data_1RM9
# 
_entry.id   1RM9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1RM9         
RCSB  RCSB020882   
WWPDB D_1000020882 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1OXD 'The same protein incorporated with different noncanonical amino acid' unspecified 
PDB 1RM9 .                                                                      unspecified 
PDB 1RMM .                                                                      unspecified 
PDB 1RMO .                                                                      unspecified 
PDB 1RMP .                                                                      unspecified 
# 
_pdbx_database_status.entry_id                        1RM9 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Budisa, N.'    1 
'Pal, P.P.'     2 
'Alefelder, S.' 3 
'Birle, P.'     4 
'Krywcun, T.'   5 
'Rubini, M.'    6 
'Wenger, W.'    7 
'Bae, J.H.'     8 
'Steiner, T.'   9 
# 
_citation.id                        primary 
_citation.title                     
'Probing the role of tryptophans in Aequorea victoria green fluorescent proteins with an expanded genetic code' 
_citation.journal_abbrev            Biol.Chem. 
_citation.journal_volume            385 
_citation.page_first                191 
_citation.page_last                 202 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1431-6730 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15101562 
_citation.pdbx_database_id_DOI      10.1515/BC.2004.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Budisa, N.'    1 
primary 'Pal, P.P.'     2 
primary 'Alefelder, S.' 3 
primary 'Birle, P.'     4 
primary 'Krywcun, T.'   5 
primary 'Rubini, M.'    6 
primary 'Wenger, W.'    7 
primary 'Bae, J.H.'     8 
primary 'Steiner, T.'   9 
# 
_cell.entry_id           1RM9 
_cell.length_a           51.057 
_cell.length_b           62.507 
_cell.length_c           69.466 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1RM9 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'avermectin-sensitive chloride channel GluCl beta/cyan fluorescent protein fusion' 26856.258 1  ? ? ? 
4-Fluorotryptophan-containing 
2 water   nat water                                                                              18.015    61 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cyan Fluorescent Protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVP(4FW)PTLVTTL(4F3)VQCFSRY
PDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITA
DKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMD
ELYK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGYGVQCFSRYPDHMKR
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNG
IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   SER n 
1 3   LYS n 
1 4   GLY n 
1 5   GLU n 
1 6   GLU n 
1 7   LEU n 
1 8   PHE n 
1 9   THR n 
1 10  GLY n 
1 11  VAL n 
1 12  VAL n 
1 13  PRO n 
1 14  ILE n 
1 15  LEU n 
1 16  VAL n 
1 17  GLU n 
1 18  LEU n 
1 19  ASP n 
1 20  GLY n 
1 21  ASP n 
1 22  VAL n 
1 23  ASN n 
1 24  GLY n 
1 25  HIS n 
1 26  LYS n 
1 27  PHE n 
1 28  SER n 
1 29  VAL n 
1 30  SER n 
1 31  GLY n 
1 32  GLU n 
1 33  GLY n 
1 34  GLU n 
1 35  GLY n 
1 36  ASP n 
1 37  ALA n 
1 38  THR n 
1 39  TYR n 
1 40  GLY n 
1 41  LYS n 
1 42  LEU n 
1 43  THR n 
1 44  LEU n 
1 45  LYS n 
1 46  PHE n 
1 47  ILE n 
1 48  CYS n 
1 49  THR n 
1 50  THR n 
1 51  GLY n 
1 52  LYS n 
1 53  LEU n 
1 54  PRO n 
1 55  VAL n 
1 56  PRO n 
1 57  4FW n 
1 58  PRO n 
1 59  THR n 
1 60  LEU n 
1 61  VAL n 
1 62  THR n 
1 63  THR n 
1 64  LEU n 
1 65  4F3 n 
1 66  VAL n 
1 67  GLN n 
1 68  CYS n 
1 69  PHE n 
1 70  SER n 
1 71  ARG n 
1 72  TYR n 
1 73  PRO n 
1 74  ASP n 
1 75  HIS n 
1 76  MET n 
1 77  LYS n 
1 78  ARG n 
1 79  HIS n 
1 80  ASP n 
1 81  PHE n 
1 82  PHE n 
1 83  LYS n 
1 84  SER n 
1 85  ALA n 
1 86  MET n 
1 87  PRO n 
1 88  GLU n 
1 89  GLY n 
1 90  TYR n 
1 91  VAL n 
1 92  GLN n 
1 93  GLU n 
1 94  ARG n 
1 95  THR n 
1 96  ILE n 
1 97  PHE n 
1 98  PHE n 
1 99  LYS n 
1 100 ASP n 
1 101 ASP n 
1 102 GLY n 
1 103 ASN n 
1 104 TYR n 
1 105 LYS n 
1 106 THR n 
1 107 ARG n 
1 108 ALA n 
1 109 GLU n 
1 110 VAL n 
1 111 LYS n 
1 112 PHE n 
1 113 GLU n 
1 114 GLY n 
1 115 ASP n 
1 116 THR n 
1 117 LEU n 
1 118 VAL n 
1 119 ASN n 
1 120 ARG n 
1 121 ILE n 
1 122 GLU n 
1 123 LEU n 
1 124 LYS n 
1 125 GLY n 
1 126 ILE n 
1 127 ASP n 
1 128 PHE n 
1 129 LYS n 
1 130 GLU n 
1 131 ASP n 
1 132 GLY n 
1 133 ASN n 
1 134 ILE n 
1 135 LEU n 
1 136 GLY n 
1 137 HIS n 
1 138 LYS n 
1 139 LEU n 
1 140 GLU n 
1 141 TYR n 
1 142 ASN n 
1 143 TYR n 
1 144 ILE n 
1 145 SER n 
1 146 HIS n 
1 147 ASN n 
1 148 VAL n 
1 149 TYR n 
1 150 ILE n 
1 151 THR n 
1 152 ALA n 
1 153 ASP n 
1 154 LYS n 
1 155 GLN n 
1 156 LYS n 
1 157 ASN n 
1 158 GLY n 
1 159 ILE n 
1 160 LYS n 
1 161 ALA n 
1 162 ASN n 
1 163 PHE n 
1 164 LYS n 
1 165 ILE n 
1 166 ARG n 
1 167 HIS n 
1 168 ASN n 
1 169 ILE n 
1 170 GLU n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 VAL n 
1 175 GLN n 
1 176 LEU n 
1 177 ALA n 
1 178 ASP n 
1 179 HIS n 
1 180 TYR n 
1 181 GLN n 
1 182 GLN n 
1 183 ASN n 
1 184 THR n 
1 185 PRO n 
1 186 ILE n 
1 187 GLY n 
1 188 ASP n 
1 189 GLY n 
1 190 PRO n 
1 191 VAL n 
1 192 LEU n 
1 193 LEU n 
1 194 PRO n 
1 195 ASP n 
1 196 ASN n 
1 197 HIS n 
1 198 TYR n 
1 199 LEU n 
1 200 SER n 
1 201 THR n 
1 202 GLN n 
1 203 SER n 
1 204 ALA n 
1 205 LEU n 
1 206 SER n 
1 207 LYS n 
1 208 ASP n 
1 209 PRO n 
1 210 ASN n 
1 211 GLU n 
1 212 LYS n 
1 213 ARG n 
1 214 ASP n 
1 215 HIS n 
1 216 MET n 
1 217 VAL n 
1 218 LEU n 
1 219 LEU n 
1 220 GLU n 
1 221 PHE n 
1 222 VAL n 
1 223 THR n 
1 224 ALA n 
1 225 ALA n 
1 226 GLY n 
1 227 ILE n 
1 228 THR n 
1 229 LEU n 
1 230 GLY n 
1 231 MET n 
1 232 ASP n 
1 233 GLU n 
1 234 LEU n 
1 235 TYR n 
1 236 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aequorea 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aequorea victoria' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6100 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pECFP 
_entity_src_gen.plasmid_details                    'plasmid bought from BD Clontech' 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GFP_AEQVI 
_struct_ref.pdbx_db_accession          P42212 
_struct_ref.pdbx_align_begin           371 
_struct_ref.pdbx_seq_one_letter_code   
;VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNG
IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RM9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 234 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P42212 
_struct_ref_seq.db_align_beg                  371 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  608 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       236 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RM9 4F3 A 65 ? UNP P42212 THR 435 CHROMOPHORE 66 1 
1 1RM9 4F3 A 65 ? UNP P42212 TRP 436 CHROMOPHORE 66 2 
1 1RM9 4F3 A 65 ? UNP P42212 GLY 437 CHROMOPHORE 66 3 
1 1RM9 ARG A 78 ? UNP P42212 GLN 450 CONFLICT    80 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4F3 'L-peptide linking' n '[2-(1-AMINO-2-HYDROXY-PROPYL)-4-(4-FLUORO-1H-INDOL-3-YLMETHYL)-5-HYDROXY-IMIDAZOL-1-YL]-ACETIC ACID' ? 
'C17 H19 F N4 O4' 362.356 
4FW 'L-peptide linking' n 4-FLUOROTRYPTOPHANE                                                                                   ? 
'C11 H11 F N2 O2' 222.216 
ALA 'L-peptide linking' y ALANINE                                                                                               ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                              ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                            ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                       ? 
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                              ? 
'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                             ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                       ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                               ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                             ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                                 ? 
'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                            ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                               ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                            ? 
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                         ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                               ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                                ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                             ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                            ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                              ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                                ? 
'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1RM9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   40.38 
_exptl_crystal.density_Matthews      2.06 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    '22% PEG 10000, pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-03-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.050 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.050 
# 
_reflns.entry_id                     1RM9 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30. 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   5068 
_reflns.number_all                   5252 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        44.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.94 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1RM9 
_refine.ls_number_reflns_obs                     5068 
_refine.ls_number_reflns_all                     5068 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               309103.44 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          0.2071 
_refine.ls_R_factor_all                          0.2071 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.9 
_refine.ls_number_reflns_R_free                  536 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.9 
_refine.aniso_B[1][1]                            -7.27 
_refine.aniso_B[2][2]                            4.72 
_refine.aniso_B[3][3]                            2.56 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.372465 
_refine.solvent_model_param_bsol                 30.4057 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1EMG 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1RM9 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.32 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.37 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1783 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             61 
_refine_hist.number_atoms_total               1844 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.0089 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.30   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.9   ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 2.37   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             682 
_refine_ls_shell.R_factor_R_work                  0.273 
_refine_ls_shell.percent_reflns_obs               93.4 
_refine_ls_shell.R_factor_R_free                  0.289 
_refine_ls_shell.R_factor_R_free_error            0.027 
_refine_ls_shell.percent_reflns_R_free            14.2 
_refine_ls_shell.number_reflns_R_free             113 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
2 PRO_4C          PRO_4C    'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1RM9 
_struct.title                     
'Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code' 
_struct.pdbx_descriptor           'avermectin-sensitive chloride channel GluCl beta/cyan fluorescent protein fusion' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RM9 
_struct_keywords.pdbx_keywords   'LUMINESCENT PROTEIN' 
_struct_keywords.text            'Beta-barrel; GFP; Noncanonical amino acid, LUMINESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 3  ? PHE A 8  ? LYS A 3  PHE A 8  5 ? 6 
HELX_P HELX_P2 2 PRO A 56 ? VAL A 61 ? PRO A 56 VAL A 61 5 ? 6 
HELX_P HELX_P3 3 VAL A 66 ? SER A 70 ? VAL A 68 SER A 72 5 ? 5 
HELX_P HELX_P4 4 PRO A 73 ? HIS A 79 ? PRO A 75 HIS A 81 5 ? 7 
HELX_P HELX_P5 5 ASP A 80 ? ALA A 85 ? ASP A 82 ALA A 87 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A PRO 56 C ? ? ? 1_555 A 4FW 57 N ? ? A PRO 56 A 4FW 57 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale2 covale ? ? A 4FW 57 C ? ? ? 1_555 A PRO 58 N ? ? A 4FW 57 A PRO 58 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale3 covale ? ? A LEU 64 C ? ? ? 1_555 A 4F3 65 N ? ? A LEU 64 A 4F3 66 1_555 ? ? ? ? ? ? ? 1.449 ? 
covale4 covale ? ? A 4F3 65 C ? ? ? 1_555 A VAL 66 N ? ? A 4F3 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.431 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          MET 
_struct_mon_prot_cis.label_seq_id           86 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           MET 
_struct_mon_prot_cis.auth_seq_id            88 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    87 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     89 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.71 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   12 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 11  ? VAL A 22  ? VAL A 11  VAL A 22  
A 2  HIS A 25  ? ASP A 36  ? HIS A 25  ASP A 36  
A 3  LYS A 41  ? CYS A 48  ? LYS A 41  CYS A 48  
A 4  HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 
A 5  HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 
A 6  TYR A 143 ? ASP A 153 ? TYR A 145 ASP A 155 
A 7  GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 
A 8  VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 
A 9  TYR A 90  ? PHE A 98  ? TYR A 92  PHE A 100 
A 10 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 
A 11 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 
A 12 VAL A 11  ? VAL A 22  ? VAL A 11  VAL A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 16  ? N VAL A 16  O GLY A 31  ? O GLY A 31  
A 2  3  N SER A 30  ? N SER A 30  O ILE A 47  ? O ILE A 47  
A 3  4  N LEU A 44  ? N LEU A 44  O LEU A 218 ? O LEU A 220 
A 4  5  O VAL A 217 ? O VAL A 219 N SER A 206 ? N SER A 208 
A 5  6  O SER A 203 ? O SER A 205 N ILE A 144 ? N ILE A 146 
A 6  7  N ASP A 153 ? N ASP A 155 O GLY A 158 ? O GLY A 160 
A 7  8  N ALA A 161 ? N ALA A 163 O GLN A 181 ? O GLN A 183 
A 8  9  O THR A 184 ? O THR A 186 N VAL A 91  ? N VAL A 93  
A 9  10 N GLN A 92  ? N GLN A 94  O ALA A 108 ? O ALA A 110 
A 10 11 N LYS A 111 ? N LYS A 113 O VAL A 118 ? O VAL A 120 
A 11 12 O GLY A 125 ? O GLY A 127 N ASP A 21  ? N ASP A 21  
# 
_atom_sites.entry_id                    1RM9 
_atom_sites.fract_transf_matrix[1][1]   0.019586 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015998 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014396 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 3   ? 22.813 7.484  50.948 1.00 55.90 ? 3   LYS A N   1 
ATOM   2    C CA  . LYS A 1 3   ? 23.841 8.418  50.397 1.00 56.35 ? 3   LYS A CA  1 
ATOM   3    C C   . LYS A 1 3   ? 23.371 9.034  49.073 1.00 56.06 ? 3   LYS A C   1 
ATOM   4    O O   . LYS A 1 3   ? 22.964 8.315  48.154 1.00 56.14 ? 3   LYS A O   1 
ATOM   5    C CB  . LYS A 1 3   ? 25.165 7.672  50.174 1.00 57.54 ? 3   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 3   ? 25.664 6.900  51.392 1.00 59.46 ? 3   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 3   ? 26.950 6.130  51.106 1.00 59.68 ? 3   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 3   ? 27.228 5.114  52.201 1.00 59.51 ? 3   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 3   ? 26.112 4.130  52.289 1.00 57.06 ? 3   LYS A NZ  1 
ATOM   10   N N   . GLY A 1 4   ? 23.439 10.388 48.974 1.00 54.65 ? 4   GLY A N   1 
ATOM   11   C CA  . GLY A 1 4   ? 23.018 11.059 47.758 1.00 52.78 ? 4   GLY A CA  1 
ATOM   12   C C   . GLY A 1 4   ? 24.089 11.053 46.684 1.00 52.15 ? 4   GLY A C   1 
ATOM   13   O O   . GLY A 1 4   ? 23.851 11.438 45.541 1.00 51.86 ? 4   GLY A O   1 
ATOM   14   N N   . GLU A 1 5   ? 25.295 10.603 47.057 1.00 52.19 ? 5   GLU A N   1 
ATOM   15   C CA  . GLU A 1 5   ? 26.404 10.556 46.121 1.00 51.76 ? 5   GLU A CA  1 
ATOM   16   C C   . GLU A 1 5   ? 26.192 9.470  45.060 1.00 49.34 ? 5   GLU A C   1 
ATOM   17   O O   . GLU A 1 5   ? 26.681 9.593  43.940 1.00 49.42 ? 5   GLU A O   1 
ATOM   18   C CB  . GLU A 1 5   ? 27.713 10.296 46.869 1.00 54.77 ? 5   GLU A CB  1 
ATOM   19   C CG  . GLU A 1 5   ? 28.954 10.339 45.980 1.00 59.20 ? 5   GLU A CG  1 
ATOM   20   C CD  . GLU A 1 5   ? 30.158 9.628  46.601 1.00 61.95 ? 5   GLU A CD  1 
ATOM   21   O OE1 . GLU A 1 5   ? 30.563 9.991  47.726 1.00 63.73 ? 5   GLU A OE1 1 
ATOM   22   O OE2 . GLU A 1 5   ? 30.704 8.713  45.947 1.00 63.54 ? 5   GLU A OE2 1 
ATOM   23   N N   . GLU A 1 6   ? 25.447 8.396  45.414 1.00 46.72 ? 6   GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 25.199 7.302  44.477 1.00 44.09 ? 6   GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 24.304 7.702  43.317 1.00 40.52 ? 6   GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 24.250 7.003  42.312 1.00 39.69 ? 6   GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 24.544 6.120  45.186 1.00 47.34 ? 6   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 25.245 5.664  46.427 1.00 51.92 ? 6   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 24.618 4.407  47.004 1.00 54.45 ? 6   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 24.655 3.358  46.319 1.00 54.78 ? 6   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 24.080 4.478  48.132 1.00 55.19 ? 6   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 23.589 8.836  43.471 1.00 36.82 ? 7   LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 22.684 9.323  42.436 1.00 32.72 ? 7   LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 23.374 10.079 41.313 1.00 30.11 ? 7   LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 22.735 10.432 40.322 1.00 29.80 ? 7   LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 21.617 10.224 43.051 1.00 32.47 ? 7   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 20.496 9.558  43.858 1.00 31.64 ? 7   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 19.696 10.590 44.656 1.00 31.14 ? 7   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 19.598 8.815  42.905 1.00 31.40 ? 7   LEU A CD2 1 
ATOM   40   N N   . PHE A 1 8   ? 24.687 10.331 41.459 1.00 27.93 ? 8   PHE A N   1 
ATOM   41   C CA  . PHE A 1 8   ? 25.427 11.079 40.446 1.00 27.13 ? 8   PHE A CA  1 
ATOM   42   C C   . PHE A 1 8   ? 26.544 10.282 39.801 1.00 27.72 ? 8   PHE A C   1 
ATOM   43   O O   . PHE A 1 8   ? 27.289 10.797 38.966 1.00 28.50 ? 8   PHE A O   1 
ATOM   44   C CB  . PHE A 1 8   ? 26.020 12.337 41.076 1.00 25.84 ? 8   PHE A CB  1 
ATOM   45   C CG  . PHE A 1 8   ? 24.997 13.356 41.463 1.00 24.15 ? 8   PHE A CG  1 
ATOM   46   C CD1 . PHE A 1 8   ? 24.434 14.189 40.507 1.00 22.98 ? 8   PHE A CD1 1 
ATOM   47   C CD2 . PHE A 1 8   ? 24.582 13.470 42.785 1.00 23.82 ? 8   PHE A CD2 1 
ATOM   48   C CE1 . PHE A 1 8   ? 23.472 15.121 40.857 1.00 22.69 ? 8   PHE A CE1 1 
ATOM   49   C CE2 . PHE A 1 8   ? 23.618 14.404 43.148 1.00 23.04 ? 8   PHE A CE2 1 
ATOM   50   C CZ  . PHE A 1 8   ? 23.061 15.234 42.179 1.00 22.89 ? 8   PHE A CZ  1 
ATOM   51   N N   . THR A 1 9   ? 26.664 9.009  40.177 1.00 26.46 ? 9   THR A N   1 
ATOM   52   C CA  . THR A 1 9   ? 27.731 8.208  39.628 1.00 26.29 ? 9   THR A CA  1 
ATOM   53   C C   . THR A 1 9   ? 27.801 8.160  38.103 1.00 26.72 ? 9   THR A C   1 
ATOM   54   O O   . THR A 1 9   ? 28.864 7.881  37.552 1.00 26.78 ? 9   THR A O   1 
ATOM   55   C CB  . THR A 1 9   ? 27.699 6.793  40.195 1.00 25.27 ? 9   THR A CB  1 
ATOM   56   O OG1 . THR A 1 9   ? 26.358 6.436  40.542 1.00 24.55 ? 9   THR A OG1 1 
ATOM   57   C CG2 . THR A 1 9   ? 28.585 6.716  41.421 1.00 23.70 ? 9   THR A CG2 1 
ATOM   58   N N   . GLY A 1 10  ? 26.693 8.457  37.401 1.00 26.53 ? 10  GLY A N   1 
ATOM   59   C CA  . GLY A 1 10  ? 26.749 8.416  35.948 1.00 25.62 ? 10  GLY A CA  1 
ATOM   60   C C   . GLY A 1 10  ? 26.136 9.644  35.309 1.00 25.55 ? 10  GLY A C   1 
ATOM   61   O O   . GLY A 1 10  ? 25.982 10.679 35.965 1.00 26.15 ? 10  GLY A O   1 
ATOM   62   N N   . VAL A 1 11  ? 25.766 9.534  34.017 1.00 24.41 ? 11  VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 25.158 10.661 33.318 1.00 23.74 ? 11  VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 23.698 10.825 33.765 1.00 22.17 ? 11  VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 22.900 9.903  33.649 1.00 20.29 ? 11  VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 25.198 10.459 31.790 1.00 23.51 ? 11  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 25.022 11.789 31.087 1.00 23.51 ? 11  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 26.506 9.816  31.392 1.00 22.89 ? 11  VAL A CG2 1 
ATOM   69   N N   . VAL A 1 12  ? 23.365 12.044 34.274 1.00 21.41 ? 12  VAL A N   1 
ATOM   70   C CA  . VAL A 1 12  ? 22.019 12.359 34.764 1.00 21.45 ? 12  VAL A CA  1 
ATOM   71   C C   . VAL A 1 12  ? 21.261 13.439 33.969 1.00 21.96 ? 12  VAL A C   1 
ATOM   72   O O   . VAL A 1 12  ? 21.747 14.565 33.828 1.00 23.79 ? 12  VAL A O   1 
ATOM   73   C CB  . VAL A 1 12  ? 22.092 12.827 36.216 1.00 20.32 ? 12  VAL A CB  1 
ATOM   74   C CG1 . VAL A 1 12  ? 20.676 13.064 36.758 1.00 20.03 ? 12  VAL A CG1 1 
ATOM   75   C CG2 . VAL A 1 12  ? 22.852 11.810 37.045 1.00 20.32 ? 12  VAL A CG2 1 
ATOM   76   N N   . PRO A 1 13  ? 20.060 13.110 33.461 1.00 21.73 ? 13  PRO A N   1 
ATOM   77   C CA  . PRO A 1 13  ? 19.239 14.053 32.688 1.00 20.74 ? 13  PRO A CA  1 
ATOM   78   C C   . PRO A 1 13  ? 18.966 15.321 33.516 1.00 20.98 ? 13  PRO A C   1 
ATOM   79   O O   . PRO A 1 13  ? 18.606 15.230 34.687 1.00 21.97 ? 13  PRO A O   1 
ATOM   80   C CB  . PRO A 1 13  ? 17.967 13.253 32.414 1.00 20.04 ? 13  PRO A CB  1 
ATOM   81   C CG  . PRO A 1 13  ? 18.466 11.834 32.354 1.00 20.36 ? 13  PRO A CG  1 
ATOM   82   C CD  . PRO A 1 13  ? 19.440 11.773 33.507 1.00 20.94 ? 13  PRO A CD  1 
ATOM   83   N N   . ILE A 1 14  ? 19.134 16.523 32.903 1.00 19.71 ? 14  ILE A N   1 
ATOM   84   C CA  . ILE A 1 14  ? 18.932 17.766 33.633 1.00 19.99 ? 14  ILE A CA  1 
ATOM   85   C C   . ILE A 1 14  ? 17.807 18.652 33.114 1.00 20.32 ? 14  ILE A C   1 
ATOM   86   O O   . ILE A 1 14  ? 17.772 19.002 31.944 1.00 22.69 ? 14  ILE A O   1 
ATOM   87   C CB  . ILE A 1 14  ? 20.236 18.608 33.642 1.00 18.58 ? 14  ILE A CB  1 
ATOM   88   C CG1 . ILE A 1 14  ? 21.382 17.783 34.234 1.00 17.48 ? 14  ILE A CG1 1 
ATOM   89   C CG2 . ILE A 1 14  ? 20.059 19.881 34.468 1.00 15.10 ? 14  ILE A CG2 1 
ATOM   90   C CD1 . ILE A 1 14  ? 22.690 18.543 34.288 1.00 17.71 ? 14  ILE A CD1 1 
ATOM   91   N N   . LEU A 1 15  ? 16.866 19.028 33.981 1.00 19.67 ? 15  LEU A N   1 
ATOM   92   C CA  . LEU A 1 15  ? 15.805 19.898 33.514 1.00 20.89 ? 15  LEU A CA  1 
ATOM   93   C C   . LEU A 1 15  ? 15.937 21.239 34.195 1.00 20.99 ? 15  LEU A C   1 
ATOM   94   O O   . LEU A 1 15  ? 16.103 21.310 35.412 1.00 21.20 ? 15  LEU A O   1 
ATOM   95   C CB  . LEU A 1 15  ? 14.423 19.313 33.826 1.00 22.94 ? 15  LEU A CB  1 
ATOM   96   C CG  . LEU A 1 15  ? 13.984 18.081 33.028 1.00 26.65 ? 15  LEU A CG  1 
ATOM   97   C CD1 . LEU A 1 15  ? 12.661 17.570 33.578 1.00 27.59 ? 15  LEU A CD1 1 
ATOM   98   C CD2 . LEU A 1 15  ? 13.858 18.442 31.550 1.00 26.89 ? 15  LEU A CD2 1 
ATOM   99   N N   . VAL A 1 16  ? 15.871 22.306 33.412 1.00 20.82 ? 16  VAL A N   1 
ATOM   100  C CA  . VAL A 1 16  ? 15.977 23.626 33.984 1.00 22.09 ? 16  VAL A CA  1 
ATOM   101  C C   . VAL A 1 16  ? 14.826 24.497 33.505 1.00 22.91 ? 16  VAL A C   1 
ATOM   102  O O   . VAL A 1 16  ? 14.678 24.725 32.301 1.00 24.39 ? 16  VAL A O   1 
ATOM   103  C CB  . VAL A 1 16  ? 17.297 24.293 33.593 1.00 23.52 ? 16  VAL A CB  1 
ATOM   104  C CG1 . VAL A 1 16  ? 17.608 25.417 34.564 1.00 22.97 ? 16  VAL A CG1 1 
ATOM   105  C CG2 . VAL A 1 16  ? 18.415 23.241 33.564 1.00 25.31 ? 16  VAL A CG2 1 
ATOM   106  N N   . GLU A 1 17  ? 13.992 24.981 34.463 1.00 22.68 ? 17  GLU A N   1 
ATOM   107  C CA  . GLU A 1 17  ? 12.851 25.847 34.179 1.00 23.18 ? 17  GLU A CA  1 
ATOM   108  C C   . GLU A 1 17  ? 13.019 27.161 34.939 1.00 23.29 ? 17  GLU A C   1 
ATOM   109  O O   . GLU A 1 17  ? 13.103 27.149 36.168 1.00 23.52 ? 17  GLU A O   1 
ATOM   110  C CB  . GLU A 1 17  ? 11.554 25.168 34.621 1.00 23.96 ? 17  GLU A CB  1 
ATOM   111  C CG  . GLU A 1 17  ? 11.270 23.848 33.924 1.00 28.83 ? 17  GLU A CG  1 
ATOM   112  C CD  . GLU A 1 17  ? 11.180 24.001 32.420 1.00 32.19 ? 17  GLU A CD  1 
ATOM   113  O OE1 . GLU A 1 17  ? 10.340 24.799 31.947 1.00 34.01 ? 17  GLU A OE1 1 
ATOM   114  O OE2 . GLU A 1 17  ? 11.934 23.313 31.702 1.00 34.63 ? 17  GLU A OE2 1 
ATOM   115  N N   . LEU A 1 18  ? 13.064 28.312 34.205 1.00 22.46 ? 18  LEU A N   1 
ATOM   116  C CA  . LEU A 1 18  ? 13.249 29.623 34.836 1.00 23.02 ? 18  LEU A CA  1 
ATOM   117  C C   . LEU A 1 18  ? 12.277 30.716 34.430 1.00 23.45 ? 18  LEU A C   1 
ATOM   118  O O   . LEU A 1 18  ? 12.008 30.933 33.244 1.00 23.77 ? 18  LEU A O   1 
ATOM   119  C CB  . LEU A 1 18  ? 14.673 30.136 34.597 1.00 24.80 ? 18  LEU A CB  1 
ATOM   120  C CG  . LEU A 1 18  ? 14.991 31.565 35.078 1.00 26.50 ? 18  LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 18  ? 16.467 31.667 35.415 1.00 29.48 ? 18  LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 18  ? 14.632 32.599 34.030 1.00 25.86 ? 18  LEU A CD2 1 
ATOM   123  N N   . ASP A 1 19  ? 11.771 31.436 35.443 1.00 23.61 ? 19  ASP A N   1 
ATOM   124  C CA  . ASP A 1 19  ? 10.854 32.547 35.231 1.00 23.32 ? 19  ASP A CA  1 
ATOM   125  C C   . ASP A 1 19  ? 11.467 33.791 35.802 1.00 23.34 ? 19  ASP A C   1 
ATOM   126  O O   . ASP A 1 19  ? 11.780 33.837 36.994 1.00 23.24 ? 19  ASP A O   1 
ATOM   127  C CB  . ASP A 1 19  ? 9.534  32.276 35.919 1.00 23.51 ? 19  ASP A CB  1 
ATOM   128  C CG  . ASP A 1 19  ? 8.788  31.171 35.262 1.00 25.10 ? 19  ASP A CG  1 
ATOM   129  O OD1 . ASP A 1 19  ? 8.761  31.168 34.017 1.00 22.37 ? 19  ASP A OD1 1 
ATOM   130  O OD2 . ASP A 1 19  ? 8.241  30.305 35.980 1.00 27.71 ? 19  ASP A OD2 1 
ATOM   131  N N   . GLY A 1 20  ? 11.636 34.809 34.945 1.00 23.04 ? 20  GLY A N   1 
ATOM   132  C CA  . GLY A 1 20  ? 12.251 36.037 35.404 1.00 22.44 ? 20  GLY A CA  1 
ATOM   133  C C   . GLY A 1 20  ? 11.521 37.317 35.093 1.00 21.89 ? 20  GLY A C   1 
ATOM   134  O O   . GLY A 1 20  ? 10.657 37.388 34.231 1.00 21.71 ? 20  GLY A O   1 
ATOM   135  N N   . ASP A 1 21  ? 11.902 38.359 35.830 1.00 22.72 ? 21  ASP A N   1 
ATOM   136  C CA  . ASP A 1 21  ? 11.313 39.676 35.669 1.00 23.86 ? 21  ASP A CA  1 
ATOM   137  C C   . ASP A 1 21  ? 12.403 40.716 35.921 1.00 25.68 ? 21  ASP A C   1 
ATOM   138  O O   . ASP A 1 21  ? 12.719 41.036 37.078 1.00 25.30 ? 21  ASP A O   1 
ATOM   139  C CB  . ASP A 1 21  ? 10.180 39.849 36.675 1.00 23.35 ? 21  ASP A CB  1 
ATOM   140  C CG  . ASP A 1 21  ? 9.529  41.212 36.599 1.00 24.63 ? 21  ASP A CG  1 
ATOM   141  O OD1 . ASP A 1 21  ? 10.229 42.207 36.309 1.00 25.00 ? 21  ASP A OD1 1 
ATOM   142  O OD2 . ASP A 1 21  ? 8.305  41.297 36.839 1.00 26.07 ? 21  ASP A OD2 1 
ATOM   143  N N   . VAL A 1 22  ? 12.977 41.248 34.827 1.00 25.67 ? 22  VAL A N   1 
ATOM   144  C CA  . VAL A 1 22  ? 14.021 42.251 34.935 1.00 26.31 ? 22  VAL A CA  1 
ATOM   145  C C   . VAL A 1 22  ? 13.463 43.623 34.552 1.00 26.61 ? 22  VAL A C   1 
ATOM   146  O O   . VAL A 1 22  ? 13.036 43.841 33.416 1.00 27.19 ? 22  VAL A O   1 
ATOM   147  C CB  . VAL A 1 22  ? 15.221 41.896 34.026 1.00 26.98 ? 22  VAL A CB  1 
ATOM   148  C CG1 . VAL A 1 22  ? 16.448 42.719 34.414 1.00 27.05 ? 22  VAL A CG1 1 
ATOM   149  C CG2 . VAL A 1 22  ? 15.518 40.406 34.137 1.00 26.85 ? 22  VAL A CG2 1 
ATOM   150  N N   . ASN A 1 23  ? 13.463 44.555 35.537 1.00 27.31 ? 23  ASN A N   1 
ATOM   151  C CA  . ASN A 1 23  ? 12.953 45.908 35.345 1.00 27.53 ? 23  ASN A CA  1 
ATOM   152  C C   . ASN A 1 23  ? 11.553 45.902 34.731 1.00 26.92 ? 23  ASN A C   1 
ATOM   153  O O   . ASN A 1 23  ? 11.158 46.868 34.086 1.00 26.61 ? 23  ASN A O   1 
ATOM   154  C CB  . ASN A 1 23  ? 13.903 46.723 34.448 1.00 28.66 ? 23  ASN A CB  1 
ATOM   155  C CG  . ASN A 1 23  ? 15.028 47.413 35.228 1.00 31.14 ? 23  ASN A CG  1 
ATOM   156  O OD1 . ASN A 1 23  ? 15.781 46.771 35.968 1.00 32.64 ? 23  ASN A OD1 1 
ATOM   157  N ND2 . ASN A 1 23  ? 15.148 48.731 35.046 1.00 29.29 ? 23  ASN A ND2 1 
ATOM   158  N N   . GLY A 1 24  ? 10.798 44.796 34.929 1.00 27.30 ? 24  GLY A N   1 
ATOM   159  C CA  . GLY A 1 24  ? 9.455  44.721 34.383 1.00 27.19 ? 24  GLY A CA  1 
ATOM   160  C C   . GLY A 1 24  ? 9.318  43.917 33.103 1.00 27.07 ? 24  GLY A C   1 
ATOM   161  O O   . GLY A 1 24  ? 8.209  43.710 32.608 1.00 27.03 ? 24  GLY A O   1 
ATOM   162  N N   . HIS A 1 25  ? 10.458 43.462 32.553 1.00 26.01 ? 25  HIS A N   1 
ATOM   163  C CA  . HIS A 1 25  ? 10.453 42.670 31.328 1.00 26.29 ? 25  HIS A CA  1 
ATOM   164  C C   . HIS A 1 25  ? 10.340 41.201 31.700 1.00 24.43 ? 25  HIS A C   1 
ATOM   165  O O   . HIS A 1 25  ? 11.306 40.585 32.126 1.00 24.20 ? 25  HIS A O   1 
ATOM   166  C CB  . HIS A 1 25  ? 11.745 42.900 30.547 1.00 29.59 ? 25  HIS A CB  1 
ATOM   167  C CG  . HIS A 1 25  ? 12.000 44.339 30.219 1.00 33.45 ? 25  HIS A CG  1 
ATOM   168  N ND1 . HIS A 1 25  ? 12.141 45.312 31.187 1.00 35.26 ? 25  HIS A ND1 1 
ATOM   169  C CD2 . HIS A 1 25  ? 12.151 44.967 29.029 1.00 34.68 ? 25  HIS A CD2 1 
ATOM   170  C CE1 . HIS A 1 25  ? 12.377 46.475 30.605 1.00 36.27 ? 25  HIS A CE1 1 
ATOM   171  N NE2 . HIS A 1 25  ? 12.387 46.292 29.297 1.00 35.89 ? 25  HIS A NE2 1 
ATOM   172  N N   . LYS A 1 26  ? 9.165  40.619 31.530 1.00 24.12 ? 26  LYS A N   1 
ATOM   173  C CA  . LYS A 1 26  ? 9.004  39.222 31.897 1.00 24.18 ? 26  LYS A CA  1 
ATOM   174  C C   . LYS A 1 26  ? 9.469  38.259 30.806 1.00 23.10 ? 26  LYS A C   1 
ATOM   175  O O   . LYS A 1 26  ? 9.311  38.533 29.626 1.00 24.15 ? 26  LYS A O   1 
ATOM   176  C CB  . LYS A 1 26  ? 7.550  38.968 32.287 1.00 23.88 ? 26  LYS A CB  1 
ATOM   177  C CG  . LYS A 1 26  ? 7.115  39.811 33.473 1.00 25.34 ? 26  LYS A CG  1 
ATOM   178  C CD  . LYS A 1 26  ? 5.781  39.361 33.995 1.00 28.88 ? 26  LYS A CD  1 
ATOM   179  C CE  . LYS A 1 26  ? 5.268  40.247 35.122 1.00 30.56 ? 26  LYS A CE  1 
ATOM   180  N NZ  . LYS A 1 26  ? 4.661  41.499 34.604 1.00 32.09 ? 26  LYS A NZ  1 
ATOM   181  N N   . PHE A 1 27  ? 10.075 37.130 31.192 1.00 23.10 ? 27  PHE A N   1 
ATOM   182  C CA  . PHE A 1 27  ? 10.544 36.191 30.183 1.00 23.68 ? 27  PHE A CA  1 
ATOM   183  C C   . PHE A 1 27  ? 10.662 34.811 30.781 1.00 23.10 ? 27  PHE A C   1 
ATOM   184  O O   . PHE A 1 27  ? 10.452 34.632 31.975 1.00 25.56 ? 27  PHE A O   1 
ATOM   185  C CB  . PHE A 1 27  ? 11.910 36.612 29.667 1.00 24.93 ? 27  PHE A CB  1 
ATOM   186  C CG  . PHE A 1 27  ? 12.962 36.605 30.723 1.00 27.42 ? 27  PHE A CG  1 
ATOM   187  C CD1 . PHE A 1 27  ? 12.947 37.551 31.737 1.00 27.85 ? 27  PHE A CD1 1 
ATOM   188  C CD2 . PHE A 1 27  ? 13.948 35.628 30.732 1.00 29.07 ? 27  PHE A CD2 1 
ATOM   189  C CE1 . PHE A 1 27  ? 13.894 37.529 32.743 1.00 29.34 ? 27  PHE A CE1 1 
ATOM   190  C CE2 . PHE A 1 27  ? 14.900 35.594 31.735 1.00 29.36 ? 27  PHE A CE2 1 
ATOM   191  C CZ  . PHE A 1 27  ? 14.872 36.550 32.745 1.00 29.79 ? 27  PHE A CZ  1 
ATOM   192  N N   . SER A 1 28  ? 11.002 33.815 29.957 1.00 19.84 ? 28  SER A N   1 
ATOM   193  C CA  . SER A 1 28  ? 11.146 32.463 30.484 1.00 17.71 ? 28  SER A CA  1 
ATOM   194  C C   . SER A 1 28  ? 12.230 31.720 29.766 1.00 16.94 ? 28  SER A C   1 
ATOM   195  O O   . SER A 1 28  ? 12.387 31.842 28.552 1.00 15.18 ? 28  SER A O   1 
ATOM   196  C CB  . SER A 1 28  ? 9.854  31.663 30.330 1.00 17.77 ? 28  SER A CB  1 
ATOM   197  O OG  . SER A 1 28  ? 8.895  32.002 31.308 1.00 18.47 ? 28  SER A OG  1 
ATOM   198  N N   . VAL A 1 29  ? 12.972 30.925 30.524 1.00 15.95 ? 29  VAL A N   1 
ATOM   199  C CA  . VAL A 1 29  ? 14.021 30.141 29.912 1.00 15.83 ? 29  VAL A CA  1 
ATOM   200  C C   . VAL A 1 29  ? 13.898 28.678 30.269 1.00 16.67 ? 29  VAL A C   1 
ATOM   201  O O   . VAL A 1 29  ? 13.657 28.321 31.412 1.00 15.85 ? 29  VAL A O   1 
ATOM   202  C CB  . VAL A 1 29  ? 15.401 30.639 30.303 1.00 14.70 ? 29  VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 29  ? 16.458 29.829 29.563 1.00 13.37 ? 29  VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 29  ? 15.530 32.119 29.986 1.00 15.23 ? 29  VAL A CG2 1 
ATOM   205  N N   . SER A 1 30  ? 14.060 27.828 29.258 1.00 18.91 ? 30  SER A N   1 
ATOM   206  C CA  . SER A 1 30  ? 13.958 26.391 29.451 1.00 21.30 ? 30  SER A CA  1 
ATOM   207  C C   . SER A 1 30  ? 15.275 25.760 29.050 1.00 22.68 ? 30  SER A C   1 
ATOM   208  O O   . SER A 1 30  ? 15.862 26.146 28.042 1.00 24.12 ? 30  SER A O   1 
ATOM   209  C CB  . SER A 1 30  ? 12.839 25.808 28.592 1.00 21.75 ? 30  SER A CB  1 
ATOM   210  O OG  . SER A 1 30  ? 11.672 25.608 29.369 1.00 23.65 ? 30  SER A OG  1 
ATOM   211  N N   . GLY A 1 31  ? 15.745 24.772 29.837 1.00 21.34 ? 31  GLY A N   1 
ATOM   212  C CA  . GLY A 1 31  ? 16.995 24.133 29.486 1.00 22.77 ? 31  GLY A CA  1 
ATOM   213  C C   . GLY A 1 31  ? 17.061 22.642 29.757 1.00 23.96 ? 31  GLY A C   1 
ATOM   214  O O   . GLY A 1 31  ? 16.490 22.172 30.742 1.00 24.03 ? 31  GLY A O   1 
ATOM   215  N N   . GLU A 1 32  ? 17.755 21.880 28.873 1.00 24.18 ? 32  GLU A N   1 
ATOM   216  C CA  . GLU A 1 32  ? 17.900 20.435 29.059 1.00 24.01 ? 32  GLU A CA  1 
ATOM   217  C C   . GLU A 1 32  ? 19.358 20.068 28.837 1.00 23.51 ? 32  GLU A C   1 
ATOM   218  O O   . GLU A 1 32  ? 20.112 20.812 28.213 1.00 23.89 ? 32  GLU A O   1 
ATOM   219  C CB  . GLU A 1 32  ? 17.060 19.633 28.064 1.00 25.54 ? 32  GLU A CB  1 
ATOM   220  C CG  . GLU A 1 32  ? 15.654 20.120 27.849 1.00 29.59 ? 32  GLU A CG  1 
ATOM   221  C CD  . GLU A 1 32  ? 14.829 19.142 27.014 1.00 33.67 ? 32  GLU A CD  1 
ATOM   222  O OE1 . GLU A 1 32  ? 15.290 18.726 25.930 1.00 34.64 ? 32  GLU A OE1 1 
ATOM   223  O OE2 . GLU A 1 32  ? 13.701 18.804 27.451 1.00 38.33 ? 32  GLU A OE2 1 
ATOM   224  N N   . GLY A 1 33  ? 19.768 18.918 29.337 1.00 23.77 ? 33  GLY A N   1 
ATOM   225  C CA  . GLY A 1 33  ? 21.141 18.523 29.137 1.00 24.79 ? 33  GLY A CA  1 
ATOM   226  C C   . GLY A 1 33  ? 21.476 17.312 29.955 1.00 25.07 ? 33  GLY A C   1 
ATOM   227  O O   . GLY A 1 33  ? 20.592 16.667 30.515 1.00 23.62 ? 33  GLY A O   1 
ATOM   228  N N   . GLU A 1 34  ? 22.778 17.009 30.013 1.00 26.32 ? 34  GLU A N   1 
ATOM   229  C CA  . GLU A 1 34  ? 23.266 15.866 30.762 1.00 27.96 ? 34  GLU A CA  1 
ATOM   230  C C   . GLU A 1 34  ? 24.302 16.320 31.782 1.00 27.76 ? 34  GLU A C   1 
ATOM   231  O O   . GLU A 1 34  ? 24.975 17.340 31.589 1.00 27.76 ? 34  GLU A O   1 
ATOM   232  C CB  . GLU A 1 34  ? 23.906 14.846 29.817 1.00 29.99 ? 34  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 34  ? 22.978 14.338 28.723 1.00 31.67 ? 34  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 34  ? 23.608 13.229 27.884 1.00 35.27 ? 34  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 34  ? 23.644 12.075 28.360 1.00 35.02 ? 34  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 34  ? 24.071 13.517 26.758 1.00 38.83 ? 34  GLU A OE2 1 
ATOM   237  N N   . GLY A 1 35  ? 24.430 15.540 32.887 1.00 27.60 ? 35  GLY A N   1 
ATOM   238  C CA  . GLY A 1 35  ? 25.397 15.850 33.928 1.00 27.85 ? 35  GLY A CA  1 
ATOM   239  C C   . GLY A 1 35  ? 26.217 14.619 34.271 1.00 29.10 ? 35  GLY A C   1 
ATOM   240  O O   . GLY A 1 35  ? 25.655 13.548 34.522 1.00 29.30 ? 35  GLY A O   1 
ATOM   241  N N   . ASP A 1 36  ? 27.569 14.760 34.271 1.00 29.24 ? 36  ASP A N   1 
ATOM   242  C CA  . ASP A 1 36  ? 28.454 13.641 34.603 1.00 29.27 ? 36  ASP A CA  1 
ATOM   243  C C   . ASP A 1 36  ? 29.405 14.099 35.699 1.00 28.21 ? 36  ASP A C   1 
ATOM   244  O O   . ASP A 1 36  ? 30.492 14.595 35.413 1.00 28.47 ? 36  ASP A O   1 
ATOM   245  C CB  . ASP A 1 36  ? 29.267 13.222 33.376 1.00 30.93 ? 36  ASP A CB  1 
ATOM   246  C CG  . ASP A 1 36  ? 29.647 11.746 33.397 1.00 33.43 ? 36  ASP A CG  1 
ATOM   247  O OD1 . ASP A 1 36  ? 30.011 11.233 34.478 1.00 34.64 ? 36  ASP A OD1 1 
ATOM   248  O OD2 . ASP A 1 36  ? 29.575 11.103 32.329 1.00 33.09 ? 36  ASP A OD2 1 
ATOM   249  N N   . ALA A 1 37  ? 28.996 13.936 36.979 1.00 26.58 ? 37  ALA A N   1 
ATOM   250  C CA  . ALA A 1 37  ? 29.836 14.383 38.088 1.00 25.49 ? 37  ALA A CA  1 
ATOM   251  C C   . ALA A 1 37  ? 31.221 13.770 38.057 1.00 25.04 ? 37  ALA A C   1 
ATOM   252  O O   . ALA A 1 37  ? 32.189 14.395 38.482 1.00 25.84 ? 37  ALA A O   1 
ATOM   253  C CB  . ALA A 1 37  ? 29.169 14.075 39.420 1.00 25.92 ? 37  ALA A CB  1 
ATOM   254  N N   . THR A 1 38  ? 31.321 12.526 37.562 1.00 23.83 ? 38  THR A N   1 
ATOM   255  C CA  . THR A 1 38  ? 32.607 11.857 37.501 1.00 22.75 ? 38  THR A CA  1 
ATOM   256  C C   . THR A 1 38  ? 33.653 12.798 36.943 1.00 23.52 ? 38  THR A C   1 
ATOM   257  O O   . THR A 1 38  ? 34.791 12.821 37.402 1.00 23.67 ? 38  THR A O   1 
ATOM   258  C CB  . THR A 1 38  ? 32.567 10.636 36.596 1.00 22.00 ? 38  THR A CB  1 
ATOM   259  O OG1 . THR A 1 38  ? 31.459 9.807  36.960 1.00 22.72 ? 38  THR A OG1 1 
ATOM   260  C CG2 . THR A 1 38  ? 33.867 9.852  36.727 1.00 21.16 ? 38  THR A CG2 1 
ATOM   261  N N   . TYR A 1 39  ? 33.251 13.595 35.932 1.00 23.22 ? 39  TYR A N   1 
ATOM   262  C CA  . TYR A 1 39  ? 34.162 14.535 35.289 1.00 23.05 ? 39  TYR A CA  1 
ATOM   263  C C   . TYR A 1 39  ? 33.680 15.971 35.427 1.00 21.59 ? 39  TYR A C   1 
ATOM   264  O O   . TYR A 1 39  ? 34.193 16.858 34.755 1.00 22.26 ? 39  TYR A O   1 
ATOM   265  C CB  . TYR A 1 39  ? 34.299 14.183 33.805 1.00 24.47 ? 39  TYR A CB  1 
ATOM   266  C CG  . TYR A 1 39  ? 34.527 12.699 33.567 1.00 27.98 ? 39  TYR A CG  1 
ATOM   267  C CD1 . TYR A 1 39  ? 35.740 12.107 33.892 1.00 28.05 ? 39  TYR A CD1 1 
ATOM   268  C CD2 . TYR A 1 39  ? 33.498 11.872 33.112 1.00 28.53 ? 39  TYR A CD2 1 
ATOM   269  C CE1 . TYR A 1 39  ? 35.927 10.743 33.786 1.00 28.47 ? 39  TYR A CE1 1 
ATOM   270  C CE2 . TYR A 1 39  ? 33.677 10.495 33.002 1.00 28.96 ? 39  TYR A CE2 1 
ATOM   271  C CZ  . TYR A 1 39  ? 34.892 9.938  33.347 1.00 28.35 ? 39  TYR A CZ  1 
ATOM   272  O OH  . TYR A 1 39  ? 35.071 8.571  33.316 1.00 29.32 ? 39  TYR A OH  1 
ATOM   273  N N   . GLY A 1 40  ? 32.677 16.201 36.306 1.00 19.92 ? 40  GLY A N   1 
ATOM   274  C CA  . GLY A 1 40  ? 32.143 17.538 36.474 1.00 20.44 ? 40  GLY A CA  1 
ATOM   275  C C   . GLY A 1 40  ? 31.730 18.105 35.123 1.00 20.39 ? 40  GLY A C   1 
ATOM   276  O O   . GLY A 1 40  ? 31.752 19.312 34.902 1.00 21.00 ? 40  GLY A O   1 
ATOM   277  N N   . LYS A 1 41  ? 31.339 17.219 34.200 1.00 19.42 ? 41  LYS A N   1 
ATOM   278  C CA  . LYS A 1 41  ? 30.955 17.648 32.869 1.00 19.72 ? 41  LYS A CA  1 
ATOM   279  C C   . LYS A 1 41  ? 29.468 17.989 32.739 1.00 21.60 ? 41  LYS A C   1 
ATOM   280  O O   . LYS A 1 41  ? 28.599 17.179 33.081 1.00 24.10 ? 41  LYS A O   1 
ATOM   281  C CB  . LYS A 1 41  ? 31.355 16.578 31.859 1.00 18.09 ? 41  LYS A CB  1 
ATOM   282  C CG  . LYS A 1 41  ? 31.045 16.928 30.431 1.00 16.87 ? 41  LYS A CG  1 
ATOM   283  C CD  . LYS A 1 41  ? 31.952 16.167 29.499 1.00 16.23 ? 41  LYS A CD  1 
ATOM   284  C CE  . LYS A 1 41  ? 31.536 16.353 28.060 1.00 16.23 ? 41  LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 41  ? 32.510 15.711 27.148 1.00 20.64 ? 41  LYS A NZ  1 
ATOM   286  N N   . LEU A 1 42  ? 29.176 19.205 32.234 1.00 20.89 ? 42  LEU A N   1 
ATOM   287  C CA  . LEU A 1 42  ? 27.803 19.659 32.062 1.00 20.38 ? 42  LEU A CA  1 
ATOM   288  C C   . LEU A 1 42  ? 27.535 20.102 30.634 1.00 21.16 ? 42  LEU A C   1 
ATOM   289  O O   . LEU A 1 42  ? 28.237 20.953 30.088 1.00 21.58 ? 42  LEU A O   1 
ATOM   290  C CB  . LEU A 1 42  ? 27.508 20.828 33.014 1.00 19.30 ? 42  LEU A CB  1 
ATOM   291  C CG  . LEU A 1 42  ? 27.186 20.525 34.481 1.00 18.08 ? 42  LEU A CG  1 
ATOM   292  C CD1 . LEU A 1 42  ? 27.304 21.778 35.357 1.00 19.65 ? 42  LEU A CD1 1 
ATOM   293  C CD2 . LEU A 1 42  ? 25.791 19.972 34.543 1.00 15.85 ? 42  LEU A CD2 1 
ATOM   294  N N   . THR A 1 43  ? 26.528 19.516 30.011 1.00 20.89 ? 43  THR A N   1 
ATOM   295  C CA  . THR A 1 43  ? 26.211 19.928 28.664 1.00 21.74 ? 43  THR A CA  1 
ATOM   296  C C   . THR A 1 43  ? 24.753 20.325 28.681 1.00 22.13 ? 43  THR A C   1 
ATOM   297  O O   . THR A 1 43  ? 23.877 19.517 29.010 1.00 22.32 ? 43  THR A O   1 
ATOM   298  C CB  . THR A 1 43  ? 26.448 18.791 27.641 1.00 22.46 ? 43  THR A CB  1 
ATOM   299  O OG1 . THR A 1 43  ? 25.647 17.654 27.972 1.00 24.37 ? 43  THR A OG1 1 
ATOM   300  C CG2 . THR A 1 43  ? 27.925 18.398 27.639 1.00 22.07 ? 43  THR A CG2 1 
ATOM   301  N N   . LEU A 1 44  ? 24.486 21.605 28.370 1.00 22.19 ? 44  LEU A N   1 
ATOM   302  C CA  . LEU A 1 44  ? 23.118 22.093 28.360 1.00 23.41 ? 44  LEU A CA  1 
ATOM   303  C C   . LEU A 1 44  ? 22.835 23.101 27.269 1.00 22.93 ? 44  LEU A C   1 
ATOM   304  O O   . LEU A 1 44  ? 23.724 23.822 26.807 1.00 22.91 ? 44  LEU A O   1 
ATOM   305  C CB  . LEU A 1 44  ? 22.757 22.715 29.715 1.00 26.61 ? 44  LEU A CB  1 
ATOM   306  C CG  . LEU A 1 44  ? 22.708 21.788 30.930 1.00 29.43 ? 44  LEU A CG  1 
ATOM   307  C CD1 . LEU A 1 44  ? 23.969 21.973 31.748 1.00 31.80 ? 44  LEU A CD1 1 
ATOM   308  C CD2 . LEU A 1 44  ? 21.497 22.113 31.771 1.00 30.86 ? 44  LEU A CD2 1 
ATOM   309  N N   . LYS A 1 45  ? 21.557 23.108 26.851 1.00 22.93 ? 45  LYS A N   1 
ATOM   310  C CA  . LYS A 1 45  ? 21.039 24.025 25.847 1.00 21.79 ? 45  LYS A CA  1 
ATOM   311  C C   . LYS A 1 45  ? 19.801 24.668 26.461 1.00 23.02 ? 45  LYS A C   1 
ATOM   312  O O   . LYS A 1 45  ? 18.920 23.971 26.985 1.00 23.54 ? 45  LYS A O   1 
ATOM   313  C CB  . LYS A 1 45  ? 20.639 23.304 24.560 1.00 19.82 ? 45  LYS A CB  1 
ATOM   314  C CG  . LYS A 1 45  ? 20.005 24.221 23.530 1.00 17.82 ? 45  LYS A CG  1 
ATOM   315  C CD  . LYS A 1 45  ? 19.798 23.533 22.187 1.00 17.26 ? 45  LYS A CD  1 
ATOM   316  C CE  . LYS A 1 45  ? 18.968 24.400 21.226 1.00 16.92 ? 45  LYS A CE  1 
ATOM   317  N NZ  . LYS A 1 45  ? 18.641 23.753 19.921 1.00 16.31 ? 45  LYS A NZ  1 
ATOM   318  N N   . PHE A 1 46  ? 19.757 26.028 26.414 1.00 23.15 ? 46  PHE A N   1 
ATOM   319  C CA  . PHE A 1 46  ? 18.667 26.829 26.957 1.00 23.27 ? 46  PHE A CA  1 
ATOM   320  C C   . PHE A 1 46  ? 17.912 27.545 25.847 1.00 23.84 ? 46  PHE A C   1 
ATOM   321  O O   . PHE A 1 46  ? 18.501 27.993 24.867 1.00 25.48 ? 46  PHE A O   1 
ATOM   322  C CB  . PHE A 1 46  ? 19.206 27.864 27.966 1.00 22.59 ? 46  PHE A CB  1 
ATOM   323  C CG  . PHE A 1 46  ? 19.839 27.248 29.192 1.00 23.28 ? 46  PHE A CG  1 
ATOM   324  C CD1 . PHE A 1 46  ? 21.199 26.929 29.206 1.00 23.78 ? 46  PHE A CD1 1 
ATOM   325  C CD2 . PHE A 1 46  ? 19.070 26.931 30.314 1.00 21.18 ? 46  PHE A CD2 1 
ATOM   326  C CE1 . PHE A 1 46  ? 21.781 26.298 30.321 1.00 21.80 ? 46  PHE A CE1 1 
ATOM   327  C CE2 . PHE A 1 46  ? 19.640 26.302 31.428 1.00 19.74 ? 46  PHE A CE2 1 
ATOM   328  C CZ  . PHE A 1 46  ? 20.999 25.985 31.429 1.00 20.54 ? 46  PHE A CZ  1 
ATOM   329  N N   . ILE A 1 47  ? 16.581 27.644 25.989 1.00 23.13 ? 47  ILE A N   1 
ATOM   330  C CA  . ILE A 1 47  ? 15.775 28.309 24.979 1.00 23.68 ? 47  ILE A CA  1 
ATOM   331  C C   . ILE A 1 47  ? 14.917 29.364 25.668 1.00 23.90 ? 47  ILE A C   1 
ATOM   332  O O   . ILE A 1 47  ? 14.500 29.170 26.813 1.00 24.53 ? 47  ILE A O   1 
ATOM   333  C CB  . ILE A 1 47  ? 14.826 27.301 24.251 1.00 25.65 ? 47  ILE A CB  1 
ATOM   334  C CG1 . ILE A 1 47  ? 15.634 26.153 23.622 1.00 26.37 ? 47  ILE A CG1 1 
ATOM   335  C CG2 . ILE A 1 47  ? 14.002 28.032 23.196 1.00 23.89 ? 47  ILE A CG2 1 
ATOM   336  C CD1 . ILE A 1 47  ? 16.612 26.559 22.535 1.00 26.71 ? 47  ILE A CD1 1 
ATOM   337  N N   . CYS A 1 48  ? 14.680 30.519 24.991 1.00 24.20 ? 48  CYS A N   1 
ATOM   338  C CA  . CYS A 1 48  ? 13.802 31.519 25.577 1.00 24.60 ? 48  CYS A CA  1 
ATOM   339  C C   . CYS A 1 48  ? 12.425 31.196 25.036 1.00 25.84 ? 48  CYS A C   1 
ATOM   340  O O   . CYS A 1 48  ? 12.092 31.457 23.874 1.00 25.18 ? 48  CYS A O   1 
ATOM   341  C CB  . CYS A 1 48  ? 14.167 32.959 25.206 1.00 23.09 ? 48  CYS A CB  1 
ATOM   342  S SG  . CYS A 1 48  ? 13.066 34.159 26.018 1.00 22.09 ? 48  CYS A SG  1 
ATOM   343  N N   . THR A 1 49  ? 11.634 30.597 25.933 1.00 27.53 ? 49  THR A N   1 
ATOM   344  C CA  . THR A 1 49  ? 10.288 30.165 25.635 1.00 28.49 ? 49  THR A CA  1 
ATOM   345  C C   . THR A 1 49  ? 9.302  31.306 25.382 1.00 28.95 ? 49  THR A C   1 
ATOM   346  O O   . THR A 1 49  ? 8.235  31.070 24.827 1.00 31.02 ? 49  THR A O   1 
ATOM   347  C CB  . THR A 1 49  ? 9.752  29.242 26.765 1.00 29.44 ? 49  THR A CB  1 
ATOM   348  O OG1 . THR A 1 49  ? 9.998  29.838 28.050 1.00 30.61 ? 49  THR A OG1 1 
ATOM   349  C CG2 . THR A 1 49  ? 10.441 27.877 26.719 1.00 28.59 ? 49  THR A CG2 1 
ATOM   350  N N   . THR A 1 50  ? 9.645  32.560 25.769 1.00 28.60 ? 50  THR A N   1 
ATOM   351  C CA  . THR A 1 50  ? 8.721  33.680 25.550 1.00 28.25 ? 50  THR A CA  1 
ATOM   352  C C   . THR A 1 50  ? 9.090  34.571 24.378 1.00 29.26 ? 50  THR A C   1 
ATOM   353  O O   . THR A 1 50  ? 8.419  35.580 24.112 1.00 29.04 ? 50  THR A O   1 
ATOM   354  C CB  . THR A 1 50  ? 8.594  34.556 26.782 1.00 26.67 ? 50  THR A CB  1 
ATOM   355  O OG1 . THR A 1 50  ? 9.890  34.860 27.307 1.00 25.54 ? 50  THR A OG1 1 
ATOM   356  C CG2 . THR A 1 50  ? 7.788  33.859 27.825 1.00 24.66 ? 50  THR A CG2 1 
ATOM   357  N N   . GLY A 1 51  ? 10.168 34.188 23.673 1.00 28.75 ? 51  GLY A N   1 
ATOM   358  C CA  . GLY A 1 51  ? 10.614 34.948 22.524 1.00 29.97 ? 51  GLY A CA  1 
ATOM   359  C C   . GLY A 1 51  ? 12.051 35.416 22.617 1.00 30.60 ? 51  GLY A C   1 
ATOM   360  O O   . GLY A 1 51  ? 12.986 34.617 22.522 1.00 30.89 ? 51  GLY A O   1 
ATOM   361  N N   . LYS A 1 52  ? 12.226 36.738 22.797 1.00 30.84 ? 52  LYS A N   1 
ATOM   362  C CA  . LYS A 1 52  ? 13.557 37.328 22.891 1.00 31.81 ? 52  LYS A CA  1 
ATOM   363  C C   . LYS A 1 52  ? 13.950 37.517 24.338 1.00 31.10 ? 52  LYS A C   1 
ATOM   364  O O   . LYS A 1 52  ? 13.155 37.973 25.157 1.00 31.38 ? 52  LYS A O   1 
ATOM   365  C CB  . LYS A 1 52  ? 13.579 38.685 22.204 1.00 35.04 ? 52  LYS A CB  1 
ATOM   366  C CG  . LYS A 1 52  ? 13.323 38.636 20.725 1.00 38.27 ? 52  LYS A CG  1 
ATOM   367  C CD  . LYS A 1 52  ? 14.583 38.966 19.947 1.00 39.87 ? 52  LYS A CD  1 
ATOM   368  C CE  . LYS A 1 52  ? 14.306 40.046 18.910 1.00 40.08 ? 52  LYS A CE  1 
ATOM   369  N NZ  . LYS A 1 52  ? 13.219 39.665 17.970 1.00 41.65 ? 52  LYS A NZ  1 
ATOM   370  N N   . LEU A 1 53  ? 15.192 37.185 24.654 1.00 28.60 ? 53  LEU A N   1 
ATOM   371  C CA  . LEU A 1 53  ? 15.649 37.335 26.017 1.00 27.24 ? 53  LEU A CA  1 
ATOM   372  C C   . LEU A 1 53  ? 15.936 38.820 26.292 1.00 27.75 ? 53  LEU A C   1 
ATOM   373  O O   . LEU A 1 53  ? 16.762 39.437 25.622 1.00 29.32 ? 53  LEU A O   1 
ATOM   374  C CB  . LEU A 1 53  ? 16.889 36.469 26.221 1.00 24.33 ? 53  LEU A CB  1 
ATOM   375  C CG  . LEU A 1 53  ? 17.374 36.238 27.656 1.00 23.51 ? 53  LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 53  ? 16.391 35.375 28.418 1.00 22.61 ? 53  LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 53  ? 18.715 35.556 27.627 1.00 22.42 ? 53  LEU A CD2 1 
ATOM   378  N N   . PRO A 1 54  ? 15.252 39.419 27.285 1.00 28.00 ? 54  PRO A N   1 
ATOM   379  C CA  . PRO A 1 54  ? 15.426 40.835 27.641 1.00 28.49 ? 54  PRO A CA  1 
ATOM   380  C C   . PRO A 1 54  ? 16.792 41.217 28.218 1.00 28.70 ? 54  PRO A C   1 
ATOM   381  O O   . PRO A 1 54  ? 17.109 42.397 28.361 1.00 29.89 ? 54  PRO A O   1 
ATOM   382  C CB  . PRO A 1 54  ? 14.291 41.073 28.635 1.00 28.77 ? 54  PRO A CB  1 
ATOM   383  C CG  . PRO A 1 54  ? 14.220 39.771 29.357 1.00 29.39 ? 54  PRO A CG  1 
ATOM   384  C CD  . PRO A 1 54  ? 14.303 38.766 28.205 1.00 29.30 ? 54  PRO A CD  1 
ATOM   385  N N   . VAL A 1 55  ? 17.611 40.205 28.541 1.00 27.89 ? 55  VAL A N   1 
ATOM   386  C CA  . VAL A 1 55  ? 18.933 40.458 29.090 1.00 26.43 ? 55  VAL A CA  1 
ATOM   387  C C   . VAL A 1 55  ? 19.969 39.580 28.410 1.00 25.94 ? 55  VAL A C   1 
ATOM   388  O O   . VAL A 1 55  ? 19.623 38.663 27.660 1.00 26.05 ? 55  VAL A O   1 
ATOM   389  C CB  . VAL A 1 55  ? 18.957 40.182 30.598 1.00 27.03 ? 55  VAL A CB  1 
ATOM   390  C CG1 . VAL A 1 55  ? 17.930 41.059 31.286 1.00 27.20 ? 55  VAL A CG1 1 
ATOM   391  C CG2 . VAL A 1 55  ? 18.672 38.715 30.863 1.00 27.36 ? 55  VAL A CG2 1 
ATOM   392  N N   . PRO A 1 56  ? 21.259 39.855 28.642 1.00 24.61 ? 56  PRO A N   1 
ATOM   393  C CA  . PRO A 1 56  ? 22.324 39.057 28.029 1.00 23.23 ? 56  PRO A CA  1 
ATOM   394  C C   . PRO A 1 56  ? 22.358 37.659 28.634 1.00 22.93 ? 56  PRO A C   1 
ATOM   395  O O   . PRO A 1 56  ? 22.292 37.502 29.853 1.00 22.37 ? 56  PRO A O   1 
ATOM   396  C CB  . PRO A 1 56  ? 23.584 39.855 28.356 1.00 24.11 ? 56  PRO A CB  1 
ATOM   397  C CG  . PRO A 1 56  ? 23.077 41.260 28.488 1.00 24.42 ? 56  PRO A CG  1 
ATOM   398  C CD  . PRO A 1 56  ? 21.813 41.061 29.273 1.00 24.29 ? 56  PRO A CD  1 
HETATM 399  N N   . 4FW A 1 57  ? 22.450 36.643 27.775 1.00 21.57 ? 57  4FW A N   1 
HETATM 400  C CA  . 4FW A 1 57  ? 22.494 35.269 28.244 1.00 19.28 ? 57  4FW A CA  1 
HETATM 401  C CB  . 4FW A 1 57  ? 22.735 34.339 27.069 1.00 18.22 ? 57  4FW A CB  1 
HETATM 402  C CG  . 4FW A 1 57  ? 21.504 33.994 26.321 1.00 17.21 ? 57  4FW A CG  1 
HETATM 403  C CD2 . 4FW A 1 57  ? 20.483 33.086 26.749 1.00 16.67 ? 57  4FW A CD2 1 
HETATM 404  C CE2 . 4FW A 1 57  ? 19.572 32.950 25.684 1.00 15.99 ? 57  4FW A CE2 1 
HETATM 405  C CE3 . 4FW A 1 57  ? 20.242 32.381 27.940 1.00 15.19 ? 57  4FW A CE3 1 
HETATM 406  C CD1 . 4FW A 1 57  ? 21.177 34.369 25.053 1.00 17.82 ? 57  4FW A CD1 1 
HETATM 407  N NE1 . 4FW A 1 57  ? 20.022 33.740 24.658 1.00 16.46 ? 57  4FW A NE1 1 
HETATM 408  C CZ2 . 4FW A 1 57  ? 18.446 32.124 25.763 1.00 14.84 ? 57  4FW A CZ2 1 
HETATM 409  C CZ3 . 4FW A 1 57  ? 19.128 31.560 28.017 1.00 14.26 ? 57  4FW A CZ3 1 
HETATM 410  F F   . 4FW A 1 57  ? 21.064 32.475 28.982 1.00 15.81 ? 57  4FW A F   1 
HETATM 411  C CH2 . 4FW A 1 57  ? 18.239 31.440 26.931 1.00 14.16 ? 57  4FW A CH2 1 
HETATM 412  C C   . 4FW A 1 57  ? 23.558 35.035 29.320 1.00 18.44 ? 57  4FW A C   1 
HETATM 413  O O   . 4FW A 1 57  ? 23.283 34.421 30.348 1.00 19.01 ? 57  4FW A O   1 
ATOM   414  N N   . PRO A 1 58  ? 24.788 35.525 29.088 1.00 17.84 ? 58  PRO A N   1 
ATOM   415  C CA  . PRO A 1 58  ? 25.885 35.369 30.041 1.00 17.58 ? 58  PRO A CA  1 
ATOM   416  C C   . PRO A 1 58  ? 25.513 35.764 31.471 1.00 17.53 ? 58  PRO A C   1 
ATOM   417  O O   . PRO A 1 58  ? 26.109 35.271 32.426 1.00 17.46 ? 58  PRO A O   1 
ATOM   418  C CB  . PRO A 1 58  ? 26.965 36.280 29.469 1.00 17.52 ? 58  PRO A CB  1 
ATOM   419  C CG  . PRO A 1 58  ? 26.772 36.131 28.018 1.00 18.36 ? 58  PRO A CG  1 
ATOM   420  C CD  . PRO A 1 58  ? 25.266 36.190 27.861 1.00 18.11 ? 58  PRO A CD  1 
ATOM   421  N N   . THR A 1 59  ? 24.510 36.668 31.633 1.00 17.06 ? 59  THR A N   1 
ATOM   422  C CA  . THR A 1 59  ? 24.104 37.105 32.970 1.00 15.14 ? 59  THR A CA  1 
ATOM   423  C C   . THR A 1 59  ? 23.179 36.117 33.634 1.00 14.19 ? 59  THR A C   1 
ATOM   424  O O   . THR A 1 59  ? 22.760 36.303 34.775 1.00 15.75 ? 59  THR A O   1 
ATOM   425  C CB  . THR A 1 59  ? 23.401 38.485 32.938 1.00 14.73 ? 59  THR A CB  1 
ATOM   426  O OG1 . THR A 1 59  ? 22.078 38.359 32.408 1.00 12.37 ? 59  THR A OG1 1 
ATOM   427  C CG2 . THR A 1 59  ? 24.199 39.447 32.099 1.00 16.72 ? 59  THR A CG2 1 
ATOM   428  N N   . LEU A 1 60  ? 22.871 35.056 32.924 1.00 13.00 ? 60  LEU A N   1 
ATOM   429  C CA  . LEU A 1 60  ? 21.974 34.071 33.457 1.00 12.19 ? 60  LEU A CA  1 
ATOM   430  C C   . LEU A 1 60  ? 22.653 32.730 33.582 1.00 12.39 ? 60  LEU A C   1 
ATOM   431  O O   . LEU A 1 60  ? 22.042 31.764 34.009 1.00 12.72 ? 60  LEU A O   1 
ATOM   432  C CB  . LEU A 1 60  ? 20.772 33.953 32.537 1.00 11.78 ? 60  LEU A CB  1 
ATOM   433  C CG  . LEU A 1 60  ? 19.902 35.199 32.362 1.00 13.82 ? 60  LEU A CG  1 
ATOM   434  C CD1 . LEU A 1 60  ? 18.664 34.789 31.596 1.00 13.08 ? 60  LEU A CD1 1 
ATOM   435  C CD2 . LEU A 1 60  ? 19.517 35.773 33.718 1.00 14.88 ? 60  LEU A CD2 1 
ATOM   436  N N   . VAL A 1 61  ? 23.935 32.675 33.222 1.00 10.58 ? 61  VAL A N   1 
ATOM   437  C CA  . VAL A 1 61  ? 24.650 31.412 33.268 1.00 10.97 ? 61  VAL A CA  1 
ATOM   438  C C   . VAL A 1 61  ? 24.727 30.786 34.650 1.00 11.60 ? 61  VAL A C   1 
ATOM   439  O O   . VAL A 1 61  ? 24.381 29.629 34.836 1.00 13.40 ? 61  VAL A O   1 
ATOM   440  C CB  . VAL A 1 61  ? 26.069 31.555 32.667 1.00 10.03 ? 61  VAL A CB  1 
ATOM   441  C CG1 . VAL A 1 61  ? 26.934 30.340 33.017 1.00 9.07  ? 61  VAL A CG1 1 
ATOM   442  C CG2 . VAL A 1 61  ? 25.952 31.703 31.148 1.00 8.47  ? 61  VAL A CG2 1 
ATOM   443  N N   . THR A 1 62  ? 25.175 31.565 35.633 1.00 12.19 ? 62  THR A N   1 
ATOM   444  C CA  . THR A 1 62  ? 25.324 31.078 36.988 1.00 12.66 ? 62  THR A CA  1 
ATOM   445  C C   . THR A 1 62  ? 23.977 30.790 37.639 1.00 13.29 ? 62  THR A C   1 
ATOM   446  O O   . THR A 1 62  ? 23.895 30.139 38.672 1.00 12.68 ? 62  THR A O   1 
ATOM   447  C CB  . THR A 1 62  ? 26.128 32.091 37.830 1.00 14.45 ? 62  THR A CB  1 
ATOM   448  O OG1 . THR A 1 62  ? 25.366 33.292 37.989 1.00 13.33 ? 62  THR A OG1 1 
ATOM   449  C CG2 . THR A 1 62  ? 27.445 32.413 37.135 1.00 14.93 ? 62  THR A CG2 1 
ATOM   450  N N   . THR A 1 63  ? 22.900 31.277 37.014 1.00 15.02 ? 63  THR A N   1 
ATOM   451  C CA  . THR A 1 63  ? 21.576 31.038 37.566 1.00 14.26 ? 63  THR A CA  1 
ATOM   452  C C   . THR A 1 63  ? 20.943 29.813 36.928 1.00 14.93 ? 63  THR A C   1 
ATOM   453  O O   . THR A 1 63  ? 20.427 28.923 37.626 1.00 15.45 ? 63  THR A O   1 
ATOM   454  C CB  . THR A 1 63  ? 20.688 32.276 37.370 1.00 12.52 ? 63  THR A CB  1 
ATOM   455  O OG1 . THR A 1 63  ? 21.261 33.389 38.065 1.00 14.21 ? 63  THR A OG1 1 
ATOM   456  C CG2 . THR A 1 63  ? 19.293 32.037 37.882 1.00 10.36 ? 63  THR A CG2 1 
ATOM   457  N N   . LEU A 1 64  ? 21.004 29.840 35.863 1.00 32.28 ? 64  LEU A N   1 
ATOM   458  C CA  . LEU A 1 64  ? 20.445 28.699 35.167 1.00 30.69 ? 64  LEU A CA  1 
ATOM   459  C C   . LEU A 1 64  ? 21.291 27.480 35.470 1.00 31.53 ? 64  LEU A C   1 
ATOM   460  O O   . LEU A 1 64  ? 20.642 26.333 35.352 1.00 31.74 ? 64  LEU A O   1 
ATOM   461  C CB  . LEU A 1 64  ? 20.592 28.887 33.663 1.00 17.07 ? 64  LEU A CB  1 
ATOM   462  C CG  . LEU A 1 64  ? 19.679 29.949 33.053 1.00 17.20 ? 64  LEU A CG  1 
ATOM   463  C CD1 . LEU A 1 64  ? 20.068 30.195 31.619 1.00 16.63 ? 64  LEU A CD1 1 
ATOM   464  C CD2 . LEU A 1 64  ? 18.238 29.489 33.153 1.00 18.41 ? 64  LEU A CD2 1 
HETATM 465  C C1  . 4F3 A 1 65  ? 29.600 29.514 37.946 1.00 36.68 ? 66  4F3 A C1  1 
HETATM 466  C C2  . 4F3 A 1 65  ? 30.284 30.044 39.040 1.00 36.05 ? 66  4F3 A C2  1 
HETATM 467  C C3  . 4F3 A 1 65  ? 31.554 30.706 38.885 1.00 38.79 ? 66  4F3 A C3  1 
HETATM 468  C C4  . 4F3 A 1 65  ? 32.147 30.841 37.625 1.00 39.05 ? 66  4F3 A C4  1 
HETATM 469  C C5  . 4F3 A 1 65  ? 31.476 30.319 36.502 1.00 39.14 ? 66  4F3 A C5  1 
HETATM 470  C C6  . 4F3 A 1 65  ? 30.232 29.674 36.671 1.00 36.78 ? 66  4F3 A C6  1 
HETATM 471  C C7  . 4F3 A 1 65  ? 28.394 28.829 37.671 1.00 35.75 ? 66  4F3 A C7  1 
HETATM 472  C C8  . 4F3 A 1 65  ? 28.387 28.638 36.288 1.00 37.09 ? 66  4F3 A C8  1 
HETATM 473  N N9  . 4F3 A 1 65  ? 29.479 29.141 35.731 1.00 40.33 ? 66  4F3 A N9  1 
HETATM 474  F F10 . 4F3 A 1 65  ? 29.702 29.910 40.212 1.00 36.98 ? 66  4F3 A F10 1 
HETATM 475  C C11 . 4F3 A 1 65  ? 27.385 28.422 38.551 1.00 36.35 ? 66  4F3 A C11 1 
HETATM 476  C C12 . 4F3 A 1 65  ? 26.187 27.787 38.225 1.00 35.25 ? 66  4F3 A C12 1 
HETATM 477  N N13 . 4F3 A 1 65  ? 25.749 27.440 37.042 1.00 34.58 ? 66  4F3 A N13 1 
HETATM 478  C C14 . 4F3 A 1 65  ? 24.599 26.907 37.072 1.00 34.53 ? 66  4F3 A C14 1 
HETATM 479  N N15 . 4F3 A 1 65  ? 24.150 26.855 38.378 1.00 34.39 ? 66  4F3 A N15 1 
HETATM 480  C C16 . 4F3 A 1 65  ? 25.154 27.401 39.134 1.00 34.03 ? 66  4F3 A C16 1 
HETATM 481  O O17 . 4F3 A 1 65  ? 25.145 27.548 40.380 1.00 34.94 ? 66  4F3 A O17 1 
HETATM 482  C C18 . 4F3 A 1 65  ? 22.860 26.339 38.902 1.00 35.71 ? 66  4F3 A C18 1 
HETATM 483  C C   . 4F3 A 1 65  ? 22.840 24.976 39.458 1.00 49.06 ? 66  4F3 A C   1 
HETATM 484  O O   . 4F3 A 1 65  ? 21.757 24.881 40.351 1.00 47.07 ? 66  4F3 A O   1 
HETATM 485  C C22 . 4F3 A 1 65  ? 23.898 26.444 35.797 1.00 35.41 ? 66  4F3 A C22 1 
HETATM 486  C C23 . 4F3 A 1 65  ? 24.886 26.051 34.694 1.00 37.20 ? 66  4F3 A C23 1 
HETATM 487  O O24 . 4F3 A 1 65  ? 25.686 24.928 35.134 1.00 40.52 ? 66  4F3 A O24 1 
HETATM 488  C C25 . 4F3 A 1 65  ? 24.224 25.605 33.385 1.00 38.28 ? 66  4F3 A C25 1 
HETATM 489  N N   . 4F3 A 1 65  ? 22.726 27.430 35.664 1.00 34.50 ? 66  4F3 A N   1 
ATOM   490  N N   . VAL A 1 66  ? 23.741 24.140 38.725 1.00 24.61 ? 68  VAL A N   1 
ATOM   491  C CA  . VAL A 1 66  ? 23.510 22.848 39.246 1.00 24.04 ? 68  VAL A CA  1 
ATOM   492  C C   . VAL A 1 66  ? 24.814 22.270 39.786 1.00 23.87 ? 68  VAL A C   1 
ATOM   493  O O   . VAL A 1 66  ? 25.305 21.239 39.326 1.00 23.76 ? 68  VAL A O   1 
ATOM   494  C CB  . VAL A 1 66  ? 22.657 21.813 38.489 1.00 20.27 ? 68  VAL A CB  1 
ATOM   495  C CG1 . VAL A 1 66  ? 21.194 22.246 38.505 1.00 20.83 ? 68  VAL A CG1 1 
ATOM   496  C CG2 . VAL A 1 66  ? 23.120 21.720 37.044 1.00 21.88 ? 68  VAL A CG2 1 
ATOM   497  N N   . GLN A 1 67  ? 25.363 23.032 40.595 1.00 23.52 ? 69  GLN A N   1 
ATOM   498  C CA  . GLN A 1 67  ? 26.595 22.742 41.307 1.00 23.21 ? 69  GLN A CA  1 
ATOM   499  C C   . GLN A 1 67  ? 26.664 21.425 42.047 1.00 23.12 ? 69  GLN A C   1 
ATOM   500  O O   . GLN A 1 67  ? 27.660 21.129 42.691 1.00 24.05 ? 69  GLN A O   1 
ATOM   501  C CB  . GLN A 1 67  ? 26.899 23.872 42.261 1.00 22.59 ? 69  GLN A CB  1 
ATOM   502  C CG  . GLN A 1 67  ? 26.944 25.188 41.563 1.00 22.21 ? 69  GLN A CG  1 
ATOM   503  C CD  . GLN A 1 67  ? 27.348 26.272 42.489 1.00 22.36 ? 69  GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 67  ? 26.783 26.408 43.570 1.00 23.26 ? 69  GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 67  ? 28.334 27.059 42.087 1.00 22.46 ? 69  GLN A NE2 1 
ATOM   506  N N   . CYS A 1 68  ? 25.599 20.642 41.965 1.00 23.07 ? 70  CYS A N   1 
ATOM   507  C CA  . CYS A 1 68  ? 25.571 19.337 42.592 1.00 23.96 ? 70  CYS A CA  1 
ATOM   508  C C   . CYS A 1 68  ? 26.157 18.326 41.605 1.00 24.19 ? 70  CYS A C   1 
ATOM   509  O O   . CYS A 1 68  ? 26.197 17.129 41.888 1.00 24.96 ? 70  CYS A O   1 
ATOM   510  C CB  . CYS A 1 68  ? 24.139 18.948 42.932 1.00 23.17 ? 70  CYS A CB  1 
ATOM   511  S SG  . CYS A 1 68  ? 23.025 19.066 41.544 1.00 27.50 ? 70  CYS A SG  1 
ATOM   512  N N   . PHE A 1 69  ? 26.598 18.825 40.414 1.00 23.11 ? 71  PHE A N   1 
ATOM   513  C CA  . PHE A 1 69  ? 27.177 17.977 39.361 1.00 23.49 ? 71  PHE A CA  1 
ATOM   514  C C   . PHE A 1 69  ? 28.686 18.169 39.242 1.00 25.06 ? 71  PHE A C   1 
ATOM   515  O O   . PHE A 1 69  ? 29.318 17.748 38.269 1.00 26.66 ? 71  PHE A O   1 
ATOM   516  C CB  . PHE A 1 69  ? 26.520 18.267 38.002 1.00 21.06 ? 71  PHE A CB  1 
ATOM   517  C CG  . PHE A 1 69  ? 25.323 17.403 37.718 1.00 20.80 ? 71  PHE A CG  1 
ATOM   518  C CD1 . PHE A 1 69  ? 25.476 16.038 37.529 1.00 20.82 ? 71  PHE A CD1 1 
ATOM   519  C CD2 . PHE A 1 69  ? 24.035 17.935 37.711 1.00 20.37 ? 71  PHE A CD2 1 
ATOM   520  C CE1 . PHE A 1 69  ? 24.372 15.211 37.346 1.00 20.42 ? 71  PHE A CE1 1 
ATOM   521  C CE2 . PHE A 1 69  ? 22.924 17.113 37.526 1.00 21.38 ? 71  PHE A CE2 1 
ATOM   522  C CZ  . PHE A 1 69  ? 23.094 15.746 37.344 1.00 20.93 ? 71  PHE A CZ  1 
ATOM   523  N N   . SER A 1 70  ? 29.276 18.803 40.258 1.00 23.81 ? 72  SER A N   1 
ATOM   524  C CA  . SER A 1 70  ? 30.697 19.053 40.232 1.00 24.04 ? 72  SER A CA  1 
ATOM   525  C C   . SER A 1 70  ? 31.515 17.848 40.721 1.00 23.41 ? 72  SER A C   1 
ATOM   526  O O   . SER A 1 70  ? 31.062 17.081 41.573 1.00 24.45 ? 72  SER A O   1 
ATOM   527  C CB  . SER A 1 70  ? 30.990 20.284 41.091 1.00 24.77 ? 72  SER A CB  1 
ATOM   528  O OG  . SER A 1 70  ? 30.593 20.067 42.431 1.00 26.35 ? 72  SER A OG  1 
ATOM   529  N N   . ARG A 1 71  ? 32.738 17.675 40.172 1.00 22.60 ? 73  ARG A N   1 
ATOM   530  C CA  . ARG A 1 71  ? 33.573 16.561 40.595 1.00 22.27 ? 73  ARG A CA  1 
ATOM   531  C C   . ARG A 1 71  ? 34.395 16.929 41.824 1.00 22.18 ? 73  ARG A C   1 
ATOM   532  O O   . ARG A 1 71  ? 35.221 17.843 41.784 1.00 20.81 ? 73  ARG A O   1 
ATOM   533  C CB  . ARG A 1 71  ? 34.525 16.135 39.479 1.00 23.00 ? 73  ARG A CB  1 
ATOM   534  C CG  . ARG A 1 71  ? 35.449 14.986 39.869 1.00 24.40 ? 73  ARG A CG  1 
ATOM   535  C CD  . ARG A 1 71  ? 36.426 14.680 38.743 1.00 26.23 ? 73  ARG A CD  1 
ATOM   536  N NE  . ARG A 1 71  ? 37.446 15.716 38.644 1.00 26.22 ? 73  ARG A NE  1 
ATOM   537  C CZ  . ARG A 1 71  ? 38.476 15.831 39.499 1.00 25.95 ? 73  ARG A CZ  1 
ATOM   538  N NH1 . ARG A 1 71  ? 38.608 14.971 40.497 1.00 26.25 ? 73  ARG A NH1 1 
ATOM   539  N NH2 . ARG A 1 71  ? 39.360 16.805 39.353 1.00 28.38 ? 73  ARG A NH2 1 
ATOM   540  N N   . TYR A 1 72  ? 34.149 16.207 42.925 1.00 21.42 ? 74  TYR A N   1 
ATOM   541  C CA  . TYR A 1 72  ? 34.887 16.449 44.152 1.00 21.83 ? 74  TYR A CA  1 
ATOM   542  C C   . TYR A 1 72  ? 35.976 15.391 44.272 1.00 21.63 ? 74  TYR A C   1 
ATOM   543  O O   . TYR A 1 72  ? 35.693 14.200 44.270 1.00 23.36 ? 74  TYR A O   1 
ATOM   544  C CB  . TYR A 1 72  ? 33.963 16.386 45.364 1.00 21.25 ? 74  TYR A CB  1 
ATOM   545  C CG  . TYR A 1 72  ? 33.374 17.714 45.779 1.00 18.93 ? 74  TYR A CG  1 
ATOM   546  C CD1 . TYR A 1 72  ? 32.374 18.327 45.023 1.00 19.09 ? 74  TYR A CD1 1 
ATOM   547  C CD2 . TYR A 1 72  ? 33.811 18.348 46.941 1.00 16.68 ? 74  TYR A CD2 1 
ATOM   548  C CE1 . TYR A 1 72  ? 31.820 19.542 45.420 1.00 17.86 ? 74  TYR A CE1 1 
ATOM   549  C CE2 . TYR A 1 72  ? 33.267 19.558 47.347 1.00 16.45 ? 74  TYR A CE2 1 
ATOM   550  C CZ  . TYR A 1 72  ? 32.270 20.151 46.586 1.00 17.62 ? 74  TYR A CZ  1 
ATOM   551  O OH  . TYR A 1 72  ? 31.714 21.336 47.010 1.00 16.11 ? 74  TYR A OH  1 
ATOM   552  N N   . PRO A 1 73  ? 37.242 15.824 44.355 1.00 20.54 ? 75  PRO A N   1 
ATOM   553  C CA  . PRO A 1 73  ? 38.343 14.863 44.474 1.00 19.70 ? 75  PRO A CA  1 
ATOM   554  C C   . PRO A 1 73  ? 38.013 13.894 45.611 1.00 17.11 ? 75  PRO A C   1 
ATOM   555  O O   . PRO A 1 73  ? 37.320 14.254 46.550 1.00 15.94 ? 75  PRO A O   1 
ATOM   556  C CB  . PRO A 1 73  ? 39.547 15.764 44.766 1.00 20.32 ? 75  PRO A CB  1 
ATOM   557  C CG  . PRO A 1 73  ? 39.188 17.051 44.033 1.00 20.10 ? 75  PRO A CG  1 
ATOM   558  C CD  . PRO A 1 73  ? 37.732 17.217 44.391 1.00 20.69 ? 75  PRO A CD  1 
ATOM   559  N N   . ASP A 1 74  ? 38.498 12.653 45.513 1.00 15.80 ? 76  ASP A N   1 
ATOM   560  C CA  . ASP A 1 74  ? 38.186 11.666 46.534 1.00 15.89 ? 76  ASP A CA  1 
ATOM   561  C C   . ASP A 1 74  ? 38.396 12.130 47.968 1.00 16.01 ? 76  ASP A C   1 
ATOM   562  O O   . ASP A 1 74  ? 37.556 11.888 48.839 1.00 12.82 ? 76  ASP A O   1 
ATOM   563  C CB  . ASP A 1 74  ? 38.994 10.405 46.318 1.00 16.92 ? 76  ASP A CB  1 
ATOM   564  C CG  . ASP A 1 74  ? 38.665 9.345  47.331 1.00 17.91 ? 76  ASP A CG  1 
ATOM   565  O OD1 . ASP A 1 74  ? 37.562 8.767  47.240 1.00 16.90 ? 76  ASP A OD1 1 
ATOM   566  O OD2 . ASP A 1 74  ? 39.499 9.109  48.232 1.00 18.92 ? 76  ASP A OD2 1 
ATOM   567  N N   . HIS A 1 75  ? 39.547 12.794 48.208 1.00 19.94 ? 77  HIS A N   1 
ATOM   568  C CA  . HIS A 1 75  ? 39.916 13.292 49.529 1.00 22.82 ? 77  HIS A CA  1 
ATOM   569  C C   . HIS A 1 75  ? 39.107 14.505 49.968 1.00 24.32 ? 77  HIS A C   1 
ATOM   570  O O   . HIS A 1 75  ? 39.372 15.050 51.030 1.00 25.88 ? 77  HIS A O   1 
ATOM   571  C CB  . HIS A 1 75  ? 41.405 13.655 49.576 1.00 23.37 ? 77  HIS A CB  1 
ATOM   572  C CG  . HIS A 1 75  ? 41.757 14.858 48.755 1.00 25.16 ? 77  HIS A CG  1 
ATOM   573  N ND1 . HIS A 1 75  ? 41.856 14.823 47.381 1.00 27.86 ? 77  HIS A ND1 1 
ATOM   574  C CD2 . HIS A 1 75  ? 41.995 16.142 49.113 1.00 25.87 ? 77  HIS A CD2 1 
ATOM   575  C CE1 . HIS A 1 75  ? 42.143 16.032 46.931 1.00 28.02 ? 77  HIS A CE1 1 
ATOM   576  N NE2 . HIS A 1 75  ? 42.231 16.850 47.962 1.00 26.01 ? 77  HIS A NE2 1 
ATOM   577  N N   . MET A 1 76  ? 38.130 14.950 49.141 1.00 26.58 ? 78  MET A N   1 
ATOM   578  C CA  . MET A 1 76  ? 37.297 16.106 49.481 1.00 27.47 ? 78  MET A CA  1 
ATOM   579  C C   . MET A 1 76  ? 35.833 15.707 49.513 1.00 27.83 ? 78  MET A C   1 
ATOM   580  O O   . MET A 1 76  ? 34.967 16.490 49.895 1.00 27.18 ? 78  MET A O   1 
ATOM   581  C CB  . MET A 1 76  ? 37.448 17.226 48.450 1.00 28.91 ? 78  MET A CB  1 
ATOM   582  C CG  . MET A 1 76  ? 38.670 18.084 48.610 1.00 32.00 ? 78  MET A CG  1 
ATOM   583  S SD  . MET A 1 76  ? 38.749 19.315 47.305 1.00 36.48 ? 78  MET A SD  1 
ATOM   584  C CE  . MET A 1 76  ? 37.675 20.605 48.011 1.00 34.16 ? 78  MET A CE  1 
ATOM   585  N N   . LYS A 1 77  ? 35.547 14.472 49.104 1.00 28.15 ? 79  LYS A N   1 
ATOM   586  C CA  . LYS A 1 77  ? 34.176 14.016 49.053 1.00 29.70 ? 79  LYS A CA  1 
ATOM   587  C C   . LYS A 1 77  ? 33.414 14.116 50.365 1.00 30.39 ? 79  LYS A C   1 
ATOM   588  O O   . LYS A 1 77  ? 32.208 13.893 50.403 1.00 30.78 ? 79  LYS A O   1 
ATOM   589  C CB  . LYS A 1 77  ? 34.131 12.591 48.488 1.00 29.94 ? 79  LYS A CB  1 
ATOM   590  C CG  . LYS A 1 77  ? 34.376 12.563 46.977 1.00 29.26 ? 79  LYS A CG  1 
ATOM   591  C CD  . LYS A 1 77  ? 34.229 11.162 46.397 1.00 30.63 ? 79  LYS A CD  1 
ATOM   592  C CE  . LYS A 1 77  ? 34.341 11.149 44.862 1.00 30.38 ? 79  LYS A CE  1 
ATOM   593  N NZ  . LYS A 1 77  ? 33.903 9.846  44.246 1.00 30.03 ? 79  LYS A NZ  1 
ATOM   594  N N   . ARG A 1 78  ? 34.115 14.476 51.450 1.00 31.76 ? 80  ARG A N   1 
ATOM   595  C CA  . ARG A 1 78  ? 33.463 14.639 52.742 1.00 32.09 ? 80  ARG A CA  1 
ATOM   596  C C   . ARG A 1 78  ? 32.971 16.074 52.859 1.00 30.84 ? 80  ARG A C   1 
ATOM   597  O O   . ARG A 1 78  ? 32.455 16.469 53.902 1.00 31.18 ? 80  ARG A O   1 
ATOM   598  C CB  . ARG A 1 78  ? 34.428 14.355 53.887 1.00 34.90 ? 80  ARG A CB  1 
ATOM   599  C CG  . ARG A 1 78  ? 35.785 15.039 53.756 1.00 40.52 ? 80  ARG A CG  1 
ATOM   600  C CD  . ARG A 1 78  ? 36.726 14.210 52.907 1.00 46.42 ? 80  ARG A CD  1 
ATOM   601  N NE  . ARG A 1 78  ? 36.854 12.859 53.450 1.00 54.86 ? 80  ARG A NE  1 
ATOM   602  C CZ  . ARG A 1 78  ? 37.505 11.836 52.842 1.00 59.82 ? 80  ARG A CZ  1 
ATOM   603  N NH1 . ARG A 1 78  ? 38.095 12.009 51.663 1.00 62.71 ? 80  ARG A NH1 1 
ATOM   604  N NH2 . ARG A 1 78  ? 37.560 10.650 53.436 1.00 62.52 ? 80  ARG A NH2 1 
ATOM   605  N N   . HIS A 1 79  ? 33.128 16.852 51.764 1.00 29.64 ? 81  HIS A N   1 
ATOM   606  C CA  . HIS A 1 79  ? 32.730 18.254 51.734 1.00 28.52 ? 81  HIS A CA  1 
ATOM   607  C C   . HIS A 1 79  ? 31.707 18.561 50.651 1.00 27.74 ? 81  HIS A C   1 
ATOM   608  O O   . HIS A 1 79  ? 31.497 19.717 50.306 1.00 27.66 ? 81  HIS A O   1 
ATOM   609  C CB  . HIS A 1 79  ? 33.975 19.124 51.518 1.00 26.37 ? 81  HIS A CB  1 
ATOM   610  C CG  . HIS A 1 79  ? 35.018 18.952 52.575 1.00 25.31 ? 81  HIS A CG  1 
ATOM   611  N ND1 . HIS A 1 79  ? 34.819 19.335 53.884 1.00 24.96 ? 81  HIS A ND1 1 
ATOM   612  C CD2 . HIS A 1 79  ? 36.263 18.425 52.524 1.00 24.95 ? 81  HIS A CD2 1 
ATOM   613  C CE1 . HIS A 1 79  ? 35.895 19.053 54.594 1.00 24.51 ? 81  HIS A CE1 1 
ATOM   614  N NE2 . HIS A 1 79  ? 36.785 18.498 53.792 1.00 24.68 ? 81  HIS A NE2 1 
ATOM   615  N N   . ASP A 1 80  ? 31.056 17.513 50.118 1.00 27.65 ? 82  ASP A N   1 
ATOM   616  C CA  . ASP A 1 80  ? 30.075 17.700 49.055 1.00 26.37 ? 82  ASP A CA  1 
ATOM   617  C C   . ASP A 1 80  ? 28.668 17.860 49.624 1.00 26.02 ? 82  ASP A C   1 
ATOM   618  O O   . ASP A 1 80  ? 27.940 16.881 49.813 1.00 26.54 ? 82  ASP A O   1 
ATOM   619  C CB  . ASP A 1 80  ? 30.122 16.504 48.102 1.00 28.01 ? 82  ASP A CB  1 
ATOM   620  C CG  . ASP A 1 80  ? 29.384 16.758 46.805 1.00 28.57 ? 82  ASP A CG  1 
ATOM   621  O OD1 . ASP A 1 80  ? 28.360 17.480 46.825 1.00 29.47 ? 82  ASP A OD1 1 
ATOM   622  O OD2 . ASP A 1 80  ? 29.824 16.216 45.768 1.00 27.98 ? 82  ASP A OD2 1 
ATOM   623  N N   . PHE A 1 81  ? 28.301 19.125 49.910 1.00 24.77 ? 83  PHE A N   1 
ATOM   624  C CA  . PHE A 1 81  ? 26.992 19.482 50.444 1.00 22.51 ? 83  PHE A CA  1 
ATOM   625  C C   . PHE A 1 81  ? 25.906 19.165 49.419 1.00 22.63 ? 83  PHE A C   1 
ATOM   626  O O   . PHE A 1 81  ? 24.888 18.538 49.727 1.00 21.59 ? 83  PHE A O   1 
ATOM   627  C CB  . PHE A 1 81  ? 26.964 20.976 50.753 1.00 20.15 ? 83  PHE A CB  1 
ATOM   628  C CG  . PHE A 1 81  ? 25.604 21.493 51.075 1.00 19.08 ? 83  PHE A CG  1 
ATOM   629  C CD1 . PHE A 1 81  ? 25.046 21.246 52.325 1.00 19.56 ? 83  PHE A CD1 1 
ATOM   630  C CD2 . PHE A 1 81  ? 24.846 22.156 50.120 1.00 17.38 ? 83  PHE A CD2 1 
ATOM   631  C CE1 . PHE A 1 81  ? 23.754 21.648 52.607 1.00 18.81 ? 83  PHE A CE1 1 
ATOM   632  C CE2 . PHE A 1 81  ? 23.550 22.559 50.396 1.00 16.85 ? 83  PHE A CE2 1 
ATOM   633  C CZ  . PHE A 1 81  ? 23.005 22.300 51.641 1.00 18.87 ? 83  PHE A CZ  1 
ATOM   634  N N   . PHE A 1 82  ? 26.151 19.617 48.181 1.00 22.14 ? 84  PHE A N   1 
ATOM   635  C CA  . PHE A 1 82  ? 25.230 19.428 47.076 1.00 22.83 ? 84  PHE A CA  1 
ATOM   636  C C   . PHE A 1 82  ? 24.696 18.002 46.906 1.00 22.99 ? 84  PHE A C   1 
ATOM   637  O O   . PHE A 1 82  ? 23.487 17.787 46.933 1.00 23.08 ? 84  PHE A O   1 
ATOM   638  C CB  . PHE A 1 82  ? 25.905 19.892 45.797 1.00 22.44 ? 84  PHE A CB  1 
ATOM   639  C CG  . PHE A 1 82  ? 26.537 21.233 45.928 1.00 21.77 ? 84  PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 82  ? 25.773 22.393 45.913 1.00 21.03 ? 84  PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 82  ? 27.913 21.347 46.111 1.00 22.81 ? 84  PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 82  ? 26.360 23.639 46.072 1.00 19.19 ? 84  PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 82  ? 28.513 22.588 46.272 1.00 21.55 ? 84  PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 82  ? 27.734 23.739 46.251 1.00 20.53 ? 84  PHE A CZ  1 
ATOM   645  N N   . LYS A 1 83  ? 25.582 17.017 46.716 1.00 22.55 ? 85  LYS A N   1 
ATOM   646  C CA  . LYS A 1 83  ? 25.110 15.643 46.539 1.00 22.62 ? 85  LYS A CA  1 
ATOM   647  C C   . LYS A 1 83  ? 24.509 15.037 47.818 1.00 21.96 ? 85  LYS A C   1 
ATOM   648  O O   . LYS A 1 83  ? 23.563 14.260 47.741 1.00 22.16 ? 85  LYS A O   1 
ATOM   649  C CB  . LYS A 1 83  ? 26.234 14.747 46.022 1.00 22.09 ? 85  LYS A CB  1 
ATOM   650  C CG  . LYS A 1 83  ? 26.812 15.222 44.714 1.00 23.72 ? 85  LYS A CG  1 
ATOM   651  C CD  . LYS A 1 83  ? 27.770 14.213 44.126 1.00 25.37 ? 85  LYS A CD  1 
ATOM   652  C CE  . LYS A 1 83  ? 28.146 14.604 42.702 1.00 27.33 ? 85  LYS A CE  1 
ATOM   653  N NZ  . LYS A 1 83  ? 28.957 15.845 42.643 1.00 26.26 ? 85  LYS A NZ  1 
ATOM   654  N N   . SER A 1 84  ? 25.044 15.413 49.017 1.00 21.32 ? 86  SER A N   1 
ATOM   655  C CA  . SER A 1 84  ? 24.528 14.863 50.269 1.00 22.61 ? 86  SER A CA  1 
ATOM   656  C C   . SER A 1 84  ? 23.073 15.249 50.553 1.00 23.34 ? 86  SER A C   1 
ATOM   657  O O   . SER A 1 84  ? 22.388 14.567 51.307 1.00 23.67 ? 86  SER A O   1 
ATOM   658  C CB  . SER A 1 84  ? 25.432 15.268 51.458 1.00 24.07 ? 86  SER A CB  1 
ATOM   659  O OG  . SER A 1 84  ? 25.305 16.629 51.822 1.00 23.80 ? 86  SER A OG  1 
ATOM   660  N N   . ALA A 1 85  ? 22.596 16.360 49.927 1.00 24.41 ? 87  ALA A N   1 
ATOM   661  C CA  . ALA A 1 85  ? 21.217 16.837 50.119 1.00 23.37 ? 87  ALA A CA  1 
ATOM   662  C C   . ALA A 1 85  ? 20.219 16.146 49.190 1.00 23.48 ? 87  ALA A C   1 
ATOM   663  O O   . ALA A 1 85  ? 19.015 16.199 49.405 1.00 24.05 ? 87  ALA A O   1 
ATOM   664  C CB  . ALA A 1 85  ? 21.156 18.345 49.912 1.00 23.01 ? 87  ALA A CB  1 
ATOM   665  N N   . MET A 1 86  ? 20.732 15.493 48.139 1.00 23.32 ? 88  MET A N   1 
ATOM   666  C CA  . MET A 1 86  ? 19.863 14.809 47.195 1.00 23.50 ? 88  MET A CA  1 
ATOM   667  C C   . MET A 1 86  ? 19.384 13.485 47.785 1.00 22.99 ? 88  MET A C   1 
ATOM   668  O O   . MET A 1 86  ? 19.998 12.955 48.706 1.00 23.73 ? 88  MET A O   1 
ATOM   669  C CB  . MET A 1 86  ? 20.609 14.575 45.879 1.00 23.74 ? 88  MET A CB  1 
ATOM   670  C CG  . MET A 1 86  ? 19.983 15.305 44.701 1.00 21.89 ? 88  MET A CG  1 
ATOM   671  S SD  . MET A 1 86  ? 19.762 17.066 45.022 1.00 22.36 ? 88  MET A SD  1 
ATOM   672  C CE  . MET A 1 86  ? 21.336 17.710 44.550 1.00 22.92 ? 88  MET A CE  1 
ATOM   673  N N   . PRO A 1 87  ? 18.281 12.920 47.251 1.00 23.18 ? 89  PRO A N   1 
ATOM   674  C CA  . PRO A 1 87  ? 17.459 13.410 46.137 1.00 22.85 ? 89  PRO A CA  1 
ATOM   675  C C   . PRO A 1 87  ? 16.406 14.437 46.526 1.00 24.24 ? 89  PRO A C   1 
ATOM   676  O O   . PRO A 1 87  ? 15.760 15.022 45.652 1.00 25.09 ? 89  PRO A O   1 
ATOM   677  C CB  . PRO A 1 87  ? 16.809 12.139 45.623 1.00 21.76 ? 89  PRO A CB  1 
ATOM   678  C CG  . PRO A 1 87  ? 16.468 11.467 46.914 1.00 20.71 ? 89  PRO A CG  1 
ATOM   679  C CD  . PRO A 1 87  ? 17.784 11.602 47.690 1.00 21.91 ? 89  PRO A CD  1 
ATOM   680  N N   . GLU A 1 88  ? 16.201 14.636 47.854 1.00 25.40 ? 90  GLU A N   1 
ATOM   681  C CA  . GLU A 1 88  ? 15.205 15.588 48.340 1.00 25.35 ? 90  GLU A CA  1 
ATOM   682  C C   . GLU A 1 88  ? 15.563 16.985 47.839 1.00 25.03 ? 90  GLU A C   1 
ATOM   683  O O   . GLU A 1 88  ? 14.720 17.882 47.794 1.00 25.00 ? 90  GLU A O   1 
ATOM   684  C CB  . GLU A 1 88  ? 15.153 15.584 49.869 1.00 27.71 ? 90  GLU A CB  1 
ATOM   685  C CG  . GLU A 1 88  ? 14.993 14.206 50.494 1.00 32.01 ? 90  GLU A CG  1 
ATOM   686  C CD  . GLU A 1 88  ? 16.321 13.623 50.954 1.00 36.18 ? 90  GLU A CD  1 
ATOM   687  O OE1 . GLU A 1 88  ? 17.244 13.511 50.116 1.00 36.66 ? 90  GLU A OE1 1 
ATOM   688  O OE2 . GLU A 1 88  ? 16.443 13.267 52.151 1.00 39.67 ? 90  GLU A OE2 1 
ATOM   689  N N   . GLY A 1 89  ? 16.851 17.161 47.470 1.00 24.07 ? 91  GLY A N   1 
ATOM   690  C CA  . GLY A 1 89  ? 17.317 18.433 46.949 1.00 24.14 ? 91  GLY A CA  1 
ATOM   691  C C   . GLY A 1 89  ? 17.570 19.521 47.970 1.00 23.54 ? 91  GLY A C   1 
ATOM   692  O O   . GLY A 1 89  ? 17.547 19.290 49.179 1.00 23.58 ? 91  GLY A O   1 
ATOM   693  N N   . TYR A 1 90  ? 17.818 20.737 47.471 1.00 22.71 ? 92  TYR A N   1 
ATOM   694  C CA  . TYR A 1 90  ? 18.079 21.865 48.342 1.00 22.84 ? 92  TYR A CA  1 
ATOM   695  C C   . TYR A 1 90  ? 17.639 23.153 47.680 1.00 22.61 ? 92  TYR A C   1 
ATOM   696  O O   . TYR A 1 90  ? 17.400 23.197 46.479 1.00 23.27 ? 92  TYR A O   1 
ATOM   697  C CB  . TYR A 1 90  ? 19.569 21.941 48.688 1.00 22.09 ? 92  TYR A CB  1 
ATOM   698  C CG  . TYR A 1 90  ? 20.481 21.975 47.478 1.00 21.18 ? 92  TYR A CG  1 
ATOM   699  C CD1 . TYR A 1 90  ? 20.668 23.149 46.757 1.00 19.75 ? 92  TYR A CD1 1 
ATOM   700  C CD2 . TYR A 1 90  ? 21.115 20.812 47.024 1.00 21.63 ? 92  TYR A CD2 1 
ATOM   701  C CE1 . TYR A 1 90  ? 21.451 23.179 45.610 1.00 19.38 ? 92  TYR A CE1 1 
ATOM   702  C CE2 . TYR A 1 90  ? 21.908 20.825 45.875 1.00 21.82 ? 92  TYR A CE2 1 
ATOM   703  C CZ  . TYR A 1 90  ? 22.069 22.006 45.167 1.00 21.53 ? 92  TYR A CZ  1 
ATOM   704  O OH  . TYR A 1 90  ? 22.806 22.007 43.999 1.00 19.07 ? 92  TYR A OH  1 
ATOM   705  N N   . VAL A 1 91  ? 17.528 24.209 48.490 1.00 21.62 ? 93  VAL A N   1 
ATOM   706  C CA  . VAL A 1 91  ? 17.126 25.503 47.998 1.00 21.08 ? 93  VAL A CA  1 
ATOM   707  C C   . VAL A 1 91  ? 18.376 26.343 47.789 1.00 22.19 ? 93  VAL A C   1 
ATOM   708  O O   . VAL A 1 91  ? 19.244 26.416 48.660 1.00 22.88 ? 93  VAL A O   1 
ATOM   709  C CB  . VAL A 1 91  ? 16.188 26.182 49.008 1.00 19.66 ? 93  VAL A CB  1 
ATOM   710  C CG1 . VAL A 1 91  ? 15.769 27.559 48.519 1.00 17.06 ? 93  VAL A CG1 1 
ATOM   711  C CG2 . VAL A 1 91  ? 14.973 25.306 49.206 1.00 20.18 ? 93  VAL A CG2 1 
ATOM   712  N N   . GLN A 1 92  ? 18.484 26.950 46.612 1.00 21.98 ? 94  GLN A N   1 
ATOM   713  C CA  . GLN A 1 92  ? 19.634 27.788 46.335 1.00 23.86 ? 94  GLN A CA  1 
ATOM   714  C C   . GLN A 1 92  ? 19.143 29.198 46.094 1.00 24.40 ? 94  GLN A C   1 
ATOM   715  O O   . GLN A 1 92  ? 18.290 29.423 45.228 1.00 22.98 ? 94  GLN A O   1 
ATOM   716  C CB  . GLN A 1 92  ? 20.397 27.275 45.106 1.00 25.54 ? 94  GLN A CB  1 
ATOM   717  C CG  . GLN A 1 92  ? 21.648 28.075 44.769 1.00 24.80 ? 94  GLN A CG  1 
ATOM   718  C CD  . GLN A 1 92  ? 22.494 27.425 43.686 1.00 27.08 ? 94  GLN A CD  1 
ATOM   719  O OE1 . GLN A 1 92  ? 22.921 26.275 43.820 1.00 26.37 ? 94  GLN A OE1 1 
ATOM   720  N NE2 . GLN A 1 92  ? 22.739 28.161 42.610 1.00 29.41 ? 94  GLN A NE2 1 
ATOM   721  N N   . GLU A 1 93  ? 19.654 30.162 46.899 1.00 23.24 ? 95  GLU A N   1 
ATOM   722  C CA  . GLU A 1 93  ? 19.272 31.559 46.717 1.00 22.94 ? 95  GLU A CA  1 
ATOM   723  C C   . GLU A 1 93  ? 20.535 32.359 46.437 1.00 22.26 ? 95  GLU A C   1 
ATOM   724  O O   . GLU A 1 93  ? 21.596 32.085 47.003 1.00 21.72 ? 95  GLU A O   1 
ATOM   725  C CB  . GLU A 1 93  ? 18.592 32.129 47.956 1.00 23.47 ? 95  GLU A CB  1 
ATOM   726  C CG  . GLU A 1 93  ? 17.270 31.493 48.320 1.00 26.66 ? 95  GLU A CG  1 
ATOM   727  C CD  . GLU A 1 93  ? 16.658 32.127 49.555 1.00 29.25 ? 95  GLU A CD  1 
ATOM   728  O OE1 . GLU A 1 93  ? 16.168 33.274 49.454 1.00 32.57 ? 95  GLU A OE1 1 
ATOM   729  O OE2 . GLU A 1 93  ? 16.664 31.480 50.624 1.00 30.45 ? 95  GLU A OE2 1 
ATOM   730  N N   . ARG A 1 94  ? 20.404 33.360 45.543 1.00 22.24 ? 96  ARG A N   1 
ATOM   731  C CA  . ARG A 1 94  ? 21.507 34.236 45.170 1.00 24.23 ? 96  ARG A CA  1 
ATOM   732  C C   . ARG A 1 94  ? 21.075 35.683 45.055 1.00 24.67 ? 96  ARG A C   1 
ATOM   733  O O   . ARG A 1 94  ? 19.896 36.001 44.896 1.00 25.04 ? 96  ARG A O   1 
ATOM   734  C CB  . ARG A 1 94  ? 22.088 33.849 43.804 1.00 22.77 ? 96  ARG A CB  1 
ATOM   735  C CG  . ARG A 1 94  ? 23.000 32.662 43.810 1.00 22.89 ? 96  ARG A CG  1 
ATOM   736  C CD  . ARG A 1 94  ? 24.381 33.060 43.357 1.00 20.56 ? 96  ARG A CD  1 
ATOM   737  N NE  . ARG A 1 94  ? 25.250 31.898 43.231 1.00 18.33 ? 96  ARG A NE  1 
ATOM   738  C CZ  . ARG A 1 94  ? 25.133 30.975 42.263 1.00 16.98 ? 96  ARG A CZ  1 
ATOM   739  N NH1 . ARG A 1 94  ? 24.192 31.092 41.338 1.00 14.22 ? 96  ARG A NH1 1 
ATOM   740  N NH2 . ARG A 1 94  ? 25.949 29.935 42.240 1.00 17.01 ? 96  ARG A NH2 1 
ATOM   741  N N   . THR A 1 95  ? 22.076 36.572 45.127 1.00 24.66 ? 97  THR A N   1 
ATOM   742  C CA  . THR A 1 95  ? 21.855 37.993 44.950 1.00 24.15 ? 97  THR A CA  1 
ATOM   743  C C   . THR A 1 95  ? 23.052 38.444 44.150 1.00 24.16 ? 97  THR A C   1 
ATOM   744  O O   . THR A 1 95  ? 24.173 38.533 44.664 1.00 24.85 ? 97  THR A O   1 
ATOM   745  C CB  . THR A 1 95  ? 21.823 38.759 46.264 1.00 25.42 ? 97  THR A CB  1 
ATOM   746  O OG1 . THR A 1 95  ? 20.934 38.105 47.175 1.00 29.06 ? 97  THR A OG1 1 
ATOM   747  C CG2 . THR A 1 95  ? 21.326 40.186 46.005 1.00 23.42 ? 97  THR A CG2 1 
ATOM   748  N N   . ILE A 1 96  ? 22.818 38.713 42.861 1.00 24.47 ? 98  ILE A N   1 
ATOM   749  C CA  . ILE A 1 96  ? 23.893 39.152 41.982 1.00 23.99 ? 98  ILE A CA  1 
ATOM   750  C C   . ILE A 1 96  ? 23.863 40.666 41.870 1.00 23.93 ? 98  ILE A C   1 
ATOM   751  O O   . ILE A 1 96  ? 22.833 41.255 41.548 1.00 23.96 ? 98  ILE A O   1 
ATOM   752  C CB  . ILE A 1 96  ? 23.750 38.517 40.580 1.00 23.02 ? 98  ILE A CB  1 
ATOM   753  C CG1 . ILE A 1 96  ? 23.606 36.994 40.702 1.00 22.34 ? 98  ILE A CG1 1 
ATOM   754  C CG2 . ILE A 1 96  ? 24.988 38.810 39.744 1.00 23.43 ? 98  ILE A CG2 1 
ATOM   755  C CD1 . ILE A 1 96  ? 23.180 36.321 39.424 1.00 22.48 ? 98  ILE A CD1 1 
ATOM   756  N N   . PHE A 1 97  ? 25.010 41.297 42.170 1.00 22.70 ? 99  PHE A N   1 
ATOM   757  C CA  . PHE A 1 97  ? 25.123 42.749 42.099 1.00 20.95 ? 99  PHE A CA  1 
ATOM   758  C C   . PHE A 1 97  ? 25.955 43.155 40.892 1.00 19.28 ? 99  PHE A C   1 
ATOM   759  O O   . PHE A 1 97  ? 27.145 42.863 40.849 1.00 19.04 ? 99  PHE A O   1 
ATOM   760  C CB  . PHE A 1 97  ? 25.800 43.299 43.358 1.00 20.65 ? 99  PHE A CB  1 
ATOM   761  C CG  . PHE A 1 97  ? 24.991 43.139 44.601 1.00 19.55 ? 99  PHE A CG  1 
ATOM   762  C CD1 . PHE A 1 97  ? 25.305 42.150 45.536 1.00 21.71 ? 99  PHE A CD1 1 
ATOM   763  C CD2 . PHE A 1 97  ? 23.910 43.964 44.839 1.00 18.37 ? 99  PHE A CD2 1 
ATOM   764  C CE1 . PHE A 1 97  ? 24.538 42.000 46.687 1.00 22.29 ? 99  PHE A CE1 1 
ATOM   765  C CE2 . PHE A 1 97  ? 23.140 43.828 45.974 1.00 21.45 ? 99  PHE A CE2 1 
ATOM   766  C CZ  . PHE A 1 97  ? 23.451 42.844 46.909 1.00 22.29 ? 99  PHE A CZ  1 
ATOM   767  N N   . PHE A 1 98  ? 25.329 43.833 39.895 1.00 17.63 ? 100 PHE A N   1 
ATOM   768  C CA  . PHE A 1 98  ? 26.073 44.279 38.715 1.00 17.34 ? 100 PHE A CA  1 
ATOM   769  C C   . PHE A 1 98  ? 26.582 45.678 38.983 1.00 16.80 ? 100 PHE A C   1 
ATOM   770  O O   . PHE A 1 98  ? 25.809 46.609 39.199 1.00 16.55 ? 100 PHE A O   1 
ATOM   771  C CB  . PHE A 1 98  ? 25.198 44.239 37.452 1.00 17.53 ? 100 PHE A CB  1 
ATOM   772  C CG  . PHE A 1 98  ? 24.955 42.846 36.942 1.00 19.19 ? 100 PHE A CG  1 
ATOM   773  C CD1 . PHE A 1 98  ? 23.949 42.055 37.499 1.00 19.26 ? 100 PHE A CD1 1 
ATOM   774  C CD2 . PHE A 1 98  ? 25.785 42.288 35.968 1.00 19.69 ? 100 PHE A CD2 1 
ATOM   775  C CE1 . PHE A 1 98  ? 23.776 40.731 37.100 1.00 20.24 ? 100 PHE A CE1 1 
ATOM   776  C CE2 . PHE A 1 98  ? 25.618 40.964 35.563 1.00 19.75 ? 100 PHE A CE2 1 
ATOM   777  C CZ  . PHE A 1 98  ? 24.613 40.184 36.131 1.00 20.46 ? 100 PHE A CZ  1 
ATOM   778  N N   . LYS A 1 99  ? 27.918 45.820 38.994 1.00 16.80 ? 101 LYS A N   1 
ATOM   779  C CA  . LYS A 1 99  ? 28.527 47.105 39.285 1.00 17.10 ? 101 LYS A CA  1 
ATOM   780  C C   . LYS A 1 99  ? 27.848 48.219 38.507 1.00 17.93 ? 101 LYS A C   1 
ATOM   781  O O   . LYS A 1 99  ? 27.600 48.108 37.302 1.00 19.06 ? 101 LYS A O   1 
ATOM   782  C CB  . LYS A 1 99  ? 30.025 47.066 38.986 1.00 14.74 ? 101 LYS A CB  1 
ATOM   783  C CG  . LYS A 1 99  ? 30.861 48.006 39.824 1.00 13.85 ? 101 LYS A CG  1 
ATOM   784  C CD  . LYS A 1 99  ? 32.197 48.264 39.157 1.00 16.67 ? 101 LYS A CD  1 
ATOM   785  C CE  . LYS A 1 99  ? 33.038 49.290 39.905 1.00 16.86 ? 101 LYS A CE  1 
ATOM   786  N NZ  . LYS A 1 99  ? 33.542 48.777 41.211 1.00 17.42 ? 101 LYS A NZ  1 
ATOM   787  N N   . ASP A 1 100 ? 27.509 49.295 39.217 1.00 18.58 ? 102 ASP A N   1 
ATOM   788  C CA  . ASP A 1 100 ? 26.882 50.438 38.585 1.00 19.68 ? 102 ASP A CA  1 
ATOM   789  C C   . ASP A 1 100 ? 25.657 50.098 37.746 1.00 20.45 ? 102 ASP A C   1 
ATOM   790  O O   . ASP A 1 100 ? 25.427 50.689 36.695 1.00 22.01 ? 102 ASP A O   1 
ATOM   791  C CB  . ASP A 1 100 ? 27.925 51.171 37.742 1.00 20.62 ? 102 ASP A CB  1 
ATOM   792  C CG  . ASP A 1 100 ? 29.114 51.606 38.556 1.00 21.77 ? 102 ASP A CG  1 
ATOM   793  O OD1 . ASP A 1 100 ? 28.921 52.416 39.477 1.00 23.55 ? 102 ASP A OD1 1 
ATOM   794  O OD2 . ASP A 1 100 ? 30.237 51.148 38.278 1.00 24.29 ? 102 ASP A OD2 1 
ATOM   795  N N   . ASP A 1 101 ? 24.880 49.109 38.208 1.00 19.74 ? 103 ASP A N   1 
ATOM   796  C CA  . ASP A 1 101 ? 23.663 48.746 37.513 1.00 18.30 ? 103 ASP A CA  1 
ATOM   797  C C   . ASP A 1 101 ? 22.742 48.006 38.474 1.00 17.34 ? 103 ASP A C   1 
ATOM   798  O O   . ASP A 1 101 ? 22.969 48.014 39.677 1.00 16.18 ? 103 ASP A O   1 
ATOM   799  C CB  . ASP A 1 101 ? 23.950 47.888 36.275 1.00 16.53 ? 103 ASP A CB  1 
ATOM   800  C CG  . ASP A 1 101 ? 23.115 48.319 35.069 1.00 16.20 ? 103 ASP A CG  1 
ATOM   801  O OD1 . ASP A 1 101 ? 21.973 48.771 35.287 1.00 16.41 ? 103 ASP A OD1 1 
ATOM   802  O OD2 . ASP A 1 101 ? 23.594 48.211 33.919 1.00 13.60 ? 103 ASP A OD2 1 
ATOM   803  N N   . GLY A 1 102 ? 21.683 47.385 37.931 1.00 17.62 ? 104 GLY A N   1 
ATOM   804  C CA  . GLY A 1 102 ? 20.724 46.677 38.755 1.00 17.63 ? 104 GLY A CA  1 
ATOM   805  C C   . GLY A 1 102 ? 21.254 45.407 39.369 1.00 18.04 ? 104 GLY A C   1 
ATOM   806  O O   . GLY A 1 102 ? 22.422 45.055 39.208 1.00 19.06 ? 104 GLY A O   1 
ATOM   807  N N   . ASN A 1 103 ? 20.396 44.703 40.081 1.00 17.93 ? 105 ASN A N   1 
ATOM   808  C CA  . ASN A 1 103 ? 20.817 43.476 40.722 1.00 18.40 ? 105 ASN A CA  1 
ATOM   809  C C   . ASN A 1 103 ? 19.786 42.400 40.489 1.00 18.59 ? 105 ASN A C   1 
ATOM   810  O O   . ASN A 1 103 ? 18.601 42.676 40.245 1.00 18.27 ? 105 ASN A O   1 
ATOM   811  C CB  . ASN A 1 103 ? 21.000 43.719 42.201 1.00 18.92 ? 105 ASN A CB  1 
ATOM   812  C CG  . ASN A 1 103 ? 19.754 44.255 42.833 1.00 19.75 ? 105 ASN A CG  1 
ATOM   813  O OD1 . ASN A 1 103 ? 18.914 43.498 43.310 1.00 20.21 ? 105 ASN A OD1 1 
ATOM   814  N ND2 . ASN A 1 103 ? 19.598 45.580 42.799 1.00 21.82 ? 105 ASN A ND2 1 
ATOM   815  N N   . TYR A 1 104 ? 20.274 41.153 40.555 1.00 18.53 ? 106 TYR A N   1 
ATOM   816  C CA  . TYR A 1 104 ? 19.465 39.965 40.365 1.00 17.98 ? 106 TYR A CA  1 
ATOM   817  C C   . TYR A 1 104 ? 19.280 39.261 41.696 1.00 17.77 ? 106 TYR A C   1 
ATOM   818  O O   . TYR A 1 104 ? 20.253 38.974 42.387 1.00 16.39 ? 106 TYR A O   1 
ATOM   819  C CB  . TYR A 1 104 ? 20.167 38.961 39.443 1.00 19.36 ? 106 TYR A CB  1 
ATOM   820  C CG  . TYR A 1 104 ? 20.072 39.220 37.959 1.00 16.79 ? 106 TYR A CG  1 
ATOM   821  C CD1 . TYR A 1 104 ? 19.217 40.190 37.450 1.00 16.56 ? 106 TYR A CD1 1 
ATOM   822  C CD2 . TYR A 1 104 ? 20.877 38.512 37.066 1.00 15.86 ? 106 TYR A CD2 1 
ATOM   823  C CE1 . TYR A 1 104 ? 19.177 40.458 36.084 1.00 17.99 ? 106 TYR A CE1 1 
ATOM   824  C CE2 . TYR A 1 104 ? 20.842 38.771 35.702 1.00 17.00 ? 106 TYR A CE2 1 
ATOM   825  C CZ  . TYR A 1 104 ? 20.000 39.753 35.215 1.00 18.38 ? 106 TYR A CZ  1 
ATOM   826  O OH  . TYR A 1 104 ? 20.051 40.097 33.875 1.00 16.77 ? 106 TYR A OH  1 
ATOM   827  N N   . LYS A 1 105 ? 18.014 38.973 42.042 1.00 19.76 ? 107 LYS A N   1 
ATOM   828  C CA  . LYS A 1 105 ? 17.708 38.225 43.258 1.00 22.62 ? 107 LYS A CA  1 
ATOM   829  C C   . LYS A 1 105 ? 17.005 36.978 42.740 1.00 22.29 ? 107 LYS A C   1 
ATOM   830  O O   . LYS A 1 105 ? 15.908 37.038 42.193 1.00 21.76 ? 107 LYS A O   1 
ATOM   831  C CB  . LYS A 1 105 ? 16.806 39.016 44.207 1.00 23.54 ? 107 LYS A CB  1 
ATOM   832  C CG  . LYS A 1 105 ? 17.348 40.386 44.569 1.00 27.27 ? 107 LYS A CG  1 
ATOM   833  C CD  . LYS A 1 105 ? 17.122 40.721 46.036 1.00 31.24 ? 107 LYS A CD  1 
ATOM   834  C CE  . LYS A 1 105 ? 16.747 42.200 46.260 1.00 35.19 ? 107 LYS A CE  1 
ATOM   835  N NZ  . LYS A 1 105 ? 17.701 43.188 45.676 1.00 35.78 ? 107 LYS A NZ  1 
ATOM   836  N N   . THR A 1 106 ? 17.673 35.843 42.909 1.00 22.17 ? 108 THR A N   1 
ATOM   837  C CA  . THR A 1 106 ? 17.139 34.591 42.422 1.00 22.37 ? 108 THR A CA  1 
ATOM   838  C C   . THR A 1 106 ? 16.942 33.573 43.547 1.00 22.64 ? 108 THR A C   1 
ATOM   839  O O   . THR A 1 106 ? 17.625 33.621 44.572 1.00 22.13 ? 108 THR A O   1 
ATOM   840  C CB  . THR A 1 106 ? 18.093 34.017 41.336 1.00 21.65 ? 108 THR A CB  1 
ATOM   841  O OG1 . THR A 1 106 ? 19.259 33.474 41.968 1.00 21.28 ? 108 THR A OG1 1 
ATOM   842  C CG2 . THR A 1 106 ? 18.529 35.139 40.398 1.00 21.18 ? 108 THR A CG2 1 
ATOM   843  N N   . ARG A 1 107 ? 15.954 32.676 43.355 1.00 21.13 ? 109 ARG A N   1 
ATOM   844  C CA  . ARG A 1 107 ? 15.666 31.606 44.305 1.00 20.91 ? 109 ARG A CA  1 
ATOM   845  C C   . ARG A 1 107 ? 15.266 30.408 43.463 1.00 21.56 ? 109 ARG A C   1 
ATOM   846  O O   . ARG A 1 107 ? 14.248 30.414 42.767 1.00 19.85 ? 109 ARG A O   1 
ATOM   847  C CB  . ARG A 1 107 ? 14.532 31.979 45.273 1.00 19.23 ? 109 ARG A CB  1 
ATOM   848  C CG  . ARG A 1 107 ? 14.252 30.919 46.326 1.00 17.77 ? 109 ARG A CG  1 
ATOM   849  C CD  . ARG A 1 107 ? 13.166 31.381 47.265 1.00 19.32 ? 109 ARG A CD  1 
ATOM   850  N NE  . ARG A 1 107 ? 12.979 30.464 48.385 1.00 23.52 ? 109 ARG A NE  1 
ATOM   851  C CZ  . ARG A 1 107 ? 12.348 29.267 48.301 1.00 25.78 ? 109 ARG A CZ  1 
ATOM   852  N NH1 . ARG A 1 107 ? 11.848 28.850 47.145 1.00 25.37 ? 109 ARG A NH1 1 
ATOM   853  N NH2 . ARG A 1 107 ? 12.227 28.512 49.384 1.00 26.68 ? 109 ARG A NH2 1 
ATOM   854  N N   . ALA A 1 108 ? 16.113 29.384 43.512 1.00 22.96 ? 110 ALA A N   1 
ATOM   855  C CA  . ALA A 1 108 ? 15.882 28.171 42.760 1.00 23.00 ? 110 ALA A CA  1 
ATOM   856  C C   . ALA A 1 108 ? 15.787 27.016 43.717 1.00 23.10 ? 110 ALA A C   1 
ATOM   857  O O   . ALA A 1 108 ? 16.205 27.105 44.873 1.00 22.87 ? 110 ALA A O   1 
ATOM   858  C CB  . ALA A 1 108 ? 17.014 27.930 41.789 1.00 23.40 ? 110 ALA A CB  1 
ATOM   859  N N   . GLU A 1 109 ? 15.220 25.930 43.194 1.00 24.16 ? 111 GLU A N   1 
ATOM   860  C CA  . GLU A 1 109 ? 15.031 24.701 43.927 1.00 24.21 ? 111 GLU A CA  1 
ATOM   861  C C   . GLU A 1 109 ? 15.630 23.585 43.102 1.00 23.56 ? 111 GLU A C   1 
ATOM   862  O O   . GLU A 1 109 ? 15.125 23.261 42.022 1.00 26.18 ? 111 GLU A O   1 
ATOM   863  C CB  . GLU A 1 109 ? 13.540 24.454 44.140 1.00 25.46 ? 111 GLU A CB  1 
ATOM   864  C CG  . GLU A 1 109 ? 13.152 24.427 45.606 1.00 28.94 ? 111 GLU A CG  1 
ATOM   865  C CD  . GLU A 1 109 ? 11.652 24.241 45.832 1.00 30.33 ? 111 GLU A CD  1 
ATOM   866  O OE1 . GLU A 1 109 ? 11.083 23.220 45.365 1.00 30.39 ? 111 GLU A OE1 1 
ATOM   867  O OE2 . GLU A 1 109 ? 11.049 25.122 46.484 1.00 30.04 ? 111 GLU A OE2 1 
ATOM   868  N N   . VAL A 1 110 ? 16.726 23.000 43.598 1.00 20.87 ? 112 VAL A N   1 
ATOM   869  C CA  . VAL A 1 110 ? 17.376 21.913 42.875 1.00 19.13 ? 112 VAL A CA  1 
ATOM   870  C C   . VAL A 1 110 ? 16.987 20.603 43.557 1.00 19.00 ? 112 VAL A C   1 
ATOM   871  O O   . VAL A 1 110 ? 17.204 20.419 44.749 1.00 19.26 ? 112 VAL A O   1 
ATOM   872  C CB  . VAL A 1 110 ? 18.914 22.086 42.873 1.00 18.06 ? 112 VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 110 ? 19.497 21.515 41.603 1.00 17.24 ? 112 VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 110 ? 19.281 23.564 43.002 1.00 17.30 ? 112 VAL A CG2 1 
ATOM   875  N N   . LYS A 1 111 ? 16.385 19.678 42.805 1.00 18.98 ? 113 LYS A N   1 
ATOM   876  C CA  . LYS A 1 111 ? 15.978 18.414 43.407 1.00 18.60 ? 113 LYS A CA  1 
ATOM   877  C C   . LYS A 1 111 ? 15.785 17.373 42.317 1.00 19.11 ? 113 LYS A C   1 
ATOM   878  O O   . LYS A 1 111 ? 15.745 17.705 41.137 1.00 19.07 ? 113 LYS A O   1 
ATOM   879  C CB  . LYS A 1 111 ? 14.676 18.606 44.171 1.00 19.85 ? 113 LYS A CB  1 
ATOM   880  C CG  . LYS A 1 111 ? 13.450 18.471 43.280 1.00 21.36 ? 113 LYS A CG  1 
ATOM   881  C CD  . LYS A 1 111 ? 12.191 18.936 43.969 1.00 24.72 ? 113 LYS A CD  1 
ATOM   882  C CE  . LYS A 1 111 ? 12.236 20.432 44.244 1.00 28.17 ? 113 LYS A CE  1 
ATOM   883  N NZ  . LYS A 1 111 ? 12.382 21.253 43.005 1.00 28.15 ? 113 LYS A NZ  1 
ATOM   884  N N   . PHE A 1 112 ? 15.647 16.105 42.736 1.00 18.79 ? 114 PHE A N   1 
ATOM   885  C CA  . PHE A 1 112 ? 15.443 15.010 41.804 1.00 18.21 ? 114 PHE A CA  1 
ATOM   886  C C   . PHE A 1 112 ? 13.954 14.738 41.595 1.00 18.28 ? 114 PHE A C   1 
ATOM   887  O O   . PHE A 1 112 ? 13.160 14.804 42.536 1.00 18.85 ? 114 PHE A O   1 
ATOM   888  C CB  . PHE A 1 112 ? 16.117 13.727 42.327 1.00 17.82 ? 114 PHE A CB  1 
ATOM   889  C CG  . PHE A 1 112 ? 17.440 13.401 41.665 1.00 17.42 ? 114 PHE A CG  1 
ATOM   890  C CD1 . PHE A 1 112 ? 17.486 13.016 40.327 1.00 16.49 ? 114 PHE A CD1 1 
ATOM   891  C CD2 . PHE A 1 112 ? 18.632 13.478 42.379 1.00 16.36 ? 114 PHE A CD2 1 
ATOM   892  C CE1 . PHE A 1 112 ? 18.704 12.712 39.707 1.00 16.92 ? 114 PHE A CE1 1 
ATOM   893  C CE2 . PHE A 1 112 ? 19.854 13.177 41.774 1.00 16.10 ? 114 PHE A CE2 1 
ATOM   894  C CZ  . PHE A 1 112 ? 19.892 12.794 40.439 1.00 16.70 ? 114 PHE A CZ  1 
ATOM   895  N N   . GLU A 1 113 ? 13.578 14.462 40.345 1.00 19.50 ? 115 GLU A N   1 
ATOM   896  C CA  . GLU A 1 113 ? 12.202 14.119 39.998 1.00 22.21 ? 115 GLU A CA  1 
ATOM   897  C C   . GLU A 1 113 ? 12.369 12.813 39.254 1.00 24.46 ? 115 GLU A C   1 
ATOM   898  O O   . GLU A 1 113 ? 12.430 12.808 38.019 1.00 26.17 ? 115 GLU A O   1 
ATOM   899  C CB  . GLU A 1 113 ? 11.576 15.130 39.041 1.00 21.77 ? 115 GLU A CB  1 
ATOM   900  C CG  . GLU A 1 113 ? 11.207 16.459 39.661 1.00 22.77 ? 115 GLU A CG  1 
ATOM   901  C CD  . GLU A 1 113 ? 10.255 16.332 40.817 1.00 21.65 ? 115 GLU A CD  1 
ATOM   902  O OE1 . GLU A 1 113 ? 9.183  15.724 40.664 1.00 21.13 ? 115 GLU A OE1 1 
ATOM   903  O OE2 . GLU A 1 113 ? 10.580 16.854 41.893 1.00 25.46 ? 115 GLU A OE2 1 
ATOM   904  N N   . GLY A 1 114 ? 12.455 11.691 40.009 1.00 24.82 ? 116 GLY A N   1 
ATOM   905  C CA  . GLY A 1 114 ? 12.646 10.399 39.381 1.00 25.03 ? 116 GLY A CA  1 
ATOM   906  C C   . GLY A 1 114 ? 14.138 10.216 39.171 1.00 25.66 ? 116 GLY A C   1 
ATOM   907  O O   . GLY A 1 114 ? 14.903 10.124 40.138 1.00 27.28 ? 116 GLY A O   1 
ATOM   908  N N   . ASP A 1 115 ? 14.565 10.154 37.893 1.00 24.95 ? 117 ASP A N   1 
ATOM   909  C CA  . ASP A 1 115 ? 15.980 10.006 37.573 1.00 24.42 ? 117 ASP A CA  1 
ATOM   910  C C   . ASP A 1 115 ? 16.488 11.288 36.938 1.00 22.68 ? 117 ASP A C   1 
ATOM   911  O O   . ASP A 1 115 ? 17.587 11.330 36.402 1.00 21.62 ? 117 ASP A O   1 
ATOM   912  C CB  . ASP A 1 115 ? 16.211 8.850  36.601 1.00 25.03 ? 117 ASP A CB  1 
ATOM   913  C CG  . ASP A 1 115 ? 15.892 7.513  37.206 1.00 26.84 ? 117 ASP A CG  1 
ATOM   914  O OD1 . ASP A 1 115 ? 16.213 7.310  38.392 1.00 28.79 ? 117 ASP A OD1 1 
ATOM   915  O OD2 . ASP A 1 115 ? 15.323 6.662  36.493 1.00 27.36 ? 117 ASP A OD2 1 
ATOM   916  N N   . THR A 1 116 ? 15.674 12.349 37.003 1.00 22.80 ? 118 THR A N   1 
ATOM   917  C CA  . THR A 1 116 ? 16.070 13.618 36.413 1.00 22.73 ? 118 THR A CA  1 
ATOM   918  C C   . THR A 1 116 ? 16.319 14.714 37.447 1.00 21.27 ? 118 THR A C   1 
ATOM   919  O O   . THR A 1 116 ? 15.466 15.001 38.282 1.00 19.74 ? 118 THR A O   1 
ATOM   920  C CB  . THR A 1 116 ? 15.013 14.128 35.439 1.00 24.42 ? 118 THR A CB  1 
ATOM   921  O OG1 . THR A 1 116 ? 14.692 13.098 34.502 1.00 27.77 ? 118 THR A OG1 1 
ATOM   922  C CG2 . THR A 1 116 ? 15.538 15.346 34.706 1.00 24.02 ? 118 THR A CG2 1 
ATOM   923  N N   . LEU A 1 117 ? 17.528 15.328 37.382 1.00 20.08 ? 119 LEU A N   1 
ATOM   924  C CA  . LEU A 1 117 ? 17.890 16.408 38.299 1.00 19.55 ? 119 LEU A CA  1 
ATOM   925  C C   . LEU A 1 117 ? 17.205 17.676 37.787 1.00 20.49 ? 119 LEU A C   1 
ATOM   926  O O   . LEU A 1 117 ? 17.426 18.099 36.643 1.00 20.11 ? 119 LEU A O   1 
ATOM   927  C CB  . LEU A 1 117 ? 19.421 16.587 38.329 1.00 17.35 ? 119 LEU A CB  1 
ATOM   928  C CG  . LEU A 1 117 ? 20.071 17.548 39.346 1.00 15.99 ? 119 LEU A CG  1 
ATOM   929  C CD1 . LEU A 1 117 ? 19.868 18.982 38.908 1.00 12.56 ? 119 LEU A CD1 1 
ATOM   930  C CD2 . LEU A 1 117 ? 19.506 17.313 40.754 1.00 14.16 ? 119 LEU A CD2 1 
ATOM   931  N N   . VAL A 1 118 ? 16.375 18.283 38.657 1.00 19.25 ? 120 VAL A N   1 
ATOM   932  C CA  . VAL A 1 118 ? 15.637 19.473 38.285 1.00 18.28 ? 120 VAL A CA  1 
ATOM   933  C C   . VAL A 1 118 ? 16.044 20.727 39.027 1.00 19.43 ? 120 VAL A C   1 
ATOM   934  O O   . VAL A 1 118 ? 16.432 20.701 40.198 1.00 18.62 ? 120 VAL A O   1 
ATOM   935  C CB  . VAL A 1 118 ? 14.140 19.264 38.501 1.00 17.64 ? 120 VAL A CB  1 
ATOM   936  C CG1 . VAL A 1 118 ? 13.339 20.295 37.700 1.00 15.25 ? 120 VAL A CG1 1 
ATOM   937  C CG2 . VAL A 1 118 ? 13.788 17.856 38.099 1.00 15.92 ? 120 VAL A CG2 1 
ATOM   938  N N   . ASN A 1 119 ? 15.925 21.844 38.323 1.00 20.32 ? 121 ASN A N   1 
ATOM   939  C CA  . ASN A 1 119 ? 16.277 23.130 38.881 1.00 21.77 ? 121 ASN A CA  1 
ATOM   940  C C   . ASN A 1 119 ? 15.278 24.188 38.440 1.00 22.57 ? 121 ASN A C   1 
ATOM   941  O O   . ASN A 1 119 ? 15.471 24.835 37.405 1.00 21.25 ? 121 ASN A O   1 
ATOM   942  C CB  . ASN A 1 119 ? 17.689 23.498 38.422 1.00 20.83 ? 121 ASN A CB  1 
ATOM   943  C CG  . ASN A 1 119 ? 18.159 24.799 39.005 1.00 21.28 ? 121 ASN A CG  1 
ATOM   944  O OD1 . ASN A 1 119 ? 17.711 25.198 40.069 1.00 23.75 ? 121 ASN A OD1 1 
ATOM   945  N ND2 . ASN A 1 119 ? 19.078 25.465 38.319 1.00 21.31 ? 121 ASN A ND2 1 
ATOM   946  N N   . ARG A 1 120 ? 14.182 24.347 39.241 1.00 23.98 ? 122 ARG A N   1 
ATOM   947  C CA  . ARG A 1 120 ? 13.133 25.331 38.960 1.00 26.55 ? 122 ARG A CA  1 
ATOM   948  C C   . ARG A 1 120 ? 13.524 26.658 39.606 1.00 26.94 ? 122 ARG A C   1 
ATOM   949  O O   . ARG A 1 120 ? 13.480 26.793 40.831 1.00 26.97 ? 122 ARG A O   1 
ATOM   950  C CB  . ARG A 1 120 ? 11.791 24.867 39.530 1.00 28.73 ? 122 ARG A CB  1 
ATOM   951  C CG  . ARG A 1 120 ? 11.248 23.585 38.922 1.00 34.86 ? 122 ARG A CG  1 
ATOM   952  C CD  . ARG A 1 120 ? 9.768  23.433 39.263 1.00 40.88 ? 122 ARG A CD  1 
ATOM   953  N NE  . ARG A 1 120 ? 9.010  24.650 38.966 1.00 46.79 ? 122 ARG A NE  1 
ATOM   954  C CZ  . ARG A 1 120 ? 7.858  24.986 39.587 1.00 48.37 ? 122 ARG A CZ  1 
ATOM   955  N NH1 . ARG A 1 120 ? 7.358  24.189 40.522 1.00 50.42 ? 122 ARG A NH1 1 
ATOM   956  N NH2 . ARG A 1 120 ? 7.227  26.113 39.278 1.00 49.22 ? 122 ARG A NH2 1 
ATOM   957  N N   . ILE A 1 121 ? 13.887 27.649 38.762 1.00 27.45 ? 123 ILE A N   1 
ATOM   958  C CA  . ILE A 1 121 ? 14.326 28.962 39.222 1.00 27.52 ? 123 ILE A CA  1 
ATOM   959  C C   . ILE A 1 121 ? 13.295 30.077 39.115 1.00 27.80 ? 123 ILE A C   1 
ATOM   960  O O   . ILE A 1 121 ? 12.417 30.053 38.272 1.00 28.04 ? 123 ILE A O   1 
ATOM   961  C CB  . ILE A 1 121 ? 15.550 29.424 38.403 1.00 26.34 ? 123 ILE A CB  1 
ATOM   962  C CG1 . ILE A 1 121 ? 16.465 28.239 38.132 1.00 25.38 ? 123 ILE A CG1 1 
ATOM   963  C CG2 . ILE A 1 121 ? 16.300 30.516 39.142 1.00 24.10 ? 123 ILE A CG2 1 
ATOM   964  C CD1 . ILE A 1 121 ? 17.287 28.389 36.873 1.00 25.26 ? 123 ILE A CD1 1 
ATOM   965  N N   . GLU A 1 122 ? 13.444 31.072 39.994 1.00 29.62 ? 124 GLU A N   1 
ATOM   966  C CA  . GLU A 1 122 ? 12.560 32.227 40.007 1.00 30.40 ? 124 GLU A CA  1 
ATOM   967  C C   . GLU A 1 122 ? 13.469 33.449 40.111 1.00 29.01 ? 124 GLU A C   1 
ATOM   968  O O   . GLU A 1 122 ? 14.045 33.707 41.163 1.00 30.64 ? 124 GLU A O   1 
ATOM   969  C CB  . GLU A 1 122 ? 11.638 32.159 41.204 1.00 33.09 ? 124 GLU A CB  1 
ATOM   970  C CG  . GLU A 1 122 ? 10.611 33.243 41.202 1.00 38.87 ? 124 GLU A CG  1 
ATOM   971  C CD  . GLU A 1 122 ? 9.877  33.331 42.511 1.00 42.68 ? 124 GLU A CD  1 
ATOM   972  O OE1 . GLU A 1 122 ? 10.491 33.795 43.504 1.00 44.61 ? 124 GLU A OE1 1 
ATOM   973  O OE2 . GLU A 1 122 ? 8.699  32.924 42.552 1.00 43.64 ? 124 GLU A OE2 1 
ATOM   974  N N   . LEU A 1 123 ? 13.623 34.216 39.015 1.00 26.23 ? 125 LEU A N   1 
ATOM   975  C CA  . LEU A 1 123 ? 14.515 35.368 39.058 1.00 25.13 ? 125 LEU A CA  1 
ATOM   976  C C   . LEU A 1 123 ? 13.808 36.712 39.005 1.00 25.90 ? 125 LEU A C   1 
ATOM   977  O O   . LEU A 1 123 ? 12.916 36.923 38.187 1.00 26.45 ? 125 LEU A O   1 
ATOM   978  C CB  . LEU A 1 123 ? 15.540 35.261 37.922 1.00 25.30 ? 125 LEU A CB  1 
ATOM   979  C CG  . LEU A 1 123 ? 16.506 36.423 37.686 1.00 25.02 ? 125 LEU A CG  1 
ATOM   980  C CD1 . LEU A 1 123 ? 17.681 35.953 36.848 1.00 25.07 ? 125 LEU A CD1 1 
ATOM   981  C CD2 . LEU A 1 123 ? 15.778 37.567 36.995 1.00 25.46 ? 125 LEU A CD2 1 
ATOM   982  N N   . LYS A 1 124 ? 14.225 37.635 39.885 1.00 26.65 ? 126 LYS A N   1 
ATOM   983  C CA  . LYS A 1 124 ? 13.633 38.971 39.940 1.00 27.13 ? 126 LYS A CA  1 
ATOM   984  C C   . LYS A 1 124 ? 14.737 40.008 39.801 1.00 26.38 ? 126 LYS A C   1 
ATOM   985  O O   . LYS A 1 124 ? 15.622 40.083 40.648 1.00 25.85 ? 126 LYS A O   1 
ATOM   986  C CB  . LYS A 1 124 ? 12.933 39.183 41.283 1.00 28.26 ? 126 LYS A CB  1 
ATOM   987  C CG  . LYS A 1 124 ? 12.064 40.410 41.350 1.00 30.14 ? 126 LYS A CG  1 
ATOM   988  C CD  . LYS A 1 124 ? 10.695 40.094 40.798 1.00 33.49 ? 126 LYS A CD  1 
ATOM   989  C CE  . LYS A 1 124 ? 9.715  41.239 41.025 1.00 34.49 ? 126 LYS A CE  1 
ATOM   990  N NZ  . LYS A 1 124 ? 9.450  41.501 42.465 1.00 36.31 ? 126 LYS A NZ  1 
ATOM   991  N N   . GLY A 1 125 ? 14.692 40.811 38.719 1.00 25.74 ? 127 GLY A N   1 
ATOM   992  C CA  . GLY A 1 125 ? 15.719 41.825 38.527 1.00 24.24 ? 127 GLY A CA  1 
ATOM   993  C C   . GLY A 1 125 ? 15.149 43.222 38.590 1.00 23.78 ? 127 GLY A C   1 
ATOM   994  O O   . GLY A 1 125 ? 14.125 43.508 37.970 1.00 23.84 ? 127 GLY A O   1 
ATOM   995  N N   . ILE A 1 126 ? 15.825 44.113 39.356 1.00 22.50 ? 128 ILE A N   1 
ATOM   996  C CA  . ILE A 1 126 ? 15.376 45.491 39.514 1.00 20.46 ? 128 ILE A CA  1 
ATOM   997  C C   . ILE A 1 126 ? 16.556 46.451 39.662 1.00 21.32 ? 128 ILE A C   1 
ATOM   998  O O   . ILE A 1 126 ? 17.646 46.047 40.075 1.00 21.88 ? 128 ILE A O   1 
ATOM   999  C CB  . ILE A 1 126 ? 14.537 45.676 40.776 1.00 19.29 ? 128 ILE A CB  1 
ATOM   1000 C CG1 . ILE A 1 126 ? 15.456 45.631 41.996 1.00 18.76 ? 128 ILE A CG1 1 
ATOM   1001 C CG2 . ILE A 1 126 ? 13.490 44.587 40.894 1.00 17.37 ? 128 ILE A CG2 1 
ATOM   1002 C CD1 . ILE A 1 126 ? 14.891 46.337 43.183 1.00 17.73 ? 128 ILE A CD1 1 
ATOM   1003 N N   . ASP A 1 127 ? 16.301 47.753 39.361 1.00 21.49 ? 129 ASP A N   1 
ATOM   1004 C CA  . ASP A 1 127 ? 17.295 48.824 39.451 1.00 22.05 ? 129 ASP A CA  1 
ATOM   1005 C C   . ASP A 1 127 ? 18.243 48.906 38.264 1.00 21.51 ? 129 ASP A C   1 
ATOM   1006 O O   . ASP A 1 127 ? 19.249 49.607 38.322 1.00 21.50 ? 129 ASP A O   1 
ATOM   1007 C CB  . ASP A 1 127 ? 18.141 48.679 40.707 1.00 24.86 ? 129 ASP A CB  1 
ATOM   1008 C CG  . ASP A 1 127 ? 17.482 49.270 41.940 1.00 28.36 ? 129 ASP A CG  1 
ATOM   1009 O OD1 . ASP A 1 127 ? 16.983 50.420 41.869 1.00 28.67 ? 129 ASP A OD1 1 
ATOM   1010 O OD2 . ASP A 1 127 ? 17.470 48.580 42.985 1.00 30.78 ? 129 ASP A OD2 1 
ATOM   1011 N N   . PHE A 1 128 ? 17.935 48.189 37.180 1.00 23.20 ? 130 PHE A N   1 
ATOM   1012 C CA  . PHE A 1 128 ? 18.793 48.241 36.012 1.00 24.64 ? 130 PHE A CA  1 
ATOM   1013 C C   . PHE A 1 128 ? 18.599 49.496 35.168 1.00 25.73 ? 130 PHE A C   1 
ATOM   1014 O O   . PHE A 1 128 ? 17.480 49.999 35.011 1.00 24.84 ? 130 PHE A O   1 
ATOM   1015 C CB  . PHE A 1 128 ? 18.620 46.985 35.147 1.00 22.09 ? 130 PHE A CB  1 
ATOM   1016 C CG  . PHE A 1 128 ? 19.251 45.749 35.735 1.00 20.09 ? 130 PHE A CG  1 
ATOM   1017 C CD1 . PHE A 1 128 ? 18.549 44.943 36.622 1.00 17.90 ? 130 PHE A CD1 1 
ATOM   1018 C CD2 . PHE A 1 128 ? 20.571 45.426 35.439 1.00 19.40 ? 130 PHE A CD2 1 
ATOM   1019 C CE1 . PHE A 1 128 ? 19.149 43.830 37.216 1.00 16.95 ? 130 PHE A CE1 1 
ATOM   1020 C CE2 . PHE A 1 128 ? 21.184 44.317 36.029 1.00 19.67 ? 130 PHE A CE2 1 
ATOM   1021 C CZ  . PHE A 1 128 ? 20.467 43.520 36.923 1.00 17.12 ? 130 PHE A CZ  1 
ATOM   1022 N N   . LYS A 1 129 ? 19.740 50.016 34.635 1.00 26.01 ? 131 LYS A N   1 
ATOM   1023 C CA  . LYS A 1 129 ? 19.737 51.199 33.794 1.00 27.15 ? 131 LYS A CA  1 
ATOM   1024 C C   . LYS A 1 129 ? 19.313 50.764 32.402 1.00 26.81 ? 131 LYS A C   1 
ATOM   1025 O O   . LYS A 1 129 ? 19.926 49.888 31.797 1.00 25.98 ? 131 LYS A O   1 
ATOM   1026 C CB  . LYS A 1 129 ? 21.136 51.824 33.761 1.00 28.67 ? 131 LYS A CB  1 
ATOM   1027 C CG  . LYS A 1 129 ? 21.599 52.333 35.129 1.00 32.18 ? 131 LYS A CG  1 
ATOM   1028 C CD  . LYS A 1 129 ? 23.006 52.938 35.115 1.00 35.04 ? 131 LYS A CD  1 
ATOM   1029 C CE  . LYS A 1 129 ? 23.493 53.216 36.548 1.00 36.60 ? 131 LYS A CE  1 
ATOM   1030 N NZ  . LYS A 1 129 ? 24.930 53.640 36.616 1.00 37.03 ? 131 LYS A NZ  1 
ATOM   1031 N N   . GLU A 1 130 ? 18.233 51.389 31.907 1.00 27.26 ? 132 GLU A N   1 
ATOM   1032 C CA  . GLU A 1 130 ? 17.687 51.080 30.594 1.00 28.21 ? 132 GLU A CA  1 
ATOM   1033 C C   . GLU A 1 130 ? 18.770 50.944 29.529 1.00 28.64 ? 132 GLU A C   1 
ATOM   1034 O O   . GLU A 1 130 ? 18.666 50.112 28.629 1.00 26.73 ? 132 GLU A O   1 
ATOM   1035 C CB  . GLU A 1 130 ? 16.678 52.154 30.194 1.00 26.33 ? 132 GLU A CB  1 
ATOM   1036 N N   . ASP A 1 131 ? 19.827 51.776 29.643 1.00 29.35 ? 133 ASP A N   1 
ATOM   1037 C CA  . ASP A 1 131 ? 20.918 51.749 28.677 1.00 30.36 ? 133 ASP A CA  1 
ATOM   1038 C C   . ASP A 1 131 ? 22.205 51.168 29.252 1.00 30.95 ? 133 ASP A C   1 
ATOM   1039 O O   . ASP A 1 131 ? 23.277 51.378 28.698 1.00 31.70 ? 133 ASP A O   1 
ATOM   1040 C CB  . ASP A 1 131 ? 21.183 53.151 28.159 1.00 30.55 ? 133 ASP A CB  1 
ATOM   1041 N N   . GLY A 1 132 ? 22.114 50.430 30.369 1.00 29.66 ? 134 GLY A N   1 
ATOM   1042 C CA  . GLY A 1 132 ? 23.324 49.872 30.929 1.00 28.20 ? 134 GLY A CA  1 
ATOM   1043 C C   . GLY A 1 132 ? 23.909 48.797 30.029 1.00 27.84 ? 134 GLY A C   1 
ATOM   1044 O O   . GLY A 1 132 ? 23.505 48.633 28.881 1.00 27.47 ? 134 GLY A O   1 
ATOM   1045 N N   . ASN A 1 133 ? 24.893 48.055 30.563 1.00 26.90 ? 135 ASN A N   1 
ATOM   1046 C CA  . ASN A 1 133 ? 25.523 46.987 29.813 1.00 24.76 ? 135 ASN A CA  1 
ATOM   1047 C C   . ASN A 1 133 ? 24.610 45.763 29.719 1.00 23.71 ? 135 ASN A C   1 
ATOM   1048 O O   . ASN A 1 133 ? 24.788 44.937 28.829 1.00 24.25 ? 135 ASN A O   1 
ATOM   1049 C CB  . ASN A 1 133 ? 26.826 46.551 30.466 1.00 25.02 ? 135 ASN A CB  1 
ATOM   1050 C CG  . ASN A 1 133 ? 27.920 47.577 30.330 1.00 24.69 ? 135 ASN A CG  1 
ATOM   1051 O OD1 . ASN A 1 133 ? 28.234 48.026 29.226 1.00 24.92 ? 135 ASN A OD1 1 
ATOM   1052 N ND2 . ASN A 1 133 ? 28.514 47.959 31.458 1.00 23.75 ? 135 ASN A ND2 1 
ATOM   1053 N N   . ILE A 1 134 ? 23.623 45.636 30.647 1.00 21.51 ? 136 ILE A N   1 
ATOM   1054 C CA  . ILE A 1 134 ? 22.722 44.492 30.614 1.00 20.25 ? 136 ILE A CA  1 
ATOM   1055 C C   . ILE A 1 134 ? 21.513 44.758 29.720 1.00 19.79 ? 136 ILE A C   1 
ATOM   1056 O O   . ILE A 1 134 ? 21.372 44.137 28.666 1.00 19.01 ? 136 ILE A O   1 
ATOM   1057 C CB  . ILE A 1 134 ? 22.208 44.092 32.024 1.00 19.26 ? 136 ILE A CB  1 
ATOM   1058 C CG1 . ILE A 1 134 ? 23.390 43.681 32.914 1.00 18.56 ? 136 ILE A CG1 1 
ATOM   1059 C CG2 . ILE A 1 134 ? 21.173 42.963 31.903 1.00 17.60 ? 136 ILE A CG2 1 
ATOM   1060 C CD1 . ILE A 1 134 ? 24.268 44.844 33.341 1.00 17.60 ? 136 ILE A CD1 1 
ATOM   1061 N N   . LEU A 1 135 ? 20.637 45.682 30.130 1.00 18.54 ? 137 LEU A N   1 
ATOM   1062 C CA  . LEU A 1 135 ? 19.477 45.980 29.304 1.00 19.59 ? 137 LEU A CA  1 
ATOM   1063 C C   . LEU A 1 135 ? 19.906 46.547 27.950 1.00 20.79 ? 137 LEU A C   1 
ATOM   1064 O O   . LEU A 1 135 ? 19.106 46.631 27.017 1.00 20.22 ? 137 LEU A O   1 
ATOM   1065 C CB  . LEU A 1 135 ? 18.541 46.963 30.006 1.00 18.96 ? 137 LEU A CB  1 
ATOM   1066 C CG  . LEU A 1 135 ? 17.872 46.388 31.257 1.00 19.89 ? 137 LEU A CG  1 
ATOM   1067 C CD1 . LEU A 1 135 ? 17.066 47.453 32.004 1.00 17.60 ? 137 LEU A CD1 1 
ATOM   1068 C CD2 . LEU A 1 135 ? 16.999 45.217 30.814 1.00 18.65 ? 137 LEU A CD2 1 
ATOM   1069 N N   . GLY A 1 136 ? 21.195 46.928 27.833 1.00 21.02 ? 138 GLY A N   1 
ATOM   1070 C CA  . GLY A 1 136 ? 21.663 47.486 26.581 1.00 21.46 ? 138 GLY A CA  1 
ATOM   1071 C C   . GLY A 1 136 ? 22.316 46.452 25.695 1.00 23.04 ? 138 GLY A C   1 
ATOM   1072 O O   . GLY A 1 136 ? 22.684 46.738 24.548 1.00 23.36 ? 138 GLY A O   1 
ATOM   1073 N N   . HIS A 1 137 ? 22.468 45.217 26.236 1.00 23.52 ? 139 HIS A N   1 
ATOM   1074 C CA  . HIS A 1 137 ? 23.089 44.142 25.484 1.00 22.96 ? 139 HIS A CA  1 
ATOM   1075 C C   . HIS A 1 137 ? 24.444 44.589 24.962 1.00 24.06 ? 139 HIS A C   1 
ATOM   1076 O O   . HIS A 1 137 ? 24.599 44.813 23.766 1.00 24.13 ? 139 HIS A O   1 
ATOM   1077 C CB  . HIS A 1 137 ? 22.194 43.752 24.312 1.00 21.13 ? 139 HIS A CB  1 
ATOM   1078 C CG  . HIS A 1 137 ? 20.991 42.961 24.714 1.00 20.66 ? 139 HIS A CG  1 
ATOM   1079 N ND1 . HIS A 1 137 ? 21.074 41.647 25.123 1.00 20.60 ? 139 HIS A ND1 1 
ATOM   1080 C CD2 . HIS A 1 137 ? 19.686 43.305 24.818 1.00 18.43 ? 139 HIS A CD2 1 
ATOM   1081 C CE1 . HIS A 1 137 ? 19.874 41.217 25.466 1.00 18.59 ? 139 HIS A CE1 1 
ATOM   1082 N NE2 . HIS A 1 137 ? 19.014 42.203 25.290 1.00 18.13 ? 139 HIS A NE2 1 
ATOM   1083 N N   . LYS A 1 138 ? 25.436 44.723 25.871 1.00 24.84 ? 140 LYS A N   1 
ATOM   1084 C CA  . LYS A 1 138 ? 26.777 45.157 25.477 1.00 26.88 ? 140 LYS A CA  1 
ATOM   1085 C C   . LYS A 1 138 ? 27.831 44.195 25.994 1.00 27.45 ? 140 LYS A C   1 
ATOM   1086 O O   . LYS A 1 138 ? 29.036 44.420 25.834 1.00 26.45 ? 140 LYS A O   1 
ATOM   1087 C CB  . LYS A 1 138 ? 27.054 46.554 26.014 1.00 26.89 ? 140 LYS A CB  1 
ATOM   1088 C CG  . LYS A 1 138 ? 26.053 47.561 25.537 1.00 27.06 ? 140 LYS A CG  1 
ATOM   1089 C CD  . LYS A 1 138 ? 26.235 48.852 26.261 1.00 27.96 ? 140 LYS A CD  1 
ATOM   1090 C CE  . LYS A 1 138 ? 25.133 49.811 25.941 1.00 27.72 ? 140 LYS A CE  1 
ATOM   1091 N NZ  . LYS A 1 138 ? 25.403 51.034 26.701 1.00 30.77 ? 140 LYS A NZ  1 
ATOM   1092 N N   . LEU A 1 139 ? 27.357 43.101 26.608 1.00 26.90 ? 141 LEU A N   1 
ATOM   1093 C CA  . LEU A 1 139 ? 28.245 42.094 27.162 1.00 27.50 ? 141 LEU A CA  1 
ATOM   1094 C C   . LEU A 1 139 ? 28.599 41.005 26.161 1.00 28.59 ? 141 LEU A C   1 
ATOM   1095 O O   . LEU A 1 139 ? 27.717 40.454 25.515 1.00 28.83 ? 141 LEU A O   1 
ATOM   1096 C CB  . LEU A 1 139 ? 27.575 41.479 28.371 1.00 26.75 ? 141 LEU A CB  1 
ATOM   1097 C CG  . LEU A 1 139 ? 27.129 42.485 29.428 1.00 25.06 ? 141 LEU A CG  1 
ATOM   1098 C CD1 . LEU A 1 139 ? 26.424 41.699 30.502 1.00 27.23 ? 141 LEU A CD1 1 
ATOM   1099 C CD2 . LEU A 1 139 ? 28.309 43.259 29.994 1.00 23.38 ? 141 LEU A CD2 1 
ATOM   1100 N N   . GLU A 1 140 ? 29.907 40.678 26.048 1.00 31.11 ? 142 GLU A N   1 
ATOM   1101 C CA  . GLU A 1 140 ? 30.362 39.648 25.112 1.00 33.61 ? 142 GLU A CA  1 
ATOM   1102 C C   . GLU A 1 140 ? 29.866 38.254 25.456 1.00 34.07 ? 142 GLU A C   1 
ATOM   1103 O O   . GLU A 1 140 ? 29.727 37.888 26.621 1.00 34.68 ? 142 GLU A O   1 
ATOM   1104 C CB  . GLU A 1 140 ? 31.891 39.622 25.020 1.00 36.02 ? 142 GLU A CB  1 
ATOM   1105 C CG  . GLU A 1 140 ? 32.482 40.778 24.223 1.00 39.50 ? 142 GLU A CG  1 
ATOM   1106 C CD  . GLU A 1 140 ? 34.001 40.851 24.304 1.00 42.06 ? 142 GLU A CD  1 
ATOM   1107 O OE1 . GLU A 1 140 ? 34.574 41.790 23.710 1.00 43.45 ? 142 GLU A OE1 1 
ATOM   1108 O OE2 . GLU A 1 140 ? 34.618 39.988 24.970 1.00 42.96 ? 142 GLU A OE2 1 
ATOM   1109 N N   . TYR A 1 141 ? 29.605 37.476 24.406 1.00 35.05 ? 143 TYR A N   1 
ATOM   1110 C CA  . TYR A 1 141 ? 29.111 36.120 24.529 1.00 36.06 ? 143 TYR A CA  1 
ATOM   1111 C C   . TYR A 1 141 ? 30.248 35.169 24.174 1.00 37.68 ? 143 TYR A C   1 
ATOM   1112 O O   . TYR A 1 141 ? 30.419 34.791 23.016 1.00 38.23 ? 143 TYR A O   1 
ATOM   1113 C CB  . TYR A 1 141 ? 27.959 35.942 23.557 1.00 33.77 ? 143 TYR A CB  1 
ATOM   1114 C CG  . TYR A 1 141 ? 27.247 34.627 23.622 1.00 31.51 ? 143 TYR A CG  1 
ATOM   1115 C CD1 . TYR A 1 141 ? 26.252 34.403 24.571 1.00 31.74 ? 143 TYR A CD1 1 
ATOM   1116 C CD2 . TYR A 1 141 ? 27.484 33.643 22.664 1.00 29.78 ? 143 TYR A CD2 1 
ATOM   1117 C CE1 . TYR A 1 141 ? 25.498 33.237 24.551 1.00 30.89 ? 143 TYR A CE1 1 
ATOM   1118 C CE2 . TYR A 1 141 ? 26.738 32.476 22.639 1.00 29.40 ? 143 TYR A CE2 1 
ATOM   1119 C CZ  . TYR A 1 141 ? 25.740 32.282 23.582 1.00 29.62 ? 143 TYR A CZ  1 
ATOM   1120 O OH  . TYR A 1 141 ? 24.944 31.167 23.524 1.00 27.14 ? 143 TYR A OH  1 
ATOM   1121 N N   . ASN A 1 142 ? 31.039 34.772 25.181 1.00 40.03 ? 144 ASN A N   1 
ATOM   1122 C CA  . ASN A 1 142 ? 32.159 33.898 24.901 1.00 43.34 ? 144 ASN A CA  1 
ATOM   1123 C C   . ASN A 1 142 ? 32.528 32.868 25.958 1.00 45.69 ? 144 ASN A C   1 
ATOM   1124 O O   . ASN A 1 142 ? 32.223 31.679 25.821 1.00 47.36 ? 144 ASN A O   1 
ATOM   1125 C CB  . ASN A 1 142 ? 33.398 34.746 24.602 1.00 44.75 ? 144 ASN A CB  1 
ATOM   1126 C CG  . ASN A 1 142 ? 33.457 36.020 25.431 1.00 45.85 ? 144 ASN A CG  1 
ATOM   1127 O OD1 . ASN A 1 142 ? 33.213 36.007 26.638 1.00 46.52 ? 144 ASN A OD1 1 
ATOM   1128 N ND2 . ASN A 1 142 ? 33.795 37.129 24.781 1.00 44.88 ? 144 ASN A ND2 1 
ATOM   1129 N N   . TYR A 1 143 ? 33.201 33.330 27.019 1.00 45.98 ? 145 TYR A N   1 
ATOM   1130 C CA  . TYR A 1 143 ? 33.630 32.412 28.051 1.00 45.76 ? 145 TYR A CA  1 
ATOM   1131 C C   . TYR A 1 143 ? 33.574 33.004 29.445 1.00 43.87 ? 145 TYR A C   1 
ATOM   1132 O O   . TYR A 1 143 ? 33.923 34.164 29.675 1.00 44.04 ? 145 TYR A O   1 
ATOM   1133 C CB  . TYR A 1 143 ? 35.053 31.952 27.737 1.00 49.11 ? 145 TYR A CB  1 
ATOM   1134 C CG  . TYR A 1 143 ? 35.467 30.662 28.397 1.00 52.90 ? 145 TYR A CG  1 
ATOM   1135 C CD1 . TYR A 1 143 ? 34.974 29.431 27.953 1.00 54.54 ? 145 TYR A CD1 1 
ATOM   1136 C CD2 . TYR A 1 143 ? 36.389 30.665 29.441 1.00 54.54 ? 145 TYR A CD2 1 
ATOM   1137 C CE1 . TYR A 1 143 ? 35.401 28.228 28.537 1.00 56.11 ? 145 TYR A CE1 1 
ATOM   1138 C CE2 . TYR A 1 143 ? 36.821 29.478 30.029 1.00 56.01 ? 145 TYR A CE2 1 
ATOM   1139 C CZ  . TYR A 1 143 ? 36.327 28.267 29.572 1.00 56.95 ? 145 TYR A CZ  1 
ATOM   1140 O OH  . TYR A 1 143 ? 36.787 27.108 30.148 1.00 59.08 ? 145 TYR A OH  1 
ATOM   1141 N N   . ILE A 1 144 ? 33.125 32.178 30.387 1.00 41.25 ? 146 ILE A N   1 
ATOM   1142 C CA  . ILE A 1 144 ? 33.047 32.597 31.779 1.00 38.47 ? 146 ILE A CA  1 
ATOM   1143 C C   . ILE A 1 144 ? 33.812 31.584 32.617 1.00 37.51 ? 146 ILE A C   1 
ATOM   1144 O O   . ILE A 1 144 ? 33.618 30.377 32.479 1.00 36.50 ? 146 ILE A O   1 
ATOM   1145 C CB  . ILE A 1 144 ? 31.586 32.668 32.255 1.00 35.91 ? 146 ILE A CB  1 
ATOM   1146 C CG1 . ILE A 1 144 ? 30.833 33.734 31.461 1.00 33.05 ? 146 ILE A CG1 1 
ATOM   1147 C CG2 . ILE A 1 144 ? 31.529 33.012 33.733 1.00 34.56 ? 146 ILE A CG2 1 
ATOM   1148 C CD1 . ILE A 1 144 ? 29.364 33.800 31.793 1.00 33.02 ? 146 ILE A CD1 1 
ATOM   1149 N N   . SER A 1 145 ? 34.712 32.087 33.480 1.00 36.59 ? 147 SER A N   1 
ATOM   1150 C CA  . SER A 1 145 ? 35.501 31.197 34.327 1.00 36.19 ? 147 SER A CA  1 
ATOM   1151 C C   . SER A 1 145 ? 36.025 31.875 35.600 1.00 34.81 ? 147 SER A C   1 
ATOM   1152 O O   . SER A 1 145 ? 36.887 32.747 35.549 1.00 34.78 ? 147 SER A O   1 
ATOM   1153 C CB  . SER A 1 145 ? 36.658 30.608 33.507 1.00 36.03 ? 147 SER A CB  1 
ATOM   1154 O OG  . SER A 1 145 ? 37.838 30.456 34.273 1.00 35.30 ? 147 SER A OG  1 
ATOM   1155 N N   . HIS A 1 146 ? 35.476 31.466 36.766 1.00 34.30 ? 148 HIS A N   1 
ATOM   1156 C CA  . HIS A 1 146 ? 35.894 32.025 38.058 1.00 33.77 ? 148 HIS A CA  1 
ATOM   1157 C C   . HIS A 1 146 ? 35.863 30.942 39.144 1.00 31.96 ? 148 HIS A C   1 
ATOM   1158 O O   . HIS A 1 146 ? 35.521 29.792 38.870 1.00 31.14 ? 148 HIS A O   1 
ATOM   1159 C CB  . HIS A 1 146 ? 34.975 33.184 38.456 1.00 36.01 ? 148 HIS A CB  1 
ATOM   1160 C CG  . HIS A 1 146 ? 35.003 34.334 37.498 1.00 37.31 ? 148 HIS A CG  1 
ATOM   1161 N ND1 . HIS A 1 146 ? 36.076 35.190 37.392 1.00 38.25 ? 148 HIS A ND1 1 
ATOM   1162 C CD2 . HIS A 1 146 ? 34.100 34.755 36.582 1.00 38.78 ? 148 HIS A CD2 1 
ATOM   1163 C CE1 . HIS A 1 146 ? 35.835 36.087 36.454 1.00 38.44 ? 148 HIS A CE1 1 
ATOM   1164 N NE2 . HIS A 1 146 ? 34.642 35.844 35.945 1.00 39.11 ? 148 HIS A NE2 1 
ATOM   1165 N N   . ASN A 1 147 ? 36.256 31.298 40.383 1.00 29.44 ? 149 ASN A N   1 
ATOM   1166 C CA  . ASN A 1 147 ? 36.216 30.315 41.460 1.00 26.77 ? 149 ASN A CA  1 
ATOM   1167 C C   . ASN A 1 147 ? 35.068 30.625 42.386 1.00 25.66 ? 149 ASN A C   1 
ATOM   1168 O O   . ASN A 1 147 ? 34.845 31.778 42.746 1.00 25.52 ? 149 ASN A O   1 
ATOM   1169 C CB  . ASN A 1 147 ? 37.483 30.309 42.306 1.00 26.62 ? 149 ASN A CB  1 
ATOM   1170 C CG  . ASN A 1 147 ? 38.665 29.719 41.594 1.00 25.27 ? 149 ASN A CG  1 
ATOM   1171 O OD1 . ASN A 1 147 ? 38.531 28.798 40.786 1.00 25.23 ? 149 ASN A OD1 1 
ATOM   1172 N ND2 . ASN A 1 147 ? 39.848 30.229 41.909 1.00 23.30 ? 149 ASN A ND2 1 
ATOM   1173 N N   . VAL A 1 148 ? 34.355 29.580 42.792 1.00 24.79 ? 150 VAL A N   1 
ATOM   1174 C CA  . VAL A 1 148 ? 33.224 29.719 43.691 1.00 24.54 ? 150 VAL A CA  1 
ATOM   1175 C C   . VAL A 1 148 ? 33.711 29.370 45.089 1.00 24.26 ? 150 VAL A C   1 
ATOM   1176 O O   . VAL A 1 148 ? 33.950 28.210 45.382 1.00 24.96 ? 150 VAL A O   1 
ATOM   1177 C CB  . VAL A 1 148 ? 32.113 28.757 43.283 1.00 24.37 ? 150 VAL A CB  1 
ATOM   1178 C CG1 . VAL A 1 148 ? 30.843 29.077 44.024 1.00 23.85 ? 150 VAL A CG1 1 
ATOM   1179 C CG2 . VAL A 1 148 ? 31.915 28.831 41.787 1.00 23.01 ? 150 VAL A CG2 1 
ATOM   1180 N N   . TYR A 1 149 ? 33.867 30.377 45.963 1.00 24.24 ? 151 TYR A N   1 
ATOM   1181 C CA  . TYR A 1 149 ? 34.348 30.102 47.317 1.00 24.74 ? 151 TYR A CA  1 
ATOM   1182 C C   . TYR A 1 149 ? 33.225 29.743 48.270 1.00 24.46 ? 151 TYR A C   1 
ATOM   1183 O O   . TYR A 1 149 ? 32.366 30.555 48.554 1.00 25.53 ? 151 TYR A O   1 
ATOM   1184 C CB  . TYR A 1 149 ? 35.140 31.295 47.838 1.00 25.16 ? 151 TYR A CB  1 
ATOM   1185 C CG  . TYR A 1 149 ? 36.342 31.575 46.973 1.00 27.50 ? 151 TYR A CG  1 
ATOM   1186 C CD1 . TYR A 1 149 ? 36.221 32.309 45.792 1.00 27.83 ? 151 TYR A CD1 1 
ATOM   1187 C CD2 . TYR A 1 149 ? 37.591 31.054 47.298 1.00 27.76 ? 151 TYR A CD2 1 
ATOM   1188 C CE1 . TYR A 1 149 ? 37.319 32.516 44.955 1.00 27.25 ? 151 TYR A CE1 1 
ATOM   1189 C CE2 . TYR A 1 149 ? 38.691 31.252 46.474 1.00 28.29 ? 151 TYR A CE2 1 
ATOM   1190 C CZ  . TYR A 1 149 ? 38.554 31.982 45.305 1.00 27.61 ? 151 TYR A CZ  1 
ATOM   1191 O OH  . TYR A 1 149 ? 39.650 32.183 44.497 1.00 27.15 ? 151 TYR A OH  1 
ATOM   1192 N N   . ILE A 1 150 ? 33.251 28.507 48.780 1.00 24.42 ? 152 ILE A N   1 
ATOM   1193 C CA  . ILE A 1 150 ? 32.201 28.042 49.666 1.00 25.18 ? 152 ILE A CA  1 
ATOM   1194 C C   . ILE A 1 150 ? 32.571 28.037 51.150 1.00 25.69 ? 152 ILE A C   1 
ATOM   1195 O O   . ILE A 1 150 ? 33.735 27.875 51.497 1.00 27.69 ? 152 ILE A O   1 
ATOM   1196 C CB  . ILE A 1 150 ? 31.755 26.631 49.226 1.00 25.99 ? 152 ILE A CB  1 
ATOM   1197 C CG1 . ILE A 1 150 ? 31.382 26.670 47.742 1.00 24.76 ? 152 ILE A CG1 1 
ATOM   1198 C CG2 . ILE A 1 150 ? 30.593 26.145 50.088 1.00 26.48 ? 152 ILE A CG2 1 
ATOM   1199 C CD1 . ILE A 1 150 ? 31.026 25.331 47.149 1.00 22.34 ? 152 ILE A CD1 1 
ATOM   1200 N N   . THR A 1 151 ? 31.565 28.253 52.027 1.00 26.05 ? 153 THR A N   1 
ATOM   1201 C CA  . THR A 1 151 ? 31.766 28.251 53.477 1.00 27.92 ? 153 THR A CA  1 
ATOM   1202 C C   . THR A 1 151 ? 30.550 27.589 54.104 1.00 27.72 ? 153 THR A C   1 
ATOM   1203 O O   . THR A 1 151 ? 29.446 27.701 53.574 1.00 27.72 ? 153 THR A O   1 
ATOM   1204 C CB  . THR A 1 151 ? 31.874 29.674 54.064 1.00 29.46 ? 153 THR A CB  1 
ATOM   1205 O OG1 . THR A 1 151 ? 32.802 30.449 53.290 1.00 33.61 ? 153 THR A OG1 1 
ATOM   1206 C CG2 . THR A 1 151 ? 32.375 29.609 55.511 1.00 29.46 ? 153 THR A CG2 1 
ATOM   1207 N N   . ALA A 1 152 ? 30.742 26.883 55.249 1.00 28.39 ? 154 ALA A N   1 
ATOM   1208 C CA  . ALA A 1 152 ? 29.626 26.210 55.919 1.00 27.66 ? 154 ALA A CA  1 
ATOM   1209 C C   . ALA A 1 152 ? 28.706 27.197 56.617 1.00 28.85 ? 154 ALA A C   1 
ATOM   1210 O O   . ALA A 1 152 ? 29.128 28.260 57.060 1.00 28.48 ? 154 ALA A O   1 
ATOM   1211 C CB  . ALA A 1 152 ? 30.152 25.178 56.916 1.00 26.02 ? 154 ALA A CB  1 
ATOM   1212 N N   . ASP A 1 153 ? 27.429 26.839 56.710 1.00 31.42 ? 155 ASP A N   1 
ATOM   1213 C CA  . ASP A 1 153 ? 26.446 27.690 57.355 1.00 32.15 ? 155 ASP A CA  1 
ATOM   1214 C C   . ASP A 1 153 ? 25.675 26.744 58.270 1.00 32.10 ? 155 ASP A C   1 
ATOM   1215 O O   . ASP A 1 153 ? 24.606 26.247 57.906 1.00 31.05 ? 155 ASP A O   1 
ATOM   1216 C CB  . ASP A 1 153 ? 25.532 28.305 56.290 1.00 33.62 ? 155 ASP A CB  1 
ATOM   1217 C CG  . ASP A 1 153 ? 24.713 29.477 56.814 1.00 35.51 ? 155 ASP A CG  1 
ATOM   1218 O OD1 . ASP A 1 153 ? 24.786 29.784 58.025 1.00 36.13 ? 155 ASP A OD1 1 
ATOM   1219 O OD2 . ASP A 1 153 ? 23.973 30.082 56.005 1.00 35.16 ? 155 ASP A OD2 1 
ATOM   1220 N N   . LYS A 1 154 ? 26.272 26.471 59.463 1.00 33.08 ? 156 LYS A N   1 
ATOM   1221 C CA  . LYS A 1 154 ? 25.696 25.561 60.454 1.00 32.75 ? 156 LYS A CA  1 
ATOM   1222 C C   . LYS A 1 154 ? 24.335 26.023 60.968 1.00 32.76 ? 156 LYS A C   1 
ATOM   1223 O O   . LYS A 1 154 ? 23.503 25.199 61.337 1.00 31.76 ? 156 LYS A O   1 
ATOM   1224 C CB  . LYS A 1 154 ? 26.676 25.367 61.626 1.00 33.67 ? 156 LYS A CB  1 
ATOM   1225 N N   . GLN A 1 155 ? 24.113 27.370 60.993 1.00 33.05 ? 157 GLN A N   1 
ATOM   1226 C CA  . GLN A 1 155 ? 22.838 27.945 61.432 1.00 32.85 ? 157 GLN A CA  1 
ATOM   1227 C C   . GLN A 1 155 ? 21.725 27.413 60.538 1.00 32.21 ? 157 GLN A C   1 
ATOM   1228 O O   . GLN A 1 155 ? 20.803 26.746 61.011 1.00 32.65 ? 157 GLN A O   1 
ATOM   1229 C CB  . GLN A 1 155 ? 22.884 29.471 61.348 1.00 35.02 ? 157 GLN A CB  1 
ATOM   1230 N N   . LYS A 1 156 ? 21.803 27.710 59.223 1.00 31.68 ? 158 LYS A N   1 
ATOM   1231 C CA  . LYS A 1 156 ? 20.790 27.234 58.282 1.00 31.99 ? 158 LYS A CA  1 
ATOM   1232 C C   . LYS A 1 156 ? 21.058 25.786 57.860 1.00 32.44 ? 158 LYS A C   1 
ATOM   1233 O O   . LYS A 1 156 ? 20.379 25.251 56.978 1.00 33.61 ? 158 LYS A O   1 
ATOM   1234 C CB  . LYS A 1 156 ? 20.724 28.157 57.052 1.00 30.72 ? 158 LYS A CB  1 
ATOM   1235 N N   . ASN A 1 157 ? 22.063 25.142 58.505 1.00 31.61 ? 159 ASN A N   1 
ATOM   1236 C CA  . ASN A 1 157 ? 22.411 23.756 58.200 1.00 31.42 ? 159 ASN A CA  1 
ATOM   1237 C C   . ASN A 1 157 ? 22.674 23.581 56.708 1.00 30.28 ? 159 ASN A C   1 
ATOM   1238 O O   . ASN A 1 157 ? 22.251 22.600 56.093 1.00 30.81 ? 159 ASN A O   1 
ATOM   1239 C CB  . ASN A 1 157 ? 21.277 22.829 58.644 1.00 33.28 ? 159 ASN A CB  1 
ATOM   1240 C CG  . ASN A 1 157 ? 21.619 21.363 58.481 1.00 35.06 ? 159 ASN A CG  1 
ATOM   1241 O OD1 . ASN A 1 157 ? 22.578 20.868 59.075 1.00 36.95 ? 159 ASN A OD1 1 
ATOM   1242 N ND2 . ASN A 1 157 ? 20.834 20.657 57.673 1.00 35.71 ? 159 ASN A ND2 1 
ATOM   1243 N N   . GLY A 1 158 ? 23.383 24.556 56.124 1.00 28.36 ? 160 GLY A N   1 
ATOM   1244 C CA  . GLY A 1 158 ? 23.698 24.496 54.712 1.00 25.70 ? 160 GLY A CA  1 
ATOM   1245 C C   . GLY A 1 158 ? 25.072 25.066 54.439 1.00 23.86 ? 160 GLY A C   1 
ATOM   1246 O O   . GLY A 1 158 ? 26.044 24.704 55.102 1.00 23.13 ? 160 GLY A O   1 
ATOM   1247 N N   . ILE A 1 159 ? 25.138 25.984 53.444 1.00 22.57 ? 161 ILE A N   1 
ATOM   1248 C CA  . ILE A 1 159 ? 26.388 26.631 53.028 1.00 20.93 ? 161 ILE A CA  1 
ATOM   1249 C C   . ILE A 1 159 ? 26.141 28.056 52.531 1.00 19.83 ? 161 ILE A C   1 
ATOM   1250 O O   . ILE A 1 159 ? 25.014 28.471 52.298 1.00 19.53 ? 161 ILE A O   1 
ATOM   1251 C CB  . ILE A 1 159 ? 27.055 25.891 51.849 1.00 21.43 ? 161 ILE A CB  1 
ATOM   1252 C CG1 . ILE A 1 159 ? 26.046 25.751 50.708 1.00 22.44 ? 161 ILE A CG1 1 
ATOM   1253 C CG2 . ILE A 1 159 ? 27.582 24.529 52.303 1.00 19.85 ? 161 ILE A CG2 1 
ATOM   1254 C CD1 . ILE A 1 159 ? 26.654 25.534 49.349 1.00 21.72 ? 161 ILE A CD1 1 
ATOM   1255 N N   . LYS A 1 160 ? 27.236 28.792 52.348 1.00 20.05 ? 162 LYS A N   1 
ATOM   1256 C CA  . LYS A 1 160 ? 27.214 30.164 51.844 1.00 21.52 ? 162 LYS A CA  1 
ATOM   1257 C C   . LYS A 1 160 ? 28.385 30.257 50.881 1.00 21.46 ? 162 LYS A C   1 
ATOM   1258 O O   . LYS A 1 160 ? 29.419 29.641 51.108 1.00 23.38 ? 162 LYS A O   1 
ATOM   1259 C CB  . LYS A 1 160 ? 27.424 31.179 52.972 1.00 21.19 ? 162 LYS A CB  1 
ATOM   1260 C CG  . LYS A 1 160 ? 26.153 31.769 53.542 1.00 22.60 ? 162 LYS A CG  1 
ATOM   1261 C CD  . LYS A 1 160 ? 26.465 32.814 54.600 1.00 23.39 ? 162 LYS A CD  1 
ATOM   1262 C CE  . LYS A 1 160 ? 25.196 33.503 55.115 1.00 24.98 ? 162 LYS A CE  1 
ATOM   1263 N NZ  . LYS A 1 160 ? 24.374 32.671 56.045 1.00 25.63 ? 162 LYS A NZ  1 
ATOM   1264 N N   . ALA A 1 161 ? 28.238 31.008 49.790 1.00 20.87 ? 163 ALA A N   1 
ATOM   1265 C CA  . ALA A 1 161 ? 29.342 31.145 48.849 1.00 20.69 ? 163 ALA A CA  1 
ATOM   1266 C C   . ALA A 1 161 ? 29.289 32.496 48.198 1.00 21.33 ? 163 ALA A C   1 
ATOM   1267 O O   . ALA A 1 161 ? 28.211 33.063 48.031 1.00 21.82 ? 163 ALA A O   1 
ATOM   1268 C CB  . ALA A 1 161 ? 29.276 30.059 47.787 1.00 20.92 ? 163 ALA A CB  1 
ATOM   1269 N N   . ASN A 1 162 ? 30.455 33.035 47.840 1.00 22.57 ? 164 ASN A N   1 
ATOM   1270 C CA  . ASN A 1 162 ? 30.506 34.314 47.156 1.00 23.31 ? 164 ASN A CA  1 
ATOM   1271 C C   . ASN A 1 162 ? 31.653 34.314 46.161 1.00 22.77 ? 164 ASN A C   1 
ATOM   1272 O O   . ASN A 1 162 ? 32.678 33.666 46.374 1.00 21.23 ? 164 ASN A O   1 
ATOM   1273 C CB  . ASN A 1 162 ? 30.655 35.468 48.141 1.00 24.95 ? 164 ASN A CB  1 
ATOM   1274 C CG  . ASN A 1 162 ? 31.421 35.082 49.365 1.00 27.57 ? 164 ASN A CG  1 
ATOM   1275 O OD1 . ASN A 1 162 ? 30.839 34.650 50.358 1.00 30.42 ? 164 ASN A OD1 1 
ATOM   1276 N ND2 . ASN A 1 162 ? 32.738 35.212 49.301 1.00 30.76 ? 164 ASN A ND2 1 
ATOM   1277 N N   . PHE A 1 163 ? 31.450 35.040 45.042 1.00 23.57 ? 165 PHE A N   1 
ATOM   1278 C CA  . PHE A 1 163 ? 32.448 35.143 43.991 1.00 24.11 ? 165 PHE A CA  1 
ATOM   1279 C C   . PHE A 1 163 ? 32.173 36.297 43.034 1.00 24.99 ? 165 PHE A C   1 
ATOM   1280 O O   . PHE A 1 163 ? 31.082 36.856 43.001 1.00 26.48 ? 165 PHE A O   1 
ATOM   1281 C CB  . PHE A 1 163 ? 32.523 33.838 43.197 1.00 22.71 ? 165 PHE A CB  1 
ATOM   1282 C CG  . PHE A 1 163 ? 31.199 33.360 42.696 1.00 21.42 ? 165 PHE A CG  1 
ATOM   1283 C CD1 . PHE A 1 163 ? 30.282 32.784 43.563 1.00 19.88 ? 165 PHE A CD1 1 
ATOM   1284 C CD2 . PHE A 1 163 ? 30.847 33.527 41.360 1.00 21.12 ? 165 PHE A CD2 1 
ATOM   1285 C CE1 . PHE A 1 163 ? 29.030 32.380 43.116 1.00 21.81 ? 165 PHE A CE1 1 
ATOM   1286 C CE2 . PHE A 1 163 ? 29.594 33.129 40.899 1.00 20.61 ? 165 PHE A CE2 1 
ATOM   1287 C CZ  . PHE A 1 163 ? 28.686 32.556 41.777 1.00 20.65 ? 165 PHE A CZ  1 
ATOM   1288 N N   . LYS A 1 164 ? 33.177 36.661 42.238 1.00 26.45 ? 166 LYS A N   1 
ATOM   1289 C CA  . LYS A 1 164 ? 32.982 37.752 41.311 1.00 28.95 ? 166 LYS A CA  1 
ATOM   1290 C C   . LYS A 1 164 ? 33.013 37.265 39.871 1.00 29.37 ? 166 LYS A C   1 
ATOM   1291 O O   . LYS A 1 164 ? 33.947 36.581 39.444 1.00 29.02 ? 166 LYS A O   1 
ATOM   1292 C CB  . LYS A 1 164 ? 34.044 38.838 41.537 1.00 31.81 ? 166 LYS A CB  1 
ATOM   1293 C CG  . LYS A 1 164 ? 33.848 39.613 42.844 1.00 35.44 ? 166 LYS A CG  1 
ATOM   1294 C CD  . LYS A 1 164 ? 34.997 40.573 43.132 1.00 38.04 ? 166 LYS A CD  1 
ATOM   1295 C CE  . LYS A 1 164 ? 34.649 41.475 44.296 1.00 39.63 ? 166 LYS A CE  1 
ATOM   1296 N NZ  . LYS A 1 164 ? 34.014 40.671 45.382 1.00 39.90 ? 166 LYS A NZ  1 
ATOM   1297 N N   . ILE A 1 165 ? 31.950 37.586 39.117 1.00 28.26 ? 167 ILE A N   1 
ATOM   1298 C CA  . ILE A 1 165 ? 31.902 37.206 37.720 1.00 28.28 ? 167 ILE A CA  1 
ATOM   1299 C C   . ILE A 1 165 ? 32.230 38.469 36.935 1.00 28.57 ? 167 ILE A C   1 
ATOM   1300 O O   . ILE A 1 165 ? 31.558 39.489 37.089 1.00 27.20 ? 167 ILE A O   1 
ATOM   1301 C CB  . ILE A 1 165 ? 30.504 36.705 37.297 1.00 28.79 ? 167 ILE A CB  1 
ATOM   1302 C CG1 . ILE A 1 165 ? 30.173 35.356 37.963 1.00 28.24 ? 167 ILE A CG1 1 
ATOM   1303 C CG2 . ILE A 1 165 ? 30.459 36.590 35.784 1.00 28.02 ? 167 ILE A CG2 1 
ATOM   1304 C CD1 . ILE A 1 165 ? 30.893 34.146 37.393 1.00 27.08 ? 167 ILE A CD1 1 
ATOM   1305 N N   . ARG A 1 166 ? 33.292 38.406 36.093 1.00 30.86 ? 168 ARG A N   1 
ATOM   1306 C CA  . ARG A 1 166 ? 33.706 39.543 35.269 1.00 33.32 ? 168 ARG A CA  1 
ATOM   1307 C C   . ARG A 1 166 ? 33.309 39.305 33.819 1.00 32.88 ? 168 ARG A C   1 
ATOM   1308 O O   . ARG A 1 166 ? 33.990 38.577 33.075 1.00 32.79 ? 168 ARG A O   1 
ATOM   1309 C CB  . ARG A 1 166 ? 35.227 39.760 35.363 1.00 37.56 ? 168 ARG A CB  1 
ATOM   1310 C CG  . ARG A 1 166 ? 35.742 39.968 36.782 1.00 43.41 ? 168 ARG A CG  1 
ATOM   1311 C CD  . ARG A 1 166 ? 37.250 39.811 36.862 1.00 49.01 ? 168 ARG A CD  1 
ATOM   1312 N NE  . ARG A 1 166 ? 37.669 39.537 38.235 1.00 54.56 ? 168 ARG A NE  1 
ATOM   1313 C CZ  . ARG A 1 166 ? 38.896 39.089 38.593 1.00 57.40 ? 168 ARG A CZ  1 
ATOM   1314 N NH1 . ARG A 1 166 ? 39.827 38.868 37.673 1.00 58.53 ? 168 ARG A NH1 1 
ATOM   1315 N NH2 . ARG A 1 166 ? 39.166 38.856 39.873 1.00 59.15 ? 168 ARG A NH2 1 
ATOM   1316 N N   . HIS A 1 167 ? 32.168 39.926 33.444 1.00 31.74 ? 169 HIS A N   1 
ATOM   1317 C CA  . HIS A 1 167 ? 31.592 39.869 32.107 1.00 28.83 ? 169 HIS A CA  1 
ATOM   1318 C C   . HIS A 1 167 ? 32.257 40.948 31.271 1.00 27.36 ? 169 HIS A C   1 
ATOM   1319 O O   . HIS A 1 167 ? 32.163 42.126 31.590 1.00 26.92 ? 169 HIS A O   1 
ATOM   1320 C CB  . HIS A 1 167 ? 30.089 40.162 32.179 1.00 28.35 ? 169 HIS A CB  1 
ATOM   1321 C CG  . HIS A 1 167 ? 29.303 39.130 32.919 1.00 28.66 ? 169 HIS A CG  1 
ATOM   1322 N ND1 . HIS A 1 167 ? 29.148 37.841 32.457 1.00 28.00 ? 169 HIS A ND1 1 
ATOM   1323 C CD2 . HIS A 1 167 ? 28.616 39.198 34.081 1.00 28.66 ? 169 HIS A CD2 1 
ATOM   1324 C CE1 . HIS A 1 167 ? 28.395 37.161 33.300 1.00 28.65 ? 169 HIS A CE1 1 
ATOM   1325 N NE2 . HIS A 1 167 ? 28.061 37.961 34.296 1.00 30.05 ? 169 HIS A NE2 1 
ATOM   1326 N N   . ASN A 1 168 ? 32.932 40.532 30.194 1.00 27.10 ? 170 ASN A N   1 
ATOM   1327 C CA  . ASN A 1 168 ? 33.602 41.477 29.319 1.00 25.90 ? 170 ASN A CA  1 
ATOM   1328 C C   . ASN A 1 168 ? 32.603 42.197 28.434 1.00 22.93 ? 170 ASN A C   1 
ATOM   1329 O O   . ASN A 1 168 ? 31.723 41.596 27.829 1.00 20.86 ? 170 ASN A O   1 
ATOM   1330 C CB  . ASN A 1 168 ? 34.639 40.768 28.445 1.00 27.90 ? 170 ASN A CB  1 
ATOM   1331 C CG  . ASN A 1 168 ? 35.902 40.405 29.212 1.00 31.12 ? 170 ASN A CG  1 
ATOM   1332 O OD1 . ASN A 1 168 ? 35.964 39.384 29.903 1.00 32.62 ? 170 ASN A OD1 1 
ATOM   1333 N ND2 . ASN A 1 168 ? 36.919 41.267 29.108 1.00 30.75 ? 170 ASN A ND2 1 
ATOM   1334 N N   . ILE A 1 169 ? 32.734 43.505 28.376 1.00 22.12 ? 171 ILE A N   1 
ATOM   1335 C CA  . ILE A 1 169 ? 31.848 44.309 27.556 1.00 21.95 ? 171 ILE A CA  1 
ATOM   1336 C C   . ILE A 1 169 ? 32.451 44.337 26.161 1.00 23.34 ? 171 ILE A C   1 
ATOM   1337 O O   . ILE A 1 169 ? 33.617 43.985 25.977 1.00 23.37 ? 171 ILE A O   1 
ATOM   1338 C CB  . ILE A 1 169 ? 31.743 45.708 28.132 1.00 20.27 ? 171 ILE A CB  1 
ATOM   1339 C CG1 . ILE A 1 169 ? 31.267 45.594 29.579 1.00 18.38 ? 171 ILE A CG1 1 
ATOM   1340 C CG2 . ILE A 1 169 ? 30.775 46.547 27.328 1.00 20.55 ? 171 ILE A CG2 1 
ATOM   1341 C CD1 . ILE A 1 169 ? 31.460 46.852 30.361 1.00 19.41 ? 171 ILE A CD1 1 
ATOM   1342 N N   . GLU A 1 170 ? 31.645 44.742 25.168 1.00 25.39 ? 172 GLU A N   1 
ATOM   1343 C CA  . GLU A 1 170 ? 32.100 44.815 23.786 1.00 26.39 ? 172 GLU A CA  1 
ATOM   1344 C C   . GLU A 1 170 ? 33.224 45.833 23.566 1.00 25.21 ? 172 GLU A C   1 
ATOM   1345 O O   . GLU A 1 170 ? 34.136 45.593 22.775 1.00 24.10 ? 172 GLU A O   1 
ATOM   1346 C CB  . GLU A 1 170 ? 30.916 45.134 22.866 1.00 30.09 ? 172 GLU A CB  1 
ATOM   1347 C CG  . GLU A 1 170 ? 30.209 46.448 23.168 1.00 35.92 ? 172 GLU A CG  1 
ATOM   1348 C CD  . GLU A 1 170 ? 28.969 46.617 22.312 1.00 38.47 ? 172 GLU A CD  1 
ATOM   1349 O OE1 . GLU A 1 170 ? 28.080 45.736 22.384 1.00 38.63 ? 172 GLU A OE1 1 
ATOM   1350 O OE2 . GLU A 1 170 ? 28.885 47.620 21.568 1.00 39.64 ? 172 GLU A OE2 1 
ATOM   1351 N N   . ASP A 1 171 ? 33.162 46.977 24.287 1.00 25.19 ? 173 ASP A N   1 
ATOM   1352 C CA  . ASP A 1 171 ? 34.172 48.024 24.174 1.00 25.06 ? 173 ASP A CA  1 
ATOM   1353 C C   . ASP A 1 171 ? 35.498 47.629 24.840 1.00 25.55 ? 173 ASP A C   1 
ATOM   1354 O O   . ASP A 1 171 ? 36.393 48.464 25.005 1.00 26.42 ? 173 ASP A O   1 
ATOM   1355 C CB  . ASP A 1 171 ? 33.648 49.314 24.806 1.00 24.23 ? 173 ASP A CB  1 
ATOM   1356 C CG  . ASP A 1 171 ? 33.605 49.245 26.327 1.00 23.47 ? 173 ASP A CG  1 
ATOM   1357 O OD1 . ASP A 1 171 ? 33.812 48.143 26.883 1.00 21.13 ? 173 ASP A OD1 1 
ATOM   1358 O OD2 . ASP A 1 171 ? 33.380 50.299 26.961 1.00 21.57 ? 173 ASP A OD2 1 
ATOM   1359 N N   . GLY A 1 172 ? 35.605 46.332 25.230 1.00 26.27 ? 174 GLY A N   1 
ATOM   1360 C CA  . GLY A 1 172 ? 36.800 45.803 25.871 1.00 26.13 ? 174 GLY A CA  1 
ATOM   1361 C C   . GLY A 1 172 ? 36.839 45.996 27.371 1.00 27.58 ? 174 GLY A C   1 
ATOM   1362 O O   . GLY A 1 172 ? 37.786 45.582 28.052 1.00 28.69 ? 174 GLY A O   1 
ATOM   1363 N N   . SER A 1 173 ? 35.779 46.623 27.919 1.00 27.33 ? 175 SER A N   1 
ATOM   1364 C CA  . SER A 1 173 ? 35.765 46.865 29.351 1.00 25.95 ? 175 SER A CA  1 
ATOM   1365 C C   . SER A 1 173 ? 35.326 45.648 30.135 1.00 25.56 ? 175 SER A C   1 
ATOM   1366 O O   . SER A 1 173 ? 35.357 44.529 29.627 1.00 25.15 ? 175 SER A O   1 
ATOM   1367 C CB  . SER A 1 173 ? 34.872 48.058 29.689 1.00 26.77 ? 175 SER A CB  1 
ATOM   1368 O OG  . SER A 1 173 ? 35.209 48.543 30.968 1.00 27.21 ? 175 SER A OG  1 
ATOM   1369 N N   . VAL A 1 174 ? 34.907 45.883 31.396 1.00 24.31 ? 176 VAL A N   1 
ATOM   1370 C CA  . VAL A 1 174 ? 34.482 44.792 32.257 1.00 23.12 ? 176 VAL A CA  1 
ATOM   1371 C C   . VAL A 1 174 ? 33.238 45.142 33.066 1.00 23.73 ? 176 VAL A C   1 
ATOM   1372 O O   . VAL A 1 174 ? 33.122 46.233 33.624 1.00 23.45 ? 176 VAL A O   1 
ATOM   1373 C CB  . VAL A 1 174 ? 35.604 44.389 33.265 1.00 23.27 ? 176 VAL A CB  1 
ATOM   1374 C CG1 . VAL A 1 174 ? 35.262 43.067 33.925 1.00 23.02 ? 176 VAL A CG1 1 
ATOM   1375 C CG2 . VAL A 1 174 ? 36.956 44.298 32.572 1.00 24.09 ? 176 VAL A CG2 1 
ATOM   1376 N N   . GLN A 1 175 ? 32.291 44.209 33.126 1.00 23.86 ? 177 GLN A N   1 
ATOM   1377 C CA  . GLN A 1 175 ? 31.104 44.446 33.913 1.00 24.08 ? 177 GLN A CA  1 
ATOM   1378 C C   . GLN A 1 175 ? 31.115 43.491 35.105 1.00 23.69 ? 177 GLN A C   1 
ATOM   1379 O O   . GLN A 1 175 ? 30.706 42.344 34.985 1.00 22.74 ? 177 GLN A O   1 
ATOM   1380 C CB  . GLN A 1 175 ? 29.850 44.228 33.064 1.00 23.63 ? 177 GLN A CB  1 
ATOM   1381 C CG  . GLN A 1 175 ? 28.562 44.240 33.866 1.00 25.07 ? 177 GLN A CG  1 
ATOM   1382 C CD  . GLN A 1 175 ? 28.393 45.508 34.702 1.00 26.35 ? 177 GLN A CD  1 
ATOM   1383 O OE1 . GLN A 1 175 ? 28.158 46.598 34.170 1.00 25.96 ? 177 GLN A OE1 1 
ATOM   1384 N NE2 . GLN A 1 175 ? 28.497 45.364 36.019 1.00 23.93 ? 177 GLN A NE2 1 
ATOM   1385 N N   . LEU A 1 176 ? 31.593 43.975 36.276 1.00 24.72 ? 178 LEU A N   1 
ATOM   1386 C CA  . LEU A 1 176 ? 31.664 43.132 37.472 1.00 26.81 ? 178 LEU A CA  1 
ATOM   1387 C C   . LEU A 1 176 ? 30.298 42.742 38.031 1.00 27.57 ? 178 LEU A C   1 
ATOM   1388 O O   . LEU A 1 176 ? 29.396 43.566 38.134 1.00 29.13 ? 178 LEU A O   1 
ATOM   1389 C CB  . LEU A 1 176 ? 32.471 43.828 38.571 1.00 27.78 ? 178 LEU A CB  1 
ATOM   1390 C CG  . LEU A 1 176 ? 32.522 43.122 39.932 1.00 30.17 ? 178 LEU A CG  1 
ATOM   1391 C CD1 . LEU A 1 176 ? 33.505 41.954 39.907 1.00 31.08 ? 178 LEU A CD1 1 
ATOM   1392 C CD2 . LEU A 1 176 ? 32.937 44.143 40.987 1.00 32.76 ? 178 LEU A CD2 1 
ATOM   1393 N N   . ALA A 1 177 ? 30.147 41.466 38.404 1.00 27.15 ? 179 ALA A N   1 
ATOM   1394 C CA  . ALA A 1 177 ? 28.888 41.015 38.965 1.00 27.32 ? 179 ALA A CA  1 
ATOM   1395 C C   . ALA A 1 177 ? 29.144 40.161 40.195 1.00 26.99 ? 179 ALA A C   1 
ATOM   1396 O O   . ALA A 1 177 ? 29.494 38.983 40.096 1.00 27.20 ? 179 ALA A O   1 
ATOM   1397 C CB  . ALA A 1 177 ? 28.090 40.243 37.930 1.00 28.78 ? 179 ALA A CB  1 
ATOM   1398 N N   . ASP A 1 178 ? 28.973 40.792 41.374 1.00 26.50 ? 180 ASP A N   1 
ATOM   1399 C CA  . ASP A 1 178 ? 29.180 40.133 42.658 1.00 27.14 ? 180 ASP A CA  1 
ATOM   1400 C C   . ASP A 1 178 ? 28.075 39.146 42.976 1.00 26.83 ? 180 ASP A C   1 
ATOM   1401 O O   . ASP A 1 178 ? 26.897 39.507 43.006 1.00 27.30 ? 180 ASP A O   1 
ATOM   1402 C CB  . ASP A 1 178 ? 29.226 41.163 43.782 1.00 28.56 ? 180 ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 178 ? 30.463 42.018 43.736 1.00 30.37 ? 180 ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 178 ? 31.567 41.482 43.978 1.00 29.34 ? 180 ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 178 ? 30.333 43.230 43.463 1.00 32.62 ? 180 ASP A OD2 1 
ATOM   1406 N N   . HIS A 1 179 ? 28.462 37.892 43.250 1.00 25.73 ? 181 HIS A N   1 
ATOM   1407 C CA  . HIS A 1 179 ? 27.483 36.872 43.588 1.00 24.72 ? 181 HIS A CA  1 
ATOM   1408 C C   . HIS A 1 179 ? 27.493 36.530 45.071 1.00 25.83 ? 181 HIS A C   1 
ATOM   1409 O O   . HIS A 1 179 ? 28.560 36.422 45.682 1.00 26.35 ? 181 HIS A O   1 
ATOM   1410 C CB  . HIS A 1 179 ? 27.754 35.598 42.812 1.00 23.17 ? 181 HIS A CB  1 
ATOM   1411 C CG  . HIS A 1 179 ? 27.416 35.680 41.361 1.00 24.90 ? 181 HIS A CG  1 
ATOM   1412 N ND1 . HIS A 1 179 ? 27.954 36.630 40.519 1.00 25.54 ? 181 HIS A ND1 1 
ATOM   1413 C CD2 . HIS A 1 179 ? 26.613 34.908 40.593 1.00 25.33 ? 181 HIS A CD2 1 
ATOM   1414 C CE1 . HIS A 1 179 ? 27.492 36.444 39.297 1.00 25.18 ? 181 HIS A CE1 1 
ATOM   1415 N NE2 . HIS A 1 179 ? 26.675 35.407 39.316 1.00 26.00 ? 181 HIS A NE2 1 
ATOM   1416 N N   . TYR A 1 180 ? 26.278 36.336 45.641 1.00 25.62 ? 182 TYR A N   1 
ATOM   1417 C CA  . TYR A 1 180 ? 26.107 35.948 47.036 1.00 26.10 ? 182 TYR A CA  1 
ATOM   1418 C C   . TYR A 1 180 ? 25.158 34.752 47.045 1.00 25.64 ? 182 TYR A C   1 
ATOM   1419 O O   . TYR A 1 180 ? 23.973 34.861 46.727 1.00 25.79 ? 182 TYR A O   1 
ATOM   1420 C CB  . TYR A 1 180 ? 25.570 37.111 47.856 1.00 26.80 ? 182 TYR A CB  1 
ATOM   1421 C CG  . TYR A 1 180 ? 26.613 38.160 48.140 1.00 27.72 ? 182 TYR A CG  1 
ATOM   1422 C CD1 . TYR A 1 180 ? 27.605 37.947 49.098 1.00 28.57 ? 182 TYR A CD1 1 
ATOM   1423 C CD2 . TYR A 1 180 ? 26.615 39.372 47.450 1.00 29.60 ? 182 TYR A CD2 1 
ATOM   1424 C CE1 . TYR A 1 180 ? 28.574 38.920 49.367 1.00 28.48 ? 182 TYR A CE1 1 
ATOM   1425 C CE2 . TYR A 1 180 ? 27.576 40.345 47.714 1.00 29.21 ? 182 TYR A CE2 1 
ATOM   1426 C CZ  . TYR A 1 180 ? 28.545 40.112 48.674 1.00 29.46 ? 182 TYR A CZ  1 
ATOM   1427 O OH  . TYR A 1 180 ? 29.462 41.088 48.983 1.00 30.98 ? 182 TYR A OH  1 
ATOM   1428 N N   . GLN A 1 181 ? 25.709 33.582 47.403 1.00 25.41 ? 183 GLN A N   1 
ATOM   1429 C CA  . GLN A 1 181 ? 24.950 32.337 47.398 1.00 26.16 ? 183 GLN A CA  1 
ATOM   1430 C C   . GLN A 1 181 ? 24.555 31.864 48.792 1.00 25.82 ? 183 GLN A C   1 
ATOM   1431 O O   . GLN A 1 181 ? 25.241 32.149 49.770 1.00 25.12 ? 183 GLN A O   1 
ATOM   1432 C CB  . GLN A 1 181 ? 25.793 31.264 46.698 1.00 26.05 ? 183 GLN A CB  1 
ATOM   1433 C CG  . GLN A 1 181 ? 24.991 30.168 46.044 1.00 26.35 ? 183 GLN A CG  1 
ATOM   1434 C CD  . GLN A 1 181 ? 25.883 29.163 45.364 1.00 27.89 ? 183 GLN A CD  1 
ATOM   1435 O OE1 . GLN A 1 181 ? 26.738 29.526 44.555 1.00 28.78 ? 183 GLN A OE1 1 
ATOM   1436 N NE2 . GLN A 1 181 ? 25.682 27.879 45.678 1.00 28.33 ? 183 GLN A NE2 1 
ATOM   1437 N N   . GLN A 1 182 ? 23.433 31.116 48.860 1.00 27.33 ? 184 GLN A N   1 
ATOM   1438 C CA  . GLN A 1 182 ? 22.914 30.577 50.115 1.00 28.31 ? 184 GLN A CA  1 
ATOM   1439 C C   . GLN A 1 182 ? 22.105 29.320 49.801 1.00 27.00 ? 184 GLN A C   1 
ATOM   1440 O O   . GLN A 1 182 ? 20.994 29.395 49.277 1.00 27.47 ? 184 GLN A O   1 
ATOM   1441 C CB  . GLN A 1 182 ? 22.026 31.613 50.806 1.00 31.63 ? 184 GLN A CB  1 
ATOM   1442 C CG  . GLN A 1 182 ? 22.042 31.562 52.318 1.00 38.19 ? 184 GLN A CG  1 
ATOM   1443 C CD  . GLN A 1 182 ? 21.492 32.848 52.911 1.00 44.05 ? 184 GLN A CD  1 
ATOM   1444 O OE1 . GLN A 1 182 ? 20.291 33.123 52.832 1.00 46.25 ? 184 GLN A OE1 1 
ATOM   1445 N NE2 . GLN A 1 182 ? 22.379 33.656 53.495 1.00 46.13 ? 184 GLN A NE2 1 
ATOM   1446 N N   . ASN A 1 183 ? 22.691 28.151 50.107 1.00 25.10 ? 185 ASN A N   1 
ATOM   1447 C CA  . ASN A 1 183 ? 22.027 26.883 49.861 1.00 23.89 ? 185 ASN A CA  1 
ATOM   1448 C C   . ASN A 1 183 ? 21.496 26.313 51.160 1.00 22.29 ? 185 ASN A C   1 
ATOM   1449 O O   . ASN A 1 183 ? 22.169 26.347 52.181 1.00 21.84 ? 185 ASN A O   1 
ATOM   1450 C CB  . ASN A 1 183 ? 23.007 25.873 49.270 1.00 24.30 ? 185 ASN A CB  1 
ATOM   1451 C CG  . ASN A 1 183 ? 23.594 26.320 47.952 1.00 24.00 ? 185 ASN A CG  1 
ATOM   1452 O OD1 . ASN A 1 183 ? 24.136 27.416 47.838 1.00 24.53 ? 185 ASN A OD1 1 
ATOM   1453 N ND2 . ASN A 1 183 ? 23.479 25.470 46.941 1.00 21.95 ? 185 ASN A ND2 1 
ATOM   1454 N N   . THR A 1 184 ? 20.266 25.786 51.116 1.00 21.84 ? 186 THR A N   1 
ATOM   1455 C CA  . THR A 1 184 ? 19.659 25.190 52.295 1.00 22.42 ? 186 THR A CA  1 
ATOM   1456 C C   . THR A 1 184 ? 18.939 23.919 51.875 1.00 22.86 ? 186 THR A C   1 
ATOM   1457 O O   . THR A 1 184 ? 18.219 23.906 50.887 1.00 22.98 ? 186 THR A O   1 
ATOM   1458 C CB  . THR A 1 184 ? 18.653 26.115 52.926 1.00 23.52 ? 186 THR A CB  1 
ATOM   1459 O OG1 . THR A 1 184 ? 19.153 27.454 52.886 1.00 26.78 ? 186 THR A OG1 1 
ATOM   1460 C CG2 . THR A 1 184 ? 18.447 25.712 54.364 1.00 26.27 ? 186 THR A CG2 1 
ATOM   1461 N N   . PRO A 1 185 ? 19.116 22.833 52.640 1.00 22.27 ? 187 PRO A N   1 
ATOM   1462 C CA  . PRO A 1 185 ? 18.476 21.558 52.312 1.00 20.93 ? 187 PRO A CA  1 
ATOM   1463 C C   . PRO A 1 185 ? 16.966 21.504 52.480 1.00 20.60 ? 187 PRO A C   1 
ATOM   1464 O O   . PRO A 1 185 ? 16.437 21.822 53.539 1.00 20.28 ? 187 PRO A O   1 
ATOM   1465 C CB  . PRO A 1 185 ? 19.198 20.576 53.233 1.00 21.71 ? 187 PRO A CB  1 
ATOM   1466 C CG  . PRO A 1 185 ? 19.397 21.387 54.464 1.00 21.84 ? 187 PRO A CG  1 
ATOM   1467 C CD  . PRO A 1 185 ? 19.824 22.747 53.935 1.00 22.20 ? 187 PRO A CD  1 
ATOM   1468 N N   . ILE A 1 186 ? 16.269 21.070 51.390 1.00 19.61 ? 188 ILE A N   1 
ATOM   1469 C CA  . ILE A 1 186 ? 14.814 20.944 51.401 1.00 17.90 ? 188 ILE A CA  1 
ATOM   1470 C C   . ILE A 1 186 ? 14.407 19.859 52.387 1.00 18.17 ? 188 ILE A C   1 
ATOM   1471 O O   . ILE A 1 186 ? 13.559 20.082 53.249 1.00 16.12 ? 188 ILE A O   1 
ATOM   1472 C CB  . ILE A 1 186 ? 14.273 20.622 49.979 1.00 16.21 ? 188 ILE A CB  1 
ATOM   1473 C CG1 . ILE A 1 186 ? 14.406 21.873 49.114 1.00 15.35 ? 188 ILE A CG1 1 
ATOM   1474 C CG2 . ILE A 1 186 ? 12.827 20.139 50.041 1.00 11.67 ? 188 ILE A CG2 1 
ATOM   1475 C CD1 . ILE A 1 186 ? 13.934 21.723 47.691 1.00 15.83 ? 188 ILE A CD1 1 
ATOM   1476 N N   . GLY A 1 187 ? 15.038 18.675 52.254 1.00 19.91 ? 189 GLY A N   1 
ATOM   1477 C CA  . GLY A 1 187 ? 14.738 17.577 53.148 1.00 22.52 ? 189 GLY A CA  1 
ATOM   1478 C C   . GLY A 1 187 ? 15.336 17.865 54.507 1.00 25.27 ? 189 GLY A C   1 
ATOM   1479 O O   . GLY A 1 187 ? 16.180 18.748 54.658 1.00 25.89 ? 189 GLY A O   1 
ATOM   1480 N N   . ASP A 1 188 ? 14.895 17.113 55.516 1.00 28.15 ? 190 ASP A N   1 
ATOM   1481 C CA  . ASP A 1 188 ? 15.406 17.315 56.849 1.00 31.85 ? 190 ASP A CA  1 
ATOM   1482 C C   . ASP A 1 188 ? 16.334 16.182 57.249 1.00 31.69 ? 190 ASP A C   1 
ATOM   1483 O O   . ASP A 1 188 ? 16.201 15.603 58.321 1.00 33.18 ? 190 ASP A O   1 
ATOM   1484 C CB  . ASP A 1 188 ? 14.251 17.455 57.850 1.00 35.52 ? 190 ASP A CB  1 
ATOM   1485 C CG  . ASP A 1 188 ? 13.205 16.352 57.717 1.00 40.01 ? 190 ASP A CG  1 
ATOM   1486 O OD1 . ASP A 1 188 ? 12.819 16.023 56.580 1.00 42.57 ? 190 ASP A OD1 1 
ATOM   1487 O OD2 . ASP A 1 188 ? 12.783 15.813 58.771 1.00 41.47 ? 190 ASP A OD2 1 
ATOM   1488 N N   . GLY A 1 189 ? 17.298 15.857 56.376 1.00 31.97 ? 191 GLY A N   1 
ATOM   1489 C CA  . GLY A 1 189 ? 18.230 14.786 56.674 1.00 30.41 ? 191 GLY A CA  1 
ATOM   1490 C C   . GLY A 1 189 ? 19.626 15.323 56.901 1.00 30.11 ? 191 GLY A C   1 
ATOM   1491 O O   . GLY A 1 189 ? 19.865 16.529 56.796 1.00 30.74 ? 191 GLY A O   1 
ATOM   1492 N N   . PRO A 1 190 ? 20.582 14.438 57.217 1.00 28.14 ? 192 PRO A N   1 
ATOM   1493 C CA  . PRO A 1 190 ? 21.955 14.881 57.453 1.00 27.77 ? 192 PRO A CA  1 
ATOM   1494 C C   . PRO A 1 190 ? 22.687 15.236 56.154 1.00 28.02 ? 192 PRO A C   1 
ATOM   1495 O O   . PRO A 1 190 ? 22.789 14.410 55.234 1.00 27.93 ? 192 PRO A O   1 
ATOM   1496 C CB  . PRO A 1 190 ? 22.565 13.688 58.177 1.00 26.42 ? 192 PRO A CB  1 
ATOM   1497 C CG  . PRO A 1 190 ? 21.902 12.539 57.495 1.00 26.75 ? 192 PRO A CG  1 
ATOM   1498 C CD  . PRO A 1 190 ? 20.462 12.985 57.417 1.00 27.11 ? 192 PRO A CD  1 
ATOM   1499 N N   . VAL A 1 191 ? 23.174 16.482 56.080 1.00 28.42 ? 193 VAL A N   1 
ATOM   1500 C CA  . VAL A 1 191 ? 23.901 16.977 54.920 1.00 26.59 ? 193 VAL A CA  1 
ATOM   1501 C C   . VAL A 1 191 ? 25.334 17.215 55.358 1.00 25.93 ? 193 VAL A C   1 
ATOM   1502 O O   . VAL A 1 191 ? 25.599 17.412 56.544 1.00 26.20 ? 193 VAL A O   1 
ATOM   1503 C CB  . VAL A 1 191 ? 23.327 18.317 54.421 1.00 24.87 ? 193 VAL A CB  1 
ATOM   1504 C CG1 . VAL A 1 191 ? 21.885 18.132 53.988 1.00 25.18 ? 193 VAL A CG1 1 
ATOM   1505 C CG2 . VAL A 1 191 ? 23.407 19.358 55.523 1.00 25.02 ? 193 VAL A CG2 1 
ATOM   1506 N N   . LEU A 1 192 ? 26.269 17.198 54.384 1.00 25.37 ? 194 LEU A N   1 
ATOM   1507 C CA  . LEU A 1 192 ? 27.686 17.405 54.668 1.00 23.89 ? 194 LEU A CA  1 
ATOM   1508 C C   . LEU A 1 192 ? 28.057 18.883 54.774 1.00 23.83 ? 194 LEU A C   1 
ATOM   1509 O O   . LEU A 1 192 ? 27.874 19.651 53.824 1.00 23.37 ? 194 LEU A O   1 
ATOM   1510 C CB  . LEU A 1 192 ? 28.527 16.738 53.574 1.00 22.38 ? 194 LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 192 ? 28.501 15.206 53.521 1.00 20.75 ? 194 LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 192 ? 29.453 14.741 52.447 1.00 19.05 ? 194 LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 192 ? 28.923 14.623 54.867 1.00 22.68 ? 194 LEU A CD2 1 
ATOM   1514 N N   . LEU A 1 193 ? 28.570 19.283 55.955 1.00 22.08 ? 195 LEU A N   1 
ATOM   1515 C CA  . LEU A 1 193 ? 28.997 20.656 56.167 1.00 21.47 ? 195 LEU A CA  1 
ATOM   1516 C C   . LEU A 1 193 ? 30.476 20.672 55.857 1.00 22.26 ? 195 LEU A C   1 
ATOM   1517 O O   . LEU A 1 193 ? 31.285 20.126 56.616 1.00 22.32 ? 195 LEU A O   1 
ATOM   1518 C CB  . LEU A 1 193 ? 28.734 21.049 57.607 1.00 22.06 ? 195 LEU A CB  1 
ATOM   1519 C CG  . LEU A 1 193 ? 27.255 20.959 57.987 1.00 22.96 ? 195 LEU A CG  1 
ATOM   1520 C CD1 . LEU A 1 193 ? 27.152 21.217 59.479 1.00 25.75 ? 195 LEU A CD1 1 
ATOM   1521 C CD2 . LEU A 1 193 ? 26.414 21.961 57.194 1.00 21.78 ? 195 LEU A CD2 1 
ATOM   1522 N N   . PRO A 1 194 ? 30.856 21.296 54.736 1.00 22.87 ? 196 PRO A N   1 
ATOM   1523 C CA  . PRO A 1 194 ? 32.241 21.395 54.269 1.00 23.89 ? 196 PRO A CA  1 
ATOM   1524 C C   . PRO A 1 194 ? 33.141 22.460 54.887 1.00 25.55 ? 196 PRO A C   1 
ATOM   1525 O O   . PRO A 1 194 ? 32.686 23.510 55.345 1.00 26.57 ? 196 PRO A O   1 
ATOM   1526 C CB  . PRO A 1 194 ? 32.064 21.605 52.773 1.00 22.28 ? 196 PRO A CB  1 
ATOM   1527 C CG  . PRO A 1 194 ? 30.894 22.537 52.749 1.00 22.04 ? 196 PRO A CG  1 
ATOM   1528 C CD  . PRO A 1 194 ? 29.937 21.940 53.781 1.00 21.50 ? 196 PRO A CD  1 
ATOM   1529 N N   . ASP A 1 195 ? 34.458 22.174 54.915 1.00 26.37 ? 197 ASP A N   1 
ATOM   1530 C CA  . ASP A 1 195 ? 35.385 23.168 55.430 1.00 28.45 ? 197 ASP A CA  1 
ATOM   1531 C C   . ASP A 1 195 ? 35.539 24.115 54.264 1.00 27.74 ? 197 ASP A C   1 
ATOM   1532 O O   . ASP A 1 195 ? 35.035 23.837 53.170 1.00 28.07 ? 197 ASP A O   1 
ATOM   1533 C CB  . ASP A 1 195 ? 36.744 22.556 55.778 1.00 31.74 ? 197 ASP A CB  1 
ATOM   1534 C CG  . ASP A 1 195 ? 36.683 21.650 56.984 1.00 34.38 ? 197 ASP A CG  1 
ATOM   1535 O OD1 . ASP A 1 195 ? 35.778 21.836 57.829 1.00 36.45 ? 197 ASP A OD1 1 
ATOM   1536 O OD2 . ASP A 1 195 ? 37.557 20.769 57.095 1.00 35.69 ? 197 ASP A OD2 1 
ATOM   1537 N N   . ASN A 1 196 ? 36.221 25.242 54.466 1.00 25.72 ? 198 ASN A N   1 
ATOM   1538 C CA  . ASN A 1 196 ? 36.378 26.159 53.359 1.00 24.73 ? 198 ASN A CA  1 
ATOM   1539 C C   . ASN A 1 196 ? 37.023 25.520 52.146 1.00 24.02 ? 198 ASN A C   1 
ATOM   1540 O O   . ASN A 1 196 ? 37.959 24.728 52.267 1.00 24.08 ? 198 ASN A O   1 
ATOM   1541 C CB  . ASN A 1 196 ? 37.187 27.367 53.791 1.00 27.79 ? 198 ASN A CB  1 
ATOM   1542 C CG  . ASN A 1 196 ? 36.327 28.427 54.411 1.00 30.94 ? 198 ASN A CG  1 
ATOM   1543 O OD1 . ASN A 1 196 ? 35.464 28.130 55.238 1.00 33.05 ? 198 ASN A OD1 1 
ATOM   1544 N ND2 . ASN A 1 196 ? 36.543 29.682 54.010 1.00 31.56 ? 198 ASN A ND2 1 
ATOM   1545 N N   . HIS A 1 197 ? 36.489 25.857 50.958 1.00 22.70 ? 199 HIS A N   1 
ATOM   1546 C CA  . HIS A 1 197 ? 37.001 25.347 49.695 1.00 20.86 ? 199 HIS A CA  1 
ATOM   1547 C C   . HIS A 1 197 ? 36.279 26.028 48.546 1.00 21.69 ? 199 HIS A C   1 
ATOM   1548 O O   . HIS A 1 197 ? 35.310 26.750 48.757 1.00 21.99 ? 199 HIS A O   1 
ATOM   1549 C CB  . HIS A 1 197 ? 36.803 23.838 49.587 1.00 20.30 ? 199 HIS A CB  1 
ATOM   1550 C CG  . HIS A 1 197 ? 35.382 23.420 49.342 1.00 19.07 ? 199 HIS A CG  1 
ATOM   1551 N ND1 . HIS A 1 197 ? 34.414 23.441 50.327 1.00 17.38 ? 199 HIS A ND1 1 
ATOM   1552 C CD2 . HIS A 1 197 ? 34.780 22.923 48.234 1.00 18.21 ? 199 HIS A CD2 1 
ATOM   1553 C CE1 . HIS A 1 197 ? 33.283 22.966 49.836 1.00 17.32 ? 199 HIS A CE1 1 
ATOM   1554 N NE2 . HIS A 1 197 ? 33.478 22.643 48.569 1.00 17.70 ? 199 HIS A NE2 1 
ATOM   1555 N N   . TYR A 1 198 ? 36.724 25.782 47.305 1.00 22.09 ? 200 TYR A N   1 
ATOM   1556 C CA  . TYR A 1 198 ? 36.063 26.428 46.191 1.00 22.19 ? 200 TYR A CA  1 
ATOM   1557 C C   . TYR A 1 198 ? 35.805 25.577 44.955 1.00 21.47 ? 200 TYR A C   1 
ATOM   1558 O O   . TYR A 1 198 ? 36.322 24.471 44.810 1.00 21.57 ? 200 TYR A O   1 
ATOM   1559 C CB  . TYR A 1 198 ? 36.845 27.680 45.795 1.00 22.61 ? 200 TYR A CB  1 
ATOM   1560 C CG  . TYR A 1 198 ? 38.191 27.383 45.216 1.00 22.43 ? 200 TYR A CG  1 
ATOM   1561 C CD1 . TYR A 1 198 ? 38.361 27.274 43.832 1.00 22.86 ? 200 TYR A CD1 1 
ATOM   1562 C CD2 . TYR A 1 198 ? 39.294 27.171 46.045 1.00 21.39 ? 200 TYR A CD2 1 
ATOM   1563 C CE1 . TYR A 1 198 ? 39.592 26.958 43.290 1.00 22.11 ? 200 TYR A CE1 1 
ATOM   1564 C CE2 . TYR A 1 198 ? 40.534 26.858 45.508 1.00 22.14 ? 200 TYR A CE2 1 
ATOM   1565 C CZ  . TYR A 1 198 ? 40.676 26.750 44.127 1.00 23.15 ? 200 TYR A CZ  1 
ATOM   1566 O OH  . TYR A 1 198 ? 41.889 26.412 43.572 1.00 22.83 ? 200 TYR A OH  1 
ATOM   1567 N N   . LEU A 1 199 ? 34.972 26.114 44.048 1.00 20.07 ? 201 LEU A N   1 
ATOM   1568 C CA  . LEU A 1 199 ? 34.650 25.406 42.826 1.00 18.31 ? 201 LEU A CA  1 
ATOM   1569 C C   . LEU A 1 199 ? 35.271 26.107 41.627 1.00 17.69 ? 201 LEU A C   1 
ATOM   1570 O O   . LEU A 1 199 ? 34.901 27.223 41.279 1.00 16.29 ? 201 LEU A O   1 
ATOM   1571 C CB  . LEU A 1 199 ? 33.124 25.299 42.651 1.00 18.37 ? 201 LEU A CB  1 
ATOM   1572 C CG  . LEU A 1 199 ? 32.309 24.450 43.642 1.00 18.77 ? 201 LEU A CG  1 
ATOM   1573 C CD1 . LEU A 1 199 ? 30.869 24.334 43.150 1.00 19.39 ? 201 LEU A CD1 1 
ATOM   1574 C CD2 . LEU A 1 199 ? 32.919 23.067 43.777 1.00 19.44 ? 201 LEU A CD2 1 
ATOM   1575 N N   . SER A 1 200 ? 36.253 25.433 41.001 1.00 18.23 ? 202 SER A N   1 
ATOM   1576 C CA  . SER A 1 200 ? 36.921 25.967 39.828 1.00 18.49 ? 202 SER A CA  1 
ATOM   1577 C C   . SER A 1 200 ? 35.972 25.748 38.647 1.00 18.31 ? 202 SER A C   1 
ATOM   1578 O O   . SER A 1 200 ? 35.962 24.673 38.059 1.00 19.83 ? 202 SER A O   1 
ATOM   1579 C CB  . SER A 1 200 ? 38.239 25.216 39.590 1.00 18.73 ? 202 SER A CB  1 
ATOM   1580 O OG  . SER A 1 200 ? 39.015 25.835 38.593 1.00 22.21 ? 202 SER A OG  1 
ATOM   1581 N N   . THR A 1 201 ? 35.149 26.788 38.294 1.00 17.28 ? 203 THR A N   1 
ATOM   1582 C CA  . THR A 1 201 ? 34.178 26.666 37.196 1.00 15.81 ? 203 THR A CA  1 
ATOM   1583 C C   . THR A 1 201 ? 34.544 27.370 35.887 1.00 16.33 ? 203 THR A C   1 
ATOM   1584 O O   . THR A 1 201 ? 35.093 28.465 35.887 1.00 16.42 ? 203 THR A O   1 
ATOM   1585 C CB  . THR A 1 201 ? 32.783 27.185 37.606 1.00 14.21 ? 203 THR A CB  1 
ATOM   1586 O OG1 . THR A 1 201 ? 32.587 27.004 39.003 1.00 11.46 ? 203 THR A OG1 1 
ATOM   1587 C CG2 . THR A 1 201 ? 31.700 26.423 36.841 1.00 13.63 ? 203 THR A CG2 1 
ATOM   1588 N N   . GLN A 1 202 ? 34.197 26.717 34.761 1.00 17.81 ? 204 GLN A N   1 
ATOM   1589 C CA  . GLN A 1 202 ? 34.478 27.244 33.428 1.00 19.18 ? 204 GLN A CA  1 
ATOM   1590 C C   . GLN A 1 202 ? 33.342 26.923 32.450 1.00 18.66 ? 204 GLN A C   1 
ATOM   1591 O O   . GLN A 1 202 ? 32.968 25.773 32.266 1.00 19.25 ? 204 GLN A O   1 
ATOM   1592 C CB  . GLN A 1 202 ? 35.784 26.656 32.917 1.00 18.86 ? 204 GLN A CB  1 
ATOM   1593 N N   . SER A 1 203 ? 32.785 27.954 31.817 1.00 19.68 ? 205 SER A N   1 
ATOM   1594 C CA  . SER A 1 203 ? 31.670 27.742 30.900 1.00 20.08 ? 205 SER A CA  1 
ATOM   1595 C C   . SER A 1 203 ? 31.951 28.210 29.489 1.00 21.01 ? 205 SER A C   1 
ATOM   1596 O O   . SER A 1 203 ? 32.481 29.295 29.277 1.00 21.43 ? 205 SER A O   1 
ATOM   1597 C CB  . SER A 1 203 ? 30.434 28.442 31.444 1.00 19.78 ? 205 SER A CB  1 
ATOM   1598 O OG  . SER A 1 203 ? 30.211 28.020 32.772 1.00 22.23 ? 205 SER A OG  1 
ATOM   1599 N N   . ALA A 1 204 ? 31.579 27.391 28.521 1.00 22.71 ? 206 ALA A N   1 
ATOM   1600 C CA  . ALA A 1 204 ? 31.804 27.742 27.139 1.00 23.62 ? 206 ALA A CA  1 
ATOM   1601 C C   . ALA A 1 204 ? 30.471 28.046 26.484 1.00 23.81 ? 206 ALA A C   1 
ATOM   1602 O O   . ALA A 1 204 ? 29.679 27.138 26.256 1.00 24.68 ? 206 ALA A O   1 
ATOM   1603 C CB  . ALA A 1 204 ? 32.492 26.600 26.412 1.00 23.89 ? 206 ALA A CB  1 
ATOM   1604 N N   . LEU A 1 205 ? 30.195 29.335 26.203 1.00 24.40 ? 207 LEU A N   1 
ATOM   1605 C CA  . LEU A 1 205 ? 28.928 29.673 25.552 1.00 25.68 ? 207 LEU A CA  1 
ATOM   1606 C C   . LEU A 1 205 ? 29.065 29.579 24.047 1.00 25.86 ? 207 LEU A C   1 
ATOM   1607 O O   . LEU A 1 205 ? 30.105 29.913 23.502 1.00 26.48 ? 207 LEU A O   1 
ATOM   1608 C CB  . LEU A 1 205 ? 28.477 31.091 25.896 1.00 25.36 ? 207 LEU A CB  1 
ATOM   1609 C CG  . LEU A 1 205 ? 27.960 31.363 27.300 1.00 25.37 ? 207 LEU A CG  1 
ATOM   1610 C CD1 . LEU A 1 205 ? 29.051 31.041 28.294 1.00 23.94 ? 207 LEU A CD1 1 
ATOM   1611 C CD2 . LEU A 1 205 ? 27.530 32.814 27.411 1.00 25.51 ? 207 LEU A CD2 1 
ATOM   1612 N N   . SER A 1 206 ? 27.983 29.117 23.379 1.00 26.94 ? 208 SER A N   1 
ATOM   1613 C CA  . SER A 1 206 ? 27.950 29.002 21.925 1.00 28.30 ? 208 SER A CA  1 
ATOM   1614 C C   . SER A 1 206 ? 26.523 28.904 21.388 1.00 29.42 ? 208 SER A C   1 
ATOM   1615 O O   . SER A 1 206 ? 25.595 28.529 22.114 1.00 29.35 ? 208 SER A O   1 
ATOM   1616 C CB  . SER A 1 206 ? 28.748 27.779 21.473 1.00 28.81 ? 208 SER A CB  1 
ATOM   1617 O OG  . SER A 1 206 ? 28.188 26.586 21.994 1.00 30.83 ? 208 SER A OG  1 
ATOM   1618 N N   . LYS A 1 207 ? 26.347 29.264 20.086 1.00 29.84 ? 209 LYS A N   1 
ATOM   1619 C CA  . LYS A 1 207 ? 25.030 29.215 19.454 1.00 30.67 ? 209 LYS A CA  1 
ATOM   1620 C C   . LYS A 1 207 ? 24.879 27.959 18.596 1.00 31.38 ? 209 LYS A C   1 
ATOM   1621 O O   . LYS A 1 207 ? 25.866 27.340 18.200 1.00 30.75 ? 209 LYS A O   1 
ATOM   1622 C CB  . LYS A 1 207 ? 24.809 30.461 18.591 1.00 29.10 ? 209 LYS A CB  1 
ATOM   1623 C CG  . LYS A 1 207 ? 24.843 31.797 19.340 1.00 28.13 ? 209 LYS A CG  1 
ATOM   1624 C CD  . LYS A 1 207 ? 23.756 31.950 20.402 1.00 28.35 ? 209 LYS A CD  1 
ATOM   1625 C CE  . LYS A 1 207 ? 23.856 33.339 21.030 1.00 29.20 ? 209 LYS A CE  1 
ATOM   1626 N NZ  . LYS A 1 207 ? 22.913 33.612 22.145 1.00 29.63 ? 209 LYS A NZ  1 
ATOM   1627 N N   . ASP A 1 208 ? 23.604 27.572 18.338 1.00 33.45 ? 210 ASP A N   1 
ATOM   1628 C CA  . ASP A 1 208 ? 23.298 26.410 17.513 1.00 34.27 ? 210 ASP A CA  1 
ATOM   1629 C C   . ASP A 1 208 ? 22.992 26.990 16.139 1.00 36.51 ? 210 ASP A C   1 
ATOM   1630 O O   . ASP A 1 208 ? 22.026 27.742 15.965 1.00 37.46 ? 210 ASP A O   1 
ATOM   1631 C CB  . ASP A 1 208 ? 22.078 25.658 18.052 1.00 31.86 ? 210 ASP A CB  1 
ATOM   1632 C CG  . ASP A 1 208 ? 21.797 24.385 17.279 1.00 30.84 ? 210 ASP A CG  1 
ATOM   1633 O OD1 . ASP A 1 208 ? 22.214 24.321 16.107 1.00 30.98 ? 210 ASP A OD1 1 
ATOM   1634 O OD2 . ASP A 1 208 ? 21.162 23.461 17.832 1.00 27.81 ? 210 ASP A OD2 1 
ATOM   1635 N N   . PRO A 1 209 ? 23.816 26.645 15.142 1.00 37.66 ? 211 PRO A N   1 
ATOM   1636 C CA  . PRO A 1 209 ? 23.634 27.144 13.779 1.00 37.67 ? 211 PRO A CA  1 
ATOM   1637 C C   . PRO A 1 209 ? 22.242 26.924 13.197 1.00 37.74 ? 211 PRO A C   1 
ATOM   1638 O O   . PRO A 1 209 ? 21.861 27.590 12.233 1.00 38.53 ? 211 PRO A O   1 
ATOM   1639 C CB  . PRO A 1 209 ? 24.739 26.427 13.002 1.00 38.10 ? 211 PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 209 ? 24.871 25.127 13.734 1.00 38.47 ? 211 PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 209 ? 24.792 25.540 15.180 1.00 38.26 ? 211 PRO A CD  1 
ATOM   1642 N N   . ASN A 1 210 ? 21.461 26.004 13.789 1.00 36.12 ? 212 ASN A N   1 
ATOM   1643 C CA  . ASN A 1 210 ? 20.131 25.761 13.261 1.00 34.75 ? 212 ASN A CA  1 
ATOM   1644 C C   . ASN A 1 210 ? 18.995 26.311 14.100 1.00 34.03 ? 212 ASN A C   1 
ATOM   1645 O O   . ASN A 1 210 ? 17.898 26.534 13.581 1.00 35.47 ? 212 ASN A O   1 
ATOM   1646 C CB  . ASN A 1 210 ? 19.903 24.272 13.048 1.00 35.13 ? 212 ASN A CB  1 
ATOM   1647 C CG  . ASN A 1 210 ? 20.956 23.645 12.168 1.00 34.66 ? 212 ASN A CG  1 
ATOM   1648 O OD1 . ASN A 1 210 ? 21.238 24.127 11.070 1.00 31.65 ? 212 ASN A OD1 1 
ATOM   1649 N ND2 . ASN A 1 210 ? 21.551 22.560 12.649 1.00 36.07 ? 212 ASN A ND2 1 
ATOM   1650 N N   . GLU A 1 211 ? 19.246 26.538 15.412 1.00 31.34 ? 213 GLU A N   1 
ATOM   1651 C CA  . GLU A 1 211 ? 18.203 27.059 16.285 1.00 29.51 ? 213 GLU A CA  1 
ATOM   1652 C C   . GLU A 1 211 ? 17.906 28.514 15.940 1.00 29.65 ? 213 GLU A C   1 
ATOM   1653 O O   . GLU A 1 211 ? 18.804 29.361 15.928 1.00 30.01 ? 213 GLU A O   1 
ATOM   1654 C CB  . GLU A 1 211 ? 18.615 26.926 17.749 1.00 28.36 ? 213 GLU A CB  1 
ATOM   1655 C CG  . GLU A 1 211 ? 17.479 27.226 18.717 1.00 25.54 ? 213 GLU A CG  1 
ATOM   1656 C CD  . GLU A 1 211 ? 16.270 26.335 18.495 1.00 24.94 ? 213 GLU A CD  1 
ATOM   1657 O OE1 . GLU A 1 211 ? 16.293 25.171 18.954 1.00 23.22 ? 213 GLU A OE1 1 
ATOM   1658 O OE2 . GLU A 1 211 ? 15.302 26.799 17.853 1.00 23.13 ? 213 GLU A OE2 1 
ATOM   1659 N N   . LYS A 1 212 ? 16.619 28.798 15.661 1.00 27.34 ? 214 LYS A N   1 
ATOM   1660 C CA  . LYS A 1 212 ? 16.197 30.136 15.280 1.00 24.96 ? 214 LYS A CA  1 
ATOM   1661 C C   . LYS A 1 212 ? 15.573 30.937 16.407 1.00 21.58 ? 214 LYS A C   1 
ATOM   1662 O O   . LYS A 1 212 ? 15.185 32.096 16.235 1.00 20.89 ? 214 LYS A O   1 
ATOM   1663 C CB  . LYS A 1 212 ? 15.221 30.039 14.108 1.00 29.21 ? 214 LYS A CB  1 
ATOM   1664 C CG  . LYS A 1 212 ? 15.842 29.535 12.795 1.00 33.61 ? 214 LYS A CG  1 
ATOM   1665 C CD  . LYS A 1 212 ? 16.730 30.595 12.139 1.00 38.51 ? 214 LYS A CD  1 
ATOM   1666 C CE  . LYS A 1 212 ? 17.434 30.054 10.908 1.00 40.85 ? 214 LYS A CE  1 
ATOM   1667 N NZ  . LYS A 1 212 ? 18.358 28.942 11.277 1.00 42.96 ? 214 LYS A NZ  1 
ATOM   1668 N N   . ARG A 1 213 ? 15.488 30.287 17.574 1.00 19.62 ? 215 ARG A N   1 
ATOM   1669 C CA  . ARG A 1 213 ? 14.941 30.864 18.798 1.00 18.15 ? 215 ARG A CA  1 
ATOM   1670 C C   . ARG A 1 213 ? 16.095 31.364 19.655 1.00 18.26 ? 215 ARG A C   1 
ATOM   1671 O O   . ARG A 1 213 ? 17.154 30.743 19.671 1.00 19.61 ? 215 ARG A O   1 
ATOM   1672 C CB  . ARG A 1 213 ? 14.183 29.792 19.557 1.00 16.17 ? 215 ARG A CB  1 
ATOM   1673 C CG  . ARG A 1 213 ? 13.022 29.241 18.806 1.00 15.73 ? 215 ARG A CG  1 
ATOM   1674 C CD  . ARG A 1 213 ? 12.411 28.083 19.561 1.00 14.23 ? 215 ARG A CD  1 
ATOM   1675 N NE  . ARG A 1 213 ? 13.202 26.874 19.400 1.00 15.67 ? 215 ARG A NE  1 
ATOM   1676 C CZ  . ARG A 1 213 ? 13.021 25.763 20.136 1.00 16.80 ? 215 ARG A CZ  1 
ATOM   1677 N NH1 . ARG A 1 213 ? 12.074 25.744 21.068 1.00 17.62 ? 215 ARG A NH1 1 
ATOM   1678 N NH2 . ARG A 1 213 ? 13.766 24.686 19.931 1.00 14.60 ? 215 ARG A NH2 1 
ATOM   1679 N N   . ASP A 1 214 ? 15.904 32.500 20.378 1.00 19.66 ? 216 ASP A N   1 
ATOM   1680 C CA  . ASP A 1 214 ? 16.970 33.030 21.241 1.00 20.57 ? 216 ASP A CA  1 
ATOM   1681 C C   . ASP A 1 214 ? 17.377 31.866 22.157 1.00 20.85 ? 216 ASP A C   1 
ATOM   1682 O O   . ASP A 1 214 ? 16.529 31.317 22.854 1.00 20.56 ? 216 ASP A O   1 
ATOM   1683 C CB  . ASP A 1 214 ? 16.448 34.208 22.084 1.00 21.07 ? 216 ASP A CB  1 
ATOM   1684 C CG  . ASP A 1 214 ? 17.519 35.259 22.368 1.00 23.52 ? 216 ASP A CG  1 
ATOM   1685 O OD1 . ASP A 1 214 ? 18.711 34.904 22.442 1.00 23.83 ? 216 ASP A OD1 1 
ATOM   1686 O OD2 . ASP A 1 214 ? 17.160 36.450 22.520 1.00 26.12 ? 216 ASP A OD2 1 
ATOM   1687 N N   . HIS A 1 215 ? 18.676 31.477 22.157 1.00 20.46 ? 217 HIS A N   1 
ATOM   1688 C CA  . HIS A 1 215 ? 19.101 30.341 22.975 1.00 18.97 ? 217 HIS A CA  1 
ATOM   1689 C C   . HIS A 1 215 ? 20.567 30.406 23.375 1.00 19.91 ? 217 HIS A C   1 
ATOM   1690 O O   . HIS A 1 215 ? 21.264 31.365 23.079 1.00 21.69 ? 217 HIS A O   1 
ATOM   1691 C CB  . HIS A 1 215 ? 18.887 29.049 22.209 1.00 18.05 ? 217 HIS A CB  1 
ATOM   1692 C CG  . HIS A 1 215 ? 19.844 28.875 21.069 1.00 20.57 ? 217 HIS A CG  1 
ATOM   1693 N ND1 . HIS A 1 215 ? 19.836 29.691 19.957 1.00 21.17 ? 217 HIS A ND1 1 
ATOM   1694 C CD2 . HIS A 1 215 ? 20.875 28.013 20.894 1.00 20.98 ? 217 HIS A CD2 1 
ATOM   1695 C CE1 . HIS A 1 215 ? 20.819 29.337 19.148 1.00 21.03 ? 217 HIS A CE1 1 
ATOM   1696 N NE2 . HIS A 1 215 ? 21.464 28.322 19.692 1.00 21.67 ? 217 HIS A NE2 1 
ATOM   1697 N N   . MET A 1 216 ? 21.039 29.341 24.034 1.00 19.11 ? 218 MET A N   1 
ATOM   1698 C CA  . MET A 1 216 ? 22.439 29.266 24.433 1.00 18.51 ? 218 MET A CA  1 
ATOM   1699 C C   . MET A 1 216 ? 22.895 27.807 24.563 1.00 17.77 ? 218 MET A C   1 
ATOM   1700 O O   . MET A 1 216 ? 22.159 26.988 25.093 1.00 17.96 ? 218 MET A O   1 
ATOM   1701 C CB  . MET A 1 216 ? 22.659 29.997 25.753 1.00 17.29 ? 218 MET A CB  1 
ATOM   1702 C CG  . MET A 1 216 ? 24.030 29.776 26.336 1.00 18.16 ? 218 MET A CG  1 
ATOM   1703 S SD  . MET A 1 216 ? 24.302 30.662 27.853 1.00 20.21 ? 218 MET A SD  1 
ATOM   1704 C CE  . MET A 1 216 ? 23.224 29.757 28.896 1.00 21.34 ? 218 MET A CE  1 
ATOM   1705 N N   . VAL A 1 217 ? 24.099 27.472 24.025 1.00 16.67 ? 219 VAL A N   1 
ATOM   1706 C CA  . VAL A 1 217 ? 24.621 26.114 24.156 1.00 17.91 ? 219 VAL A CA  1 
ATOM   1707 C C   . VAL A 1 217 ? 25.791 26.243 25.115 1.00 19.67 ? 219 VAL A C   1 
ATOM   1708 O O   . VAL A 1 217 ? 26.735 26.996 24.879 1.00 19.06 ? 219 VAL A O   1 
ATOM   1709 C CB  . VAL A 1 217 ? 25.083 25.484 22.807 1.00 17.57 ? 219 VAL A CB  1 
ATOM   1710 C CG1 . VAL A 1 217 ? 25.748 24.117 23.052 1.00 15.34 ? 219 VAL A CG1 1 
ATOM   1711 C CG2 . VAL A 1 217 ? 23.882 25.283 21.905 1.00 17.04 ? 219 VAL A CG2 1 
ATOM   1712 N N   . LEU A 1 218 ? 25.687 25.507 26.226 1.00 21.33 ? 220 LEU A N   1 
ATOM   1713 C CA  . LEU A 1 218 ? 26.674 25.564 27.275 1.00 23.65 ? 220 LEU A CA  1 
ATOM   1714 C C   . LEU A 1 218 ? 27.429 24.257 27.498 1.00 24.86 ? 220 LEU A C   1 
ATOM   1715 O O   . LEU A 1 218 ? 26.844 23.175 27.452 1.00 26.63 ? 220 LEU A O   1 
ATOM   1716 C CB  . LEU A 1 218 ? 25.978 25.992 28.572 1.00 24.53 ? 220 LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 218 ? 26.761 26.949 29.462 1.00 26.81 ? 220 LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 218 ? 27.032 28.215 28.668 1.00 26.88 ? 220 LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 218 ? 25.995 27.262 30.742 1.00 26.84 ? 220 LEU A CD2 1 
ATOM   1720 N N   . LEU A 1 219 ? 28.749 24.377 27.726 1.00 25.72 ? 221 LEU A N   1 
ATOM   1721 C CA  . LEU A 1 219 ? 29.629 23.244 27.981 1.00 25.85 ? 221 LEU A CA  1 
ATOM   1722 C C   . LEU A 1 219 ? 30.467 23.614 29.202 1.00 26.41 ? 221 LEU A C   1 
ATOM   1723 O O   . LEU A 1 219 ? 31.594 24.080 29.085 1.00 27.75 ? 221 LEU A O   1 
ATOM   1724 C CB  . LEU A 1 219 ? 30.535 22.991 26.781 1.00 24.08 ? 221 LEU A CB  1 
ATOM   1725 C CG  . LEU A 1 219 ? 31.663 22.005 27.072 1.00 23.23 ? 221 LEU A CG  1 
ATOM   1726 C CD1 . LEU A 1 219 ? 31.096 20.615 27.299 1.00 22.70 ? 221 LEU A CD1 1 
ATOM   1727 C CD2 . LEU A 1 219 ? 32.639 22.016 25.917 1.00 23.07 ? 221 LEU A CD2 1 
ATOM   1728 N N   . GLU A 1 220 ? 29.904 23.394 30.382 1.00 26.01 ? 222 GLU A N   1 
ATOM   1729 C CA  . GLU A 1 220 ? 30.555 23.751 31.629 1.00 25.57 ? 222 GLU A CA  1 
ATOM   1730 C C   . GLU A 1 220 ? 31.365 22.633 32.287 1.00 24.42 ? 222 GLU A C   1 
ATOM   1731 O O   . GLU A 1 220 ? 31.160 21.460 31.991 1.00 24.54 ? 222 GLU A O   1 
ATOM   1732 C CB  . GLU A 1 220 ? 29.477 24.247 32.566 1.00 28.44 ? 222 GLU A CB  1 
ATOM   1733 C CG  . GLU A 1 220 ? 29.914 25.249 33.577 1.00 33.06 ? 222 GLU A CG  1 
ATOM   1734 C CD  . GLU A 1 220 ? 28.704 25.808 34.262 1.00 35.73 ? 222 GLU A CD  1 
ATOM   1735 O OE1 . GLU A 1 220 ? 28.093 26.743 33.710 1.00 38.67 ? 222 GLU A OE1 1 
ATOM   1736 O OE2 . GLU A 1 220 ? 28.344 25.282 35.336 1.00 38.30 ? 222 GLU A OE2 1 
ATOM   1737 N N   . PHE A 1 221 ? 32.307 23.030 33.188 1.00 23.82 ? 223 PHE A N   1 
ATOM   1738 C CA  . PHE A 1 221 ? 33.184 22.120 33.937 1.00 23.62 ? 223 PHE A CA  1 
ATOM   1739 C C   . PHE A 1 221 ? 33.382 22.644 35.367 1.00 22.99 ? 223 PHE A C   1 
ATOM   1740 O O   . PHE A 1 221 ? 33.889 23.740 35.577 1.00 22.33 ? 223 PHE A O   1 
ATOM   1741 C CB  . PHE A 1 221 ? 34.545 21.985 33.237 1.00 23.73 ? 223 PHE A CB  1 
ATOM   1742 C CG  . PHE A 1 221 ? 34.508 21.116 32.006 1.00 26.25 ? 223 PHE A CG  1 
ATOM   1743 C CD1 . PHE A 1 221 ? 34.301 19.742 32.117 1.00 26.41 ? 223 PHE A CD1 1 
ATOM   1744 C CD2 . PHE A 1 221 ? 34.623 21.668 30.730 1.00 26.37 ? 223 PHE A CD2 1 
ATOM   1745 C CE1 . PHE A 1 221 ? 34.203 18.931 30.986 1.00 24.89 ? 223 PHE A CE1 1 
ATOM   1746 C CE2 . PHE A 1 221 ? 34.525 20.860 29.589 1.00 26.52 ? 223 PHE A CE2 1 
ATOM   1747 C CZ  . PHE A 1 221 ? 34.314 19.491 29.724 1.00 26.32 ? 223 PHE A CZ  1 
ATOM   1748 N N   . VAL A 1 222 ? 32.959 21.858 36.362 1.00 22.70 ? 224 VAL A N   1 
ATOM   1749 C CA  . VAL A 1 222 ? 33.092 22.284 37.742 1.00 22.05 ? 224 VAL A CA  1 
ATOM   1750 C C   . VAL A 1 222 ? 33.857 21.231 38.500 1.00 23.11 ? 224 VAL A C   1 
ATOM   1751 O O   . VAL A 1 222 ? 33.473 20.060 38.514 1.00 22.85 ? 224 VAL A O   1 
ATOM   1752 C CB  . VAL A 1 222 ? 31.723 22.475 38.404 1.00 21.39 ? 224 VAL A CB  1 
ATOM   1753 C CG1 . VAL A 1 222 ? 31.849 23.395 39.617 1.00 21.72 ? 224 VAL A CG1 1 
ATOM   1754 C CG2 . VAL A 1 222 ? 30.753 23.036 37.396 1.00 23.02 ? 224 VAL A CG2 1 
ATOM   1755 N N   . THR A 1 223 ? 34.967 21.653 39.113 1.00 23.65 ? 225 THR A N   1 
ATOM   1756 C CA  . THR A 1 223 ? 35.795 20.747 39.883 1.00 23.92 ? 225 THR A CA  1 
ATOM   1757 C C   . THR A 1 223 ? 36.202 21.387 41.206 1.00 24.09 ? 225 THR A C   1 
ATOM   1758 O O   . THR A 1 223 ? 36.735 22.498 41.237 1.00 22.60 ? 225 THR A O   1 
ATOM   1759 C CB  . THR A 1 223 ? 37.052 20.339 39.088 1.00 23.30 ? 225 THR A CB  1 
ATOM   1760 O OG1 . THR A 1 223 ? 37.986 19.709 39.965 1.00 22.23 ? 225 THR A OG1 1 
ATOM   1761 C CG2 . THR A 1 223 ? 37.698 21.541 38.422 1.00 25.23 ? 225 THR A CG2 1 
ATOM   1762 N N   . ALA A 1 224 ? 35.912 20.674 42.320 1.00 25.47 ? 226 ALA A N   1 
ATOM   1763 C CA  . ALA A 1 224 ? 36.244 21.163 43.659 1.00 25.85 ? 226 ALA A CA  1 
ATOM   1764 C C   . ALA A 1 224 ? 37.752 21.191 43.851 1.00 26.97 ? 226 ALA A C   1 
ATOM   1765 O O   . ALA A 1 224 ? 38.482 20.432 43.207 1.00 27.68 ? 226 ALA A O   1 
ATOM   1766 C CB  . ALA A 1 224 ? 35.606 20.275 44.719 1.00 24.60 ? 226 ALA A CB  1 
ATOM   1767 N N   . ALA A 1 225 ? 38.212 22.074 44.757 1.00 28.79 ? 227 ALA A N   1 
ATOM   1768 C CA  . ALA A 1 225 ? 39.628 22.239 45.047 1.00 30.28 ? 227 ALA A CA  1 
ATOM   1769 C C   . ALA A 1 225 ? 39.770 23.197 46.223 1.00 32.63 ? 227 ALA A C   1 
ATOM   1770 O O   . ALA A 1 225 ? 38.775 23.706 46.737 1.00 33.15 ? 227 ALA A O   1 
ATOM   1771 C CB  . ALA A 1 225 ? 40.330 22.807 43.828 1.00 28.07 ? 227 ALA A CB  1 
ATOM   1772 N N   . GLY A 1 226 ? 41.026 23.457 46.658 1.00 34.92 ? 228 GLY A N   1 
ATOM   1773 C CA  . GLY A 1 226 ? 41.233 24.387 47.759 1.00 37.02 ? 228 GLY A CA  1 
ATOM   1774 C C   . GLY A 1 226 ? 41.689 23.746 49.051 1.00 38.83 ? 228 GLY A C   1 
ATOM   1775 O O   . GLY A 1 226 ? 42.221 24.427 49.940 1.00 39.09 ? 228 GLY A O   1 
ATOM   1776 N N   . ILE A 1 227 ? 41.466 22.418 49.150 1.00 39.00 ? 229 ILE A N   1 
ATOM   1777 C CA  . ILE A 1 227 ? 41.851 21.639 50.316 1.00 40.33 ? 229 ILE A CA  1 
ATOM   1778 C C   . ILE A 1 227 ? 42.971 20.679 49.906 1.00 41.11 ? 229 ILE A C   1 
ATOM   1779 O O   . ILE A 1 227 ? 43.913 20.491 50.701 1.00 41.67 ? 229 ILE A O   1 
ATOM   1780 C CB  . ILE A 1 227 ? 40.642 20.853 50.870 1.00 39.59 ? 229 ILE A CB  1 
ATOM   1781 C CG1 . ILE A 1 227 ? 39.532 21.827 51.278 1.00 37.84 ? 229 ILE A CG1 1 
ATOM   1782 C CG2 . ILE A 1 227 ? 41.037 20.032 52.080 1.00 38.84 ? 229 ILE A CG2 1 
ATOM   1783 C CD1 . ILE A 1 227 ? 38.340 21.160 51.913 1.00 37.56 ? 229 ILE A CD1 1 
HETATM 1784 O O   . HOH B 2 .   ? 21.283 35.633 49.263 1.00 3.31  ? 239 HOH A O   1 
HETATM 1785 O O   . HOH B 2 .   ? 11.506 11.480 42.633 1.00 20.99 ? 240 HOH A O   1 
HETATM 1786 O O   . HOH B 2 .   ? 24.751 41.014 25.231 1.00 16.87 ? 241 HOH A O   1 
HETATM 1787 O O   . HOH B 2 .   ? 10.780 36.997 26.383 1.00 9.08  ? 242 HOH A O   1 
HETATM 1788 O O   . HOH B 2 .   ? 25.895 12.874 37.561 1.00 24.73 ? 243 HOH A O   1 
HETATM 1789 O O   . HOH B 2 .   ? 28.361 18.438 44.444 1.00 10.89 ? 244 HOH A O   1 
HETATM 1790 O O   . HOH B 2 .   ? 17.302 35.177 47.440 1.00 38.76 ? 245 HOH A O   1 
HETATM 1791 O O   . HOH B 2 .   ? 25.221 6.742  32.828 1.00 3.41  ? 246 HOH A O   1 
HETATM 1792 O O   . HOH B 2 .   ? 29.522 25.265 24.079 1.00 5.15  ? 247 HOH A O   1 
HETATM 1793 O O   . HOH B 2 .   ? 21.312 47.681 32.202 1.00 26.44 ? 248 HOH A O   1 
HETATM 1794 O O   . HOH B 2 .   ? 30.387 36.999 30.251 1.00 7.15  ? 249 HOH A O   1 
HETATM 1795 O O   . HOH B 2 .   ? 29.953 21.440 49.596 1.00 8.79  ? 250 HOH A O   1 
HETATM 1796 O O   . HOH B 2 .   ? 19.443 30.718 42.899 1.00 15.57 ? 251 HOH A O   1 
HETATM 1797 O O   . HOH B 2 .   ? 21.814 32.513 40.426 1.00 13.59 ? 252 HOH A O   1 
HETATM 1798 O O   . HOH B 2 .   ? 22.956 37.140 24.925 1.00 30.51 ? 253 HOH A O   1 
HETATM 1799 O O   . HOH B 2 .   ? 17.421 17.535 51.603 1.00 3.76  ? 254 HOH A O   1 
HETATM 1800 O O   . HOH B 2 .   ? 25.644 33.834 34.695 1.00 19.39 ? 255 HOH A O   1 
HETATM 1801 O O   . HOH B 2 .   ? 28.280 24.915 37.919 1.00 44.18 ? 256 HOH A O   1 
HETATM 1802 O O   . HOH B 2 .   ? 33.246 49.931 31.868 1.00 28.71 ? 257 HOH A O   1 
HETATM 1803 O O   . HOH B 2 .   ? 35.764 34.406 41.869 1.00 14.74 ? 258 HOH A O   1 
HETATM 1804 O O   . HOH B 2 .   ? 30.293 39.239 28.780 1.00 21.27 ? 259 HOH A O   1 
HETATM 1805 O O   . HOH B 2 .   ? 18.204 15.435 53.273 1.00 17.44 ? 260 HOH A O   1 
HETATM 1806 O O   . HOH B 2 .   ? 20.636 29.005 40.625 1.00 19.06 ? 261 HOH A O   1 
HETATM 1807 O O   . HOH B 2 .   ? 15.368 42.235 43.425 1.00 32.05 ? 262 HOH A O   1 
HETATM 1808 O O   . HOH B 2 .   ? 26.646 11.528 50.114 1.00 20.69 ? 263 HOH A O   1 
HETATM 1809 O O   . HOH B 2 .   ? 9.327  27.914 37.951 1.00 5.66  ? 264 HOH A O   1 
HETATM 1810 O O   . HOH B 2 .   ? 29.035 11.075 36.970 1.00 36.14 ? 265 HOH A O   1 
HETATM 1811 O O   . HOH B 2 .   ? 23.420 34.258 36.800 1.00 24.86 ? 266 HOH A O   1 
HETATM 1812 O O   . HOH B 2 .   ? 30.222 8.036  34.007 1.00 10.65 ? 267 HOH A O   1 
HETATM 1813 O O   . HOH B 2 .   ? 33.389 37.316 30.431 1.00 24.46 ? 268 HOH A O   1 
HETATM 1814 O O   . HOH B 2 .   ? 38.232 34.352 40.425 1.00 17.48 ? 269 HOH A O   1 
HETATM 1815 O O   . HOH B 2 .   ? 13.061 32.480 20.631 1.00 14.53 ? 270 HOH A O   1 
HETATM 1816 O O   . HOH B 2 .   ? 29.809 26.425 40.064 1.00 15.31 ? 271 HOH A O   1 
HETATM 1817 O O   . HOH B 2 .   ? 36.206 9.822  51.020 1.00 18.81 ? 272 HOH A O   1 
HETATM 1818 O O   . HOH B 2 .   ? 35.250 51.142 42.377 1.00 23.69 ? 273 HOH A O   1 
HETATM 1819 O O   . HOH B 2 .   ? 24.519 17.950 59.589 1.00 12.82 ? 274 HOH A O   1 
HETATM 1820 O O   . HOH B 2 .   ? 13.186 36.149 44.692 1.00 31.06 ? 275 HOH A O   1 
HETATM 1821 O O   . HOH B 2 .   ? 27.037 24.881 20.035 1.00 24.99 ? 276 HOH A O   1 
HETATM 1822 O O   . HOH B 2 .   ? 28.481 17.767 58.221 1.00 35.34 ? 277 HOH A O   1 
HETATM 1823 O O   . HOH B 2 .   ? 39.835 31.251 37.969 1.00 31.52 ? 278 HOH A O   1 
HETATM 1824 O O   . HOH B 2 .   ? 24.721 12.648 53.575 1.00 49.39 ? 279 HOH A O   1 
HETATM 1825 O O   . HOH B 2 .   ? 9.463  26.839 22.561 1.00 35.75 ? 280 HOH A O   1 
HETATM 1826 O O   . HOH B 2 .   ? 5.786  45.603 33.264 1.00 38.62 ? 281 HOH A O   1 
HETATM 1827 O O   . HOH B 2 .   ? 14.447 29.478 52.190 1.00 32.38 ? 282 HOH A O   1 
HETATM 1828 O O   . HOH B 2 .   ? 11.720 28.464 43.499 1.00 34.20 ? 283 HOH A O   1 
HETATM 1829 O O   . HOH B 2 .   ? 15.810 45.122 27.044 1.00 26.21 ? 284 HOH A O   1 
HETATM 1830 O O   . HOH B 2 .   ? 29.082 44.917 41.966 1.00 5.79  ? 285 HOH A O   1 
HETATM 1831 O O   . HOH B 2 .   ? 27.595 49.386 42.296 1.00 25.33 ? 286 HOH A O   1 
HETATM 1832 O O   . HOH B 2 .   ? 26.042 48.591 32.705 1.00 32.44 ? 287 HOH A O   1 
HETATM 1833 O O   . HOH B 2 .   ? 38.064 20.471 60.109 1.00 32.62 ? 288 HOH A O   1 
HETATM 1834 O O   . HOH B 2 .   ? 13.189 7.649  41.612 1.00 24.14 ? 289 HOH A O   1 
HETATM 1835 O O   . HOH B 2 .   ? 20.031 33.126 20.352 1.00 20.19 ? 290 HOH A O   1 
HETATM 1836 O O   . HOH B 2 .   ? 42.841 20.251 45.873 1.00 21.36 ? 291 HOH A O   1 
HETATM 1837 O O   . HOH B 2 .   ? 37.513 25.800 57.209 1.00 3.11  ? 292 HOH A O   1 
HETATM 1838 O O   . HOH B 2 .   ? 35.960 35.245 32.318 1.00 46.55 ? 293 HOH A O   1 
HETATM 1839 O O   . HOH B 2 .   ? 32.517 17.449 56.565 1.00 26.25 ? 294 HOH A O   1 
HETATM 1840 O O   . HOH B 2 .   ? 29.667 41.223 21.652 1.00 31.25 ? 295 HOH A O   1 
HETATM 1841 O O   . HOH B 2 .   ? 34.188 24.789 23.487 1.00 37.33 ? 296 HOH A O   1 
HETATM 1842 O O   . HOH B 2 .   ? 32.956 23.273 59.599 1.00 33.59 ? 297 HOH A O   1 
HETATM 1843 O O   . HOH B 2 .   ? 29.397 9.109  50.810 1.00 27.05 ? 298 HOH A O   1 
HETATM 1844 O O   . HOH B 2 .   ? 32.241 14.128 42.436 1.00 46.32 ? 299 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  CYS 48  48  48  CYS CYS A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  4FW 57  57  57  4FW 4FW A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  4F3 65  66  66  4F3 4F3 A . n 
A 1 66  VAL 66  68  68  VAL VAL A . n 
A 1 67  GLN 67  69  69  GLN GLN A . n 
A 1 68  CYS 68  70  70  CYS CYS A . n 
A 1 69  PHE 69  71  71  PHE PHE A . n 
A 1 70  SER 70  72  72  SER SER A . n 
A 1 71  ARG 71  73  73  ARG ARG A . n 
A 1 72  TYR 72  74  74  TYR TYR A . n 
A 1 73  PRO 73  75  75  PRO PRO A . n 
A 1 74  ASP 74  76  76  ASP ASP A . n 
A 1 75  HIS 75  77  77  HIS HIS A . n 
A 1 76  MET 76  78  78  MET MET A . n 
A 1 77  LYS 77  79  79  LYS LYS A . n 
A 1 78  ARG 78  80  80  ARG ARG A . n 
A 1 79  HIS 79  81  81  HIS HIS A . n 
A 1 80  ASP 80  82  82  ASP ASP A . n 
A 1 81  PHE 81  83  83  PHE PHE A . n 
A 1 82  PHE 82  84  84  PHE PHE A . n 
A 1 83  LYS 83  85  85  LYS LYS A . n 
A 1 84  SER 84  86  86  SER SER A . n 
A 1 85  ALA 85  87  87  ALA ALA A . n 
A 1 86  MET 86  88  88  MET MET A . n 
A 1 87  PRO 87  89  89  PRO PRO A . n 
A 1 88  GLU 88  90  90  GLU GLU A . n 
A 1 89  GLY 89  91  91  GLY GLY A . n 
A 1 90  TYR 90  92  92  TYR TYR A . n 
A 1 91  VAL 91  93  93  VAL VAL A . n 
A 1 92  GLN 92  94  94  GLN GLN A . n 
A 1 93  GLU 93  95  95  GLU GLU A . n 
A 1 94  ARG 94  96  96  ARG ARG A . n 
A 1 95  THR 95  97  97  THR THR A . n 
A 1 96  ILE 96  98  98  ILE ILE A . n 
A 1 97  PHE 97  99  99  PHE PHE A . n 
A 1 98  PHE 98  100 100 PHE PHE A . n 
A 1 99  LYS 99  101 101 LYS LYS A . n 
A 1 100 ASP 100 102 102 ASP ASP A . n 
A 1 101 ASP 101 103 103 ASP ASP A . n 
A 1 102 GLY 102 104 104 GLY GLY A . n 
A 1 103 ASN 103 105 105 ASN ASN A . n 
A 1 104 TYR 104 106 106 TYR TYR A . n 
A 1 105 LYS 105 107 107 LYS LYS A . n 
A 1 106 THR 106 108 108 THR THR A . n 
A 1 107 ARG 107 109 109 ARG ARG A . n 
A 1 108 ALA 108 110 110 ALA ALA A . n 
A 1 109 GLU 109 111 111 GLU GLU A . n 
A 1 110 VAL 110 112 112 VAL VAL A . n 
A 1 111 LYS 111 113 113 LYS LYS A . n 
A 1 112 PHE 112 114 114 PHE PHE A . n 
A 1 113 GLU 113 115 115 GLU GLU A . n 
A 1 114 GLY 114 116 116 GLY GLY A . n 
A 1 115 ASP 115 117 117 ASP ASP A . n 
A 1 116 THR 116 118 118 THR THR A . n 
A 1 117 LEU 117 119 119 LEU LEU A . n 
A 1 118 VAL 118 120 120 VAL VAL A . n 
A 1 119 ASN 119 121 121 ASN ASN A . n 
A 1 120 ARG 120 122 122 ARG ARG A . n 
A 1 121 ILE 121 123 123 ILE ILE A . n 
A 1 122 GLU 122 124 124 GLU GLU A . n 
A 1 123 LEU 123 125 125 LEU LEU A . n 
A 1 124 LYS 124 126 126 LYS LYS A . n 
A 1 125 GLY 125 127 127 GLY GLY A . n 
A 1 126 ILE 126 128 128 ILE ILE A . n 
A 1 127 ASP 127 129 129 ASP ASP A . n 
A 1 128 PHE 128 130 130 PHE PHE A . n 
A 1 129 LYS 129 131 131 LYS LYS A . n 
A 1 130 GLU 130 132 132 GLU GLU A . n 
A 1 131 ASP 131 133 133 ASP ASP A . n 
A 1 132 GLY 132 134 134 GLY GLY A . n 
A 1 133 ASN 133 135 135 ASN ASN A . n 
A 1 134 ILE 134 136 136 ILE ILE A . n 
A 1 135 LEU 135 137 137 LEU LEU A . n 
A 1 136 GLY 136 138 138 GLY GLY A . n 
A 1 137 HIS 137 139 139 HIS HIS A . n 
A 1 138 LYS 138 140 140 LYS LYS A . n 
A 1 139 LEU 139 141 141 LEU LEU A . n 
A 1 140 GLU 140 142 142 GLU GLU A . n 
A 1 141 TYR 141 143 143 TYR TYR A . n 
A 1 142 ASN 142 144 144 ASN ASN A . n 
A 1 143 TYR 143 145 145 TYR TYR A . n 
A 1 144 ILE 144 146 146 ILE ILE A . n 
A 1 145 SER 145 147 147 SER SER A . n 
A 1 146 HIS 146 148 148 HIS HIS A . n 
A 1 147 ASN 147 149 149 ASN ASN A . n 
A 1 148 VAL 148 150 150 VAL VAL A . n 
A 1 149 TYR 149 151 151 TYR TYR A . n 
A 1 150 ILE 150 152 152 ILE ILE A . n 
A 1 151 THR 151 153 153 THR THR A . n 
A 1 152 ALA 152 154 154 ALA ALA A . n 
A 1 153 ASP 153 155 155 ASP ASP A . n 
A 1 154 LYS 154 156 156 LYS LYS A . n 
A 1 155 GLN 155 157 157 GLN GLN A . n 
A 1 156 LYS 156 158 158 LYS LYS A . n 
A 1 157 ASN 157 159 159 ASN ASN A . n 
A 1 158 GLY 158 160 160 GLY GLY A . n 
A 1 159 ILE 159 161 161 ILE ILE A . n 
A 1 160 LYS 160 162 162 LYS LYS A . n 
A 1 161 ALA 161 163 163 ALA ALA A . n 
A 1 162 ASN 162 164 164 ASN ASN A . n 
A 1 163 PHE 163 165 165 PHE PHE A . n 
A 1 164 LYS 164 166 166 LYS LYS A . n 
A 1 165 ILE 165 167 167 ILE ILE A . n 
A 1 166 ARG 166 168 168 ARG ARG A . n 
A 1 167 HIS 167 169 169 HIS HIS A . n 
A 1 168 ASN 168 170 170 ASN ASN A . n 
A 1 169 ILE 169 171 171 ILE ILE A . n 
A 1 170 GLU 170 172 172 GLU GLU A . n 
A 1 171 ASP 171 173 173 ASP ASP A . n 
A 1 172 GLY 172 174 174 GLY GLY A . n 
A 1 173 SER 173 175 175 SER SER A . n 
A 1 174 VAL 174 176 176 VAL VAL A . n 
A 1 175 GLN 175 177 177 GLN GLN A . n 
A 1 176 LEU 176 178 178 LEU LEU A . n 
A 1 177 ALA 177 179 179 ALA ALA A . n 
A 1 178 ASP 178 180 180 ASP ASP A . n 
A 1 179 HIS 179 181 181 HIS HIS A . n 
A 1 180 TYR 180 182 182 TYR TYR A . n 
A 1 181 GLN 181 183 183 GLN GLN A . n 
A 1 182 GLN 182 184 184 GLN GLN A . n 
A 1 183 ASN 183 185 185 ASN ASN A . n 
A 1 184 THR 184 186 186 THR THR A . n 
A 1 185 PRO 185 187 187 PRO PRO A . n 
A 1 186 ILE 186 188 188 ILE ILE A . n 
A 1 187 GLY 187 189 189 GLY GLY A . n 
A 1 188 ASP 188 190 190 ASP ASP A . n 
A 1 189 GLY 189 191 191 GLY GLY A . n 
A 1 190 PRO 190 192 192 PRO PRO A . n 
A 1 191 VAL 191 193 193 VAL VAL A . n 
A 1 192 LEU 192 194 194 LEU LEU A . n 
A 1 193 LEU 193 195 195 LEU LEU A . n 
A 1 194 PRO 194 196 196 PRO PRO A . n 
A 1 195 ASP 195 197 197 ASP ASP A . n 
A 1 196 ASN 196 198 198 ASN ASN A . n 
A 1 197 HIS 197 199 199 HIS HIS A . n 
A 1 198 TYR 198 200 200 TYR TYR A . n 
A 1 199 LEU 199 201 201 LEU LEU A . n 
A 1 200 SER 200 202 202 SER SER A . n 
A 1 201 THR 201 203 203 THR THR A . n 
A 1 202 GLN 202 204 204 GLN GLN A . n 
A 1 203 SER 203 205 205 SER SER A . n 
A 1 204 ALA 204 206 206 ALA ALA A . n 
A 1 205 LEU 205 207 207 LEU LEU A . n 
A 1 206 SER 206 208 208 SER SER A . n 
A 1 207 LYS 207 209 209 LYS LYS A . n 
A 1 208 ASP 208 210 210 ASP ASP A . n 
A 1 209 PRO 209 211 211 PRO PRO A . n 
A 1 210 ASN 210 212 212 ASN ASN A . n 
A 1 211 GLU 211 213 213 GLU GLU A . n 
A 1 212 LYS 212 214 214 LYS LYS A . n 
A 1 213 ARG 213 215 215 ARG ARG A . n 
A 1 214 ASP 214 216 216 ASP ASP A . n 
A 1 215 HIS 215 217 217 HIS HIS A . n 
A 1 216 MET 216 218 218 MET MET A . n 
A 1 217 VAL 217 219 219 VAL VAL A . n 
A 1 218 LEU 218 220 220 LEU LEU A . n 
A 1 219 LEU 219 221 221 LEU LEU A . n 
A 1 220 GLU 220 222 222 GLU GLU A . n 
A 1 221 PHE 221 223 223 PHE PHE A . n 
A 1 222 VAL 222 224 224 VAL VAL A . n 
A 1 223 THR 223 225 225 THR THR A . n 
A 1 224 ALA 224 226 226 ALA ALA A . n 
A 1 225 ALA 225 227 227 ALA ALA A . n 
A 1 226 GLY 226 228 228 GLY GLY A . n 
A 1 227 ILE 227 229 229 ILE ILE A . n 
A 1 228 THR 228 230 ?   ?   ?   A . n 
A 1 229 LEU 229 231 ?   ?   ?   A . n 
A 1 230 GLY 230 232 ?   ?   ?   A . n 
A 1 231 MET 231 233 ?   ?   ?   A . n 
A 1 232 ASP 232 234 ?   ?   ?   A . n 
A 1 233 GLU 233 235 ?   ?   ?   A . n 
A 1 234 LEU 234 236 ?   ?   ?   A . n 
A 1 235 TYR 235 237 ?   ?   ?   A . n 
A 1 236 LYS 236 238 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 4FW 57 A 4FW 57 ? TRP 4-FLUOROTRYPTOPHANE 
2 A 4F3 65 A 4F3 66 ? GLY ?                   
3 A 4F3 65 A 4F3 66 ? TYR ?                   
4 A 4F3 65 A 4F3 66 ? GLY ?                   
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            THR 
_pdbx_validate_rmsd_bond.auth_seq_id_1             63 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            LEU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             64 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.067 
_pdbx_validate_rmsd_bond.bond_target_value         1.336 
_pdbx_validate_rmsd_bond.bond_deviation            -0.269 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O A 4F3 66 ? ? C A 4F3 66 ? ? N  A VAL 68 ? ? 140.38 122.70 17.68  1.60 Y 
2 1 C A 4F3 66 ? ? N A VAL 68 ? ? CA A VAL 68 ? ? 104.04 121.70 -17.66 2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 69  ? ? -51.49  0.91   
2 1 LYS A 79  ? ? -56.29  -6.76  
3 1 ASP A 129 ? ? 80.50   11.98  
4 1 HIS A 139 ? ? 53.33   71.75  
5 1 ASN A 144 ? ? -145.76 -77.28 
6 1 ASP A 190 ? ? -107.22 49.64  
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   THR 
_pdbx_validate_polymer_linkage.auth_seq_id_1    63 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   LEU 
_pdbx_validate_polymer_linkage.auth_seq_id_2    64 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.07 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 132 ? CG  ? A GLU 130 CG  
2  1 Y 1 A GLU 132 ? CD  ? A GLU 130 CD  
3  1 Y 1 A GLU 132 ? OE1 ? A GLU 130 OE1 
4  1 Y 1 A GLU 132 ? OE2 ? A GLU 130 OE2 
5  1 Y 1 A ASP 133 ? CG  ? A ASP 131 CG  
6  1 Y 1 A ASP 133 ? OD1 ? A ASP 131 OD1 
7  1 Y 1 A ASP 133 ? OD2 ? A ASP 131 OD2 
8  1 Y 1 A LYS 156 ? CG  ? A LYS 154 CG  
9  1 Y 1 A LYS 156 ? CD  ? A LYS 154 CD  
10 1 Y 1 A LYS 156 ? CE  ? A LYS 154 CE  
11 1 Y 1 A LYS 156 ? NZ  ? A LYS 154 NZ  
12 1 Y 1 A GLN 157 ? CG  ? A GLN 155 CG  
13 1 Y 1 A GLN 157 ? CD  ? A GLN 155 CD  
14 1 Y 1 A GLN 157 ? OE1 ? A GLN 155 OE1 
15 1 Y 1 A GLN 157 ? NE2 ? A GLN 155 NE2 
16 1 Y 1 A LYS 158 ? CG  ? A LYS 156 CG  
17 1 Y 1 A LYS 158 ? CD  ? A LYS 156 CD  
18 1 Y 1 A LYS 158 ? CE  ? A LYS 156 CE  
19 1 Y 1 A LYS 158 ? NZ  ? A LYS 156 NZ  
20 1 Y 1 A GLN 204 ? CG  ? A GLN 202 CG  
21 1 Y 1 A GLN 204 ? CD  ? A GLN 202 CD  
22 1 Y 1 A GLN 204 ? OE1 ? A GLN 202 OE1 
23 1 Y 1 A GLN 204 ? NE2 ? A GLN 202 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? A VAL 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A THR 230 ? A THR 228 
4  1 Y 1 A LEU 231 ? A LEU 229 
5  1 Y 1 A GLY 232 ? A GLY 230 
6  1 Y 1 A MET 233 ? A MET 231 
7  1 Y 1 A ASP 234 ? A ASP 232 
8  1 Y 1 A GLU 235 ? A GLU 233 
9  1 Y 1 A LEU 236 ? A LEU 234 
10 1 Y 1 A TYR 237 ? A TYR 235 
11 1 Y 1 A LYS 238 ? A LYS 236 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  239 1  HOH HOH A . 
B 2 HOH 2  240 2  HOH HOH A . 
B 2 HOH 3  241 3  HOH HOH A . 
B 2 HOH 4  242 4  HOH HOH A . 
B 2 HOH 5  243 5  HOH HOH A . 
B 2 HOH 6  244 6  HOH HOH A . 
B 2 HOH 7  245 7  HOH HOH A . 
B 2 HOH 8  246 8  HOH HOH A . 
B 2 HOH 9  247 9  HOH HOH A . 
B 2 HOH 10 248 10 HOH HOH A . 
B 2 HOH 11 249 11 HOH HOH A . 
B 2 HOH 12 250 12 HOH HOH A . 
B 2 HOH 13 251 13 HOH HOH A . 
B 2 HOH 14 252 14 HOH HOH A . 
B 2 HOH 15 253 15 HOH HOH A . 
B 2 HOH 16 254 16 HOH HOH A . 
B 2 HOH 17 255 17 HOH HOH A . 
B 2 HOH 18 256 18 HOH HOH A . 
B 2 HOH 19 257 19 HOH HOH A . 
B 2 HOH 20 258 20 HOH HOH A . 
B 2 HOH 21 259 21 HOH HOH A . 
B 2 HOH 22 260 22 HOH HOH A . 
B 2 HOH 23 261 23 HOH HOH A . 
B 2 HOH 24 262 24 HOH HOH A . 
B 2 HOH 25 263 25 HOH HOH A . 
B 2 HOH 26 264 26 HOH HOH A . 
B 2 HOH 27 265 27 HOH HOH A . 
B 2 HOH 28 266 28 HOH HOH A . 
B 2 HOH 29 267 29 HOH HOH A . 
B 2 HOH 30 268 30 HOH HOH A . 
B 2 HOH 31 269 31 HOH HOH A . 
B 2 HOH 32 270 32 HOH HOH A . 
B 2 HOH 33 271 33 HOH HOH A . 
B 2 HOH 34 272 34 HOH HOH A . 
B 2 HOH 35 273 35 HOH HOH A . 
B 2 HOH 36 274 36 HOH HOH A . 
B 2 HOH 37 275 37 HOH HOH A . 
B 2 HOH 38 276 38 HOH HOH A . 
B 2 HOH 39 277 39 HOH HOH A . 
B 2 HOH 40 278 40 HOH HOH A . 
B 2 HOH 41 279 41 HOH HOH A . 
B 2 HOH 42 280 42 HOH HOH A . 
B 2 HOH 43 281 43 HOH HOH A . 
B 2 HOH 44 282 44 HOH HOH A . 
B 2 HOH 45 283 45 HOH HOH A . 
B 2 HOH 46 284 46 HOH HOH A . 
B 2 HOH 47 285 47 HOH HOH A . 
B 2 HOH 48 286 48 HOH HOH A . 
B 2 HOH 49 287 49 HOH HOH A . 
B 2 HOH 50 288 50 HOH HOH A . 
B 2 HOH 51 289 51 HOH HOH A . 
B 2 HOH 52 290 52 HOH HOH A . 
B 2 HOH 53 291 53 HOH HOH A . 
B 2 HOH 54 292 54 HOH HOH A . 
B 2 HOH 55 293 55 HOH HOH A . 
B 2 HOH 56 294 56 HOH HOH A . 
B 2 HOH 57 295 57 HOH HOH A . 
B 2 HOH 58 296 58 HOH HOH A . 
B 2 HOH 59 297 59 HOH HOH A . 
B 2 HOH 60 298 60 HOH HOH A . 
B 2 HOH 61 299 61 HOH HOH A . 
#