data_1QXT
# 
_entry.id   1QXT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1QXT         
RCSB  RCSB020199   
WWPDB D_1000020199 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QY3 . unspecified 
PDB 1QYF . unspecified 
PDB 1QYO . unspecified 
PDB 1QYQ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.entry_id                        1QXT 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barondeau, D.P.' 1 
'Putnam, C.D.'    2 
'Kassmann, C.J.'  3 
'Tainer, J.A.'    4 
'Getzoff, E.D.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Mechanism and energetics of green fluorescent protein chromophore synthesis revealed by trapped intermediate structures' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            100 
_citation.page_first                12111 
_citation.page_last                 12116 
_citation.year                      ? 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14523232 
_citation.pdbx_database_id_DOI      10.1073/pnas.2133463100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Barondeau, D.P.' 1 
primary 'Putnam, C.D.'    2 
primary 'Kassmann, C.J.'  3 
primary 'Tainer, J.A.'    4 
primary 'Getzoff, E.D.'   5 
# 
_cell.entry_id           1QXT 
_cell.length_a           51.928 
_cell.length_b           61.571 
_cell.length_c           69.832 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QXT 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'green-fluorescent protein' 25691.842 1   ? 'R96A F99S M153T V163A F64L S65T' 'residues 1-229' ? 
2 water   nat water                       18.015    143 ? ?                                 ?                ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK
QHDFFKSAMPEGYVQEATISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKN
GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK
QHDFFKSAMPEGYVQEATISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKN
GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   GLY n 
1 6   GLU n 
1 7   GLU n 
1 8   LEU n 
1 9   PHE n 
1 10  THR n 
1 11  GLY n 
1 12  VAL n 
1 13  VAL n 
1 14  PRO n 
1 15  ILE n 
1 16  LEU n 
1 17  VAL n 
1 18  GLU n 
1 19  LEU n 
1 20  ASP n 
1 21  GLY n 
1 22  ASP n 
1 23  VAL n 
1 24  ASN n 
1 25  GLY n 
1 26  HIS n 
1 27  LYS n 
1 28  PHE n 
1 29  SER n 
1 30  VAL n 
1 31  SER n 
1 32  GLY n 
1 33  GLU n 
1 34  GLY n 
1 35  GLU n 
1 36  GLY n 
1 37  ASP n 
1 38  ALA n 
1 39  THR n 
1 40  TYR n 
1 41  GLY n 
1 42  LYS n 
1 43  LEU n 
1 44  THR n 
1 45  LEU n 
1 46  LYS n 
1 47  PHE n 
1 48  ILE n 
1 49  CYS n 
1 50  THR n 
1 51  THR n 
1 52  GLY n 
1 53  LYS n 
1 54  LEU n 
1 55  PRO n 
1 56  VAL n 
1 57  PRO n 
1 58  TRP n 
1 59  PRO n 
1 60  THR n 
1 61  LEU n 
1 62  VAL n 
1 63  THR n 
1 64  THR n 
1 65  LEU n 
1 66  THR n 
1 67  TYR n 
1 68  GLY n 
1 69  VAL n 
1 70  GLN n 
1 71  CYS n 
1 72  PHE n 
1 73  SER n 
1 74  ARG n 
1 75  TYR n 
1 76  PRO n 
1 77  ASP n 
1 78  HIS n 
1 79  MET n 
1 80  LYS n 
1 81  GLN n 
1 82  HIS n 
1 83  ASP n 
1 84  PHE n 
1 85  PHE n 
1 86  LYS n 
1 87  SER n 
1 88  ALA n 
1 89  MET n 
1 90  PRO n 
1 91  GLU n 
1 92  GLY n 
1 93  TYR n 
1 94  VAL n 
1 95  GLN n 
1 96  GLU n 
1 97  ALA n 
1 98  THR n 
1 99  ILE n 
1 100 SER n 
1 101 PHE n 
1 102 LYS n 
1 103 ASP n 
1 104 ASP n 
1 105 GLY n 
1 106 ASN n 
1 107 TYR n 
1 108 LYS n 
1 109 THR n 
1 110 ARG n 
1 111 ALA n 
1 112 GLU n 
1 113 VAL n 
1 114 LYS n 
1 115 PHE n 
1 116 GLU n 
1 117 GLY n 
1 118 ASP n 
1 119 THR n 
1 120 LEU n 
1 121 VAL n 
1 122 ASN n 
1 123 ARG n 
1 124 ILE n 
1 125 GLU n 
1 126 LEU n 
1 127 LYS n 
1 128 GLY n 
1 129 ILE n 
1 130 ASP n 
1 131 PHE n 
1 132 LYS n 
1 133 GLU n 
1 134 ASP n 
1 135 GLY n 
1 136 ASN n 
1 137 ILE n 
1 138 LEU n 
1 139 GLY n 
1 140 HIS n 
1 141 LYS n 
1 142 LEU n 
1 143 GLU n 
1 144 TYR n 
1 145 ASN n 
1 146 TYR n 
1 147 ASN n 
1 148 SER n 
1 149 HIS n 
1 150 ASN n 
1 151 VAL n 
1 152 TYR n 
1 153 ILE n 
1 154 THR n 
1 155 ALA n 
1 156 ASP n 
1 157 LYS n 
1 158 GLN n 
1 159 LYS n 
1 160 ASN n 
1 161 GLY n 
1 162 ILE n 
1 163 LYS n 
1 164 ALA n 
1 165 ASN n 
1 166 PHE n 
1 167 LYS n 
1 168 ILE n 
1 169 ARG n 
1 170 HIS n 
1 171 ASN n 
1 172 ILE n 
1 173 GLU n 
1 174 ASP n 
1 175 GLY n 
1 176 SER n 
1 177 VAL n 
1 178 GLN n 
1 179 LEU n 
1 180 ALA n 
1 181 ASP n 
1 182 HIS n 
1 183 TYR n 
1 184 GLN n 
1 185 GLN n 
1 186 ASN n 
1 187 THR n 
1 188 PRO n 
1 189 ILE n 
1 190 GLY n 
1 191 ASP n 
1 192 GLY n 
1 193 PRO n 
1 194 VAL n 
1 195 LEU n 
1 196 LEU n 
1 197 PRO n 
1 198 ASP n 
1 199 ASN n 
1 200 HIS n 
1 201 TYR n 
1 202 LEU n 
1 203 SER n 
1 204 THR n 
1 205 GLN n 
1 206 SER n 
1 207 ALA n 
1 208 LEU n 
1 209 SER n 
1 210 LYS n 
1 211 ASP n 
1 212 PRO n 
1 213 ASN n 
1 214 GLU n 
1 215 LYS n 
1 216 ARG n 
1 217 ASP n 
1 218 HIS n 
1 219 MET n 
1 220 VAL n 
1 221 LEU n 
1 222 LEU n 
1 223 GLU n 
1 224 PHE n 
1 225 VAL n 
1 226 THR n 
1 227 ALA n 
1 228 ALA n 
1 229 GLY n 
1 230 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aequorea 
_entity_src_gen.pdbx_gene_src_gene                 GFP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aequorea victoria' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6100 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JM109 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               pKEN2 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GFP_AEQVI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P42212 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QXT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 230 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P42212 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  229 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       229 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1QXT ALA A 2   ? UNP P42212 ?   ?   'CLONING ARTIFACT' 1   1 
1 1QXT LEU A 65  ? UNP P42212 PHE 64  ENGINEERED         64  2 
1 1QXT THR A 66  ? UNP P42212 SER 65  ENGINEERED         65  3 
1 1QXT ALA A 97  ? UNP P42212 ARG 96  ENGINEERED         96  4 
1 1QXT SER A 100 ? UNP P42212 PHE 99  ENGINEERED         99  5 
1 1QXT THR A 154 ? UNP P42212 MET 153 ENGINEERED         153 6 
1 1QXT ALA A 164 ? UNP P42212 VAL 163 ENGINEERED         163 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1QXT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.36 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'PEG 4000, MAGNESIUM CHLORIDE, HEPES, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-03-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'CURVED CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.78 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.78 
# 
_reflns.entry_id                     1QXT 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   15550 
_reflns.number_all                   15708 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.066 
_reflns.pdbx_netI_over_sigmaI        18.2 
_reflns.B_iso_Wilson_estimate        13.8 
_reflns.pdbx_redundancy              3.53 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.372 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1QXT 
_refine.ls_number_reflns_obs                     14709 
_refine.ls_number_reflns_all                     15708 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               606673.23 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.pdbx_data_cutoff_high_rms_absF           606673.23 
_refine.ls_d_res_low                             19.74 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    93.9 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          0.218 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  728 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               28.2 
_refine.aniso_B[1][1]                            -8.72 
_refine.aniso_B[2][2]                            -0.09 
_refine.aniso_B[3][3]                            8.81 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.385569 
_refine.solvent_model_param_bsol                 26.5548 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ema 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1QXT 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1782 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             143 
_refine_hist.number_atoms_total               1925 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        19.74 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      28.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.36  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.26  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.94  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.11  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.18  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             2172 
_refine_ls_shell.R_factor_R_work                  0.271 
_refine_ls_shell.percent_reflns_obs               89.4 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            0.032 
_refine_ls_shell.percent_reflns_R_free            5.4 
_refine_ls_shell.number_reflns_R_free             125 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN.GFP.PARAM PROTEIN.GFP.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1QXT 
_struct.title                     
'Crystal structure of precyclized intermediate for the green fluorescent protein R96A variant (A)' 
_struct.pdbx_descriptor           'green-fluorescent protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QXT 
_struct_keywords.pdbx_keywords   'LUMINESCENT PROTEIN' 
_struct_keywords.text            'beta barrel, trapped intermediate, chromophore, LUMINESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 5  ? THR A 10 ? GLY A 4  THR A 9  5 ? 6  
HELX_P HELX_P2 2 PRO A 57 ? TYR A 67 ? PRO A 56 TYR A 66 1 ? 11 
HELX_P HELX_P3 3 GLY A 68 ? SER A 73 ? GLY A 67 SER A 72 5 ? 6  
HELX_P HELX_P4 4 PRO A 76 ? HIS A 82 ? PRO A 75 HIS A 81 5 ? 7  
HELX_P HELX_P5 5 ASP A 83 ? ALA A 88 ? ASP A 82 ALA A 87 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MET 
_struct_mon_prot_cis.label_seq_id           89 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MET 
_struct_mon_prot_cis.auth_seq_id            88 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    90 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     89 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.17 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   12 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 13  ? VAL A 23  ? VAL A 12  VAL A 22  
A 2  HIS A 26  ? ASP A 37  ? HIS A 25  ASP A 36  
A 3  LYS A 42  ? CYS A 49  ? LYS A 41  CYS A 48  
A 4  HIS A 218 ? ALA A 228 ? HIS A 217 ALA A 227 
A 5  HIS A 200 ? SER A 209 ? HIS A 199 SER A 208 
A 6  HIS A 149 ? ASP A 156 ? HIS A 148 ASP A 155 
A 7  GLY A 161 ? ASN A 171 ? GLY A 160 ASN A 170 
A 8  VAL A 177 ? PRO A 188 ? VAL A 176 PRO A 187 
A 9  TYR A 93  ? PHE A 101 ? TYR A 92  PHE A 100 
A 10 ASN A 106 ? GLU A 116 ? ASN A 105 GLU A 115 
A 11 THR A 119 ? ILE A 129 ? THR A 118 ILE A 128 
A 12 VAL A 13  ? VAL A 23  ? VAL A 12  VAL A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 17  ? N VAL A 16  O GLY A 32  ? O GLY A 31  
A 2  3  N ASP A 37  ? N ASP A 36  O LYS A 42  ? O LYS A 41  
A 3  4  N PHE A 47  ? N PHE A 46  O MET A 219 ? O MET A 218 
A 4  5  O THR A 226 ? O THR A 225 N SER A 203 ? N SER A 202 
A 5  6  O HIS A 200 ? O HIS A 199 N ILE A 153 ? N ILE A 152 
A 6  7  N ASP A 156 ? N ASP A 155 O GLY A 161 ? O GLY A 160 
A 7  8  N ALA A 164 ? N ALA A 163 O GLN A 184 ? O GLN A 183 
A 8  9  O THR A 187 ? O THR A 186 N VAL A 94  ? N VAL A 93  
A 9  10 N ALA A 97  ? N ALA A 96  O THR A 109 ? O THR A 108 
A 10 11 N GLU A 116 ? N GLU A 115 O THR A 119 ? O THR A 118 
A 11 12 O GLY A 128 ? O GLY A 127 N ASP A 22  ? N ASP A 21  
# 
_database_PDB_matrix.entry_id          1QXT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1QXT 
_atom_sites.fract_transf_matrix[1][1]   0.019257 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016241 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014320 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 5   ? 24.818 8.930  13.674  1.00 38.24 ? 4    GLY A N   1 
ATOM   2    C CA  . GLY A 1 5   ? 24.891 10.338 13.190  1.00 38.34 ? 4    GLY A CA  1 
ATOM   3    C C   . GLY A 1 5   ? 25.890 10.461 12.056  1.00 37.80 ? 4    GLY A C   1 
ATOM   4    O O   . GLY A 1 5   ? 25.530 10.829 10.936  1.00 36.36 ? 4    GLY A O   1 
ATOM   5    N N   . GLU A 1 6   ? 27.144 10.116 12.362  1.00 38.03 ? 5    GLU A N   1 
ATOM   6    C CA  . GLU A 1 6   ? 28.279 10.134 11.429  1.00 37.06 ? 5    GLU A CA  1 
ATOM   7    C C   . GLU A 1 6   ? 28.111 9.032  10.365  1.00 36.55 ? 5    GLU A C   1 
ATOM   8    O O   . GLU A 1 6   ? 28.568 9.176  9.224   1.00 34.58 ? 5    GLU A O   1 
ATOM   9    C CB  . GLU A 1 6   ? 29.578 9.902  12.225  1.00 38.41 ? 5    GLU A CB  1 
ATOM   10   C CG  . GLU A 1 6   ? 30.744 10.841 11.900  1.00 40.50 ? 5    GLU A CG  1 
ATOM   11   C CD  . GLU A 1 6   ? 31.678 11.086 13.101  1.00 42.99 ? 5    GLU A CD  1 
ATOM   12   O OE1 . GLU A 1 6   ? 32.021 12.269 13.365  1.00 37.67 ? 5    GLU A OE1 1 
ATOM   13   O OE2 . GLU A 1 6   ? 32.065 10.102 13.781  1.00 40.75 ? 5    GLU A OE2 1 
ATOM   14   N N   . GLU A 1 7   ? 27.392 7.974  10.749  1.00 35.58 ? 6    GLU A N   1 
ATOM   15   C CA  . GLU A 1 7   ? 27.103 6.799  9.916   1.00 36.24 ? 6    GLU A CA  1 
ATOM   16   C C   . GLU A 1 7   ? 26.248 7.045  8.661   1.00 33.55 ? 6    GLU A C   1 
ATOM   17   O O   . GLU A 1 7   ? 26.341 6.301  7.682   1.00 33.69 ? 6    GLU A O   1 
ATOM   18   C CB  . GLU A 1 7   ? 26.443 5.705  10.774  1.00 39.65 ? 6    GLU A CB  1 
ATOM   19   C CG  . GLU A 1 7   ? 25.175 6.152  11.527  1.00 44.55 ? 6    GLU A CG  1 
ATOM   20   C CD  . GLU A 1 7   ? 24.244 5.002  11.883  1.00 47.68 ? 6    GLU A CD  1 
ATOM   21   O OE1 . GLU A 1 7   ? 23.754 4.967  13.032  1.00 49.24 ? 6    GLU A OE1 1 
ATOM   22   O OE2 . GLU A 1 7   ? 23.985 4.138  11.012  1.00 49.54 ? 6    GLU A OE2 1 
ATOM   23   N N   . LEU A 1 8   ? 25.421 8.086  8.705   1.00 32.07 ? 7    LEU A N   1 
ATOM   24   C CA  . LEU A 1 8   ? 24.532 8.446  7.596   1.00 30.85 ? 7    LEU A CA  1 
ATOM   25   C C   . LEU A 1 8   ? 25.241 9.200  6.458   1.00 28.96 ? 7    LEU A C   1 
ATOM   26   O O   . LEU A 1 8   ? 24.642 9.462  5.413   1.00 28.33 ? 7    LEU A O   1 
ATOM   27   C CB  . LEU A 1 8   ? 23.378 9.308  8.127   1.00 32.07 ? 7    LEU A CB  1 
ATOM   28   C CG  . LEU A 1 8   ? 22.431 8.737  9.192   1.00 32.99 ? 7    LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 8   ? 21.596 9.856  9.771   1.00 31.50 ? 7    LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 8   ? 21.536 7.643  8.606   1.00 32.81 ? 7    LEU A CD2 1 
ATOM   31   N N   . PHE A 1 9   ? 26.522 9.506  6.661   1.00 28.21 ? 8    PHE A N   1 
ATOM   32   C CA  . PHE A 1 9   ? 27.326 10.268 5.704   1.00 28.51 ? 8    PHE A CA  1 
ATOM   33   C C   . PHE A 1 9   ? 28.502 9.543  5.058   1.00 30.02 ? 8    PHE A C   1 
ATOM   34   O O   . PHE A 1 9   ? 29.345 10.180 4.413   1.00 30.05 ? 8    PHE A O   1 
ATOM   35   C CB  . PHE A 1 9   ? 27.845 11.532 6.386   1.00 25.17 ? 8    PHE A CB  1 
ATOM   36   C CG  . PHE A 1 9   ? 26.771 12.500 6.758   1.00 24.63 ? 8    PHE A CG  1 
ATOM   37   C CD1 . PHE A 1 9   ? 26.145 12.421 8.018   1.00 21.02 ? 8    PHE A CD1 1 
ATOM   38   C CD2 . PHE A 1 9   ? 26.373 13.501 5.854   1.00 22.58 ? 8    PHE A CD2 1 
ATOM   39   C CE1 . PHE A 1 9   ? 25.130 13.329 8.379   1.00 22.85 ? 8    PHE A CE1 1 
ATOM   40   C CE2 . PHE A 1 9   ? 25.352 14.427 6.198   1.00 23.38 ? 8    PHE A CE2 1 
ATOM   41   C CZ  . PHE A 1 9   ? 24.731 14.342 7.465   1.00 23.89 ? 8    PHE A CZ  1 
ATOM   42   N N   . THR A 1 10  ? 28.543 8.219  5.205   1.00 31.01 ? 9    THR A N   1 
ATOM   43   C CA  . THR A 1 10  ? 29.618 7.385  4.649   1.00 32.12 ? 9    THR A CA  1 
ATOM   44   C C   . THR A 1 10  ? 29.625 7.285  3.115   1.00 32.37 ? 9    THR A C   1 
ATOM   45   O O   . THR A 1 10  ? 30.661 6.967  2.510   1.00 32.71 ? 9    THR A O   1 
ATOM   46   C CB  . THR A 1 10  ? 29.595 5.965  5.260   1.00 32.47 ? 9    THR A CB  1 
ATOM   47   O OG1 . THR A 1 10  ? 28.261 5.442  5.222   1.00 35.04 ? 9    THR A OG1 1 
ATOM   48   C CG2 . THR A 1 10  ? 30.088 5.999  6.706   1.00 32.73 ? 9    THR A CG2 1 
ATOM   49   N N   . GLY A 1 11  ? 28.478 7.588  2.502   1.00 31.73 ? 10   GLY A N   1 
ATOM   50   C CA  . GLY A 1 11  ? 28.345 7.546  1.053   1.00 31.04 ? 10   GLY A CA  1 
ATOM   51   C C   . GLY A 1 11  ? 27.857 8.862  0.466   1.00 30.72 ? 10   GLY A C   1 
ATOM   52   O O   . GLY A 1 11  ? 27.971 9.913  1.098   1.00 30.85 ? 10   GLY A O   1 
ATOM   53   N N   . VAL A 1 12  ? 27.320 8.800  -0.750  1.00 30.14 ? 11   VAL A N   1 
ATOM   54   C CA  . VAL A 1 12  ? 26.795 9.978  -1.444  1.00 29.94 ? 11   VAL A CA  1 
ATOM   55   C C   . VAL A 1 12  ? 25.324 10.181 -1.044  1.00 28.31 ? 11   VAL A C   1 
ATOM   56   O O   . VAL A 1 12  ? 24.480 9.304  -1.259  1.00 28.22 ? 11   VAL A O   1 
ATOM   57   C CB  . VAL A 1 12  ? 26.967 9.838  -2.985  1.00 30.68 ? 11   VAL A CB  1 
ATOM   58   C CG1 . VAL A 1 12  ? 26.437 11.063 -3.702  1.00 30.75 ? 11   VAL A CG1 1 
ATOM   59   C CG2 . VAL A 1 12  ? 28.438 9.638  -3.332  1.00 28.67 ? 11   VAL A CG2 1 
ATOM   60   N N   . VAL A 1 13  ? 25.043 11.342 -0.449  1.00 26.11 ? 12   VAL A N   1 
ATOM   61   C CA  . VAL A 1 13  ? 23.704 11.683 0.044   1.00 24.96 ? 12   VAL A CA  1 
ATOM   62   C C   . VAL A 1 13  ? 23.025 12.807 -0.762  1.00 24.03 ? 12   VAL A C   1 
ATOM   63   O O   . VAL A 1 13  ? 23.631 13.863 -0.974  1.00 23.80 ? 12   VAL A O   1 
ATOM   64   C CB  . VAL A 1 13  ? 23.779 12.093 1.563   1.00 25.15 ? 12   VAL A CB  1 
ATOM   65   C CG1 . VAL A 1 13  ? 22.402 12.491 2.123   1.00 24.91 ? 12   VAL A CG1 1 
ATOM   66   C CG2 . VAL A 1 13  ? 24.383 10.966 2.399   1.00 25.02 ? 12   VAL A CG2 1 
ATOM   67   N N   . PRO A 1 14  ? 21.765 12.591 -1.224  1.00 23.11 ? 13   PRO A N   1 
ATOM   68   C CA  . PRO A 1 14  ? 21.051 13.624 -1.989  1.00 21.95 ? 13   PRO A CA  1 
ATOM   69   C C   . PRO A 1 14  ? 20.660 14.820 -1.114  1.00 21.79 ? 13   PRO A C   1 
ATOM   70   O O   . PRO A 1 14  ? 20.409 14.667 0.085   1.00 19.73 ? 13   PRO A O   1 
ATOM   71   C CB  . PRO A 1 14  ? 19.831 12.876 -2.540  1.00 24.08 ? 13   PRO A CB  1 
ATOM   72   C CG  . PRO A 1 14  ? 19.628 11.750 -1.569  1.00 24.57 ? 13   PRO A CG  1 
ATOM   73   C CD  . PRO A 1 14  ? 21.028 11.309 -1.286  1.00 23.24 ? 13   PRO A CD  1 
ATOM   74   N N   . ILE A 1 15  ? 20.696 16.013 -1.709  1.00 20.35 ? 14   ILE A N   1 
ATOM   75   C CA  . ILE A 1 15  ? 20.378 17.264 -1.009  1.00 20.26 ? 14   ILE A CA  1 
ATOM   76   C C   . ILE A 1 15  ? 19.206 18.006 -1.646  1.00 20.73 ? 14   ILE A C   1 
ATOM   77   O O   . ILE A 1 15  ? 19.072 18.049 -2.871  1.00 20.90 ? 14   ILE A O   1 
ATOM   78   C CB  . ILE A 1 15  ? 21.601 18.244 -0.991  1.00 18.30 ? 14   ILE A CB  1 
ATOM   79   C CG1 . ILE A 1 15  ? 22.832 17.570 -0.392  1.00 16.98 ? 14   ILE A CG1 1 
ATOM   80   C CG2 . ILE A 1 15  ? 21.290 19.515 -0.171  1.00 19.37 ? 14   ILE A CG2 1 
ATOM   81   C CD1 . ILE A 1 15  ? 24.117 18.319 -0.652  1.00 14.57 ? 14   ILE A CD1 1 
ATOM   82   N N   . LEU A 1 16  ? 18.390 18.613 -0.785  1.00 20.72 ? 15   LEU A N   1 
ATOM   83   C CA  . LEU A 1 16  ? 17.237 19.410 -1.173  1.00 21.40 ? 15   LEU A CA  1 
ATOM   84   C C   . LEU A 1 16  ? 17.263 20.719 -0.403  1.00 22.73 ? 15   LEU A C   1 
ATOM   85   O O   . LEU A 1 16  ? 17.326 20.721 0.829   1.00 21.92 ? 15   LEU A O   1 
ATOM   86   C CB  . LEU A 1 16  ? 15.934 18.687 -0.839  1.00 25.10 ? 15   LEU A CB  1 
ATOM   87   C CG  . LEU A 1 16  ? 15.397 17.609 -1.768  1.00 25.07 ? 15   LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 16  ? 14.114 17.081 -1.142  1.00 25.37 ? 15   LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 16  ? 15.152 18.182 -3.166  1.00 27.79 ? 15   LEU A CD2 1 
ATOM   90   N N   . VAL A 1 17  ? 17.274 21.833 -1.129  1.00 23.28 ? 16   VAL A N   1 
ATOM   91   C CA  . VAL A 1 17  ? 17.278 23.153 -0.506  1.00 22.66 ? 16   VAL A CA  1 
ATOM   92   C C   . VAL A 1 17  ? 16.081 23.937 -1.032  1.00 23.64 ? 16   VAL A C   1 
ATOM   93   O O   . VAL A 1 17  ? 15.842 23.981 -2.239  1.00 23.43 ? 16   VAL A O   1 
ATOM   94   C CB  . VAL A 1 17  ? 18.591 23.959 -0.803  1.00 20.99 ? 16   VAL A CB  1 
ATOM   95   C CG1 . VAL A 1 17  ? 18.531 25.351 -0.163  1.00 20.74 ? 16   VAL A CG1 1 
ATOM   96   C CG2 . VAL A 1 17  ? 19.817 23.228 -0.284  1.00 20.65 ? 16   VAL A CG2 1 
ATOM   97   N N   . GLU A 1 18  ? 15.300 24.498 -0.113  1.00 22.95 ? 17   GLU A N   1 
ATOM   98   C CA  . GLU A 1 18  ? 14.145 25.320 -0.465  1.00 23.60 ? 17   GLU A CA  1 
ATOM   99   C C   . GLU A 1 18  ? 14.234 26.603 0.342   1.00 23.88 ? 17   GLU A C   1 
ATOM   100  O O   . GLU A 1 18  ? 14.310 26.562 1.571   1.00 24.28 ? 17   GLU A O   1 
ATOM   101  C CB  . GLU A 1 18  ? 12.817 24.599 -0.182  1.00 26.57 ? 17   GLU A CB  1 
ATOM   102  C CG  . GLU A 1 18  ? 12.541 23.331 -1.023  1.00 31.51 ? 17   GLU A CG  1 
ATOM   103  C CD  . GLU A 1 18  ? 12.462 23.566 -2.534  1.00 33.59 ? 17   GLU A CD  1 
ATOM   104  O OE1 . GLU A 1 18  ? 11.861 24.571 -2.978  1.00 37.42 ? 17   GLU A OE1 1 
ATOM   105  O OE2 . GLU A 1 18  ? 12.991 22.718 -3.282  1.00 36.97 ? 17   GLU A OE2 1 
ATOM   106  N N   . LEU A 1 19  ? 14.296 27.733 -0.363  1.00 23.37 ? 18   LEU A N   1 
ATOM   107  C CA  . LEU A 1 19  ? 14.392 29.052 0.259   1.00 22.84 ? 18   LEU A CA  1 
ATOM   108  C C   . LEU A 1 19  ? 13.251 29.971 -0.161  1.00 22.79 ? 18   LEU A C   1 
ATOM   109  O O   . LEU A 1 19  ? 12.921 30.054 -1.339  1.00 20.96 ? 18   LEU A O   1 
ATOM   110  C CB  . LEU A 1 19  ? 15.746 29.715 -0.088  1.00 23.41 ? 18   LEU A CB  1 
ATOM   111  C CG  . LEU A 1 19  ? 15.996 31.227 0.120   1.00 26.03 ? 18   LEU A CG  1 
ATOM   112  C CD1 . LEU A 1 19  ? 16.018 31.593 1.587   1.00 25.53 ? 18   LEU A CD1 1 
ATOM   113  C CD2 . LEU A 1 19  ? 17.287 31.663 -0.533  1.00 24.50 ? 18   LEU A CD2 1 
ATOM   114  N N   . ASP A 1 20  ? 12.668 30.654 0.820   1.00 21.98 ? 19   ASP A N   1 
ATOM   115  C CA  . ASP A 1 20  ? 11.610 31.632 0.584   1.00 24.38 ? 19   ASP A CA  1 
ATOM   116  C C   . ASP A 1 20  ? 12.186 32.930 1.124   1.00 25.07 ? 19   ASP A C   1 
ATOM   117  O O   . ASP A 1 20  ? 12.476 33.040 2.321   1.00 24.35 ? 19   ASP A O   1 
ATOM   118  C CB  . ASP A 1 20  ? 10.312 31.280 1.327   1.00 26.53 ? 19   ASP A CB  1 
ATOM   119  C CG  . ASP A 1 20  ? 9.543  30.139 0.675   1.00 29.71 ? 19   ASP A CG  1 
ATOM   120  O OD1 . ASP A 1 20  ? 8.963  29.322 1.423   1.00 31.89 ? 19   ASP A OD1 1 
ATOM   121  O OD2 . ASP A 1 20  ? 9.498  30.065 -0.572  1.00 29.92 ? 19   ASP A OD2 1 
ATOM   122  N N   . GLY A 1 21  ? 12.395 33.890 0.227   1.00 23.73 ? 20   GLY A N   1 
ATOM   123  C CA  . GLY A 1 21  ? 12.962 35.159 0.624   1.00 23.81 ? 20   GLY A CA  1 
ATOM   124  C C   . GLY A 1 21  ? 12.100 36.373 0.370   1.00 24.10 ? 20   GLY A C   1 
ATOM   125  O O   . GLY A 1 21  ? 11.161 36.332 -0.424  1.00 22.87 ? 20   GLY A O   1 
ATOM   126  N N   . ASP A 1 22  ? 12.475 37.467 1.028   1.00 25.50 ? 21   ASP A N   1 
ATOM   127  C CA  . ASP A 1 22  ? 11.795 38.753 0.928   1.00 27.68 ? 21   ASP A CA  1 
ATOM   128  C C   . ASP A 1 22  ? 12.881 39.819 1.092   1.00 28.08 ? 21   ASP A C   1 
ATOM   129  O O   . ASP A 1 22  ? 13.355 40.062 2.204   1.00 27.09 ? 21   ASP A O   1 
ATOM   130  C CB  . ASP A 1 22  ? 10.738 38.870 2.049   1.00 29.81 ? 21   ASP A CB  1 
ATOM   131  C CG  . ASP A 1 22  ? 9.827  40.099 1.915   1.00 34.11 ? 21   ASP A CG  1 
ATOM   132  O OD1 . ASP A 1 22  ? 10.264 41.164 1.419   1.00 35.21 ? 21   ASP A OD1 1 
ATOM   133  O OD2 . ASP A 1 22  ? 8.658  39.999 2.352   1.00 35.67 ? 21   ASP A OD2 1 
ATOM   134  N N   . VAL A 1 23  ? 13.329 40.393 -0.024  1.00 29.27 ? 22   VAL A N   1 
ATOM   135  C CA  . VAL A 1 23  ? 14.338 41.453 0.019   1.00 31.05 ? 22   VAL A CA  1 
ATOM   136  C C   . VAL A 1 23  ? 13.733 42.698 -0.596  1.00 31.72 ? 22   VAL A C   1 
ATOM   137  O O   . VAL A 1 23  ? 13.356 42.698 -1.769  1.00 31.49 ? 22   VAL A O   1 
ATOM   138  C CB  . VAL A 1 23  ? 15.659 41.122 -0.749  1.00 30.89 ? 22   VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 23  ? 16.689 42.255 -0.545  1.00 28.96 ? 22   VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 23  ? 16.263 39.832 -0.265  1.00 32.26 ? 22   VAL A CG2 1 
ATOM   141  N N   . ASN A 1 24  ? 13.655 43.749 0.219   1.00 33.47 ? 23   ASN A N   1 
ATOM   142  C CA  . ASN A 1 24  ? 13.127 45.057 -0.164  1.00 35.96 ? 23   ASN A CA  1 
ATOM   143  C C   . ASN A 1 24  ? 11.853 45.083 -1.023  1.00 36.38 ? 23   ASN A C   1 
ATOM   144  O O   . ASN A 1 24  ? 11.828 45.642 -2.126  1.00 37.80 ? 23   ASN A O   1 
ATOM   145  C CB  . ASN A 1 24  ? 14.242 45.930 -0.764  1.00 37.60 ? 23   ASN A CB  1 
ATOM   146  C CG  . ASN A 1 24  ? 15.117 46.590 0.303   1.00 39.92 ? 23   ASN A CG  1 
ATOM   147  O OD1 . ASN A 1 24  ? 15.420 45.999 1.344   1.00 39.17 ? 23   ASN A OD1 1 
ATOM   148  N ND2 . ASN A 1 24  ? 15.523 47.828 0.043   1.00 42.76 ? 23   ASN A ND2 1 
ATOM   149  N N   . GLY A 1 25  ? 10.813 44.429 -0.508  1.00 36.48 ? 24   GLY A N   1 
ATOM   150  C CA  . GLY A 1 25  ? 9.529  44.376 -1.187  1.00 37.22 ? 24   GLY A CA  1 
ATOM   151  C C   . GLY A 1 25  ? 9.382  43.352 -2.291  1.00 36.45 ? 24   GLY A C   1 
ATOM   152  O O   . GLY A 1 25  ? 8.281  43.166 -2.817  1.00 37.64 ? 24   GLY A O   1 
ATOM   153  N N   . HIS A 1 26  ? 10.495 42.723 -2.660  1.00 34.51 ? 25   HIS A N   1 
ATOM   154  C CA  . HIS A 1 26  ? 10.513 41.711 -3.708  1.00 33.27 ? 25   HIS A CA  1 
ATOM   155  C C   . HIS A 1 26  ? 10.578 40.322 -3.085  1.00 31.64 ? 25   HIS A C   1 
ATOM   156  O O   . HIS A 1 26  ? 11.575 39.952 -2.454  1.00 30.02 ? 25   HIS A O   1 
ATOM   157  C CB  . HIS A 1 26  ? 11.717 41.908 -4.632  1.00 34.29 ? 25   HIS A CB  1 
ATOM   158  C CG  . HIS A 1 26  ? 11.682 43.173 -5.435  1.00 35.29 ? 25   HIS A CG  1 
ATOM   159  N ND1 . HIS A 1 26  ? 12.374 44.307 -5.066  1.00 36.85 ? 25   HIS A ND1 1 
ATOM   160  C CD2 . HIS A 1 26  ? 11.082 43.465 -6.614  1.00 35.48 ? 25   HIS A CD2 1 
ATOM   161  C CE1 . HIS A 1 26  ? 12.205 45.241 -5.985  1.00 37.87 ? 25   HIS A CE1 1 
ATOM   162  N NE2 . HIS A 1 26  ? 11.424 44.756 -6.935  1.00 38.24 ? 25   HIS A NE2 1 
ATOM   163  N N   . LYS A 1 27  ? 9.489  39.575 -3.236  1.00 29.75 ? 26   LYS A N   1 
ATOM   164  C CA  . LYS A 1 27  ? 9.409  38.219 -2.712  1.00 29.78 ? 26   LYS A CA  1 
ATOM   165  C C   . LYS A 1 27  ? 9.887  37.242 -3.778  1.00 27.85 ? 26   LYS A C   1 
ATOM   166  O O   . LYS A 1 27  ? 9.619  37.432 -4.969  1.00 28.71 ? 26   LYS A O   1 
ATOM   167  C CB  . LYS A 1 27  ? 7.986  37.894 -2.250  1.00 32.26 ? 26   LYS A CB  1 
ATOM   168  C CG  . LYS A 1 27  ? 7.560  38.693 -1.025  1.00 35.43 ? 26   LYS A CG  1 
ATOM   169  C CD  . LYS A 1 27  ? 6.140  38.383 -0.599  1.00 38.09 ? 26   LYS A CD  1 
ATOM   170  C CE  . LYS A 1 27  ? 5.759  39.199 0.625   1.00 39.91 ? 26   LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 27  ? 4.341  38.974 1.024   1.00 43.66 ? 26   LYS A NZ  1 
ATOM   172  N N   . PHE A 1 28  ? 10.655 36.244 -3.348  1.00 23.34 ? 27   PHE A N   1 
ATOM   173  C CA  . PHE A 1 28  ? 11.199 35.234 -4.250  1.00 21.89 ? 27   PHE A CA  1 
ATOM   174  C C   . PHE A 1 28  ? 11.357 33.868 -3.588  1.00 21.36 ? 27   PHE A C   1 
ATOM   175  O O   . PHE A 1 28  ? 11.274 33.737 -2.361  1.00 21.01 ? 27   PHE A O   1 
ATOM   176  C CB  . PHE A 1 28  ? 12.550 35.699 -4.852  1.00 18.73 ? 27   PHE A CB  1 
ATOM   177  C CG  . PHE A 1 28  ? 13.677 35.802 -3.849  1.00 20.16 ? 27   PHE A CG  1 
ATOM   178  C CD1 . PHE A 1 28  ? 13.767 36.907 -2.982  1.00 19.69 ? 27   PHE A CD1 1 
ATOM   179  C CD2 . PHE A 1 28  ? 14.662 34.790 -3.769  1.00 18.37 ? 27   PHE A CD2 1 
ATOM   180  C CE1 . PHE A 1 28  ? 14.820 37.012 -2.047  1.00 21.42 ? 27   PHE A CE1 1 
ATOM   181  C CE2 . PHE A 1 28  ? 15.725 34.877 -2.835  1.00 20.56 ? 27   PHE A CE2 1 
ATOM   182  C CZ  . PHE A 1 28  ? 15.805 35.995 -1.969  1.00 20.11 ? 27   PHE A CZ  1 
ATOM   183  N N   . SER A 1 29  ? 11.656 32.875 -4.420  1.00 21.64 ? 28   SER A N   1 
ATOM   184  C CA  . SER A 1 29  ? 11.873 31.506 -3.982  1.00 21.59 ? 28   SER A CA  1 
ATOM   185  C C   . SER A 1 29  ? 12.982 30.853 -4.789  1.00 21.91 ? 28   SER A C   1 
ATOM   186  O O   . SER A 1 29  ? 13.125 31.115 -5.989  1.00 21.43 ? 28   SER A O   1 
ATOM   187  C CB  . SER A 1 29  ? 10.590 30.678 -4.094  1.00 24.96 ? 28   SER A CB  1 
ATOM   188  O OG  . SER A 1 29  ? 9.628  31.113 -3.151  1.00 26.78 ? 28   SER A OG  1 
ATOM   189  N N   . VAL A 1 30  ? 13.805 30.062 -4.100  1.00 20.19 ? 29   VAL A N   1 
ATOM   190  C CA  . VAL A 1 30  ? 14.913 29.330 -4.712  1.00 18.90 ? 29   VAL A CA  1 
ATOM   191  C C   . VAL A 1 30  ? 14.796 27.848 -4.356  1.00 20.31 ? 29   VAL A C   1 
ATOM   192  O O   . VAL A 1 30  ? 14.549 27.486 -3.198  1.00 18.28 ? 29   VAL A O   1 
ATOM   193  C CB  . VAL A 1 30  ? 16.328 29.873 -4.251  1.00 19.59 ? 29   VAL A CB  1 
ATOM   194  C CG1 . VAL A 1 30  ? 17.480 28.988 -4.787  1.00 16.28 ? 29   VAL A CG1 1 
ATOM   195  C CG2 . VAL A 1 30  ? 16.542 31.288 -4.752  1.00 18.16 ? 29   VAL A CG2 1 
ATOM   196  N N   . SER A 1 31  ? 14.951 27.007 -5.376  1.00 20.00 ? 30   SER A N   1 
ATOM   197  C CA  . SER A 1 31  ? 14.926 25.563 -5.213  1.00 22.20 ? 30   SER A CA  1 
ATOM   198  C C   . SER A 1 31  ? 16.312 25.024 -5.560  1.00 22.09 ? 30   SER A C   1 
ATOM   199  O O   . SER A 1 31  ? 16.872 25.346 -6.614  1.00 20.62 ? 30   SER A O   1 
ATOM   200  C CB  . SER A 1 31  ? 13.871 24.920 -6.116  1.00 23.60 ? 30   SER A CB  1 
ATOM   201  O OG  . SER A 1 31  ? 13.830 23.523 -5.889  1.00 29.42 ? 30   SER A OG  1 
ATOM   202  N N   . GLY A 1 32  ? 16.854 24.210 -4.660  1.00 19.83 ? 31   GLY A N   1 
ATOM   203  C CA  . GLY A 1 32  ? 18.163 23.629 -4.862  1.00 18.98 ? 31   GLY A CA  1 
ATOM   204  C C   . GLY A 1 32  ? 18.157 22.126 -4.740  1.00 20.35 ? 31   GLY A C   1 
ATOM   205  O O   . GLY A 1 32  ? 17.460 21.553 -3.895  1.00 20.94 ? 31   GLY A O   1 
ATOM   206  N N   . GLU A 1 33  ? 18.898 21.487 -5.639  1.00 19.22 ? 32   GLU A N   1 
ATOM   207  C CA  . GLU A 1 33  ? 19.029 20.034 -5.678  1.00 19.61 ? 32   GLU A CA  1 
ATOM   208  C C   . GLU A 1 33  ? 20.481 19.684 -5.933  1.00 19.13 ? 32   GLU A C   1 
ATOM   209  O O   . GLU A 1 33  ? 21.203 20.439 -6.594  1.00 19.23 ? 32   GLU A O   1 
ATOM   210  C CB  . GLU A 1 33  ? 18.189 19.435 -6.807  1.00 19.68 ? 32   GLU A CB  1 
ATOM   211  C CG  . GLU A 1 33  ? 16.684 19.476 -6.613  1.00 20.85 ? 32   GLU A CG  1 
ATOM   212  C CD  . GLU A 1 33  ? 15.953 18.841 -7.770  1.00 23.50 ? 32   GLU A CD  1 
ATOM   213  O OE1 . GLU A 1 33  ? 16.447 17.817 -8.292  1.00 22.65 ? 32   GLU A OE1 1 
ATOM   214  O OE2 . GLU A 1 33  ? 14.892 19.364 -8.168  1.00 24.10 ? 32   GLU A OE2 1 
ATOM   215  N N   . GLY A 1 34  ? 20.892 18.525 -5.435  1.00 18.23 ? 33   GLY A N   1 
ATOM   216  C CA  . GLY A 1 34  ? 22.255 18.077 -5.624  1.00 18.63 ? 33   GLY A CA  1 
ATOM   217  C C   . GLY A 1 34  ? 22.635 16.920 -4.729  1.00 19.55 ? 33   GLY A C   1 
ATOM   218  O O   . GLY A 1 34  ? 21.774 16.220 -4.192  1.00 18.41 ? 33   GLY A O   1 
ATOM   219  N N   . GLU A 1 35  ? 23.941 16.732 -4.567  1.00 20.91 ? 34   GLU A N   1 
ATOM   220  C CA  . GLU A 1 35  ? 24.478 15.661 -3.741  1.00 21.29 ? 34   GLU A CA  1 
ATOM   221  C C   . GLU A 1 35  ? 25.717 16.092 -2.981  1.00 20.93 ? 34   GLU A C   1 
ATOM   222  O O   . GLU A 1 35  ? 26.434 17.013 -3.395  1.00 19.78 ? 34   GLU A O   1 
ATOM   223  C CB  . GLU A 1 35  ? 24.749 14.391 -4.570  1.00 25.57 ? 34   GLU A CB  1 
ATOM   224  C CG  . GLU A 1 35  ? 25.615 14.565 -5.822  1.00 32.14 ? 34   GLU A CG  1 
ATOM   225  C CD  . GLU A 1 35  ? 25.817 13.258 -6.591  1.00 35.56 ? 34   GLU A CD  1 
ATOM   226  O OE1 . GLU A 1 35  ? 24.809 12.620 -6.974  1.00 36.46 ? 34   GLU A OE1 1 
ATOM   227  O OE2 . GLU A 1 35  ? 26.987 12.861 -6.800  1.00 37.40 ? 34   GLU A OE2 1 
ATOM   228  N N   . GLY A 1 36  ? 25.902 15.473 -1.819  1.00 20.21 ? 35   GLY A N   1 
ATOM   229  C CA  . GLY A 1 36  ? 27.045 15.759 -0.977  1.00 20.29 ? 35   GLY A CA  1 
ATOM   230  C C   . GLY A 1 36  ? 27.788 14.491 -0.621  1.00 21.99 ? 35   GLY A C   1 
ATOM   231  O O   . GLY A 1 36  ? 27.172 13.450 -0.374  1.00 20.95 ? 35   GLY A O   1 
ATOM   232  N N   . ASP A 1 37  ? 29.113 14.594 -0.561  1.00 24.00 ? 36   ASP A N   1 
ATOM   233  C CA  . ASP A 1 37  ? 29.980 13.468 -0.234  1.00 25.78 ? 36   ASP A CA  1 
ATOM   234  C C   . ASP A 1 37  ? 30.940 13.942 0.859   1.00 24.59 ? 36   ASP A C   1 
ATOM   235  O O   . ASP A 1 37  ? 32.032 14.446 0.580   1.00 24.30 ? 36   ASP A O   1 
ATOM   236  C CB  . ASP A 1 37  ? 30.732 13.009 -1.500  1.00 28.81 ? 36   ASP A CB  1 
ATOM   237  C CG  . ASP A 1 37  ? 31.356 11.614 -1.367  1.00 33.58 ? 36   ASP A CG  1 
ATOM   238  O OD1 . ASP A 1 37  ? 31.702 11.036 -2.419  1.00 35.96 ? 36   ASP A OD1 1 
ATOM   239  O OD2 . ASP A 1 37  ? 31.531 11.098 -0.239  1.00 34.28 ? 36   ASP A OD2 1 
ATOM   240  N N   . ALA A 1 38  ? 30.520 13.737 2.106   1.00 24.27 ? 37   ALA A N   1 
ATOM   241  C CA  . ALA A 1 38  ? 31.272 14.130 3.298   1.00 23.40 ? 37   ALA A CA  1 
ATOM   242  C C   . ALA A 1 38  ? 32.675 13.547 3.451   1.00 22.71 ? 37   ALA A C   1 
ATOM   243  O O   . ALA A 1 38  ? 33.542 14.186 4.044   1.00 20.24 ? 37   ALA A O   1 
ATOM   244  C CB  . ALA A 1 38  ? 30.461 13.844 4.525   1.00 24.68 ? 37   ALA A CB  1 
ATOM   245  N N   . THR A 1 39  ? 32.904 12.365 2.872   1.00 23.40 ? 38   THR A N   1 
ATOM   246  C CA  . THR A 1 39  ? 34.210 11.685 2.917   1.00 23.95 ? 38   THR A CA  1 
ATOM   247  C C   . THR A 1 39  ? 35.293 12.543 2.228   1.00 24.08 ? 38   THR A C   1 
ATOM   248  O O   . THR A 1 39  ? 36.452 12.552 2.650   1.00 23.21 ? 38   THR A O   1 
ATOM   249  C CB  . THR A 1 39  ? 34.133 10.283 2.237   1.00 24.34 ? 38   THR A CB  1 
ATOM   250  O OG1 . THR A 1 39  ? 33.072 9.526  2.822   1.00 25.63 ? 38   THR A OG1 1 
ATOM   251  C CG2 . THR A 1 39  ? 35.428 9.497  2.426   1.00 26.64 ? 38   THR A CG2 1 
ATOM   252  N N   . TYR A 1 40  ? 34.879 13.290 1.202   1.00 24.55 ? 39   TYR A N   1 
ATOM   253  C CA  . TYR A 1 40  ? 35.771 14.172 0.441   1.00 24.26 ? 39   TYR A CA  1 
ATOM   254  C C   . TYR A 1 40  ? 35.374 15.641 0.607   1.00 24.17 ? 39   TYR A C   1 
ATOM   255  O O   . TYR A 1 40  ? 35.972 16.523 -0.021  1.00 24.99 ? 39   TYR A O   1 
ATOM   256  C CB  . TYR A 1 40  ? 35.762 13.783 -1.047  1.00 26.89 ? 39   TYR A CB  1 
ATOM   257  C CG  . TYR A 1 40  ? 36.010 12.309 -1.293  1.00 29.67 ? 39   TYR A CG  1 
ATOM   258  C CD1 . TYR A 1 40  ? 37.292 11.746 -1.125  1.00 31.48 ? 39   TYR A CD1 1 
ATOM   259  C CD2 . TYR A 1 40  ? 34.941 11.449 -1.609  1.00 31.40 ? 39   TYR A CD2 1 
ATOM   260  C CE1 . TYR A 1 40  ? 37.497 10.339 -1.256  1.00 32.76 ? 39   TYR A CE1 1 
ATOM   261  C CE2 . TYR A 1 40  ? 35.131 10.049 -1.744  1.00 33.30 ? 39   TYR A CE2 1 
ATOM   262  C CZ  . TYR A 1 40  ? 36.410 9.505  -1.564  1.00 34.21 ? 39   TYR A CZ  1 
ATOM   263  O OH  . TYR A 1 40  ? 36.585 8.144  -1.681  1.00 34.80 ? 39   TYR A OH  1 
ATOM   264  N N   . GLY A 1 41  ? 34.369 15.890 1.457   1.00 23.97 ? 40   GLY A N   1 
ATOM   265  C CA  . GLY A 1 41  ? 33.859 17.235 1.717   1.00 23.59 ? 40   GLY A CA  1 
ATOM   266  C C   . GLY A 1 41  ? 33.408 17.949 0.457   1.00 23.18 ? 40   GLY A C   1 
ATOM   267  O O   . GLY A 1 41  ? 33.586 19.154 0.323   1.00 25.32 ? 40   GLY A O   1 
ATOM   268  N N   . LYS A 1 42  ? 32.843 17.176 -0.466  1.00 22.30 ? 41   LYS A N   1 
ATOM   269  C CA  . LYS A 1 42  ? 32.406 17.665 -1.764  1.00 21.02 ? 41   LYS A CA  1 
ATOM   270  C C   . LYS A 1 42  ? 30.900 17.889 -1.858  1.00 22.01 ? 41   LYS A C   1 
ATOM   271  O O   . LYS A 1 42  ? 30.103 17.040 -1.454  1.00 21.74 ? 41   LYS A O   1 
ATOM   272  C CB  . LYS A 1 42  ? 32.870 16.677 -2.844  1.00 22.75 ? 41   LYS A CB  1 
ATOM   273  C CG  . LYS A 1 42  ? 32.791 17.176 -4.278  1.00 24.36 ? 41   LYS A CG  1 
ATOM   274  C CD  . LYS A 1 42  ? 33.362 16.134 -5.222  1.00 24.19 ? 41   LYS A CD  1 
ATOM   275  C CE  . LYS A 1 42  ? 33.524 16.672 -6.628  1.00 24.71 ? 41   LYS A CE  1 
ATOM   276  N NZ  . LYS A 1 42  ? 34.142 15.642 -7.496  1.00 24.06 ? 41   LYS A NZ  1 
ATOM   277  N N   . LEU A 1 43  ? 30.538 19.048 -2.406  1.00 21.66 ? 42   LEU A N   1 
ATOM   278  C CA  . LEU A 1 43  ? 29.154 19.473 -2.607  1.00 22.12 ? 42   LEU A CA  1 
ATOM   279  C C   . LEU A 1 43  ? 28.941 19.934 -4.045  1.00 21.87 ? 42   LEU A C   1 
ATOM   280  O O   . LEU A 1 43  ? 29.685 20.786 -4.533  1.00 20.49 ? 42   LEU A O   1 
ATOM   281  C CB  . LEU A 1 43  ? 28.825 20.657 -1.691  1.00 24.17 ? 42   LEU A CB  1 
ATOM   282  C CG  . LEU A 1 43  ? 28.692 20.421 -0.195  1.00 24.15 ? 42   LEU A CG  1 
ATOM   283  C CD1 . LEU A 1 43  ? 28.948 21.695 0.580   1.00 26.02 ? 42   LEU A CD1 1 
ATOM   284  C CD2 . LEU A 1 43  ? 27.329 19.873 0.067   1.00 25.56 ? 42   LEU A CD2 1 
ATOM   285  N N   . THR A 1 44  ? 27.972 19.328 -4.731  1.00 20.41 ? 43   THR A N   1 
ATOM   286  C CA  . THR A 1 44  ? 27.612 19.715 -6.101  1.00 23.55 ? 43   THR A CA  1 
ATOM   287  C C   . THR A 1 44  ? 26.126 20.043 -6.042  1.00 22.37 ? 43   THR A C   1 
ATOM   288  O O   . THR A 1 44  ? 25.315 19.188 -5.685  1.00 24.31 ? 43   THR A O   1 
ATOM   289  C CB  . THR A 1 44  ? 27.883 18.603 -7.150  1.00 25.16 ? 43   THR A CB  1 
ATOM   290  O OG1 . THR A 1 44  ? 27.486 17.329 -6.631  1.00 28.09 ? 43   THR A OG1 1 
ATOM   291  C CG2 . THR A 1 44  ? 29.356 18.570 -7.526  1.00 25.89 ? 43   THR A CG2 1 
ATOM   292  N N   . LEU A 1 45  ? 25.783 21.305 -6.304  1.00 20.11 ? 44   LEU A N   1 
ATOM   293  C CA  . LEU A 1 45  ? 24.396 21.770 -6.231  1.00 19.34 ? 44   LEU A CA  1 
ATOM   294  C C   . LEU A 1 45  ? 23.979 22.691 -7.369  1.00 19.87 ? 44   LEU A C   1 
ATOM   295  O O   . LEU A 1 45  ? 24.800 23.434 -7.901  1.00 20.03 ? 44   LEU A O   1 
ATOM   296  C CB  . LEU A 1 45  ? 24.179 22.529 -4.907  1.00 19.46 ? 44   LEU A CB  1 
ATOM   297  C CG  . LEU A 1 45  ? 24.165 21.822 -3.538  1.00 22.02 ? 44   LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 45  ? 24.662 22.748 -2.440  1.00 23.49 ? 44   LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 45  ? 22.775 21.302 -3.239  1.00 22.57 ? 44   LEU A CD2 1 
ATOM   300  N N   . LYS A 1 46  ? 22.698 22.624 -7.738  1.00 20.18 ? 45   LYS A N   1 
ATOM   301  C CA  . LYS A 1 46  ? 22.129 23.494 -8.767  1.00 19.40 ? 45   LYS A CA  1 
ATOM   302  C C   . LYS A 1 46  ? 20.929 24.216 -8.150  1.00 18.39 ? 45   LYS A C   1 
ATOM   303  O O   . LYS A 1 46  ? 19.934 23.588 -7.768  1.00 19.54 ? 45   LYS A O   1 
ATOM   304  C CB  . LYS A 1 46  ? 21.710 22.722 -10.031 1.00 18.49 ? 45   LYS A CB  1 
ATOM   305  C CG  . LYS A 1 46  ? 21.233 23.644 -11.162 1.00 17.81 ? 45   LYS A CG  1 
ATOM   306  C CD  . LYS A 1 46  ? 20.654 22.889 -12.345 1.00 18.58 ? 45   LYS A CD  1 
ATOM   307  C CE  . LYS A 1 46  ? 20.089 23.871 -13.372 1.00 17.79 ? 45   LYS A CE  1 
ATOM   308  N NZ  . LYS A 1 46  ? 19.363 23.194 -14.480 1.00 18.01 ? 45   LYS A NZ  1 
ATOM   309  N N   . PHE A 1 47  ? 21.051 25.536 -8.051  1.00 16.84 ? 46   PHE A N   1 
ATOM   310  C CA  . PHE A 1 47  ? 20.021 26.400 -7.478  1.00 17.97 ? 46   PHE A CA  1 
ATOM   311  C C   . PHE A 1 47  ? 19.257 27.119 -8.574  1.00 19.33 ? 46   PHE A C   1 
ATOM   312  O O   . PHE A 1 47  ? 19.865 27.655 -9.491  1.00 19.28 ? 46   PHE A O   1 
ATOM   313  C CB  . PHE A 1 47  ? 20.660 27.428 -6.550  1.00 17.17 ? 46   PHE A CB  1 
ATOM   314  C CG  . PHE A 1 47  ? 21.289 26.829 -5.335  1.00 19.25 ? 46   PHE A CG  1 
ATOM   315  C CD1 . PHE A 1 47  ? 22.682 26.684 -5.253  1.00 18.85 ? 46   PHE A CD1 1 
ATOM   316  C CD2 . PHE A 1 47  ? 20.491 26.385 -4.268  1.00 17.65 ? 46   PHE A CD2 1 
ATOM   317  C CE1 . PHE A 1 47  ? 23.283 26.099 -4.117  1.00 20.44 ? 46   PHE A CE1 1 
ATOM   318  C CE2 . PHE A 1 47  ? 21.072 25.794 -3.125  1.00 19.29 ? 46   PHE A CE2 1 
ATOM   319  C CZ  . PHE A 1 47  ? 22.472 25.651 -3.047  1.00 20.27 ? 46   PHE A CZ  1 
ATOM   320  N N   . ILE A 1 48  ? 17.926 27.088 -8.498  1.00 19.07 ? 47   ILE A N   1 
ATOM   321  C CA  . ILE A 1 48  ? 17.070 27.732 -9.501  1.00 20.47 ? 47   ILE A CA  1 
ATOM   322  C C   . ILE A 1 48  ? 16.054 28.669 -8.850  1.00 21.02 ? 47   ILE A C   1 
ATOM   323  O O   . ILE A 1 48  ? 15.365 28.279 -7.901  1.00 20.46 ? 47   ILE A O   1 
ATOM   324  C CB  . ILE A 1 48  ? 16.260 26.674 -10.351 1.00 19.37 ? 47   ILE A CB  1 
ATOM   325  C CG1 . ILE A 1 48  ? 17.191 25.604 -10.947 1.00 19.37 ? 47   ILE A CG1 1 
ATOM   326  C CG2 . ILE A 1 48  ? 15.521 27.372 -11.509 1.00 22.44 ? 47   ILE A CG2 1 
ATOM   327  C CD1 . ILE A 1 48  ? 16.481 24.387 -11.492 1.00 20.57 ? 47   ILE A CD1 1 
ATOM   328  N N   . CYS A 1 49  ? 15.951 29.896 -9.371  1.00 21.66 ? 48   CYS A N   1 
ATOM   329  C CA  . CYS A 1 49  ? 14.957 30.851 -8.873  1.00 22.46 ? 48   CYS A CA  1 
ATOM   330  C C   . CYS A 1 49  ? 13.664 30.477 -9.598  1.00 23.52 ? 48   CYS A C   1 
ATOM   331  O O   . CYS A 1 49  ? 13.578 30.560 -10.827 1.00 25.05 ? 48   CYS A O   1 
ATOM   332  C CB  . CYS A 1 49  ? 15.338 32.303 -9.172  1.00 21.67 ? 48   CYS A CB  1 
ATOM   333  S SG  . CYS A 1 49  ? 14.093 33.486 -8.563  1.00 24.69 ? 48   CYS A SG  1 
ATOM   334  N N   . THR A 1 50  ? 12.695 30.000 -8.822  1.00 25.19 ? 49   THR A N   1 
ATOM   335  C CA  . THR A 1 50  ? 11.410 29.533 -9.342  1.00 26.01 ? 49   THR A CA  1 
ATOM   336  C C   . THR A 1 50  ? 10.352 30.608 -9.569  1.00 26.26 ? 49   THR A C   1 
ATOM   337  O O   . THR A 1 50  ? 9.326  30.349 -10.204 1.00 28.05 ? 49   THR A O   1 
ATOM   338  C CB  . THR A 1 50  ? 10.822 28.440 -8.424  1.00 25.59 ? 49   THR A CB  1 
ATOM   339  O OG1 . THR A 1 50  ? 10.745 28.935 -7.082  1.00 23.83 ? 49   THR A OG1 1 
ATOM   340  C CG2 . THR A 1 50  ? 11.697 27.188 -8.452  1.00 26.25 ? 49   THR A CG2 1 
ATOM   341  N N   . THR A 1 51  ? 10.602 31.802 -9.045  1.00 25.10 ? 50   THR A N   1 
ATOM   342  C CA  . THR A 1 51  ? 9.669  32.919 -9.180  1.00 26.81 ? 50   THR A CA  1 
ATOM   343  C C   . THR A 1 51  ? 10.048 33.895 -10.303 1.00 28.25 ? 50   THR A C   1 
ATOM   344  O O   . THR A 1 51  ? 9.342  34.878 -10.542 1.00 29.32 ? 50   THR A O   1 
ATOM   345  C CB  . THR A 1 51  ? 9.536  33.674 -7.847  1.00 25.36 ? 50   THR A CB  1 
ATOM   346  O OG1 . THR A 1 51  ? 10.840 33.991 -7.348  1.00 24.14 ? 50   THR A OG1 1 
ATOM   347  C CG2 . THR A 1 51  ? 8.796  32.819 -6.817  1.00 23.98 ? 50   THR A CG2 1 
ATOM   348  N N   . GLY A 1 52  ? 11.157 33.610 -10.987 1.00 28.63 ? 51   GLY A N   1 
ATOM   349  C CA  . GLY A 1 52  ? 11.616 34.458 -12.075 1.00 30.07 ? 51   GLY A CA  1 
ATOM   350  C C   . GLY A 1 52  ? 13.025 34.960 -11.844 1.00 29.57 ? 51   GLY A C   1 
ATOM   351  O O   . GLY A 1 52  ? 13.925 34.170 -11.565 1.00 30.63 ? 51   GLY A O   1 
ATOM   352  N N   . LYS A 1 53  ? 13.216 36.274 -11.962 1.00 29.80 ? 52   LYS A N   1 
ATOM   353  C CA  . LYS A 1 53  ? 14.524 36.903 -11.757 1.00 29.32 ? 52   LYS A CA  1 
ATOM   354  C C   . LYS A 1 53  ? 14.809 37.096 -10.267 1.00 27.40 ? 52   LYS A C   1 
ATOM   355  O O   . LYS A 1 53  ? 13.924 37.487 -9.504  1.00 26.68 ? 52   LYS A O   1 
ATOM   356  C CB  . LYS A 1 53  ? 14.585 38.272 -12.445 1.00 33.91 ? 52   LYS A CB  1 
ATOM   357  C CG  . LYS A 1 53  ? 14.495 38.251 -13.964 1.00 39.23 ? 52   LYS A CG  1 
ATOM   358  C CD  . LYS A 1 53  ? 14.567 39.672 -14.512 1.00 43.22 ? 52   LYS A CD  1 
ATOM   359  C CE  . LYS A 1 53  ? 14.468 39.719 -16.032 1.00 44.66 ? 52   LYS A CE  1 
ATOM   360  N NZ  . LYS A 1 53  ? 14.661 41.112 -16.538 1.00 45.64 ? 52   LYS A NZ  1 
ATOM   361  N N   . LEU A 1 54  ? 16.044 36.807 -9.864  1.00 26.20 ? 53   LEU A N   1 
ATOM   362  C CA  . LEU A 1 54  ? 16.481 36.968 -8.477  1.00 25.64 ? 53   LEU A CA  1 
ATOM   363  C C   . LEU A 1 54  ? 16.721 38.476 -8.282  1.00 26.36 ? 53   LEU A C   1 
ATOM   364  O O   . LEU A 1 54  ? 17.406 39.097 -9.098  1.00 27.12 ? 53   LEU A O   1 
ATOM   365  C CB  . LEU A 1 54  ? 17.777 36.181 -8.242  1.00 24.48 ? 53   LEU A CB  1 
ATOM   366  C CG  . LEU A 1 54  ? 18.112 35.752 -6.814  1.00 23.37 ? 53   LEU A CG  1 
ATOM   367  C CD1 . LEU A 1 54  ? 17.271 34.563 -6.410  1.00 20.89 ? 53   LEU A CD1 1 
ATOM   368  C CD2 . LEU A 1 54  ? 19.563 35.391 -6.734  1.00 21.27 ? 53   LEU A CD2 1 
ATOM   369  N N   . PRO A 1 55  ? 16.103 39.093 -7.249  1.00 26.77 ? 54   PRO A N   1 
ATOM   370  C CA  . PRO A 1 55  ? 16.271 40.533 -6.992  1.00 26.84 ? 54   PRO A CA  1 
ATOM   371  C C   . PRO A 1 55  ? 17.619 40.948 -6.407  1.00 25.51 ? 54   PRO A C   1 
ATOM   372  O O   . PRO A 1 55  ? 17.919 42.139 -6.304  1.00 29.16 ? 54   PRO A O   1 
ATOM   373  C CB  . PRO A 1 55  ? 15.127 40.838 -6.032  1.00 27.36 ? 54   PRO A CB  1 
ATOM   374  C CG  . PRO A 1 55  ? 15.023 39.583 -5.240  1.00 27.75 ? 54   PRO A CG  1 
ATOM   375  C CD  . PRO A 1 55  ? 15.107 38.523 -6.319  1.00 27.85 ? 54   PRO A CD  1 
ATOM   376  N N   . VAL A 1 56  ? 18.415 39.952 -6.026  1.00 23.67 ? 55   VAL A N   1 
ATOM   377  C CA  . VAL A 1 56  ? 19.746 40.145 -5.444  1.00 22.20 ? 55   VAL A CA  1 
ATOM   378  C C   . VAL A 1 56  ? 20.751 39.282 -6.241  1.00 20.98 ? 55   VAL A C   1 
ATOM   379  O O   . VAL A 1 56  ? 20.330 38.414 -7.008  1.00 20.07 ? 55   VAL A O   1 
ATOM   380  C CB  . VAL A 1 56  ? 19.752 39.755 -3.920  1.00 22.79 ? 55   VAL A CB  1 
ATOM   381  C CG1 . VAL A 1 56  ? 18.958 40.767 -3.111  1.00 22.75 ? 55   VAL A CG1 1 
ATOM   382  C CG2 . VAL A 1 56  ? 19.212 38.342 -3.698  1.00 25.11 ? 55   VAL A CG2 1 
ATOM   383  N N   . PRO A 1 57  ? 22.072 39.567 -6.156  1.00 20.25 ? 56   PRO A N   1 
ATOM   384  C CA  . PRO A 1 57  ? 22.995 38.721 -6.921  1.00 18.88 ? 56   PRO A CA  1 
ATOM   385  C C   . PRO A 1 57  ? 23.147 37.348 -6.268  1.00 18.08 ? 56   PRO A C   1 
ATOM   386  O O   . PRO A 1 57  ? 23.042 37.230 -5.043  1.00 17.45 ? 56   PRO A O   1 
ATOM   387  C CB  . PRO A 1 57  ? 24.318 39.491 -6.831  1.00 20.10 ? 56   PRO A CB  1 
ATOM   388  C CG  . PRO A 1 57  ? 23.903 40.887 -6.612  1.00 21.42 ? 56   PRO A CG  1 
ATOM   389  C CD  . PRO A 1 57  ? 22.802 40.737 -5.630  1.00 21.87 ? 56   PRO A CD  1 
ATOM   390  N N   . TRP A 1 58  ? 23.420 36.326 -7.085  1.00 18.12 ? 57   TRP A N   1 
ATOM   391  C CA  . TRP A 1 58  ? 23.629 34.962 -6.588  1.00 17.66 ? 57   TRP A CA  1 
ATOM   392  C C   . TRP A 1 58  ? 24.736 34.804 -5.524  1.00 17.10 ? 57   TRP A C   1 
ATOM   393  O O   . TRP A 1 58  ? 24.525 34.056 -4.561  1.00 17.01 ? 57   TRP A O   1 
ATOM   394  C CB  . TRP A 1 58  ? 23.833 33.959 -7.739  1.00 18.04 ? 57   TRP A CB  1 
ATOM   395  C CG  . TRP A 1 58  ? 22.571 33.574 -8.444  1.00 16.91 ? 57   TRP A CG  1 
ATOM   396  C CD1 . TRP A 1 58  ? 22.152 34.010 -9.672  1.00 18.21 ? 57   TRP A CD1 1 
ATOM   397  C CD2 . TRP A 1 58  ? 21.541 32.712 -7.948  1.00 16.62 ? 57   TRP A CD2 1 
ATOM   398  N NE1 . TRP A 1 58  ? 20.922 33.480 -9.972  1.00 18.79 ? 57   TRP A NE1 1 
ATOM   399  C CE2 . TRP A 1 58  ? 20.517 32.679 -8.934  1.00 18.21 ? 57   TRP A CE2 1 
ATOM   400  C CE3 . TRP A 1 58  ? 21.371 31.961 -6.758  1.00 16.78 ? 57   TRP A CE3 1 
ATOM   401  C CZ2 . TRP A 1 58  ? 19.333 31.929 -8.772  1.00 17.13 ? 57   TRP A CZ2 1 
ATOM   402  C CZ3 . TRP A 1 58  ? 20.185 31.209 -6.596  1.00 17.30 ? 57   TRP A CZ3 1 
ATOM   403  C CH2 . TRP A 1 58  ? 19.185 31.202 -7.605  1.00 19.45 ? 57   TRP A CH2 1 
ATOM   404  N N   . PRO A 1 59  ? 25.905 35.508 -5.661  1.00 16.66 ? 58   PRO A N   1 
ATOM   405  C CA  . PRO A 1 59  ? 26.946 35.355 -4.635  1.00 17.59 ? 58   PRO A CA  1 
ATOM   406  C C   . PRO A 1 59  ? 26.543 35.752 -3.211  1.00 16.22 ? 58   PRO A C   1 
ATOM   407  O O   . PRO A 1 59  ? 27.060 35.184 -2.260  1.00 16.61 ? 58   PRO A O   1 
ATOM   408  C CB  . PRO A 1 59  ? 28.074 36.243 -5.153  1.00 15.91 ? 58   PRO A CB  1 
ATOM   409  C CG  . PRO A 1 59  ? 27.953 36.085 -6.604  1.00 18.02 ? 58   PRO A CG  1 
ATOM   410  C CD  . PRO A 1 59  ? 26.480 36.247 -6.811  1.00 16.57 ? 58   PRO A CD  1 
ATOM   411  N N   . THR A 1 60  ? 25.581 36.669 -3.083  1.00 18.99 ? 59   THR A N   1 
ATOM   412  C CA  . THR A 1 60  ? 25.105 37.143 -1.777  1.00 20.17 ? 59   THR A CA  1 
ATOM   413  C C   . THR A 1 60  ? 24.293 36.103 -1.023  1.00 20.10 ? 59   THR A C   1 
ATOM   414  O O   . THR A 1 60  ? 24.187 36.159 0.204   1.00 21.16 ? 59   THR A O   1 
ATOM   415  C CB  . THR A 1 60  ? 24.257 38.432 -1.882  1.00 19.64 ? 59   THR A CB  1 
ATOM   416  O OG1 . THR A 1 60  ? 23.046 38.180 -2.603  1.00 21.84 ? 59   THR A OG1 1 
ATOM   417  C CG2 . THR A 1 60  ? 25.029 39.525 -2.549  1.00 19.75 ? 59   THR A CG2 1 
ATOM   418  N N   . LEU A 1 61  ? 23.736 35.156 -1.777  1.00 19.77 ? 60   LEU A N   1 
ATOM   419  C CA  . LEU A 1 61  ? 22.931 34.082 -1.219  1.00 19.77 ? 60   LEU A CA  1 
ATOM   420  C C   . LEU A 1 61  ? 23.689 32.781 -0.990  1.00 19.94 ? 60   LEU A C   1 
ATOM   421  O O   . LEU A 1 61  ? 23.124 31.852 -0.417  1.00 18.70 ? 60   LEU A O   1 
ATOM   422  C CB  . LEU A 1 61  ? 21.710 33.800 -2.104  1.00 19.28 ? 60   LEU A CB  1 
ATOM   423  C CG  . LEU A 1 61  ? 20.609 34.845 -2.278  1.00 19.43 ? 60   LEU A CG  1 
ATOM   424  C CD1 . LEU A 1 61  ? 19.501 34.229 -3.112  1.00 17.14 ? 60   LEU A CD1 1 
ATOM   425  C CD2 . LEU A 1 61  ? 20.056 35.310 -0.933  1.00 18.24 ? 60   LEU A CD2 1 
ATOM   426  N N   . VAL A 1 62  ? 24.964 32.720 -1.392  1.00 19.32 ? 61   VAL A N   1 
ATOM   427  C CA  . VAL A 1 62  ? 25.774 31.505 -1.228  1.00 18.31 ? 61   VAL A CA  1 
ATOM   428  C C   . VAL A 1 62  ? 25.827 30.997 0.216   1.00 19.93 ? 61   VAL A C   1 
ATOM   429  O O   . VAL A 1 62  ? 25.555 29.827 0.440   1.00 19.57 ? 61   VAL A O   1 
ATOM   430  C CB  . VAL A 1 62  ? 27.219 31.659 -1.810  1.00 17.58 ? 61   VAL A CB  1 
ATOM   431  C CG1 . VAL A 1 62  ? 28.120 30.458 -1.431  1.00 16.24 ? 61   VAL A CG1 1 
ATOM   432  C CG2 . VAL A 1 62  ? 27.158 31.737 -3.323  1.00 18.05 ? 61   VAL A CG2 1 
ATOM   433  N N   . THR A 1 63  ? 26.074 31.887 1.182   1.00 19.78 ? 62   THR A N   1 
ATOM   434  C CA  . THR A 1 63  ? 26.146 31.476 2.590   1.00 21.75 ? 62   THR A CA  1 
ATOM   435  C C   . THR A 1 63  ? 24.793 31.016 3.125   1.00 21.98 ? 62   THR A C   1 
ATOM   436  O O   . THR A 1 63  ? 24.734 30.039 3.860   1.00 23.68 ? 62   THR A O   1 
ATOM   437  C CB  . THR A 1 63  ? 26.725 32.575 3.521   1.00 21.34 ? 62   THR A CB  1 
ATOM   438  O OG1 . THR A 1 63  ? 25.763 33.615 3.723   1.00 21.97 ? 62   THR A OG1 1 
ATOM   439  C CG2 . THR A 1 63  ? 27.988 33.166 2.945   1.00 21.62 ? 62   THR A CG2 1 
ATOM   440  N N   . THR A 1 64  ? 23.718 31.690 2.702   1.00 21.70 ? 63   THR A N   1 
ATOM   441  C CA  . THR A 1 64  ? 22.347 31.358 3.110   1.00 21.61 ? 63   THR A CA  1 
ATOM   442  C C   . THR A 1 64  ? 21.948 29.972 2.580   1.00 23.48 ? 63   THR A C   1 
ATOM   443  O O   . THR A 1 64  ? 21.375 29.162 3.311   1.00 24.72 ? 63   THR A O   1 
ATOM   444  C CB  . THR A 1 64  ? 21.325 32.431 2.616   1.00 20.73 ? 63   THR A CB  1 
ATOM   445  O OG1 . THR A 1 64  ? 21.587 33.678 3.268   1.00 21.00 ? 63   THR A OG1 1 
ATOM   446  C CG2 . THR A 1 64  ? 19.875 32.016 2.898   1.00 18.62 ? 63   THR A CG2 1 
ATOM   447  N N   . LEU A 1 65  ? 22.306 29.704 1.327   1.00 21.53 ? 64   LEU A N   1 
ATOM   448  C CA  . LEU A 1 65  ? 21.991 28.441 0.664   1.00 22.17 ? 64   LEU A CA  1 
ATOM   449  C C   . LEU A 1 65  ? 22.911 27.272 1.023   1.00 23.11 ? 64   LEU A C   1 
ATOM   450  O O   . LEU A 1 65  ? 22.556 26.109 0.784   1.00 23.98 ? 64   LEU A O   1 
ATOM   451  C CB  . LEU A 1 65  ? 21.992 28.644 -0.852  1.00 20.01 ? 64   LEU A CB  1 
ATOM   452  C CG  . LEU A 1 65  ? 20.944 29.576 -1.474  1.00 23.64 ? 64   LEU A CG  1 
ATOM   453  C CD1 . LEU A 1 65  ? 21.382 29.956 -2.884  1.00 21.32 ? 64   LEU A CD1 1 
ATOM   454  C CD2 . LEU A 1 65  ? 19.565 28.924 -1.478  1.00 21.47 ? 64   LEU A CD2 1 
ATOM   455  N N   . THR A 1 66  ? 24.087 27.576 1.580   1.00 21.79 ? 65   THR A N   1 
ATOM   456  C CA  . THR A 1 66  ? 25.052 26.541 1.946   1.00 23.38 ? 65   THR A CA  1 
ATOM   457  C C   . THR A 1 66  ? 25.374 26.323 3.414   1.00 23.95 ? 65   THR A C   1 
ATOM   458  O O   . THR A 1 66  ? 26.020 25.322 3.739   1.00 23.85 ? 65   THR A O   1 
ATOM   459  C CB  . THR A 1 66  ? 26.412 26.705 1.230   1.00 23.12 ? 65   THR A CB  1 
ATOM   460  O OG1 . THR A 1 66  ? 26.946 28.005 1.493   1.00 25.23 ? 65   THR A OG1 1 
ATOM   461  C CG2 . THR A 1 66  ? 26.275 26.485 -0.249  1.00 24.36 ? 65   THR A CG2 1 
ATOM   462  N N   . TYR A 1 67  ? 24.965 27.235 4.302   1.00 25.32 ? 66   TYR A N   1 
ATOM   463  C CA  . TYR A 1 67  ? 25.275 27.053 5.722   1.00 26.59 ? 66   TYR A CA  1 
ATOM   464  C C   . TYR A 1 67  ? 24.530 25.863 6.330   1.00 26.06 ? 66   TYR A C   1 
ATOM   465  O O   . TYR A 1 67  ? 24.955 25.290 7.333   1.00 26.77 ? 66   TYR A O   1 
ATOM   466  C CB  . TYR A 1 67  ? 25.143 28.365 6.535   1.00 28.55 ? 66   TYR A CB  1 
ATOM   467  C CG  . TYR A 1 67  ? 23.769 28.816 7.018   1.00 30.42 ? 66   TYR A CG  1 
ATOM   468  C CD1 . TYR A 1 67  ? 22.695 29.022 6.130   1.00 32.02 ? 66   TYR A CD1 1 
ATOM   469  C CD2 . TYR A 1 67  ? 23.564 29.115 8.376   1.00 31.51 ? 66   TYR A CD2 1 
ATOM   470  C CE1 . TYR A 1 67  ? 21.438 29.529 6.591   1.00 34.85 ? 66   TYR A CE1 1 
ATOM   471  C CE2 . TYR A 1 67  ? 22.325 29.613 8.852   1.00 32.41 ? 66   TYR A CE2 1 
ATOM   472  C CZ  . TYR A 1 67  ? 21.268 29.821 7.958   1.00 34.92 ? 66   TYR A CZ  1 
ATOM   473  O OH  . TYR A 1 67  ? 20.068 30.315 8.430   1.00 35.18 ? 66   TYR A OH  1 
ATOM   474  N N   . GLY A 1 68  ? 23.491 25.431 5.615   1.00 24.24 ? 67   GLY A N   1 
ATOM   475  C CA  . GLY A 1 68  ? 22.699 24.291 6.022   1.00 23.73 ? 67   GLY A CA  1 
ATOM   476  C C   . GLY A 1 68  ? 23.310 22.964 5.613   1.00 23.44 ? 67   GLY A C   1 
ATOM   477  O O   . GLY A 1 68  ? 22.904 21.920 6.127   1.00 22.59 ? 67   GLY A O   1 
ATOM   478  N N   . VAL A 1 69  ? 24.251 23.000 4.666   1.00 23.01 ? 68   VAL A N   1 
ATOM   479  C CA  . VAL A 1 69  ? 24.935 21.785 4.207   1.00 22.45 ? 68   VAL A CA  1 
ATOM   480  C C   . VAL A 1 69  ? 26.376 21.677 4.731   1.00 22.09 ? 68   VAL A C   1 
ATOM   481  O O   . VAL A 1 69  ? 27.220 20.987 4.150   1.00 20.97 ? 68   VAL A O   1 
ATOM   482  C CB  . VAL A 1 69  ? 24.855 21.583 2.649   1.00 23.83 ? 68   VAL A CB  1 
ATOM   483  C CG1 . VAL A 1 69  ? 23.425 21.360 2.226   1.00 24.40 ? 68   VAL A CG1 1 
ATOM   484  C CG2 . VAL A 1 69  ? 25.444 22.750 1.893   1.00 23.70 ? 68   VAL A CG2 1 
ATOM   485  N N   . GLN A 1 70  ? 26.623 22.323 5.874   1.00 20.83 ? 69   GLN A N   1 
ATOM   486  C CA  . GLN A 1 70  ? 27.926 22.286 6.550   1.00 20.64 ? 69   GLN A CA  1 
ATOM   487  C C   . GLN A 1 70  ? 28.152 20.890 7.154   1.00 19.87 ? 69   GLN A C   1 
ATOM   488  O O   . GLN A 1 70  ? 29.238 20.581 7.644   1.00 20.29 ? 69   GLN A O   1 
ATOM   489  C CB  . GLN A 1 70  ? 28.007 23.358 7.646   1.00 19.44 ? 69   GLN A CB  1 
ATOM   490  C CG  . GLN A 1 70  ? 28.303 24.767 7.136   1.00 20.87 ? 69   GLN A CG  1 
ATOM   491  C CD  . GLN A 1 70  ? 28.101 25.858 8.188   1.00 24.79 ? 69   GLN A CD  1 
ATOM   492  O OE1 . GLN A 1 70  ? 27.523 25.625 9.258   1.00 24.41 ? 69   GLN A OE1 1 
ATOM   493  N NE2 . GLN A 1 70  ? 28.549 27.067 7.868   1.00 22.53 ? 69   GLN A NE2 1 
ATOM   494  N N   . CYS A 1 71  ? 27.119 20.047 7.072   1.00 19.83 ? 70   CYS A N   1 
ATOM   495  C CA  . CYS A 1 71  ? 27.172 18.668 7.553   1.00 19.50 ? 70   CYS A CA  1 
ATOM   496  C C   . CYS A 1 71  ? 27.958 17.772 6.592   1.00 20.08 ? 70   CYS A C   1 
ATOM   497  O O   . CYS A 1 71  ? 28.296 16.635 6.925   1.00 19.56 ? 70   CYS A O   1 
ATOM   498  C CB  . CYS A 1 71  ? 25.762 18.122 7.812   1.00 21.22 ? 70   CYS A CB  1 
ATOM   499  S SG  . CYS A 1 71  ? 24.649 18.117 6.394   1.00 25.87 ? 70   CYS A SG  1 
ATOM   500  N N   . PHE A 1 72  ? 28.253 18.308 5.404   1.00 17.78 ? 71   PHE A N   1 
ATOM   501  C CA  . PHE A 1 72  ? 29.034 17.589 4.401   1.00 19.35 ? 71   PHE A CA  1 
ATOM   502  C C   . PHE A 1 72  ? 30.507 17.965 4.407   1.00 20.06 ? 71   PHE A C   1 
ATOM   503  O O   . PHE A 1 72  ? 31.249 17.630 3.479   1.00 21.23 ? 71   PHE A O   1 
ATOM   504  C CB  . PHE A 1 72  ? 28.438 17.761 3.010   1.00 17.48 ? 71   PHE A CB  1 
ATOM   505  C CG  . PHE A 1 72  ? 27.115 17.108 2.860   1.00 19.00 ? 71   PHE A CG  1 
ATOM   506  C CD1 . PHE A 1 72  ? 27.026 15.712 2.720   1.00 20.22 ? 71   PHE A CD1 1 
ATOM   507  C CD2 . PHE A 1 72  ? 25.940 17.868 2.901   1.00 18.64 ? 71   PHE A CD2 1 
ATOM   508  C CE1 . PHE A 1 72  ? 25.770 15.076 2.625   1.00 20.90 ? 71   PHE A CE1 1 
ATOM   509  C CE2 . PHE A 1 72  ? 24.676 17.252 2.810   1.00 19.56 ? 71   PHE A CE2 1 
ATOM   510  C CZ  . PHE A 1 72  ? 24.589 15.846 2.670   1.00 20.38 ? 71   PHE A CZ  1 
ATOM   511  N N   . SER A 1 73  ? 30.919 18.656 5.468   1.00 20.01 ? 72   SER A N   1 
ATOM   512  C CA  . SER A 1 73  ? 32.304 19.060 5.656   1.00 20.45 ? 72   SER A CA  1 
ATOM   513  C C   . SER A 1 73  ? 33.126 17.827 5.981   1.00 20.22 ? 72   SER A C   1 
ATOM   514  O O   . SER A 1 73  ? 32.633 16.915 6.652   1.00 17.36 ? 72   SER A O   1 
ATOM   515  C CB  . SER A 1 73  ? 32.424 20.026 6.833   1.00 22.12 ? 72   SER A CB  1 
ATOM   516  O OG  . SER A 1 73  ? 31.673 21.209 6.622   1.00 25.30 ? 72   SER A OG  1 
ATOM   517  N N   . ARG A 1 74  ? 34.345 17.767 5.453   1.00 20.17 ? 73   ARG A N   1 
ATOM   518  C CA  . ARG A 1 74  ? 35.214 16.640 5.765   1.00 21.42 ? 73   ARG A CA  1 
ATOM   519  C C   . ARG A 1 74  ? 35.955 16.954 7.048   1.00 20.24 ? 73   ARG A C   1 
ATOM   520  O O   . ARG A 1 74  ? 36.738 17.895 7.108   1.00 20.77 ? 73   ARG A O   1 
ATOM   521  C CB  . ARG A 1 74  ? 36.238 16.350 4.663   1.00 22.11 ? 73   ARG A CB  1 
ATOM   522  C CG  . ARG A 1 74  ? 37.109 15.133 4.975   1.00 21.60 ? 73   ARG A CG  1 
ATOM   523  C CD  . ARG A 1 74  ? 38.207 14.933 3.964   1.00 21.77 ? 73   ARG A CD  1 
ATOM   524  N NE  . ARG A 1 74  ? 39.315 15.891 4.033   1.00 25.32 ? 73   ARG A NE  1 
ATOM   525  C CZ  . ARG A 1 74  ? 40.337 15.827 4.889   1.00 25.27 ? 73   ARG A CZ  1 
ATOM   526  N NH1 . ARG A 1 74  ? 40.417 14.851 5.785   1.00 24.30 ? 73   ARG A NH1 1 
ATOM   527  N NH2 . ARG A 1 74  ? 41.316 16.719 4.810   1.00 27.01 ? 73   ARG A NH2 1 
ATOM   528  N N   . TYR A 1 75  ? 35.656 16.186 8.085   1.00 19.46 ? 74   TYR A N   1 
ATOM   529  C CA  . TYR A 1 75  ? 36.335 16.344 9.351   1.00 19.13 ? 74   TYR A CA  1 
ATOM   530  C C   . TYR A 1 75  ? 37.434 15.288 9.374   1.00 19.96 ? 74   TYR A C   1 
ATOM   531  O O   . TYR A 1 75  ? 37.142 14.103 9.179   1.00 19.51 ? 74   TYR A O   1 
ATOM   532  C CB  . TYR A 1 75  ? 35.364 16.149 10.518  1.00 18.59 ? 74   TYR A CB  1 
ATOM   533  C CG  . TYR A 1 75  ? 34.717 17.440 10.971  1.00 19.54 ? 74   TYR A CG  1 
ATOM   534  C CD1 . TYR A 1 75  ? 33.706 18.066 10.197  1.00 16.82 ? 74   TYR A CD1 1 
ATOM   535  C CD2 . TYR A 1 75  ? 35.127 18.066 12.167  1.00 19.85 ? 74   TYR A CD2 1 
ATOM   536  C CE1 . TYR A 1 75  ? 33.107 19.297 10.611  1.00 16.31 ? 74   TYR A CE1 1 
ATOM   537  C CE2 . TYR A 1 75  ? 34.540 19.305 12.588  1.00 18.59 ? 74   TYR A CE2 1 
ATOM   538  C CZ  . TYR A 1 75  ? 33.531 19.904 11.804  1.00 17.76 ? 74   TYR A CZ  1 
ATOM   539  O OH  . TYR A 1 75  ? 32.949 21.080 12.219  1.00 18.01 ? 74   TYR A OH  1 
ATOM   540  N N   . PRO A 1 76  ? 38.722 15.707 9.494   1.00 19.71 ? 75   PRO A N   1 
ATOM   541  C CA  . PRO A 1 76  ? 39.830 14.739 9.533   1.00 20.66 ? 75   PRO A CA  1 
ATOM   542  C C   . PRO A 1 76  ? 39.603 13.803 10.723  1.00 20.51 ? 75   PRO A C   1 
ATOM   543  O O   . PRO A 1 76  ? 38.931 14.194 11.675  1.00 18.85 ? 75   PRO A O   1 
ATOM   544  C CB  . PRO A 1 76  ? 41.053 15.627 9.746   1.00 20.10 ? 75   PRO A CB  1 
ATOM   545  C CG  . PRO A 1 76  ? 40.676 16.899 9.051   1.00 21.02 ? 75   PRO A CG  1 
ATOM   546  C CD  . PRO A 1 76  ? 39.248 17.089 9.498   1.00 20.19 ? 75   PRO A CD  1 
ATOM   547  N N   . ASP A 1 77  ? 40.102 12.568 10.651  1.00 22.94 ? 76   ASP A N   1 
ATOM   548  C CA  . ASP A 1 77  ? 39.888 11.595 11.731  1.00 23.41 ? 76   ASP A CA  1 
ATOM   549  C C   . ASP A 1 77  ? 40.168 12.078 13.158  1.00 23.94 ? 76   ASP A C   1 
ATOM   550  O O   . ASP A 1 77  ? 39.322 11.893 14.044  1.00 23.98 ? 76   ASP A O   1 
ATOM   551  C CB  . ASP A 1 77  ? 40.620 10.275 11.458  1.00 23.52 ? 76   ASP A CB  1 
ATOM   552  C CG  . ASP A 1 77  ? 40.237 9.189  12.450  1.00 22.66 ? 76   ASP A CG  1 
ATOM   553  O OD1 . ASP A 1 77  ? 39.189 8.533  12.258  1.00 21.64 ? 76   ASP A OD1 1 
ATOM   554  O OD2 . ASP A 1 77  ? 40.969 9.034  13.446  1.00 22.98 ? 76   ASP A OD2 1 
ATOM   555  N N   . HIS A 1 78  ? 41.308 12.747 13.351  1.00 23.86 ? 77   HIS A N   1 
ATOM   556  C CA  . HIS A 1 78  ? 41.712 13.258 14.667  1.00 24.96 ? 77   HIS A CA  1 
ATOM   557  C C   . HIS A 1 78  ? 40.810 14.389 15.197  1.00 24.83 ? 77   HIS A C   1 
ATOM   558  O O   . HIS A 1 78  ? 40.916 14.785 16.360  1.00 25.08 ? 77   HIS A O   1 
ATOM   559  C CB  . HIS A 1 78  ? 43.198 13.684 14.653  1.00 25.58 ? 77   HIS A CB  1 
ATOM   560  C CG  . HIS A 1 78  ? 43.473 14.955 13.903  1.00 27.50 ? 77   HIS A CG  1 
ATOM   561  N ND1 . HIS A 1 78  ? 43.458 15.030 12.527  1.00 28.79 ? 77   HIS A ND1 1 
ATOM   562  C CD2 . HIS A 1 78  ? 43.768 16.202 14.342  1.00 27.49 ? 77   HIS A CD2 1 
ATOM   563  C CE1 . HIS A 1 78  ? 43.732 16.267 12.152  1.00 29.13 ? 77   HIS A CE1 1 
ATOM   564  N NE2 . HIS A 1 78  ? 43.921 16.998 13.234  1.00 30.05 ? 77   HIS A NE2 1 
ATOM   565  N N   . MET A 1 79  ? 39.937 14.889 14.318  1.00 24.94 ? 78   MET A N   1 
ATOM   566  C CA  . MET A 1 79  ? 38.998 15.968 14.618  1.00 24.59 ? 78   MET A CA  1 
ATOM   567  C C   . MET A 1 79  ? 37.538 15.535 14.640  1.00 24.81 ? 78   MET A C   1 
ATOM   568  O O   . MET A 1 79  ? 36.666 16.366 14.897  1.00 25.69 ? 78   MET A O   1 
ATOM   569  C CB  . MET A 1 79  ? 39.125 17.081 13.577  1.00 24.20 ? 78   MET A CB  1 
ATOM   570  C CG  . MET A 1 79  ? 40.351 17.954 13.692  1.00 24.33 ? 78   MET A CG  1 
ATOM   571  S SD  . MET A 1 79  ? 40.258 19.341 12.533  1.00 24.03 ? 78   MET A SD  1 
ATOM   572  C CE  . MET A 1 79  ? 38.910 20.261 13.248  1.00 24.63 ? 78   MET A CE  1 
ATOM   573  N N   . LYS A 1 80  ? 37.267 14.254 14.380  1.00 25.90 ? 79   LYS A N   1 
ATOM   574  C CA  . LYS A 1 80  ? 35.891 13.734 14.336  1.00 27.18 ? 79   LYS A CA  1 
ATOM   575  C C   . LYS A 1 80  ? 34.992 13.935 15.558  1.00 25.70 ? 79   LYS A C   1 
ATOM   576  O O   . LYS A 1 80  ? 33.775 14.009 15.410  1.00 24.66 ? 79   LYS A O   1 
ATOM   577  C CB  . LYS A 1 80  ? 35.862 12.270 13.897  1.00 29.35 ? 79   LYS A CB  1 
ATOM   578  C CG  . LYS A 1 80  ? 35.979 12.083 12.391  1.00 34.20 ? 79   LYS A CG  1 
ATOM   579  C CD  . LYS A 1 80  ? 35.695 10.640 11.987  1.00 36.52 ? 79   LYS A CD  1 
ATOM   580  C CE  . LYS A 1 80  ? 36.098 10.359 10.538  1.00 39.44 ? 79   LYS A CE  1 
ATOM   581  N NZ  . LYS A 1 80  ? 35.423 11.240 9.544   1.00 38.74 ? 79   LYS A NZ  1 
ATOM   582  N N   . GLN A 1 81  ? 35.594 14.093 16.739  1.00 25.57 ? 80   GLN A N   1 
ATOM   583  C CA  . GLN A 1 81  ? 34.842 14.319 17.981  1.00 26.73 ? 80   GLN A CA  1 
ATOM   584  C C   . GLN A 1 81  ? 34.357 15.775 18.086  1.00 26.56 ? 80   GLN A C   1 
ATOM   585  O O   . GLN A 1 81  ? 33.683 16.153 19.044  1.00 26.28 ? 80   GLN A O   1 
ATOM   586  C CB  . GLN A 1 81  ? 35.681 13.920 19.217  1.00 25.97 ? 80   GLN A CB  1 
ATOM   587  C CG  . GLN A 1 81  ? 36.876 14.831 19.568  1.00 29.54 ? 80   GLN A CG  1 
ATOM   588  C CD  . GLN A 1 81  ? 38.196 14.474 18.869  1.00 32.57 ? 80   GLN A CD  1 
ATOM   589  O OE1 . GLN A 1 81  ? 38.222 14.001 17.724  1.00 28.64 ? 80   GLN A OE1 1 
ATOM   590  N NE2 . GLN A 1 81  ? 39.308 14.736 19.561  1.00 32.39 ? 80   GLN A NE2 1 
ATOM   591  N N   . HIS A 1 82  ? 34.706 16.573 17.076  1.00 26.63 ? 81   HIS A N   1 
ATOM   592  C CA  . HIS A 1 82  ? 34.340 17.983 17.015  1.00 25.58 ? 81   HIS A CA  1 
ATOM   593  C C   . HIS A 1 82  ? 33.297 18.285 15.932  1.00 26.00 ? 81   HIS A C   1 
ATOM   594  O O   . HIS A 1 82  ? 33.034 19.454 15.632  1.00 26.57 ? 81   HIS A O   1 
ATOM   595  C CB  . HIS A 1 82  ? 35.591 18.846 16.784  1.00 27.01 ? 81   HIS A CB  1 
ATOM   596  C CG  . HIS A 1 82  ? 36.644 18.678 17.832  1.00 29.06 ? 81   HIS A CG  1 
ATOM   597  N ND1 . HIS A 1 82  ? 36.493 19.136 19.123  1.00 29.16 ? 81   HIS A ND1 1 
ATOM   598  C CD2 . HIS A 1 82  ? 37.851 18.068 17.787  1.00 30.18 ? 81   HIS A CD2 1 
ATOM   599  C CE1 . HIS A 1 82  ? 37.561 18.810 19.830  1.00 30.89 ? 81   HIS A CE1 1 
ATOM   600  N NE2 . HIS A 1 82  ? 38.400 18.162 19.043  1.00 32.63 ? 81   HIS A NE2 1 
ATOM   601  N N   . ASP A 1 83  ? 32.716 17.237 15.346  1.00 23.95 ? 82   ASP A N   1 
ATOM   602  C CA  . ASP A 1 83  ? 31.705 17.391 14.297  1.00 23.56 ? 82   ASP A CA  1 
ATOM   603  C C   . ASP A 1 83  ? 30.281 17.428 14.848  1.00 23.84 ? 82   ASP A C   1 
ATOM   604  O O   . ASP A 1 83  ? 29.596 16.402 14.901  1.00 23.36 ? 82   ASP A O   1 
ATOM   605  C CB  . ASP A 1 83  ? 31.840 16.281 13.244  1.00 22.56 ? 82   ASP A CB  1 
ATOM   606  C CG  . ASP A 1 83  ? 31.052 16.570 11.954  1.00 20.97 ? 82   ASP A CG  1 
ATOM   607  O OD1 . ASP A 1 83  ? 30.189 17.480 11.915  1.00 18.84 ? 82   ASP A OD1 1 
ATOM   608  O OD2 . ASP A 1 83  ? 31.318 15.879 10.952  1.00 21.58 ? 82   ASP A OD2 1 
ATOM   609  N N   . PHE A 1 84  ? 29.835 18.633 15.195  1.00 22.90 ? 83   PHE A N   1 
ATOM   610  C CA  . PHE A 1 84  ? 28.495 18.872 15.725  1.00 22.09 ? 83   PHE A CA  1 
ATOM   611  C C   . PHE A 1 84  ? 27.414 18.542 14.690  1.00 21.54 ? 83   PHE A C   1 
ATOM   612  O O   . PHE A 1 84  ? 26.417 17.889 15.003  1.00 20.29 ? 83   PHE A O   1 
ATOM   613  C CB  . PHE A 1 84  ? 28.381 20.345 16.180  1.00 20.50 ? 83   PHE A CB  1 
ATOM   614  C CG  . PHE A 1 84  ? 26.953 20.841 16.365  1.00 22.35 ? 83   PHE A CG  1 
ATOM   615  C CD1 . PHE A 1 84  ? 26.241 20.559 17.548  1.00 20.02 ? 83   PHE A CD1 1 
ATOM   616  C CD2 . PHE A 1 84  ? 26.302 21.555 15.327  1.00 18.95 ? 83   PHE A CD2 1 
ATOM   617  C CE1 . PHE A 1 84  ? 24.887 20.975 17.699  1.00 20.20 ? 83   PHE A CE1 1 
ATOM   618  C CE2 . PHE A 1 84  ? 24.960 21.972 15.456  1.00 21.15 ? 83   PHE A CE2 1 
ATOM   619  C CZ  . PHE A 1 84  ? 24.244 21.683 16.648  1.00 22.57 ? 83   PHE A CZ  1 
ATOM   620  N N   . PHE A 1 85  ? 27.608 19.085 13.491  1.00 21.13 ? 84   PHE A N   1 
ATOM   621  C CA  . PHE A 1 85  ? 26.696 18.956 12.358  1.00 21.92 ? 84   PHE A CA  1 
ATOM   622  C C   . PHE A 1 85  ? 26.143 17.566 12.066  1.00 22.71 ? 84   PHE A C   1 
ATOM   623  O O   . PHE A 1 85  ? 24.925 17.397 11.970  1.00 23.98 ? 84   PHE A O   1 
ATOM   624  C CB  . PHE A 1 85  ? 27.352 19.522 11.105  1.00 20.85 ? 84   PHE A CB  1 
ATOM   625  C CG  . PHE A 1 85  ? 27.939 20.890 11.277  1.00 20.81 ? 84   PHE A CG  1 
ATOM   626  C CD1 . PHE A 1 85  ? 27.108 22.022 11.385  1.00 21.73 ? 84   PHE A CD1 1 
ATOM   627  C CD2 . PHE A 1 85  ? 29.336 21.057 11.316  1.00 20.77 ? 84   PHE A CD2 1 
ATOM   628  C CE1 . PHE A 1 85  ? 27.663 23.323 11.530  1.00 22.33 ? 84   PHE A CE1 1 
ATOM   629  C CE2 . PHE A 1 85  ? 29.915 22.340 11.458  1.00 20.90 ? 84   PHE A CE2 1 
ATOM   630  C CZ  . PHE A 1 85  ? 29.078 23.482 11.564  1.00 22.65 ? 84   PHE A CZ  1 
ATOM   631  N N   . LYS A 1 86  ? 27.034 16.580 11.962  1.00 22.44 ? 85   LYS A N   1 
ATOM   632  C CA  . LYS A 1 86  ? 26.648 15.191 11.692  1.00 23.68 ? 85   LYS A CA  1 
ATOM   633  C C   . LYS A 1 86  ? 26.038 14.494 12.911  1.00 23.89 ? 85   LYS A C   1 
ATOM   634  O O   . LYS A 1 86  ? 25.160 13.649 12.764  1.00 24.84 ? 85   LYS A O   1 
ATOM   635  C CB  . LYS A 1 86  ? 27.848 14.367 11.209  1.00 22.73 ? 85   LYS A CB  1 
ATOM   636  C CG  . LYS A 1 86  ? 28.385 14.729 9.842   1.00 20.77 ? 85   LYS A CG  1 
ATOM   637  C CD  . LYS A 1 86  ? 29.477 13.741 9.431   1.00 19.54 ? 85   LYS A CD  1 
ATOM   638  C CE  . LYS A 1 86  ? 30.164 14.140 8.131   1.00 18.93 ? 85   LYS A CE  1 
ATOM   639  N NZ  . LYS A 1 86  ? 30.734 15.524 8.117   1.00 20.35 ? 85   LYS A NZ  1 
ATOM   640  N N   . SER A 1 87  ? 26.489 14.876 14.107  1.00 25.21 ? 86   SER A N   1 
ATOM   641  C CA  . SER A 1 87  ? 26.009 14.280 15.362  1.00 24.39 ? 86   SER A CA  1 
ATOM   642  C C   . SER A 1 87  ? 24.555 14.593 15.701  1.00 23.97 ? 86   SER A C   1 
ATOM   643  O O   . SER A 1 87  ? 23.928 13.875 16.480  1.00 24.21 ? 86   SER A O   1 
ATOM   644  C CB  . SER A 1 87  ? 26.900 14.705 16.529  1.00 23.36 ? 86   SER A CB  1 
ATOM   645  O OG  . SER A 1 87  ? 26.727 16.070 16.868  1.00 20.87 ? 86   SER A OG  1 
ATOM   646  N N   . ALA A 1 88  ? 24.045 15.683 15.130  1.00 24.00 ? 87   ALA A N   1 
ATOM   647  C CA  . ALA A 1 88  ? 22.669 16.126 15.347  1.00 23.75 ? 87   ALA A CA  1 
ATOM   648  C C   . ALA A 1 88  ? 21.681 15.433 14.413  1.00 23.70 ? 87   ALA A C   1 
ATOM   649  O O   . ALA A 1 88  ? 20.467 15.544 14.594  1.00 24.30 ? 87   ALA A O   1 
ATOM   650  C CB  . ALA A 1 88  ? 22.580 17.640 15.185  1.00 23.71 ? 87   ALA A CB  1 
ATOM   651  N N   . MET A 1 89  ? 22.214 14.692 13.441  1.00 23.43 ? 88   MET A N   1 
ATOM   652  C CA  . MET A 1 89  ? 21.416 13.972 12.449  1.00 23.72 ? 88   MET A CA  1 
ATOM   653  C C   . MET A 1 89  ? 20.938 12.606 12.978  1.00 24.60 ? 88   MET A C   1 
ATOM   654  O O   . MET A 1 89  ? 21.658 11.980 13.760  1.00 23.81 ? 88   MET A O   1 
ATOM   655  C CB  . MET A 1 89  ? 22.226 13.821 11.155  1.00 22.79 ? 88   MET A CB  1 
ATOM   656  C CG  . MET A 1 89  ? 22.583 15.144 10.505  1.00 23.03 ? 88   MET A CG  1 
ATOM   657  S SD  . MET A 1 89  ? 21.143 16.179 10.166  1.00 26.14 ? 88   MET A SD  1 
ATOM   658  C CE  . MET A 1 89  ? 21.942 17.717 9.867   1.00 22.71 ? 88   MET A CE  1 
ATOM   659  N N   . PRO A 1 90  ? 19.760 12.093 12.519  1.00 25.96 ? 89   PRO A N   1 
ATOM   660  C CA  . PRO A 1 90  ? 18.744 12.569 11.560  1.00 26.03 ? 89   PRO A CA  1 
ATOM   661  C C   . PRO A 1 90  ? 17.789 13.706 11.946  1.00 27.41 ? 89   PRO A C   1 
ATOM   662  O O   . PRO A 1 90  ? 17.273 14.402 11.060  1.00 26.35 ? 89   PRO A O   1 
ATOM   663  C CB  . PRO A 1 90  ? 17.976 11.290 11.229  1.00 27.35 ? 89   PRO A CB  1 
ATOM   664  C CG  . PRO A 1 90  ? 17.991 10.553 12.517  1.00 27.04 ? 89   PRO A CG  1 
ATOM   665  C CD  . PRO A 1 90  ? 19.423 10.719 12.962  1.00 26.79 ? 89   PRO A CD  1 
ATOM   666  N N   . GLU A 1 91  ? 17.610 13.927 13.252  1.00 26.74 ? 90   GLU A N   1 
ATOM   667  C CA  . GLU A 1 91  ? 16.698 14.962 13.768  1.00 28.01 ? 90   GLU A CA  1 
ATOM   668  C C   . GLU A 1 91  ? 17.079 16.381 13.362  1.00 26.09 ? 90   GLU A C   1 
ATOM   669  O O   . GLU A 1 91  ? 16.212 17.236 13.178  1.00 25.77 ? 90   GLU A O   1 
ATOM   670  C CB  . GLU A 1 91  ? 16.562 14.858 15.289  1.00 30.03 ? 90   GLU A CB  1 
ATOM   671  C CG  . GLU A 1 91  ? 15.996 13.525 15.778  1.00 34.87 ? 90   GLU A CG  1 
ATOM   672  C CD  . GLU A 1 91  ? 17.065 12.600 16.342  1.00 38.82 ? 90   GLU A CD  1 
ATOM   673  O OE1 . GLU A 1 91  ? 16.943 12.211 17.524  1.00 41.07 ? 90   GLU A OE1 1 
ATOM   674  O OE2 . GLU A 1 91  ? 18.028 12.268 15.615  1.00 39.22 ? 90   GLU A OE2 1 
ATOM   675  N N   . GLY A 1 92  ? 18.383 16.608 13.235  1.00 24.63 ? 91   GLY A N   1 
ATOM   676  C CA  . GLY A 1 92  ? 18.911 17.884 12.801  1.00 22.84 ? 91   GLY A CA  1 
ATOM   677  C C   . GLY A 1 92  ? 18.949 19.053 13.755  1.00 24.58 ? 91   GLY A C   1 
ATOM   678  O O   . GLY A 1 92  ? 18.894 18.901 14.982  1.00 23.27 ? 91   GLY A O   1 
ATOM   679  N N   . TYR A 1 93  ? 19.032 20.239 13.159  1.00 24.45 ? 92   TYR A N   1 
ATOM   680  C CA  . TYR A 1 93  ? 19.110 21.485 13.903  1.00 25.41 ? 92   TYR A CA  1 
ATOM   681  C C   . TYR A 1 93  ? 18.375 22.650 13.268  1.00 25.39 ? 92   TYR A C   1 
ATOM   682  O O   . TYR A 1 93  ? 18.057 22.628 12.078  1.00 25.43 ? 92   TYR A O   1 
ATOM   683  C CB  . TYR A 1 93  ? 20.584 21.875 14.162  1.00 27.51 ? 92   TYR A CB  1 
ATOM   684  C CG  . TYR A 1 93  ? 21.519 21.801 12.964  1.00 31.50 ? 92   TYR A CG  1 
ATOM   685  C CD1 . TYR A 1 93  ? 21.638 22.885 12.067  1.00 32.28 ? 92   TYR A CD1 1 
ATOM   686  C CD2 . TYR A 1 93  ? 22.298 20.648 12.719  1.00 31.96 ? 92   TYR A CD2 1 
ATOM   687  C CE1 . TYR A 1 93  ? 22.511 22.822 10.948  1.00 34.32 ? 92   TYR A CE1 1 
ATOM   688  C CE2 . TYR A 1 93  ? 23.180 20.579 11.598  1.00 34.77 ? 92   TYR A CE2 1 
ATOM   689  C CZ  . TYR A 1 93  ? 23.274 21.672 10.719  1.00 35.15 ? 92   TYR A CZ  1 
ATOM   690  O OH  . TYR A 1 93  ? 24.094 21.617 9.612   1.00 38.01 ? 92   TYR A OH  1 
ATOM   691  N N   . VAL A 1 94  ? 18.053 23.629 14.109  1.00 25.05 ? 93   VAL A N   1 
ATOM   692  C CA  . VAL A 1 94  ? 17.430 24.873 13.685  1.00 26.57 ? 93   VAL A CA  1 
ATOM   693  C C   . VAL A 1 94  ? 18.613 25.844 13.711  1.00 26.88 ? 93   VAL A C   1 
ATOM   694  O O   . VAL A 1 94  ? 19.370 25.895 14.685  1.00 25.58 ? 93   VAL A O   1 
ATOM   695  C CB  . VAL A 1 94  ? 16.312 25.354 14.662  1.00 27.86 ? 93   VAL A CB  1 
ATOM   696  C CG1 . VAL A 1 94  ? 15.963 26.828 14.421  1.00 28.60 ? 93   VAL A CG1 1 
ATOM   697  C CG2 . VAL A 1 94  ? 15.060 24.523 14.469  1.00 26.87 ? 93   VAL A CG2 1 
ATOM   698  N N   . GLN A 1 95  ? 18.799 26.560 12.613  1.00 26.10 ? 94   GLN A N   1 
ATOM   699  C CA  . GLN A 1 95  ? 19.884 27.519 12.524  1.00 26.45 ? 94   GLN A CA  1 
ATOM   700  C C   . GLN A 1 95  ? 19.394 28.902 12.148  1.00 26.07 ? 94   GLN A C   1 
ATOM   701  O O   . GLN A 1 95  ? 18.375 29.045 11.477  1.00 25.54 ? 94   GLN A O   1 
ATOM   702  C CB  . GLN A 1 95  ? 20.969 27.034 11.560  1.00 25.82 ? 94   GLN A CB  1 
ATOM   703  C CG  . GLN A 1 95  ? 20.445 26.507 10.239  1.00 28.39 ? 94   GLN A CG  1 
ATOM   704  C CD  . GLN A 1 95  ? 21.532 26.130 9.263   1.00 30.85 ? 94   GLN A CD  1 
ATOM   705  O OE1 . GLN A 1 95  ? 22.591 25.633 9.643   1.00 29.98 ? 94   GLN A OE1 1 
ATOM   706  N NE2 . GLN A 1 95  ? 21.268 26.359 7.982   1.00 31.87 ? 94   GLN A NE2 1 
ATOM   707  N N   . GLU A 1 96  ? 20.080 29.913 12.673  1.00 25.92 ? 95   GLU A N   1 
ATOM   708  C CA  . GLU A 1 96  ? 19.767 31.311 12.407  1.00 26.41 ? 95   GLU A CA  1 
ATOM   709  C C   . GLU A 1 96  ? 21.049 32.007 11.991  1.00 25.28 ? 95   GLU A C   1 
ATOM   710  O O   . GLU A 1 96  ? 22.129 31.645 12.452  1.00 25.44 ? 95   GLU A O   1 
ATOM   711  C CB  . GLU A 1 96  ? 19.197 31.998 13.657  1.00 30.67 ? 95   GLU A CB  1 
ATOM   712  C CG  . GLU A 1 96  ? 17.713 31.726 13.928  1.00 37.01 ? 95   GLU A CG  1 
ATOM   713  C CD  . GLU A 1 96  ? 17.217 32.290 15.259  1.00 40.29 ? 95   GLU A CD  1 
ATOM   714  O OE1 . GLU A 1 96  ? 17.903 33.144 15.867  1.00 41.94 ? 95   GLU A OE1 1 
ATOM   715  O OE2 . GLU A 1 96  ? 16.126 31.873 15.701  1.00 44.66 ? 95   GLU A OE2 1 
ATOM   716  N N   . ALA A 1 97  ? 20.929 32.964 11.076  1.00 24.27 ? 96   ALA A N   1 
ATOM   717  C CA  . ALA A 1 97  ? 22.076 33.727 10.612  1.00 24.36 ? 96   ALA A CA  1 
ATOM   718  C C   . ALA A 1 97  ? 21.740 35.127 10.170  1.00 24.79 ? 96   ALA A C   1 
ATOM   719  O O   . ALA A 1 97  ? 20.692 35.374 9.571   1.00 25.46 ? 96   ALA A O   1 
ATOM   720  C CB  . ALA A 1 97  ? 22.821 33.002 9.491   1.00 23.06 ? 96   ALA A CB  1 
ATOM   721  N N   . THR A 1 98  ? 22.656 36.036 10.483  1.00 23.83 ? 97   THR A N   1 
ATOM   722  C CA  . THR A 1 98  ? 22.542 37.428 10.108  1.00 24.45 ? 97   THR A CA  1 
ATOM   723  C C   . THR A 1 98  ? 23.725 37.731 9.209   1.00 23.00 ? 97   THR A C   1 
ATOM   724  O O   . THR A 1 98  ? 24.879 37.558 9.608   1.00 23.25 ? 97   THR A O   1 
ATOM   725  C CB  . THR A 1 98  ? 22.547 38.367 11.345  1.00 25.47 ? 97   THR A CB  1 
ATOM   726  O OG1 . THR A 1 98  ? 21.484 37.990 12.228  1.00 26.74 ? 97   THR A OG1 1 
ATOM   727  C CG2 . THR A 1 98  ? 22.336 39.826 10.920  1.00 26.22 ? 97   THR A CG2 1 
ATOM   728  N N   . ILE A 1 99  ? 23.423 38.081 7.961   1.00 23.58 ? 98   ILE A N   1 
ATOM   729  C CA  . ILE A 1 99  ? 24.449 38.433 6.985   1.00 22.53 ? 98   ILE A CA  1 
ATOM   730  C C   . ILE A 1 99  ? 24.338 39.948 6.838   1.00 23.83 ? 98   ILE A C   1 
ATOM   731  O O   . ILE A 1 99  ? 23.398 40.453 6.225   1.00 21.99 ? 98   ILE A O   1 
ATOM   732  C CB  . ILE A 1 99  ? 24.266 37.722 5.596   1.00 20.91 ? 98   ILE A CB  1 
ATOM   733  C CG1 . ILE A 1 99  ? 24.272 36.193 5.743   1.00 22.86 ? 98   ILE A CG1 1 
ATOM   734  C CG2 . ILE A 1 99  ? 25.427 38.062 4.671   1.00 20.62 ? 98   ILE A CG2 1 
ATOM   735  C CD1 . ILE A 1 99  ? 22.911 35.567 6.008   1.00 22.75 ? 98   ILE A CD1 1 
ATOM   736  N N   . SER A 1 100 ? 25.289 40.657 7.439   1.00 24.40 ? 99   SER A N   1 
ATOM   737  C CA  . SER A 1 100 ? 25.313 42.117 7.410   1.00 23.60 ? 99   SER A CA  1 
ATOM   738  C C   . SER A 1 100 ? 26.273 42.658 6.367   1.00 23.31 ? 99   SER A C   1 
ATOM   739  O O   . SER A 1 100 ? 27.463 42.376 6.418   1.00 23.11 ? 99   SER A O   1 
ATOM   740  C CB  . SER A 1 100 ? 25.691 42.657 8.785   1.00 23.73 ? 99   SER A CB  1 
ATOM   741  O OG  . SER A 1 100 ? 24.929 42.043 9.811   1.00 24.20 ? 99   SER A OG  1 
ATOM   742  N N   . PHE A 1 101 ? 25.752 43.449 5.434   1.00 23.00 ? 100  PHE A N   1 
ATOM   743  C CA  . PHE A 1 101 ? 26.575 44.036 4.376   1.00 24.82 ? 100  PHE A CA  1 
ATOM   744  C C   . PHE A 1 101 ? 27.002 45.435 4.788   1.00 26.77 ? 100  PHE A C   1 
ATOM   745  O O   . PHE A 1 101 ? 26.154 46.268 5.112   1.00 26.77 ? 100  PHE A O   1 
ATOM   746  C CB  . PHE A 1 101 ? 25.812 44.079 3.053   1.00 23.63 ? 100  PHE A CB  1 
ATOM   747  C CG  . PHE A 1 101 ? 25.450 42.723 2.521   1.00 23.62 ? 100  PHE A CG  1 
ATOM   748  C CD1 . PHE A 1 101 ? 26.276 42.083 1.580   1.00 21.48 ? 100  PHE A CD1 1 
ATOM   749  C CD2 . PHE A 1 101 ? 24.294 42.064 2.981   1.00 22.61 ? 100  PHE A CD2 1 
ATOM   750  C CE1 . PHE A 1 101 ? 25.957 40.785 1.096   1.00 20.39 ? 100  PHE A CE1 1 
ATOM   751  C CE2 . PHE A 1 101 ? 23.956 40.773 2.512   1.00 22.91 ? 100  PHE A CE2 1 
ATOM   752  C CZ  . PHE A 1 101 ? 24.793 40.130 1.566   1.00 20.08 ? 100  PHE A CZ  1 
ATOM   753  N N   . LYS A 1 102 ? 28.316 45.667 4.798   1.00 27.96 ? 101  LYS A N   1 
ATOM   754  C CA  . LYS A 1 102 ? 28.902 46.955 5.182   1.00 29.09 ? 101  LYS A CA  1 
ATOM   755  C C   . LYS A 1 102 ? 28.400 48.093 4.297   1.00 30.56 ? 101  LYS A C   1 
ATOM   756  O O   . LYS A 1 102 ? 28.363 47.969 3.061   1.00 27.89 ? 101  LYS A O   1 
ATOM   757  C CB  . LYS A 1 102 ? 30.433 46.888 5.145   1.00 30.00 ? 101  LYS A CB  1 
ATOM   758  C CG  . LYS A 1 102 ? 31.132 48.075 5.821   1.00 33.31 ? 101  LYS A CG  1 
ATOM   759  C CD  . LYS A 1 102 ? 32.641 47.968 5.742   1.00 34.65 ? 101  LYS A CD  1 
ATOM   760  C CE  . LYS A 1 102 ? 33.317 49.131 6.455   1.00 36.59 ? 101  LYS A CE  1 
ATOM   761  N NZ  . LYS A 1 102 ? 33.085 50.445 5.785   1.00 41.05 ? 101  LYS A NZ  1 
ATOM   762  N N   . ASP A 1 103 ? 27.960 49.169 4.965   1.00 31.21 ? 102  ASP A N   1 
ATOM   763  C CA  . ASP A 1 103 ? 27.413 50.393 4.355   1.00 31.55 ? 102  ASP A CA  1 
ATOM   764  C C   . ASP A 1 103 ? 26.128 50.102 3.559   1.00 30.71 ? 102  ASP A C   1 
ATOM   765  O O   . ASP A 1 103 ? 25.739 50.872 2.682   1.00 31.61 ? 102  ASP A O   1 
ATOM   766  C CB  . ASP A 1 103 ? 28.463 51.121 3.475   1.00 33.62 ? 102  ASP A CB  1 
ATOM   767  C CG  . ASP A 1 103 ? 29.772 51.420 4.218   1.00 37.20 ? 102  ASP A CG  1 
ATOM   768  O OD1 . ASP A 1 103 ? 29.734 51.840 5.396   1.00 38.29 ? 102  ASP A OD1 1 
ATOM   769  O OD2 . ASP A 1 103 ? 30.850 51.219 3.611   1.00 39.68 ? 102  ASP A OD2 1 
ATOM   770  N N   . ASP A 1 104 ? 25.485 48.977 3.883   1.00 29.73 ? 103  ASP A N   1 
ATOM   771  C CA  . ASP A 1 104 ? 24.251 48.537 3.230   1.00 27.30 ? 103  ASP A CA  1 
ATOM   772  C C   . ASP A 1 104 ? 23.357 47.762 4.220   1.00 27.29 ? 103  ASP A C   1 
ATOM   773  O O   . ASP A 1 104 ? 23.561 47.832 5.440   1.00 27.05 ? 103  ASP A O   1 
ATOM   774  C CB  . ASP A 1 104 ? 24.587 47.686 1.991   1.00 27.60 ? 103  ASP A CB  1 
ATOM   775  C CG  . ASP A 1 104 ? 23.682 47.990 0.801   1.00 26.97 ? 103  ASP A CG  1 
ATOM   776  O OD1 . ASP A 1 104 ? 22.461 48.124 0.994   1.00 28.00 ? 103  ASP A OD1 1 
ATOM   777  O OD2 . ASP A 1 104 ? 24.194 48.100 -0.332  1.00 27.80 ? 103  ASP A OD2 1 
ATOM   778  N N   . GLY A 1 105 ? 22.394 47.004 3.695   1.00 25.25 ? 104  GLY A N   1 
ATOM   779  C CA  . GLY A 1 105 ? 21.471 46.262 4.542   1.00 26.27 ? 104  GLY A CA  1 
ATOM   780  C C   . GLY A 1 105 ? 21.902 44.917 5.089   1.00 25.85 ? 104  GLY A C   1 
ATOM   781  O O   . GLY A 1 105 ? 23.077 44.554 5.031   1.00 26.71 ? 104  GLY A O   1 
ATOM   782  N N   . ASN A 1 106 ? 20.931 44.169 5.606   1.00 24.66 ? 105  ASN A N   1 
ATOM   783  C CA  . ASN A 1 106 ? 21.204 42.857 6.182   1.00 26.36 ? 105  ASN A CA  1 
ATOM   784  C C   . ASN A 1 106 ? 20.152 41.794 5.891   1.00 24.56 ? 105  ASN A C   1 
ATOM   785  O O   . ASN A 1 106 ? 18.977 42.112 5.681   1.00 24.27 ? 105  ASN A O   1 
ATOM   786  C CB  . ASN A 1 106 ? 21.436 42.969 7.706   1.00 27.92 ? 105  ASN A CB  1 
ATOM   787  C CG  . ASN A 1 106 ? 20.219 43.485 8.464   1.00 30.62 ? 105  ASN A CG  1 
ATOM   788  O OD1 . ASN A 1 106 ? 19.382 42.704 8.927   1.00 31.52 ? 105  ASN A OD1 1 
ATOM   789  N ND2 . ASN A 1 106 ? 20.124 44.802 8.605   1.00 34.26 ? 105  ASN A ND2 1 
ATOM   790  N N   . TYR A 1 107 ? 20.602 40.538 5.830   1.00 23.84 ? 106  TYR A N   1 
ATOM   791  C CA  . TYR A 1 107 ? 19.717 39.394 5.625   1.00 21.55 ? 106  TYR A CA  1 
ATOM   792  C C   . TYR A 1 107 ? 19.547 38.705 6.974   1.00 21.90 ? 106  TYR A C   1 
ATOM   793  O O   . TYR A 1 107 ? 20.540 38.380 7.626   1.00 20.71 ? 106  TYR A O   1 
ATOM   794  C CB  . TYR A 1 107 ? 20.324 38.335 4.693   1.00 21.71 ? 106  TYR A CB  1 
ATOM   795  C CG  . TYR A 1 107 ? 20.502 38.655 3.230   1.00 20.37 ? 106  TYR A CG  1 
ATOM   796  C CD1 . TYR A 1 107 ? 19.710 39.618 2.571   1.00 20.62 ? 106  TYR A CD1 1 
ATOM   797  C CD2 . TYR A 1 107 ? 21.466 37.958 2.475   1.00 21.32 ? 106  TYR A CD2 1 
ATOM   798  C CE1 . TYR A 1 107 ? 19.883 39.883 1.186   1.00 21.19 ? 106  TYR A CE1 1 
ATOM   799  C CE2 . TYR A 1 107 ? 21.645 38.212 1.100   1.00 19.36 ? 106  TYR A CE2 1 
ATOM   800  C CZ  . TYR A 1 107 ? 20.858 39.176 0.469   1.00 18.15 ? 106  TYR A CZ  1 
ATOM   801  O OH  . TYR A 1 107 ? 21.078 39.460 -0.848  1.00 19.44 ? 106  TYR A OH  1 
ATOM   802  N N   . LYS A 1 108 ? 18.297 38.486 7.379   1.00 23.10 ? 107  LYS A N   1 
ATOM   803  C CA  . LYS A 1 108 ? 17.982 37.777 8.620   1.00 25.85 ? 107  LYS A CA  1 
ATOM   804  C C   . LYS A 1 108 ? 17.445 36.434 8.149   1.00 24.60 ? 107  LYS A C   1 
ATOM   805  O O   . LYS A 1 108 ? 16.421 36.381 7.464   1.00 24.86 ? 107  LYS A O   1 
ATOM   806  C CB  . LYS A 1 108 ? 16.922 38.520 9.440   1.00 29.66 ? 107  LYS A CB  1 
ATOM   807  C CG  . LYS A 1 108 ? 17.456 39.678 10.275  1.00 35.10 ? 107  LYS A CG  1 
ATOM   808  C CD  . LYS A 1 108 ? 16.312 40.378 11.006  1.00 39.45 ? 107  LYS A CD  1 
ATOM   809  C CE  . LYS A 1 108 ? 16.772 41.658 11.698  1.00 42.15 ? 107  LYS A CE  1 
ATOM   810  N NZ  . LYS A 1 108 ? 15.622 42.421 12.279  1.00 42.18 ? 107  LYS A NZ  1 
ATOM   811  N N   . THR A 1 109 ? 18.181 35.361 8.439   1.00 24.54 ? 108  THR A N   1 
ATOM   812  C CA  . THR A 1 109 ? 17.780 34.025 8.000   1.00 22.75 ? 108  THR A CA  1 
ATOM   813  C C   . THR A 1 109 ? 17.524 33.030 9.122   1.00 23.06 ? 108  THR A C   1 
ATOM   814  O O   . THR A 1 109 ? 18.065 33.158 10.218  1.00 22.89 ? 108  THR A O   1 
ATOM   815  C CB  . THR A 1 109 ? 18.819 33.389 7.008   1.00 24.13 ? 108  THR A CB  1 
ATOM   816  O OG1 . THR A 1 109 ? 20.015 33.026 7.707   1.00 25.31 ? 108  THR A OG1 1 
ATOM   817  C CG2 . THR A 1 109 ? 19.191 34.353 5.886   1.00 22.49 ? 108  THR A CG2 1 
ATOM   818  N N   . ARG A 1 110 ? 16.673 32.052 8.826   1.00 22.48 ? 109  ARG A N   1 
ATOM   819  C CA  . ARG A 1 110 ? 16.331 30.970 9.743   1.00 25.17 ? 109  ARG A CA  1 
ATOM   820  C C   . ARG A 1 110 ? 16.157 29.738 8.871   1.00 25.15 ? 109  ARG A C   1 
ATOM   821  O O   . ARG A 1 110 ? 15.548 29.810 7.800   1.00 25.84 ? 109  ARG A O   1 
ATOM   822  C CB  . ARG A 1 110 ? 15.040 31.247 10.524  1.00 26.27 ? 109  ARG A CB  1 
ATOM   823  C CG  . ARG A 1 110 ? 14.762 30.218 11.627  1.00 28.06 ? 109  ARG A CG  1 
ATOM   824  C CD  . ARG A 1 110 ? 13.396 30.413 12.276  1.00 31.54 ? 109  ARG A CD  1 
ATOM   825  N NE  . ARG A 1 110 ? 13.142 29.435 13.338  1.00 33.96 ? 109  ARG A NE  1 
ATOM   826  C CZ  . ARG A 1 110 ? 12.635 28.216 13.154  1.00 34.18 ? 109  ARG A CZ  1 
ATOM   827  N NH1 . ARG A 1 110 ? 12.314 27.792 11.938  1.00 35.63 ? 109  ARG A NH1 1 
ATOM   828  N NH2 . ARG A 1 110 ? 12.450 27.414 14.193  1.00 33.21 ? 109  ARG A NH2 1 
ATOM   829  N N   . ALA A 1 111 ? 16.717 28.620 9.319   1.00 25.08 ? 110  ALA A N   1 
ATOM   830  C CA  . ALA A 1 111 ? 16.623 27.372 8.579   1.00 25.64 ? 110  ALA A CA  1 
ATOM   831  C C   . ALA A 1 111 ? 16.440 26.144 9.451   1.00 26.39 ? 110  ALA A C   1 
ATOM   832  O O   . ALA A 1 111 ? 16.886 26.103 10.600  1.00 26.50 ? 110  ALA A O   1 
ATOM   833  C CB  . ALA A 1 111 ? 17.838 27.195 7.674   1.00 24.34 ? 110  ALA A CB  1 
ATOM   834  N N   . GLU A 1 112 ? 15.763 25.155 8.878   1.00 26.93 ? 111  GLU A N   1 
ATOM   835  C CA  . GLU A 1 112 ? 15.502 23.878 9.517   1.00 27.39 ? 111  GLU A CA  1 
ATOM   836  C C   . GLU A 1 112 ? 16.249 22.853 8.664   1.00 26.09 ? 111  GLU A C   1 
ATOM   837  O O   . GLU A 1 112 ? 15.961 22.682 7.476   1.00 24.80 ? 111  GLU A O   1 
ATOM   838  C CB  . GLU A 1 112 ? 13.999 23.600 9.527   1.00 32.21 ? 111  GLU A CB  1 
ATOM   839  C CG  . GLU A 1 112 ? 13.569 22.424 10.377  1.00 37.40 ? 111  GLU A CG  1 
ATOM   840  C CD  . GLU A 1 112 ? 12.076 22.197 10.303  1.00 41.28 ? 111  GLU A CD  1 
ATOM   841  O OE1 . GLU A 1 112 ? 11.658 21.244 9.611   1.00 42.37 ? 111  GLU A OE1 1 
ATOM   842  O OE2 . GLU A 1 112 ? 11.323 22.987 10.918  1.00 41.83 ? 111  GLU A OE2 1 
ATOM   843  N N   . VAL A 1 113 ? 17.278 22.258 9.261   1.00 24.93 ? 112  VAL A N   1 
ATOM   844  C CA  . VAL A 1 113 ? 18.123 21.267 8.598   1.00 23.79 ? 112  VAL A CA  1 
ATOM   845  C C   . VAL A 1 113 ? 17.927 19.917 9.268   1.00 24.88 ? 112  VAL A C   1 
ATOM   846  O O   . VAL A 1 113 ? 18.181 19.777 10.467  1.00 24.06 ? 112  VAL A O   1 
ATOM   847  C CB  . VAL A 1 113 ? 19.626 21.670 8.685   1.00 22.93 ? 112  VAL A CB  1 
ATOM   848  C CG1 . VAL A 1 113 ? 20.504 20.689 7.914   1.00 24.40 ? 112  VAL A CG1 1 
ATOM   849  C CG2 . VAL A 1 113 ? 19.829 23.073 8.156   1.00 25.18 ? 112  VAL A CG2 1 
ATOM   850  N N   . LYS A 1 114 ? 17.480 18.935 8.485   1.00 24.89 ? 113  LYS A N   1 
ATOM   851  C CA  . LYS A 1 114 ? 17.230 17.578 8.970   1.00 27.36 ? 113  LYS A CA  1 
ATOM   852  C C   . LYS A 1 114 ? 17.182 16.577 7.824   1.00 28.80 ? 113  LYS A C   1 
ATOM   853  O O   . LYS A 1 114 ? 17.255 16.951 6.651   1.00 27.72 ? 113  LYS A O   1 
ATOM   854  C CB  . LYS A 1 114 ? 15.901 17.501 9.761   1.00 28.21 ? 113  LYS A CB  1 
ATOM   855  C CG  . LYS A 1 114 ? 14.631 17.890 8.991   1.00 30.73 ? 113  LYS A CG  1 
ATOM   856  C CD  . LYS A 1 114 ? 13.373 17.516 9.763   1.00 35.12 ? 113  LYS A CD  1 
ATOM   857  C CE  . LYS A 1 114 ? 12.119 17.937 9.010   1.00 39.44 ? 113  LYS A CE  1 
ATOM   858  N NZ  . LYS A 1 114 ? 10.859 17.397 9.610   1.00 41.41 ? 113  LYS A NZ  1 
ATOM   859  N N   . PHE A 1 115 ? 17.060 15.302 8.185   1.00 30.30 ? 114  PHE A N   1 
ATOM   860  C CA  . PHE A 1 115 ? 16.940 14.227 7.212   1.00 32.45 ? 114  PHE A CA  1 
ATOM   861  C C   . PHE A 1 115 ? 15.473 13.897 6.983   1.00 34.27 ? 114  PHE A C   1 
ATOM   862  O O   . PHE A 1 115 ? 14.699 13.772 7.938   1.00 36.02 ? 114  PHE A O   1 
ATOM   863  C CB  . PHE A 1 115 ? 17.648 12.966 7.691   1.00 31.48 ? 114  PHE A CB  1 
ATOM   864  C CG  . PHE A 1 115 ? 19.014 12.776 7.112   1.00 31.11 ? 114  PHE A CG  1 
ATOM   865  C CD1 . PHE A 1 115 ? 19.196 12.002 5.951   1.00 30.67 ? 114  PHE A CD1 1 
ATOM   866  C CD2 . PHE A 1 115 ? 20.136 13.342 7.736   1.00 31.36 ? 114  PHE A CD2 1 
ATOM   867  C CE1 . PHE A 1 115 ? 20.491 11.786 5.409   1.00 31.88 ? 114  PHE A CE1 1 
ATOM   868  C CE2 . PHE A 1 115 ? 21.437 13.138 7.211   1.00 31.35 ? 114  PHE A CE2 1 
ATOM   869  C CZ  . PHE A 1 115 ? 21.617 12.357 6.043   1.00 30.46 ? 114  PHE A CZ  1 
ATOM   870  N N   . GLU A 1 116 ? 15.084 13.855 5.712   1.00 34.85 ? 115  GLU A N   1 
ATOM   871  C CA  . GLU A 1 116 ? 13.730 13.488 5.311   1.00 35.84 ? 115  GLU A CA  1 
ATOM   872  C C   . GLU A 1 116 ? 13.938 12.251 4.448   1.00 35.39 ? 115  GLU A C   1 
ATOM   873  O O   . GLU A 1 116 ? 14.145 12.339 3.231   1.00 35.11 ? 115  GLU A O   1 
ATOM   874  C CB  . GLU A 1 116 ? 13.027 14.613 4.532   1.00 37.07 ? 115  GLU A CB  1 
ATOM   875  C CG  . GLU A 1 116 ? 12.584 15.819 5.371   1.00 39.25 ? 115  GLU A CG  1 
ATOM   876  C CD  . GLU A 1 116 ? 11.280 15.616 6.138   1.00 39.83 ? 115  GLU A CD  1 
ATOM   877  O OE1 . GLU A 1 116 ? 10.456 16.552 6.129   1.00 44.69 ? 115  GLU A OE1 1 
ATOM   878  O OE2 . GLU A 1 116 ? 11.078 14.559 6.774   1.00 39.26 ? 115  GLU A OE2 1 
ATOM   879  N N   . GLY A 1 117 ? 13.933 11.100 5.120   1.00 35.11 ? 116  GLY A N   1 
ATOM   880  C CA  . GLY A 1 117 ? 14.174 9.826  4.466   1.00 33.83 ? 116  GLY A CA  1 
ATOM   881  C C   . GLY A 1 117 ? 15.684 9.673  4.434   1.00 34.49 ? 116  GLY A C   1 
ATOM   882  O O   . GLY A 1 117 ? 16.343 9.809  5.473   1.00 35.45 ? 116  GLY A O   1 
ATOM   883  N N   . ASP A 1 118 ? 16.233 9.449  3.243   1.00 31.97 ? 117  ASP A N   1 
ATOM   884  C CA  . ASP A 1 118 ? 17.680 9.315  3.062   1.00 32.28 ? 117  ASP A CA  1 
ATOM   885  C C   . ASP A 1 118 ? 18.216 10.584 2.379   1.00 30.88 ? 117  ASP A C   1 
ATOM   886  O O   . ASP A 1 118 ? 19.300 10.583 1.787   1.00 30.47 ? 117  ASP A O   1 
ATOM   887  C CB  . ASP A 1 118 ? 18.004 8.071  2.214   1.00 34.46 ? 117  ASP A CB  1 
ATOM   888  C CG  . ASP A 1 118 ? 17.683 6.758  2.929   1.00 37.84 ? 117  ASP A CG  1 
ATOM   889  O OD1 . ASP A 1 118 ? 17.855 6.671  4.167   1.00 35.56 ? 117  ASP A OD1 1 
ATOM   890  O OD2 . ASP A 1 118 ? 17.269 5.807  2.235   1.00 39.65 ? 117  ASP A OD2 1 
ATOM   891  N N   . THR A 1 119 ? 17.454 11.669 2.510   1.00 29.01 ? 118  THR A N   1 
ATOM   892  C CA  . THR A 1 119 ? 17.793 12.954 1.905   1.00 27.99 ? 118  THR A CA  1 
ATOM   893  C C   . THR A 1 119 ? 17.990 14.050 2.955   1.00 27.31 ? 118  THR A C   1 
ATOM   894  O O   . THR A 1 119 ? 17.200 14.168 3.891   1.00 27.22 ? 118  THR A O   1 
ATOM   895  C CB  . THR A 1 119 ? 16.677 13.390 0.907   1.00 26.63 ? 118  THR A CB  1 
ATOM   896  O OG1 . THR A 1 119 ? 16.458 12.344 -0.050  1.00 29.06 ? 118  THR A OG1 1 
ATOM   897  C CG2 . THR A 1 119 ? 17.067 14.656 0.148   1.00 27.81 ? 118  THR A CG2 1 
ATOM   898  N N   . LEU A 1 120 ? 19.046 14.849 2.785   1.00 24.66 ? 119  LEU A N   1 
ATOM   899  C CA  . LEU A 1 120 ? 19.321 15.963 3.689   1.00 21.57 ? 119  LEU A CA  1 
ATOM   900  C C   . LEU A 1 120 ? 18.587 17.173 3.120   1.00 21.28 ? 119  LEU A C   1 
ATOM   901  O O   . LEU A 1 120 ? 18.844 17.599 1.990   1.00 19.26 ? 119  LEU A O   1 
ATOM   902  C CB  . LEU A 1 120 ? 20.834 16.227 3.801   1.00 20.56 ? 119  LEU A CB  1 
ATOM   903  C CG  . LEU A 1 120 ? 21.420 17.183 4.860   1.00 18.47 ? 119  LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 120 ? 21.350 18.652 4.433   1.00 18.01 ? 119  LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 120 ? 20.791 16.963 6.223   1.00 21.14 ? 119  LEU A CD2 1 
ATOM   906  N N   . VAL A 1 121 ? 17.699 17.733 3.937   1.00 22.45 ? 120  VAL A N   1 
ATOM   907  C CA  . VAL A 1 121 ? 16.870 18.872 3.550   1.00 23.64 ? 120  VAL A CA  1 
ATOM   908  C C   . VAL A 1 121 ? 17.185 20.154 4.323   1.00 23.81 ? 120  VAL A C   1 
ATOM   909  O O   . VAL A 1 121 ? 17.516 20.107 5.504   1.00 23.76 ? 120  VAL A O   1 
ATOM   910  C CB  . VAL A 1 121 ? 15.347 18.495 3.699   1.00 24.50 ? 120  VAL A CB  1 
ATOM   911  C CG1 . VAL A 1 121 ? 14.416 19.684 3.421   1.00 22.48 ? 120  VAL A CG1 1 
ATOM   912  C CG2 . VAL A 1 121 ? 15.003 17.357 2.752   1.00 20.81 ? 120  VAL A CG2 1 
ATOM   913  N N   . ASN A 1 122 ? 17.090 21.282 3.615   1.00 23.17 ? 121  ASN A N   1 
ATOM   914  C CA  . ASN A 1 122 ? 17.286 22.629 4.156   1.00 26.22 ? 121  ASN A CA  1 
ATOM   915  C C   . ASN A 1 122 ? 16.037 23.435 3.797   1.00 25.94 ? 121  ASN A C   1 
ATOM   916  O O   . ASN A 1 122 ? 15.751 23.632 2.612   1.00 28.28 ? 121  ASN A O   1 
ATOM   917  C CB  . ASN A 1 122 ? 18.475 23.348 3.497   1.00 28.60 ? 121  ASN A CB  1 
ATOM   918  C CG  . ASN A 1 122 ? 19.829 22.863 3.970   1.00 29.73 ? 121  ASN A CG  1 
ATOM   919  O OD1 . ASN A 1 122 ? 20.847 23.372 3.507   1.00 33.97 ? 121  ASN A OD1 1 
ATOM   920  N ND2 . ASN A 1 122 ? 19.862 21.903 4.893   1.00 31.39 ? 121  ASN A ND2 1 
ATOM   921  N N   . ARG A 1 123 ? 15.259 23.835 4.802   1.00 25.32 ? 122  ARG A N   1 
ATOM   922  C CA  . ARG A 1 123 ? 14.067 24.662 4.582   1.00 26.20 ? 122  ARG A CA  1 
ATOM   923  C C   . ARG A 1 123 ? 14.475 25.999 5.167   1.00 24.94 ? 122  ARG A C   1 
ATOM   924  O O   . ARG A 1 123 ? 14.670 26.110 6.378   1.00 21.75 ? 122  ARG A O   1 
ATOM   925  C CB  . ARG A 1 123 ? 12.836 24.108 5.308   1.00 29.82 ? 122  ARG A CB  1 
ATOM   926  C CG  . ARG A 1 123 ? 12.296 22.807 4.751   1.00 33.23 ? 122  ARG A CG  1 
ATOM   927  C CD  . ARG A 1 123 ? 10.834 22.602 5.132   1.00 38.11 ? 122  ARG A CD  1 
ATOM   928  N NE  . ARG A 1 123 ? 10.606 22.632 6.577   1.00 44.97 ? 122  ARG A NE  1 
ATOM   929  C CZ  . ARG A 1 123 ? 9.420  22.827 7.151   1.00 47.46 ? 122  ARG A CZ  1 
ATOM   930  N NH1 . ARG A 1 123 ? 8.330  23.007 6.410   1.00 47.91 ? 122  ARG A NH1 1 
ATOM   931  N NH2 . ARG A 1 123 ? 9.327  22.868 8.476   1.00 48.41 ? 122  ARG A NH2 1 
ATOM   932  N N   . ILE A 1 124 ? 14.666 26.987 4.291   1.00 21.86 ? 123  ILE A N   1 
ATOM   933  C CA  . ILE A 1 124 ? 15.139 28.312 4.690   1.00 22.20 ? 123  ILE A CA  1 
ATOM   934  C C   . ILE A 1 124 ? 14.171 29.474 4.426   1.00 23.09 ? 123  ILE A C   1 
ATOM   935  O O   . ILE A 1 124 ? 13.409 29.468 3.463   1.00 22.67 ? 123  ILE A O   1 
ATOM   936  C CB  . ILE A 1 124 ? 16.515 28.655 3.981   1.00 21.11 ? 123  ILE A CB  1 
ATOM   937  C CG1 . ILE A 1 124 ? 17.418 27.414 3.861   1.00 18.79 ? 123  ILE A CG1 1 
ATOM   938  C CG2 . ILE A 1 124 ? 17.263 29.760 4.745   1.00 20.42 ? 123  ILE A CG2 1 
ATOM   939  C CD1 . ILE A 1 124 ? 18.537 27.552 2.862   1.00 21.58 ? 123  ILE A CD1 1 
ATOM   940  N N   . GLU A 1 125 ? 14.210 30.457 5.322   1.00 24.15 ? 124  GLU A N   1 
ATOM   941  C CA  . GLU A 1 125 ? 13.423 31.686 5.222   1.00 27.19 ? 124  GLU A CA  1 
ATOM   942  C C   . GLU A 1 125 ? 14.417 32.831 5.333   1.00 26.52 ? 124  GLU A C   1 
ATOM   943  O O   . GLU A 1 125 ? 15.300 32.796 6.190   1.00 25.95 ? 124  GLU A O   1 
ATOM   944  C CB  . GLU A 1 125 ? 12.385 31.801 6.347   1.00 29.79 ? 124  GLU A CB  1 
ATOM   945  C CG  . GLU A 1 125 ? 11.125 30.982 6.136   1.00 33.99 ? 124  GLU A CG  1 
ATOM   946  C CD  . GLU A 1 125 ? 10.051 31.297 7.160   1.00 38.00 ? 124  GLU A CD  1 
ATOM   947  O OE1 . GLU A 1 125 ? 8.993  31.833 6.760   1.00 41.88 ? 124  GLU A OE1 1 
ATOM   948  O OE2 . GLU A 1 125 ? 10.264 31.014 8.362   1.00 38.85 ? 124  GLU A OE2 1 
ATOM   949  N N   . LEU A 1 126 ? 14.293 33.820 4.450   1.00 27.64 ? 125  LEU A N   1 
ATOM   950  C CA  . LEU A 1 126 ? 15.185 34.987 4.449   1.00 27.55 ? 125  LEU A CA  1 
ATOM   951  C C   . LEU A 1 126 ? 14.400 36.298 4.402   1.00 27.79 ? 125  LEU A C   1 
ATOM   952  O O   . LEU A 1 126 ? 13.442 36.424 3.640   1.00 27.15 ? 125  LEU A O   1 
ATOM   953  C CB  . LEU A 1 126 ? 16.175 34.912 3.264   1.00 25.69 ? 125  LEU A CB  1 
ATOM   954  C CG  . LEU A 1 126 ? 17.173 36.040 2.930   1.00 26.60 ? 125  LEU A CG  1 
ATOM   955  C CD1 . LEU A 1 126 ? 18.448 35.450 2.399   1.00 25.14 ? 125  LEU A CD1 1 
ATOM   956  C CD2 . LEU A 1 126 ? 16.615 37.005 1.912   1.00 24.29 ? 125  LEU A CD2 1 
ATOM   957  N N   . LYS A 1 127 ? 14.848 37.272 5.194   1.00 28.08 ? 126  LYS A N   1 
ATOM   958  C CA  . LYS A 1 127 ? 14.245 38.600 5.236   1.00 29.83 ? 126  LYS A CA  1 
ATOM   959  C C   . LYS A 1 127 ? 15.382 39.618 5.079   1.00 29.06 ? 126  LYS A C   1 
ATOM   960  O O   . LYS A 1 127 ? 16.251 39.727 5.948   1.00 28.00 ? 126  LYS A O   1 
ATOM   961  C CB  . LYS A 1 127 ? 13.480 38.818 6.551   1.00 34.00 ? 126  LYS A CB  1 
ATOM   962  C CG  . LYS A 1 127 ? 12.404 39.911 6.472   1.00 39.60 ? 126  LYS A CG  1 
ATOM   963  C CD  . LYS A 1 127 ? 11.640 40.097 7.783   1.00 44.51 ? 126  LYS A CD  1 
ATOM   964  C CE  . LYS A 1 127 ? 12.470 40.850 8.824   1.00 47.28 ? 126  LYS A CE  1 
ATOM   965  N NZ  . LYS A 1 127 ? 11.770 40.984 10.133  1.00 48.65 ? 126  LYS A NZ  1 
ATOM   966  N N   . GLY A 1 128 ? 15.401 40.297 3.929   1.00 28.02 ? 127  GLY A N   1 
ATOM   967  C CA  . GLY A 1 128 ? 16.415 41.297 3.625   1.00 27.44 ? 127  GLY A CA  1 
ATOM   968  C C   . GLY A 1 128 ? 15.885 42.697 3.858   1.00 30.11 ? 127  GLY A C   1 
ATOM   969  O O   . GLY A 1 128 ? 14.903 43.099 3.230   1.00 30.25 ? 127  GLY A O   1 
ATOM   970  N N   . ILE A 1 129 ? 16.517 43.429 4.778   1.00 30.27 ? 128  ILE A N   1 
ATOM   971  C CA  . ILE A 1 129 ? 16.079 44.783 5.128   1.00 31.78 ? 128  ILE A CA  1 
ATOM   972  C C   . ILE A 1 129 ? 17.129 45.889 4.991   1.00 31.56 ? 128  ILE A C   1 
ATOM   973  O O   . ILE A 1 129 ? 18.333 45.630 5.040   1.00 28.92 ? 128  ILE A O   1 
ATOM   974  C CB  . ILE A 1 129 ? 15.479 44.841 6.581   1.00 33.04 ? 128  ILE A CB  1 
ATOM   975  C CG1 . ILE A 1 129 ? 16.548 44.581 7.653   1.00 35.20 ? 128  ILE A CG1 1 
ATOM   976  C CG2 . ILE A 1 129 ? 14.339 43.827 6.735   1.00 34.19 ? 128  ILE A CG2 1 
ATOM   977  C CD1 . ILE A 1 129 ? 16.128 44.971 9.068   1.00 36.96 ? 128  ILE A CD1 1 
ATOM   978  N N   . ASP A 1 130 ? 16.632 47.121 4.839   1.00 31.34 ? 129  ASP A N   1 
ATOM   979  C CA  . ASP A 1 130 ? 17.417 48.362 4.730   1.00 30.75 ? 129  ASP A CA  1 
ATOM   980  C C   . ASP A 1 130 ? 18.523 48.443 3.680   1.00 29.79 ? 129  ASP A C   1 
ATOM   981  O O   . ASP A 1 130 ? 19.601 49.000 3.925   1.00 28.72 ? 129  ASP A O   1 
ATOM   982  C CB  . ASP A 1 130 ? 17.937 48.792 6.115   1.00 32.77 ? 129  ASP A CB  1 
ATOM   983  C CG  . ASP A 1 130 ? 16.815 49.041 7.107   1.00 35.74 ? 129  ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 130 ? 15.924 49.865 6.804   1.00 37.81 ? 129  ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 130 ? 16.815 48.398 8.179   1.00 37.80 ? 129  ASP A OD2 1 
ATOM   986  N N   . PHE A 1 131 ? 18.240 47.884 2.507   1.00 28.89 ? 130  PHE A N   1 
ATOM   987  C CA  . PHE A 1 131 ? 19.173 47.888 1.389   1.00 29.93 ? 130  PHE A CA  1 
ATOM   988  C C   . PHE A 1 131 ? 19.018 49.123 0.506   1.00 31.09 ? 130  PHE A C   1 
ATOM   989  O O   . PHE A 1 131 ? 17.901 49.567 0.238   1.00 33.51 ? 130  PHE A O   1 
ATOM   990  C CB  . PHE A 1 131 ? 18.994 46.634 0.536   1.00 28.00 ? 130  PHE A CB  1 
ATOM   991  C CG  . PHE A 1 131 ? 19.641 45.413 1.103   1.00 26.37 ? 130  PHE A CG  1 
ATOM   992  C CD1 . PHE A 1 131 ? 18.898 44.510 1.879   1.00 23.30 ? 130  PHE A CD1 1 
ATOM   993  C CD2 . PHE A 1 131 ? 21.002 45.153 0.861   1.00 26.91 ? 130  PHE A CD2 1 
ATOM   994  C CE1 . PHE A 1 131 ? 19.502 43.355 2.414   1.00 24.65 ? 130  PHE A CE1 1 
ATOM   995  C CE2 . PHE A 1 131 ? 21.630 44.000 1.388   1.00 24.04 ? 130  PHE A CE2 1 
ATOM   996  C CZ  . PHE A 1 131 ? 20.877 43.098 2.166   1.00 24.26 ? 130  PHE A CZ  1 
ATOM   997  N N   . LYS A 1 132 ? 20.152 49.664 0.065   1.00 33.27 ? 131  LYS A N   1 
ATOM   998  C CA  . LYS A 1 132 ? 20.201 50.839 -0.802  1.00 34.35 ? 131  LYS A CA  1 
ATOM   999  C C   . LYS A 1 132 ? 20.011 50.416 -2.260  1.00 35.68 ? 131  LYS A C   1 
ATOM   1000 O O   . LYS A 1 132 ? 20.679 49.489 -2.728  1.00 33.78 ? 131  LYS A O   1 
ATOM   1001 C CB  . LYS A 1 132 ? 21.560 51.534 -0.661  1.00 36.40 ? 131  LYS A CB  1 
ATOM   1002 C CG  . LYS A 1 132 ? 21.866 52.082 0.720   1.00 38.65 ? 131  LYS A CG  1 
ATOM   1003 C CD  . LYS A 1 132 ? 23.305 52.569 0.786   1.00 41.41 ? 131  LYS A CD  1 
ATOM   1004 C CE  . LYS A 1 132 ? 23.603 53.231 2.119   1.00 43.05 ? 131  LYS A CE  1 
ATOM   1005 N NZ  . LYS A 1 132 ? 25.047 53.587 2.231   1.00 44.19 ? 131  LYS A NZ  1 
ATOM   1006 N N   . GLU A 1 133 ? 19.122 51.108 -2.979  1.00 37.50 ? 132  GLU A N   1 
ATOM   1007 C CA  . GLU A 1 133 ? 18.851 50.815 -4.397  1.00 40.23 ? 132  GLU A CA  1 
ATOM   1008 C C   . GLU A 1 133 ? 20.057 51.108 -5.288  1.00 39.97 ? 132  GLU A C   1 
ATOM   1009 O O   . GLU A 1 133 ? 20.231 50.496 -6.343  1.00 41.68 ? 132  GLU A O   1 
ATOM   1010 C CB  . GLU A 1 133 ? 17.639 51.602 -4.893  1.00 43.06 ? 132  GLU A CB  1 
ATOM   1011 C CG  . GLU A 1 133 ? 16.321 51.136 -4.312  1.00 47.36 ? 132  GLU A CG  1 
ATOM   1012 C CD  . GLU A 1 133 ? 15.146 51.915 -4.858  1.00 49.82 ? 132  GLU A CD  1 
ATOM   1013 O OE1 . GLU A 1 133 ? 14.974 53.083 -4.449  1.00 50.47 ? 132  GLU A OE1 1 
ATOM   1014 O OE2 . GLU A 1 133 ? 14.400 51.365 -5.698  1.00 52.39 ? 132  GLU A OE2 1 
ATOM   1015 N N   . ASP A 1 134 ? 20.897 52.022 -4.811  1.00 40.99 ? 133  ASP A N   1 
ATOM   1016 C CA  . ASP A 1 134 ? 22.123 52.447 -5.480  1.00 41.69 ? 133  ASP A CA  1 
ATOM   1017 C C   . ASP A 1 134 ? 23.332 51.634 -4.991  1.00 39.80 ? 133  ASP A C   1 
ATOM   1018 O O   . ASP A 1 134 ? 24.461 51.863 -5.432  1.00 40.20 ? 133  ASP A O   1 
ATOM   1019 C CB  . ASP A 1 134 ? 22.356 53.952 -5.233  1.00 45.21 ? 133  ASP A CB  1 
ATOM   1020 C CG  . ASP A 1 134 ? 22.312 54.329 -3.745  1.00 48.42 ? 133  ASP A CG  1 
ATOM   1021 O OD1 . ASP A 1 134 ? 23.388 54.406 -3.108  1.00 51.64 ? 133  ASP A OD1 1 
ATOM   1022 O OD2 . ASP A 1 134 ? 21.198 54.538 -3.217  1.00 50.89 ? 133  ASP A OD2 1 
ATOM   1023 N N   . GLY A 1 135 ? 23.081 50.695 -4.077  1.00 37.16 ? 134  GLY A N   1 
ATOM   1024 C CA  . GLY A 1 135 ? 24.137 49.865 -3.515  1.00 33.81 ? 134  GLY A CA  1 
ATOM   1025 C C   . GLY A 1 135 ? 24.621 48.740 -4.411  1.00 31.60 ? 134  GLY A C   1 
ATOM   1026 O O   . GLY A 1 135 ? 24.096 48.539 -5.512  1.00 32.69 ? 134  GLY A O   1 
ATOM   1027 N N   . ASN A 1 136 ? 25.609 47.993 -3.921  1.00 28.90 ? 135  ASN A N   1 
ATOM   1028 C CA  . ASN A 1 136 ? 26.198 46.874 -4.658  1.00 27.62 ? 135  ASN A CA  1 
ATOM   1029 C C   . ASN A 1 136 ? 25.299 45.649 -4.757  1.00 25.64 ? 135  ASN A C   1 
ATOM   1030 O O   . ASN A 1 136 ? 25.439 44.841 -5.680  1.00 26.79 ? 135  ASN A O   1 
ATOM   1031 C CB  . ASN A 1 136 ? 27.543 46.472 -4.047  1.00 26.75 ? 135  ASN A CB  1 
ATOM   1032 C CG  . ASN A 1 136 ? 28.594 47.553 -4.182  1.00 28.88 ? 135  ASN A CG  1 
ATOM   1033 O OD1 . ASN A 1 136 ? 28.910 48.001 -5.287  1.00 31.66 ? 135  ASN A OD1 1 
ATOM   1034 N ND2 . ASN A 1 136 ? 29.161 47.963 -3.057  1.00 26.60 ? 135  ASN A ND2 1 
ATOM   1035 N N   . ILE A 1 137 ? 24.360 45.534 -3.823  1.00 25.26 ? 136  ILE A N   1 
ATOM   1036 C CA  . ILE A 1 137 ? 23.444 44.401 -3.790  1.00 25.18 ? 136  ILE A CA  1 
ATOM   1037 C C   . ILE A 1 137 ? 22.231 44.609 -4.706  1.00 24.96 ? 136  ILE A C   1 
ATOM   1038 O O   . ILE A 1 137 ? 22.090 43.888 -5.694  1.00 24.02 ? 136  ILE A O   1 
ATOM   1039 C CB  . ILE A 1 137 ? 23.040 44.027 -2.327  1.00 24.56 ? 136  ILE A CB  1 
ATOM   1040 C CG1 . ILE A 1 137 ? 24.274 43.619 -1.508  1.00 24.00 ? 136  ILE A CG1 1 
ATOM   1041 C CG2 . ILE A 1 137 ? 22.099 42.830 -2.301  1.00 22.97 ? 136  ILE A CG2 1 
ATOM   1042 C CD1 . ILE A 1 137 ? 24.999 44.758 -0.830  1.00 22.96 ? 136  ILE A CD1 1 
ATOM   1043 N N   . LEU A 1 138 ? 21.396 45.611 -4.425  1.00 25.82 ? 137  LEU A N   1 
ATOM   1044 C CA  . LEU A 1 138 ? 20.217 45.870 -5.267  1.00 27.93 ? 137  LEU A CA  1 
ATOM   1045 C C   . LEU A 1 138 ? 20.548 46.434 -6.653  1.00 27.70 ? 137  LEU A C   1 
ATOM   1046 O O   . LEU A 1 138 ? 19.735 46.339 -7.576  1.00 28.14 ? 137  LEU A O   1 
ATOM   1047 C CB  . LEU A 1 138 ? 19.205 46.770 -4.558  1.00 28.23 ? 137  LEU A CB  1 
ATOM   1048 C CG  . LEU A 1 138 ? 18.450 46.225 -3.338  1.00 30.08 ? 137  LEU A CG  1 
ATOM   1049 C CD1 . LEU A 1 138 ? 17.427 47.267 -2.906  1.00 28.98 ? 137  LEU A CD1 1 
ATOM   1050 C CD2 . LEU A 1 138 ? 17.751 44.901 -3.631  1.00 30.59 ? 137  LEU A CD2 1 
ATOM   1051 N N   . GLY A 1 139 ? 21.759 46.976 -6.791  1.00 27.99 ? 138  GLY A N   1 
ATOM   1052 C CA  . GLY A 1 139 ? 22.212 47.517 -8.063  1.00 27.14 ? 138  GLY A CA  1 
ATOM   1053 C C   . GLY A 1 139 ? 22.908 46.472 -8.926  1.00 27.89 ? 138  GLY A C   1 
ATOM   1054 O O   . GLY A 1 139 ? 23.351 46.791 -10.034 1.00 29.14 ? 138  GLY A O   1 
ATOM   1055 N N   . HIS A 1 140 ? 23.012 45.235 -8.413  1.00 26.37 ? 139  HIS A N   1 
ATOM   1056 C CA  . HIS A 1 140 ? 23.648 44.091 -9.098  1.00 26.39 ? 139  HIS A CA  1 
ATOM   1057 C C   . HIS A 1 140 ? 25.049 44.404 -9.644  1.00 25.28 ? 139  HIS A C   1 
ATOM   1058 O O   . HIS A 1 140 ? 25.337 44.202 -10.828 1.00 26.86 ? 139  HIS A O   1 
ATOM   1059 C CB  . HIS A 1 140 ? 22.735 43.544 -10.210 1.00 27.30 ? 139  HIS A CB  1 
ATOM   1060 C CG  . HIS A 1 140 ? 21.470 42.924 -9.707  1.00 30.52 ? 139  HIS A CG  1 
ATOM   1061 N ND1 . HIS A 1 140 ? 21.290 41.559 -9.635  1.00 30.86 ? 139  HIS A ND1 1 
ATOM   1062 C CD2 . HIS A 1 140 ? 20.316 43.478 -9.264  1.00 30.72 ? 139  HIS A CD2 1 
ATOM   1063 C CE1 . HIS A 1 140 ? 20.080 41.301 -9.175  1.00 31.26 ? 139  HIS A CE1 1 
ATOM   1064 N NE2 . HIS A 1 140 ? 19.469 42.447 -8.941  1.00 31.60 ? 139  HIS A NE2 1 
ATOM   1065 N N   . LYS A 1 141 ? 25.900 44.922 -8.761  1.00 24.29 ? 140  LYS A N   1 
ATOM   1066 C CA  . LYS A 1 141 ? 27.262 45.322 -9.107  1.00 25.20 ? 140  LYS A CA  1 
ATOM   1067 C C   . LYS A 1 141 ? 28.337 44.294 -8.750  1.00 25.19 ? 140  LYS A C   1 
ATOM   1068 O O   . LYS A 1 141 ? 29.532 44.544 -8.940  1.00 25.17 ? 140  LYS A O   1 
ATOM   1069 C CB  . LYS A 1 141 ? 27.585 46.673 -8.449  1.00 25.54 ? 140  LYS A CB  1 
ATOM   1070 C CG  . LYS A 1 141 ? 26.593 47.786 -8.773  1.00 25.47 ? 140  LYS A CG  1 
ATOM   1071 C CD  . LYS A 1 141 ? 26.956 49.090 -8.087  1.00 28.01 ? 140  LYS A CD  1 
ATOM   1072 C CE  . LYS A 1 141 ? 25.857 50.122 -8.268  1.00 28.99 ? 140  LYS A CE  1 
ATOM   1073 N NZ  . LYS A 1 141 ? 26.224 51.423 -7.645  1.00 30.91 ? 140  LYS A NZ  1 
ATOM   1074 N N   . LEU A 1 142 ? 27.914 43.126 -8.268  1.00 24.71 ? 141  LEU A N   1 
ATOM   1075 C CA  . LEU A 1 142 ? 28.849 42.070 -7.876  1.00 23.56 ? 141  LEU A CA  1 
ATOM   1076 C C   . LEU A 1 142 ? 29.179 41.064 -8.967  1.00 24.11 ? 141  LEU A C   1 
ATOM   1077 O O   . LEU A 1 142 ? 28.305 40.681 -9.754  1.00 24.53 ? 141  LEU A O   1 
ATOM   1078 C CB  . LEU A 1 142 ? 28.332 41.331 -6.642  1.00 22.95 ? 141  LEU A CB  1 
ATOM   1079 C CG  . LEU A 1 142 ? 28.051 42.180 -5.400  1.00 24.43 ? 141  LEU A CG  1 
ATOM   1080 C CD1 . LEU A 1 142 ? 27.611 41.275 -4.294  1.00 25.24 ? 141  LEU A CD1 1 
ATOM   1081 C CD2 . LEU A 1 142 ? 29.278 42.966 -4.977  1.00 25.17 ? 141  LEU A CD2 1 
ATOM   1082 N N   . GLU A 1 143 ? 30.446 40.634 -8.989  1.00 23.76 ? 142  GLU A N   1 
ATOM   1083 C CA  . GLU A 1 143 ? 30.952 39.643 -9.951  1.00 24.43 ? 142  GLU A CA  1 
ATOM   1084 C C   . GLU A 1 143 ? 30.414 38.259 -9.594  1.00 22.99 ? 142  GLU A C   1 
ATOM   1085 O O   . GLU A 1 143 ? 30.182 37.963 -8.420  1.00 22.45 ? 142  GLU A O   1 
ATOM   1086 C CB  . GLU A 1 143 ? 32.483 39.581 -9.926  1.00 26.32 ? 142  GLU A CB  1 
ATOM   1087 C CG  . GLU A 1 143 ? 33.193 40.813 -10.474 1.00 30.30 ? 142  GLU A CG  1 
ATOM   1088 C CD  . GLU A 1 143 ? 34.714 40.722 -10.386 1.00 33.37 ? 142  GLU A CD  1 
ATOM   1089 O OE1 . GLU A 1 143 ? 35.247 39.713 -9.863  1.00 32.94 ? 142  GLU A OE1 1 
ATOM   1090 O OE2 . GLU A 1 143 ? 35.383 41.677 -10.838 1.00 34.81 ? 142  GLU A OE2 1 
ATOM   1091 N N   . TYR A 1 144 ? 30.250 37.417 -10.611 1.00 22.36 ? 143  TYR A N   1 
ATOM   1092 C CA  . TYR A 1 144 ? 29.733 36.066 -10.438 1.00 21.40 ? 143  TYR A CA  1 
ATOM   1093 C C   . TYR A 1 144 ? 30.852 35.086 -10.067 1.00 21.58 ? 143  TYR A C   1 
ATOM   1094 O O   . TYR A 1 144 ? 31.359 34.331 -10.902 1.00 19.82 ? 143  TYR A O   1 
ATOM   1095 C CB  . TYR A 1 144 ? 28.961 35.625 -11.696 1.00 22.38 ? 143  TYR A CB  1 
ATOM   1096 C CG  . TYR A 1 144 ? 28.172 34.336 -11.535 1.00 23.11 ? 143  TYR A CG  1 
ATOM   1097 C CD1 . TYR A 1 144 ? 27.078 34.254 -10.645 1.00 19.59 ? 143  TYR A CD1 1 
ATOM   1098 C CD2 . TYR A 1 144 ? 28.536 33.179 -12.255 1.00 21.97 ? 143  TYR A CD2 1 
ATOM   1099 C CE1 . TYR A 1 144 ? 26.367 33.042 -10.474 1.00 20.61 ? 143  TYR A CE1 1 
ATOM   1100 C CE2 . TYR A 1 144 ? 27.836 31.967 -12.091 1.00 20.36 ? 143  TYR A CE2 1 
ATOM   1101 C CZ  . TYR A 1 144 ? 26.757 31.908 -11.206 1.00 20.51 ? 143  TYR A CZ  1 
ATOM   1102 O OH  . TYR A 1 144 ? 26.065 30.736 -11.083 1.00 18.81 ? 143  TYR A OH  1 
ATOM   1103 N N   . ASN A 1 145 ? 31.262 35.174 -8.803  1.00 21.02 ? 144  ASN A N   1 
ATOM   1104 C CA  . ASN A 1 145 ? 32.298 34.326 -8.213  1.00 21.38 ? 144  ASN A CA  1 
ATOM   1105 C C   . ASN A 1 145 ? 32.167 34.370 -6.691  1.00 20.02 ? 144  ASN A C   1 
ATOM   1106 O O   . ASN A 1 145 ? 31.345 35.124 -6.149  1.00 19.53 ? 144  ASN A O   1 
ATOM   1107 C CB  . ASN A 1 145 ? 33.730 34.715 -8.679  1.00 22.71 ? 144  ASN A CB  1 
ATOM   1108 C CG  . ASN A 1 145 ? 34.055 36.198 -8.494  1.00 26.12 ? 144  ASN A CG  1 
ATOM   1109 O OD1 . ASN A 1 145 ? 33.846 36.774 -7.422  1.00 25.68 ? 144  ASN A OD1 1 
ATOM   1110 N ND2 . ASN A 1 145 ? 34.596 36.814 -9.543  1.00 23.07 ? 144  ASN A ND2 1 
ATOM   1111 N N   . TYR A 1 146 ? 32.989 33.578 -6.010  1.00 20.82 ? 145  TYR A N   1 
ATOM   1112 C CA  . TYR A 1 146 ? 32.966 33.501 -4.553  1.00 22.75 ? 145  TYR A CA  1 
ATOM   1113 C C   . TYR A 1 146 ? 34.361 33.066 -4.100  1.00 23.21 ? 145  TYR A C   1 
ATOM   1114 O O   . TYR A 1 146 ? 34.831 31.982 -4.459  1.00 23.53 ? 145  TYR A O   1 
ATOM   1115 C CB  . TYR A 1 146 ? 31.874 32.502 -4.116  1.00 23.46 ? 145  TYR A CB  1 
ATOM   1116 C CG  . TYR A 1 146 ? 31.517 32.512 -2.648  1.00 25.29 ? 145  TYR A CG  1 
ATOM   1117 C CD1 . TYR A 1 146 ? 30.701 33.525 -2.100  1.00 25.63 ? 145  TYR A CD1 1 
ATOM   1118 C CD2 . TYR A 1 146 ? 32.006 31.509 -1.790  1.00 26.41 ? 145  TYR A CD2 1 
ATOM   1119 C CE1 . TYR A 1 146 ? 30.387 33.538 -0.707  1.00 27.03 ? 145  TYR A CE1 1 
ATOM   1120 C CE2 . TYR A 1 146 ? 31.699 31.503 -0.421  1.00 25.43 ? 145  TYR A CE2 1 
ATOM   1121 C CZ  . TYR A 1 146 ? 30.896 32.519 0.118   1.00 27.28 ? 145  TYR A CZ  1 
ATOM   1122 O OH  . TYR A 1 146 ? 30.640 32.511 1.466   1.00 28.83 ? 145  TYR A OH  1 
ATOM   1123 N N   . ASN A 1 147 ? 35.017 33.930 -3.324  1.00 22.23 ? 146  ASN A N   1 
ATOM   1124 C CA  . ASN A 1 147 ? 36.371 33.677 -2.818  1.00 22.79 ? 146  ASN A CA  1 
ATOM   1125 C C   . ASN A 1 147 ? 36.426 32.559 -1.781  1.00 22.22 ? 146  ASN A C   1 
ATOM   1126 O O   . ASN A 1 147 ? 35.418 32.221 -1.153  1.00 20.78 ? 146  ASN A O   1 
ATOM   1127 C CB  . ASN A 1 147 ? 36.964 34.941 -2.173  1.00 24.44 ? 146  ASN A CB  1 
ATOM   1128 C CG  . ASN A 1 147 ? 37.001 36.135 -3.113  1.00 26.49 ? 146  ASN A CG  1 
ATOM   1129 O OD1 . ASN A 1 147 ? 37.126 35.991 -4.330  1.00 29.38 ? 146  ASN A OD1 1 
ATOM   1130 N ND2 . ASN A 1 147 ? 36.913 37.329 -2.539  1.00 28.03 ? 146  ASN A ND2 1 
ATOM   1131 N N   . SER A 1 148 ? 37.620 31.995 -1.621  1.00 23.58 ? 147  SER A N   1 
ATOM   1132 C CA  . SER A 1 148 ? 37.880 30.947 -0.638  1.00 24.47 ? 147  SER A CA  1 
ATOM   1133 C C   . SER A 1 148 ? 37.961 31.638 0.720   1.00 24.09 ? 147  SER A C   1 
ATOM   1134 O O   . SER A 1 148 ? 38.460 32.766 0.810   1.00 22.05 ? 147  SER A O   1 
ATOM   1135 C CB  . SER A 1 148 ? 39.203 30.249 -0.948  1.00 25.62 ? 147  SER A CB  1 
ATOM   1136 O OG  . SER A 1 148 ? 39.167 29.672 -2.243  1.00 28.66 ? 147  SER A OG  1 
ATOM   1137 N N   . HIS A 1 149 ? 37.398 31.004 1.747   1.00 23.50 ? 148  HIS A N   1 
ATOM   1138 C CA  . HIS A 1 149 ? 37.397 31.575 3.097   1.00 23.57 ? 148  HIS A CA  1 
ATOM   1139 C C   . HIS A 1 149 ? 37.255 30.501 4.176   1.00 23.22 ? 148  HIS A C   1 
ATOM   1140 O O   . HIS A 1 149 ? 37.004 29.328 3.879   1.00 21.45 ? 148  HIS A O   1 
ATOM   1141 C CB  . HIS A 1 149 ? 36.261 32.612 3.249   1.00 23.64 ? 148  HIS A CB  1 
ATOM   1142 C CG  . HIS A 1 149 ? 34.889 32.024 3.132   1.00 26.19 ? 148  HIS A CG  1 
ATOM   1143 N ND1 . HIS A 1 149 ? 34.224 31.463 4.202   1.00 27.60 ? 148  HIS A ND1 1 
ATOM   1144 C CD2 . HIS A 1 149 ? 34.095 31.831 2.054   1.00 29.13 ? 148  HIS A CD2 1 
ATOM   1145 C CE1 . HIS A 1 149 ? 33.084 30.942 3.785   1.00 27.86 ? 148  HIS A CE1 1 
ATOM   1146 N NE2 . HIS A 1 149 ? 32.980 31.153 2.487   1.00 29.12 ? 148  HIS A NE2 1 
ATOM   1147 N N   . ASN A 1 150 ? 37.363 30.940 5.427   1.00 22.50 ? 149  ASN A N   1 
ATOM   1148 C CA  . ASN A 1 150 ? 37.233 30.066 6.587   1.00 23.85 ? 149  ASN A CA  1 
ATOM   1149 C C   . ASN A 1 150 ? 35.911 30.347 7.298   1.00 24.79 ? 149  ASN A C   1 
ATOM   1150 O O   . ASN A 1 150 ? 35.323 31.414 7.115   1.00 26.42 ? 149  ASN A O   1 
ATOM   1151 C CB  . ASN A 1 150 ? 38.401 30.280 7.557   1.00 21.96 ? 149  ASN A CB  1 
ATOM   1152 C CG  . ASN A 1 150 ? 39.748 29.879 6.969   1.00 22.95 ? 149  ASN A CG  1 
ATOM   1153 O OD1 . ASN A 1 150 ? 39.870 28.849 6.303   1.00 20.36 ? 149  ASN A OD1 1 
ATOM   1154 N ND2 . ASN A 1 150 ? 40.777 30.675 7.252   1.00 20.40 ? 149  ASN A ND2 1 
ATOM   1155 N N   . VAL A 1 151 ? 35.400 29.347 8.018   1.00 24.67 ? 150  VAL A N   1 
ATOM   1156 C CA  . VAL A 1 151 ? 34.158 29.463 8.794   1.00 22.90 ? 150  VAL A CA  1 
ATOM   1157 C C   . VAL A 1 151 ? 34.568 29.092 10.218  1.00 24.07 ? 150  VAL A C   1 
ATOM   1158 O O   . VAL A 1 151 ? 34.704 27.908 10.536  1.00 23.40 ? 150  VAL A O   1 
ATOM   1159 C CB  . VAL A 1 151 ? 33.035 28.482 8.292   1.00 21.90 ? 150  VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 151 ? 31.770 28.606 9.154   1.00 22.54 ? 150  VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 151 ? 32.696 28.731 6.830   1.00 21.65 ? 150  VAL A CG2 1 
ATOM   1162 N N   . TYR A 1 152 ? 34.762 30.102 11.066  1.00 24.30 ? 151  TYR A N   1 
ATOM   1163 C CA  . TYR A 1 152 ? 35.185 29.889 12.456  1.00 24.83 ? 151  TYR A CA  1 
ATOM   1164 C C   . TYR A 1 152 ? 34.039 29.448 13.345  1.00 25.03 ? 151  TYR A C   1 
ATOM   1165 O O   . TYR A 1 152 ? 33.020 30.120 13.424  1.00 23.89 ? 151  TYR A O   1 
ATOM   1166 C CB  . TYR A 1 152 ? 35.874 31.143 13.016  1.00 25.26 ? 151  TYR A CB  1 
ATOM   1167 C CG  . TYR A 1 152 ? 37.060 31.587 12.188  1.00 24.35 ? 151  TYR A CG  1 
ATOM   1168 C CD1 . TYR A 1 152 ? 38.337 31.018 12.385  1.00 23.71 ? 151  TYR A CD1 1 
ATOM   1169 C CD2 . TYR A 1 152 ? 36.901 32.535 11.154  1.00 24.74 ? 151  TYR A CD2 1 
ATOM   1170 C CE1 . TYR A 1 152 ? 39.440 31.377 11.557  1.00 24.19 ? 151  TYR A CE1 1 
ATOM   1171 C CE2 . TYR A 1 152 ? 37.989 32.904 10.319  1.00 25.26 ? 151  TYR A CE2 1 
ATOM   1172 C CZ  . TYR A 1 152 ? 39.252 32.318 10.525  1.00 24.91 ? 151  TYR A CZ  1 
ATOM   1173 O OH  . TYR A 1 152 ? 40.296 32.647 9.687   1.00 25.06 ? 151  TYR A OH  1 
ATOM   1174 N N   . ILE A 1 153 ? 34.214 28.281 13.964  1.00 24.29 ? 152  ILE A N   1 
ATOM   1175 C CA  . ILE A 1 153 ? 33.219 27.668 14.841  1.00 24.43 ? 152  ILE A CA  1 
ATOM   1176 C C   . ILE A 1 153 ? 33.672 27.643 16.305  1.00 25.16 ? 152  ILE A C   1 
ATOM   1177 O O   . ILE A 1 153 ? 34.834 27.367 16.604  1.00 22.60 ? 152  ILE A O   1 
ATOM   1178 C CB  . ILE A 1 153 ? 32.919 26.201 14.387  1.00 24.28 ? 152  ILE A CB  1 
ATOM   1179 C CG1 . ILE A 1 153 ? 32.383 26.185 12.955  1.00 24.75 ? 152  ILE A CG1 1 
ATOM   1180 C CG2 . ILE A 1 153 ? 31.903 25.506 15.321  1.00 22.94 ? 152  ILE A CG2 1 
ATOM   1181 C CD1 . ILE A 1 153 ? 32.425 24.836 12.344  1.00 24.37 ? 152  ILE A CD1 1 
ATOM   1182 N N   . THR A 1 154 ? 32.709 27.876 17.195  1.00 26.45 ? 153  THR A N   1 
ATOM   1183 C CA  . THR A 1 154 ? 32.914 27.865 18.641  1.00 29.60 ? 153  THR A CA  1 
ATOM   1184 C C   . THR A 1 154 ? 31.662 27.228 19.272  1.00 30.04 ? 153  THR A C   1 
ATOM   1185 O O   . THR A 1 154 ? 30.577 27.275 18.682  1.00 28.11 ? 153  THR A O   1 
ATOM   1186 C CB  . THR A 1 154 ? 33.198 29.307 19.191  1.00 30.05 ? 153  THR A CB  1 
ATOM   1187 O OG1 . THR A 1 154 ? 33.525 29.237 20.584  1.00 34.47 ? 153  THR A OG1 1 
ATOM   1188 C CG2 . THR A 1 154 ? 32.011 30.246 18.989  1.00 30.92 ? 153  THR A CG2 1 
ATOM   1189 N N   . ALA A 1 155 ? 31.819 26.605 20.440  1.00 30.84 ? 154  ALA A N   1 
ATOM   1190 C CA  . ALA A 1 155 ? 30.697 25.954 21.129  1.00 32.32 ? 154  ALA A CA  1 
ATOM   1191 C C   . ALA A 1 155 ? 29.824 26.917 21.932  1.00 33.61 ? 154  ALA A C   1 
ATOM   1192 O O   . ALA A 1 155 ? 30.297 27.945 22.423  1.00 33.22 ? 154  ALA A O   1 
ATOM   1193 C CB  . ALA A 1 155 ? 31.203 24.838 22.035  1.00 31.04 ? 154  ALA A CB  1 
ATOM   1194 N N   . ASP A 1 156 ? 28.544 26.567 22.033  1.00 36.00 ? 155  ASP A N   1 
ATOM   1195 C CA  . ASP A 1 156 ? 27.544 27.330 22.777  1.00 39.12 ? 155  ASP A CA  1 
ATOM   1196 C C   . ASP A 1 156 ? 26.881 26.291 23.691  1.00 40.86 ? 155  ASP A C   1 
ATOM   1197 O O   . ASP A 1 156 ? 25.841 25.719 23.353  1.00 39.80 ? 155  ASP A O   1 
ATOM   1198 C CB  . ASP A 1 156 ? 26.532 27.964 21.800  1.00 40.15 ? 155  ASP A CB  1 
ATOM   1199 C CG  . ASP A 1 156 ? 25.558 28.939 22.475  1.00 42.38 ? 155  ASP A CG  1 
ATOM   1200 O OD1 . ASP A 1 156 ? 25.802 29.391 23.617  1.00 44.09 ? 155  ASP A OD1 1 
ATOM   1201 O OD2 . ASP A 1 156 ? 24.541 29.269 21.830  1.00 43.73 ? 155  ASP A OD2 1 
ATOM   1202 N N   . LYS A 1 157 ? 27.527 26.040 24.833  1.00 43.83 ? 156  LYS A N   1 
ATOM   1203 C CA  . LYS A 1 157 ? 27.085 25.063 25.836  1.00 47.51 ? 156  LYS A CA  1 
ATOM   1204 C C   . LYS A 1 157 ? 25.719 25.297 26.482  1.00 48.23 ? 156  LYS A C   1 
ATOM   1205 O O   . LYS A 1 157 ? 25.033 24.338 26.847  1.00 49.52 ? 156  LYS A O   1 
ATOM   1206 C CB  . LYS A 1 157 ? 28.143 24.919 26.935  1.00 49.35 ? 156  LYS A CB  1 
ATOM   1207 C CG  . LYS A 1 157 ? 29.386 24.153 26.516  1.00 51.96 ? 156  LYS A CG  1 
ATOM   1208 C CD  . LYS A 1 157 ? 30.340 23.977 27.688  1.00 55.07 ? 156  LYS A CD  1 
ATOM   1209 C CE  . LYS A 1 157 ? 31.503 23.053 27.338  1.00 56.05 ? 156  LYS A CE  1 
ATOM   1210 N NZ  . LYS A 1 157 ? 31.071 21.637 27.125  1.00 57.80 ? 156  LYS A NZ  1 
ATOM   1211 N N   . GLN A 1 158 ? 25.326 26.567 26.592  1.00 49.74 ? 157  GLN A N   1 
ATOM   1212 C CA  . GLN A 1 158 ? 24.048 26.966 27.193  1.00 50.87 ? 157  GLN A CA  1 
ATOM   1213 C C   . GLN A 1 158 ? 22.838 26.548 26.357  1.00 50.32 ? 157  GLN A C   1 
ATOM   1214 O O   . GLN A 1 158 ? 21.776 26.232 26.901  1.00 50.71 ? 157  GLN A O   1 
ATOM   1215 C CB  . GLN A 1 158 ? 24.020 28.482 27.415  1.00 52.79 ? 157  GLN A CB  1 
ATOM   1216 C CG  . GLN A 1 158 ? 25.085 28.990 28.376  1.00 56.15 ? 157  GLN A CG  1 
ATOM   1217 C CD  . GLN A 1 158 ? 25.083 30.501 28.501  1.00 58.55 ? 157  GLN A CD  1 
ATOM   1218 O OE1 . GLN A 1 158 ? 25.566 31.212 27.615  1.00 60.30 ? 157  GLN A OE1 1 
ATOM   1219 N NE2 . GLN A 1 158 ? 24.544 31.002 29.608  1.00 59.42 ? 157  GLN A NE2 1 
ATOM   1220 N N   . LYS A 1 159 ? 23.023 26.538 25.037  1.00 49.24 ? 158  LYS A N   1 
ATOM   1221 C CA  . LYS A 1 159 ? 21.976 26.165 24.088  1.00 48.53 ? 158  LYS A CA  1 
ATOM   1222 C C   . LYS A 1 159 ? 22.237 24.808 23.429  1.00 45.93 ? 158  LYS A C   1 
ATOM   1223 O O   . LYS A 1 159 ? 21.513 24.406 22.509  1.00 45.57 ? 158  LYS A O   1 
ATOM   1224 C CB  . LYS A 1 159 ? 21.806 27.265 23.027  1.00 49.91 ? 158  LYS A CB  1 
ATOM   1225 C CG  . LYS A 1 159 ? 21.184 28.551 23.567  1.00 52.94 ? 158  LYS A CG  1 
ATOM   1226 C CD  . LYS A 1 159 ? 21.064 29.622 22.497  1.00 56.37 ? 158  LYS A CD  1 
ATOM   1227 C CE  . LYS A 1 159 ? 20.460 30.895 23.069  1.00 57.21 ? 158  LYS A CE  1 
ATOM   1228 N NZ  . LYS A 1 159 ? 20.342 31.954 22.031  1.00 59.31 ? 158  LYS A NZ  1 
ATOM   1229 N N   . ASN A 1 160 ? 23.267 24.108 23.923  1.00 43.30 ? 159  ASN A N   1 
ATOM   1230 C CA  . ASN A 1 160 ? 23.699 22.778 23.448  1.00 40.17 ? 159  ASN A CA  1 
ATOM   1231 C C   . ASN A 1 160 ? 24.024 22.729 21.947  1.00 37.06 ? 159  ASN A C   1 
ATOM   1232 O O   . ASN A 1 160 ? 23.860 21.700 21.286  1.00 34.09 ? 159  ASN A O   1 
ATOM   1233 C CB  . ASN A 1 160 ? 22.661 21.703 23.820  1.00 43.20 ? 159  ASN A CB  1 
ATOM   1234 C CG  . ASN A 1 160 ? 23.267 20.556 24.599  1.00 47.68 ? 159  ASN A CG  1 
ATOM   1235 O OD1 . ASN A 1 160 ? 23.450 19.458 24.069  1.00 48.68 ? 159  ASN A OD1 1 
ATOM   1236 N ND2 . ASN A 1 160 ? 23.584 20.804 25.869  1.00 48.89 ? 159  ASN A ND2 1 
ATOM   1237 N N   . GLY A 1 161 ? 24.508 23.854 21.432  1.00 34.87 ? 160  GLY A N   1 
ATOM   1238 C CA  . GLY A 1 161 ? 24.836 23.944 20.026  1.00 33.66 ? 160  GLY A CA  1 
ATOM   1239 C C   . GLY A 1 161 ? 26.128 24.670 19.757  1.00 33.26 ? 160  GLY A C   1 
ATOM   1240 O O   . GLY A 1 161 ? 27.067 24.611 20.561  1.00 33.04 ? 160  GLY A O   1 
ATOM   1241 N N   . ILE A 1 162 ? 26.197 25.303 18.586  1.00 31.06 ? 161  ILE A N   1 
ATOM   1242 C CA  . ILE A 1 162 ? 27.383 26.051 18.173  1.00 28.77 ? 161  ILE A CA  1 
ATOM   1243 C C   . ILE A 1 162 ? 27.052 27.432 17.641  1.00 27.75 ? 161  ILE A C   1 
ATOM   1244 O O   . ILE A 1 162 ? 25.887 27.774 17.424  1.00 26.54 ? 161  ILE A O   1 
ATOM   1245 C CB  . ILE A 1 162 ? 28.214 25.317 17.065  1.00 28.75 ? 161  ILE A CB  1 
ATOM   1246 C CG1 . ILE A 1 162 ? 27.394 25.111 15.791  1.00 29.47 ? 161  ILE A CG1 1 
ATOM   1247 C CG2 . ILE A 1 162 ? 28.742 24.009 17.567  1.00 26.57 ? 161  ILE A CG2 1 
ATOM   1248 C CD1 . ILE A 1 162 ? 28.080 25.581 14.538  1.00 33.64 ? 161  ILE A CD1 1 
ATOM   1249 N N   . LYS A 1 163 ? 28.115 28.204 17.442  1.00 27.10 ? 162  LYS A N   1 
ATOM   1250 C CA  . LYS A 1 163 ? 28.073 29.546 16.880  1.00 28.41 ? 162  LYS A CA  1 
ATOM   1251 C C   . LYS A 1 163 ? 29.170 29.561 15.823  1.00 26.89 ? 162  LYS A C   1 
ATOM   1252 O O   . LYS A 1 163 ? 30.214 28.917 15.994  1.00 26.17 ? 162  LYS A O   1 
ATOM   1253 C CB  . LYS A 1 163 ? 28.354 30.619 17.941  1.00 31.30 ? 162  LYS A CB  1 
ATOM   1254 C CG  . LYS A 1 163 ? 27.171 30.934 18.838  1.00 35.21 ? 162  LYS A CG  1 
ATOM   1255 C CD  . LYS A 1 163 ? 27.535 31.876 19.970  1.00 39.68 ? 162  LYS A CD  1 
ATOM   1256 C CE  . LYS A 1 163 ? 26.288 32.244 20.756  1.00 42.30 ? 162  LYS A CE  1 
ATOM   1257 N NZ  . LYS A 1 163 ? 26.588 32.992 22.004  1.00 45.90 ? 162  LYS A NZ  1 
ATOM   1258 N N   . ALA A 1 164 ? 28.900 30.233 14.709  1.00 24.70 ? 163  ALA A N   1 
ATOM   1259 C CA  . ALA A 1 164 ? 29.861 30.341 13.622  1.00 24.19 ? 163  ALA A CA  1 
ATOM   1260 C C   . ALA A 1 164 ? 29.919 31.772 13.125  1.00 24.65 ? 163  ALA A C   1 
ATOM   1261 O O   . ALA A 1 164 ? 28.894 32.460 13.063  1.00 23.30 ? 163  ALA A O   1 
ATOM   1262 C CB  . ALA A 1 164 ? 29.520 29.378 12.485  1.00 23.31 ? 163  ALA A CB  1 
ATOM   1263 N N   . ASN A 1 165 ? 31.126 32.220 12.789  1.00 24.57 ? 164  ASN A N   1 
ATOM   1264 C CA  . ASN A 1 165 ? 31.343 33.586 12.327  1.00 25.65 ? 164  ASN A CA  1 
ATOM   1265 C C   . ASN A 1 165 ? 32.485 33.668 11.324  1.00 25.44 ? 164  ASN A C   1 
ATOM   1266 O O   . ASN A 1 165 ? 33.454 32.910 11.417  1.00 23.91 ? 164  ASN A O   1 
ATOM   1267 C CB  . ASN A 1 165 ? 31.633 34.499 13.540  1.00 29.24 ? 164  ASN A CB  1 
ATOM   1268 C CG  . ASN A 1 165 ? 31.722 35.973 13.168  1.00 33.47 ? 164  ASN A CG  1 
ATOM   1269 O OD1 . ASN A 1 165 ? 32.797 36.575 13.229  1.00 34.07 ? 164  ASN A OD1 1 
ATOM   1270 N ND2 . ASN A 1 165 ? 30.593 36.555 12.768  1.00 34.99 ? 164  ASN A ND2 1 
ATOM   1271 N N   . PHE A 1 166 ? 32.308 34.540 10.326  1.00 22.52 ? 165  PHE A N   1 
ATOM   1272 C CA  . PHE A 1 166 ? 33.306 34.813 9.293   1.00 24.75 ? 165  PHE A CA  1 
ATOM   1273 C C   . PHE A 1 166 ? 33.001 36.067 8.485   1.00 25.01 ? 165  PHE A C   1 
ATOM   1274 O O   . PHE A 1 166 ? 31.850 36.503 8.410   1.00 24.37 ? 165  PHE A O   1 
ATOM   1275 C CB  . PHE A 1 166 ? 33.538 33.614 8.343   1.00 27.18 ? 165  PHE A CB  1 
ATOM   1276 C CG  . PHE A 1 166 ? 32.325 33.174 7.554   1.00 28.20 ? 165  PHE A CG  1 
ATOM   1277 C CD1 . PHE A 1 166 ? 32.112 33.637 6.236   1.00 29.81 ? 165  PHE A CD1 1 
ATOM   1278 C CD2 . PHE A 1 166 ? 31.431 32.235 8.090   1.00 27.30 ? 165  PHE A CD2 1 
ATOM   1279 C CE1 . PHE A 1 166 ? 31.018 33.159 5.462   1.00 27.42 ? 165  PHE A CE1 1 
ATOM   1280 C CE2 . PHE A 1 166 ? 30.343 31.747 7.330   1.00 26.53 ? 165  PHE A CE2 1 
ATOM   1281 C CZ  . PHE A 1 166 ? 30.137 32.211 6.012   1.00 27.42 ? 165  PHE A CZ  1 
ATOM   1282 N N   . LYS A 1 167 ? 34.044 36.601 7.851   1.00 27.17 ? 166  LYS A N   1 
ATOM   1283 C CA  . LYS A 1 167 ? 33.954 37.781 6.997   1.00 28.84 ? 166  LYS A CA  1 
ATOM   1284 C C   . LYS A 1 167 ? 33.969 37.348 5.532   1.00 29.36 ? 166  LYS A C   1 
ATOM   1285 O O   . LYS A 1 167 ? 34.779 36.505 5.133   1.00 31.79 ? 166  LYS A O   1 
ATOM   1286 C CB  . LYS A 1 167 ? 35.122 38.733 7.274   1.00 31.84 ? 166  LYS A CB  1 
ATOM   1287 C CG  . LYS A 1 167 ? 35.014 39.526 8.574   1.00 36.41 ? 166  LYS A CG  1 
ATOM   1288 C CD  . LYS A 1 167 ? 33.996 40.660 8.455   1.00 39.83 ? 166  LYS A CD  1 
ATOM   1289 C CE  . LYS A 1 167 ? 34.026 41.582 9.671   1.00 40.94 ? 166  LYS A CE  1 
ATOM   1290 N NZ  . LYS A 1 167 ? 33.671 40.874 10.935  1.00 42.52 ? 166  LYS A NZ  1 
ATOM   1291 N N   . ILE A 1 168 ? 33.029 37.886 4.757   1.00 30.13 ? 167  ILE A N   1 
ATOM   1292 C CA  . ILE A 1 168 ? 32.893 37.594 3.326   1.00 30.08 ? 167  ILE A CA  1 
ATOM   1293 C C   . ILE A 1 168 ? 33.371 38.827 2.564   1.00 30.51 ? 167  ILE A C   1 
ATOM   1294 O O   . ILE A 1 168 ? 33.115 39.958 2.987   1.00 30.93 ? 167  ILE A O   1 
ATOM   1295 C CB  . ILE A 1 168 ? 31.402 37.356 2.909   1.00 31.25 ? 167  ILE A CB  1 
ATOM   1296 C CG1 . ILE A 1 168 ? 30.681 36.462 3.924   1.00 30.87 ? 167  ILE A CG1 1 
ATOM   1297 C CG2 . ILE A 1 168 ? 31.338 36.707 1.524   1.00 29.87 ? 167  ILE A CG2 1 
ATOM   1298 C CD1 . ILE A 1 168 ? 29.179 36.689 4.016   1.00 30.93 ? 167  ILE A CD1 1 
ATOM   1299 N N   . ARG A 1 169 ? 34.088 38.599 1.465   1.00 29.12 ? 168  ARG A N   1 
ATOM   1300 C CA  . ARG A 1 169 ? 34.585 39.673 0.605   1.00 29.58 ? 168  ARG A CA  1 
ATOM   1301 C C   . ARG A 1 169 ? 34.044 39.462 -0.805  1.00 28.01 ? 168  ARG A C   1 
ATOM   1302 O O   . ARG A 1 169 ? 34.587 38.671 -1.580  1.00 28.01 ? 168  ARG A O   1 
ATOM   1303 C CB  . ARG A 1 169 ? 36.120 39.710 0.583   1.00 33.02 ? 168  ARG A CB  1 
ATOM   1304 C CG  . ARG A 1 169 ? 36.755 40.186 1.874   1.00 36.90 ? 168  ARG A CG  1 
ATOM   1305 C CD  . ARG A 1 169 ? 38.089 39.501 2.105   1.00 42.19 ? 168  ARG A CD  1 
ATOM   1306 N NE  . ARG A 1 169 ? 38.368 39.310 3.531   1.00 45.94 ? 168  ARG A NE  1 
ATOM   1307 C CZ  . ARG A 1 169 ? 37.912 38.303 4.279   1.00 47.41 ? 168  ARG A CZ  1 
ATOM   1308 N NH1 . ARG A 1 169 ? 37.130 37.361 3.759   1.00 50.47 ? 168  ARG A NH1 1 
ATOM   1309 N NH2 . ARG A 1 169 ? 38.276 38.218 5.551   1.00 47.40 ? 168  ARG A NH2 1 
ATOM   1310 N N   . HIS A 1 170 ? 32.938 40.137 -1.109  1.00 26.03 ? 169  HIS A N   1 
ATOM   1311 C CA  . HIS A 1 170 ? 32.311 40.047 -2.423  1.00 26.42 ? 169  HIS A CA  1 
ATOM   1312 C C   . HIS A 1 170 ? 33.064 40.952 -3.386  1.00 28.55 ? 169  HIS A C   1 
ATOM   1313 O O   . HIS A 1 170 ? 33.345 42.097 -3.060  1.00 28.48 ? 169  HIS A O   1 
ATOM   1314 C CB  . HIS A 1 170 ? 30.845 40.475 -2.351  1.00 24.13 ? 169  HIS A CB  1 
ATOM   1315 C CG  . HIS A 1 170 ? 29.960 39.506 -1.633  1.00 22.66 ? 169  HIS A CG  1 
ATOM   1316 N ND1 . HIS A 1 170 ? 29.867 38.178 -1.990  1.00 19.25 ? 169  HIS A ND1 1 
ATOM   1317 C CD2 . HIS A 1 170 ? 29.114 39.675 -0.590  1.00 23.45 ? 169  HIS A CD2 1 
ATOM   1318 C CE1 . HIS A 1 170 ? 29.000 37.572 -1.200  1.00 21.00 ? 169  HIS A CE1 1 
ATOM   1319 N NE2 . HIS A 1 170 ? 28.527 38.458 -0.342  1.00 22.18 ? 169  HIS A NE2 1 
ATOM   1320 N N   . ASN A 1 171 ? 33.397 40.429 -4.563  1.00 27.93 ? 170  ASN A N   1 
ATOM   1321 C CA  . ASN A 1 171 ? 34.132 41.194 -5.565  1.00 30.07 ? 170  ASN A CA  1 
ATOM   1322 C C   . ASN A 1 171 ? 33.206 42.042 -6.444  1.00 29.63 ? 170  ASN A C   1 
ATOM   1323 O O   . ASN A 1 171 ? 32.276 41.520 -7.056  1.00 28.65 ? 170  ASN A O   1 
ATOM   1324 C CB  . ASN A 1 171 ? 34.995 40.252 -6.410  1.00 31.43 ? 170  ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 171 ? 35.898 39.371 -5.561  1.00 34.15 ? 170  ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 171 ? 36.807 39.856 -4.891  1.00 37.86 ? 170  ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 171 ? 35.629 38.074 -5.564  1.00 36.68 ? 170  ASN A ND2 1 
ATOM   1328 N N   . ILE A 1 172 ? 33.425 43.359 -6.427  1.00 30.07 ? 171  ILE A N   1 
ATOM   1329 C CA  . ILE A 1 172 ? 32.638 44.316 -7.219  1.00 31.20 ? 171  ILE A CA  1 
ATOM   1330 C C   . ILE A 1 172 ? 33.271 44.454 -8.609  1.00 32.54 ? 171  ILE A C   1 
ATOM   1331 O O   . ILE A 1 172 ? 34.480 44.263 -8.773  1.00 32.94 ? 171  ILE A O   1 
ATOM   1332 C CB  . ILE A 1 172 ? 32.561 45.740 -6.537  1.00 30.70 ? 171  ILE A CB  1 
ATOM   1333 C CG1 . ILE A 1 172 ? 32.123 45.622 -5.073  1.00 30.68 ? 171  ILE A CG1 1 
ATOM   1334 C CG2 . ILE A 1 172 ? 31.558 46.650 -7.265  1.00 28.40 ? 171  ILE A CG2 1 
ATOM   1335 C CD1 . ILE A 1 172 ? 32.263 46.914 -4.269  1.00 34.88 ? 171  ILE A CD1 1 
ATOM   1336 N N   . GLU A 1 173 ? 32.436 44.817 -9.584  1.00 33.92 ? 172  GLU A N   1 
ATOM   1337 C CA  . GLU A 1 173 ? 32.810 45.012 -10.990 1.00 35.39 ? 172  GLU A CA  1 
ATOM   1338 C C   . GLU A 1 173 ? 33.954 46.003 -11.264 1.00 33.90 ? 172  GLU A C   1 
ATOM   1339 O O   . GLU A 1 173 ? 34.681 45.844 -12.245 1.00 32.63 ? 172  GLU A O   1 
ATOM   1340 C CB  . GLU A 1 173 ? 31.567 45.413 -11.799 1.00 37.11 ? 172  GLU A CB  1 
ATOM   1341 C CG  . GLU A 1 173 ? 30.826 46.640 -11.248 1.00 40.68 ? 172  GLU A CG  1 
ATOM   1342 C CD  . GLU A 1 173 ? 29.553 46.983 -12.005 1.00 43.12 ? 172  GLU A CD  1 
ATOM   1343 O OE1 . GLU A 1 173 ? 28.856 46.061 -12.488 1.00 43.10 ? 172  GLU A OE1 1 
ATOM   1344 O OE2 . GLU A 1 173 ? 29.236 48.188 -12.093 1.00 45.06 ? 172  GLU A OE2 1 
ATOM   1345 N N   . ASP A 1 174 ? 34.112 47.003 -10.393 1.00 33.70 ? 173  ASP A N   1 
ATOM   1346 C CA  . ASP A 1 174 ? 35.168 48.013 -10.546 1.00 34.22 ? 173  ASP A CA  1 
ATOM   1347 C C   . ASP A 1 174 ? 36.535 47.585 -9.986  1.00 34.46 ? 173  ASP A C   1 
ATOM   1348 O O   . ASP A 1 174 ? 37.536 48.290 -10.151 1.00 35.70 ? 173  ASP A O   1 
ATOM   1349 C CB  . ASP A 1 174 ? 34.725 49.376 -9.961  1.00 34.82 ? 173  ASP A CB  1 
ATOM   1350 C CG  . ASP A 1 174 ? 34.368 49.321 -8.469  1.00 34.88 ? 173  ASP A CG  1 
ATOM   1351 O OD1 . ASP A 1 174 ? 34.541 48.271 -7.816  1.00 35.19 ? 173  ASP A OD1 1 
ATOM   1352 O OD2 . ASP A 1 174 ? 33.914 50.359 -7.942  1.00 36.61 ? 173  ASP A OD2 1 
ATOM   1353 N N   . GLY A 1 175 ? 36.555 46.432 -9.318  1.00 34.27 ? 174  GLY A N   1 
ATOM   1354 C CA  . GLY A 1 175 ? 37.781 45.907 -8.738  1.00 34.76 ? 174  GLY A CA  1 
ATOM   1355 C C   . GLY A 1 175 ? 37.812 45.979 -7.226  1.00 34.71 ? 174  GLY A C   1 
ATOM   1356 O O   . GLY A 1 175 ? 38.691 45.387 -6.597  1.00 37.01 ? 174  GLY A O   1 
ATOM   1357 N N   . SER A 1 176 ? 36.875 46.728 -6.645  1.00 34.36 ? 175  SER A N   1 
ATOM   1358 C CA  . SER A 1 176 ? 36.765 46.900 -5.194  1.00 34.60 ? 175  SER A CA  1 
ATOM   1359 C C   . SER A 1 176 ? 36.025 45.716 -4.565  1.00 34.29 ? 175  SER A C   1 
ATOM   1360 O O   . SER A 1 176 ? 35.612 44.793 -5.273  1.00 34.00 ? 175  SER A O   1 
ATOM   1361 C CB  . SER A 1 176 ? 36.030 48.208 -4.886  1.00 34.62 ? 175  SER A CB  1 
ATOM   1362 O OG  . SER A 1 176 ? 35.979 48.463 -3.493  1.00 40.16 ? 175  SER A OG  1 
ATOM   1363 N N   . VAL A 1 177 ? 35.936 45.696 -3.234  1.00 34.35 ? 176  VAL A N   1 
ATOM   1364 C CA  . VAL A 1 177 ? 35.223 44.623 -2.542  1.00 34.42 ? 176  VAL A CA  1 
ATOM   1365 C C   . VAL A 1 177 ? 34.101 45.120 -1.628  1.00 34.02 ? 176  VAL A C   1 
ATOM   1366 O O   . VAL A 1 177 ? 34.149 46.237 -1.112  1.00 34.89 ? 176  VAL A O   1 
ATOM   1367 C CB  . VAL A 1 177 ? 36.161 43.605 -1.778  1.00 35.21 ? 176  VAL A CB  1 
ATOM   1368 C CG1 . VAL A 1 177 ? 36.996 42.783 -2.756  1.00 36.23 ? 176  VAL A CG1 1 
ATOM   1369 C CG2 . VAL A 1 177 ? 37.054 44.292 -0.807  1.00 36.53 ? 176  VAL A CG2 1 
ATOM   1370 N N   . GLN A 1 178 ? 33.038 44.322 -1.546  1.00 30.94 ? 177  GLN A N   1 
ATOM   1371 C CA  . GLN A 1 178 ? 31.878 44.606 -0.705  1.00 29.66 ? 177  GLN A CA  1 
ATOM   1372 C C   . GLN A 1 178 ? 31.977 43.646 0.480   1.00 28.64 ? 177  GLN A C   1 
ATOM   1373 O O   . GLN A 1 178 ? 31.851 42.432 0.320   1.00 27.38 ? 177  GLN A O   1 
ATOM   1374 C CB  . GLN A 1 178 ? 30.573 44.403 -1.504  1.00 27.46 ? 177  GLN A CB  1 
ATOM   1375 C CG  . GLN A 1 178 ? 29.246 44.357 -0.702  1.00 28.18 ? 177  GLN A CG  1 
ATOM   1376 C CD  . GLN A 1 178 ? 28.911 45.657 0.011   1.00 27.77 ? 177  GLN A CD  1 
ATOM   1377 O OE1 . GLN A 1 178 ? 28.627 46.665 -0.626  1.00 28.03 ? 177  GLN A OE1 1 
ATOM   1378 N NE2 . GLN A 1 178 ? 28.945 45.632 1.341   1.00 24.49 ? 177  GLN A NE2 1 
ATOM   1379 N N   . LEU A 1 179 ? 32.240 44.207 1.659   1.00 28.77 ? 178  LEU A N   1 
ATOM   1380 C CA  . LEU A 1 179 ? 32.375 43.425 2.880   1.00 30.10 ? 178  LEU A CA  1 
ATOM   1381 C C   . LEU A 1 179 ? 31.047 42.988 3.464   1.00 29.39 ? 178  LEU A C   1 
ATOM   1382 O O   . LEU A 1 179 ? 30.032 43.673 3.323   1.00 29.49 ? 178  LEU A O   1 
ATOM   1383 C CB  . LEU A 1 179 ? 33.181 44.195 3.927   1.00 32.66 ? 178  LEU A CB  1 
ATOM   1384 C CG  . LEU A 1 179 ? 34.702 44.130 3.757   1.00 37.25 ? 178  LEU A CG  1 
ATOM   1385 C CD1 . LEU A 1 179 ? 35.346 45.366 4.348   1.00 37.51 ? 178  LEU A CD1 1 
ATOM   1386 C CD2 . LEU A 1 179 ? 35.252 42.858 4.409   1.00 39.16 ? 178  LEU A CD2 1 
ATOM   1387 N N   . ALA A 1 180 ? 31.063 41.811 4.080   1.00 27.98 ? 179  ALA A N   1 
ATOM   1388 C CA  . ALA A 1 180 ? 29.883 41.247 4.706   1.00 28.39 ? 179  ALA A CA  1 
ATOM   1389 C C   . ALA A 1 180 ? 30.291 40.337 5.844   1.00 28.83 ? 179  ALA A C   1 
ATOM   1390 O O   . ALA A 1 180 ? 31.330 39.683 5.780   1.00 30.23 ? 179  ALA A O   1 
ATOM   1391 C CB  . ALA A 1 180 ? 29.033 40.485 3.688   1.00 28.79 ? 179  ALA A CB  1 
ATOM   1392 N N   . ASP A 1 181 ? 29.484 40.335 6.900   1.00 27.21 ? 180  ASP A N   1 
ATOM   1393 C CA  . ASP A 1 181 ? 29.732 39.504 8.066   1.00 27.92 ? 180  ASP A CA  1 
ATOM   1394 C C   . ASP A 1 181 ? 28.577 38.528 8.197   1.00 27.03 ? 180  ASP A C   1 
ATOM   1395 O O   . ASP A 1 181 ? 27.421 38.915 8.075   1.00 27.31 ? 180  ASP A O   1 
ATOM   1396 C CB  . ASP A 1 181 ? 29.840 40.374 9.327   1.00 30.32 ? 180  ASP A CB  1 
ATOM   1397 C CG  . ASP A 1 181 ? 30.079 39.556 10.600  1.00 33.92 ? 180  ASP A CG  1 
ATOM   1398 O OD1 . ASP A 1 181 ? 29.087 39.216 11.287  1.00 34.53 ? 180  ASP A OD1 1 
ATOM   1399 O OD2 . ASP A 1 181 ? 31.253 39.278 10.925  1.00 38.89 ? 180  ASP A OD2 1 
ATOM   1400 N N   . HIS A 1 182 ? 28.913 37.271 8.468   1.00 25.57 ? 181  HIS A N   1 
ATOM   1401 C CA  . HIS A 1 182 ? 27.937 36.202 8.648   1.00 25.33 ? 181  HIS A CA  1 
ATOM   1402 C C   . HIS A 1 182 ? 28.085 35.727 10.101  1.00 25.28 ? 181  HIS A C   1 
ATOM   1403 O O   . HIS A 1 182 ? 29.165 35.297 10.499  1.00 25.00 ? 181  HIS A O   1 
ATOM   1404 C CB  . HIS A 1 182 ? 28.229 35.066 7.635   1.00 24.86 ? 181  HIS A CB  1 
ATOM   1405 C CG  . HIS A 1 182 ? 27.329 33.865 7.747   1.00 26.68 ? 181  HIS A CG  1 
ATOM   1406 N ND1 . HIS A 1 182 ? 26.298 33.624 6.866   1.00 26.59 ? 181  HIS A ND1 1 
ATOM   1407 C CD2 . HIS A 1 182 ? 27.345 32.807 8.598   1.00 26.70 ? 181  HIS A CD2 1 
ATOM   1408 C CE1 . HIS A 1 182 ? 25.720 32.474 7.168   1.00 26.38 ? 181  HIS A CE1 1 
ATOM   1409 N NE2 . HIS A 1 182 ? 26.337 31.958 8.214   1.00 26.33 ? 181  HIS A NE2 1 
ATOM   1410 N N   . TYR A 1 183 ? 27.019 35.870 10.890  1.00 26.92 ? 182  TYR A N   1 
ATOM   1411 C CA  . TYR A 1 183 ? 27.000 35.418 12.287  1.00 28.07 ? 182  TYR A CA  1 
ATOM   1412 C C   . TYR A 1 183 ? 25.913 34.349 12.329  1.00 27.30 ? 182  TYR A C   1 
ATOM   1413 O O   . TYR A 1 183 ? 24.742 34.639 12.100  1.00 26.56 ? 182  TYR A O   1 
ATOM   1414 C CB  . TYR A 1 183 ? 26.688 36.564 13.264  1.00 31.87 ? 182  TYR A CB  1 
ATOM   1415 C CG  . TYR A 1 183 ? 27.009 36.234 14.718  1.00 38.23 ? 182  TYR A CG  1 
ATOM   1416 C CD1 . TYR A 1 183 ? 28.334 36.331 15.206  1.00 41.79 ? 182  TYR A CD1 1 
ATOM   1417 C CD2 . TYR A 1 183 ? 26.000 35.802 15.612  1.00 39.54 ? 182  TYR A CD2 1 
ATOM   1418 C CE1 . TYR A 1 183 ? 28.655 36.002 16.561  1.00 44.70 ? 182  TYR A CE1 1 
ATOM   1419 C CE2 . TYR A 1 183 ? 26.306 35.466 16.972  1.00 43.04 ? 182  TYR A CE2 1 
ATOM   1420 C CZ  . TYR A 1 183 ? 27.635 35.571 17.431  1.00 44.81 ? 182  TYR A CZ  1 
ATOM   1421 O OH  . TYR A 1 183 ? 27.943 35.258 18.737  1.00 47.30 ? 182  TYR A OH  1 
ATOM   1422 N N   . GLN A 1 184 ? 26.320 33.131 12.674  1.00 25.91 ? 183  GLN A N   1 
ATOM   1423 C CA  . GLN A 1 184 ? 25.454 31.957 12.704  1.00 26.06 ? 183  GLN A CA  1 
ATOM   1424 C C   . GLN A 1 184 ? 25.312 31.309 14.081  1.00 24.03 ? 183  GLN A C   1 
ATOM   1425 O O   . GLN A 1 184 ? 26.260 31.297 14.856  1.00 23.20 ? 183  GLN A O   1 
ATOM   1426 C CB  . GLN A 1 184 ? 26.040 30.954 11.705  1.00 25.01 ? 183  GLN A CB  1 
ATOM   1427 C CG  . GLN A 1 184 ? 25.405 29.585 11.605  1.00 28.86 ? 183  GLN A CG  1 
ATOM   1428 C CD  . GLN A 1 184 ? 26.217 28.647 10.724  1.00 28.07 ? 183  GLN A CD  1 
ATOM   1429 O OE1 . GLN A 1 184 ? 26.868 29.081 9.769   1.00 27.19 ? 183  GLN A OE1 1 
ATOM   1430 N NE2 . GLN A 1 184 ? 26.184 27.358 11.043  1.00 26.76 ? 183  GLN A NE2 1 
ATOM   1431 N N   . GLN A 1 185 ? 24.117 30.790 14.367  1.00 25.99 ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 185 ? 23.805 30.082 15.621  1.00 29.32 ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 185 ? 23.025 28.813 15.279  1.00 28.29 ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 185 ? 22.060 28.870 14.515  1.00 28.51 ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 185 ? 22.954 30.940 16.572  1.00 30.96 ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 185 ? 23.722 31.959 17.396  1.00 38.38 ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 185 ? 22.887 32.558 18.516  1.00 41.69 ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 185 ? 22.822 32.011 19.622  1.00 46.38 ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 185 ? 22.246 33.687 18.237  1.00 43.40 ? 184  GLN A NE2 1 
ATOM   1440 N N   . ASN A 1 186 ? 23.459 27.671 15.818  1.00 27.76 ? 185  ASN A N   1 
ATOM   1441 C CA  . ASN A 1 186 ? 22.796 26.379 15.578  1.00 28.07 ? 185  ASN A CA  1 
ATOM   1442 C C   . ASN A 1 186 ? 22.348 25.758 16.898  1.00 28.02 ? 185  ASN A C   1 
ATOM   1443 O O   . ASN A 1 186 ? 23.122 25.716 17.853  1.00 27.75 ? 185  ASN A O   1 
ATOM   1444 C CB  . ASN A 1 186 ? 23.734 25.376 14.893  1.00 27.23 ? 185  ASN A CB  1 
ATOM   1445 C CG  . ASN A 1 186 ? 24.213 25.826 13.527  1.00 28.22 ? 185  ASN A CG  1 
ATOM   1446 O OD1 . ASN A 1 186 ? 24.766 26.907 13.373  1.00 29.17 ? 185  ASN A OD1 1 
ATOM   1447 N ND2 . ASN A 1 186 ? 24.074 24.952 12.542  1.00 29.41 ? 185  ASN A ND2 1 
ATOM   1448 N N   . THR A 1 187 ? 21.121 25.237 16.923  1.00 28.00 ? 186  THR A N   1 
ATOM   1449 C CA  . THR A 1 187 ? 20.540 24.601 18.117  1.00 29.04 ? 186  THR A CA  1 
ATOM   1450 C C   . THR A 1 187 ? 19.816 23.314 17.678  1.00 27.39 ? 186  THR A C   1 
ATOM   1451 O O   . THR A 1 187 ? 18.941 23.376 16.809  1.00 27.67 ? 186  THR A O   1 
ATOM   1452 C CB  . THR A 1 187 ? 19.522 25.559 18.829  1.00 29.51 ? 186  THR A CB  1 
ATOM   1453 O OG1 . THR A 1 187 ? 20.146 26.825 19.078  1.00 30.66 ? 186  THR A OG1 1 
ATOM   1454 C CG2 . THR A 1 187 ? 19.070 24.982 20.173  1.00 30.99 ? 186  THR A CG2 1 
ATOM   1455 N N   . PRO A 1 188 ? 20.154 22.141 18.281  1.00 26.97 ? 187  PRO A N   1 
ATOM   1456 C CA  . PRO A 1 188 ? 19.515 20.863 17.923  1.00 26.06 ? 187  PRO A CA  1 
ATOM   1457 C C   . PRO A 1 188 ? 17.999 20.748 18.142  1.00 26.83 ? 187  PRO A C   1 
ATOM   1458 O O   . PRO A 1 188 ? 17.446 21.364 19.060  1.00 25.96 ? 187  PRO A O   1 
ATOM   1459 C CB  . PRO A 1 188 ? 20.306 19.834 18.741  1.00 26.05 ? 187  PRO A CB  1 
ATOM   1460 C CG  . PRO A 1 188 ? 20.801 20.616 19.913  1.00 28.08 ? 187  PRO A CG  1 
ATOM   1461 C CD  . PRO A 1 188 ? 21.223 21.909 19.276  1.00 27.01 ? 187  PRO A CD  1 
ATOM   1462 N N   . ILE A 1 189 ? 17.350 19.991 17.252  1.00 26.42 ? 188  ILE A N   1 
ATOM   1463 C CA  . ILE A 1 189 ? 15.902 19.744 17.276  1.00 27.84 ? 188  ILE A CA  1 
ATOM   1464 C C   . ILE A 1 189 ? 15.566 18.585 18.223  1.00 29.97 ? 188  ILE A C   1 
ATOM   1465 O O   . ILE A 1 189 ? 14.676 18.714 19.066  1.00 31.98 ? 188  ILE A O   1 
ATOM   1466 C CB  . ILE A 1 189 ? 15.354 19.446 15.828  1.00 26.89 ? 188  ILE A CB  1 
ATOM   1467 C CG1 . ILE A 1 189 ? 15.412 20.724 14.975  1.00 26.35 ? 188  ILE A CG1 1 
ATOM   1468 C CG2 . ILE A 1 189 ? 13.894 18.925 15.858  1.00 26.02 ? 188  ILE A CG2 1 
ATOM   1469 C CD1 . ILE A 1 189 ? 15.155 20.522 13.476  1.00 24.40 ? 188  ILE A CD1 1 
ATOM   1470 N N   . GLY A 1 190 ? 16.290 17.473 18.078  1.00 31.40 ? 189  GLY A N   1 
ATOM   1471 C CA  . GLY A 1 190 ? 16.055 16.294 18.903  1.00 33.75 ? 189  GLY A CA  1 
ATOM   1472 C C   . GLY A 1 190 ? 16.608 16.328 20.316  1.00 35.19 ? 189  GLY A C   1 
ATOM   1473 O O   . GLY A 1 190 ? 17.398 17.210 20.663  1.00 34.95 ? 189  GLY A O   1 
ATOM   1474 N N   . ASP A 1 191 ? 16.187 15.353 21.124  1.00 37.43 ? 190  ASP A N   1 
ATOM   1475 C CA  . ASP A 1 191 ? 16.619 15.230 22.520  1.00 40.02 ? 190  ASP A CA  1 
ATOM   1476 C C   . ASP A 1 191 ? 17.904 14.410 22.710  1.00 39.75 ? 190  ASP A C   1 
ATOM   1477 O O   . ASP A 1 191 ? 18.401 14.274 23.833  1.00 41.69 ? 190  ASP A O   1 
ATOM   1478 C CB  . ASP A 1 191 ? 15.476 14.689 23.411  1.00 41.67 ? 190  ASP A CB  1 
ATOM   1479 C CG  . ASP A 1 191 ? 14.757 13.473 22.812  1.00 44.98 ? 190  ASP A CG  1 
ATOM   1480 O OD1 . ASP A 1 191 ? 13.506 13.496 22.768  1.00 46.92 ? 190  ASP A OD1 1 
ATOM   1481 O OD2 . ASP A 1 191 ? 15.425 12.494 22.404  1.00 44.95 ? 190  ASP A OD2 1 
ATOM   1482 N N   . GLY A 1 192 ? 18.443 13.899 21.600  1.00 38.69 ? 191  GLY A N   1 
ATOM   1483 C CA  . GLY A 1 192 ? 19.661 13.101 21.622  1.00 35.11 ? 191  GLY A CA  1 
ATOM   1484 C C   . GLY A 1 192 ? 20.937 13.895 21.878  1.00 33.52 ? 191  GLY A C   1 
ATOM   1485 O O   . GLY A 1 192 ? 20.925 15.123 21.755  1.00 33.50 ? 191  GLY A O   1 
ATOM   1486 N N   . PRO A 1 193 ? 22.061 13.228 22.211  1.00 31.33 ? 192  PRO A N   1 
ATOM   1487 C CA  . PRO A 1 193 ? 23.334 13.908 22.478  1.00 30.01 ? 192  PRO A CA  1 
ATOM   1488 C C   . PRO A 1 193 ? 24.053 14.412 21.224  1.00 28.20 ? 192  PRO A C   1 
ATOM   1489 O O   . PRO A 1 193 ? 23.983 13.795 20.155  1.00 26.36 ? 192  PRO A O   1 
ATOM   1490 C CB  . PRO A 1 193 ? 24.141 12.830 23.188  1.00 29.56 ? 192  PRO A CB  1 
ATOM   1491 C CG  . PRO A 1 193 ? 23.725 11.588 22.475  1.00 31.70 ? 192  PRO A CG  1 
ATOM   1492 C CD  . PRO A 1 193 ? 22.222 11.765 22.317  1.00 31.22 ? 192  PRO A CD  1 
ATOM   1493 N N   . VAL A 1 194 ? 24.693 15.567 21.364  1.00 26.46 ? 193  VAL A N   1 
ATOM   1494 C CA  . VAL A 1 194 ? 25.451 16.178 20.280  1.00 27.32 ? 193  VAL A CA  1 
ATOM   1495 C C   . VAL A 1 194 ? 26.896 16.373 20.711  1.00 28.45 ? 193  VAL A C   1 
ATOM   1496 O O   . VAL A 1 194 ? 27.204 16.345 21.911  1.00 28.78 ? 193  VAL A O   1 
ATOM   1497 C CB  . VAL A 1 194 ? 24.855 17.544 19.826  1.00 26.15 ? 193  VAL A CB  1 
ATOM   1498 C CG1 . VAL A 1 194 ? 23.516 17.334 19.126  1.00 25.51 ? 193  VAL A CG1 1 
ATOM   1499 C CG2 . VAL A 1 194 ? 24.699 18.500 21.010  1.00 26.04 ? 193  VAL A CG2 1 
ATOM   1500 N N   . LEU A 1 195 ? 27.777 16.537 19.727  1.00 28.94 ? 194  LEU A N   1 
ATOM   1501 C CA  . LEU A 1 195 ? 29.197 16.763 19.986  1.00 29.59 ? 194  LEU A CA  1 
ATOM   1502 C C   . LEU A 1 195 ? 29.445 18.261 20.070  1.00 30.15 ? 194  LEU A C   1 
ATOM   1503 O O   . LEU A 1 195 ? 29.123 18.999 19.138  1.00 30.22 ? 194  LEU A O   1 
ATOM   1504 C CB  . LEU A 1 195 ? 30.063 16.147 18.880  1.00 28.16 ? 194  LEU A CB  1 
ATOM   1505 C CG  . LEU A 1 195 ? 30.107 14.622 18.724  1.00 29.15 ? 194  LEU A CG  1 
ATOM   1506 C CD1 . LEU A 1 195 ? 30.765 14.282 17.394  1.00 29.18 ? 194  LEU A CD1 1 
ATOM   1507 C CD2 . LEU A 1 195 ? 30.832 13.948 19.888  1.00 29.62 ? 194  LEU A CD2 1 
ATOM   1508 N N   . LEU A 1 196 ? 29.908 18.708 21.236  1.00 30.81 ? 195  LEU A N   1 
ATOM   1509 C CA  . LEU A 1 196 ? 30.229 20.117 21.476  1.00 31.10 ? 195  LEU A CA  1 
ATOM   1510 C C   . LEU A 1 196 ? 31.721 20.285 21.175  1.00 29.56 ? 195  LEU A C   1 
ATOM   1511 O O   . LEU A 1 196 ? 32.570 19.758 21.898  1.00 28.65 ? 195  LEU A O   1 
ATOM   1512 C CB  . LEU A 1 196 ? 29.892 20.514 22.919  1.00 33.98 ? 195  LEU A CB  1 
ATOM   1513 C CG  . LEU A 1 196 ? 28.404 20.462 23.288  1.00 37.02 ? 195  LEU A CG  1 
ATOM   1514 C CD1 . LEU A 1 196 ? 28.228 20.646 24.784  1.00 38.71 ? 195  LEU A CD1 1 
ATOM   1515 C CD2 . LEU A 1 196 ? 27.625 21.522 22.511  1.00 38.42 ? 195  LEU A CD2 1 
ATOM   1516 N N   . PRO A 1 197 ? 32.057 21.013 20.090  1.00 27.47 ? 196  PRO A N   1 
ATOM   1517 C CA  . PRO A 1 197 ? 33.447 21.233 19.683  1.00 25.49 ? 196  PRO A CA  1 
ATOM   1518 C C   . PRO A 1 197 ? 34.274 22.307 20.362  1.00 25.51 ? 196  PRO A C   1 
ATOM   1519 O O   . PRO A 1 197 ? 33.746 23.252 20.949  1.00 25.65 ? 196  PRO A O   1 
ATOM   1520 C CB  . PRO A 1 197 ? 33.293 21.586 18.211  1.00 26.57 ? 196  PRO A CB  1 
ATOM   1521 C CG  . PRO A 1 197 ? 32.064 22.419 18.197  1.00 25.57 ? 196  PRO A CG  1 
ATOM   1522 C CD  . PRO A 1 197 ? 31.132 21.647 19.125  1.00 27.24 ? 196  PRO A CD  1 
ATOM   1523 N N   . ASP A 1 198 ? 35.590 22.159 20.213  1.00 25.64 ? 197  ASP A N   1 
ATOM   1524 C CA  . ASP A 1 198 ? 36.559 23.144 20.680  1.00 25.66 ? 197  ASP A CA  1 
ATOM   1525 C C   . ASP A 1 198 ? 36.657 24.063 19.462  1.00 25.86 ? 197  ASP A C   1 
ATOM   1526 O O   . ASP A 1 198 ? 36.181 23.699 18.366  1.00 24.54 ? 197  ASP A O   1 
ATOM   1527 C CB  . ASP A 1 198 ? 37.935 22.513 20.929  1.00 27.89 ? 197  ASP A CB  1 
ATOM   1528 C CG  . ASP A 1 198 ? 37.995 21.691 22.204  1.00 29.64 ? 197  ASP A CG  1 
ATOM   1529 O OD1 . ASP A 1 198 ? 37.257 21.995 23.168  1.00 32.26 ? 197  ASP A OD1 1 
ATOM   1530 O OD2 . ASP A 1 198 ? 38.813 20.750 22.247  1.00 29.24 ? 197  ASP A OD2 1 
ATOM   1531 N N   . ASN A 1 199 ? 37.279 25.228 19.633  1.00 24.94 ? 198  ASN A N   1 
ATOM   1532 C CA  . ASN A 1 199 ? 37.436 26.187 18.536  1.00 25.05 ? 198  ASN A CA  1 
ATOM   1533 C C   . ASN A 1 199 ? 38.203 25.611 17.348  1.00 26.39 ? 198  ASN A C   1 
ATOM   1534 O O   . ASN A 1 199 ? 39.263 25.000 17.511  1.00 26.57 ? 198  ASN A O   1 
ATOM   1535 C CB  . ASN A 1 199 ? 38.131 27.464 19.017  1.00 24.96 ? 198  ASN A CB  1 
ATOM   1536 C CG  . ASN A 1 199 ? 37.287 28.267 19.988  1.00 27.37 ? 198  ASN A CG  1 
ATOM   1537 O OD1 . ASN A 1 199 ? 36.158 27.893 20.324  1.00 27.10 ? 198  ASN A OD1 1 
ATOM   1538 N ND2 . ASN A 1 199 ? 37.838 29.382 20.451  1.00 29.87 ? 198  ASN A ND2 1 
ATOM   1539 N N   . HIS A 1 200 ? 37.575 25.703 16.179  1.00 23.74 ? 199  HIS A N   1 
ATOM   1540 C CA  . HIS A 1 200 ? 38.154 25.237 14.927  1.00 23.65 ? 199  HIS A CA  1 
ATOM   1541 C C   . HIS A 1 200 ? 37.504 25.998 13.780  1.00 23.93 ? 199  HIS A C   1 
ATOM   1542 O O   . HIS A 1 200 ? 36.666 26.881 14.006  1.00 24.06 ? 199  HIS A O   1 
ATOM   1543 C CB  . HIS A 1 200 ? 38.015 23.702 14.764  1.00 21.70 ? 199  HIS A CB  1 
ATOM   1544 C CG  . HIS A 1 200 ? 36.619 23.217 14.498  1.00 21.36 ? 199  HIS A CG  1 
ATOM   1545 N ND1 . HIS A 1 200 ? 35.651 23.141 15.477  1.00 21.09 ? 199  HIS A ND1 1 
ATOM   1546 C CD2 . HIS A 1 200 ? 36.038 22.769 13.359  1.00 20.39 ? 199  HIS A CD2 1 
ATOM   1547 C CE1 . HIS A 1 200 ? 34.535 22.670 14.950  1.00 19.95 ? 199  HIS A CE1 1 
ATOM   1548 N NE2 . HIS A 1 200 ? 34.743 22.438 13.667  1.00 18.66 ? 199  HIS A NE2 1 
ATOM   1549 N N   . TYR A 1 201 ? 37.898 25.659 12.557  1.00 23.54 ? 200  TYR A N   1 
ATOM   1550 C CA  . TYR A 1 201 ? 37.343 26.302 11.377  1.00 23.92 ? 200  TYR A CA  1 
ATOM   1551 C C   . TYR A 1 201 ? 37.125 25.338 10.219  1.00 23.00 ? 200  TYR A C   1 
ATOM   1552 O O   . TYR A 1 201 ? 37.667 24.233 10.211  1.00 20.64 ? 200  TYR A O   1 
ATOM   1553 C CB  . TYR A 1 201 ? 38.203 27.508 10.931  1.00 23.08 ? 200  TYR A CB  1 
ATOM   1554 C CG  . TYR A 1 201 ? 39.621 27.211 10.459  1.00 25.86 ? 200  TYR A CG  1 
ATOM   1555 C CD1 . TYR A 1 201 ? 39.894 26.957 9.091   1.00 26.19 ? 200  TYR A CD1 1 
ATOM   1556 C CD2 . TYR A 1 201 ? 40.702 27.209 11.364  1.00 26.26 ? 200  TYR A CD2 1 
ATOM   1557 C CE1 . TYR A 1 201 ? 41.213 26.710 8.633   1.00 26.39 ? 200  TYR A CE1 1 
ATOM   1558 C CE2 . TYR A 1 201 ? 42.034 26.962 10.915  1.00 27.26 ? 200  TYR A CE2 1 
ATOM   1559 C CZ  . TYR A 1 201 ? 42.274 26.713 9.550   1.00 27.31 ? 200  TYR A CZ  1 
ATOM   1560 O OH  . TYR A 1 201 ? 43.551 26.464 9.107   1.00 28.59 ? 200  TYR A OH  1 
ATOM   1561 N N   . LEU A 1 202 ? 36.298 25.765 9.267   1.00 22.24 ? 201  LEU A N   1 
ATOM   1562 C CA  . LEU A 1 202 ? 36.027 24.996 8.059   1.00 22.79 ? 201  LEU A CA  1 
ATOM   1563 C C   . LEU A 1 202 ? 36.624 25.805 6.917   1.00 25.25 ? 201  LEU A C   1 
ATOM   1564 O O   . LEU A 1 202 ? 36.279 26.973 6.737   1.00 25.07 ? 201  LEU A O   1 
ATOM   1565 C CB  . LEU A 1 202 ? 34.524 24.821 7.812   1.00 23.00 ? 201  LEU A CB  1 
ATOM   1566 C CG  . LEU A 1 202 ? 33.600 24.196 8.854   1.00 20.55 ? 201  LEU A CG  1 
ATOM   1567 C CD1 . LEU A 1 202 ? 32.168 24.262 8.375   1.00 22.25 ? 201  LEU A CD1 1 
ATOM   1568 C CD2 . LEU A 1 202 ? 33.992 22.776 9.159   1.00 22.14 ? 201  LEU A CD2 1 
ATOM   1569 N N   . SER A 1 203 ? 37.556 25.193 6.191   1.00 24.70 ? 202  SER A N   1 
ATOM   1570 C CA  . SER A 1 203 ? 38.215 25.818 5.048   1.00 24.86 ? 202  SER A CA  1 
ATOM   1571 C C   . SER A 1 203 ? 37.356 25.519 3.822   1.00 25.28 ? 202  SER A C   1 
ATOM   1572 O O   . SER A 1 203 ? 37.147 24.356 3.466   1.00 23.64 ? 202  SER A O   1 
ATOM   1573 C CB  . SER A 1 203 ? 39.632 25.255 4.881   1.00 24.14 ? 202  SER A CB  1 
ATOM   1574 O OG  . SER A 1 203 ? 40.281 25.822 3.756   1.00 28.59 ? 202  SER A OG  1 
ATOM   1575 N N   . THR A 1 204 ? 36.817 26.576 3.218   1.00 25.79 ? 203  THR A N   1 
ATOM   1576 C CA  . THR A 1 204 ? 35.950 26.436 2.055   1.00 27.18 ? 203  THR A CA  1 
ATOM   1577 C C   . THR A 1 204 ? 36.519 27.053 0.789   1.00 27.18 ? 203  THR A C   1 
ATOM   1578 O O   . THR A 1 204 ? 37.282 28.013 0.847   1.00 26.70 ? 203  THR A O   1 
ATOM   1579 C CB  . THR A 1 204 ? 34.547 27.101 2.273   1.00 28.48 ? 203  THR A CB  1 
ATOM   1580 O OG1 . THR A 1 204 ? 34.682 28.531 2.280   1.00 33.26 ? 203  THR A OG1 1 
ATOM   1581 C CG2 . THR A 1 204 ? 33.906 26.657 3.582   1.00 27.90 ? 203  THR A CG2 1 
ATOM   1582 N N   . GLN A 1 205 ? 36.163 26.454 -0.344  1.00 26.19 ? 204  GLN A N   1 
ATOM   1583 C CA  . GLN A 1 205 ? 36.522 26.956 -1.671  1.00 27.71 ? 204  GLN A CA  1 
ATOM   1584 C C   . GLN A 1 205 ? 35.336 26.644 -2.572  1.00 25.71 ? 204  GLN A C   1 
ATOM   1585 O O   . GLN A 1 205 ? 34.742 25.565 -2.476  1.00 21.90 ? 204  GLN A O   1 
ATOM   1586 C CB  . GLN A 1 205 ? 37.861 26.425 -2.206  1.00 29.92 ? 204  GLN A CB  1 
ATOM   1587 C CG  . GLN A 1 205 ? 38.105 24.946 -2.155  1.00 34.58 ? 204  GLN A CG  1 
ATOM   1588 C CD  . GLN A 1 205 ? 39.482 24.602 -2.686  1.00 37.28 ? 204  GLN A CD  1 
ATOM   1589 O OE1 . GLN A 1 205 ? 40.454 24.549 -1.932  1.00 39.36 ? 204  GLN A OE1 1 
ATOM   1590 N NE2 . GLN A 1 205 ? 39.577 24.394 -3.996  1.00 38.20 ? 204  GLN A NE2 1 
ATOM   1591 N N   . SER A 1 206 ? 34.939 27.638 -3.363  1.00 25.47 ? 205  SER A N   1 
ATOM   1592 C CA  . SER A 1 206 ? 33.774 27.525 -4.232  1.00 25.68 ? 205  SER A CA  1 
ATOM   1593 C C   . SER A 1 206 ? 33.970 27.957 -5.677  1.00 25.66 ? 205  SER A C   1 
ATOM   1594 O O   . SER A 1 206 ? 34.677 28.928 -5.957  1.00 28.19 ? 205  SER A O   1 
ATOM   1595 C CB  . SER A 1 206 ? 32.638 28.362 -3.649  1.00 25.39 ? 205  SER A CB  1 
ATOM   1596 O OG  . SER A 1 206 ? 32.482 28.136 -2.261  1.00 25.60 ? 205  SER A OG  1 
ATOM   1597 N N   . ALA A 1 207 ? 33.305 27.238 -6.581  1.00 25.18 ? 206  ALA A N   1 
ATOM   1598 C CA  . ALA A 1 207 ? 33.328 27.527 -8.014  1.00 22.56 ? 206  ALA A CA  1 
ATOM   1599 C C   . ALA A 1 207 ? 31.878 27.695 -8.451  1.00 21.69 ? 206  ALA A C   1 
ATOM   1600 O O   . ALA A 1 207 ? 31.042 26.805 -8.249  1.00 18.05 ? 206  ALA A O   1 
ATOM   1601 C CB  . ALA A 1 207 ? 33.994 26.395 -8.795  1.00 22.52 ? 206  ALA A CB  1 
ATOM   1602 N N   . LEU A 1 208 ? 31.578 28.883 -8.967  1.00 21.59 ? 207  LEU A N   1 
ATOM   1603 C CA  . LEU A 1 208 ? 30.247 29.230 -9.449  1.00 21.82 ? 207  LEU A CA  1 
ATOM   1604 C C   . LEU A 1 208 ? 30.224 29.135 -10.966 1.00 21.88 ? 207  LEU A C   1 
ATOM   1605 O O   . LEU A 1 208 ? 31.154 29.589 -11.638 1.00 22.35 ? 207  LEU A O   1 
ATOM   1606 C CB  . LEU A 1 208 ? 29.864 30.642 -8.983  1.00 20.81 ? 207  LEU A CB  1 
ATOM   1607 C CG  . LEU A 1 208 ? 29.199 30.827 -7.609  1.00 23.82 ? 207  LEU A CG  1 
ATOM   1608 C CD1 . LEU A 1 208 ? 30.001 30.215 -6.480  1.00 24.91 ? 207  LEU A CD1 1 
ATOM   1609 C CD2 . LEU A 1 208 ? 28.960 32.303 -7.342  1.00 23.41 ? 207  LEU A CD2 1 
ATOM   1610 N N   . SER A 1 209 ? 29.173 28.513 -11.495 1.00 20.67 ? 208  SER A N   1 
ATOM   1611 C CA  . SER A 1 209 ? 29.014 28.339 -12.937 1.00 21.58 ? 208  SER A CA  1 
ATOM   1612 C C   . SER A 1 209 ? 27.552 28.390 -13.372 1.00 22.30 ? 208  SER A C   1 
ATOM   1613 O O   . SER A 1 209 ? 26.653 28.630 -12.559 1.00 21.23 ? 208  SER A O   1 
ATOM   1614 C CB  . SER A 1 209 ? 29.664 27.022 -13.394 1.00 21.47 ? 208  SER A CB  1 
ATOM   1615 O OG  . SER A 1 209 ? 29.146 25.910 -12.688 1.00 19.69 ? 208  SER A OG  1 
ATOM   1616 N N   . LYS A 1 210 ? 27.338 28.243 -14.678 1.00 23.11 ? 209  LYS A N   1 
ATOM   1617 C CA  . LYS A 1 210 ? 26.007 28.241 -15.272 1.00 22.61 ? 209  LYS A CA  1 
ATOM   1618 C C   . LYS A 1 210 ? 25.823 26.949 -16.065 1.00 25.78 ? 209  LYS A C   1 
ATOM   1619 O O   . LYS A 1 210 ? 26.800 26.332 -16.504 1.00 25.95 ? 209  LYS A O   1 
ATOM   1620 C CB  . LYS A 1 210 ? 25.830 29.429 -16.240 1.00 22.62 ? 209  LYS A CB  1 
ATOM   1621 C CG  . LYS A 1 210 ? 25.926 30.845 -15.642 1.00 21.33 ? 209  LYS A CG  1 
ATOM   1622 C CD  . LYS A 1 210 ? 24.813 31.144 -14.638 1.00 20.46 ? 209  LYS A CD  1 
ATOM   1623 C CE  . LYS A 1 210 ? 24.796 32.612 -14.259 1.00 18.74 ? 209  LYS A CE  1 
ATOM   1624 N NZ  . LYS A 1 210 ? 23.844 32.881 -13.141 1.00 20.08 ? 209  LYS A NZ  1 
ATOM   1625 N N   . ASP A 1 211 ? 24.567 26.531 -16.206 1.00 28.20 ? 210  ASP A N   1 
ATOM   1626 C CA  . ASP A 1 211 ? 24.192 25.353 -16.993 1.00 29.84 ? 210  ASP A CA  1 
ATOM   1627 C C   . ASP A 1 211 ? 23.863 26.001 -18.356 1.00 30.28 ? 210  ASP A C   1 
ATOM   1628 O O   . ASP A 1 211 ? 22.936 26.817 -18.445 1.00 27.93 ? 210  ASP A O   1 
ATOM   1629 C CB  . ASP A 1 211 ? 22.950 24.682 -16.371 1.00 32.85 ? 210  ASP A CB  1 
ATOM   1630 C CG  . ASP A 1 211 ? 22.555 23.363 -17.055 1.00 37.34 ? 210  ASP A CG  1 
ATOM   1631 O OD1 . ASP A 1 211 ? 22.544 23.279 -18.305 1.00 37.64 ? 210  ASP A OD1 1 
ATOM   1632 O OD2 . ASP A 1 211 ? 22.217 22.409 -16.319 1.00 38.72 ? 210  ASP A OD2 1 
ATOM   1633 N N   . PRO A 1 212 ? 24.644 25.681 -19.418 1.00 31.56 ? 211  PRO A N   1 
ATOM   1634 C CA  . PRO A 1 212 ? 24.429 26.247 -20.765 1.00 32.13 ? 211  PRO A CA  1 
ATOM   1635 C C   . PRO A 1 212 ? 23.044 26.051 -21.393 1.00 31.97 ? 211  PRO A C   1 
ATOM   1636 O O   . PRO A 1 212 ? 22.595 26.880 -22.190 1.00 32.63 ? 211  PRO A O   1 
ATOM   1637 C CB  . PRO A 1 212 ? 25.535 25.587 -21.598 1.00 32.31 ? 211  PRO A CB  1 
ATOM   1638 C CG  . PRO A 1 212 ? 25.780 24.276 -20.884 1.00 32.88 ? 211  PRO A CG  1 
ATOM   1639 C CD  . PRO A 1 212 ? 25.762 24.715 -19.441 1.00 31.20 ? 211  PRO A CD  1 
ATOM   1640 N N   . ASN A 1 213 ? 22.352 24.992 -20.974 1.00 32.86 ? 212  ASN A N   1 
ATOM   1641 C CA  . ASN A 1 213 ? 21.018 24.666 -21.490 1.00 34.33 ? 212  ASN A CA  1 
ATOM   1642 C C   . ASN A 1 213 ? 19.868 25.180 -20.603 1.00 33.74 ? 212  ASN A C   1 
ATOM   1643 O O   . ASN A 1 213 ? 18.708 24.797 -20.799 1.00 34.24 ? 212  ASN A O   1 
ATOM   1644 C CB  . ASN A 1 213 ? 20.894 23.145 -21.689 1.00 36.58 ? 212  ASN A CB  1 
ATOM   1645 C CG  . ASN A 1 213 ? 21.968 22.579 -22.618 1.00 37.60 ? 212  ASN A CG  1 
ATOM   1646 O OD1 . ASN A 1 213 ? 22.226 23.113 -23.700 1.00 39.40 ? 212  ASN A OD1 1 
ATOM   1647 N ND2 . ASN A 1 213 ? 22.603 21.496 -22.188 1.00 38.45 ? 212  ASN A ND2 1 
ATOM   1648 N N   . GLU A 1 214 ? 20.185 26.080 -19.668 1.00 30.37 ? 213  GLU A N   1 
ATOM   1649 C CA  . GLU A 1 214 ? 19.188 26.627 -18.749 1.00 28.35 ? 213  GLU A CA  1 
ATOM   1650 C C   . GLU A 1 214 ? 18.859 28.103 -18.984 1.00 27.16 ? 213  GLU A C   1 
ATOM   1651 O O   . GLU A 1 214 ? 19.740 28.961 -18.915 1.00 27.57 ? 213  GLU A O   1 
ATOM   1652 C CB  . GLU A 1 214 ? 19.636 26.390 -17.299 1.00 26.03 ? 213  GLU A CB  1 
ATOM   1653 C CG  . GLU A 1 214 ? 18.666 26.853 -16.208 1.00 22.43 ? 213  GLU A CG  1 
ATOM   1654 C CD  . GLU A 1 214 ? 17.380 26.071 -16.190 1.00 22.00 ? 213  GLU A CD  1 
ATOM   1655 O OE1 . GLU A 1 214 ? 17.381 24.938 -15.668 1.00 22.63 ? 213  GLU A OE1 1 
ATOM   1656 O OE2 . GLU A 1 214 ? 16.369 26.598 -16.694 1.00 21.86 ? 213  GLU A OE2 1 
ATOM   1657 N N   . LYS A 1 215 ? 17.571 28.379 -19.201 1.00 27.51 ? 214  LYS A N   1 
ATOM   1658 C CA  . LYS A 1 215 ? 17.066 29.732 -19.446 1.00 29.61 ? 214  LYS A CA  1 
ATOM   1659 C C   . LYS A 1 215 ? 16.580 30.454 -18.182 1.00 28.33 ? 214  LYS A C   1 
ATOM   1660 O O   . LYS A 1 215 ? 16.460 31.684 -18.170 1.00 28.14 ? 214  LYS A O   1 
ATOM   1661 C CB  . LYS A 1 215 ? 15.938 29.707 -20.488 1.00 34.20 ? 214  LYS A CB  1 
ATOM   1662 C CG  . LYS A 1 215 ? 16.385 29.500 -21.936 1.00 38.39 ? 214  LYS A CG  1 
ATOM   1663 C CD  . LYS A 1 215 ? 16.241 28.049 -22.374 1.00 42.38 ? 214  LYS A CD  1 
ATOM   1664 C CE  . LYS A 1 215 ? 16.399 27.901 -23.884 1.00 44.39 ? 214  LYS A CE  1 
ATOM   1665 N NZ  . LYS A 1 215 ? 15.276 28.533 -24.640 1.00 45.56 ? 214  LYS A NZ  1 
ATOM   1666 N N   . ARG A 1 216 ? 16.294 29.689 -17.127 1.00 26.07 ? 215  ARG A N   1 
ATOM   1667 C CA  . ARG A 1 216 ? 15.833 30.250 -15.849 1.00 22.30 ? 215  ARG A CA  1 
ATOM   1668 C C   . ARG A 1 216 ? 17.031 30.816 -15.088 1.00 21.66 ? 215  ARG A C   1 
ATOM   1669 O O   . ARG A 1 216 ? 18.169 30.400 -15.333 1.00 22.20 ? 215  ARG A O   1 
ATOM   1670 C CB  . ARG A 1 216 ? 15.144 29.168 -14.999 1.00 23.33 ? 215  ARG A CB  1 
ATOM   1671 C CG  . ARG A 1 216 ? 13.843 28.616 -15.586 1.00 20.02 ? 215  ARG A CG  1 
ATOM   1672 C CD  . ARG A 1 216 ? 13.347 27.374 -14.827 1.00 22.59 ? 215  ARG A CD  1 
ATOM   1673 N NE  . ARG A 1 216 ? 14.177 26.196 -15.110 1.00 21.56 ? 215  ARG A NE  1 
ATOM   1674 C CZ  . ARG A 1 216 ? 14.065 25.010 -14.511 1.00 22.46 ? 215  ARG A CZ  1 
ATOM   1675 N NH1 . ARG A 1 216 ? 13.146 24.796 -13.569 1.00 20.30 ? 215  ARG A NH1 1 
ATOM   1676 N NH2 . ARG A 1 216 ? 14.897 24.031 -14.845 1.00 21.67 ? 215  ARG A NH2 1 
ATOM   1677 N N   . ASP A 1 217 ? 16.780 31.786 -14.201 1.00 21.12 ? 216  ASP A N   1 
ATOM   1678 C CA  . ASP A 1 217 ? 17.835 32.401 -13.386 1.00 19.98 ? 216  ASP A CA  1 
ATOM   1679 C C   . ASP A 1 217 ? 18.319 31.298 -12.440 1.00 20.44 ? 216  ASP A C   1 
ATOM   1680 O O   . ASP A 1 217 ? 17.521 30.720 -11.688 1.00 19.89 ? 216  ASP A O   1 
ATOM   1681 C CB  . ASP A 1 217 ? 17.281 33.598 -12.604 1.00 19.98 ? 216  ASP A CB  1 
ATOM   1682 C CG  . ASP A 1 217 ? 18.358 34.610 -12.215 1.00 20.96 ? 216  ASP A CG  1 
ATOM   1683 O OD1 . ASP A 1 217 ? 19.559 34.389 -12.496 1.00 20.36 ? 216  ASP A OD1 1 
ATOM   1684 O OD2 . ASP A 1 217 ? 17.987 35.648 -11.626 1.00 22.22 ? 216  ASP A OD2 1 
ATOM   1685 N N   . HIS A 1 218 ? 19.607 30.971 -12.538 1.00 18.81 ? 217  HIS A N   1 
ATOM   1686 C CA  . HIS A 1 218 ? 20.178 29.879 -11.758 1.00 19.43 ? 217  HIS A CA  1 
ATOM   1687 C C   . HIS A 1 218 ? 21.636 30.040 -11.317 1.00 18.88 ? 217  HIS A C   1 
ATOM   1688 O O   . HIS A 1 218 ? 22.331 30.976 -11.725 1.00 18.87 ? 217  HIS A O   1 
ATOM   1689 C CB  . HIS A 1 218 ? 20.044 28.571 -12.567 1.00 19.81 ? 217  HIS A CB  1 
ATOM   1690 C CG  . HIS A 1 218 ? 20.916 28.526 -13.783 1.00 21.73 ? 217  HIS A CG  1 
ATOM   1691 N ND1 . HIS A 1 218 ? 20.774 29.412 -14.830 1.00 23.70 ? 217  HIS A ND1 1 
ATOM   1692 C CD2 . HIS A 1 218 ? 21.981 27.748 -14.090 1.00 21.28 ? 217  HIS A CD2 1 
ATOM   1693 C CE1 . HIS A 1 218 ? 21.717 29.186 -15.727 1.00 22.00 ? 217  HIS A CE1 1 
ATOM   1694 N NE2 . HIS A 1 218 ? 22.462 28.181 -15.302 1.00 23.82 ? 217  HIS A NE2 1 
ATOM   1695 N N   . MET A 1 219 ? 22.087 29.071 -10.517 1.00 16.93 ? 218  MET A N   1 
ATOM   1696 C CA  . MET A 1 219 ? 23.458 28.997 -10.025 1.00 16.89 ? 218  MET A CA  1 
ATOM   1697 C C   . MET A 1 219 ? 23.886 27.556 -9.795  1.00 18.48 ? 218  MET A C   1 
ATOM   1698 O O   . MET A 1 219 ? 23.243 26.818 -9.039  1.00 18.81 ? 218  MET A O   1 
ATOM   1699 C CB  . MET A 1 219 ? 23.660 29.795 -8.725  1.00 17.22 ? 218  MET A CB  1 
ATOM   1700 C CG  . MET A 1 219 ? 25.083 29.689 -8.116  1.00 15.97 ? 218  MET A CG  1 
ATOM   1701 S SD  . MET A 1 219 ? 25.415 30.729 -6.675  1.00 19.02 ? 218  MET A SD  1 
ATOM   1702 C CE  . MET A 1 219 ? 24.398 29.938 -5.397  1.00 12.80 ? 218  MET A CE  1 
ATOM   1703 N N   . VAL A 1 220 ? 24.977 27.171 -10.452 1.00 17.23 ? 219  VAL A N   1 
ATOM   1704 C CA  . VAL A 1 220 ? 25.556 25.841 -10.287 1.00 18.19 ? 219  VAL A CA  1 
ATOM   1705 C C   . VAL A 1 220 ? 26.747 26.080 -9.366  1.00 17.79 ? 219  VAL A C   1 
ATOM   1706 O O   . VAL A 1 220 ? 27.572 26.962 -9.615  1.00 17.59 ? 219  VAL A O   1 
ATOM   1707 C CB  . VAL A 1 220 ? 26.014 25.204 -11.632 1.00 17.78 ? 219  VAL A CB  1 
ATOM   1708 C CG1 . VAL A 1 220 ? 26.776 23.882 -11.389 1.00 16.87 ? 219  VAL A CG1 1 
ATOM   1709 C CG2 . VAL A 1 220 ? 24.807 24.953 -12.532 1.00 16.77 ? 219  VAL A CG2 1 
ATOM   1710 N N   . LEU A 1 221 ? 26.813 25.287 -8.303  1.00 17.89 ? 220  LEU A N   1 
ATOM   1711 C CA  . LEU A 1 221 ? 27.860 25.400 -7.306  1.00 18.41 ? 220  LEU A CA  1 
ATOM   1712 C C   . LEU A 1 221 ? 28.591 24.101 -6.990  1.00 18.74 ? 220  LEU A C   1 
ATOM   1713 O O   . LEU A 1 221 ? 27.972 23.064 -6.749  1.00 18.04 ? 220  LEU A O   1 
ATOM   1714 C CB  . LEU A 1 221 ? 27.259 25.984 -6.017  1.00 21.08 ? 220  LEU A CB  1 
ATOM   1715 C CG  . LEU A 1 221 ? 28.031 26.038 -4.689  1.00 20.83 ? 220  LEU A CG  1 
ATOM   1716 C CD1 . LEU A 1 221 ? 29.271 26.901 -4.778  1.00 22.89 ? 220  LEU A CD1 1 
ATOM   1717 C CD2 . LEU A 1 221 ? 27.098 26.586 -3.646  1.00 24.49 ? 220  LEU A CD2 1 
ATOM   1718 N N   . LEU A 1 222 ? 29.919 24.195 -7.014  1.00 18.13 ? 221  LEU A N   1 
ATOM   1719 C CA  . LEU A 1 222 ? 30.824 23.107 -6.660  1.00 19.87 ? 221  LEU A CA  1 
ATOM   1720 C C   . LEU A 1 222 ? 31.539 23.697 -5.447  1.00 19.95 ? 221  LEU A C   1 
ATOM   1721 O O   . LEU A 1 222 ? 32.126 24.769 -5.542  1.00 20.34 ? 221  LEU A O   1 
ATOM   1722 C CB  . LEU A 1 222 ? 31.832 22.801 -7.783  1.00 17.16 ? 221  LEU A CB  1 
ATOM   1723 C CG  . LEU A 1 222 ? 33.065 21.937 -7.445  1.00 20.73 ? 221  LEU A CG  1 
ATOM   1724 C CD1 . LEU A 1 222 ? 32.678 20.539 -6.948  1.00 18.21 ? 221  LEU A CD1 1 
ATOM   1725 C CD2 . LEU A 1 222 ? 33.984 21.850 -8.652  1.00 21.67 ? 221  LEU A CD2 1 
ATOM   1726 N N   . GLU A 1 223 ? 31.462 23.010 -4.312  1.00 20.75 ? 222  GLU A N   1 
ATOM   1727 C CA  . GLU A 1 223 ? 32.089 23.505 -3.090  1.00 22.52 ? 222  GLU A CA  1 
ATOM   1728 C C   . GLU A 1 223 ? 32.814 22.417 -2.304  1.00 21.71 ? 222  GLU A C   1 
ATOM   1729 O O   . GLU A 1 223 ? 32.321 21.297 -2.170  1.00 22.41 ? 222  GLU A O   1 
ATOM   1730 C CB  . GLU A 1 223 ? 31.029 24.186 -2.210  1.00 25.14 ? 222  GLU A CB  1 
ATOM   1731 C CG  . GLU A 1 223 ? 31.562 25.057 -1.076  1.00 30.40 ? 222  GLU A CG  1 
ATOM   1732 C CD  . GLU A 1 223 ? 30.446 25.733 -0.299  1.00 32.71 ? 222  GLU A CD  1 
ATOM   1733 O OE1 . GLU A 1 223 ? 29.972 25.155 0.701   1.00 34.83 ? 222  GLU A OE1 1 
ATOM   1734 O OE2 . GLU A 1 223 ? 30.028 26.837 -0.701  1.00 39.19 ? 222  GLU A OE2 1 
ATOM   1735 N N   . PHE A 1 224 ? 34.019 22.750 -1.846  1.00 21.32 ? 223  PHE A N   1 
ATOM   1736 C CA  . PHE A 1 224 ? 34.831 21.854 -1.029  1.00 20.60 ? 223  PHE A CA  1 
ATOM   1737 C C   . PHE A 1 224 ? 34.923 22.462 0.352   1.00 21.29 ? 223  PHE A C   1 
ATOM   1738 O O   . PHE A 1 224 ? 35.184 23.656 0.484   1.00 18.87 ? 223  PHE A O   1 
ATOM   1739 C CB  . PHE A 1 224 ? 36.233 21.667 -1.612  1.00 21.26 ? 223  PHE A CB  1 
ATOM   1740 C CG  . PHE A 1 224 ? 36.252 20.879 -2.881  1.00 19.50 ? 223  PHE A CG  1 
ATOM   1741 C CD1 . PHE A 1 224 ? 36.283 21.533 -4.129  1.00 19.77 ? 223  PHE A CD1 1 
ATOM   1742 C CD2 . PHE A 1 224 ? 36.211 19.471 -2.844  1.00 21.38 ? 223  PHE A CD2 1 
ATOM   1743 C CE1 . PHE A 1 224 ? 36.272 20.787 -5.346  1.00 19.92 ? 223  PHE A CE1 1 
ATOM   1744 C CE2 . PHE A 1 224 ? 36.197 18.711 -4.046  1.00 20.93 ? 223  PHE A CE2 1 
ATOM   1745 C CZ  . PHE A 1 224 ? 36.228 19.374 -5.303  1.00 19.47 ? 223  PHE A CZ  1 
ATOM   1746 N N   . VAL A 1 225 ? 34.587 21.671 1.370   1.00 21.07 ? 224  VAL A N   1 
ATOM   1747 C CA  . VAL A 1 225 ? 34.632 22.132 2.759   1.00 21.68 ? 224  VAL A CA  1 
ATOM   1748 C C   . VAL A 1 225 ? 35.423 21.116 3.599   1.00 22.39 ? 224  VAL A C   1 
ATOM   1749 O O   . VAL A 1 225 ? 35.086 19.927 3.638   1.00 21.28 ? 224  VAL A O   1 
ATOM   1750 C CB  . VAL A 1 225 ? 33.205 22.333 3.375   1.00 22.05 ? 224  VAL A CB  1 
ATOM   1751 C CG1 . VAL A 1 225 ? 33.311 23.088 4.687   1.00 22.70 ? 224  VAL A CG1 1 
ATOM   1752 C CG2 . VAL A 1 225 ? 32.266 23.096 2.435   1.00 23.03 ? 224  VAL A CG2 1 
ATOM   1753 N N   . THR A 1 226 ? 36.473 21.599 4.263   1.00 21.71 ? 225  THR A N   1 
ATOM   1754 C CA  . THR A 1 226 ? 37.335 20.761 5.097   1.00 22.26 ? 225  THR A CA  1 
ATOM   1755 C C   . THR A 1 226 ? 37.580 21.413 6.456   1.00 21.54 ? 225  THR A C   1 
ATOM   1756 O O   . THR A 1 226 ? 37.968 22.575 6.523   1.00 21.28 ? 225  THR A O   1 
ATOM   1757 C CB  . THR A 1 226 ? 38.710 20.514 4.402   1.00 24.56 ? 225  THR A CB  1 
ATOM   1758 O OG1 . THR A 1 226 ? 38.495 19.985 3.088   1.00 23.93 ? 225  THR A OG1 1 
ATOM   1759 C CG2 . THR A 1 226 ? 39.575 19.525 5.202   1.00 24.29 ? 225  THR A CG2 1 
ATOM   1760 N N   . ALA A 1 227 ? 37.390 20.644 7.531   1.00 19.83 ? 226  ALA A N   1 
ATOM   1761 C CA  . ALA A 1 227 ? 37.624 21.147 8.884   1.00 19.43 ? 226  ALA A CA  1 
ATOM   1762 C C   . ALA A 1 227 ? 39.112 21.132 9.196   1.00 20.51 ? 226  ALA A C   1 
ATOM   1763 O O   . ALA A 1 227 ? 39.838 20.262 8.707   1.00 18.71 ? 226  ALA A O   1 
ATOM   1764 C CB  . ALA A 1 227 ? 36.873 20.336 9.895   1.00 16.75 ? 226  ALA A CB  1 
ATOM   1765 N N   . ALA A 1 228 ? 39.557 22.131 9.958   1.00 19.62 ? 227  ALA A N   1 
ATOM   1766 C CA  . ALA A 1 228 ? 40.961 22.287 10.344  1.00 23.27 ? 227  ALA A CA  1 
ATOM   1767 C C   . ALA A 1 228 ? 41.072 23.167 11.587  1.00 24.77 ? 227  ALA A C   1 
ATOM   1768 O O   . ALA A 1 228 ? 40.056 23.653 12.100  1.00 23.79 ? 227  ALA A O   1 
ATOM   1769 C CB  . ALA A 1 228 ? 41.757 22.909 9.193   1.00 24.84 ? 227  ALA A CB  1 
ATOM   1770 N N   . GLY A 1 229 ? 42.304 23.357 12.067  1.00 27.10 ? 228  GLY A N   1 
ATOM   1771 C CA  . GLY A 1 229 ? 42.548 24.194 13.236  1.00 29.67 ? 228  GLY A CA  1 
ATOM   1772 C C   . GLY A 1 229 ? 42.982 23.463 14.484  1.00 31.38 ? 228  GLY A C   1 
ATOM   1773 O O   . GLY A 1 229 ? 43.533 24.071 15.405  1.00 32.28 ? 228  GLY A O   1 
ATOM   1774 N N   . ILE A 1 230 ? 42.664 22.172 14.539  1.00 32.17 ? 229  ILE A N   1 
ATOM   1775 C CA  . ILE A 1 230 ? 43.017 21.310 15.660  1.00 34.14 ? 229  ILE A CA  1 
ATOM   1776 C C   . ILE A 1 230 ? 43.986 20.240 15.134  1.00 35.49 ? 229  ILE A C   1 
ATOM   1777 O O   . ILE A 1 230 ? 43.741 19.693 14.037  1.00 35.97 ? 229  ILE A O   1 
ATOM   1778 C CB  . ILE A 1 230 ? 41.734 20.676 16.309  1.00 33.54 ? 229  ILE A CB  1 
ATOM   1779 C CG1 . ILE A 1 230 ? 40.890 21.771 16.974  1.00 33.35 ? 229  ILE A CG1 1 
ATOM   1780 C CG2 . ILE A 1 230 ? 42.101 19.607 17.363  1.00 36.37 ? 229  ILE A CG2 1 
ATOM   1781 C CD1 . ILE A 1 230 ? 39.478 21.358 17.339  1.00 29.48 ? 229  ILE A CD1 1 
ATOM   1782 O OXT . ILE A 1 230 ? 45.005 19.994 15.808  1.00 36.61 ? 229  ILE A OXT 1 
HETATM 1783 O O   . HOH B 2 .   ? 24.430 37.135 -9.878  1.00 11.40 ? 1001 HOH A O   1 
HETATM 1784 O O   . HOH B 2 .   ? 21.249 32.806 -14.269 1.00 19.88 ? 1002 HOH A O   1 
HETATM 1785 O O   . HOH B 2 .   ? 30.396 25.270 -10.462 1.00 15.87 ? 1003 HOH A O   1 
HETATM 1786 O O   . HOH B 2 .   ? 43.355 12.930 10.738  1.00 23.39 ? 1004 HOH A O   1 
HETATM 1787 O O   . HOH B 2 .   ? 18.255 22.008 -9.267  1.00 21.47 ? 1005 HOH A O   1 
HETATM 1788 O O   . HOH B 2 .   ? 30.231 18.248 9.095   1.00 16.17 ? 1006 HOH A O   1 
HETATM 1789 O O   . HOH B 2 .   ? 43.770 9.609  13.508  1.00 18.64 ? 1007 HOH A O   1 
HETATM 1790 O O   . HOH B 2 .   ? 31.215 36.965 -4.101  1.00 23.14 ? 1008 HOH A O   1 
HETATM 1791 O O   . HOH B 2 .   ? 25.056 24.510 9.796   1.00 35.82 ? 1009 HOH A O   1 
HETATM 1792 O O   . HOH B 2 .   ? 42.551 19.901 7.895   1.00 25.85 ? 1010 HOH A O   1 
HETATM 1793 O O   . HOH B 2 .   ? 38.039 25.848 22.465  1.00 26.96 ? 1011 HOH A O   1 
HETATM 1794 O O   . HOH B 2 .   ? 38.792 12.670 6.549   1.00 28.28 ? 1012 HOH A O   1 
HETATM 1795 O O   . HOH B 2 .   ? 28.982 27.697 4.938   1.00 30.56 ? 1013 HOH A O   1 
HETATM 1796 O O   . HOH B 2 .   ? 31.004 38.278 -13.145 1.00 28.56 ? 1014 HOH A O   1 
HETATM 1797 O O   . HOH B 2 .   ? 12.319 29.074 8.995   1.00 36.03 ? 1015 HOH A O   1 
HETATM 1798 O O   . HOH B 2 .   ? 28.019 12.215 2.505   1.00 24.91 ? 1016 HOH A O   1 
HETATM 1799 O O   . HOH B 2 .   ? 23.982 35.496 -12.470 1.00 24.74 ? 1017 HOH A O   1 
HETATM 1800 O O   . HOH B 2 .   ? 29.595 28.781 -16.593 1.00 30.31 ? 1019 HOH A O   1 
HETATM 1801 O O   . HOH B 2 .   ? 28.228 24.060 -14.791 1.00 33.59 ? 1020 HOH A O   1 
HETATM 1802 O O   . HOH B 2 .   ? 13.445 16.511 13.346  1.00 29.25 ? 1021 HOH A O   1 
HETATM 1803 O O   . HOH B 2 .   ? 22.244 46.889 7.872   1.00 28.56 ? 1022 HOH A O   1 
HETATM 1804 O O   . HOH B 2 .   ? 17.954 53.400 -1.455  1.00 30.80 ? 1023 HOH A O   1 
HETATM 1805 O O   . HOH B 2 .   ? 28.758 25.301 3.460   1.00 26.15 ? 1024 HOH A O   1 
HETATM 1806 O O   . HOH B 2 .   ? 26.811 37.289 1.708   1.00 19.43 ? 1025 HOH A O   1 
HETATM 1807 O O   . HOH B 2 .   ? 6.431  45.287 -1.906  1.00 30.72 ? 1026 HOH A O   1 
HETATM 1808 O O   . HOH B 2 .   ? 34.347 25.803 21.549  1.00 29.13 ? 1027 HOH A O   1 
HETATM 1809 O O   . HOH B 2 .   ? 19.603 38.195 -11.169 1.00 35.22 ? 1028 HOH A O   1 
HETATM 1810 O O   . HOH B 2 .   ? 10.832 26.579 -12.469 1.00 31.49 ? 1029 HOH A O   1 
HETATM 1811 O O   . HOH B 2 .   ? 36.593 35.577 8.464   1.00 33.23 ? 1030 HOH A O   1 
HETATM 1812 O O   . HOH B 2 .   ? 34.335 29.342 -0.642  1.00 28.36 ? 1031 HOH A O   1 
HETATM 1813 O O   . HOH B 2 .   ? 33.668 13.913 7.751   1.00 32.94 ? 1032 HOH A O   1 
HETATM 1814 O O   . HOH B 2 .   ? 33.731 35.037 0.011   1.00 34.17 ? 1033 HOH A O   1 
HETATM 1815 O O   . HOH B 2 .   ? 23.913 19.307 -9.389  1.00 46.69 ? 1034 HOH A O   1 
HETATM 1816 O O   . HOH B 2 .   ? 44.604 10.596 11.102  1.00 22.02 ? 1035 HOH A O   1 
HETATM 1817 O O   . HOH B 2 .   ? 31.230 38.910 -5.948  1.00 26.00 ? 1036 HOH A O   1 
HETATM 1818 O O   . HOH B 2 .   ? 33.482 36.216 -2.203  1.00 18.24 ? 1037 HOH A O   1 
HETATM 1819 O O   . HOH B 2 .   ? 32.768 13.699 11.034  1.00 21.07 ? 1038 HOH A O   1 
HETATM 1820 O O   . HOH B 2 .   ? 30.763 10.487 2.120   1.00 33.10 ? 1039 HOH A O   1 
HETATM 1821 O O   . HOH B 2 .   ? 26.988 34.617 0.277   1.00 23.99 ? 1040 HOH A O   1 
HETATM 1822 O O   . HOH B 2 .   ? 23.969 34.671 2.284   1.00 23.01 ? 1041 HOH A O   1 
HETATM 1823 O O   . HOH B 2 .   ? 24.791 16.943 -7.930  1.00 50.91 ? 1042 HOH A O   1 
HETATM 1824 O O   . HOH B 2 .   ? 29.735 13.788 14.004  1.00 21.41 ? 1043 HOH A O   1 
HETATM 1825 O O   . HOH B 2 .   ? 12.126 42.201 3.341   1.00 30.19 ? 1044 HOH A O   1 
HETATM 1826 O O   . HOH B 2 .   ? 20.649 16.164 -8.994  1.00 44.37 ? 1045 HOH A O   1 
HETATM 1827 O O   . HOH B 2 .   ? 31.053 12.135 -4.732  1.00 38.52 ? 1046 HOH A O   1 
HETATM 1828 O O   . HOH B 2 .   ? 14.026 32.175 -13.299 1.00 28.23 ? 1047 HOH A O   1 
HETATM 1829 O O   . HOH B 2 .   ? 11.718 36.290 -8.457  1.00 31.40 ? 1048 HOH A O   1 
HETATM 1830 O O   . HOH B 2 .   ? 23.362 40.139 -10.210 1.00 22.14 ? 1049 HOH A O   1 
HETATM 1831 O O   . HOH B 2 .   ? 25.726 41.357 -9.261  1.00 22.31 ? 1050 HOH A O   1 
HETATM 1832 O O   . HOH B 2 .   ? 21.291 26.753 4.479   1.00 24.16 ? 1051 HOH A O   1 
HETATM 1833 O O   . HOH B 2 .   ? 31.245 21.467 14.633  1.00 21.91 ? 1052 HOH A O   1 
HETATM 1834 O O   . HOH B 2 .   ? 27.897 49.214 7.942   1.00 31.78 ? 1053 HOH A O   1 
HETATM 1835 O O   . HOH B 2 .   ? 22.182 47.369 -2.373  1.00 27.41 ? 1054 HOH A O   1 
HETATM 1836 O O   . HOH B 2 .   ? 26.680 48.374 -0.945  1.00 32.82 ? 1055 HOH A O   1 
HETATM 1837 O O   . HOH B 2 .   ? 16.625 41.416 7.826   1.00 47.04 ? 1056 HOH A O   1 
HETATM 1838 O O   . HOH B 2 .   ? 8.230  31.290 4.045   1.00 36.48 ? 1057 HOH A O   1 
HETATM 1839 O O   . HOH B 2 .   ? 23.924 49.277 -10.995 1.00 34.26 ? 1058 HOH A O   1 
HETATM 1840 O O   . HOH B 2 .   ? 36.550 29.812 -3.907  1.00 21.44 ? 1059 HOH A O   1 
HETATM 1841 O O   . HOH B 2 .   ? 24.779 16.952 23.968  1.00 38.78 ? 1060 HOH A O   1 
HETATM 1842 O O   . HOH B 2 .   ? 33.634 30.799 -9.544  1.00 29.63 ? 1061 HOH A O   1 
HETATM 1843 O O   . HOH B 2 .   ? 30.036 28.372 2.578   1.00 38.97 ? 1062 HOH A O   1 
HETATM 1844 O O   . HOH B 2 .   ? 45.567 20.931 18.202  1.00 34.89 ? 1063 HOH A O   1 
HETATM 1845 O O   . HOH B 2 .   ? 18.984 16.715 17.034  1.00 29.59 ? 1064 HOH A O   1 
HETATM 1846 O O   . HOH B 2 .   ? 38.453 33.453 5.853   1.00 28.67 ? 1065 HOH A O   1 
HETATM 1847 O O   . HOH B 2 .   ? 26.291 39.664 10.870  1.00 25.16 ? 1066 HOH A O   1 
HETATM 1848 O O   . HOH B 2 .   ? 36.871 29.150 16.224  1.00 34.73 ? 1067 HOH A O   1 
HETATM 1849 O O   . HOH B 2 .   ? 19.194 14.584 18.627  1.00 41.46 ? 1068 HOH A O   1 
HETATM 1850 O O   . HOH B 2 .   ? 39.790 28.550 15.189  1.00 32.26 ? 1069 HOH A O   1 
HETATM 1851 O O   . HOH B 2 .   ? 31.052 16.895 23.072  1.00 28.25 ? 1070 HOH A O   1 
HETATM 1852 O O   . HOH B 2 .   ? 29.931 31.336 -15.422 1.00 27.35 ? 1071 HOH A O   1 
HETATM 1853 O O   . HOH B 2 .   ? 46.924 18.282 14.898  1.00 45.69 ? 1072 HOH A O   1 
HETATM 1854 O O   . HOH B 2 .   ? 24.717 45.704 7.617   1.00 37.84 ? 1073 HOH A O   1 
HETATM 1855 O O   . HOH B 2 .   ? 32.670 32.153 16.439  1.00 47.05 ? 1074 HOH A O   1 
HETATM 1856 O O   . HOH B 2 .   ? 12.318 26.897 -25.387 1.00 37.13 ? 1075 HOH A O   1 
HETATM 1857 O O   . HOH B 2 .   ? 8.782  34.354 -0.109  1.00 31.36 ? 1076 HOH A O   1 
HETATM 1858 O O   . HOH B 2 .   ? 39.903 28.231 1.888   1.00 32.73 ? 1077 HOH A O   1 
HETATM 1859 O O   . HOH B 2 .   ? 32.943 24.374 -11.673 1.00 42.37 ? 1078 HOH A O   1 
HETATM 1860 O O   . HOH B 2 .   ? 15.976 22.882 -8.380  1.00 31.25 ? 1079 HOH A O   1 
HETATM 1861 O O   . HOH B 2 .   ? 37.628 11.160 4.828   1.00 29.28 ? 1080 HOH A O   1 
HETATM 1862 O O   . HOH B 2 .   ? 32.083 36.471 -14.618 1.00 46.78 ? 1081 HOH A O   1 
HETATM 1863 O O   . HOH B 2 .   ? 11.577 27.054 7.759   1.00 33.81 ? 1082 HOH A O   1 
HETATM 1864 O O   . HOH B 2 .   ? 5.181  43.555 -0.728  1.00 43.37 ? 1083 HOH A O   1 
HETATM 1865 O O   . HOH B 2 .   ? 21.372 36.602 -12.088 1.00 34.27 ? 1084 HOH A O   1 
HETATM 1866 O O   . HOH B 2 .   ? 28.267 11.476 14.895  1.00 42.50 ? 1085 HOH A O   1 
HETATM 1867 O O   . HOH B 2 .   ? 28.925 13.686 -4.896  1.00 26.84 ? 1086 HOH A O   1 
HETATM 1868 O O   . HOH B 2 .   ? 14.028 47.905 -3.671  1.00 50.50 ? 1087 HOH A O   1 
HETATM 1869 O O   . HOH B 2 .   ? 7.940  33.421 -2.710  1.00 33.64 ? 1088 HOH A O   1 
HETATM 1870 O O   . HOH B 2 .   ? 37.722 7.567  9.586   1.00 42.82 ? 1089 HOH A O   1 
HETATM 1871 O O   . HOH B 2 .   ? 14.084 21.500 -7.313  1.00 46.01 ? 1090 HOH A O   1 
HETATM 1872 O O   . HOH B 2 .   ? 34.030 12.777 -5.584  1.00 43.21 ? 1091 HOH A O   1 
HETATM 1873 O O   . HOH B 2 .   ? 39.446 11.192 16.705  1.00 54.11 ? 1092 HOH A O   1 
HETATM 1874 O O   . HOH B 2 .   ? 37.326 8.942  15.551  1.00 36.05 ? 1093 HOH A O   1 
HETATM 1875 O O   . HOH B 2 .   ? 25.385 40.083 13.291  1.00 38.75 ? 1094 HOH A O   1 
HETATM 1876 O O   . HOH B 2 .   ? 21.262 8.805  1.834   1.00 43.31 ? 1095 HOH A O   1 
HETATM 1877 O O   . HOH B 2 .   ? 23.091 28.275 19.496  1.00 46.67 ? 1096 HOH A O   1 
HETATM 1878 O O   . HOH B 2 .   ? 32.764 50.676 -5.258  1.00 37.75 ? 1097 HOH A O   1 
HETATM 1879 O O   . HOH B 2 .   ? 22.312 34.354 15.358  1.00 33.48 ? 1098 HOH A O   1 
HETATM 1880 O O   . HOH B 2 .   ? 39.170 17.561 1.896   1.00 41.83 ? 1099 HOH A O   1 
HETATM 1881 O O   . HOH B 2 .   ? 11.584 23.925 15.099  1.00 39.27 ? 1100 HOH A O   1 
HETATM 1882 O O   . HOH B 2 .   ? 21.499 50.922 4.961   1.00 41.24 ? 1101 HOH A O   1 
HETATM 1883 O O   . HOH B 2 .   ? 23.925 45.575 -12.920 1.00 40.62 ? 1102 HOH A O   1 
HETATM 1884 O O   . HOH B 2 .   ? 29.448 44.139 7.760   1.00 34.77 ? 1103 HOH A O   1 
HETATM 1885 O O   . HOH B 2 .   ? 11.193 19.530 6.309   1.00 55.82 ? 1104 HOH A O   1 
HETATM 1886 O O   . HOH B 2 .   ? 21.739 8.655  4.427   1.00 47.72 ? 1105 HOH A O   1 
HETATM 1887 O O   . HOH B 2 .   ? 17.207 15.657 -6.833  1.00 29.09 ? 1107 HOH A O   1 
HETATM 1888 O O   . HOH B 2 .   ? 20.296 28.918 17.234  1.00 40.37 ? 1108 HOH A O   1 
HETATM 1889 O O   . HOH B 2 .   ? 15.683 25.798 -19.474 1.00 33.44 ? 1109 HOH A O   1 
HETATM 1890 O O   . HOH B 2 .   ? 39.852 32.629 -3.571  1.00 38.42 ? 1110 HOH A O   1 
HETATM 1891 O O   . HOH B 2 .   ? 42.825 31.104 10.749  1.00 35.87 ? 1111 HOH A O   1 
HETATM 1892 O O   . HOH B 2 .   ? 38.529 22.349 1.415   1.00 40.36 ? 1112 HOH A O   1 
HETATM 1893 O O   . HOH B 2 .   ? 25.678 22.307 -15.319 1.00 43.49 ? 1113 HOH A O   1 
HETATM 1894 O O   . HOH B 2 .   ? 20.331 32.073 -17.685 1.00 33.49 ? 1114 HOH A O   1 
HETATM 1895 O O   . HOH B 2 .   ? 27.340 7.966  15.073  1.00 48.26 ? 1115 HOH A O   1 
HETATM 1896 O O   . HOH B 2 .   ? 35.351 29.535 -10.957 1.00 38.65 ? 1116 HOH A O   1 
HETATM 1897 O O   . HOH B 2 .   ? 11.613 18.277 12.650  1.00 44.34 ? 1117 HOH A O   1 
HETATM 1898 O O   . HOH B 2 .   ? 16.717 41.681 -10.514 1.00 43.64 ? 1118 HOH A O   1 
HETATM 1899 O O   . HOH B 2 .   ? 39.029 37.120 -0.067  1.00 39.80 ? 1119 HOH A O   1 
HETATM 1900 O O   . HOH B 2 .   ? 44.012 20.309 11.266  1.00 38.80 ? 1120 HOH A O   1 
HETATM 1901 O O   . HOH B 2 .   ? 35.351 33.130 16.097  1.00 48.84 ? 1121 HOH A O   1 
HETATM 1902 O O   . HOH B 2 .   ? 26.496 48.075 -13.043 1.00 41.19 ? 1122 HOH A O   1 
HETATM 1903 O O   . HOH B 2 .   ? 23.594 40.448 -12.989 1.00 32.31 ? 1123 HOH A O   1 
HETATM 1904 O O   . HOH B 2 .   ? 41.602 28.563 -2.871  1.00 42.91 ? 1124 HOH A O   1 
HETATM 1905 O O   . HOH B 2 .   ? 20.108 16.210 25.611  1.00 47.08 ? 1125 HOH A O   1 
HETATM 1906 O O   . HOH B 2 .   ? 12.737 48.930 -6.440  1.00 44.73 ? 1126 HOH A O   1 
HETATM 1907 O O   . HOH B 2 .   ? 27.056 12.499 19.737  1.00 48.07 ? 1127 HOH A O   1 
HETATM 1908 O O   . HOH B 2 .   ? 20.296 48.194 9.366   1.00 38.77 ? 1128 HOH A O   1 
HETATM 1909 O O   . HOH B 2 .   ? 22.682 15.103 -7.519  1.00 48.74 ? 1129 HOH A O   1 
HETATM 1910 O O   . HOH B 2 .   ? 20.306 43.013 11.993  1.00 46.12 ? 1132 HOH A O   1 
HETATM 1911 O O   . HOH B 2 .   ? 13.078 29.713 16.699  1.00 41.54 ? 1133 HOH A O   1 
HETATM 1912 O O   . HOH B 2 .   ? 27.365 51.376 -5.196  1.00 38.41 ? 1134 HOH A O   1 
HETATM 1913 O O   . HOH B 2 .   ? 41.219 25.254 19.142  1.00 30.53 ? 1135 HOH A O   1 
HETATM 1914 O O   . HOH B 2 .   ? 36.870 42.691 -8.634  1.00 36.88 ? 1136 HOH A O   1 
HETATM 1915 O O   . HOH B 2 .   ? 34.429 31.518 -7.273  1.00 33.56 ? 1138 HOH A O   1 
HETATM 1916 O O   . HOH B 2 .   ? 29.090 14.845 23.705  1.00 42.40 ? 1140 HOH A O   1 
HETATM 1917 O O   . HOH B 2 .   ? 40.147 41.007 -9.539  1.00 45.44 ? 1142 HOH A O   1 
HETATM 1918 O O   . HOH B 2 .   ? 37.888 39.851 -8.910  1.00 30.16 ? 1143 HOH A O   1 
HETATM 1919 O O   . HOH B 2 .   ? 38.028 41.915 -10.524 1.00 39.08 ? 1144 HOH A O   1 
HETATM 1920 O O   . HOH B 2 .   ? 39.066 41.740 -6.954  1.00 40.09 ? 1145 HOH A O   1 
HETATM 1921 O O   . HOH B 2 .   ? 25.643 8.031  3.315   1.00 36.07 ? 1146 HOH A O   1 
HETATM 1922 O O   . HOH B 2 .   ? 23.094 9.339  -3.720  1.00 40.56 ? 1147 HOH A O   1 
HETATM 1923 O O   . HOH B 2 .   ? 17.213 44.819 -7.812  1.00 48.21 ? 1149 HOH A O   1 
HETATM 1924 O O   . HOH B 2 .   ? 24.448 31.584 24.728  1.00 49.60 ? 1150 HOH A O   1 
HETATM 1925 O O   . HOH B 2 .   ? 11.214 25.299 12.137  1.00 46.16 ? 1151 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   ALA 2   1   ?   ?   ?   A . n 
A 1 3   SER 3   2   ?   ?   ?   A . n 
A 1 4   LYS 4   3   ?   ?   ?   A . n 
A 1 5   GLY 5   4   4   GLY GLY A . n 
A 1 6   GLU 6   5   5   GLU GLU A . n 
A 1 7   GLU 7   6   6   GLU GLU A . n 
A 1 8   LEU 8   7   7   LEU LEU A . n 
A 1 9   PHE 9   8   8   PHE PHE A . n 
A 1 10  THR 10  9   9   THR THR A . n 
A 1 11  GLY 11  10  10  GLY GLY A . n 
A 1 12  VAL 12  11  11  VAL VAL A . n 
A 1 13  VAL 13  12  12  VAL VAL A . n 
A 1 14  PRO 14  13  13  PRO PRO A . n 
A 1 15  ILE 15  14  14  ILE ILE A . n 
A 1 16  LEU 16  15  15  LEU LEU A . n 
A 1 17  VAL 17  16  16  VAL VAL A . n 
A 1 18  GLU 18  17  17  GLU GLU A . n 
A 1 19  LEU 19  18  18  LEU LEU A . n 
A 1 20  ASP 20  19  19  ASP ASP A . n 
A 1 21  GLY 21  20  20  GLY GLY A . n 
A 1 22  ASP 22  21  21  ASP ASP A . n 
A 1 23  VAL 23  22  22  VAL VAL A . n 
A 1 24  ASN 24  23  23  ASN ASN A . n 
A 1 25  GLY 25  24  24  GLY GLY A . n 
A 1 26  HIS 26  25  25  HIS HIS A . n 
A 1 27  LYS 27  26  26  LYS LYS A . n 
A 1 28  PHE 28  27  27  PHE PHE A . n 
A 1 29  SER 29  28  28  SER SER A . n 
A 1 30  VAL 30  29  29  VAL VAL A . n 
A 1 31  SER 31  30  30  SER SER A . n 
A 1 32  GLY 32  31  31  GLY GLY A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  GLY 34  33  33  GLY GLY A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  GLY 36  35  35  GLY GLY A . n 
A 1 37  ASP 37  36  36  ASP ASP A . n 
A 1 38  ALA 38  37  37  ALA ALA A . n 
A 1 39  THR 39  38  38  THR THR A . n 
A 1 40  TYR 40  39  39  TYR TYR A . n 
A 1 41  GLY 41  40  40  GLY GLY A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  THR 44  43  43  THR THR A . n 
A 1 45  LEU 45  44  44  LEU LEU A . n 
A 1 46  LYS 46  45  45  LYS LYS A . n 
A 1 47  PHE 47  46  46  PHE PHE A . n 
A 1 48  ILE 48  47  47  ILE ILE A . n 
A 1 49  CYS 49  48  48  CYS CYS A . n 
A 1 50  THR 50  49  49  THR THR A . n 
A 1 51  THR 51  50  50  THR THR A . n 
A 1 52  GLY 52  51  51  GLY GLY A . n 
A 1 53  LYS 53  52  52  LYS LYS A . n 
A 1 54  LEU 54  53  53  LEU LEU A . n 
A 1 55  PRO 55  54  54  PRO PRO A . n 
A 1 56  VAL 56  55  55  VAL VAL A . n 
A 1 57  PRO 57  56  56  PRO PRO A . n 
A 1 58  TRP 58  57  57  TRP TRP A . n 
A 1 59  PRO 59  58  58  PRO PRO A . n 
A 1 60  THR 60  59  59  THR THR A . n 
A 1 61  LEU 61  60  60  LEU LEU A . n 
A 1 62  VAL 62  61  61  VAL VAL A . n 
A 1 63  THR 63  62  62  THR THR A . n 
A 1 64  THR 64  63  63  THR THR A . n 
A 1 65  LEU 65  64  64  LEU LEU A . n 
A 1 66  THR 66  65  65  THR THR A . n 
A 1 67  TYR 67  66  66  TYR TYR A . n 
A 1 68  GLY 68  67  67  GLY GLY A . n 
A 1 69  VAL 69  68  68  VAL VAL A . n 
A 1 70  GLN 70  69  69  GLN GLN A . n 
A 1 71  CYS 71  70  70  CYS CYS A . n 
A 1 72  PHE 72  71  71  PHE PHE A . n 
A 1 73  SER 73  72  72  SER SER A . n 
A 1 74  ARG 74  73  73  ARG ARG A . n 
A 1 75  TYR 75  74  74  TYR TYR A . n 
A 1 76  PRO 76  75  75  PRO PRO A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  HIS 78  77  77  HIS HIS A . n 
A 1 79  MET 79  78  78  MET MET A . n 
A 1 80  LYS 80  79  79  LYS LYS A . n 
A 1 81  GLN 81  80  80  GLN GLN A . n 
A 1 82  HIS 82  81  81  HIS HIS A . n 
A 1 83  ASP 83  82  82  ASP ASP A . n 
A 1 84  PHE 84  83  83  PHE PHE A . n 
A 1 85  PHE 85  84  84  PHE PHE A . n 
A 1 86  LYS 86  85  85  LYS LYS A . n 
A 1 87  SER 87  86  86  SER SER A . n 
A 1 88  ALA 88  87  87  ALA ALA A . n 
A 1 89  MET 89  88  88  MET MET A . n 
A 1 90  PRO 90  89  89  PRO PRO A . n 
A 1 91  GLU 91  90  90  GLU GLU A . n 
A 1 92  GLY 92  91  91  GLY GLY A . n 
A 1 93  TYR 93  92  92  TYR TYR A . n 
A 1 94  VAL 94  93  93  VAL VAL A . n 
A 1 95  GLN 95  94  94  GLN GLN A . n 
A 1 96  GLU 96  95  95  GLU GLU A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  THR 98  97  97  THR THR A . n 
A 1 99  ILE 99  98  98  ILE ILE A . n 
A 1 100 SER 100 99  99  SER SER A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 LYS 102 101 101 LYS LYS A . n 
A 1 103 ASP 103 102 102 ASP ASP A . n 
A 1 104 ASP 104 103 103 ASP ASP A . n 
A 1 105 GLY 105 104 104 GLY GLY A . n 
A 1 106 ASN 106 105 105 ASN ASN A . n 
A 1 107 TYR 107 106 106 TYR TYR A . n 
A 1 108 LYS 108 107 107 LYS LYS A . n 
A 1 109 THR 109 108 108 THR THR A . n 
A 1 110 ARG 110 109 109 ARG ARG A . n 
A 1 111 ALA 111 110 110 ALA ALA A . n 
A 1 112 GLU 112 111 111 GLU GLU A . n 
A 1 113 VAL 113 112 112 VAL VAL A . n 
A 1 114 LYS 114 113 113 LYS LYS A . n 
A 1 115 PHE 115 114 114 PHE PHE A . n 
A 1 116 GLU 116 115 115 GLU GLU A . n 
A 1 117 GLY 117 116 116 GLY GLY A . n 
A 1 118 ASP 118 117 117 ASP ASP A . n 
A 1 119 THR 119 118 118 THR THR A . n 
A 1 120 LEU 120 119 119 LEU LEU A . n 
A 1 121 VAL 121 120 120 VAL VAL A . n 
A 1 122 ASN 122 121 121 ASN ASN A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 ILE 124 123 123 ILE ILE A . n 
A 1 125 GLU 125 124 124 GLU GLU A . n 
A 1 126 LEU 126 125 125 LEU LEU A . n 
A 1 127 LYS 127 126 126 LYS LYS A . n 
A 1 128 GLY 128 127 127 GLY GLY A . n 
A 1 129 ILE 129 128 128 ILE ILE A . n 
A 1 130 ASP 130 129 129 ASP ASP A . n 
A 1 131 PHE 131 130 130 PHE PHE A . n 
A 1 132 LYS 132 131 131 LYS LYS A . n 
A 1 133 GLU 133 132 132 GLU GLU A . n 
A 1 134 ASP 134 133 133 ASP ASP A . n 
A 1 135 GLY 135 134 134 GLY GLY A . n 
A 1 136 ASN 136 135 135 ASN ASN A . n 
A 1 137 ILE 137 136 136 ILE ILE A . n 
A 1 138 LEU 138 137 137 LEU LEU A . n 
A 1 139 GLY 139 138 138 GLY GLY A . n 
A 1 140 HIS 140 139 139 HIS HIS A . n 
A 1 141 LYS 141 140 140 LYS LYS A . n 
A 1 142 LEU 142 141 141 LEU LEU A . n 
A 1 143 GLU 143 142 142 GLU GLU A . n 
A 1 144 TYR 144 143 143 TYR TYR A . n 
A 1 145 ASN 145 144 144 ASN ASN A . n 
A 1 146 TYR 146 145 145 TYR TYR A . n 
A 1 147 ASN 147 146 146 ASN ASN A . n 
A 1 148 SER 148 147 147 SER SER A . n 
A 1 149 HIS 149 148 148 HIS HIS A . n 
A 1 150 ASN 150 149 149 ASN ASN A . n 
A 1 151 VAL 151 150 150 VAL VAL A . n 
A 1 152 TYR 152 151 151 TYR TYR A . n 
A 1 153 ILE 153 152 152 ILE ILE A . n 
A 1 154 THR 154 153 153 THR THR A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 LYS 157 156 156 LYS LYS A . n 
A 1 158 GLN 158 157 157 GLN GLN A . n 
A 1 159 LYS 159 158 158 LYS LYS A . n 
A 1 160 ASN 160 159 159 ASN ASN A . n 
A 1 161 GLY 161 160 160 GLY GLY A . n 
A 1 162 ILE 162 161 161 ILE ILE A . n 
A 1 163 LYS 163 162 162 LYS LYS A . n 
A 1 164 ALA 164 163 163 ALA ALA A . n 
A 1 165 ASN 165 164 164 ASN ASN A . n 
A 1 166 PHE 166 165 165 PHE PHE A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 ILE 168 167 167 ILE ILE A . n 
A 1 169 ARG 169 168 168 ARG ARG A . n 
A 1 170 HIS 170 169 169 HIS HIS A . n 
A 1 171 ASN 171 170 170 ASN ASN A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 GLU 173 172 172 GLU GLU A . n 
A 1 174 ASP 174 173 173 ASP ASP A . n 
A 1 175 GLY 175 174 174 GLY GLY A . n 
A 1 176 SER 176 175 175 SER SER A . n 
A 1 177 VAL 177 176 176 VAL VAL A . n 
A 1 178 GLN 178 177 177 GLN GLN A . n 
A 1 179 LEU 179 178 178 LEU LEU A . n 
A 1 180 ALA 180 179 179 ALA ALA A . n 
A 1 181 ASP 181 180 180 ASP ASP A . n 
A 1 182 HIS 182 181 181 HIS HIS A . n 
A 1 183 TYR 183 182 182 TYR TYR A . n 
A 1 184 GLN 184 183 183 GLN GLN A . n 
A 1 185 GLN 185 184 184 GLN GLN A . n 
A 1 186 ASN 186 185 185 ASN ASN A . n 
A 1 187 THR 187 186 186 THR THR A . n 
A 1 188 PRO 188 187 187 PRO PRO A . n 
A 1 189 ILE 189 188 188 ILE ILE A . n 
A 1 190 GLY 190 189 189 GLY GLY A . n 
A 1 191 ASP 191 190 190 ASP ASP A . n 
A 1 192 GLY 192 191 191 GLY GLY A . n 
A 1 193 PRO 193 192 192 PRO PRO A . n 
A 1 194 VAL 194 193 193 VAL VAL A . n 
A 1 195 LEU 195 194 194 LEU LEU A . n 
A 1 196 LEU 196 195 195 LEU LEU A . n 
A 1 197 PRO 197 196 196 PRO PRO A . n 
A 1 198 ASP 198 197 197 ASP ASP A . n 
A 1 199 ASN 199 198 198 ASN ASN A . n 
A 1 200 HIS 200 199 199 HIS HIS A . n 
A 1 201 TYR 201 200 200 TYR TYR A . n 
A 1 202 LEU 202 201 201 LEU LEU A . n 
A 1 203 SER 203 202 202 SER SER A . n 
A 1 204 THR 204 203 203 THR THR A . n 
A 1 205 GLN 205 204 204 GLN GLN A . n 
A 1 206 SER 206 205 205 SER SER A . n 
A 1 207 ALA 207 206 206 ALA ALA A . n 
A 1 208 LEU 208 207 207 LEU LEU A . n 
A 1 209 SER 209 208 208 SER SER A . n 
A 1 210 LYS 210 209 209 LYS LYS A . n 
A 1 211 ASP 211 210 210 ASP ASP A . n 
A 1 212 PRO 212 211 211 PRO PRO A . n 
A 1 213 ASN 213 212 212 ASN ASN A . n 
A 1 214 GLU 214 213 213 GLU GLU A . n 
A 1 215 LYS 215 214 214 LYS LYS A . n 
A 1 216 ARG 216 215 215 ARG ARG A . n 
A 1 217 ASP 217 216 216 ASP ASP A . n 
A 1 218 HIS 218 217 217 HIS HIS A . n 
A 1 219 MET 219 218 218 MET MET A . n 
A 1 220 VAL 220 219 219 VAL VAL A . n 
A 1 221 LEU 221 220 220 LEU LEU A . n 
A 1 222 LEU 222 221 221 LEU LEU A . n 
A 1 223 GLU 223 222 222 GLU GLU A . n 
A 1 224 PHE 224 223 223 PHE PHE A . n 
A 1 225 VAL 225 224 224 VAL VAL A . n 
A 1 226 THR 226 225 225 THR THR A . n 
A 1 227 ALA 227 226 226 ALA ALA A . n 
A 1 228 ALA 228 227 227 ALA ALA A . n 
A 1 229 GLY 229 228 228 GLY GLY A . n 
A 1 230 ILE 230 229 229 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1001 1001 HOH HOH A . 
B 2 HOH 2   1002 1002 HOH HOH A . 
B 2 HOH 3   1003 1003 HOH HOH A . 
B 2 HOH 4   1004 1004 HOH HOH A . 
B 2 HOH 5   1005 1005 HOH HOH A . 
B 2 HOH 6   1006 1006 HOH HOH A . 
B 2 HOH 7   1007 1007 HOH HOH A . 
B 2 HOH 8   1008 1008 HOH HOH A . 
B 2 HOH 9   1009 1009 HOH HOH A . 
B 2 HOH 10  1010 1010 HOH HOH A . 
B 2 HOH 11  1011 1011 HOH HOH A . 
B 2 HOH 12  1012 1012 HOH HOH A . 
B 2 HOH 13  1013 1013 HOH HOH A . 
B 2 HOH 14  1014 1014 HOH HOH A . 
B 2 HOH 15  1015 1015 HOH HOH A . 
B 2 HOH 16  1016 1016 HOH HOH A . 
B 2 HOH 17  1017 1017 HOH HOH A . 
B 2 HOH 18  1019 1019 HOH HOH A . 
B 2 HOH 19  1020 1020 HOH HOH A . 
B 2 HOH 20  1021 1021 HOH HOH A . 
B 2 HOH 21  1022 1022 HOH HOH A . 
B 2 HOH 22  1023 1023 HOH HOH A . 
B 2 HOH 23  1024 1024 HOH HOH A . 
B 2 HOH 24  1025 1025 HOH HOH A . 
B 2 HOH 25  1026 1026 HOH HOH A . 
B 2 HOH 26  1027 1027 HOH HOH A . 
B 2 HOH 27  1028 1028 HOH HOH A . 
B 2 HOH 28  1029 1029 HOH HOH A . 
B 2 HOH 29  1030 1030 HOH HOH A . 
B 2 HOH 30  1031 1031 HOH HOH A . 
B 2 HOH 31  1032 1032 HOH HOH A . 
B 2 HOH 32  1033 1033 HOH HOH A . 
B 2 HOH 33  1034 1034 HOH HOH A . 
B 2 HOH 34  1035 1035 HOH HOH A . 
B 2 HOH 35  1036 1036 HOH HOH A . 
B 2 HOH 36  1037 1037 HOH HOH A . 
B 2 HOH 37  1038 1038 HOH HOH A . 
B 2 HOH 38  1039 1039 HOH HOH A . 
B 2 HOH 39  1040 1040 HOH HOH A . 
B 2 HOH 40  1041 1041 HOH HOH A . 
B 2 HOH 41  1042 1042 HOH HOH A . 
B 2 HOH 42  1043 1043 HOH HOH A . 
B 2 HOH 43  1044 1044 HOH HOH A . 
B 2 HOH 44  1045 1045 HOH HOH A . 
B 2 HOH 45  1046 1046 HOH HOH A . 
B 2 HOH 46  1047 1047 HOH HOH A . 
B 2 HOH 47  1048 1048 HOH HOH A . 
B 2 HOH 48  1049 1049 HOH HOH A . 
B 2 HOH 49  1050 1050 HOH HOH A . 
B 2 HOH 50  1051 1051 HOH HOH A . 
B 2 HOH 51  1052 1052 HOH HOH A . 
B 2 HOH 52  1053 1053 HOH HOH A . 
B 2 HOH 53  1054 1054 HOH HOH A . 
B 2 HOH 54  1055 1055 HOH HOH A . 
B 2 HOH 55  1056 1056 HOH HOH A . 
B 2 HOH 56  1057 1057 HOH HOH A . 
B 2 HOH 57  1058 1058 HOH HOH A . 
B 2 HOH 58  1059 1059 HOH HOH A . 
B 2 HOH 59  1060 1060 HOH HOH A . 
B 2 HOH 60  1061 1061 HOH HOH A . 
B 2 HOH 61  1062 1062 HOH HOH A . 
B 2 HOH 62  1063 1063 HOH HOH A . 
B 2 HOH 63  1064 1064 HOH HOH A . 
B 2 HOH 64  1065 1065 HOH HOH A . 
B 2 HOH 65  1066 1066 HOH HOH A . 
B 2 HOH 66  1067 1067 HOH HOH A . 
B 2 HOH 67  1068 1068 HOH HOH A . 
B 2 HOH 68  1069 1069 HOH HOH A . 
B 2 HOH 69  1070 1070 HOH HOH A . 
B 2 HOH 70  1071 1071 HOH HOH A . 
B 2 HOH 71  1072 1072 HOH HOH A . 
B 2 HOH 72  1073 1073 HOH HOH A . 
B 2 HOH 73  1074 1074 HOH HOH A . 
B 2 HOH 74  1075 1075 HOH HOH A . 
B 2 HOH 75  1076 1076 HOH HOH A . 
B 2 HOH 76  1077 1077 HOH HOH A . 
B 2 HOH 77  1078 1078 HOH HOH A . 
B 2 HOH 78  1079 1079 HOH HOH A . 
B 2 HOH 79  1080 1080 HOH HOH A . 
B 2 HOH 80  1081 1081 HOH HOH A . 
B 2 HOH 81  1082 1082 HOH HOH A . 
B 2 HOH 82  1083 1083 HOH HOH A . 
B 2 HOH 83  1084 1084 HOH HOH A . 
B 2 HOH 84  1085 1085 HOH HOH A . 
B 2 HOH 85  1086 1086 HOH HOH A . 
B 2 HOH 86  1087 1087 HOH HOH A . 
B 2 HOH 87  1088 1088 HOH HOH A . 
B 2 HOH 88  1089 1089 HOH HOH A . 
B 2 HOH 89  1090 1090 HOH HOH A . 
B 2 HOH 90  1091 1091 HOH HOH A . 
B 2 HOH 91  1092 1092 HOH HOH A . 
B 2 HOH 92  1093 1093 HOH HOH A . 
B 2 HOH 93  1094 1094 HOH HOH A . 
B 2 HOH 94  1095 1095 HOH HOH A . 
B 2 HOH 95  1096 1096 HOH HOH A . 
B 2 HOH 96  1097 1097 HOH HOH A . 
B 2 HOH 97  1098 1098 HOH HOH A . 
B 2 HOH 98  1099 1099 HOH HOH A . 
B 2 HOH 99  1100 1100 HOH HOH A . 
B 2 HOH 100 1101 1101 HOH HOH A . 
B 2 HOH 101 1102 1102 HOH HOH A . 
B 2 HOH 102 1103 1103 HOH HOH A . 
B 2 HOH 103 1104 1104 HOH HOH A . 
B 2 HOH 104 1105 1105 HOH HOH A . 
B 2 HOH 105 1107 1107 HOH HOH A . 
B 2 HOH 106 1108 1108 HOH HOH A . 
B 2 HOH 107 1109 1109 HOH HOH A . 
B 2 HOH 108 1110 1110 HOH HOH A . 
B 2 HOH 109 1111 1111 HOH HOH A . 
B 2 HOH 110 1112 1112 HOH HOH A . 
B 2 HOH 111 1113 1113 HOH HOH A . 
B 2 HOH 112 1114 1114 HOH HOH A . 
B 2 HOH 113 1115 1115 HOH HOH A . 
B 2 HOH 114 1116 1116 HOH HOH A . 
B 2 HOH 115 1117 1117 HOH HOH A . 
B 2 HOH 116 1118 1118 HOH HOH A . 
B 2 HOH 117 1119 1119 HOH HOH A . 
B 2 HOH 118 1120 1120 HOH HOH A . 
B 2 HOH 119 1121 1121 HOH HOH A . 
B 2 HOH 120 1122 1122 HOH HOH A . 
B 2 HOH 121 1123 1123 HOH HOH A . 
B 2 HOH 122 1124 1124 HOH HOH A . 
B 2 HOH 123 1125 1125 HOH HOH A . 
B 2 HOH 124 1126 1126 HOH HOH A . 
B 2 HOH 125 1127 1127 HOH HOH A . 
B 2 HOH 126 1128 1128 HOH HOH A . 
B 2 HOH 127 1129 1129 HOH HOH A . 
B 2 HOH 128 1132 1132 HOH HOH A . 
B 2 HOH 129 1133 1133 HOH HOH A . 
B 2 HOH 130 1134 1134 HOH HOH A . 
B 2 HOH 131 1135 1135 HOH HOH A . 
B 2 HOH 132 1136 1136 HOH HOH A . 
B 2 HOH 133 1138 1138 HOH HOH A . 
B 2 HOH 134 1140 1140 HOH HOH A . 
B 2 HOH 135 1142 1142 HOH HOH A . 
B 2 HOH 136 1143 1143 HOH HOH A . 
B 2 HOH 137 1144 1144 HOH HOH A . 
B 2 HOH 138 1145 1145 HOH HOH A . 
B 2 HOH 139 1146 1146 HOH HOH A . 
B 2 HOH 140 1147 1147 HOH HOH A . 
B 2 HOH 141 1149 1149 HOH HOH A . 
B 2 HOH 142 1150 1150 HOH HOH A . 
B 2 HOH 143 1151 1151 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-09-23 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 0 ? A MET 1 
2 1 Y 1 A ALA 1 ? A ALA 2 
3 1 Y 1 A SER 2 ? A SER 3 
4 1 Y 1 A LYS 3 ? A LYS 4 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#