   3552 O O    . VAL A 1 370 ? 28.021 -19.955 18.979  1.00 16.69  ? 382  VAL A O    1 
ATOM   3553 C CB   . VAL A 1 370 ? 27.071 -17.371 17.149  1.00 12.84  ? 382  VAL A CB   1 
ATOM   3554 C CG1  . VAL A 1 370 ? 28.424 -16.828 16.774  1.00 16.89  ? 382  VAL A CG1  1 
ATOM   3555 C CG2  . VAL A 1 370 ? 25.997 -16.779 16.245  1.00 12.68  ? 382  VAL A CG2  1 
ATOM   3556 H H    . VAL A 1 370 ? 25.268 -18.724 18.253  1.00 0.00   ? 382  VAL A H    1 
ATOM   3557 N N    . ALA A 1 371 ? 29.214 -20.090 17.078  1.00 17.96  ? 383  ALA A N    1 
ATOM   3558 C CA   . ALA A 1 371 ? 30.292 -20.891 17.705  1.00 16.99  ? 383  ALA A CA   1 
ATOM   3559 C C    . ALA A 1 371 ? 30.873 -20.320 18.994  1.00 17.65  ? 383  ALA A C    1 
ATOM   3560 O O    . ALA A 1 371 ? 31.431 -21.053 19.819  1.00 20.81  ? 383  ALA A O    1 
ATOM   3561 C CB   . ALA A 1 371 ? 31.424 -21.182 16.697  1.00 19.32  ? 383  ALA A CB   1 
ATOM   3562 H H    . ALA A 1 371 ? 29.281 -19.848 16.131  1.00 0.00   ? 383  ALA A H    1 
ATOM   3563 N N    . SER A 1 372 ? 30.731 -19.008 19.153  1.00 20.06  ? 384  SER A N    1 
ATOM   3564 C CA   . SER A 1 372 ? 31.186 -18.300 20.341  1.00 15.94  ? 384  SER A CA   1 
ATOM   3565 C C    . SER A 1 372 ? 30.356 -18.588 21.592  1.00 18.69  ? 384  SER A C    1 
ATOM   3566 O O    . SER A 1 372 ? 30.757 -18.226 22.690  1.00 19.75  ? 384  SER A O    1 
ATOM   3567 C CB   . SER A 1 372 ? 31.157 -16.797 20.079  1.00 18.97  ? 384  SER A CB   1 
ATOM   3568 O OG   . SER A 1 372 ? 29.838 -16.361 19.824  1.00 21.02  ? 384  SER A OG   1 
ATOM   3569 H H    . SER A 1 372 ? 30.304 -18.491 18.438  1.00 0.00   ? 384  SER A H    1 
ATOM   3570 H HG   . SER A 1 372 ? 29.836 -15.414 19.667  1.00 0.00   ? 384  SER A HG   1 
ATOM   3571 N N    . GLY A 1 373 ? 29.208 -19.244 21.431  1.00 18.51  ? 385  GLY A N    1 
ATOM   3572 C CA   . GLY A 1 373 ? 28.357 -19.498 22.577  1.00 16.02  ? 385  GLY A CA   1 
ATOM   3573 C C    . GLY A 1 373 ? 27.261 -18.449 22.687  1.00 14.14  ? 385  GLY A C    1 
ATOM   3574 O O    . GLY A 1 373 ? 26.477 -18.461 23.634  1.00 15.94  ? 385  GLY A O    1 
ATOM   3575 H H    . GLY A 1 373 ? 28.954 -19.560 20.551  1.00 0.00   ? 385  GLY A H    1 
ATOM   3576 N N    . ARG A 1 374 ? 27.228 -17.515 21.739  1.00 11.07  ? 386  ARG A N    1 
ATOM   3577 C CA   . ARG A 1 374 ? 26.198 -16.477 21.739  1.00 14.84  ? 386  ARG A CA   1 
ATOM   3578 C C    . ARG A 1 374 ? 24.874 -17.088 21.303  1.00 13.14  ? 386  ARG A C    1 
ATOM   3579 O O    . ARG A 1 374 ? 24.803 -17.738 20.258  1.00 13.05  ? 386  ARG A O    1 
ATOM   3580 C CB   . ARG A 1 374 ? 26.561 -15.344 20.775  1.00 14.47  ? 386  ARG A CB   1 
ATOM   3581 C CG   . ARG A 1 374 ? 25.659 -14.124 20.896  1.00 8.78   ? 386  ARG A CG   1 
ATOM   3582 C CD   . ARG A 1 374 ? 25.846 -13.185 19.723  1.00 9.42   ? 386  ARG A CD   1 
ATOM   3583 N NE   . ARG A 1 374 ? 25.170 -13.677 18.534  1.00 11.38  ? 386  ARG A NE   1 
ATOM   3584 C CZ   . ARG A 1 374 ? 25.119 -13.015 17.379  1.00 13.04  ? 386  ARG A CZ   1 
ATOM   3585 N NH1  . ARG A 1 374 ? 25.721 -11.833 17.253  1.00 14.78  ? 386  ARG A NH1  1 
ATOM   3586 N NH2  . ARG A 1 374 ? 24.415 -13.500 16.364  1.00 10.54  ? 386  ARG A NH2  1 
ATOM   3587 H H    . ARG A 1 374 ? 27.901 -17.519 21.027  1.00 0.00   ? 386  ARG A H    1 
ATOM   3588 H HE   . ARG A 1 374 ? 24.723 -14.548 18.580  1.00 0.00   ? 386  ARG A HE   1 
ATOM   3589 H HH11 . ARG A 1 374 ? 26.216 -11.430 18.022  1.00 0.00   ? 386  ARG A HH11 1 
ATOM   3590 H HH12 . ARG A 1 374 ? 25.678 -11.348 16.381  1.00 0.00   ? 386  ARG A HH12 1 
ATOM   3591 H HH21 . ARG A 1 374 ? 23.924 -14.364 16.468  1.00 0.00   ? 386  ARG A HH21 1 
ATOM   3592 H HH22 . ARG A 1 374 ? 24.384 -13.010 15.495  1.00 0.00   ? 386  ARG A HH22 1 
ATOM   3593 N N    . VAL A 1 375 ? 23.841 -16.905 22.121  1.00 16.77  ? 387  VAL A N    1 
ATOM   3594 C CA   . VAL A 1 375 ? 22.508 -17.429 21.820  1.00 19.23  ? 387  VAL A CA   1 
ATOM   3595 C C    . VAL A 1 375 ? 21.516 -16.264 21.676  1.00 15.67  ? 387  VAL A C    1 
ATOM   3596 O O    . VAL A 1 375 ? 21.721 -15.205 22.272  1.00 20.28  ? 387  VAL A O    1 
ATOM   3597 C CB   . VAL A 1 375 ? 22.019 -18.423 22.926  1.00 15.50  ? 387  VAL A CB   1 
ATOM   3598 C CG1  . VAL A 1 375 ? 22.865 -19.668 22.914  1.00 12.29  ? 387  VAL A CG1  1 
ATOM   3599 C CG2  . VAL A 1 375 ? 22.079 -17.790 24.301  1.00 19.73  ? 387  VAL A CG2  1 
ATOM   3600 H H    . VAL A 1 375 ? 23.972 -16.395 22.938  1.00 0.00   ? 387  VAL A H    1 
ATOM   3601 N N    . ASN A 1 376 ? 20.515 -16.412 20.803  1.00 18.26  ? 388  ASN A N    1 
ATOM   3602 C CA   . ASN A 1 376 ? 19.511 -15.361 20.632  1.00 15.32  ? 388  ASN A CA   1 
ATOM   3603 C C    . ASN A 1 376 ? 18.349 -15.702 21.545  1.00 12.36  ? 388  ASN A C    1 
ATOM   3604 O O    . ASN A 1 376 ? 17.633 -16.678 21.311  1.00 12.91  ? 388  ASN A O    1 
ATOM   3605 C CB   . ASN A 1 376 ? 19.012 -15.222 19.179  1.00 13.19  ? 388  ASN A CB   1 
ATOM   3606 C CG   . ASN A 1 376 ? 18.190 -13.942 18.952  1.00 13.24  ? 388  ASN A CG   1 
ATOM   3607 O OD1  . ASN A 1 376 ? 18.073 -13.094 19.848  1.00 11.27  ? 388  ASN A OD1  1 
ATOM   3608 N ND2  . ASN A 1 376 ? 17.635 -13.773 17.758  1.00 14.91  ? 388  ASN A ND2  1 
ATOM   3609 H H    . ASN A 1 376 ? 20.446 -17.236 20.280  1.00 0.00   ? 388  ASN A H    1 
ATOM   3610 H HD21 . ASN A 1 376 ? 17.766 -14.464 17.075  1.00 0.00   ? 388  ASN A HD21 1 
ATOM   3611 H HD22 . ASN A 1 376 ? 17.118 -12.955 17.614  1.00 0.00   ? 388  ASN A HD22 1 
ATOM   3612 N N    . VAL A 1 377 ? 18.251 -14.957 22.644  1.00 14.31  ? 389  VAL A N    1 
ATOM   3613 C CA   . VAL A 1 377 ? 17.182 -15.130 23.615  1.00 15.88  ? 389  VAL A CA   1 
ATOM   3614 C C    . VAL A 1 377 ? 15.835 -14.691 22.982  1.00 17.96  ? 389  VAL A C    1 
ATOM   3615 O O    . VAL A 1 377 ? 14.790 -15.257 23.305  1.00 20.36  ? 389  VAL A O    1 
ATOM   3616 C CB   . VAL A 1 377 ? 17.510 -14.394 24.969  1.00 18.05  ? 389  VAL A CB   1 
ATOM   3617 C CG1  . VAL A 1 377 ? 16.385 -14.558 25.961  1.00 17.81  ? 389  VAL A CG1  1 
ATOM   3618 C CG2  . VAL A 1 377 ? 18.788 -14.971 25.576  1.00 18.69  ? 389  VAL A CG2  1 
ATOM   3619 H H    . VAL A 1 377 ? 18.940 -14.288 22.813  1.00 0.00   ? 389  VAL A H    1 
ATOM   3620 N N    . ALA A 1 378 ? 15.875 -13.713 22.069  1.00 19.09  ? 390  ALA A N    1 
ATOM   3621 C CA   . ALA A 1 378 ? 14.668 -13.262 21.355  1.00 18.05  ? 390  ALA A CA   1 
ATOM   3622 C C    . ALA A 1 378 ? 14.124 -14.334 20.396  1.00 18.76  ? 390  ALA A C    1 
ATOM   3623 O O    . ALA A 1 378 ? 13.013 -14.222 19.877  1.00 23.44  ? 390  ALA A O    1 
ATOM   3624 C CB   . ALA A 1 378 ? 14.952 -11.950 20.576  1.00 14.43  ? 390  ALA A CB   1 
ATOM   3625 H H    . ALA A 1 378 ? 16.734 -13.286 21.870  1.00 0.00   ? 390  ALA A H    1 
ATOM   3626 N N    . GLY A 1 379 ? 14.950 -15.339 20.123  1.00 17.99  ? 391  GLY A N    1 
ATOM   3627 C CA   . GLY A 1 379 ? 14.550 -16.436 19.261  1.00 16.10  ? 391  GLY A CA   1 
ATOM   3628 C C    . GLY A 1 379 ? 13.888 -17.546 20.058  1.00 16.37  ? 391  GLY A C    1 
ATOM   3629 O O    . GLY A 1 379 ? 13.449 -18.550 19.508  1.00 18.52  ? 391  GLY A O    1 
ATOM   3630 H H    . GLY A 1 379 ? 15.852 -15.342 20.504  1.00 0.00   ? 391  GLY A H    1 
ATOM   3631 N N    . MET A 1 380 ? 13.854 -17.363 21.373  1.00 21.56  ? 392  MET A N    1 
ATOM   3632 C CA   . MET A 1 380 ? 13.247 -18.321 22.296  1.00 26.44  ? 392  MET A CA   1 
ATOM   3633 C C    . MET A 1 380 ? 11.782 -17.988 22.552  1.00 27.76  ? 392  MET A C    1 
ATOM   3634 O O    . MET A 1 380 ? 11.424 -16.823 22.708  1.00 26.27  ? 392  MET A O    1 
ATOM   3635 C CB   . MET A 1 380 ? 13.972 -18.294 23.645  1.00 25.13  ? 392  MET A CB   1 
ATOM   3636 C CG   . MET A 1 380 ? 15.417 -18.668 23.577  1.00 24.72  ? 392  MET A CG   1 
ATOM   3637 S SD   . MET A 1 380 ? 16.254 -18.487 25.126  1.00 24.15  ? 392  MET A SD   1 
ATOM   3638 C CE   . MET A 1 380 ? 17.846 -18.991 24.603  1.00 24.78  ? 392  MET A CE   1 
ATOM   3639 H H    . MET A 1 380 ? 14.254 -16.553 21.747  1.00 0.00   ? 392  MET A H    1 
ATOM   3640 N N    . THR A 1 381 ? 10.953 -19.029 22.613  1.00 29.23  ? 393  THR A N    1 
ATOM   3641 C CA   . THR A 1 381 ? 9.515  -18.914 22.878  1.00 29.44  ? 393  THR A CA   1 
ATOM   3642 C C    . THR A 1 381 ? 9.206  -20.005 23.920  1.00 30.23  ? 393  THR A C    1 
ATOM   3643 O O    . THR A 1 381 ? 9.974  -20.964 24.046  1.00 29.20  ? 393  THR A O    1 
ATOM   3644 C CB   . THR A 1 381 ? 8.691  -19.180 21.594  1.00 27.92  ? 393  THR A CB   1 
ATOM   3645 O OG1  . THR A 1 381 ? 8.862  -20.547 21.203  1.00 27.61  ? 393  THR A OG1  1 
ATOM   3646 C CG2  . THR A 1 381 ? 9.152  -18.267 20.450  1.00 23.05  ? 393  THR A CG2  1 
ATOM   3647 H H    . THR A 1 381 ? 11.322 -19.920 22.470  1.00 0.00   ? 393  THR A H    1 
ATOM   3648 H HG1  . THR A 1 381 ? 8.345  -20.724 20.414  1.00 0.00   ? 393  THR A HG1  1 
ATOM   3649 N N    . PRO A 1 382 ? 8.068  -19.903 24.643  1.00 32.19  ? 394  PRO A N    1 
ATOM   3650 C CA   . PRO A 1 382 ? 7.707  -20.898 25.661  1.00 32.11  ? 394  PRO A CA   1 
ATOM   3651 C C    . PRO A 1 382 ? 7.450  -22.312 25.111  1.00 33.67  ? 394  PRO A C    1 
ATOM   3652 O O    . PRO A 1 382 ? 7.445  -23.299 25.859  1.00 34.49  ? 394  PRO A O    1 
ATOM   3653 C CB   . PRO A 1 382 ? 6.457  -20.290 26.305  1.00 32.54  ? 394  PRO A CB   1 
ATOM   3654 C CG   . PRO A 1 382 ? 6.595  -18.802 26.010  1.00 32.68  ? 394  PRO A CG   1 
ATOM   3655 C CD   . PRO A 1 382 ? 7.051  -18.837 24.589  1.00 33.13  ? 394  PRO A CD   1 
ATOM   3656 N N    . ASP A 1 383 ? 7.237  -22.379 23.796  1.00 32.73  ? 395  ASP A N    1 
ATOM   3657 C CA   . ASP A 1 383 ? 6.994  -23.613 23.064  1.00 33.53  ? 395  ASP A CA   1 
ATOM   3658 C C    . ASP A 1 383 ? 8.314  -24.319 22.775  1.00 31.48  ? 395  ASP A C    1 
ATOM   3659 O O    . ASP A 1 383 ? 8.362  -25.555 22.722  1.00 30.61  ? 395  ASP A O    1 
ATOM   3660 C CB   . ASP A 1 383 ? 6.247  -23.300 21.764  1.00 40.70  ? 395  ASP A CB   1 
ATOM   3661 C CG   . ASP A 1 383 ? 4.853  -22.743 22.014  1.00 46.81  ? 395  ASP A CG   1 
ATOM   3662 O OD1  . ASP A 1 383 ? 3.946  -23.550 22.307  1.00 49.43  ? 395  ASP A OD1  1 
ATOM   3663 O OD2  . ASP A 1 383 ? 4.679  -21.508 21.932  1.00 53.02  ? 395  ASP A OD2  1 
ATOM   3664 H H    . ASP A 1 383 ? 7.240  -21.543 23.286  1.00 0.00   ? 395  ASP A H    1 
ATOM   3665 N N    . ASN A 1 384 ? 9.376  -23.549 22.515  1.00 28.80  ? 396  ASN A N    1 
ATOM   3666 C CA   . ASN A 1 384 ? 10.675 -24.176 22.287  1.00 24.26  ? 396  ASN A CA   1 
ATOM   3667 C C    . ASN A 1 384 ? 11.599 -24.166 23.480  1.00 22.95  ? 396  ASN A C    1 
ATOM   3668 O O    . ASN A 1 384 ? 12.664 -24.773 23.431  1.00 27.06  ? 396  ASN A O    1 
ATOM   3669 C CB   . ASN A 1 384 ? 11.427 -23.683 21.021  1.00 19.53  ? 396  ASN A CB   1 
ATOM   3670 C CG   . ASN A 1 384 ? 11.927 -22.225 21.079  1.00 16.86  ? 396  ASN A CG   1 
ATOM   3671 O OD1  . ASN A 1 384 ? 12.094 -21.608 20.010  1.00 25.77  ? 396  ASN A OD1  1 
ATOM   3672 N ND2  . ASN A 1 384 ? 12.244 -21.688 22.247  1.00 18.93  ? 396  ASN A ND2  1 
ATOM   3673 H H    . ASN A 1 384 ? 9.285  -22.574 22.479  1.00 0.00   ? 396  ASN A H    1 
ATOM   3674 H HD21 . ASN A 1 384 ? 12.189 -22.137 23.104  1.00 0.00   ? 396  ASN A HD21 1 
ATOM   3675 H HD22 . ASN A 1 384 ? 12.553 -20.763 22.188  1.00 0.00   ? 396  ASN A HD22 1 
ATOM   3676 N N    . MET A 1 385 ? 11.180 -23.534 24.571  1.00 23.28  ? 397  MET A N    1 
ATOM   3677 C CA   . MET A 1 385 ? 12.045 -23.485 25.738  1.00 22.20  ? 397  MET A CA   1 
ATOM   3678 C C    . MET A 1 385 ? 12.453 -24.833 26.308  1.00 25.56  ? 397  MET A C    1 
ATOM   3679 O O    . MET A 1 385 ? 13.610 -25.027 26.690  1.00 26.32  ? 397  MET A O    1 
ATOM   3680 C CB   . MET A 1 385 ? 11.450 -22.624 26.846  1.00 23.36  ? 397  MET A CB   1 
ATOM   3681 C CG   . MET A 1 385 ? 12.483 -22.179 27.867  1.00 27.21  ? 397  MET A CG   1 
ATOM   3682 S SD   . MET A 1 385 ? 13.512 -20.875 27.198  1.00 28.84  ? 397  MET A SD   1 
ATOM   3683 C CE   . MET A 1 385 ? 14.825 -21.782 26.544  1.00 32.97  ? 397  MET A CE   1 
ATOM   3684 H H    . MET A 1 385 ? 10.298 -23.108 24.591  1.00 0.00   ? 397  MET A H    1 
ATOM   3685 N N    . ALA A 1 386 ? 11.505 -25.769 26.391  1.00 24.78  ? 398  ALA A N    1 
ATOM   3686 C CA   . ALA A 1 386 ? 11.811 -27.075 26.953  1.00 24.05  ? 398  ALA A CA   1 
ATOM   3687 C C    . ALA A 1 386 ? 12.776 -27.957 26.150  1.00 24.44  ? 398  ALA A C    1 
ATOM   3688 O O    . ALA A 1 386 ? 13.781 -28.423 26.702  1.00 24.80  ? 398  ALA A O    1 
ATOM   3689 C CB   . ALA A 1 386 ? 10.517 -27.834 27.281  1.00 25.43  ? 398  ALA A CB   1 
ATOM   3690 H H    . ALA A 1 386 ? 10.600 -25.574 26.069  1.00 0.00   ? 398  ALA A H    1 
ATOM   3691 N N    . PRO A 1 387 ? 12.500 -28.200 24.851  1.00 24.05  ? 399  PRO A N    1 
ATOM   3692 C CA   . PRO A 1 387 ? 13.399 -29.031 24.045  1.00 23.47  ? 399  PRO A CA   1 
ATOM   3693 C C    . PRO A 1 387 ? 14.789 -28.435 23.879  1.00 25.05  ? 399  PRO A C    1 
ATOM   3694 O O    . PRO A 1 387 ? 15.784 -29.140 23.691  1.00 25.93  ? 399  PRO A O    1 
ATOM   3695 C CB   . PRO A 1 387 ? 12.663 -29.160 22.705  1.00 25.70  ? 399  PRO A CB   1 
ATOM   3696 C CG   . PRO A 1 387 ? 11.795 -27.952 22.662  1.00 25.26  ? 399  PRO A CG   1 
ATOM   3697 C CD   . PRO A 1 387 ? 11.300 -27.832 24.072  1.00 23.93  ? 399  PRO A CD   1 
ATOM   3698 N N    . LEU A 1 388 ? 14.837 -27.105 23.911  1.00 25.20  ? 400  LEU A N    1 
ATOM   3699 C CA   . LEU A 1 388 ? 16.075 -26.367 23.800  1.00 25.63  ? 400  LEU A CA   1 
ATOM   3700 C C    . LEU A 1 388 ? 16.880 -26.553 25.093  1.00 24.09  ? 400  LEU A C    1 
ATOM   3701 O O    . LEU A 1 388 ? 18.059 -26.920 25.045  1.00 29.00  ? 400  LEU A O    1 
ATOM   3702 C CB   . LEU A 1 388 ? 15.757 -24.895 23.492  1.00 24.53  ? 400  LEU A CB   1 
ATOM   3703 C CG   . LEU A 1 388 ? 16.568 -23.710 24.003  1.00 25.82  ? 400  LEU A CG   1 
ATOM   3704 C CD1  . LEU A 1 388 ? 18.025 -23.825 23.610  1.00 26.34  ? 400  LEU A CD1  1 
ATOM   3705 C CD2  . LEU A 1 388 ? 15.953 -22.454 23.410  1.00 26.59  ? 400  LEU A CD2  1 
ATOM   3706 H H    . LEU A 1 388 ? 14.000 -26.606 24.016  1.00 0.00   ? 400  LEU A H    1 
ATOM   3707 N N    . CYS A 1 389 ? 16.237 -26.364 26.244  1.00 20.78  ? 401  CYS A N    1 
ATOM   3708 C CA   . CYS A 1 389 ? 16.943 -26.551 27.508  1.00 20.97  ? 401  CYS A CA   1 
ATOM   3709 C C    . CYS A 1 389 ? 17.368 -28.002 27.742  1.00 22.68  ? 401  CYS A C    1 
ATOM   3710 O O    . CYS A 1 389 ? 18.364 -28.253 28.423  1.00 22.43  ? 401  CYS A O    1 
ATOM   3711 C CB   . CYS A 1 389 ? 16.133 -26.003 28.676  1.00 16.83  ? 401  CYS A CB   1 
ATOM   3712 S SG   . CYS A 1 389 ? 16.090 -24.216 28.598  1.00 18.05  ? 401  CYS A SG   1 
ATOM   3713 H H    . CYS A 1 389 ? 15.293 -26.110 26.238  1.00 0.00   ? 401  CYS A H    1 
ATOM   3714 N N    . GLU A 1 390 ? 16.615 -28.950 27.183  1.00 25.03  ? 402  GLU A N    1 
ATOM   3715 C CA   . GLU A 1 390 ? 16.965 -30.360 27.308  1.00 28.59  ? 402  GLU A CA   1 
ATOM   3716 C C    . GLU A 1 390 ? 18.204 -30.660 26.468  1.00 27.73  ? 402  GLU A C    1 
ATOM   3717 O O    . GLU A 1 390 ? 19.045 -31.467 26.857  1.00 26.05  ? 402  GLU A O    1 
ATOM   3718 C CB   . GLU A 1 390 ? 15.788 -31.250 26.886  1.00 31.57  ? 402  GLU A CB   1 
ATOM   3719 C CG   . GLU A 1 390 ? 14.826 -31.548 28.026  1.00 40.60  ? 402  GLU A CG   1 
ATOM   3720 C CD   . GLU A 1 390 ? 13.407 -31.885 27.578  1.00 46.07  ? 402  GLU A CD   1 
ATOM   3721 O OE1  . GLU A 1 390 ? 13.202 -32.297 26.412  1.00 51.08  ? 402  GLU A OE1  1 
ATOM   3722 O OE2  . GLU A 1 390 ? 12.495 -31.738 28.417  1.00 51.01  ? 402  GLU A OE2  1 
ATOM   3723 H H    . GLU A 1 390 ? 15.822 -28.694 26.671  1.00 0.00   ? 402  GLU A H    1 
ATOM   3724 N N    . ALA A 1 391 ? 18.296 -30.008 25.312  1.00 27.50  ? 403  ALA A N    1 
ATOM   3725 C CA   . ALA A 1 391 ? 19.429 -30.186 24.416  1.00 26.21  ? 403  ALA A CA   1 
ATOM   3726 C C    . ALA A 1 391 ? 20.679 -29.628 25.073  1.00 26.00  ? 403  ALA A C    1 
ATOM   3727 O O    . ALA A 1 391 ? 21.748 -30.249 25.048  1.00 25.41  ? 403  ALA A O    1 
ATOM   3728 C CB   . ALA A 1 391 ? 19.174 -29.469 23.093  1.00 22.52  ? 403  ALA A CB   1 
ATOM   3729 H H    . ALA A 1 391 ? 17.581 -29.387 25.060  1.00 0.00   ? 403  ALA A H    1 
ATOM   3730 N N    . ILE A 1 392 ? 20.541 -28.446 25.666  1.00 28.08  ? 404  ILE A N    1 
ATOM   3731 C CA   . ILE A 1 392 ? 21.665 -27.810 26.335  1.00 27.36  ? 404  ILE A CA   1 
ATOM   3732 C C    . ILE A 1 392 ? 22.177 -28.631 27.517  1.00 29.85  ? 404  ILE A C    1 
ATOM   3733 O O    . ILE A 1 392 ? 23.362 -28.966 27.548  1.00 28.76  ? 404  ILE A O    1 
ATOM   3734 C CB   . ILE A 1 392 ? 21.329 -26.371 26.799  1.00 27.96  ? 404  ILE A CB   1 
ATOM   3735 C CG1  . ILE A 1 392 ? 21.205 -25.451 25.582  1.00 21.85  ? 404  ILE A CG1  1 
ATOM   3736 C CG2  . ILE A 1 392 ? 22.420 -25.852 27.737  1.00 25.38  ? 404  ILE A CG2  1 
ATOM   3737 C CD1  . ILE A 1 392 ? 20.780 -24.069 25.950  1.00 24.17  ? 404  ILE A CD1  1 
ATOM   3738 H H    . ILE A 1 392 ? 19.670 -28.003 25.662  1.00 0.00   ? 404  ILE A H    1 
ATOM   3739 N N    . VAL A 1 393 ? 21.306 -29.004 28.459  1.00 30.34  ? 405  VAL A N    1 
ATOM   3740 C CA   . VAL A 1 393 ? 21.802 -29.766 29.602  1.00 31.46  ? 405  VAL A CA   1 
ATOM   3741 C C    . VAL A 1 393 ? 22.425 -31.101 29.201  1.00 32.73  ? 405  VAL A C    1 
ATOM   3742 O O    . VAL A 1 393 ? 23.229 -31.669 29.952  1.00 34.91  ? 405  VAL A O    1 
ATOM   3743 C CB   . VAL A 1 393 ? 20.734 -29.993 30.707  1.00 30.98  ? 405  VAL A CB   1 
ATOM   3744 C CG1  . VAL A 1 393 ? 20.076 -28.681 31.075  1.00 33.06  ? 405  VAL A CG1  1 
ATOM   3745 C CG2  . VAL A 1 393 ? 19.720 -31.031 30.304  1.00 35.40  ? 405  VAL A CG2  1 
ATOM   3746 H H    . VAL A 1 393 ? 20.358 -28.777 28.378  1.00 0.00   ? 405  VAL A H    1 
ATOM   3747 N N    . ALA A 1 394 ? 22.086 -31.585 28.008  1.00 32.60  ? 407  ALA A N    1 
ATOM   3748 C CA   . ALA A 1 394 ? 22.650 -32.835 27.531  1.00 30.65  ? 407  ALA A CA   1 
ATOM   3749 C C    . ALA A 1 394 ? 24.053 -32.718 26.933  1.00 29.14  ? 407  ALA A C    1 
ATOM   3750 O O    . ALA A 1 394 ? 24.699 -33.738 26.709  1.00 29.75  ? 407  ALA A O    1 
ATOM   3751 C CB   . ALA A 1 394 ? 21.706 -33.499 26.541  1.00 33.31  ? 407  ALA A CB   1 
ATOM   3752 H H    . ALA A 1 394 ? 21.448 -31.098 27.446  1.00 0.00   ? 407  ALA A H    1 
ATOM   3753 N N    . VAL A 1 395 ? 24.516 -31.507 26.630  1.00 27.57  ? 408  VAL A N    1 
ATOM   3754 C CA   . VAL A 1 395 ? 25.873 -31.376 26.091  1.00 29.47  ? 408  VAL A CA   1 
ATOM   3755 C C    . VAL A 1 395 ? 26.816 -30.816 27.145  1.00 28.94  ? 408  VAL A C    1 
ATOM   3756 O O    . VAL A 1 395 ? 28.021 -30.698 26.922  1.00 29.70  ? 408  VAL A O    1 
ATOM   3757 C CB   . VAL A 1 395 ? 25.949 -30.490 24.814  1.00 27.62  ? 408  VAL A CB   1 
ATOM   3758 C CG1  . VAL A 1 395 ? 25.077 -31.071 23.707  1.00 24.74  ? 408  VAL A CG1  1 
ATOM   3759 C CG2  . VAL A 1 395 ? 25.573 -29.058 25.129  1.00 27.78  ? 408  VAL A CG2  1 
ATOM   3760 H H    . VAL A 1 395 ? 23.953 -30.719 26.757  1.00 0.00   ? 408  VAL A H    1 
ATOM   3761 N N    . LEU A 1 396 ? 26.242 -30.489 28.299  1.00 29.60  ? 409  LEU A N    1 
ATOM   3762 C CA   . LEU A 1 396 ? 26.984 -29.951 29.426  1.00 32.58  ? 409  LEU A CA   1 
ATOM   3763 C C    . LEU A 1 396 ? 27.767 -31.040 30.151  1.00 35.54  ? 409  LEU A C    1 
ATOM   3764 O O    . LEU A 1 396 ? 27.259 -32.183 30.231  1.00 37.23  ? 409  LEU A O    1 
ATOM   3765 C CB   . LEU A 1 396 ? 26.037 -29.276 30.424  1.00 30.25  ? 409  LEU A CB   1 
ATOM   3766 C CG   . LEU A 1 396 ? 25.365 -27.946 30.099  1.00 29.76  ? 409  LEU A CG   1 
ATOM   3767 C CD1  . LEU A 1 396 ? 24.807 -27.390 31.397  1.00 30.57  ? 409  LEU A CD1  1 
ATOM   3768 C CD2  . LEU A 1 396 ? 26.355 -26.963 29.501  1.00 30.53  ? 409  LEU A CD2  1 
ATOM   3769 O OXT  . LEU A 1 396 ? 28.860 -30.713 30.664  1.00 39.09  ? 409  LEU A OXT  1 
ATOM   3770 H H    . LEU A 1 396 ? 25.275 -30.613 28.401  1.00 0.00   ? 409  LEU A H    1 
HETATM 3771 N N1   . PLP B 2 .   ? 26.706 -3.525  14.984  1.00 12.37  ? 410  PLP A N1   1 
HETATM 3772 C C2   . PLP B 2 .   ? 26.117 -4.328  15.883  1.00 12.47  ? 410  PLP A C2   1 
HETATM 3773 C C2A  . PLP B 2 .   ? 26.752 -4.457  17.280  1.00 12.09  ? 410  PLP A C2A  1 
HETATM 3774 C C3   . PLP B 2 .   ? 25.007 -4.994  15.555  1.00 17.25  ? 410  PLP A C3   1 
HETATM 3775 O O3   . PLP B 2 .   ? 24.397 -5.825  16.467  1.00 16.83  ? 410  PLP A O3   1 
HETATM 3776 C C4   . PLP B 2 .   ? 24.490 -4.812  14.309  1.00 18.09  ? 410  PLP A C4   1 
HETATM 3777 C C4A  . PLP B 2 .   ? 23.181 -5.571  13.986  1.00 20.61  ? 410  PLP A C4A  1 
HETATM 3778 C C5   . PLP B 2 .   ? 25.116 -3.961  13.399  1.00 15.51  ? 410  PLP A C5   1 
HETATM 3779 C C6   . PLP B 2 .   ? 26.228 -3.322  13.758  1.00 11.68  ? 410  PLP A C6   1 
HETATM 3780 C C5A  . PLP B 2 .   ? 24.530 -3.614  12.042  1.00 14.08  ? 410  PLP A C5A  1 
HETATM 3781 O O4P  . PLP B 2 .   ? 23.549 -4.251  11.453  1.00 13.74  ? 410  PLP A O4P  1 
HETATM 3782 P P    . PLP B 2 .   ? 22.819 -3.700  10.100  1.00 11.18  ? 410  PLP A P    1 
HETATM 3783 O O1P  . PLP B 2 .   ? 21.927 -2.520  10.427  1.00 11.26  ? 410  PLP A O1P  1 
HETATM 3784 O O2P  . PLP B 2 .   ? 21.843 -4.891  9.980   1.00 11.96  ? 410  PLP A O2P  1 
HETATM 3785 O O3P  . PLP B 2 .   ? 23.837 -3.529  9.144   1.00 21.67  ? 410  PLP A O3P  1 
HETATM 3786 C C1   . MAE C 3 .   ? 23.932 -10.240 14.747  1.00 22.28  ? 411  MAE A C1   1 
HETATM 3787 O O1   . MAE C 3 .   ? 24.925 -9.794  15.368  1.00 24.14  ? 411  MAE A O1   1 
HETATM 3788 O O2   . MAE C 3 .   ? 23.546 -11.428 14.863  1.00 18.98  ? 411  MAE A O2   1 
HETATM 3789 C C2   . MAE C 3 .   ? 23.164 -9.294  13.900  1.00 19.15  ? 411  MAE A C2   1 
HETATM 3790 C C3   . MAE C 3 .   ? 23.448 -8.829  12.690  1.00 16.31  ? 411  MAE A C3   1 
HETATM 3791 C C4   . MAE C 3 .   ? 24.646 -9.110  11.831  1.00 17.38  ? 411  MAE A C4   1 
HETATM 3792 O O3   . MAE C 3 .   ? 24.600 -8.706  10.646  1.00 13.82  ? 411  MAE A O3   1 
HETATM 3793 O O4   . MAE C 3 .   ? 25.652 -9.747  12.319  1.00 15.20  ? 411  MAE A O4   1 
HETATM 3794 O O    . HOH D 4 .   ? 42.918 -16.902 -9.160  1.00 40.36  ? 2001 HOH A O    1 
HETATM 3795 O O    . HOH D 4 .   ? 30.038 -12.179 10.797  1.00 22.28  ? 2002 HOH A O    1 
HETATM 3796 O O    . HOH D 4 .   ? 31.941 -12.711 5.994   1.00 32.07  ? 2003 HOH A O    1 
HETATM 3797 O O    . HOH D 4 .   ? 9.954  10.754  3.634   1.00 35.07  ? 2004 HOH A O    1 
HETATM 3798 O O    . HOH D 4 .   ? 13.525 -21.505 15.213  1.00 31.14  ? 2005 HOH A O    1 
HETATM 3799 O O    . HOH D 4 .   ? 23.295 -15.979 18.617  1.00 15.19  ? 2006 HOH A O    1 
HETATM 3800 O O    . HOH D 4 .   ? 17.581 -16.314 15.734  1.00 37.70  ? 2007 HOH A O    1 
HETATM 3801 O O    . HOH D 4 .   ? 6.486  -8.773  20.228  1.00 28.48  ? 2008 HOH A O    1 
HETATM 3802 O O    . HOH D 4 .   ? 3.535  -10.093 17.018  1.00 49.83  ? 2009 HOH A O    1 
HETATM 3803 O O    . HOH D 4 .   ? 4.439  -12.070 20.926  1.00 23.52  ? 2010 HOH A O    1 
HETATM 3804 O O    . HOH D 4 .   ? 9.657  -14.659 9.798   1.00 40.11  ? 2011 HOH A O    1 
HETATM 3805 O O    . HOH D 4 .   ? 9.065  -8.017  14.476  1.00 31.87  ? 2012 HOH A O    1 
HETATM 3806 O O    . HOH D 4 .   ? 10.089 -7.604  10.285  1.00 11.66  ? 2013 HOH A O    1 
HETATM 3807 O O    . HOH D 4 .   ? 2.752  -6.418  13.569  1.00 45.57  ? 2014 HOH A O    1 
HETATM 3808 O O    . HOH D 4 .   ? 8.809  -3.861  11.051  1.00 10.59  ? 2015 HOH A O    1 
HETATM 3809 O O    . HOH D 4 .   ? 4.812  1.474   0.408   1.00 20.11  ? 2016 HOH A O    1 
HETATM 3810 O O    . HOH D 4 .   ? 6.032  -3.054  1.568   1.00 26.20  ? 2017 HOH A O    1 
HETATM 3811 O O    . HOH D 4 .   ? 9.300  8.759   0.358   1.00 30.84  ? 2018 HOH A O    1 
HETATM 3812 O O    . HOH D 4 .   ? 5.329  4.582   -4.205  1.00 29.24  ? 2019 HOH A O    1 
HETATM 3813 O O    . HOH D 4 .   ? 7.116  12.018  -3.169  1.00 36.95  ? 2020 HOH A O    1 
HETATM 3814 O O    . HOH D 4 .   ? 13.170 11.702  -3.993  1.00 29.23  ? 2021 HOH A O    1 
HETATM 3815 O O    . HOH D 4 .   ? 23.803 15.317  -2.182  1.00 26.34  ? 2022 HOH A O    1 
HETATM 3816 O O    . HOH D 4 .   ? 20.193 15.428  1.548   1.00 27.57  ? 2023 HOH A O    1 
HETATM 3817 O O    . HOH D 4 .   ? 19.918 11.932  6.142   1.00 17.74  ? 2024 HOH A O    1 
HETATM 3818 O O    . HOH D 4 .   ? 29.612 25.858  15.454  1.00 36.21  ? 2025 HOH A O    1 
HETATM 3819 O O    . HOH D 4 .   ? 31.208 19.025  22.912  1.00 42.91  ? 2026 HOH A O    1 
HETATM 3820 O O    . HOH D 4 .   ? 20.841 14.485  6.689   1.00 27.68  ? 2027 HOH A O    1 
HETATM 3821 O O    . HOH D 4 .   ? 23.226 16.099  7.972   1.00 31.16  ? 2028 HOH A O    1 
HETATM 3822 O O    . HOH D 4 .   ? 18.909 3.880   4.154   1.00 17.35  ? 2029 HOH A O    1 
HETATM 3823 O O    . HOH D 4 .   ? 24.181 7.757   1.906   1.00 11.43  ? 2030 HOH A O    1 
HETATM 3824 O O    . HOH D 4 .   ? 31.942 4.261   1.399   1.00 22.23  ? 2031 HOH A O    1 
HETATM 3825 O O    . HOH D 4 .   ? 41.576 15.193  2.934   1.00 35.07  ? 2032 HOH A O    1 
HETATM 3826 O O    . HOH D 4 .   ? 45.646 5.158   14.202  1.00 29.64  ? 2033 HOH A O    1 
HETATM 3827 O O    . HOH D 4 .   ? 35.397 -10.936 18.750  1.00 44.40  ? 2034 HOH A O    1 
HETATM 3828 O O    . HOH D 4 .   ? 32.202 -12.448 18.872  1.00 20.01  ? 2035 HOH A O    1 
HETATM 3829 O O    . HOH D 4 .   ? 30.234 -1.717  25.503  1.00 28.42  ? 2036 HOH A O    1 
HETATM 3830 O O    . HOH D 4 .   ? 29.685 -6.162  34.819  1.00 25.91  ? 2037 HOH A O    1 
HETATM 3831 O O    . HOH D 4 .   ? 46.730 -3.759  24.939  1.00 44.10  ? 2038 HOH A O    1 
HETATM 3832 O O    . HOH D 4 .   ? 50.048 8.719   21.979  1.00 34.50  ? 2039 HOH A O    1 
HETATM 3833 O O    . HOH D 4 .   ? 48.517 2.088   18.952  1.00 21.58  ? 2040 HOH A O    1 
HETATM 3834 O O    . HOH D 4 .   ? 21.857 1.263   23.156  1.00 37.29  ? 2041 HOH A O    1 
HETATM 3835 O O    . HOH D 4 .   ? 23.429 -0.440  20.748  1.00 29.57  ? 2042 HOH A O    1 
HETATM 3836 O O    . HOH D 4 .   ? 23.522 2.110   34.837  1.00 43.35  ? 2043 HOH A O    1 
HETATM 3837 O O    . HOH D 4 .   ? 25.827 -3.847  20.259  1.00 10.65  ? 2044 HOH A O    1 
HETATM 3838 O O    . HOH D 4 .   ? 23.818 -7.503  21.982  1.00 32.83  ? 2045 HOH A O    1 
HETATM 3839 O O    . HOH D 4 .   ? 24.923 -5.273  31.652  1.00 49.65  ? 2046 HOH A O    1 
HETATM 3840 O O    . HOH D 4 .   ? 24.949 -0.062  13.657  1.00 17.80  ? 2047 HOH A O    1 
HETATM 3841 O O    . HOH D 4 .   ? 25.349 -1.554  19.129  1.00 31.80  ? 2048 HOH A O    1 
HETATM 3842 O O    . HOH D 4 .   ? 18.252 -1.354  15.501  1.00 8.44   ? 2049 HOH A O    1 
HETATM 3843 O O    . HOH D 4 .   ? 13.139 6.477   26.883  1.00 32.42  ? 2050 HOH A O    1 
HETATM 3844 O O    . HOH D 4 .   ? 24.739 4.971   25.265  1.00 24.01  ? 2051 HOH A O    1 
HETATM 3845 O O    . HOH D 4 .   ? 36.942 19.250  14.989  1.00 19.67  ? 2052 HOH A O    1 
HETATM 3846 O O    . HOH D 4 .   ? 24.166 7.753   13.555  1.00 10.16  ? 2053 HOH A O    1 
HETATM 3847 O O    . HOH D 4 .   ? 19.840 2.020   17.397  1.00 15.07  ? 2054 HOH A O    1 
HETATM 3848 O O    . HOH D 4 .   ? 17.675 -1.809  8.232   1.00 9.52   ? 2055 HOH A O    1 
HETATM 3849 O O    . HOH D 4 .   ? 11.943 -6.783  14.922  1.00 34.29  ? 2056 HOH A O    1 
HETATM 3850 O O    . HOH D 4 .   ? 14.725 0.147   1.312   1.00 11.22  ? 2057 HOH A O    1 
HETATM 3851 O O    . HOH D 4 .   ? 26.638 22.151  10.144  1.00 29.10  ? 2058 HOH A O    1 
HETATM 3852 O O    . HOH D 4 .   ? 30.935 16.068  -1.560  1.00 25.89  ? 2059 HOH A O    1 
HETATM 3853 O O    . HOH D 4 .   ? 34.285 4.947   -0.620  1.00 14.37  ? 2060 HOH A O    1 
HETATM 3854 O O    . HOH D 4 .   ? 18.557 7.563   -3.489  1.00 17.47  ? 2061 HOH A O    1 
HETATM 3855 O O    . HOH D 4 .   ? 16.163 2.458   3.432   1.00 20.52  ? 2062 HOH A O    1 
HETATM 3856 O O    . HOH D 4 .   ? 4.022  4.800   23.397  1.00 17.77  ? 2063 HOH A O    1 
HETATM 3857 O O    . HOH D 4 .   ? 1.558  -0.548  19.703  1.00 27.94  ? 2064 HOH A O    1 
HETATM 3858 O O    . HOH D 4 .   ? 10.590 1.956   23.910  1.00 30.97  ? 2065 HOH A O    1 
HETATM 3859 O O    . HOH D 4 .   ? 5.556  -8.376  25.498  1.00 27.58  ? 2066 HOH A O    1 
HETATM 3860 O O    . HOH D 4 .   ? 6.857  -15.091 25.167  1.00 22.53  ? 2067 HOH A O    1 
HETATM 3861 O O    . HOH D 4 .   ? 28.927 -22.362 38.274  1.00 52.55  ? 2068 HOH A O    1 
HETATM 3862 O O    . HOH D 4 .   ? 15.972 -9.361  32.200  1.00 72.17  ? 2069 HOH A O    1 
HETATM 3863 O O    . HOH D 4 .   ? 22.964 -8.972  24.313  1.00 31.54  ? 2070 HOH A O    1 
HETATM 3864 O O    . HOH D 4 .   ? 20.925 -7.063  21.610  1.00 24.48  ? 2071 HOH A O    1 
HETATM 3865 O O    . HOH D 4 .   ? 33.218 -29.165 25.280  1.00 30.17  ? 2072 HOH A O    1 
HETATM 3866 O O    . HOH D 4 .   ? 30.410 -34.198 14.549  1.00 67.48  ? 2073 HOH A O    1 
HETATM 3867 O O    . HOH D 4 .   ? 24.650 -24.792 17.613  1.00 16.65  ? 2074 HOH A O    1 
HETATM 3868 O O    . HOH D 4 .   ? 29.195 -19.587 14.345  1.00 22.57  ? 2075 HOH A O    1 
HETATM 3869 O O    . HOH D 4 .   ? 30.088 -17.725 25.332  1.00 43.77  ? 2076 HOH A O    1 
HETATM 3870 O O    . HOH D 4 .   ? 29.828 -14.139 18.369  1.00 29.44  ? 2077 HOH A O    1 
HETATM 3871 O O    . HOH D 4 .   ? 13.968 -19.553 17.113  1.00 44.16  ? 2078 HOH A O    1 
HETATM 3872 O O    . HOH D 4 .   ? 23.504 -7.161  8.888   1.00 12.71  ? 2079 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   5   5   MET MET A . n 
A 1 2   PHE 2   6   6   PHE PHE A . n 
A 1 3   GLU 3   7   7   GLU GLU A . n 
A 1 4   ASN 4   8   8   ASN ASN A . n 
A 1 5   ILE 5   9   9   ILE ILE A . n 
A 1 6   THR 6   10  10  THR THR A . n 
A 1 7   ALA 7   11  11  ALA ALA A . n 
A 1 8   ALA 8   12  12  ALA ALA A . n 
A 1 9   PRO 9   13  13  PRO PRO A . n 
A 1 10  ALA 10  14  14  ALA ALA A . n 
A 1 11  ASP 11  15  15  ASP ASP A . n 
A 1 12  PRO 12  16  16  PRO PRO A . n 
A 1 13  ILE 13  17  17  ILE ILE A . n 
A 1 14  LEU 14  18  18  LEU LEU A . n 
A 1 15  GLY 15  19  19  GLY GLY A . n 
A 1 16  LEU 16  20  20  LEU LEU A . n 
A 1 17  ALA 17  21  21  ALA ALA A . n 
A 1 18  ASP 18  22  22  ASP ASP A . n 
A 1 19  LEU 19  23  23  LEU LEU A . n 
A 1 20  PHE 20  24  24  PHE PHE A . n 
A 1 21  ARG 21  25  25  ARG ARG A . n 
A 1 22  ALA 22  26  26  ALA ALA A . n 
A 1 23  ASP 23  27  27  ASP ASP A . n 
A 1 24  GLU 24  28  28  GLU GLU A . n 
A 1 25  ARG 25  29  29  ARG ARG A . n 
A 1 26  PRO 26  30  30  PRO PRO A . n 
A 1 27  GLY 27  31  31  GLY GLY A . n 
A 1 28  LYS 28  32  32  LYS LYS A . n 
A 1 29  ILE 29  33  33  ILE ILE A . n 
A 1 30  ASN 30  34  34  ASN ASN A . n 
A 1 31  LEU 31  35  35  LEU LEU A . n 
A 1 32  GLY 32  36  36  GLY GLY A . n 
A 1 33  ILE 33  37  37  ILE ILE A . n 
A 1 34  GLY 34  38  38  GLY GLY A . n 
A 1 35  VAL 35  39  39  VAL VAL A . n 
A 1 36  TYR 36  40  40  TYR TYR A . n 
A 1 37  LYS 37  41  41  LYS LYS A . n 
A 1 38  ASP 38  42  42  ASP ASP A . n 
A 1 39  GLU 39  43  43  GLU GLU A . n 
A 1 40  THR 40  44  44  THR THR A . n 
A 1 41  GLY 41  45  45  GLY GLY A . n 
A 1 42  LYS 42  46  46  LYS LYS A . n 
A 1 43  THR 43  47  47  THR THR A . n 
A 1 44  PRO 44  48  48  PRO PRO A . n 
A 1 45  VAL 45  49  49  VAL VAL A . n 
A 1 46  LEU 46  50  50  LEU LEU A . n 
A 1 47  THR 47  51  51  THR THR A . n 
A 1 48  SER 48  52  52  SER SER A . n 
A 1 49  VAL 49  53  53  VAL VAL A . n 
A 1 50  LYS 50  54  54  LYS LYS A . n 
A 1 51  LYS 51  55  55  LYS LYS A . n 
A 1 52  ALA 52  56  56  ALA ALA A . n 
A 1 53  GLU 53  57  57  GLU GLU A . n 
A 1 54  GLN 54  58  58  GLN GLN A . n 
A 1 55  TYR 55  59  59  TYR TYR A . n 
A 1 56  LEU 56  60  60  LEU LEU A . n 
A 1 57  LEU 57  61  61  LEU LEU A . n 
A 1 58  GLU 58  62  62  GLU GLU A . n 
A 1 59  ASN 59  63  63  ASN ASN A . n 
A 1 60  GLU 60  64  64  GLU GLU A . n 
A 1 61  THR 61  66  66  THR THR A . n 
A 1 62  THR 62  67  67  THR THR A . n 
A 1 63  LYS 63  68  68  LYS LYS A . n 
A 1 64  ASN 64  69  69  ASN ASN A . n 
A 1 65  TYR 65  70  70  TYR TYR A . n 
A 1 66  LEU 66  71  71  LEU LEU A . n 
A 1 67  GLY 67  72  72  GLY GLY A . n 
A 1 68  ILE 68  73  73  ILE ILE A . n 
A 1 69  ASP 69  74  74  ASP ASP A . n 
A 1 70  GLY 70  75  75  GLY GLY A . n 
A 1 71  ILE 71  76  76  ILE ILE A . n 
A 1 72  PRO 72  77  77  PRO PRO A . n 
A 1 73  GLU 73  78  78  GLU GLU A . n 
A 1 74  PHE 74  79  79  PHE PHE A . n 
A 1 75  GLY 75  80  80  GLY GLY A . n 
A 1 76  ARG 76  81  81  ARG ARG A . n 
A 1 77  CYS 77  82  82  CYS CYS A . n 
A 1 78  THR 78  83  83  THR THR A . n 
A 1 79  GLN 79  84  84  GLN GLN A . n 
A 1 80  GLU 80  85  85  GLU GLU A . n 
A 1 81  LEU 81  86  86  LEU LEU A . n 
A 1 82  LEU 82  87  87  LEU LEU A . n 
A 1 83  PHE 83  88  88  PHE PHE A . n 
A 1 84  GLY 84  89  89  GLY GLY A . n 
A 1 85  LYS 85  90  90  LYS LYS A . n 
A 1 86  GLY 86  91  91  GLY GLY A . n 
A 1 87  SER 87  92  92  SER SER A . n 
A 1 88  ALA 88  93  93  ALA ALA A . n 
A 1 89  LEU 89  94  94  LEU LEU A . n 
A 1 90  ILE 90  95  95  ILE ILE A . n 
A 1 91  ASN 91  96  96  ASN ASN A . n 
A 1 92  ASP 92  97  97  ASP ASP A . n 
A 1 93  LYS 93  98  98  LYS LYS A . n 
A 1 94  ARG 94  99  99  ARG ARG A . n 
A 1 95  ALA 95  100 100 ALA ALA A . n 
A 1 96  ARG 96  101 101 ARG ARG A . n 
A 1 97  THR 97  102 102 THR THR A . n 
A 1 98  ALA 98  103 103 ALA ALA A . n 
A 1 99  GLN 99  104 104 GLN GLN A . n 
A 1 100 THR 100 105 105 THR THR A . n 
A 1 101 PRO 101 106 106 PRO PRO A . n 
A 1 102 GLY 102 107 107 GLY GLY A . n 
A 1 103 GLY 103 108 108 GLY GLY A . n 
A 1 104 THR 104 109 109 THR THR A . n 
A 1 105 GLY 105 110 110 GLY GLY A . n 
A 1 106 ALA 106 111 111 ALA ALA A . n 
A 1 107 LEU 107 112 112 LEU LEU A . n 
A 1 108 ARG 108 113 113 ARG ARG A . n 
A 1 109 VAL 109 114 114 VAL VAL A . n 
A 1 110 ALA 110 115 115 ALA ALA A . n 
A 1 111 ALA 111 116 116 ALA ALA A . n 
A 1 112 ASP 112 117 117 ASP ASP A . n 
A 1 113 PHE 113 118 118 PHE PHE A . n 
A 1 114 LEU 114 119 119 LEU LEU A . n 
A 1 115 ALA 115 120 120 ALA ALA A . n 
A 1 116 LYS 116 121 121 LYS LYS A . n 
A 1 117 ASN 117 122 122 ASN ASN A . n 
A 1 118 THR 118 123 123 THR THR A . n 
A 1 119 SER 119 124 124 SER SER A . n 
A 1 120 VAL 120 125 125 VAL VAL A . n 
A 1 121 LYS 121 126 126 LYS LYS A . n 
A 1 122 ARG 122 129 129 ARG ARG A . n 
A 1 123 VAL 123 133 133 VAL VAL A . n 
A 1 124 TRP 124 134 134 TRP TRP A . n 
A 1 125 VAL 125 135 135 VAL VAL A . n 
A 1 126 SER 126 136 136 SER SER A . n 
A 1 127 ASN 127 137 137 ASN ASN A . n 
A 1 128 PRO 128 138 138 PRO PRO A . n 
A 1 129 SER 129 139 139 SER SER A . n 
A 1 130 TRP 130 140 140 TRP TRP A . n 
A 1 131 PRO 131 141 141 PRO PRO A . n 
A 1 132 ASN 132 142 142 ASN ASN A . n 
A 1 133 HIS 133 143 143 HIS HIS A . n 
A 1 134 LYS 134 144 144 LYS LYS A . n 
A 1 135 SER 135 145 145 SER SER A . n 
A 1 136 VAL 136 146 146 VAL VAL A . n 
A 1 137 PHE 137 147 147 PHE PHE A . n 
A 1 138 ASN 138 148 148 ASN ASN A . n 
A 1 139 SER 139 149 149 SER SER A . n 
A 1 140 ALA 140 150 150 ALA ALA A . n 
A 1 141 GLY 141 151 151 GLY GLY A . n 
A 1 142 LEU 142 152 152 LEU LEU A . n 
A 1 143 GLU 143 154 154 GLU GLU A . n 
A 1 144 VAL 144 155 155 VAL VAL A . n 
A 1 145 ARG 145 156 156 ARG ARG A . n 
A 1 146 GLU 146 157 157 GLU GLU A . n 
A 1 147 TYR 147 158 158 TYR TYR A . n 
A 1 148 ALA 148 159 159 ALA ALA A . n 
A 1 149 TYR 149 160 160 TYR TYR A . n 
A 1 150 TYR 150 161 161 TYR TYR A . n 
A 1 151 ASP 151 162 162 ASP ASP A . n 
A 1 152 ALA 152 163 163 ALA ALA A . n 
A 1 153 GLU 153 164 164 GLU GLU A . n 
A 1 154 ASN 154 165 165 ASN ASN A . n 
A 1 155 HIS 155 166 166 HIS HIS A . n 
A 1 156 THR 156 167 167 THR THR A . n 
A 1 157 LEU 157 168 168 LEU LEU A . n 
A 1 158 ASP 158 169 169 ASP ASP A . n 
A 1 159 PHE 159 170 170 PHE PHE A . n 
A 1 160 ASP 160 171 171 ASP ASP A . n 
A 1 161 ALA 161 172 172 ALA ALA A . n 
A 1 162 LEU 162 173 173 LEU LEU A . n 
A 1 163 ILE 163 174 174 ILE ILE A . n 
A 1 164 ASN 164 175 175 ASN ASN A . n 
A 1 165 SER 165 176 176 SER SER A . n 
A 1 166 LEU 166 177 177 LEU LEU A . n 
A 1 167 ASN 167 178 178 ASN ASN A . n 
A 1 168 GLU 168 179 179 GLU GLU A . n 
A 1 169 ALA 169 180 180 ALA ALA A . n 
A 1 170 GLN 170 181 181 GLN GLN A . n 
A 1 171 ALA 171 182 182 ALA ALA A . n 
A 1 172 GLY 172 183 183 GLY GLY A . n 
A 1 173 ASP 173 184 184 ASP ASP A . n 
A 1 174 VAL 174 185 185 VAL VAL A . n 
A 1 175 VAL 175 186 186 VAL VAL A . n 
A 1 176 LEU 176 187 187 LEU LEU A . n 
A 1 177 PHE 177 188 188 PHE PHE A . n 
A 1 178 HIS 178 189 189 HIS HIS A . n 
A 1 179 GLY 179 190 190 GLY GLY A . n 
A 1 180 TYR 180 191 191 TYR TYR A . n 
A 1 181 CYS 181 192 192 CYS CYS A . n 
A 1 182 HIS 182 193 193 HIS HIS A . n 
A 1 183 ASN 183 194 194 ASN ASN A . n 
A 1 184 PRO 184 195 195 PRO PRO A . n 
A 1 185 THR 185 196 196 THR THR A . n 
A 1 186 GLY 186 197 197 GLY GLY A . n 
A 1 187 ILE 187 198 198 ILE ILE A . n 
A 1 188 ASP 188 199 199 ASP ASP A . n 
A 1 189 PRO 189 200 200 PRO PRO A . n 
A 1 190 THR 190 201 201 THR THR A . n 
A 1 191 LEU 191 202 202 LEU LEU A . n 
A 1 192 GLU 192 203 203 GLU GLU A . n 
A 1 193 GLN 193 204 204 GLN GLN A . n 
A 1 194 TRP 194 205 205 TRP TRP A . n 
A 1 195 GLN 195 206 206 GLN GLN A . n 
A 1 196 THR 196 207 207 THR THR A . n 
A 1 197 LEU 197 208 208 LEU LEU A . n 
A 1 198 ALA 198 209 209 ALA ALA A . n 
A 1 199 GLN 199 210 210 GLN GLN A . n 
A 1 200 LEU 200 211 211 LEU LEU A . n 
A 1 201 SER 201 212 212 SER SER A . n 
A 1 202 VAL 202 213 213 VAL VAL A . n 
A 1 203 GLU 203 214 214 GLU GLU A . n 
A 1 204 LYS 204 215 215 LYS LYS A . n 
A 1 205 GLY 205 216 216 GLY GLY A . n 
A 1 206 TRP 206 217 217 TRP TRP A . n 
A 1 207 LEU 207 218 218 LEU LEU A . n 
A 1 208 PRO 208 219 219 PRO PRO A . n 
A 1 209 LEU 209 220 220 LEU LEU A . n 
A 1 210 PHE 210 221 221 PHE PHE A . n 
A 1 211 ASP 211 222 222 ASP ASP A . n 
A 1 212 PHE 212 223 223 PHE PHE A . n 
A 1 213 ALA 213 224 224 ALA ALA A . n 
A 1 214 TYR 214 225 225 TYR TYR A . n 
A 1 215 GLN 215 226 226 GLN GLN A . n 
A 1 216 GLY 216 227 227 GLY GLY A . n 
A 1 217 PHE 217 228 228 PHE PHE A . n 
A 1 218 ALA 218 229 229 ALA ALA A . n 
A 1 219 ARG 219 230 230 ARG ARG A . n 
A 1 220 GLY 220 231 231 GLY GLY A . n 
A 1 221 LEU 221 233 233 LEU LEU A . n 
A 1 222 GLU 222 234 234 GLU GLU A . n 
A 1 223 GLU 223 235 235 GLU GLU A . n 
A 1 224 ASP 224 236 236 ASP ASP A . n 
A 1 225 ALA 225 237 237 ALA ALA A . n 
A 1 226 GLU 226 238 238 GLU GLU A . n 
A 1 227 GLY 227 239 239 GLY GLY A . n 
A 1 228 LEU 228 240 240 LEU LEU A . n 
A 1 229 ARG 229 241 241 ARG ARG A . n 
A 1 230 ALA 230 242 242 ALA ALA A . n 
A 1 231 PHE 231 243 243 PHE PHE A . n 
A 1 232 ALA 232 244 244 ALA ALA A . n 
A 1 233 ALA 233 245 245 ALA ALA A . n 
A 1 234 MET 234 246 246 MET MET A . n 
A 1 235 HIS 235 247 247 HIS HIS A . n 
A 1 236 LYS 236 248 248 LYS LYS A . n 
A 1 237 GLU 237 249 249 GLU GLU A . n 
A 1 238 LEU 238 250 250 LEU LEU A . n 
A 1 239 ILE 239 251 251 ILE ILE A . n 
A 1 240 VAL 240 252 252 VAL VAL A . n 
A 1 241 ALA 241 253 253 ALA ALA A . n 
A 1 242 SER 242 254 254 SER SER A . n 
A 1 243 SER 243 255 255 SER SER A . n 
A 1 244 TYR 244 256 256 TYR TYR A . n 
A 1 245 SER 245 257 257 SER SER A . n 
A 1 246 LYS 246 258 258 LYS LYS A . n 
A 1 247 ASN 247 259 259 ASN ASN A . n 
A 1 248 PHE 248 260 260 PHE PHE A . n 
A 1 249 GLY 249 261 261 GLY GLY A . n 
A 1 250 LEU 250 262 262 LEU LEU A . n 
A 1 251 TYR 251 263 263 TYR TYR A . n 
A 1 252 ASN 252 264 264 ASN ASN A . n 
A 1 253 GLU 253 265 265 GLU GLU A . n 
A 1 254 ARG 254 266 266 ARG ARG A . n 
A 1 255 VAL 255 267 267 VAL VAL A . n 
A 1 256 GLY 256 268 268 GLY GLY A . n 
A 1 257 ALA 257 269 269 ALA ALA A . n 
A 1 258 CYS 258 270 270 CYS CYS A . n 
A 1 259 THR 259 271 271 THR THR A . n 
A 1 260 LEU 260 272 272 LEU LEU A . n 
A 1 261 VAL 261 273 273 VAL VAL A . n 
A 1 262 ALA 262 274 274 ALA ALA A . n 
A 1 263 ALA 263 275 275 ALA ALA A . n 
A 1 264 ASP 264 276 276 ASP ASP A . n 
A 1 265 SER 265 277 277 SER SER A . n 
A 1 266 GLU 266 278 278 GLU GLU A . n 
A 1 267 THR 267 279 279 THR THR A . n 
A 1 268 VAL 268 280 280 VAL VAL A . n 
A 1 269 ASP 269 281 281 ASP ASP A . n 
A 1 270 ARG 270 282 282 ARG ARG A . n 
A 1 271 ALA 271 283 283 ALA ALA A . n 
A 1 272 PHE 272 284 284 PHE PHE A . n 
A 1 273 SER 273 285 285 SER SER A . n 
A 1 274 GLN 274 286 286 GLN GLN A . n 
A 1 275 MET 275 287 287 MET MET A . n 
A 1 276 LYS 276 288 288 LYS LYS A . n 
A 1 277 ALA 277 289 289 ALA ALA A . n 
A 1 278 ALA 278 290 290 ALA ALA A . n 
A 1 279 ILE 279 291 291 ILE ILE A . n 
A 1 280 ARG 280 292 292 ARG ARG A . n 
A 1 281 ALA 281 293 293 ALA ALA A . n 
A 1 282 ASN 282 294 294 ASN ASN A . n 
A 1 283 TYR 283 295 295 TYR TYR A . n 
A 1 284 SER 284 296 296 SER SER A . n 
A 1 285 ASN 285 297 297 ASN ASN A . n 
A 1 286 PRO 286 298 298 PRO PRO A . n 
A 1 287 PRO 287 299 299 PRO PRO A . n 
A 1 288 ALA 288 300 300 ALA ALA A . n 
A 1 289 HIS 289 301 301 HIS HIS A . n 
A 1 290 GLY 290 302 302 GLY GLY A . n 
A 1 291 ALA 291 303 303 ALA ALA A . n 
A 1 292 SER 292 304 304 SER SER A . n 
A 1 293 VAL 293 305 305 VAL VAL A . n 
A 1 294 VAL 294 306 306 VAL VAL A . n 
A 1 295 ALA 295 307 307 ALA ALA A . n 
A 1 296 THR 296 308 308 THR THR A . n 
A 1 297 ILE 297 309 309 ILE ILE A . n 
A 1 298 LEU 298 310 310 LEU LEU A . n 
A 1 299 SER 299 311 311 SER SER A . n 
A 1 300 ASN 300 312 312 ASN ASN A . n 
A 1 301 ASP 301 313 313 ASP ASP A . n 
A 1 302 ALA 302 314 314 ALA ALA A . n 
A 1 303 LEU 303 315 315 LEU LEU A . n 
A 1 304 ARG 304 316 316 ARG ARG A . n 
A 1 305 ALA 305 317 317 ALA ALA A . n 
A 1 306 ILE 306 318 318 ILE ILE A . n 
A 1 307 TRP 307 319 319 TRP TRP A . n 
A 1 308 GLU 308 320 320 GLU GLU A . n 
A 1 309 GLN 309 321 321 GLN GLN A . n 
A 1 310 GLU 310 322 322 GLU GLU A . n 
A 1 311 LEU 311 323 323 LEU LEU A . n 
A 1 312 THR 312 324 324 THR THR A . n 
A 1 313 ASP 313 325 325 ASP ASP A . n 
A 1 314 MET 314 326 326 MET MET A . n 
A 1 315 ARG 315 327 327 ARG ARG A . n 
A 1 316 GLN 316 328 328 GLN GLN A . n 
A 1 317 ARG 317 329 329 ARG ARG A . n 
A 1 318 ILE 318 330 330 ILE ILE A . n 
A 1 319 GLN 319 331 331 GLN GLN A . n 
A 1 320 ARG 320 332 332 ARG ARG A . n 
A 1 321 MET 321 333 333 MET MET A . n 
A 1 322 ARG 322 334 334 ARG ARG A . n 
A 1 323 GLN 323 335 335 GLN GLN A . n 
A 1 324 LEU 324 336 336 LEU LEU A . n 
A 1 325 PHE 325 337 337 PHE PHE A . n 
A 1 326 VAL 326 338 338 VAL VAL A . n 
A 1 327 ASN 327 339 339 ASN ASN A . n 
A 1 328 THR 328 340 340 THR THR A . n 
A 1 329 LEU 329 341 341 LEU LEU A . n 
A 1 330 GLN 330 342 342 GLN GLN A . n 
A 1 331 GLU 331 343 343 GLU GLU A . n 
A 1 332 LYS 332 344 344 LYS LYS A . n 
A 1 333 GLY 333 345 345 GLY GLY A . n 
A 1 334 ALA 334 346 346 ALA ALA A . n 
A 1 335 ASN 335 347 347 ASN ASN A . n 
A 1 336 ARG 336 348 348 ARG ARG A . n 
A 1 337 ASP 337 349 349 ASP ASP A . n 
A 1 338 PHE 338 350 350 PHE PHE A . n 
A 1 339 SER 339 351 351 SER SER A . n 
A 1 340 PHE 340 352 352 PHE PHE A . n 
A 1 341 ILE 341 353 353 ILE ILE A . n 
A 1 342 ILE 342 354 354 ILE ILE A . n 
A 1 343 LYS 343 355 355 LYS LYS A . n 
A 1 344 GLN 344 356 356 GLN GLN A . n 
A 1 345 ASN 345 357 357 ASN ASN A . n 
A 1 346 GLY 346 358 358 GLY GLY A . n 
A 1 347 MET 347 359 359 MET MET A . n 
A 1 348 PHE 348 360 360 PHE PHE A . n 
A 1 349 SER 349 361 361 SER SER A . n 
A 1 350 PHE 350 362 362 PHE PHE A . n 
A 1 351 SER 351 363 363 SER SER A . n 
A 1 352 GLY 352 364 364 GLY GLY A . n 
A 1 353 LEU 353 365 365 LEU LEU A . n 
A 1 354 THR 354 366 366 THR THR A . n 
A 1 355 LYS 355 367 367 LYS LYS A . n 
A 1 356 GLU 356 368 368 GLU GLU A . n 
A 1 357 GLN 357 369 369 GLN GLN A . n 
A 1 358 VAL 358 370 370 VAL VAL A . n 
A 1 359 LEU 359 371 371 LEU LEU A . n 
A 1 360 ARG 360 372 372 ARG ARG A . n 
A 1 361 LEU 361 373 373 LEU LEU A . n 
A 1 362 ARG 362 374 374 ARG ARG A . n 
A 1 363 GLU 363 375 375 GLU GLU A . n 
A 1 364 GLU 364 376 376 GLU GLU A . n 
A 1 365 PHE 365 377 377 PHE PHE A . n 
A 1 366 GLY 366 378 378 GLY GLY A . n 
A 1 367 VAL 367 379 379 VAL VAL A . n 
A 1 368 TYR 368 380 380 TYR TYR A . n 
A 1 369 ALA 369 381 381 ALA ALA A . n 
A 1 370 VAL 370 382 382 VAL VAL A . n 
A 1 371 ALA 371 383 383 ALA ALA A . n 
A 1 372 SER 372 384 384 SER SER A . n 
A 1 373 GLY 373 385 385 GLY GLY A . n 
A 1 374 ARG 374 386 386 ARG ARG A . n 
A 1 375 VAL 375 387 387 VAL VAL A . n 
A 1 376 ASN 376 388 388 ASN ASN A . n 
A 1 377 VAL 377 389 389 VAL VAL A . n 
A 1 378 ALA 378 390 390 ALA ALA A . n 
A 1 379 GLY 379 391 391 GLY GLY A . n 
A 1 380 MET 380 392 392 MET MET A . n 
A 1 381 THR 381 393 393 THR THR A . n 
A 1 382 PRO 382 394 394 PRO PRO A . n 
A 1 383 ASP 383 395 395 ASP ASP A . n 
A 1 384 ASN 384 396 396 ASN ASN A . n 
A 1 385 MET 385 397 397 MET MET A . n 
A 1 386 ALA 386 398 398 ALA ALA A . n 
A 1 387 PRO 387 399 399 PRO PRO A . n 
A 1 388 LEU 388 400 400 LEU LEU A . n 
A 1 389 CYS 389 401 401 CYS CYS A . n 
A 1 390 GLU 390 402 402 GLU GLU A . n 
A 1 391 ALA 391 403 403 ALA ALA A . n 
A 1 392 ILE 392 404 404 ILE ILE A . n 
A 1 393 VAL 393 405 405 VAL VAL A . n 
A 1 394 ALA 394 407 407 ALA ALA A . n 
A 1 395 VAL 395 408 408 VAL VAL A . n 
A 1 396 LEU 396 409 409 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PLP 1  410  410  PLP PLP A . 
C 3 MAE 1  411  411  MAE MAE A . 
D 4 HOH 1  2001 2001 HOH HOH A . 
D 4 HOH 2  2002 2002 HOH HOH A . 
D 4 HOH 3  2003 2003 HOH HOH A . 
D 4 HOH 4  2004 2004 HOH HOH A . 
D 4 HOH 5  2005 2005 HOH HOH A . 
D 4 HOH 6  2006 2006 HOH HOH A . 
D 4 HOH 7  2007 2007 HOH HOH A . 
D 4 HOH 8  2008 2008 HOH HOH A . 
D 4 HOH 9  2009 2009 HOH HOH A . 
D 4 HOH 10 2010 2010 HOH HOH A . 
D 4 HOH 11 2011 2011 HOH HOH A . 
D 4 HOH 12 2012 2012 HOH HOH A . 
D 4 HOH 13 2013 2013 HOH HOH A . 
D 4 HOH 14 2014 2014 HOH HOH A . 
D 4 HOH 15 2015 2015 HOH HOH A . 
D 4 HOH 16 2016 2016 HOH HOH A . 
D 4 HOH 17 2017 2017 HOH HOH A . 
D 4 HOH 18 2018 2018 HOH HOH A . 
D 4 HOH 19 2019 2019 HOH HOH A . 
D 4 HOH 20 2020 2020 HOH HOH A . 
D 4 HOH 21 2021 2021 HOH HOH A . 
D 4 HOH 22 2022 2022 HOH HOH A . 
D 4 HOH 23 2023 2023 HOH HOH A . 
D 4 HOH 24 2024 2024 HOH HOH A . 
D 4 HOH 25 2025 2025 HOH HOH A . 
D 4 HOH 26 2026 2026 HOH HOH A . 
D 4 HOH 27 2027 2027 HOH HOH A . 
D 4 HOH 28 2028 2028 HOH HOH A . 
D 4 HOH 29 2029 2029 HOH HOH A . 
D 4 HOH 30 2030 2030 HOH HOH A . 
D 4 HOH 31 2031 2031 HOH HOH A . 
D 4 HOH 32 2032 2032 HOH HOH A . 
D 4 HOH 33 2033 2033 HOH HOH A . 
D 4 HOH 34 2034 2034 HOH HOH A . 
D 4 HOH 35 2035 2035 HOH HOH A . 
D 4 HOH 36 2036 2036 HOH HOH A . 
D 4 HOH 37 2037 2037 HOH HOH A . 
D 4 HOH 38 2038 2038 HOH HOH A . 
D 4 HOH 39 2039 2039 HOH HOH A . 
D 4 HOH 40 2040 2040 HOH HOH A . 
D 4 HOH 41 2041 2041 HOH HOH A . 
D 4 HOH 42 2042 2042 HOH HOH A . 
D 4 HOH 43 2043 2043 HOH HOH A . 
D 4 HOH 44 2044 2044 HOH HOH A . 
D 4 HOH 45 2045 2045 HOH HOH A . 
D 4 HOH 46 2046 2046 HOH HOH A . 
D 4 HOH 47 2047 2047 HOH HOH A . 
D 4 HOH 48 2048 2048 HOH HOH A . 
D 4 HOH 49 2049 2049 HOH HOH A . 
D 4 HOH 50 2050 2050 HOH HOH A . 
D 4 HOH 51 2051 2051 HOH HOH A . 
D 4 HOH 52 2052 2052 HOH HOH A . 
D 4 HOH 53 2053 2053 HOH HOH A . 
D 4 HOH 54 2054 2054 HOH HOH A . 
D 4 HOH 55 2055 2055 HOH HOH A . 
D 4 HOH 56 2056 2056 HOH HOH A . 
D 4 HOH 57 2057 2057 HOH HOH A . 
D 4 HOH 58 2058 2058 HOH HOH A . 
D 4 HOH 59 2059 2059 HOH HOH A . 
D 4 HOH 60 2060 2060 HOH HOH A . 
D 4 HOH 61 2061 2061 HOH HOH A . 
D 4 HOH 62 2062 2062 HOH HOH A . 
D 4 HOH 63 2063 2063 HOH HOH A . 
D 4 HOH 64 2064 2064 HOH HOH A . 
D 4 HOH 65 2065 2065 HOH HOH A . 
D 4 HOH 66 2066 2066 HOH HOH A . 
D 4 HOH 67 2067 2067 HOH HOH A . 
D 4 HOH 68 2068 2068 HOH HOH A . 
D 4 HOH 69 2069 2069 HOH HOH A . 
D 4 HOH 70 2070 2070 HOH HOH A . 
D 4 HOH 71 2071 2071 HOH HOH A . 
D 4 HOH 72 2072 2072 HOH HOH A . 
D 4 HOH 73 2073 2073 HOH HOH A . 
D 4 HOH 74 2074 2074 HOH HOH A . 
D 4 HOH 75 2075 2075 HOH HOH A . 
D 4 HOH 76 2076 2076 HOH HOH A . 
D 4 HOH 77 2077 2077 HOH HOH A . 
D 4 HOH 78 2078 2078 HOH HOH A . 
D 4 HOH 79 2079 2079 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7710  ? 
1 MORE         -39.0 ? 
1 'SSA (A^2)'  34580 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-06-05 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-07-05 
5 'Structure model' 1 4 2023-12-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source                 
2 5 'Structure model' chem_comp_atom                
3 5 'Structure model' chem_comp_bond                
4 5 'Structure model' database_2                    
5 5 'Structure model' pdbx_initial_refinement_model 
6 5 'Structure model' struct_conn                   
7 5 'Structure model' struct_site                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.type'                 
2 5 'Structure model' '_database_2.pdbx_DOI'                
3 5 'Structure model' '_database_2.pdbx_database_accession' 
4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
6 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
7 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR refinement       3.851 ? 1 
R-AXIS 'data reduction' .     ? 2 
R-AXIS 'data scaling'   .     ? 3 
X-PLOR phasing          3.851 ? 4 
# 
_pdbx_entry_details.entry_id                 1QIR 
_pdbx_entry_details.compound_details         
;NUMBERED TO MATCH NUMBERING OF CHICKEN CYTOPLASMIC ASPARTATE
AMINOTRANSFERASE
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HG   A SER 136 ? ? HE2 A HIS 193  ? ? 1.28 
2 1 HD21 A ASN 312 ? ? H   A LEU 315  ? ? 1.31 
3 1 OE1  A GLU 375 ? ? O   A HOH 2073 ? ? 2.04 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              173 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              173 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              173 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.87 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            15.57 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 160 ? ? -151.81 -68.62 
2 1 CYS A 192 ? ? 63.06   64.82  
3 1 ALA A 229 ? ? -99.36  -66.30 
4 1 TYR A 263 ? ? -28.33  -62.23 
5 1 ARG A 266 ? ? 59.25   78.16  
6 1 ASN A 294 ? ? -108.91 -79.17 
7 1 SER A 296 ? ? 76.89   -65.24 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             PHE 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              360 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -10.04 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
HOH O    O N N 158 
HOH H1   H N N 159 
HOH H2   H N N 160 
ILE N    N N N 161 
ILE CA   C N S 162 
ILE C    C N N 163 
ILE O    O N N 164 
ILE CB   C N S 165 
ILE CG1  C N N 166 
ILE CG2  C N N 167 
ILE CD1  C N N 168 
ILE OXT  O N N 169 
ILE H    H N N 170 
ILE H2   H N N 171 
ILE HA   H N N 172 
ILE HB   H N N 173 
ILE HG12 H N N 174 
ILE HG13 H N N 175 
ILE HG21 H N N 176 
ILE HG22 H N N 177 
ILE HG23 H N N 178 
ILE HD11 H N N 179 
ILE HD12 H N N 180 
ILE HD13 H N N 181 
ILE HXT  H N N 182 
LEU N    N N N 183 
LEU CA   C N S 184 
LEU C    C N N 185 
LEU O    O N N 186 
LEU CB   C N N 187 
LEU CG   C N N 188 
LEU CD1  C N N 189 
LEU CD2  C N N 190 
LEU OXT  O N N 191 
LEU H    H N N 192 
LEU H2   H N N 193 
LEU HA   H N N 194 
LEU HB2  H N N 195 
LEU HB3  H N N 196 
LEU HG   H N N 197 
LEU HD11 H N N 198 
LEU HD12 H N N 199 
LEU HD13 H N N 200 
LEU HD21 H N N 201 
LEU HD22 H N N 202 
LEU HD23 H N N 203 
LEU HXT  H N N 204 
LYS N    N N N 205 
LYS CA   C N S 206 
LYS C    C N N 207 
LYS O    O N N 208 
LYS CB   C N N 209 
LYS CG   C N N 210 
LYS CD   C N N 211 
LYS CE   C N N 212 
LYS NZ   N N N 213 
LYS OXT  O N N 214 
LYS H    H N N 215 
LYS H2   H N N 216 
LYS HA   H N N 217 
LYS HB2  H N N 218 
LYS HB3  H N N 219 
LYS HG2  H N N 220 
LYS HG3  H N N 221 
LYS HD2  H N N 222 
LYS HD3  H N N 223 
LYS HE2  H N N 224 
LYS HE3  H N N 225 
LYS HZ1  H N N 226 
LYS HZ2  H N N 227 
LYS HZ3  H N N 228 
LYS HXT  H N N 229 
MAE C1   C N N 230 
MAE O1   O N N 231 
MAE O2   O N N 232 
MAE C2   C N N 233 
MAE C3   C N N 234 
MAE C4   C N N 235 
MAE O3   O N N 236 
MAE O4   O N N 237 
MAE HO2  H N N 238 
MAE H2   H N N 239 
MAE H3   H N N 240 
MAE HO4  H N N 241 
MET N    N N N 242 
MET CA   C N S 243 
MET C    C N N 244 
MET O    O N N 245 
MET CB   C N N 246 
MET CG   C N N 247 
MET SD   S N N 248 
MET CE   C N N 249 
MET OXT  O N N 250 
MET H    H N N 251 
MET H2   H N N 252 
MET HA   H N N 253 
MET HB2  H N N 254 
MET HB3  H N N 255 
MET HG2  H N N 256 
MET HG3  H N N 257 
MET HE1  H N N 258 
MET HE2  H N N 259 
MET HE3  H N N 260 
MET HXT  H N N 261 
PHE N    N N N 262 
PHE CA   C N S 263 
PHE C    C N N 264 
PHE O    O N N 265 
PHE CB   C N N 266 
PHE CG   C Y N 267 
PHE CD1  C Y N 268 
PHE CD2  C Y N 269 
PHE CE1  C Y N 270 
PHE CE2  C Y N 271 
PHE CZ   C Y N 272 
PHE OXT  O N N 273 
PHE H    H N N 274 
PHE H2   H N N 275 
PHE HA   H N N 276 
PHE HB2  H N N 277 
PHE HB3  H N N 278 
PHE HD1  H N N 279 
PHE HD2  H N N 280 
PHE HE1  H N N 281 
PHE HE2  H N N 282 
PHE HZ   H N N 283 
PHE HXT  H N N 284 
PLP N1   N Y N 285 
PLP C2   C Y N 286 
PLP C2A  C N N 287 
PLP C3   C Y N 288 
PLP O3   O N N 289 
PLP C4   C Y N 290 
PLP C4A  C N N 291 
PLP O4A  O N N 292 
PLP C5   C Y N 293 
PLP C6   C Y N 294 
PLP C5A  C N N 295 
PLP O4P  O N N 296 
PLP P    P N N 297 
PLP O1P  O N N 298 
PLP O2P  O N N 299 
PLP O3P  O N N 300 
PLP H2A1 H N N 301 
PLP H2A2 H N N 302 
PLP H2A3 H N N 303 
PLP HO3  H N N 304 
PLP H4A  H N N 305 
PLP H6   H N N 306 
PLP H5A1 H N N 307 
PLP H5A2 H N N 308 
PLP HOP2 H N N 309 
PLP HOP3 H N N 310 
PRO N    N N N 311 
PRO CA   C N S 312 
PRO C    C N N 313 
PRO O    O N N 314 
PRO CB   C N N 315 
PRO CG   C N N 316 
PRO CD   C N N 317 
PRO OXT  O N N 318 
PRO H    H N N 319 
PRO HA   H N N 320 
PRO HB2  H N N 321 
PRO HB3  H N N 322 
PRO HG2  H N N 323 
PRO HG3  H N N 324 
PRO HD2  H N N 325 
PRO HD3  H N N 326 
PRO HXT  H N N 327 
SER N    N N N 328 
SER CA   C N S 329 
SER C    C N N 330 
SER O    O N N 331 
SER CB   C N N 332 
SER OG   O N N 333 
SER OXT  O N N 334 
SER H    H N N 335 
SER H2   H N N 336 
SER HA   H N N 337 
SER HB2  H N N 338 
SER HB3  H N N 339 
SER HG   H N N 340 
SER HXT  H N N 341 
THR N    N N N 342 
THR CA   C N S 343 
THR C    C N N 344 
THR O    O N N 345 
THR CB   C N R 346 
THR OG1  O N N 347 
THR CG2  C N N 348 
THR OXT  O N N 349 
THR H    H N N 350 
THR H2   H N N 351 
THR HA   H N N 352 
THR HB   H N N 353 
THR HG1  H N N 354 
THR HG21 H N N 355 
THR HG22 H N N 356 
THR HG23 H N N 357 
THR HXT  H N N 358 
TRP N    N N N 359 
TRP CA   C N S 360 
TRP C    C N N 361 
TRP O    O N N 362 
TRP CB   C N N 363 
TRP CG   C Y N 364 
TRP CD1  C Y N 365 
TRP CD2  C Y N 366 
TRP NE1  N Y N 367 
TRP CE2  C Y N 368 
TRP CE3  C Y N 369 
TRP CZ2  C Y N 370 
TRP CZ3  C Y N 371 
TRP CH2  C Y N 372 
TRP OXT  O N N 373 
TRP H    H N N 374 
TRP H2   H N N 375 
TRP HA   H N N 376 
TRP HB2  H N N 377 
TRP HB3  H N N 378 
TRP HD1  H N N 379 
TRP HE1  H N N 380 
TRP HE3  H N N 381 
TRP HZ2  H N N 382 
TRP HZ3  H N N 383 
TRP HH2  H N N 384 
TRP HXT  H N N 385 
TYR N    N N N 386 
TYR CA   C N S 387 
TYR C    C N N 388 
TYR O    O N N 389 
TYR CB   C N N 390 
TYR CG   C Y N 391 
TYR CD1  C Y N 392 
TYR CD2  C Y N 393 
TYR CE1  C Y N 394 
TYR CE2  C Y N 395 
TYR CZ   C Y N 396 
TYR OH   O N N 397 
TYR OXT  O N N 398 
TYR H    H N N 399 
TYR H2   H N N 400 
TYR HA   H N N 401 
TYR HB2  H N N 402 
TYR HB3  H N N 403 
TYR HD1  H N N 404 
TYR HD2  H N N 405 
TYR HE1  H N N 406 
TYR HE2  H N N 407 
TYR HH   H N N 408 
TYR HXT  H N N 409 
VAL N    N N N 410 
VAL CA   C N S 411 
VAL C    C N N 412 
VAL O    O N N 413 
VAL CB   C N N 414 
VAL CG1  C N N 415 
VAL CG2  C N N 416 
VAL OXT  O N N 417 
VAL H    H N N 418 
VAL H2   H N N 419 
VAL HA   H N N 420 
VAL HB   H N N 421 
VAL HG11 H N N 422 
VAL HG12 H N N 423 
VAL HG13 H N N 424 
VAL HG21 H N N 425 
VAL HG22 H N N 426 
VAL HG23 H N N 427 
VAL HXT  H N N 428 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MAE C1  O1   doub N N 218 
MAE C1  O2   sing N N 219 
MAE C1  C2   sing N N 220 
MAE O2  HO2  sing N N 221 
MAE C2  C3   doub N Z 222 
MAE C2  H2   sing N N 223 
MAE C3  C4   sing N N 224 
MAE C3  H3   sing N N 225 
MAE C4  O3   doub N N 226 
MAE C4  O4   sing N N 227 
MAE O4  HO4  sing N N 228 
MET N   CA   sing N N 229 
MET N   H    sing N N 230 
MET N   H2   sing N N 231 
MET CA  C    sing N N 232 
MET CA  CB   sing N N 233 
MET CA  HA   sing N N 234 
MET C   O    doub N N 235 
MET C   OXT  sing N N 236 
MET CB  CG   sing N N 237 
MET CB  HB2  sing N N 238 
MET CB  HB3  sing N N 239 
MET CG  SD   sing N N 240 
MET CG  HG2  sing N N 241 
MET CG  HG3  sing N N 242 
MET SD  CE   sing N N 243 
MET CE  HE1  sing N N 244 
MET CE  HE2  sing N N 245 
MET CE  HE3  sing N N 246 
MET OXT HXT  sing N N 247 
PHE N   CA   sing N N 248 
PHE N   H    sing N N 249 
PHE N   H2   sing N N 250 
PHE CA  C    sing N N 251 
PHE CA  CB   sing N N 252 
PHE CA  HA   sing N N 253 
PHE C   O    doub N N 254 
PHE C   OXT  sing N N 255 
PHE CB  CG   sing N N 256 
PHE CB  HB2  sing N N 257 
PHE CB  HB3  sing N N 258 
PHE CG  CD1  doub Y N 259 
PHE CG  CD2  sing Y N 260 
PHE CD1 CE1  sing Y N 261 
PHE CD1 HD1  sing N N 262 
PHE CD2 CE2  doub Y N 263 
PHE CD2 HD2  sing N N 264 
PHE CE1 CZ   doub Y N 265 
PHE CE1 HE1  sing N N 266 
PHE CE2 CZ   sing Y N 267 
PHE CE2 HE2  sing N N 268 
PHE CZ  HZ   sing N N 269 
PHE OXT HXT  sing N N 270 
PLP N1  C2   doub Y N 271 
PLP N1  C6   sing Y N 272 
PLP C2  C2A  sing N N 273 
PLP C2  C3   sing Y N 274 
PLP C2A H2A1 sing N N 275 
PLP C2A H2A2 sing N N 276 
PLP C2A H2A3 sing N N 277 
PLP C3  O3   sing N N 278 
PLP C3  C4   doub Y N 279 
PLP O3  HO3  sing N N 280 
PLP C4  C4A  sing N N 281 
PLP C4  C5   sing Y N 282 
PLP C4A O4A  doub N N 283 
PLP C4A H4A  sing N N 284 
PLP C5  C6   doub Y N 285 
PLP C5  C5A  sing N N 286 
PLP C6  H6   sing N N 287 
PLP C5A O4P  sing N N 288 
PLP C5A H5A1 sing N N 289 
PLP C5A H5A2 sing N N 290 
PLP O4P P    sing N N 291 
PLP P   O1P  doub N N 292 
PLP P   O2P  sing N N 293 
PLP P   O3P  sing N N 294 
PLP O2P HOP2 sing N N 295 
PLP O3P HOP3 sing N N 296 
PRO N   CA   sing N N 297 
PRO N   CD   sing N N 298 
PRO N   H    sing N N 299 
PRO CA  C    sing N N 300 
PRO CA  CB   sing N N 301 
PRO CA  HA   sing N N 302 
PRO C   O    doub N N 303 
PRO C   OXT  sing N N 304 
PRO CB  CG   sing N N 305 
PRO CB  HB2  sing N N 306 
PRO CB  HB3  sing N N 307 
PRO CG  CD   sing N N 308 
PRO CG  HG2  sing N N 309 
PRO CG  HG3  sing N N 310 
PRO CD  HD2  sing N N 311 
PRO CD  HD3  sing N N 312 
PRO OXT HXT  sing N N 313 
SER N   CA   sing N N 314 
SER N   H    sing N N 315 
SER N   H2   sing N N 316 
SER CA  C    sing N N 317 
SER CA  CB   sing N N 318 
SER CA  HA   sing N N 319 
SER C   O    doub N N 320 
SER C   OXT  sing N N 321 
SER CB  OG   sing N N 322 
SER CB  HB2  sing N N 323 
SER CB  HB3  sing N N 324 
SER OG  HG   sing N N 325 
SER OXT HXT  sing N N 326 
THR N   CA   sing N N 327 
THR N   H    sing N N 328 
THR N   H2   sing N N 329 
THR CA  C    sing N N 330 
THR CA  CB   sing N N 331 
THR CA  HA   sing N N 332 
THR C   O    doub N N 333 
THR C   OXT  sing N N 334 
THR CB  OG1  sing N N 335 
THR CB  CG2  sing N N 336 
THR CB  HB   sing N N 337 
THR OG1 HG1  sing N N 338 
THR CG2 HG21 sing N N 339 
THR CG2 HG22 sing N N 340 
THR CG2 HG23 sing N N 341 
THR OXT HXT  sing N N 342 
TRP N   CA   sing N N 343 
TRP N   H    sing N N 344 
TRP N   H2   sing N N 345 
TRP CA  C    sing N N 346 
TRP CA  CB   sing N N 347 
TRP CA  HA   sing N N 348 
TRP C   O    doub N N 349 
TRP C   OXT  sing N N 350 
TRP CB  CG   sing N N 351 
TRP CB  HB2  sing N N 352 
TRP CB  HB3  sing N N 353 
TRP CG  CD1  doub Y N 354 
TRP CG  CD2  sing Y N 355 
TRP CD1 NE1  sing Y N 356 
TRP CD1 HD1  sing N N 357 
TRP CD2 CE2  doub Y N 358 
TRP CD2 CE3  sing Y N 359 
TRP NE1 CE2  sing Y N 360 
TRP NE1 HE1  sing N N 361 
TRP CE2 CZ2  sing Y N 362 
TRP CE3 CZ3  doub Y N 363 
TRP CE3 HE3  sing N N 364 
TRP CZ2 CH2  doub Y N 365 
TRP CZ2 HZ2  sing N N 366 
TRP CZ3 CH2  sing Y N 367 
TRP CZ3 HZ3  sing N N 368 
TRP CH2 HH2  sing N N 369 
TRP OXT HXT  sing N N 370 
TYR N   CA   sing N N 371 
TYR N   H    sing N N 372 
TYR N   H2   sing N N 373 
TYR CA  C    sing N N 374 
TYR CA  CB   sing N N 375 
TYR CA  HA   sing N N 376 
TYR C   O    doub N N 377 
TYR C   OXT  sing N N 378 
TYR CB  CG   sing N N 379 
TYR CB  HB2  sing N N 380 
TYR CB  HB3  sing N N 381 
TYR CG  CD1  doub Y N 382 
TYR CG  CD2  sing Y N 383 
TYR CD1 CE1  sing Y N 384 
TYR CD1 HD1  sing N N 385 
TYR CD2 CE2  doub Y N 386 
TYR CD2 HD2  sing N N 387 
TYR CE1 CZ   doub Y N 388 
TYR CE1 HE1  sing N N 389 
TYR CE2 CZ   sing Y N 390 
TYR CE2 HE2  sing N N 391 
TYR CZ  OH   sing N N 392 
TYR OH  HH   sing N N 393 
TYR OXT HXT  sing N N 394 
VAL N   CA   sing N N 395 
VAL N   H    sing N N 396 
VAL N   H2   sing N N 397 
VAL CA  C    sing N N 398 
VAL CA  CB   sing N N 399 
VAL CA  HA   sing N N 400 
VAL C   O    doub N N 401 
VAL C   OXT  sing N N 402 
VAL CB  CG1  sing N N 403 
VAL CB  CG2  sing N N 404 
VAL CB  HB   sing N N 405 
VAL CG1 HG11 sing N N 406 
VAL CG1 HG12 sing N N 407 
VAL CG1 HG13 sing N N 408 
VAL CG2 HG21 sing N N 409 
VAL CG2 HG22 sing N N 410 
VAL CG2 HG23 sing N N 411 
VAL OXT HXT  sing N N 412 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE" PLP 
3 'MALEIC ACID'            MAE 
4 water                    HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1ASA 
_pdbx_initial_refinement_model.details          ? 
#