data_1SO2
# 
_entry.id   1SO2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1SO2         
RCSB  RCSB021864   
WWPDB D_1000021864 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1soj 
_pdbx_database_related.details        
'Crystal Structure of Human Phosphodiesterase 3B: Atomic Basis for Substrate and Inhibitor Specificity' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1SO2 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scapin, G.'          1  
'Patel, S.B.'         2  
'Chung, C.'           3  
'Varnerin, J.P.'      4  
'Edmondson, S.D.'     5  
'Mastracchio, A.'     6  
'Parmee, E.R.'        7  
'Becker, J.W.'        8  
'Singh, S.B.'         9  
'Van Der Ploeg, L.H.' 10 
'Tota, M.R.'          11 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of Human Phosphodiesterase 3B: Atomic Basis for Substrate and Inhibitor Specificity' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            43 
_citation.page_first                6091 
_citation.page_last                 6100 
_citation.year                      2004 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15147193 
_citation.pdbx_database_id_DOI      10.1021/bi049868i 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Scapin, G.'          1  
primary 'Patel, S.B.'         2  
primary 'Chung, C.'           3  
primary 'Varnerin, J.P.'      4  
primary 'Edmondson, S.D.'     5  
primary 'Mastracchio, A.'     6  
primary 'Parmee, E.R.'        7  
primary 'Singh, S.B.'         8  
primary 'Becker, J.W.'        9  
primary 'Van Der Ploeg, L.H.' 10 
primary 'Tota, M.R.'          11 
# 
_cell.entry_id           1SO2 
_cell.length_a           147.482 
_cell.length_b           121.772 
_cell.length_c           126.671 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.74 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1SO2 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;cGMP-inhibited 3',5'-cyclic phosphodiesterase B
;
48158.781 4   3.1.4.17 ? 'catalytic domain, residues 654-1073' ? 
2 non-polymer syn 'MAGNESIUM ION'                                                                                         24.305 9 
?        ? MERCK1                                ? 
3 non-polymer syn '1-DEOXY-1-[(2-HYDROXYETHYL)(NONANOYL)AMINO]HEXITOL'                                                    365.462 
4   ?        ? HEGA-9                                ? 
4 non-polymer syn '6-(4-{[2-(3-IODOBENZYL)-3-OXOCYCLOHEX-1-EN-1-YL]AMINO}PHENYL)-5-METHYL-4,5-DIHYDROPYRIDAZIN-3(2H)-ONE' 513.371 
4   ?        ? ?                                     ? 
5 water       nat water                                                                                                   18.015 
362 ?        ? ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cyclic GMP inhibited phosphodiesterase B, CGI-PDE B, CGIPDE1, CGIP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRD
IPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMA
LYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILAT
DLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPI
SPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPRRKS
RRRIFCQLMHHLTENHKIWK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRD
IPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMA
LYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILAT
DLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPI
SPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPRRKS
RRRIFCQLMHHLTENHKIWK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLN n 
1 3   GLU n 
1 4   VAL n 
1 5   SER n 
1 6   LEU n 
1 7   ASP n 
1 8   LEU n 
1 9   ILE n 
1 10  LEU n 
1 11  VAL n 
1 12  GLU n 
1 13  GLU n 
1 14  TYR n 
1 15  ASP n 
1 16  SER n 
1 17  LEU n 
1 18  ILE n 
1 19  GLU n 
1 20  LYS n 
1 21  MET n 
1 22  SER n 
1 23  ASN n 
1 24  TRP n 
1 25  ASN n 
1 26  PHE n 
1 27  PRO n 
1 28  ILE n 
1 29  PHE n 
1 30  GLU n 
1 31  LEU n 
1 32  VAL n 
1 33  GLU n 
1 34  LYS n 
1 35  MET n 
1 36  GLY n 
1 37  GLU n 
1 38  LYS n 
1 39  SER n 
1 40  GLY n 
1 41  ARG n 
1 42  ILE n 
1 43  LEU n 
1 44  SER n 
1 45  GLN n 
1 46  VAL n 
1 47  MET n 
1 48  TYR n 
1 49  THR n 
1 50  LEU n 
1 51  PHE n 
1 52  GLN n 
1 53  ASP n 
1 54  THR n 
1 55  GLY n 
1 56  LEU n 
1 57  LEU n 
1 58  GLU n 
1 59  ILE n 
1 60  PHE n 
1 61  LYS n 
1 62  ILE n 
1 63  PRO n 
1 64  THR n 
1 65  GLN n 
1 66  GLN n 
1 67  PHE n 
1 68  MET n 
1 69  ASN n 
1 70  TYR n 
1 71  PHE n 
1 72  ARG n 
1 73  ALA n 
1 74  LEU n 
1 75  GLU n 
1 76  ASN n 
1 77  GLY n 
1 78  TYR n 
1 79  ARG n 
1 80  ASP n 
1 81  ILE n 
1 82  PRO n 
1 83  TYR n 
1 84  HIS n 
1 85  ASN n 
1 86  ARG n 
1 87  ILE n 
1 88  HIS n 
1 89  ALA n 
1 90  THR n 
1 91  ASP n 
1 92  VAL n 
1 93  LEU n 
1 94  HIS n 
1 95  ALA n 
1 96  VAL n 
1 97  TRP n 
1 98  TYR n 
1 99  LEU n 
1 100 THR n 
1 101 THR n 
1 102 ARG n 
1 103 PRO n 
1 104 VAL n 
1 105 PRO n 
1 106 GLY n 
1 107 LEU n 
1 108 GLN n 
1 109 GLN n 
1 110 ILE n 
1 111 HIS n 
1 112 ASN n 
1 113 GLY n 
1 114 CYS n 
1 115 GLY n 
1 116 THR n 
1 117 GLY n 
1 118 ASN n 
1 119 GLU n 
1 120 THR n 
1 121 ASP n 
1 122 SER n 
1 123 ASP n 
1 124 GLY n 
1 125 ARG n 
1 126 ILE n 
1 127 ASN n 
1 128 HIS n 
1 129 GLY n 
1 130 ARG n 
1 131 ILE n 
1 132 ALA n 
1 133 TYR n 
1 134 ILE n 
1 135 SER n 
1 136 SER n 
1 137 LYS n 
1 138 SER n 
1 139 CYS n 
1 140 SER n 
1 141 ASN n 
1 142 PRO n 
1 143 ASP n 
1 144 GLU n 
1 145 SER n 
1 146 TYR n 
1 147 GLY n 
1 148 CYS n 
1 149 LEU n 
1 150 SER n 
1 151 SER n 
1 152 ASN n 
1 153 ILE n 
1 154 PRO n 
1 155 ALA n 
1 156 LEU n 
1 157 GLU n 
1 158 LEU n 
1 159 MET n 
1 160 ALA n 
1 161 LEU n 
1 162 TYR n 
1 163 VAL n 
1 164 ALA n 
1 165 ALA n 
1 166 ALA n 
1 167 MET n 
1 168 HIS n 
1 169 ASP n 
1 170 TYR n 
1 171 ASP n 
1 172 HIS n 
1 173 PRO n 
1 174 GLY n 
1 175 ARG n 
1 176 THR n 
1 177 ASN n 
1 178 ALA n 
1 179 PHE n 
1 180 LEU n 
1 181 VAL n 
1 182 ALA n 
1 183 THR n 
1 184 ASN n 
1 185 ALA n 
1 186 PRO n 
1 187 GLN n 
1 188 ALA n 
1 189 VAL n 
1 190 LEU n 
1 191 TYR n 
1 192 ASN n 
1 193 ASP n 
1 194 ARG n 
1 195 SER n 
1 196 VAL n 
1 197 LEU n 
1 198 GLU n 
1 199 ASN n 
1 200 HIS n 
1 201 HIS n 
1 202 ALA n 
1 203 ALA n 
1 204 SER n 
1 205 ALA n 
1 206 TRP n 
1 207 ASN n 
1 208 LEU n 
1 209 TYR n 
1 210 LEU n 
1 211 SER n 
1 212 ARG n 
1 213 PRO n 
1 214 GLU n 
1 215 TYR n 
1 216 ASN n 
1 217 PHE n 
1 218 LEU n 
1 219 LEU n 
1 220 HIS n 
1 221 LEU n 
1 222 ASP n 
1 223 HIS n 
1 224 VAL n 
1 225 GLU n 
1 226 PHE n 
1 227 LYS n 
1 228 ARG n 
1 229 PHE n 
1 230 ARG n 
1 231 PHE n 
1 232 LEU n 
1 233 VAL n 
1 234 ILE n 
1 235 GLU n 
1 236 ALA n 
1 237 ILE n 
1 238 LEU n 
1 239 ALA n 
1 240 THR n 
1 241 ASP n 
1 242 LEU n 
1 243 LYS n 
1 244 LYS n 
1 245 HIS n 
1 246 PHE n 
1 247 ASP n 
1 248 PHE n 
1 249 LEU n 
1 250 ALA n 
1 251 GLU n 
1 252 PHE n 
1 253 ASN n 
1 254 ALA n 
1 255 LYS n 
1 256 ALA n 
1 257 ASN n 
1 258 ASP n 
1 259 VAL n 
1 260 ASN n 
1 261 SER n 
1 262 ASN n 
1 263 GLY n 
1 264 ILE n 
1 265 GLU n 
1 266 TRP n 
1 267 SER n 
1 268 ASN n 
1 269 GLU n 
1 270 ASN n 
1 271 ASP n 
1 272 ARG n 
1 273 LEU n 
1 274 LEU n 
1 275 VAL n 
1 276 CYS n 
1 277 GLN n 
1 278 VAL n 
1 279 CYS n 
1 280 ILE n 
1 281 LYS n 
1 282 LEU n 
1 283 ALA n 
1 284 ASP n 
1 285 ILE n 
1 286 ASN n 
1 287 GLY n 
1 288 PRO n 
1 289 ALA n 
1 290 LYS n 
1 291 VAL n 
1 292 ARG n 
1 293 ASP n 
1 294 LEU n 
1 295 HIS n 
1 296 LEU n 
1 297 LYS n 
1 298 TRP n 
1 299 THR n 
1 300 GLU n 
1 301 GLY n 
1 302 ILE n 
1 303 VAL n 
1 304 ASN n 
1 305 GLU n 
1 306 PHE n 
1 307 TYR n 
1 308 GLU n 
1 309 GLN n 
1 310 GLY n 
1 311 ASP n 
1 312 GLU n 
1 313 GLU n 
1 314 ALA n 
1 315 ASN n 
1 316 LEU n 
1 317 GLY n 
1 318 LEU n 
1 319 PRO n 
1 320 ILE n 
1 321 SER n 
1 322 PRO n 
1 323 PHE n 
1 324 MET n 
1 325 ASP n 
1 326 ARG n 
1 327 SER n 
1 328 SER n 
1 329 PRO n 
1 330 GLN n 
1 331 LEU n 
1 332 ALA n 
1 333 LYS n 
1 334 LEU n 
1 335 GLN n 
1 336 GLU n 
1 337 SER n 
1 338 PHE n 
1 339 ILE n 
1 340 THR n 
1 341 HIS n 
1 342 ILE n 
1 343 VAL n 
1 344 GLY n 
1 345 PRO n 
1 346 LEU n 
1 347 CYS n 
1 348 ASN n 
1 349 SER n 
1 350 TYR n 
1 351 ASP n 
1 352 ALA n 
1 353 ALA n 
1 354 GLY n 
1 355 LEU n 
1 356 LEU n 
1 357 PRO n 
1 358 GLY n 
1 359 GLN n 
1 360 TRP n 
1 361 LEU n 
1 362 GLU n 
1 363 ALA n 
1 364 GLU n 
1 365 GLU n 
1 366 ASP n 
1 367 ASN n 
1 368 ASP n 
1 369 THR n 
1 370 GLU n 
1 371 SER n 
1 372 GLY n 
1 373 ASP n 
1 374 ASP n 
1 375 GLU n 
1 376 ASP n 
1 377 GLY n 
1 378 GLU n 
1 379 GLU n 
1 380 LEU n 
1 381 ASP n 
1 382 THR n 
1 383 GLU n 
1 384 ASP n 
1 385 GLU n 
1 386 GLU n 
1 387 MET n 
1 388 GLU n 
1 389 ASN n 
1 390 ASN n 
1 391 LEU n 
1 392 ASN n 
1 393 PRO n 
1 394 LYS n 
1 395 PRO n 
1 396 PRO n 
1 397 ARG n 
1 398 ARG n 
1 399 LYS n 
1 400 SER n 
1 401 ARG n 
1 402 ARG n 
1 403 ARG n 
1 404 ILE n 
1 405 PHE n 
1 406 CYS n 
1 407 GLN n 
1 408 LEU n 
1 409 MET n 
1 410 HIS n 
1 411 HIS n 
1 412 LEU n 
1 413 THR n 
1 414 GLU n 
1 415 ASN n 
1 416 HIS n 
1 417 LYS n 
1 418 ILE n 
1 419 TRP n 
1 420 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PDE3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               CodonPlus 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET30a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDE3B_HUMAN 
_struct_ref.pdbx_db_accession          Q13370 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRD
IPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMA
LYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILAT
DLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPI
SPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPRRKS
RRRIFCQLMHHLTENHKIWK
;
_struct_ref.pdbx_align_begin           654 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1SO2 A 1 ? 420 ? Q13370 654 ? 1073 ? 654 1073 
2 1 1SO2 B 1 ? 420 ? Q13370 654 ? 1073 ? 654 1073 
3 1 1SO2 C 1 ? 420 ? Q13370 654 ? 1073 ? 654 1073 
4 1 1SO2 D 1 ? 420 ? Q13370 654 ? 1073 ? 654 1073 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
666 non-polymer         . '6-(4-{[2-(3-IODOBENZYL)-3-OXOCYCLOHEX-1-EN-1-YL]AMINO}PHENYL)-5-METHYL-4,5-DIHYDROPYRIDAZIN-3(2H)-ONE' 
'(5R)-6-(4-{[2-(3-IODOBENZYL)-3-OXOCYCLOHEX-1-EN-1-YL]AMINO}PHENYL)-5-METHYL-4,5-DIHYDROPYRIDAZIN-3(2H)-ONE' 'C24 H24 I N3 O2' 
513.371 
ALA 'L-peptide linking' y ALANINE                                                                                                 
?                                                                                                            'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                
?                                                                                                            'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
?                                                                                                            'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
?                                                                                                            'C4 H7 N O4'      
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                                
?                                                                                                            'C3 H7 N O2 S'    
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
?                                                                                                            'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
?                                                                                                            'C5 H9 N O4'      
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
?                                                                                                            'C2 H5 N O2'      
75.067  
HG9 non-polymer         . '1-DEOXY-1-[(2-HYDROXYETHYL)(NONANOYL)AMINO]HEXITOL'                                                    
'HG9A-9, NONANOYL-N-HYDROXYETHYLGLUCAMIDE'                                                                   'C17 H35 N O7'    
365.462 
HIS 'L-peptide linking' y HISTIDINE                                                                                               
?                                                                                                            'C6 H10 N3 O2 1'  
156.162 
HOH non-polymer         . WATER                                                                                                   
?                                                                                                            'H2 O'            
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
?                                                                                                            'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                 
?                                                                                                            'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                  
?                                                                                                            'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
?                                                                                                            'C5 H11 N O2 S'   
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                                         
?                                                                                                            'Mg 2'            
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
?                                                                                                            'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                 
?                                                                                                            'C5 H9 N O2'      
115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
?                                                                                                            'C3 H7 N O3'      
105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
?                                                                                                            'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                              
?                                                                                                            'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                
?                                                                                                            'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking' y VALINE                                                                                                  
?                                                                                                            'C5 H11 N O2'     
117.146 
# 
_exptl.entry_id          1SO2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.93 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      3.34 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'Peg MMe, MES, MAgnesium Sulfate, HEGA-9, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2002-11-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.000 1.0 
2 1.0   1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             1.000 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1SO2 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   85711 
_reflns.number_all                   85883 
_reflns.percent_possible_obs         99.80 
_reflns.pdbx_Rmerge_I_obs            0.064 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.40000 
_reflns.B_iso_Wilson_estimate        47.60 
_reflns.pdbx_redundancy              5.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   99.70 
_reflns_shell.Rmerge_I_obs           0.315 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        5.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      8543 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1SO2 
_refine.ls_number_reflns_obs                     85708 
_refine.ls_number_reflns_all                     85874 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.239 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.277 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  5354 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.70 
_refine.aniso_B[1][1]                            -0.0200 
_refine.aniso_B[2][2]                            -21.375 
_refine.aniso_B[3][3]                            21.2950 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            8.50100 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 0.33 
_refine.solvent_model_param_bsol                 41.10 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1F0J 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1SO2 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.390 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.42 
_refine_analyze.Luzzati_sigma_a_free            0.45 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11705 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         225 
_refine_hist.number_atoms_solvent             362 
_refine_hist.number_atoms_total               12292 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.012 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.37  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 20.82 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.95  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.12  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.84  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.78  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.62  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.50 
_refine_ls_shell.number_reflns_R_work             8105 
_refine_ls_shell.R_factor_R_work                  0.318 
_refine_ls_shell.percent_reflns_obs               99.80 
_refine_ls_shell.R_factor_R_free                  0.341 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.00 
_refine_ls_shell.number_reflns_R_free             433 
_refine_ls_shell.number_reflns_obs                8538 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 ION.PARAM         WATER.TOP   'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   ION.TOP     'X-RAY DIFFRACTION' 
4 CIS_PEPTIDE.PARAM ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1SO2 
_struct.title                     'CATALYTIC DOMAIN OF HUMAN PHOSPHODIESTERASE 3B In COMPLEX WITH A DIHYDROPYRIDAZINE INHIBITOR' 
_struct.pdbx_descriptor           'CATALYTIC DOMAIN OF HUMAN PHOSPHODIESTERASE 3B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1SO2 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'PDE3B PHOSPHODIESTERASE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 4 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 4 ? 
S N N 2 ? 
T N N 2 ? 
U N N 4 ? 
V N N 5 ? 
W N N 5 ? 
X N N 5 ? 
Y N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 8   ? SER A 22  ? LEU A 661  SER A 675  1 ? 15 
HELX_P HELX_P2  2  PRO A 27  ? GLY A 36  ? PRO A 680  GLY A 689  1 ? 10 
HELX_P HELX_P3  3  GLU A 37  ? GLY A 40  ? GLU A 690  GLY A 693  5 ? 4  
HELX_P HELX_P4  4  ARG A 41  ? THR A 54  ? ARG A 694  THR A 707  1 ? 14 
HELX_P HELX_P5  5  GLY A 55  ? PHE A 60  ? GLY A 708  PHE A 713  1 ? 6  
HELX_P HELX_P6  6  PRO A 63  ? ASN A 76  ? PRO A 716  ASN A 729  1 ? 14 
HELX_P HELX_P7  7  ASN A 85  ? THR A 100 ? ASN A 738  THR A 753  1 ? 16 
HELX_P HELX_P8  8  CYS A 148 ? ASN A 152 ? CYS A 801  ASN A 805  5 ? 5  
HELX_P HELX_P9  9  PRO A 154 ? HIS A 168 ? PRO A 807  HIS A 821  1 ? 15 
HELX_P HELX_P10 10 THR A 176 ? THR A 183 ? THR A 829  THR A 836  1 ? 8  
HELX_P HELX_P11 11 ALA A 185 ? TYR A 191 ? ALA A 838  TYR A 844  1 ? 7  
HELX_P HELX_P12 12 SER A 195 ? SER A 211 ? SER A 848  SER A 864  1 ? 17 
HELX_P HELX_P13 13 ARG A 212 ? ASN A 216 ? ARG A 865  ASN A 869  5 ? 5  
HELX_P HELX_P14 14 ASP A 222 ? ALA A 239 ? ASP A 875  ALA A 892  1 ? 18 
HELX_P HELX_P15 15 THR A 240 ? LYS A 243 ? THR A 893  LYS A 896  5 ? 4  
HELX_P HELX_P16 16 LYS A 244 ? ASN A 257 ? LYS A 897  ASN A 910  1 ? 14 
HELX_P HELX_P17 17 ASN A 268 ? ILE A 285 ? ASN A 921  ILE A 938  1 ? 18 
HELX_P HELX_P18 18 ASN A 286 ? LYS A 290 ? ASN A 939  LYS A 943  5 ? 5  
HELX_P HELX_P19 19 VAL A 291 ? LEU A 316 ? VAL A 944  LEU A 969  1 ? 26 
HELX_P HELX_P20 20 GLN A 330 ? ILE A 342 ? GLN A 983  ILE A 995  1 ? 13 
HELX_P HELX_P21 21 ILE A 342 ? ALA A 353 ? ILE A 995  ALA A 1006 1 ? 12 
HELX_P HELX_P22 22 CYS A 406 ? LYS A 420 ? CYS A 1059 LYS A 1073 1 ? 15 
HELX_P HELX_P23 23 LEU B 10  ? SER B 22  ? LEU B 663  SER B 675  1 ? 13 
HELX_P HELX_P24 24 PRO B 27  ? MET B 35  ? PRO B 680  MET B 688  1 ? 9  
HELX_P HELX_P25 25 GLU B 37  ? GLY B 40  ? GLU B 690  GLY B 693  5 ? 4  
HELX_P HELX_P26 26 ARG B 41  ? GLY B 55  ? ARG B 694  GLY B 708  1 ? 15 
HELX_P HELX_P27 27 GLY B 55  ? PHE B 60  ? GLY B 708  PHE B 713  1 ? 6  
HELX_P HELX_P28 28 PRO B 63  ? ASN B 76  ? PRO B 716  ASN B 729  1 ? 14 
HELX_P HELX_P29 29 ASN B 85  ? ARG B 102 ? ASN B 738  ARG B 755  1 ? 18 
HELX_P HELX_P30 30 CYS B 148 ? ASN B 152 ? CYS B 801  ASN B 805  5 ? 5  
HELX_P HELX_P31 31 PRO B 154 ? HIS B 168 ? PRO B 807  HIS B 821  1 ? 15 
HELX_P HELX_P32 32 THR B 176 ? THR B 183 ? THR B 829  THR B 836  1 ? 8  
HELX_P HELX_P33 33 ALA B 185 ? TYR B 191 ? ALA B 838  TYR B 844  1 ? 7  
HELX_P HELX_P34 34 SER B 195 ? ARG B 212 ? SER B 848  ARG B 865  1 ? 18 
HELX_P HELX_P35 35 PRO B 213 ? ASN B 216 ? PRO B 866  ASN B 869  5 ? 4  
HELX_P HELX_P36 36 ASP B 222 ? ALA B 239 ? ASP B 875  ALA B 892  1 ? 18 
HELX_P HELX_P37 37 THR B 240 ? LYS B 243 ? THR B 893  LYS B 896  5 ? 4  
HELX_P HELX_P38 38 LYS B 244 ? ASP B 258 ? LYS B 897  ASP B 911  1 ? 15 
HELX_P HELX_P39 39 ASN B 268 ? ILE B 285 ? ASN B 921  ILE B 938  1 ? 18 
HELX_P HELX_P40 40 ASN B 286 ? LYS B 290 ? ASN B 939  LYS B 943  5 ? 5  
HELX_P HELX_P41 41 VAL B 291 ? LEU B 316 ? VAL B 944  LEU B 969  1 ? 26 
HELX_P HELX_P42 42 GLN B 330 ? ILE B 342 ? GLN B 983  ILE B 995  1 ? 13 
HELX_P HELX_P43 43 ILE B 342 ? ALA B 353 ? ILE B 995  ALA B 1006 1 ? 12 
HELX_P HELX_P44 44 CYS B 406 ? LYS B 420 ? CYS B 1059 LYS B 1073 1 ? 15 
HELX_P HELX_P45 45 ILE C 9   ? SER C 22  ? ILE C 662  SER C 675  1 ? 14 
HELX_P HELX_P46 46 PRO C 27  ? GLY C 36  ? PRO C 680  GLY C 689  1 ? 10 
HELX_P HELX_P47 47 GLU C 37  ? GLY C 40  ? GLU C 690  GLY C 693  5 ? 4  
HELX_P HELX_P48 48 ARG C 41  ? GLY C 55  ? ARG C 694  GLY C 708  1 ? 15 
HELX_P HELX_P49 49 GLY C 55  ? PHE C 60  ? GLY C 708  PHE C 713  1 ? 6  
HELX_P HELX_P50 50 PRO C 63  ? ASN C 76  ? PRO C 716  ASN C 729  1 ? 14 
HELX_P HELX_P51 51 ASN C 85  ? ARG C 102 ? ASN C 738  ARG C 755  1 ? 18 
HELX_P HELX_P52 52 CYS C 148 ? ASN C 152 ? CYS C 801  ASN C 805  5 ? 5  
HELX_P HELX_P53 53 PRO C 154 ? HIS C 168 ? PRO C 807  HIS C 821  1 ? 15 
HELX_P HELX_P54 54 THR C 176 ? THR C 183 ? THR C 829  THR C 836  1 ? 8  
HELX_P HELX_P55 55 ALA C 185 ? TYR C 191 ? ALA C 838  TYR C 844  1 ? 7  
HELX_P HELX_P56 56 SER C 195 ? ARG C 212 ? SER C 848  ARG C 865  1 ? 18 
HELX_P HELX_P57 57 PRO C 213 ? ASN C 216 ? PRO C 866  ASN C 869  5 ? 4  
HELX_P HELX_P58 58 ASP C 222 ? THR C 240 ? ASP C 875  THR C 893  1 ? 19 
HELX_P HELX_P59 59 ASP C 241 ? LYS C 243 ? ASP C 894  LYS C 896  5 ? 3  
HELX_P HELX_P60 60 LYS C 244 ? ASN C 257 ? LYS C 897  ASN C 910  1 ? 14 
HELX_P HELX_P61 61 ASN C 268 ? ILE C 285 ? ASN C 921  ILE C 938  1 ? 18 
HELX_P HELX_P62 62 ASN C 286 ? LYS C 290 ? ASN C 939  LYS C 943  5 ? 5  
HELX_P HELX_P63 63 VAL C 291 ? LEU C 316 ? VAL C 944  LEU C 969  1 ? 26 
HELX_P HELX_P64 64 GLN C 330 ? ILE C 342 ? GLN C 983  ILE C 995  1 ? 13 
HELX_P HELX_P65 65 ILE C 342 ? ALA C 353 ? ILE C 995  ALA C 1006 1 ? 12 
HELX_P HELX_P66 66 CYS C 406 ? LYS C 420 ? CYS C 1059 LYS C 1073 1 ? 15 
HELX_P HELX_P67 67 LEU D 8   ? SER D 22  ? LEU D 661  SER D 675  1 ? 15 
HELX_P HELX_P68 68 PRO D 27  ? MET D 35  ? PRO D 680  MET D 688  1 ? 9  
HELX_P HELX_P69 69 GLY D 36  ? GLY D 40  ? GLY D 689  GLY D 693  5 ? 5  
HELX_P HELX_P70 70 ARG D 41  ? GLY D 55  ? ARG D 694  GLY D 708  1 ? 15 
HELX_P HELX_P71 71 GLY D 55  ? PHE D 60  ? GLY D 708  PHE D 713  1 ? 6  
HELX_P HELX_P72 72 PRO D 63  ? ASN D 76  ? PRO D 716  ASN D 729  1 ? 14 
HELX_P HELX_P73 73 ASN D 85  ? THR D 101 ? ASN D 738  THR D 754  1 ? 17 
HELX_P HELX_P74 74 CYS D 148 ? ASN D 152 ? CYS D 801  ASN D 805  5 ? 5  
HELX_P HELX_P75 75 PRO D 154 ? ALA D 166 ? PRO D 807  ALA D 819  1 ? 13 
HELX_P HELX_P76 76 THR D 176 ? THR D 183 ? THR D 829  THR D 836  1 ? 8  
HELX_P HELX_P77 77 ALA D 185 ? TYR D 191 ? ALA D 838  TYR D 844  1 ? 7  
HELX_P HELX_P78 78 SER D 195 ? LEU D 210 ? SER D 848  LEU D 863  1 ? 16 
HELX_P HELX_P79 79 ARG D 212 ? ASN D 216 ? ARG D 865  ASN D 869  5 ? 5  
HELX_P HELX_P80 80 ASP D 222 ? LEU D 238 ? ASP D 875  LEU D 891  1 ? 17 
HELX_P HELX_P81 81 ALA D 239 ? LYS D 243 ? ALA D 892  LYS D 896  5 ? 5  
HELX_P HELX_P82 82 LYS D 244 ? ALA D 256 ? LYS D 897  ALA D 909  1 ? 13 
HELX_P HELX_P83 83 ASN D 268 ? ILE D 285 ? ASN D 921  ILE D 938  1 ? 18 
HELX_P HELX_P84 84 ASN D 286 ? LYS D 290 ? ASN D 939  LYS D 943  5 ? 5  
HELX_P HELX_P85 85 VAL D 291 ? LEU D 316 ? VAL D 944  LEU D 969  1 ? 26 
HELX_P HELX_P86 86 GLN D 330 ? ILE D 342 ? GLN D 983  ILE D 995  1 ? 13 
HELX_P HELX_P87 87 ILE D 342 ? GLY D 354 ? ILE D 995  GLY D 1007 1 ? 13 
HELX_P HELX_P88 88 CYS D 406 ? LYS D 420 ? CYS D 1059 LYS D 1073 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG . MG ? ? ? 1_555 A HIS 88  NE2 ? ? A MG 471 A HIS 741 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc2  metalc ? ? E MG . MG ? ? ? 1_555 A HIS 168 NE2 ? ? A MG 471 A HIS 821 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc3  metalc ? ? E MG . MG ? ? ? 1_555 A ASP 284 OD1 ? ? A MG 471 A ASP 937 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc4  metalc ? ? E MG . MG ? ? ? 1_555 A ASP 169 OD2 ? ? A MG 471 A ASP 822 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc5  metalc ? ? E MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 471 A HOH 11  1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc6  metalc ? ? F MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 472 A HOH 15  1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc7  metalc ? ? F MG . MG ? ? ? 1_555 A ASP 169 OD1 ? ? A MG 472 A ASP 822 1_555 ? ? ? ? ? ? ? 1.914 ? 
metalc8  metalc ? ? F MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 472 A HOH 11  1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc9  metalc ? ? F MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 472 A HOH 12  1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc10 metalc ? ? F MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 472 A HOH 13  1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc11 metalc ? ? F MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 472 A HOH 14  1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc12 metalc ? ? G MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 479 A HOH 51  1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc13 metalc ? ? G MG . MG ? ? ? 1_555 A ASN 315 OD1 ? ? A MG 479 A ASN 968 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc14 metalc ? ? G MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 479 A HOH 52  1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc15 metalc ? ? G MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 479 A HOH 53  1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc16 metalc ? ? G MG . MG ? ? ? 1_555 V HOH .   O   ? ? A MG 479 A HOH 54  1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc17 metalc ? ? K MG . MG ? ? ? 1_555 B HIS 168 NE2 ? ? B MG 473 B HIS 821 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc18 metalc ? ? K MG . MG ? ? ? 1_555 B ASP 169 OD2 ? ? B MG 473 B ASP 822 1_555 ? ? ? ? ? ? ? 1.854 ? 
metalc19 metalc ? ? K MG . MG ? ? ? 1_555 B ASP 284 OD1 ? ? B MG 473 B ASP 937 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc20 metalc ? ? K MG . MG ? ? ? 1_555 W HOH .   O   ? ? B MG 473 B HOH 21  1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc21 metalc ? ? K MG . MG ? ? ? 1_555 B HIS 88  NE2 ? ? B MG 473 B HIS 741 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc22 metalc ? ? L MG . MG ? ? ? 1_555 W HOH .   O   ? ? B MG 474 B HOH 22  1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc23 metalc ? ? L MG . MG ? ? ? 1_555 B ASP 169 OD1 ? ? B MG 474 B ASP 822 1_555 ? ? ? ? ? ? ? 1.824 ? 
metalc24 metalc ? ? L MG . MG ? ? ? 1_555 W HOH .   O   ? ? B MG 474 B HOH 23  1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc25 metalc ? ? L MG . MG ? ? ? 1_555 W HOH .   O   ? ? B MG 474 B HOH 24  1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc26 metalc ? ? L MG . MG ? ? ? 1_555 W HOH .   O   ? ? B MG 474 B HOH 26  1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc27 metalc ? ? L MG . MG ? ? ? 1_555 W HOH .   O   ? ? B MG 474 B HOH 21  1_555 ? ? ? ? ? ? ? 1.969 ? 
metalc28 metalc ? ? P MG . MG ? ? ? 1_555 C ASP 169 OD2 ? ? C MG 475 C ASP 822 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc29 metalc ? ? P MG . MG ? ? ? 1_555 X HOH .   O   ? ? C MG 475 C HOH 31  1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc30 metalc ? ? P MG . MG ? ? ? 1_555 C HIS 168 NE2 ? ? C MG 475 C HIS 821 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc31 metalc ? ? P MG . MG ? ? ? 1_555 C ASP 284 OD1 ? ? C MG 475 C ASP 937 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc32 metalc ? ? P MG . MG ? ? ? 1_555 C ASP 284 OD2 ? ? C MG 475 C ASP 937 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc33 metalc ? ? P MG . MG ? ? ? 1_555 C HIS 88  NE2 ? ? C MG 475 C HIS 741 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc34 metalc ? ? Q MG . MG ? ? ? 1_555 X HOH .   O   ? ? C MG 476 C HOH 31  1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc35 metalc ? ? Q MG . MG ? ? ? 1_555 X HOH .   O   ? ? C MG 476 C HOH 33  1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc36 metalc ? ? Q MG . MG ? ? ? 1_555 X HOH .   O   ? ? C MG 476 C HOH 34  1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc37 metalc ? ? Q MG . MG ? ? ? 1_555 X HOH .   O   ? ? C MG 476 C HOH 32  1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc38 metalc ? ? Q MG . MG ? ? ? 1_555 X HOH .   O   ? ? C MG 476 C HOH 36  1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc39 metalc ? ? Q MG . MG ? ? ? 1_555 C ASP 169 OD1 ? ? C MG 476 C ASP 822 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc40 metalc ? ? S MG . MG ? ? ? 1_555 D ASP 169 OD2 ? ? D MG 477 D ASP 822 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc41 metalc ? ? S MG . MG ? ? ? 1_555 D ASP 284 OD1 ? ? D MG 477 D ASP 937 1_555 ? ? ? ? ? ? ? 1.854 ? 
metalc42 metalc ? ? S MG . MG ? ? ? 1_555 Y HOH .   O   ? ? D MG 477 D HOH 41  1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc43 metalc ? ? S MG . MG ? ? ? 1_555 D HIS 88  NE2 ? ? D MG 477 D HIS 741 1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc44 metalc ? ? S MG . MG ? ? ? 1_555 D ASP 284 OD2 ? ? D MG 477 D ASP 937 1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc45 metalc ? ? S MG . MG ? ? ? 1_555 D HIS 168 NE2 ? ? D MG 477 D HIS 821 1_555 ? ? ? ? ? ? ? 2.737 ? 
metalc46 metalc ? ? T MG . MG ? ? ? 1_555 D ASP 169 OD1 ? ? D MG 478 D ASP 822 1_555 ? ? ? ? ? ? ? 1.831 ? 
metalc47 metalc ? ? T MG . MG ? ? ? 1_555 Y HOH .   O   ? ? D MG 478 D HOH 41  1_555 ? ? ? ? ? ? ? 1.904 ? 
metalc48 metalc ? ? T MG . MG ? ? ? 1_555 Y HOH .   O   ? ? D MG 478 D HOH 42  1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc49 metalc ? ? T MG . MG ? ? ? 1_555 Y HOH .   O   ? ? D MG 478 D HOH 44  1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc50 metalc ? ? T MG . MG ? ? ? 1_555 Y HOH .   O   ? ? D MG 478 D HOH 46  1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc51 metalc ? ? T MG . MG ? ? ? 1_555 Y HOH .   O   ? ? D MG 478 D HOH 43  1_555 ? ? ? ? ? ? ? 1.772 ? 
metalc52 metalc ? ? G MG . MG ? ? ? 1_555 B ASP 222 OD1 ? ? A MG 479 B ASP 875 2_655 ? ? ? ? ? ? ? 2.109 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 104 ? PRO A 105 ? VAL A 757  PRO A 758  
A 2 TYR A 146 ? GLY A 147 ? TYR A 799  GLY A 800  
B 1 GLN A 359 ? TRP A 360 ? GLN A 1012 TRP A 1013 
B 2 ILE A 404 ? PHE A 405 ? ILE A 1057 PHE A 1058 
C 1 VAL B 104 ? PRO B 105 ? VAL B 757  PRO B 758  
C 2 TYR B 146 ? GLY B 147 ? TYR B 799  GLY B 800  
D 1 GLN B 359 ? TRP B 360 ? GLN B 1012 TRP B 1013 
D 2 ILE B 404 ? PHE B 405 ? ILE B 1057 PHE B 1058 
E 1 VAL C 104 ? PRO C 105 ? VAL C 757  PRO C 758  
E 2 TYR C 146 ? GLY C 147 ? TYR C 799  GLY C 800  
F 1 GLN C 359 ? TRP C 360 ? GLN C 1012 TRP C 1013 
F 2 ILE C 404 ? PHE C 405 ? ILE C 1057 PHE C 1058 
G 1 GLN D 359 ? TRP D 360 ? GLN D 1012 TRP D 1013 
G 2 ILE D 404 ? PHE D 405 ? ILE D 1057 PHE D 1058 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 104 ? N VAL A 757  O GLY A 147 ? O GLY A 800  
B 1 2 N GLN A 359 ? N GLN A 1012 O PHE A 405 ? O PHE A 1058 
C 1 2 N VAL B 104 ? N VAL B 757  O GLY B 147 ? O GLY B 800  
D 1 2 N GLN B 359 ? N GLN B 1012 O PHE B 405 ? O PHE B 1058 
E 1 2 N VAL C 104 ? N VAL C 757  O GLY C 147 ? O GLY C 800  
F 1 2 N GLN C 359 ? N GLN C 1012 O PHE C 405 ? O PHE C 1058 
G 1 2 N GLN D 359 ? N GLN D 1012 O PHE D 405 ? O PHE D 1058 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 471'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 472'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 473'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG B 474'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG C 475'  
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG C 476'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 477'  
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG D 478'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 479'  
BC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HG9 B 451' 
BC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE HG9 B 452' 
BC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HG9 A 453' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE HG9 A 454' 
BC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE 666 A 461' 
BC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 666 B 462' 
BC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 666 C 463' 
BC8 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 666 D 464' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  HOH V .   ? HOH A 11   . ? 1_555 ? 
2   AC1 5  HIS A 88  ? HIS A 741  . ? 1_555 ? 
3   AC1 5  HIS A 168 ? HIS A 821  . ? 1_555 ? 
4   AC1 5  ASP A 169 ? ASP A 822  . ? 1_555 ? 
5   AC1 5  ASP A 284 ? ASP A 937  . ? 1_555 ? 
6   AC2 6  HOH V .   ? HOH A 11   . ? 1_555 ? 
7   AC2 6  HOH V .   ? HOH A 12   . ? 1_555 ? 
8   AC2 6  HOH V .   ? HOH A 13   . ? 1_555 ? 
9   AC2 6  HOH V .   ? HOH A 14   . ? 1_555 ? 
10  AC2 6  HOH V .   ? HOH A 15   . ? 1_555 ? 
11  AC2 6  ASP A 169 ? ASP A 822  . ? 1_555 ? 
12  AC3 6  HOH W .   ? HOH B 21   . ? 1_555 ? 
13  AC3 6  MG  L .   ? MG  B 474  . ? 1_555 ? 
14  AC3 6  HIS B 88  ? HIS B 741  . ? 1_555 ? 
15  AC3 6  HIS B 168 ? HIS B 821  . ? 1_555 ? 
16  AC3 6  ASP B 169 ? ASP B 822  . ? 1_555 ? 
17  AC3 6  ASP B 284 ? ASP B 937  . ? 1_555 ? 
18  AC4 7  HOH W .   ? HOH B 21   . ? 1_555 ? 
19  AC4 7  HOH W .   ? HOH B 22   . ? 1_555 ? 
20  AC4 7  HOH W .   ? HOH B 23   . ? 1_555 ? 
21  AC4 7  HOH W .   ? HOH B 24   . ? 1_555 ? 
22  AC4 7  HOH W .   ? HOH B 26   . ? 1_555 ? 
23  AC4 7  MG  K .   ? MG  B 473  . ? 1_555 ? 
24  AC4 7  ASP B 169 ? ASP B 822  . ? 1_555 ? 
25  AC5 5  HOH X .   ? HOH C 31   . ? 1_555 ? 
26  AC5 5  HIS C 88  ? HIS C 741  . ? 1_555 ? 
27  AC5 5  HIS C 168 ? HIS C 821  . ? 1_555 ? 
28  AC5 5  ASP C 169 ? ASP C 822  . ? 1_555 ? 
29  AC5 5  ASP C 284 ? ASP C 937  . ? 1_555 ? 
30  AC6 6  HOH X .   ? HOH C 31   . ? 1_555 ? 
31  AC6 6  HOH X .   ? HOH C 32   . ? 1_555 ? 
32  AC6 6  HOH X .   ? HOH C 33   . ? 1_555 ? 
33  AC6 6  HOH X .   ? HOH C 34   . ? 1_555 ? 
34  AC6 6  HOH X .   ? HOH C 36   . ? 1_555 ? 
35  AC6 6  ASP C 169 ? ASP C 822  . ? 1_555 ? 
36  AC7 6  HOH Y .   ? HOH D 41   . ? 1_555 ? 
37  AC7 6  MG  T .   ? MG  D 478  . ? 1_555 ? 
38  AC7 6  HIS D 88  ? HIS D 741  . ? 1_555 ? 
39  AC7 6  HIS D 168 ? HIS D 821  . ? 1_555 ? 
40  AC7 6  ASP D 169 ? ASP D 822  . ? 1_555 ? 
41  AC7 6  ASP D 284 ? ASP D 937  . ? 1_555 ? 
42  AC8 8  HOH Y .   ? HOH D 41   . ? 1_555 ? 
43  AC8 8  HOH Y .   ? HOH D 42   . ? 1_555 ? 
44  AC8 8  HOH Y .   ? HOH D 43   . ? 1_555 ? 
45  AC8 8  HOH Y .   ? HOH D 44   . ? 1_555 ? 
46  AC8 8  HOH Y .   ? HOH D 46   . ? 1_555 ? 
47  AC8 8  MG  S .   ? MG  D 477  . ? 1_555 ? 
48  AC8 8  HIS D 168 ? HIS D 821  . ? 1_555 ? 
49  AC8 8  ASP D 169 ? ASP D 822  . ? 1_555 ? 
50  AC9 6  HOH V .   ? HOH A 51   . ? 1_555 ? 
51  AC9 6  HOH V .   ? HOH A 52   . ? 1_555 ? 
52  AC9 6  HOH V .   ? HOH A 53   . ? 1_555 ? 
53  AC9 6  HOH V .   ? HOH A 54   . ? 1_555 ? 
54  AC9 6  ASN A 315 ? ASN A 968  . ? 1_555 ? 
55  AC9 6  ASP B 222 ? ASP B 875  . ? 2_655 ? 
56  BC1 10 HOH W .   ? HOH B 223  . ? 1_555 ? 
57  BC1 10 HOH W .   ? HOH B 256  . ? 1_555 ? 
58  BC1 10 HOH W .   ? HOH B 385  . ? 1_555 ? 
59  BC1 10 HOH W .   ? HOH B 391  . ? 1_555 ? 
60  BC1 10 ASN B 304 ? ASN B 957  . ? 1_555 ? 
61  BC1 10 ARG B 326 ? ARG B 979  . ? 1_555 ? 
62  BC1 10 LEU B 331 ? LEU B 984  . ? 1_555 ? 
63  BC1 10 ALA D 332 ? ALA D 985  . ? 2_656 ? 
64  BC1 10 ILE D 418 ? ILE D 1071 . ? 2_656 ? 
65  BC1 10 LYS D 420 ? LYS D 1073 . ? 2_656 ? 
66  BC2 9  ALA B 332 ? ALA B 985  . ? 1_555 ? 
67  BC2 9  LYS B 417 ? LYS B 1070 . ? 1_555 ? 
68  BC2 9  ILE B 418 ? ILE B 1071 . ? 1_555 ? 
69  BC2 9  LYS B 420 ? LYS B 1073 . ? 1_555 ? 
70  BC2 9  LEU D 296 ? LEU D 949  . ? 2_656 ? 
71  BC2 9  ASN D 304 ? ASN D 957  . ? 2_656 ? 
72  BC2 9  TYR D 307 ? TYR D 960  . ? 2_656 ? 
73  BC2 9  ARG D 326 ? ARG D 979  . ? 2_656 ? 
74  BC2 9  LEU D 331 ? LEU D 984  . ? 2_656 ? 
75  BC3 10 HOH V .   ? HOH A 126  . ? 1_555 ? 
76  BC3 10 HOH V .   ? HOH A 301  . ? 1_555 ? 
77  BC3 10 GLU A 300 ? GLU A 953  . ? 1_555 ? 
78  BC3 10 ASN A 304 ? ASN A 957  . ? 1_555 ? 
79  BC3 10 ARG A 326 ? ARG A 979  . ? 1_555 ? 
80  BC3 10 LEU A 331 ? LEU A 984  . ? 1_555 ? 
81  BC3 10 ARG B 130 ? ARG B 783  . ? 2_655 ? 
82  BC3 10 ALA C 332 ? ALA C 985  . ? 4_545 ? 
83  BC3 10 ILE C 418 ? ILE C 1071 . ? 4_545 ? 
84  BC3 10 LYS C 420 ? LYS C 1073 . ? 4_545 ? 
85  BC4 6  ALA A 332 ? ALA A 985  . ? 1_555 ? 
86  BC4 6  ILE A 418 ? ILE A 1071 . ? 1_555 ? 
87  BC4 6  LYS A 420 ? LYS A 1073 . ? 1_555 ? 
88  BC4 6  HOH X .   ? HOH C 288  . ? 4_545 ? 
89  BC4 6  ASN C 304 ? ASN C 957  . ? 4_545 ? 
90  BC4 6  ARG C 326 ? ARG C 979  . ? 4_545 ? 
91  BC5 14 HOH V .   ? HOH A 148  . ? 1_555 ? 
92  BC5 14 HOH V .   ? HOH A 200  . ? 1_555 ? 
93  BC5 14 TYR A 83  ? TYR A 736  . ? 1_555 ? 
94  BC5 14 THR A 176 ? THR A 829  . ? 1_555 ? 
95  BC5 14 ILE A 285 ? ILE A 938  . ? 1_555 ? 
96  BC5 14 GLY A 287 ? GLY A 940  . ? 1_555 ? 
97  BC5 14 PRO A 288 ? PRO A 941  . ? 1_555 ? 
98  BC5 14 HIS A 295 ? HIS A 948  . ? 1_555 ? 
99  BC5 14 TRP A 298 ? TRP A 951  . ? 1_555 ? 
100 BC5 14 THR A 299 ? THR A 952  . ? 1_555 ? 
101 BC5 14 LEU A 334 ? LEU A 987  . ? 1_555 ? 
102 BC5 14 GLN A 335 ? GLN A 988  . ? 1_555 ? 
103 BC5 14 SER A 337 ? SER A 990  . ? 1_555 ? 
104 BC5 14 PHE A 338 ? PHE A 991  . ? 1_555 ? 
105 BC6 12 TYR B 83  ? TYR B 736  . ? 1_555 ? 
106 BC6 12 ILE B 285 ? ILE B 938  . ? 1_555 ? 
107 BC6 12 GLY B 287 ? GLY B 940  . ? 1_555 ? 
108 BC6 12 PRO B 288 ? PRO B 941  . ? 1_555 ? 
109 BC6 12 HIS B 295 ? HIS B 948  . ? 1_555 ? 
110 BC6 12 TRP B 298 ? TRP B 951  . ? 1_555 ? 
111 BC6 12 THR B 299 ? THR B 952  . ? 1_555 ? 
112 BC6 12 PHE B 323 ? PHE B 976  . ? 1_555 ? 
113 BC6 12 LEU B 334 ? LEU B 987  . ? 1_555 ? 
114 BC6 12 GLN B 335 ? GLN B 988  . ? 1_555 ? 
115 BC6 12 SER B 337 ? SER B 990  . ? 1_555 ? 
116 BC6 12 PHE B 338 ? PHE B 991  . ? 1_555 ? 
117 BC7 13 HOH X .   ? HOH C 182  . ? 1_555 ? 
118 BC7 13 TYR C 83  ? TYR C 736  . ? 1_555 ? 
119 BC7 13 THR C 176 ? THR C 829  . ? 1_555 ? 
120 BC7 13 LEU C 242 ? LEU C 895  . ? 1_555 ? 
121 BC7 13 ILE C 285 ? ILE C 938  . ? 1_555 ? 
122 BC7 13 GLY C 287 ? GLY C 940  . ? 1_555 ? 
123 BC7 13 PRO C 288 ? PRO C 941  . ? 1_555 ? 
124 BC7 13 HIS C 295 ? HIS C 948  . ? 1_555 ? 
125 BC7 13 THR C 299 ? THR C 952  . ? 1_555 ? 
126 BC7 13 LEU C 334 ? LEU C 987  . ? 1_555 ? 
127 BC7 13 GLN C 335 ? GLN C 988  . ? 1_555 ? 
128 BC7 13 SER C 337 ? SER C 990  . ? 1_555 ? 
129 BC7 13 PHE C 338 ? PHE C 991  . ? 1_555 ? 
130 BC8 12 HOH Y .   ? HOH D 320  . ? 1_555 ? 
131 BC8 12 TYR D 83  ? TYR D 736  . ? 1_555 ? 
132 BC8 12 THR D 176 ? THR D 829  . ? 1_555 ? 
133 BC8 12 ILE D 285 ? ILE D 938  . ? 1_555 ? 
134 BC8 12 GLY D 287 ? GLY D 940  . ? 1_555 ? 
135 BC8 12 PRO D 288 ? PRO D 941  . ? 1_555 ? 
136 BC8 12 HIS D 295 ? HIS D 948  . ? 1_555 ? 
137 BC8 12 TRP D 298 ? TRP D 951  . ? 1_555 ? 
138 BC8 12 THR D 299 ? THR D 952  . ? 1_555 ? 
139 BC8 12 LEU D 334 ? LEU D 987  . ? 1_555 ? 
140 BC8 12 GLN D 335 ? GLN D 988  . ? 1_555 ? 
141 BC8 12 PHE D 338 ? PHE D 991  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1SO2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1SO2 
_atom_sites.fract_transf_matrix[1][1]   0.006780 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001286 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008212 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008035 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
I  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A 1 6   ? 24.054  5.563   26.238 1.00 76.21 ? 659  LEU A N   1 
ATOM   2     C  CA  . LEU A 1 6   ? 22.642  6.064   26.385 1.00 76.78 ? 659  LEU A CA  1 
ATOM   3     C  C   . LEU A 1 6   ? 21.815  5.111   27.271 1.00 76.81 ? 659  LEU A C   1 
ATOM   4     O  O   . LEU A 1 6   ? 20.896  4.426   26.790 1.00 77.41 ? 659  LEU A O   1 
ATOM   5     C  CB  . LEU A 1 6   ? 21.996  6.211   24.988 1.00 75.87 ? 659  LEU A CB  1 
ATOM   6     N  N   . ASP A 1 7   ? 22.150  5.089   28.565 1.00 77.01 ? 660  ASP A N   1 
ATOM   7     C  CA  . ASP A 1 7   ? 21.506  4.221   29.560 1.00 76.76 ? 660  ASP A CA  1 
ATOM   8     C  C   . ASP A 1 7   ? 22.035  2.758   29.467 1.00 77.08 ? 660  ASP A C   1 
ATOM   9     O  O   . ASP A 1 7   ? 23.043  2.409   30.097 1.00 76.29 ? 660  ASP A O   1 
ATOM   10    C  CB  . ASP A 1 7   ? 19.947  4.267   29.403 1.00 76.01 ? 660  ASP A CB  1 
ATOM   11    N  N   . LEU A 1 8   ? 21.363  1.920   28.670 1.00 77.46 ? 661  LEU A N   1 
ATOM   12    C  CA  . LEU A 1 8   ? 21.737  0.500   28.501 1.00 77.38 ? 661  LEU A CA  1 
ATOM   13    C  C   . LEU A 1 8   ? 22.725  0.231   27.352 1.00 77.20 ? 661  LEU A C   1 
ATOM   14    O  O   . LEU A 1 8   ? 23.223  -0.895  27.188 1.00 77.12 ? 661  LEU A O   1 
ATOM   15    C  CB  . LEU A 1 8   ? 20.467  -0.346  28.304 1.00 76.17 ? 661  LEU A CB  1 
ATOM   16    N  N   . ILE A 1 9   ? 22.993  1.270   26.561 1.00 77.07 ? 662  ILE A N   1 
ATOM   17    C  CA  . ILE A 1 9   ? 23.919  1.182   25.429 1.00 76.44 ? 662  ILE A CA  1 
ATOM   18    C  C   . ILE A 1 9   ? 25.370  1.392   25.909 1.00 75.57 ? 662  ILE A C   1 
ATOM   19    O  O   . ILE A 1 9   ? 26.322  1.059   25.197 1.00 75.46 ? 662  ILE A O   1 
ATOM   20    C  CB  . ILE A 1 9   ? 23.546  2.232   24.360 1.00 75.66 ? 662  ILE A CB  1 
ATOM   21    N  N   . LEU A 1 10  ? 25.530  1.932   27.120 1.00 74.61 ? 663  LEU A N   1 
ATOM   22    C  CA  . LEU A 1 10  ? 26.860  2.178   27.682 1.00 73.32 ? 663  LEU A CA  1 
ATOM   23    C  C   . LEU A 1 10  ? 27.530  0.845   27.991 1.00 72.23 ? 663  LEU A C   1 
ATOM   24    O  O   . LEU A 1 10  ? 28.753  0.703   27.868 1.00 72.04 ? 663  LEU A O   1 
ATOM   25    C  CB  . LEU A 1 10  ? 26.759  3.021   28.962 1.00 72.30 ? 663  LEU A CB  1 
ATOM   26    C  CG  . LEU A 1 10  ? 28.086  3.523   29.564 1.00 72.12 ? 663  LEU A CG  1 
ATOM   27    C  CD1 . LEU A 1 10  ? 28.785  4.471   28.564 1.00 71.07 ? 663  LEU A CD1 1 
ATOM   28    C  CD2 . LEU A 1 10  ? 27.802  4.222   30.917 1.00 70.57 ? 663  LEU A CD2 1 
ATOM   29    N  N   . VAL A 1 11  ? 26.710  -0.131  28.377 1.00 71.72 ? 664  VAL A N   1 
ATOM   30    C  CA  . VAL A 1 11  ? 27.191  -1.473  28.702 1.00 71.59 ? 664  VAL A CA  1 
ATOM   31    C  C   . VAL A 1 11  ? 27.443  -2.300  27.420 1.00 71.75 ? 664  VAL A C   1 
ATOM   32    O  O   . VAL A 1 11  ? 28.465  -2.997  27.309 1.00 72.28 ? 664  VAL A O   1 
ATOM   33    C  CB  . VAL A 1 11  ? 26.178  -2.217  29.620 1.00 70.46 ? 664  VAL A CB  1 
ATOM   34    C  CG1 . VAL A 1 11  ? 26.833  -3.451  30.224 1.00 69.74 ? 664  VAL A CG1 1 
ATOM   35    C  CG2 . VAL A 1 11  ? 25.679  -1.280  30.723 1.00 69.53 ? 664  VAL A CG2 1 
ATOM   36    N  N   . GLU A 1 12  ? 26.523  -2.223  26.454 1.00 71.11 ? 665  GLU A N   1 
ATOM   37    C  CA  . GLU A 1 12  ? 26.682  -2.958  25.200 1.00 69.97 ? 665  GLU A CA  1 
ATOM   38    C  C   . GLU A 1 12  ? 27.964  -2.528  24.488 1.00 67.73 ? 665  GLU A C   1 
ATOM   39    O  O   . GLU A 1 12  ? 28.661  -3.353  23.887 1.00 68.24 ? 665  GLU A O   1 
ATOM   40    C  CB  . GLU A 1 12  ? 25.476  -2.723  24.272 1.00 71.57 ? 665  GLU A CB  1 
ATOM   41    C  CG  . GLU A 1 12  ? 24.205  -3.508  24.641 1.00 72.74 ? 665  GLU A CG  1 
ATOM   42    C  CD  . GLU A 1 12  ? 23.005  -3.153  23.743 1.00 73.94 ? 665  GLU A CD  1 
ATOM   43    O  OE1 . GLU A 1 12  ? 23.032  -3.439  22.511 1.00 73.48 ? 665  GLU A OE1 1 
ATOM   44    O  OE2 . GLU A 1 12  ? 22.030  -2.576  24.278 1.00 74.51 ? 665  GLU A OE2 1 
ATOM   45    N  N   . GLU A 1 13  ? 28.266  -1.233  24.553 1.00 65.85 ? 666  GLU A N   1 
ATOM   46    C  CA  . GLU A 1 13  ? 29.473  -0.683  23.924 1.00 64.08 ? 666  GLU A CA  1 
ATOM   47    C  C   . GLU A 1 13  ? 30.732  -1.240  24.609 1.00 61.51 ? 666  GLU A C   1 
ATOM   48    O  O   . GLU A 1 13  ? 31.675  -1.665  23.946 1.00 60.79 ? 666  GLU A O   1 
ATOM   49    C  CB  . GLU A 1 13  ? 29.462  0.852   24.014 1.00 64.31 ? 666  GLU A CB  1 
ATOM   50    C  CG  . GLU A 1 13  ? 29.616  1.572   22.670 1.00 66.66 ? 666  GLU A CG  1 
ATOM   51    C  CD  . GLU A 1 13  ? 29.099  3.020   22.707 1.00 67.62 ? 666  GLU A CD  1 
ATOM   52    O  OE1 . GLU A 1 13  ? 29.177  3.719   21.662 1.00 66.43 ? 666  GLU A OE1 1 
ATOM   53    O  OE2 . GLU A 1 13  ? 28.607  3.450   23.784 1.00 68.09 ? 666  GLU A OE2 1 
ATOM   54    N  N   . TYR A 1 14  ? 30.728  -1.255  25.935 1.00 58.38 ? 667  TYR A N   1 
ATOM   55    C  CA  . TYR A 1 14  ? 31.870  -1.757  26.683 1.00 57.18 ? 667  TYR A CA  1 
ATOM   56    C  C   . TYR A 1 14  ? 32.102  -3.247  26.445 1.00 56.12 ? 667  TYR A C   1 
ATOM   57    O  O   . TYR A 1 14  ? 33.184  -3.666  26.024 1.00 55.87 ? 667  TYR A O   1 
ATOM   58    C  CB  . TYR A 1 14  ? 31.681  -1.501  28.192 1.00 55.28 ? 667  TYR A CB  1 
ATOM   59    C  CG  . TYR A 1 14  ? 32.811  -2.042  29.065 1.00 54.72 ? 667  TYR A CG  1 
ATOM   60    C  CD1 . TYR A 1 14  ? 34.005  -1.328  29.234 1.00 54.11 ? 667  TYR A CD1 1 
ATOM   61    C  CD2 . TYR A 1 14  ? 32.711  -3.301  29.671 1.00 53.79 ? 667  TYR A CD2 1 
ATOM   62    C  CE1 . TYR A 1 14  ? 35.077  -1.863  29.986 1.00 53.19 ? 667  TYR A CE1 1 
ATOM   63    C  CE2 . TYR A 1 14  ? 33.769  -3.841  30.417 1.00 53.62 ? 667  TYR A CE2 1 
ATOM   64    C  CZ  . TYR A 1 14  ? 34.957  -3.111  30.573 1.00 53.32 ? 667  TYR A CZ  1 
ATOM   65    O  OH  . TYR A 1 14  ? 35.988  -3.625  31.336 1.00 51.39 ? 667  TYR A OH  1 
ATOM   66    N  N   . ASP A 1 15  ? 31.074  -4.048  26.709 1.00 55.76 ? 668  ASP A N   1 
ATOM   67    C  CA  . ASP A 1 15  ? 31.180  -5.496  26.563 1.00 55.35 ? 668  ASP A CA  1 
ATOM   68    C  C   . ASP A 1 15  ? 31.606  -5.963  25.185 1.00 53.56 ? 668  ASP A C   1 
ATOM   69    O  O   . ASP A 1 15  ? 32.310  -6.969  25.051 1.00 53.91 ? 668  ASP A O   1 
ATOM   70    C  CB  . ASP A 1 15  ? 29.856  -6.151  26.956 1.00 56.67 ? 668  ASP A CB  1 
ATOM   71    C  CG  . ASP A 1 15  ? 29.482  -5.882  28.411 1.00 58.50 ? 668  ASP A CG  1 
ATOM   72    O  OD1 . ASP A 1 15  ? 30.292  -6.201  29.311 1.00 58.16 ? 668  ASP A OD1 1 
ATOM   73    O  OD2 . ASP A 1 15  ? 28.375  -5.356  28.657 1.00 60.35 ? 668  ASP A OD2 1 
ATOM   74    N  N   . SER A 1 16  ? 31.191  -5.231  24.160 1.00 52.64 ? 669  SER A N   1 
ATOM   75    C  CA  . SER A 1 16  ? 31.534  -5.587  22.786 1.00 51.57 ? 669  SER A CA  1 
ATOM   76    C  C   . SER A 1 16  ? 33.013  -5.270  22.497 1.00 50.22 ? 669  SER A C   1 
ATOM   77    O  O   . SER A 1 16  ? 33.764  -6.133  22.032 1.00 50.66 ? 669  SER A O   1 
ATOM   78    C  CB  . SER A 1 16  ? 30.612  -4.830  21.819 1.00 51.14 ? 669  SER A CB  1 
ATOM   79    O  OG  . SER A 1 16  ? 30.747  -5.325  20.499 1.00 53.35 ? 669  SER A OG  1 
ATOM   80    N  N   . LEU A 1 17  ? 33.428  -4.038  22.788 1.00 48.56 ? 670  LEU A N   1 
ATOM   81    C  CA  . LEU A 1 17  ? 34.812  -3.633  22.562 1.00 46.30 ? 670  LEU A CA  1 
ATOM   82    C  C   . LEU A 1 17  ? 35.751  -4.595  23.278 1.00 45.75 ? 670  LEU A C   1 
ATOM   83    O  O   . LEU A 1 17  ? 36.759  -5.028  22.721 1.00 43.59 ? 670  LEU A O   1 
ATOM   84    C  CB  . LEU A 1 17  ? 35.043  -2.206  23.059 1.00 44.92 ? 670  LEU A CB  1 
ATOM   85    C  CG  . LEU A 1 17  ? 36.460  -1.656  22.860 1.00 45.51 ? 670  LEU A CG  1 
ATOM   86    C  CD1 . LEU A 1 17  ? 36.931  -1.896  21.414 1.00 44.82 ? 670  LEU A CD1 1 
ATOM   87    C  CD2 . LEU A 1 17  ? 36.490  -0.184  23.203 1.00 43.49 ? 670  LEU A CD2 1 
ATOM   88    N  N   . ILE A 1 18  ? 35.394  -4.937  24.510 1.00 46.65 ? 671  ILE A N   1 
ATOM   89    C  CA  . ILE A 1 18  ? 36.190  -5.853  25.306 1.00 48.53 ? 671  ILE A CA  1 
ATOM   90    C  C   . ILE A 1 18  ? 36.264  -7.185  24.607 1.00 50.39 ? 671  ILE A C   1 
ATOM   91    O  O   . ILE A 1 18  ? 37.295  -7.870  24.622 1.00 51.21 ? 671  ILE A O   1 
ATOM   92    C  CB  . ILE A 1 18  ? 35.579  -6.070  26.710 1.00 47.65 ? 671  ILE A CB  1 
ATOM   93    C  CG1 . ILE A 1 18  ? 36.052  -4.967  27.660 1.00 47.14 ? 671  ILE A CG1 1 
ATOM   94    C  CG2 . ILE A 1 18  ? 36.021  -7.409  27.272 1.00 47.43 ? 671  ILE A CG2 1 
ATOM   95    C  CD1 . ILE A 1 18  ? 37.567  -4.941  27.833 1.00 43.28 ? 671  ILE A CD1 1 
ATOM   96    N  N   . GLU A 1 19  ? 35.159  -7.546  23.978 1.00 51.96 ? 672  GLU A N   1 
ATOM   97    C  CA  . GLU A 1 19  ? 35.089  -8.813  23.283 1.00 52.38 ? 672  GLU A CA  1 
ATOM   98    C  C   . GLU A 1 19  ? 36.051  -8.820  22.108 1.00 50.84 ? 672  GLU A C   1 
ATOM   99    O  O   . GLU A 1 19  ? 36.821  -9.765  21.926 1.00 51.35 ? 672  GLU A O   1 
ATOM   100   C  CB  . GLU A 1 19  ? 33.651  -9.055  22.812 1.00 54.39 ? 672  GLU A CB  1 
ATOM   101   C  CG  . GLU A 1 19  ? 33.500  -10.187 21.808 1.00 57.87 ? 672  GLU A CG  1 
ATOM   102   C  CD  . GLU A 1 19  ? 32.787  -9.736  20.533 1.00 62.12 ? 672  GLU A CD  1 
ATOM   103   O  OE1 . GLU A 1 19  ? 31.597  -9.312  20.616 1.00 62.94 ? 672  GLU A OE1 1 
ATOM   104   O  OE2 . GLU A 1 19  ? 33.419  -9.800  19.443 1.00 63.39 ? 672  GLU A OE2 1 
ATOM   105   N  N   . LYS A 1 20  ? 36.013  -7.758  21.317 1.00 49.39 ? 673  LYS A N   1 
ATOM   106   C  CA  . LYS A 1 20  ? 36.862  -7.655  20.137 1.00 48.01 ? 673  LYS A CA  1 
ATOM   107   C  C   . LYS A 1 20  ? 38.347  -7.553  20.495 1.00 46.86 ? 673  LYS A C   1 
ATOM   108   O  O   . LYS A 1 20  ? 39.202  -8.141  19.832 1.00 46.42 ? 673  LYS A O   1 
ATOM   109   C  CB  . LYS A 1 20  ? 36.439  -6.430  19.322 1.00 48.57 ? 673  LYS A CB  1 
ATOM   110   C  CG  . LYS A 1 20  ? 34.918  -6.239  19.215 1.00 50.17 ? 673  LYS A CG  1 
ATOM   111   C  CD  . LYS A 1 20  ? 34.551  -5.195  18.164 1.00 50.63 ? 673  LYS A CD  1 
ATOM   112   C  CE  . LYS A 1 20  ? 33.197  -4.528  18.443 1.00 52.80 ? 673  LYS A CE  1 
ATOM   113   N  NZ  . LYS A 1 20  ? 33.166  -3.632  19.663 1.00 52.80 ? 673  LYS A NZ  1 
ATOM   114   N  N   . MET A 1 21  ? 38.652  -6.808  21.552 1.00 46.14 ? 674  MET A N   1 
ATOM   115   C  CA  . MET A 1 21  ? 40.037  -6.616  21.959 1.00 44.85 ? 674  MET A CA  1 
ATOM   116   C  C   . MET A 1 21  ? 40.630  -7.859  22.611 1.00 44.12 ? 674  MET A C   1 
ATOM   117   O  O   . MET A 1 21  ? 41.846  -7.980  22.704 1.00 42.11 ? 674  MET A O   1 
ATOM   118   C  CB  . MET A 1 21  ? 40.161  -5.440  22.922 1.00 44.57 ? 674  MET A CB  1 
ATOM   119   C  CG  . MET A 1 21  ? 39.808  -4.089  22.327 1.00 45.37 ? 674  MET A CG  1 
ATOM   120   S  SD  . MET A 1 21  ? 40.557  -2.720  23.272 1.00 45.49 ? 674  MET A SD  1 
ATOM   121   C  CE  . MET A 1 21  ? 39.333  -2.542  24.649 1.00 41.64 ? 674  MET A CE  1 
ATOM   122   N  N   . SER A 1 22  ? 39.782  -8.781  23.053 1.00 44.04 ? 675  SER A N   1 
ATOM   123   C  CA  . SER A 1 22  ? 40.295  -9.988  23.681 1.00 46.03 ? 675  SER A CA  1 
ATOM   124   C  C   . SER A 1 22  ? 41.091  -10.809 22.679 1.00 47.17 ? 675  SER A C   1 
ATOM   125   O  O   . SER A 1 22  ? 41.677  -11.844 23.016 1.00 48.18 ? 675  SER A O   1 
ATOM   126   C  CB  . SER A 1 22  ? 39.165  -10.821 24.283 1.00 45.79 ? 675  SER A CB  1 
ATOM   127   O  OG  . SER A 1 22  ? 38.655  -10.210 25.454 1.00 45.80 ? 675  SER A OG  1 
ATOM   128   N  N   . ASN A 1 23  ? 41.139  -10.324 21.445 1.00 48.13 ? 676  ASN A N   1 
ATOM   129   C  CA  . ASN A 1 23  ? 41.889  -10.993 20.378 1.00 48.68 ? 676  ASN A CA  1 
ATOM   130   C  C   . ASN A 1 23  ? 43.225  -10.337 20.099 1.00 47.18 ? 676  ASN A C   1 
ATOM   131   O  O   . ASN A 1 23  ? 43.307  -9.120  19.990 1.00 47.25 ? 676  ASN A O   1 
ATOM   132   C  CB  . ASN A 1 23  ? 41.084  -10.983 19.073 1.00 50.94 ? 676  ASN A CB  1 
ATOM   133   C  CG  . ASN A 1 23  ? 39.951  -11.968 19.097 1.00 54.02 ? 676  ASN A CG  1 
ATOM   134   O  OD1 . ASN A 1 23  ? 40.180  -13.184 19.065 1.00 55.22 ? 676  ASN A OD1 1 
ATOM   135   N  ND2 . ASN A 1 23  ? 38.719  -11.464 19.178 1.00 53.76 ? 676  ASN A ND2 1 
ATOM   136   N  N   . TRP A 1 24  ? 44.263  -11.155 19.980 1.00 45.26 ? 677  TRP A N   1 
ATOM   137   C  CA  . TRP A 1 24  ? 45.575  -10.657 19.644 1.00 43.28 ? 677  TRP A CA  1 
ATOM   138   C  C   . TRP A 1 24  ? 45.393  -9.907  18.332 1.00 43.90 ? 677  TRP A C   1 
ATOM   139   O  O   . TRP A 1 24  ? 45.838  -8.774  18.186 1.00 44.78 ? 677  TRP A O   1 
ATOM   140   C  CB  . TRP A 1 24  ? 46.559  -11.807 19.449 1.00 40.89 ? 677  TRP A CB  1 
ATOM   141   C  CG  . TRP A 1 24  ? 47.853  -11.387 18.852 1.00 40.93 ? 677  TRP A CG  1 
ATOM   142   C  CD1 . TRP A 1 24  ? 48.385  -11.817 17.671 1.00 41.49 ? 677  TRP A CD1 1 
ATOM   143   C  CD2 . TRP A 1 24  ? 48.781  -10.417 19.377 1.00 41.25 ? 677  TRP A CD2 1 
ATOM   144   N  NE1 . TRP A 1 24  ? 49.584  -11.177 17.420 1.00 39.80 ? 677  TRP A NE1 1 
ATOM   145   C  CE2 . TRP A 1 24  ? 49.851  -10.316 18.451 1.00 40.40 ? 677  TRP A CE2 1 
ATOM   146   C  CE3 . TRP A 1 24  ? 48.810  -9.625  20.532 1.00 40.35 ? 677  TRP A CE3 1 
ATOM   147   C  CZ2 . TRP A 1 24  ? 50.941  -9.458  18.645 1.00 40.20 ? 677  TRP A CZ2 1 
ATOM   148   C  CZ3 . TRP A 1 24  ? 49.903  -8.764  20.728 1.00 41.44 ? 677  TRP A CZ3 1 
ATOM   149   C  CH2 . TRP A 1 24  ? 50.954  -8.692  19.782 1.00 40.08 ? 677  TRP A CH2 1 
ATOM   150   N  N   . ASN A 1 25  ? 44.719  -10.528 17.373 1.00 44.55 ? 678  ASN A N   1 
ATOM   151   C  CA  . ASN A 1 25  ? 44.492  -9.866  16.098 1.00 43.94 ? 678  ASN A CA  1 
ATOM   152   C  C   . ASN A 1 25  ? 43.279  -8.964  16.147 1.00 44.03 ? 678  ASN A C   1 
ATOM   153   O  O   . ASN A 1 25  ? 42.423  -8.987  15.262 1.00 45.14 ? 678  ASN A O   1 
ATOM   154   C  CB  . ASN A 1 25  ? 44.364  -10.890 14.977 1.00 43.30 ? 678  ASN A CB  1 
ATOM   155   C  CG  . ASN A 1 25  ? 45.693  -11.491 14.609 1.00 45.22 ? 678  ASN A CG  1 
ATOM   156   O  OD1 . ASN A 1 25  ? 46.612  -10.785 14.175 1.00 47.48 ? 678  ASN A OD1 1 
ATOM   157   N  ND2 . ASN A 1 25  ? 45.819  -12.792 14.786 1.00 45.25 ? 678  ASN A ND2 1 
ATOM   158   N  N   . PHE A 1 26  ? 43.220  -8.163  17.200 1.00 42.77 ? 679  PHE A N   1 
ATOM   159   C  CA  . PHE A 1 26  ? 42.132  -7.223  17.384 1.00 42.42 ? 679  PHE A CA  1 
ATOM   160   C  C   . PHE A 1 26  ? 41.919  -6.429  16.104 1.00 42.82 ? 679  PHE A C   1 
ATOM   161   O  O   . PHE A 1 26  ? 42.830  -5.757  15.622 1.00 43.73 ? 679  PHE A O   1 
ATOM   162   C  CB  . PHE A 1 26  ? 42.476  -6.281  18.539 1.00 42.30 ? 679  PHE A CB  1 
ATOM   163   C  CG  . PHE A 1 26  ? 41.620  -5.045  18.609 1.00 43.25 ? 679  PHE A CG  1 
ATOM   164   C  CD1 . PHE A 1 26  ? 40.235  -5.129  18.512 1.00 44.64 ? 679  PHE A CD1 1 
ATOM   165   C  CD2 . PHE A 1 26  ? 42.198  -3.793  18.810 1.00 43.23 ? 679  PHE A CD2 1 
ATOM   166   C  CE1 . PHE A 1 26  ? 39.434  -3.983  18.615 1.00 44.14 ? 679  PHE A CE1 1 
ATOM   167   C  CE2 . PHE A 1 26  ? 41.400  -2.633  18.920 1.00 44.45 ? 679  PHE A CE2 1 
ATOM   168   C  CZ  . PHE A 1 26  ? 40.022  -2.732  18.821 1.00 43.64 ? 679  PHE A CZ  1 
ATOM   169   N  N   . PRO A 1 27  ? 40.706  -6.492  15.534 1.00 43.62 ? 680  PRO A N   1 
ATOM   170   C  CA  . PRO A 1 27  ? 40.346  -5.781  14.300 1.00 42.05 ? 680  PRO A CA  1 
ATOM   171   C  C   . PRO A 1 27  ? 40.177  -4.301  14.583 1.00 40.83 ? 680  PRO A C   1 
ATOM   172   O  O   . PRO A 1 27  ? 39.075  -3.763  14.525 1.00 41.99 ? 680  PRO A O   1 
ATOM   173   C  CB  . PRO A 1 27  ? 39.036  -6.447  13.906 1.00 42.49 ? 680  PRO A CB  1 
ATOM   174   C  CG  . PRO A 1 27  ? 38.402  -6.671  15.241 1.00 41.86 ? 680  PRO A CG  1 
ATOM   175   C  CD  . PRO A 1 27  ? 39.547  -7.247  16.049 1.00 43.11 ? 680  PRO A CD  1 
ATOM   176   N  N   . ILE A 1 28  ? 41.288  -3.642  14.862 1.00 40.57 ? 681  ILE A N   1 
ATOM   177   C  CA  . ILE A 1 28  ? 41.279  -2.223  15.214 1.00 39.73 ? 681  ILE A CA  1 
ATOM   178   C  C   . ILE A 1 28  ? 40.766  -1.255  14.132 1.00 38.89 ? 681  ILE A C   1 
ATOM   179   O  O   . ILE A 1 28  ? 40.148  -0.222  14.440 1.00 37.47 ? 681  ILE A O   1 
ATOM   180   C  CB  . ILE A 1 28  ? 42.709  -1.799  15.720 1.00 36.64 ? 681  ILE A CB  1 
ATOM   181   C  CG1 . ILE A 1 28  ? 42.651  -0.426  16.402 1.00 36.39 ? 681  ILE A CG1 1 
ATOM   182   C  CG2 . ILE A 1 28  ? 43.712  -1.826  14.564 1.00 36.03 ? 681  ILE A CG2 1 
ATOM   183   C  CD1 . ILE A 1 28  ? 44.016  0.148   16.770 1.00 32.82 ? 681  ILE A CD1 1 
ATOM   184   N  N   . PHE A 1 29  ? 41.002  -1.591  12.871 1.00 40.33 ? 682  PHE A N   1 
ATOM   185   C  CA  . PHE A 1 29  ? 40.580  -0.716  11.782 1.00 43.28 ? 682  PHE A CA  1 
ATOM   186   C  C   . PHE A 1 29  ? 39.077  -0.730  11.604 1.00 43.58 ? 682  PHE A C   1 
ATOM   187   O  O   . PHE A 1 29  ? 38.493  0.256   11.168 1.00 44.11 ? 682  PHE A O   1 
ATOM   188   C  CB  . PHE A 1 29  ? 41.311  -1.091  10.489 1.00 43.18 ? 682  PHE A CB  1 
ATOM   189   C  CG  . PHE A 1 29  ? 42.789  -0.824  10.554 1.00 44.67 ? 682  PHE A CG  1 
ATOM   190   C  CD1 . PHE A 1 29  ? 43.694  -1.853  10.796 1.00 44.88 ? 682  PHE A CD1 1 
ATOM   191   C  CD2 . PHE A 1 29  ? 43.272  0.475   10.452 1.00 44.50 ? 682  PHE A CD2 1 
ATOM   192   C  CE1 . PHE A 1 29  ? 45.058  -1.586  10.938 1.00 43.56 ? 682  PHE A CE1 1 
ATOM   193   C  CE2 . PHE A 1 29  ? 44.626  0.740   10.594 1.00 45.01 ? 682  PHE A CE2 1 
ATOM   194   C  CZ  . PHE A 1 29  ? 45.519  -0.291  10.838 1.00 44.06 ? 682  PHE A CZ  1 
ATOM   195   N  N   . GLU A 1 30  ? 38.460  -1.850  11.952 1.00 44.29 ? 683  GLU A N   1 
ATOM   196   C  CA  . GLU A 1 30  ? 37.017  -1.959  11.897 1.00 46.22 ? 683  GLU A CA  1 
ATOM   197   C  C   . GLU A 1 30  ? 36.421  -1.029  12.949 1.00 45.88 ? 683  GLU A C   1 
ATOM   198   O  O   . GLU A 1 30  ? 35.423  -0.327  12.700 1.00 45.97 ? 683  GLU A O   1 
ATOM   199   C  CB  . GLU A 1 30  ? 36.593  -3.391  12.169 1.00 47.57 ? 683  GLU A CB  1 
ATOM   200   C  CG  . GLU A 1 30  ? 36.634  -4.224  10.930 1.00 51.88 ? 683  GLU A CG  1 
ATOM   201   C  CD  . GLU A 1 30  ? 36.297  -5.652  11.196 1.00 55.45 ? 683  GLU A CD  1 
ATOM   202   O  OE1 . GLU A 1 30  ? 35.353  -5.907  11.980 1.00 57.35 ? 683  GLU A OE1 1 
ATOM   203   O  OE2 . GLU A 1 30  ? 36.973  -6.530  10.610 1.00 58.28 ? 683  GLU A OE2 1 
ATOM   204   N  N   . LEU A 1 31  ? 37.029  -1.045  14.132 1.00 44.62 ? 684  LEU A N   1 
ATOM   205   C  CA  . LEU A 1 31  ? 36.611  -0.170  15.214 1.00 44.47 ? 684  LEU A CA  1 
ATOM   206   C  C   . LEU A 1 31  ? 36.643  1.274   14.720 1.00 44.79 ? 684  LEU A C   1 
ATOM   207   O  O   . LEU A 1 31  ? 35.699  2.033   14.942 1.00 45.68 ? 684  LEU A O   1 
ATOM   208   C  CB  . LEU A 1 31  ? 37.552  -0.324  16.402 1.00 44.06 ? 684  LEU A CB  1 
ATOM   209   C  CG  . LEU A 1 31  ? 37.205  0.625   17.536 1.00 44.24 ? 684  LEU A CG  1 
ATOM   210   C  CD1 . LEU A 1 31  ? 35.798  0.320   18.056 1.00 43.45 ? 684  LEU A CD1 1 
ATOM   211   C  CD2 . LEU A 1 31  ? 38.242  0.477   18.628 1.00 44.10 ? 684  LEU A CD2 1 
ATOM   212   N  N   . VAL A 1 32  ? 37.730  1.648   14.047 1.00 45.32 ? 685  VAL A N   1 
ATOM   213   C  CA  . VAL A 1 32  ? 37.870  2.990   13.494 1.00 45.70 ? 685  VAL A CA  1 
ATOM   214   C  C   . VAL A 1 32  ? 36.667  3.265   12.572 1.00 48.02 ? 685  VAL A C   1 
ATOM   215   O  O   . VAL A 1 32  ? 35.977  4.294   12.701 1.00 46.94 ? 685  VAL A O   1 
ATOM   216   C  CB  . VAL A 1 32  ? 39.186  3.114   12.691 1.00 45.19 ? 685  VAL A CB  1 
ATOM   217   C  CG1 . VAL A 1 32  ? 39.189  4.384   11.872 1.00 41.59 ? 685  VAL A CG1 1 
ATOM   218   C  CG2 . VAL A 1 32  ? 40.366  3.094   13.639 1.00 42.00 ? 685  VAL A CG2 1 
ATOM   219   N  N   . GLU A 1 33  ? 36.427  2.340   11.638 1.00 49.80 ? 686  GLU A N   1 
ATOM   220   C  CA  . GLU A 1 33  ? 35.293  2.422   10.704 1.00 50.91 ? 686  GLU A CA  1 
ATOM   221   C  C   . GLU A 1 33  ? 33.958  2.465   11.491 1.00 50.45 ? 686  GLU A C   1 
ATOM   222   O  O   . GLU A 1 33  ? 33.066  3.243   11.176 1.00 48.96 ? 686  GLU A O   1 
ATOM   223   C  CB  . GLU A 1 33  ? 35.367  1.212   9.750  1.00 53.61 ? 686  GLU A CB  1 
ATOM   224   C  CG  . GLU A 1 33  ? 34.041  0.656   9.179  1.00 58.06 ? 686  GLU A CG  1 
ATOM   225   C  CD  . GLU A 1 33  ? 34.215  -0.744  8.512  1.00 61.18 ? 686  GLU A CD  1 
ATOM   226   O  OE1 . GLU A 1 33  ? 34.539  -1.741  9.227  1.00 61.58 ? 686  GLU A OE1 1 
ATOM   227   O  OE2 . GLU A 1 33  ? 34.037  -0.846  7.267  1.00 61.22 ? 686  GLU A OE2 1 
ATOM   228   N  N   . LYS A 1 34  ? 33.841  1.649   12.534 1.00 50.23 ? 687  LYS A N   1 
ATOM   229   C  CA  . LYS A 1 34  ? 32.628  1.627   13.335 1.00 50.11 ? 687  LYS A CA  1 
ATOM   230   C  C   . LYS A 1 34  ? 32.393  2.896   14.150 1.00 51.35 ? 687  LYS A C   1 
ATOM   231   O  O   . LYS A 1 34  ? 31.244  3.203   14.482 1.00 52.18 ? 687  LYS A O   1 
ATOM   232   C  CB  . LYS A 1 34  ? 32.626  0.411   14.264 1.00 49.04 ? 687  LYS A CB  1 
ATOM   233   N  N   . MET A 1 35  ? 33.451  3.630   14.502 1.00 51.07 ? 688  MET A N   1 
ATOM   234   C  CA  . MET A 1 35  ? 33.269  4.860   15.281 1.00 50.65 ? 688  MET A CA  1 
ATOM   235   C  C   . MET A 1 35  ? 32.833  6.018   14.389 1.00 51.37 ? 688  MET A C   1 
ATOM   236   O  O   . MET A 1 35  ? 32.235  7.002   14.846 1.00 49.50 ? 688  MET A O   1 
ATOM   237   C  CB  . MET A 1 35  ? 34.563  5.230   15.995 1.00 50.81 ? 688  MET A CB  1 
ATOM   238   C  CG  . MET A 1 35  ? 35.039  4.156   16.950 1.00 50.14 ? 688  MET A CG  1 
ATOM   239   S  SD  . MET A 1 35  ? 36.372  4.697   18.044 1.00 49.06 ? 688  MET A SD  1 
ATOM   240   C  CE  . MET A 1 35  ? 35.545  5.877   19.083 1.00 44.66 ? 688  MET A CE  1 
ATOM   241   N  N   . GLY A 1 36  ? 33.155  5.891   13.108 1.00 52.86 ? 689  GLY A N   1 
ATOM   242   C  CA  . GLY A 1 36  ? 32.805  6.913   12.152 1.00 54.90 ? 689  GLY A CA  1 
ATOM   243   C  C   . GLY A 1 36  ? 33.420  8.285   12.379 1.00 57.45 ? 689  GLY A C   1 
ATOM   244   O  O   . GLY A 1 36  ? 34.641  8.474   12.238 1.00 57.36 ? 689  GLY A O   1 
ATOM   245   N  N   . GLU A 1 37  ? 32.558  9.249   12.716 1.00 58.67 ? 690  GLU A N   1 
ATOM   246   C  CA  . GLU A 1 37  ? 32.954  10.650  12.934 1.00 59.27 ? 690  GLU A CA  1 
ATOM   247   C  C   . GLU A 1 37  ? 33.513  10.894  14.321 1.00 58.46 ? 690  GLU A C   1 
ATOM   248   O  O   . GLU A 1 37  ? 34.004  11.980  14.613 1.00 58.14 ? 690  GLU A O   1 
ATOM   249   C  CB  . GLU A 1 37  ? 31.762  11.581  12.727 1.00 61.47 ? 690  GLU A CB  1 
ATOM   250   C  CG  . GLU A 1 37  ? 31.211  11.572  11.323 1.00 66.61 ? 690  GLU A CG  1 
ATOM   251   C  CD  . GLU A 1 37  ? 30.039  12.523  11.170 1.00 70.18 ? 690  GLU A CD  1 
ATOM   252   O  OE1 . GLU A 1 37  ? 30.278  13.759  11.212 1.00 71.86 ? 690  GLU A OE1 1 
ATOM   253   O  OE2 . GLU A 1 37  ? 28.882  12.041  11.022 1.00 71.63 ? 690  GLU A OE2 1 
ATOM   254   N  N   . LYS A 1 38  ? 33.407  9.878   15.168 1.00 57.26 ? 691  LYS A N   1 
ATOM   255   C  CA  . LYS A 1 38  ? 33.911  9.939   16.526 1.00 55.98 ? 691  LYS A CA  1 
ATOM   256   C  C   . LYS A 1 38  ? 35.170  9.064   16.608 1.00 54.18 ? 691  LYS A C   1 
ATOM   257   O  O   . LYS A 1 38  ? 35.625  8.716   17.702 1.00 54.38 ? 691  LYS A O   1 
ATOM   258   C  CB  . LYS A 1 38  ? 32.843  9.409   17.499 1.00 57.90 ? 691  LYS A CB  1 
ATOM   259   C  CG  . LYS A 1 38  ? 31.546  10.231  17.533 1.00 59.64 ? 691  LYS A CG  1 
ATOM   260   C  CD  . LYS A 1 38  ? 30.424  9.577   18.380 1.00 62.25 ? 691  LYS A CD  1 
ATOM   261   C  CE  . LYS A 1 38  ? 30.777  9.358   19.863 1.00 62.90 ? 691  LYS A CE  1 
ATOM   262   N  NZ  . LYS A 1 38  ? 31.574  8.107   20.094 1.00 64.82 ? 691  LYS A NZ  1 
ATOM   263   N  N   . SER A 1 39  ? 35.726  8.699   15.454 1.00 51.16 ? 692  SER A N   1 
ATOM   264   C  CA  . SER A 1 39  ? 36.905  7.840   15.443 1.00 49.46 ? 692  SER A CA  1 
ATOM   265   C  C   . SER A 1 39  ? 38.151  8.574   15.968 1.00 47.83 ? 692  SER A C   1 
ATOM   266   O  O   . SER A 1 39  ? 39.188  7.968   16.185 1.00 46.61 ? 692  SER A O   1 
ATOM   267   C  CB  . SER A 1 39  ? 37.151  7.283   14.031 1.00 48.44 ? 692  SER A CB  1 
ATOM   268   O  OG  . SER A 1 39  ? 37.564  8.311   13.141 1.00 49.33 ? 692  SER A OG  1 
ATOM   269   N  N   . GLY A 1 40  ? 38.037  9.877   16.187 1.00 47.03 ? 693  GLY A N   1 
ATOM   270   C  CA  . GLY A 1 40  ? 39.173  10.623  16.700 1.00 45.63 ? 693  GLY A CA  1 
ATOM   271   C  C   . GLY A 1 40  ? 39.306  10.496  18.206 1.00 45.20 ? 693  GLY A C   1 
ATOM   272   O  O   . GLY A 1 40  ? 40.221  11.065  18.805 1.00 44.02 ? 693  GLY A O   1 
ATOM   273   N  N   . ARG A 1 41  ? 38.381  9.754   18.813 1.00 43.55 ? 694  ARG A N   1 
ATOM   274   C  CA  . ARG A 1 41  ? 38.388  9.545   20.250 1.00 42.45 ? 694  ARG A CA  1 
ATOM   275   C  C   . ARG A 1 41  ? 38.709  8.085   20.567 1.00 39.94 ? 694  ARG A C   1 
ATOM   276   O  O   . ARG A 1 41  ? 38.452  7.613   21.667 1.00 40.00 ? 694  ARG A O   1 
ATOM   277   C  CB  . ARG A 1 41  ? 37.029  9.924   20.843 1.00 42.56 ? 694  ARG A CB  1 
ATOM   278   C  CG  . ARG A 1 41  ? 36.462  11.177  20.230 1.00 47.33 ? 694  ARG A CG  1 
ATOM   279   C  CD  . ARG A 1 41  ? 36.226  12.293  21.226 1.00 52.05 ? 694  ARG A CD  1 
ATOM   280   N  NE  . ARG A 1 41  ? 35.127  12.017  22.158 1.00 56.07 ? 694  ARG A NE  1 
ATOM   281   C  CZ  . ARG A 1 41  ? 34.548  12.937  22.936 1.00 58.36 ? 694  ARG A CZ  1 
ATOM   282   N  NH1 . ARG A 1 41  ? 34.958  14.211  22.904 1.00 58.11 ? 694  ARG A NH1 1 
ATOM   283   N  NH2 . ARG A 1 41  ? 33.550  12.581  23.746 1.00 58.68 ? 694  ARG A NH2 1 
ATOM   284   N  N   . ILE A 1 42  ? 39.302  7.384   19.612 1.00 37.87 ? 695  ILE A N   1 
ATOM   285   C  CA  . ILE A 1 42  ? 39.624  5.981   19.795 1.00 37.14 ? 695  ILE A CA  1 
ATOM   286   C  C   . ILE A 1 42  ? 40.644  5.687   20.908 1.00 36.84 ? 695  ILE A C   1 
ATOM   287   O  O   . ILE A 1 42  ? 40.506  4.709   21.654 1.00 37.92 ? 695  ILE A O   1 
ATOM   288   C  CB  . ILE A 1 42  ? 40.078  5.334   18.432 1.00 35.85 ? 695  ILE A CB  1 
ATOM   289   C  CG1 . ILE A 1 42  ? 40.267  3.821   18.608 1.00 36.45 ? 695  ILE A CG1 1 
ATOM   290   C  CG2 . ILE A 1 42  ? 41.386  5.936   17.957 1.00 36.63 ? 695  ILE A CG2 1 
ATOM   291   C  CD1 . ILE A 1 42  ? 40.754  3.100   17.378 1.00 33.07 ? 695  ILE A CD1 1 
ATOM   292   N  N   . LEU A 1 43  ? 41.659  6.532   21.054 1.00 37.99 ? 696  LEU A N   1 
ATOM   293   C  CA  . LEU A 1 43  ? 42.675  6.287   22.092 1.00 36.08 ? 696  LEU A CA  1 
ATOM   294   C  C   . LEU A 1 43  ? 42.109  6.491   23.510 1.00 36.42 ? 696  LEU A C   1 
ATOM   295   O  O   . LEU A 1 43  ? 42.386  5.702   24.419 1.00 35.08 ? 696  LEU A O   1 
ATOM   296   C  CB  . LEU A 1 43  ? 43.898  7.184   21.853 1.00 33.04 ? 696  LEU A CB  1 
ATOM   297   C  CG  . LEU A 1 43  ? 45.091  7.031   22.807 1.00 33.49 ? 696  LEU A CG  1 
ATOM   298   C  CD1 . LEU A 1 43  ? 45.670  5.604   22.775 1.00 29.00 ? 696  LEU A CD1 1 
ATOM   299   C  CD2 . LEU A 1 43  ? 46.158  8.060   22.419 1.00 32.85 ? 696  LEU A CD2 1 
ATOM   300   N  N   . SER A 1 44  ? 41.296  7.531   23.687 1.00 36.21 ? 697  SER A N   1 
ATOM   301   C  CA  . SER A 1 44  ? 40.717  7.804   24.987 1.00 36.97 ? 697  SER A CA  1 
ATOM   302   C  C   . SER A 1 44  ? 39.670  6.782   25.326 1.00 38.09 ? 697  SER A C   1 
ATOM   303   O  O   . SER A 1 44  ? 39.508  6.386   26.488 1.00 38.76 ? 697  SER A O   1 
ATOM   304   C  CB  . SER A 1 44  ? 40.123  9.225   25.049 1.00 37.50 ? 697  SER A CB  1 
ATOM   305   O  OG  . SER A 1 44  ? 39.210  9.496   24.001 1.00 39.08 ? 697  SER A OG  1 
ATOM   306   N  N   . GLN A 1 45  ? 38.960  6.325   24.306 1.00 39.96 ? 698  GLN A N   1 
ATOM   307   C  CA  . GLN A 1 45  ? 37.913  5.346   24.535 1.00 40.06 ? 698  GLN A CA  1 
ATOM   308   C  C   . GLN A 1 45  ? 38.516  4.026   24.935 1.00 38.90 ? 698  GLN A C   1 
ATOM   309   O  O   . GLN A 1 45  ? 38.071  3.405   25.893 1.00 38.27 ? 698  GLN A O   1 
ATOM   310   C  CB  . GLN A 1 45  ? 37.050  5.217   23.285 1.00 41.77 ? 698  GLN A CB  1 
ATOM   311   C  CG  . GLN A 1 45  ? 36.238  6.487   23.025 1.00 44.33 ? 698  GLN A CG  1 
ATOM   312   C  CD  . GLN A 1 45  ? 35.390  6.873   24.231 1.00 47.57 ? 698  GLN A CD  1 
ATOM   313   O  OE1 . GLN A 1 45  ? 34.575  6.077   24.700 1.00 48.29 ? 698  GLN A OE1 1 
ATOM   314   N  NE2 . GLN A 1 45  ? 35.581  8.094   24.742 1.00 49.10 ? 698  GLN A NE2 1 
ATOM   315   N  N   . VAL A 1 46  ? 39.551  3.612   24.214 1.00 38.34 ? 699  VAL A N   1 
ATOM   316   C  CA  . VAL A 1 46  ? 40.209  2.361   24.526 1.00 38.06 ? 699  VAL A CA  1 
ATOM   317   C  C   . VAL A 1 46  ? 40.874  2.413   25.895 1.00 38.97 ? 699  VAL A C   1 
ATOM   318   O  O   . VAL A 1 46  ? 40.909  1.410   26.593 1.00 40.69 ? 699  VAL A O   1 
ATOM   319   C  CB  . VAL A 1 46  ? 41.249  2.012   23.457 1.00 36.55 ? 699  VAL A CB  1 
ATOM   320   C  CG1 . VAL A 1 46  ? 42.120  0.837   23.916 1.00 35.71 ? 699  VAL A CG1 1 
ATOM   321   C  CG2 . VAL A 1 46  ? 40.534  1.654   22.165 1.00 36.50 ? 699  VAL A CG2 1 
ATOM   322   N  N   . MET A 1 47  ? 41.400  3.575   26.278 1.00 39.73 ? 700  MET A N   1 
ATOM   323   C  CA  . MET A 1 47  ? 42.046  3.723   27.572 1.00 41.42 ? 700  MET A CA  1 
ATOM   324   C  C   . MET A 1 47  ? 41.040  3.505   28.690 1.00 41.19 ? 700  MET A C   1 
ATOM   325   O  O   . MET A 1 47  ? 41.275  2.716   29.605 1.00 41.35 ? 700  MET A O   1 
ATOM   326   C  CB  . MET A 1 47  ? 42.704  5.111   27.704 1.00 41.73 ? 700  MET A CB  1 
ATOM   327   C  CG  . MET A 1 47  ? 44.072  5.235   27.017 1.00 42.72 ? 700  MET A CG  1 
ATOM   328   S  SD  . MET A 1 47  ? 45.424  4.649   28.071 1.00 44.63 ? 700  MET A SD  1 
ATOM   329   C  CE  . MET A 1 47  ? 45.079  2.982   28.153 1.00 45.01 ? 700  MET A CE  1 
ATOM   330   N  N   . TYR A 1 48  ? 39.915  4.206   28.622 1.00 41.43 ? 701  TYR A N   1 
ATOM   331   C  CA  . TYR A 1 48  ? 38.886  4.049   29.642 1.00 42.91 ? 701  TYR A CA  1 
ATOM   332   C  C   . TYR A 1 48  ? 38.471  2.576   29.798 1.00 41.85 ? 701  TYR A C   1 
ATOM   333   O  O   . TYR A 1 48  ? 38.416  2.059   30.902 1.00 42.51 ? 701  TYR A O   1 
ATOM   334   C  CB  . TYR A 1 48  ? 37.663  4.894   29.287 1.00 44.58 ? 701  TYR A CB  1 
ATOM   335   C  CG  . TYR A 1 48  ? 36.539  4.752   30.283 1.00 47.50 ? 701  TYR A CG  1 
ATOM   336   C  CD1 . TYR A 1 48  ? 36.508  5.523   31.444 1.00 49.42 ? 701  TYR A CD1 1 
ATOM   337   C  CD2 . TYR A 1 48  ? 35.518  3.820   30.083 1.00 49.65 ? 701  TYR A CD2 1 
ATOM   338   C  CE1 . TYR A 1 48  ? 35.487  5.376   32.393 1.00 51.89 ? 701  TYR A CE1 1 
ATOM   339   C  CE2 . TYR A 1 48  ? 34.486  3.656   31.027 1.00 51.52 ? 701  TYR A CE2 1 
ATOM   340   C  CZ  . TYR A 1 48  ? 34.479  4.436   32.177 1.00 53.29 ? 701  TYR A CZ  1 
ATOM   341   O  OH  . TYR A 1 48  ? 33.494  4.259   33.126 1.00 55.99 ? 701  TYR A OH  1 
ATOM   342   N  N   . THR A 1 49  ? 38.180  1.922   28.681 1.00 40.39 ? 702  THR A N   1 
ATOM   343   C  CA  . THR A 1 49  ? 37.774  0.527   28.662 1.00 40.32 ? 702  THR A CA  1 
ATOM   344   C  C   . THR A 1 49  ? 38.795  -0.375  29.338 1.00 41.06 ? 702  THR A C   1 
ATOM   345   O  O   . THR A 1 49  ? 38.448  -1.257  30.127 1.00 40.21 ? 702  THR A O   1 
ATOM   346   C  CB  . THR A 1 49  ? 37.629  0.001   27.210 1.00 39.61 ? 702  THR A CB  1 
ATOM   347   O  OG1 . THR A 1 49  ? 36.704  0.811   26.475 1.00 36.53 ? 702  THR A OG1 1 
ATOM   348   C  CG2 . THR A 1 49  ? 37.145  -1.436  27.224 1.00 39.76 ? 702  THR A CG2 1 
ATOM   349   N  N   . LEU A 1 50  ? 40.062  -0.173  28.993 1.00 41.01 ? 703  LEU A N   1 
ATOM   350   C  CA  . LEU A 1 50  ? 41.128  -0.987  29.556 1.00 40.89 ? 703  LEU A CA  1 
ATOM   351   C  C   . LEU A 1 50  ? 41.432  -0.691  31.038 1.00 40.95 ? 703  LEU A C   1 
ATOM   352   O  O   . LEU A 1 50  ? 41.658  -1.605  31.826 1.00 41.36 ? 703  LEU A O   1 
ATOM   353   C  CB  . LEU A 1 50  ? 42.392  -0.842  28.708 1.00 38.20 ? 703  LEU A CB  1 
ATOM   354   C  CG  . LEU A 1 50  ? 42.403  -1.489  27.323 1.00 37.59 ? 703  LEU A CG  1 
ATOM   355   C  CD1 . LEU A 1 50  ? 43.823  -1.459  26.754 1.00 36.90 ? 703  LEU A CD1 1 
ATOM   356   C  CD2 . LEU A 1 50  ? 41.936  -2.918  27.412 1.00 36.86 ? 703  LEU A CD2 1 
ATOM   357   N  N   . PHE A 1 51  ? 41.421  0.570   31.435 1.00 41.73 ? 704  PHE A N   1 
ATOM   358   C  CA  . PHE A 1 51  ? 41.728  0.855   32.829 1.00 43.84 ? 704  PHE A CA  1 
ATOM   359   C  C   . PHE A 1 51  ? 40.624  0.309   33.704 1.00 46.51 ? 704  PHE A C   1 
ATOM   360   O  O   . PHE A 1 51  ? 40.800  0.117   34.903 1.00 48.35 ? 704  PHE A O   1 
ATOM   361   C  CB  . PHE A 1 51  ? 41.890  2.362   33.062 1.00 40.03 ? 704  PHE A CB  1 
ATOM   362   C  CG  . PHE A 1 51  ? 43.307  2.844   32.969 1.00 38.36 ? 704  PHE A CG  1 
ATOM   363   C  CD1 . PHE A 1 51  ? 44.096  2.535   31.874 1.00 37.66 ? 704  PHE A CD1 1 
ATOM   364   C  CD2 . PHE A 1 51  ? 43.854  3.624   33.975 1.00 39.08 ? 704  PHE A CD2 1 
ATOM   365   C  CE1 . PHE A 1 51  ? 45.424  3.004   31.789 1.00 38.09 ? 704  PHE A CE1 1 
ATOM   366   C  CE2 . PHE A 1 51  ? 45.173  4.096   33.896 1.00 35.27 ? 704  PHE A CE2 1 
ATOM   367   C  CZ  . PHE A 1 51  ? 45.950  3.785   32.806 1.00 35.24 ? 704  PHE A CZ  1 
ATOM   368   N  N   . GLN A 1 52  ? 39.483  0.058   33.079 1.00 48.99 ? 705  GLN A N   1 
ATOM   369   C  CA  . GLN A 1 52  ? 38.300  -0.455  33.757 1.00 50.47 ? 705  GLN A CA  1 
ATOM   370   C  C   . GLN A 1 52  ? 38.349  -1.980  33.740 1.00 48.99 ? 705  GLN A C   1 
ATOM   371   O  O   . GLN A 1 52  ? 37.886  -2.644  34.662 1.00 47.92 ? 705  GLN A O   1 
ATOM   372   C  CB  . GLN A 1 52  ? 37.048  0.056   33.040 1.00 52.61 ? 705  GLN A CB  1 
ATOM   373   C  CG  . GLN A 1 52  ? 35.774  -0.255  33.751 1.00 58.12 ? 705  GLN A CG  1 
ATOM   374   C  CD  . GLN A 1 52  ? 35.676  0.420   35.111 1.00 61.58 ? 705  GLN A CD  1 
ATOM   375   O  OE1 . GLN A 1 52  ? 35.570  1.644   35.194 1.00 64.07 ? 705  GLN A OE1 1 
ATOM   376   N  NE2 . GLN A 1 52  ? 35.716  -0.374  36.183 1.00 62.69 ? 705  GLN A NE2 1 
ATOM   377   N  N   . ASP A 1 53  ? 38.931  -2.531  32.686 1.00 48.31 ? 706  ASP A N   1 
ATOM   378   C  CA  . ASP A 1 53  ? 39.054  -3.975  32.576 1.00 48.27 ? 706  ASP A CA  1 
ATOM   379   C  C   . ASP A 1 53  ? 40.069  -4.485  33.612 1.00 47.79 ? 706  ASP A C   1 
ATOM   380   O  O   . ASP A 1 53  ? 39.893  -5.552  34.219 1.00 45.66 ? 706  ASP A O   1 
ATOM   381   C  CB  . ASP A 1 53  ? 39.481  -4.365  31.146 1.00 47.06 ? 706  ASP A CB  1 
ATOM   382   C  CG  . ASP A 1 53  ? 40.134  -5.738  31.087 1.00 48.00 ? 706  ASP A CG  1 
ATOM   383   O  OD1 . ASP A 1 53  ? 41.364  -5.805  31.226 1.00 49.78 ? 706  ASP A OD1 1 
ATOM   384   O  OD2 . ASP A 1 53  ? 39.430  -6.752  30.920 1.00 49.10 ? 706  ASP A OD2 1 
ATOM   385   N  N   . THR A 1 54  ? 41.110  -3.684  33.827 1.00 47.60 ? 707  THR A N   1 
ATOM   386   C  CA  . THR A 1 54  ? 42.188  -4.016  34.753 1.00 46.58 ? 707  THR A CA  1 
ATOM   387   C  C   . THR A 1 54  ? 41.948  -3.506  36.160 1.00 46.11 ? 707  THR A C   1 
ATOM   388   O  O   . THR A 1 54  ? 42.728  -3.782  37.069 1.00 46.31 ? 707  THR A O   1 
ATOM   389   C  CB  . THR A 1 54  ? 43.491  -3.448  34.249 1.00 46.88 ? 707  THR A CB  1 
ATOM   390   O  OG1 . THR A 1 54  ? 43.386  -2.025  34.190 1.00 47.02 ? 707  THR A OG1 1 
ATOM   391   C  CG2 . THR A 1 54  ? 43.782  -3.995  32.850 1.00 48.32 ? 707  THR A CG2 1 
ATOM   392   N  N   . GLY A 1 55  ? 40.865  -2.760  36.328 1.00 45.70 ? 708  GLY A N   1 
ATOM   393   C  CA  . GLY A 1 55  ? 40.515  -2.240  37.629 1.00 44.24 ? 708  GLY A CA  1 
ATOM   394   C  C   . GLY A 1 55  ? 41.410  -1.130  38.090 1.00 45.45 ? 708  GLY A C   1 
ATOM   395   O  O   . GLY A 1 55  ? 41.450  -0.840  39.284 1.00 47.83 ? 708  GLY A O   1 
ATOM   396   N  N   . LEU A 1 56  ? 42.127  -0.490  37.172 1.00 44.51 ? 709  LEU A N   1 
ATOM   397   C  CA  . LEU A 1 56  ? 43.012  0.584   37.577 1.00 42.73 ? 709  LEU A CA  1 
ATOM   398   C  C   . LEU A 1 56  ? 42.295  1.832   38.090 1.00 43.79 ? 709  LEU A C   1 
ATOM   399   O  O   . LEU A 1 56  ? 42.843  2.546   38.934 1.00 43.37 ? 709  LEU A O   1 
ATOM   400   C  CB  . LEU A 1 56  ? 43.989  0.930   36.450 1.00 40.04 ? 709  LEU A CB  1 
ATOM   401   C  CG  . LEU A 1 56  ? 45.110  -0.108  36.272 1.00 38.79 ? 709  LEU A CG  1 
ATOM   402   C  CD1 . LEU A 1 56  ? 45.975  0.208   35.085 1.00 37.85 ? 709  LEU A CD1 1 
ATOM   403   C  CD2 . LEU A 1 56  ? 45.966  -0.133  37.511 1.00 36.43 ? 709  LEU A CD2 1 
ATOM   404   N  N   . LEU A 1 57  ? 41.079  2.101   37.614 1.00 45.14 ? 710  LEU A N   1 
ATOM   405   C  CA  . LEU A 1 57  ? 40.352  3.283   38.092 1.00 46.53 ? 710  LEU A CA  1 
ATOM   406   C  C   . LEU A 1 57  ? 40.029  3.067   39.565 1.00 47.59 ? 710  LEU A C   1 
ATOM   407   O  O   . LEU A 1 57  ? 40.071  3.989   40.384 1.00 47.41 ? 710  LEU A O   1 
ATOM   408   C  CB  . LEU A 1 57  ? 39.051  3.475   37.322 1.00 46.04 ? 710  LEU A CB  1 
ATOM   409   C  CG  . LEU A 1 57  ? 39.210  3.515   35.805 1.00 46.83 ? 710  LEU A CG  1 
ATOM   410   C  CD1 . LEU A 1 57  ? 37.832  3.621   35.175 1.00 46.05 ? 710  LEU A CD1 1 
ATOM   411   C  CD2 . LEU A 1 57  ? 40.080  4.692   35.391 1.00 47.03 ? 710  LEU A CD2 1 
ATOM   412   N  N   . GLU A 1 58  ? 39.716  1.824   39.897 1.00 49.89 ? 711  GLU A N   1 
ATOM   413   C  CA  . GLU A 1 58  ? 39.394  1.454   41.263 1.00 51.40 ? 711  GLU A CA  1 
ATOM   414   C  C   . GLU A 1 58  ? 40.641  1.525   42.132 1.00 49.85 ? 711  GLU A C   1 
ATOM   415   O  O   . GLU A 1 58  ? 40.686  2.245   43.125 1.00 50.32 ? 711  GLU A O   1 
ATOM   416   C  CB  . GLU A 1 58  ? 38.825  0.035   41.284 1.00 55.25 ? 711  GLU A CB  1 
ATOM   417   C  CG  . GLU A 1 58  ? 37.419  -0.064  41.823 1.00 61.63 ? 711  GLU A CG  1 
ATOM   418   C  CD  . GLU A 1 58  ? 37.386  -0.046  43.346 1.00 66.70 ? 711  GLU A CD  1 
ATOM   419   O  OE1 . GLU A 1 58  ? 38.082  -0.898  43.953 1.00 69.08 ? 711  GLU A OE1 1 
ATOM   420   O  OE2 . GLU A 1 58  ? 36.670  0.807   43.939 1.00 68.53 ? 711  GLU A OE2 1 
ATOM   421   N  N   . ILE A 1 59  ? 41.667  0.782   41.752 1.00 47.99 ? 712  ILE A N   1 
ATOM   422   C  CA  . ILE A 1 59  ? 42.893  0.772   42.536 1.00 47.38 ? 712  ILE A CA  1 
ATOM   423   C  C   . ILE A 1 59  ? 43.430  2.146   42.925 1.00 46.79 ? 712  ILE A C   1 
ATOM   424   O  O   . ILE A 1 59  ? 43.775  2.359   44.071 1.00 47.64 ? 712  ILE A O   1 
ATOM   425   C  CB  . ILE A 1 59  ? 44.015  0.019   41.807 1.00 47.36 ? 712  ILE A CB  1 
ATOM   426   C  CG1 . ILE A 1 59  ? 43.636  -1.451  41.685 1.00 47.66 ? 712  ILE A CG1 1 
ATOM   427   C  CG2 . ILE A 1 59  ? 45.329  0.172   42.579 1.00 46.18 ? 712  ILE A CG2 1 
ATOM   428   C  CD1 . ILE A 1 59  ? 44.533  -2.263  40.783 1.00 49.20 ? 712  ILE A CD1 1 
ATOM   429   N  N   . PHE A 1 60  ? 43.515  3.076   41.982 1.00 45.85 ? 713  PHE A N   1 
ATOM   430   C  CA  . PHE A 1 60  ? 44.048  4.379   42.305 1.00 43.81 ? 713  PHE A CA  1 
ATOM   431   C  C   . PHE A 1 60  ? 43.023  5.479   42.434 1.00 44.31 ? 713  PHE A C   1 
ATOM   432   O  O   . PHE A 1 60  ? 43.366  6.662   42.356 1.00 44.86 ? 713  PHE A O   1 
ATOM   433   C  CB  . PHE A 1 60  ? 45.128  4.772   41.290 1.00 41.39 ? 713  PHE A CB  1 
ATOM   434   C  CG  . PHE A 1 60  ? 46.276  3.794   41.222 1.00 38.89 ? 713  PHE A CG  1 
ATOM   435   C  CD1 . PHE A 1 60  ? 46.396  2.909   40.157 1.00 38.84 ? 713  PHE A CD1 1 
ATOM   436   C  CD2 . PHE A 1 60  ? 47.193  3.698   42.263 1.00 39.13 ? 713  PHE A CD2 1 
ATOM   437   C  CE1 . PHE A 1 60  ? 47.402  1.940   40.132 1.00 36.03 ? 713  PHE A CE1 1 
ATOM   438   C  CE2 . PHE A 1 60  ? 48.207  2.721   42.239 1.00 37.79 ? 713  PHE A CE2 1 
ATOM   439   C  CZ  . PHE A 1 60  ? 48.296  1.849   41.169 1.00 37.43 ? 713  PHE A CZ  1 
ATOM   440   N  N   . LYS A 1 61  ? 41.772  5.097   42.653 1.00 45.67 ? 714  LYS A N   1 
ATOM   441   C  CA  . LYS A 1 61  ? 40.695  6.072   42.820 1.00 47.85 ? 714  LYS A CA  1 
ATOM   442   C  C   . LYS A 1 61  ? 40.873  7.195   41.798 1.00 47.34 ? 714  LYS A C   1 
ATOM   443   O  O   . LYS A 1 61  ? 40.986  8.368   42.151 1.00 45.98 ? 714  LYS A O   1 
ATOM   444   C  CB  . LYS A 1 61  ? 40.718  6.678   44.235 1.00 50.25 ? 714  LYS A CB  1 
ATOM   445   C  CG  . LYS A 1 61  ? 41.059  5.701   45.355 1.00 54.70 ? 714  LYS A CG  1 
ATOM   446   C  CD  . LYS A 1 61  ? 39.979  4.611   45.543 1.00 60.14 ? 714  LYS A CD  1 
ATOM   447   C  CE  . LYS A 1 61  ? 38.737  5.118   46.306 1.00 62.88 ? 714  LYS A CE  1 
ATOM   448   N  NZ  . LYS A 1 61  ? 39.009  5.526   47.732 1.00 62.36 ? 714  LYS A NZ  1 
ATOM   449   N  N   . ILE A 1 62  ? 40.921  6.814   40.527 1.00 47.21 ? 715  ILE A N   1 
ATOM   450   C  CA  . ILE A 1 62  ? 41.096  7.764   39.444 1.00 45.64 ? 715  ILE A CA  1 
ATOM   451   C  C   . ILE A 1 62  ? 39.770  8.401   39.060 1.00 45.45 ? 715  ILE A C   1 
ATOM   452   O  O   . ILE A 1 62  ? 38.808  7.713   38.721 1.00 46.15 ? 715  ILE A O   1 
ATOM   453   C  CB  . ILE A 1 62  ? 41.713  7.061   38.235 1.00 44.50 ? 715  ILE A CB  1 
ATOM   454   C  CG1 . ILE A 1 62  ? 43.158  6.700   38.561 1.00 43.84 ? 715  ILE A CG1 1 
ATOM   455   C  CG2 . ILE A 1 62  ? 41.632  7.950   37.002 1.00 44.32 ? 715  ILE A CG2 1 
ATOM   456   C  CD1 . ILE A 1 62  ? 43.799  5.753   37.569 1.00 42.60 ? 715  ILE A CD1 1 
ATOM   457   N  N   . PRO A 1 63  ? 39.694  9.732   39.126 1.00 45.44 ? 716  PRO A N   1 
ATOM   458   C  CA  . PRO A 1 63  ? 38.426  10.375  38.754 1.00 44.73 ? 716  PRO A CA  1 
ATOM   459   C  C   . PRO A 1 63  ? 38.233  10.285  37.250 1.00 45.20 ? 716  PRO A C   1 
ATOM   460   O  O   . PRO A 1 63  ? 39.129  10.635  36.487 1.00 46.11 ? 716  PRO A O   1 
ATOM   461   C  CB  . PRO A 1 63  ? 38.609  11.809  39.223 1.00 44.25 ? 716  PRO A CB  1 
ATOM   462   C  CG  . PRO A 1 63  ? 40.135  12.023  39.046 1.00 44.99 ? 716  PRO A CG  1 
ATOM   463   C  CD  . PRO A 1 63  ? 40.720  10.715  39.530 1.00 44.36 ? 716  PRO A CD  1 
ATOM   464   N  N   . THR A 1 64  ? 37.064  9.816   36.831 1.00 44.84 ? 717  THR A N   1 
ATOM   465   C  CA  . THR A 1 64  ? 36.739  9.681   35.417 1.00 43.28 ? 717  THR A CA  1 
ATOM   466   C  C   . THR A 1 64  ? 36.871  10.978  34.648 1.00 42.15 ? 717  THR A C   1 
ATOM   467   O  O   . THR A 1 64  ? 37.488  11.004  33.595 1.00 41.92 ? 717  THR A O   1 
ATOM   468   C  CB  . THR A 1 64  ? 35.295  9.166   35.204 1.00 42.87 ? 717  THR A CB  1 
ATOM   469   O  OG1 . THR A 1 64  ? 35.210  7.802   35.632 1.00 42.24 ? 717  THR A OG1 1 
ATOM   470   C  CG2 . THR A 1 64  ? 34.916  9.245   33.734 1.00 40.29 ? 717  THR A CG2 1 
ATOM   471   N  N   . GLN A 1 65  ? 36.290  12.054  35.161 1.00 42.15 ? 718  GLN A N   1 
ATOM   472   C  CA  . GLN A 1 65  ? 36.359  13.315  34.442 1.00 42.26 ? 718  GLN A CA  1 
ATOM   473   C  C   . GLN A 1 65  ? 37.771  13.775  34.033 1.00 41.72 ? 718  GLN A C   1 
ATOM   474   O  O   . GLN A 1 65  ? 38.005  14.067  32.861 1.00 42.33 ? 718  GLN A O   1 
ATOM   475   C  CB  . GLN A 1 65  ? 35.674  14.430  35.238 1.00 42.40 ? 718  GLN A CB  1 
ATOM   476   C  CG  . GLN A 1 65  ? 35.437  15.705  34.399 1.00 43.30 ? 718  GLN A CG  1 
ATOM   477   C  CD  . GLN A 1 65  ? 34.665  15.424  33.097 1.00 44.74 ? 718  GLN A CD  1 
ATOM   478   O  OE1 . GLN A 1 65  ? 33.587  14.841  33.110 1.00 45.49 ? 718  GLN A OE1 1 
ATOM   479   N  NE2 . GLN A 1 65  ? 35.220  15.847  31.979 1.00 44.97 ? 718  GLN A NE2 1 
ATOM   480   N  N   . GLN A 1 66  ? 38.706  13.848  34.980 1.00 39.69 ? 719  GLN A N   1 
ATOM   481   C  CA  . GLN A 1 66  ? 40.049  14.297  34.645 1.00 37.99 ? 719  GLN A CA  1 
ATOM   482   C  C   . GLN A 1 66  ? 40.792  13.232  33.855 1.00 37.74 ? 719  GLN A C   1 
ATOM   483   O  O   . GLN A 1 66  ? 41.727  13.538  33.119 1.00 36.99 ? 719  GLN A O   1 
ATOM   484   C  CB  . GLN A 1 66  ? 40.839  14.675  35.902 1.00 37.35 ? 719  GLN A CB  1 
ATOM   485   C  CG  . GLN A 1 66  ? 40.225  15.796  36.701 1.00 38.03 ? 719  GLN A CG  1 
ATOM   486   C  CD  . GLN A 1 66  ? 39.418  15.288  37.886 1.00 40.33 ? 719  GLN A CD  1 
ATOM   487   O  OE1 . GLN A 1 66  ? 38.422  14.581  37.731 1.00 40.16 ? 719  GLN A OE1 1 
ATOM   488   N  NE2 . GLN A 1 66  ? 39.863  15.646  39.090 1.00 41.89 ? 719  GLN A NE2 1 
ATOM   489   N  N   . PHE A 1 67  ? 40.376  11.980  33.994 1.00 37.05 ? 720  PHE A N   1 
ATOM   490   C  CA  . PHE A 1 67  ? 41.035  10.923  33.241 1.00 38.01 ? 720  PHE A CA  1 
ATOM   491   C  C   . PHE A 1 67  ? 40.672  11.158  31.767 1.00 38.79 ? 720  PHE A C   1 
ATOM   492   O  O   . PHE A 1 67  ? 41.544  11.216  30.908 1.00 40.02 ? 720  PHE A O   1 
ATOM   493   C  CB  . PHE A 1 67  ? 40.562  9.546   33.717 1.00 36.77 ? 720  PHE A CB  1 
ATOM   494   C  CG  . PHE A 1 67  ? 41.171  8.388   32.967 1.00 36.17 ? 720  PHE A CG  1 
ATOM   495   C  CD1 . PHE A 1 67  ? 42.334  7.770   33.424 1.00 37.48 ? 720  PHE A CD1 1 
ATOM   496   C  CD2 . PHE A 1 67  ? 40.573  7.896   31.815 1.00 37.10 ? 720  PHE A CD2 1 
ATOM   497   C  CE1 . PHE A 1 67  ? 42.893  6.677   32.745 1.00 36.82 ? 720  PHE A CE1 1 
ATOM   498   C  CE2 . PHE A 1 67  ? 41.123  6.801   31.122 1.00 36.91 ? 720  PHE A CE2 1 
ATOM   499   C  CZ  . PHE A 1 67  ? 42.289  6.191   31.595 1.00 36.54 ? 720  PHE A CZ  1 
ATOM   500   N  N   . MET A 1 68  ? 39.389  11.331  31.471 1.00 38.14 ? 721  MET A N   1 
ATOM   501   C  CA  . MET A 1 68  ? 38.988  11.562  30.093 1.00 37.06 ? 721  MET A CA  1 
ATOM   502   C  C   . MET A 1 68  ? 39.483  12.893  29.535 1.00 35.13 ? 721  MET A C   1 
ATOM   503   O  O   . MET A 1 68  ? 39.805  12.998  28.346 1.00 34.40 ? 721  MET A O   1 
ATOM   504   C  CB  . MET A 1 68  ? 37.463  11.482  29.956 1.00 38.99 ? 721  MET A CB  1 
ATOM   505   C  CG  . MET A 1 68  ? 36.856  10.106  30.277 1.00 41.32 ? 721  MET A CG  1 
ATOM   506   S  SD  . MET A 1 68  ? 37.607  8.672   29.426 1.00 42.38 ? 721  MET A SD  1 
ATOM   507   C  CE  . MET A 1 68  ? 36.820  8.692   27.842 1.00 42.65 ? 721  MET A CE  1 
ATOM   508   N  N   . ASN A 1 69  ? 39.542  13.920  30.372 1.00 34.11 ? 722  ASN A N   1 
ATOM   509   C  CA  . ASN A 1 69  ? 40.012  15.222  29.879 1.00 34.18 ? 722  ASN A CA  1 
ATOM   510   C  C   . ASN A 1 69  ? 41.430  15.098  29.302 1.00 35.03 ? 722  ASN A C   1 
ATOM   511   O  O   . ASN A 1 69  ? 41.708  15.553  28.188 1.00 33.57 ? 722  ASN A O   1 
ATOM   512   C  CB  . ASN A 1 69  ? 40.023  16.268  31.010 1.00 34.07 ? 722  ASN A CB  1 
ATOM   513   C  CG  . ASN A 1 69  ? 38.616  16.641  31.493 1.00 35.42 ? 722  ASN A CG  1 
ATOM   514   O  OD1 . ASN A 1 69  ? 37.626  16.420  30.790 1.00 35.65 ? 722  ASN A OD1 1 
ATOM   515   N  ND2 . ASN A 1 69  ? 38.532  17.227  32.672 1.00 33.39 ? 722  ASN A ND2 1 
ATOM   516   N  N   . TYR A 1 70  ? 42.319  14.464  30.076 1.00 35.04 ? 723  TYR A N   1 
ATOM   517   C  CA  . TYR A 1 70  ? 43.690  14.303  29.657 1.00 33.86 ? 723  TYR A CA  1 
ATOM   518   C  C   . TYR A 1 70  ? 43.842  13.470  28.413 1.00 33.60 ? 723  TYR A C   1 
ATOM   519   O  O   . TYR A 1 70  ? 44.421  13.922  27.431 1.00 32.64 ? 723  TYR A O   1 
ATOM   520   C  CB  . TYR A 1 70  ? 44.569  13.692  30.769 1.00 34.01 ? 723  TYR A CB  1 
ATOM   521   C  CG  . TYR A 1 70  ? 46.024  13.577  30.357 1.00 29.46 ? 723  TYR A CG  1 
ATOM   522   C  CD1 . TYR A 1 70  ? 46.781  14.714  30.084 1.00 29.15 ? 723  TYR A CD1 1 
ATOM   523   C  CD2 . TYR A 1 70  ? 46.606  12.337  30.130 1.00 28.40 ? 723  TYR A CD2 1 
ATOM   524   C  CE1 . TYR A 1 70  ? 48.090  14.623  29.578 1.00 27.82 ? 723  TYR A CE1 1 
ATOM   525   C  CE2 . TYR A 1 70  ? 47.905  12.232  29.632 1.00 26.81 ? 723  TYR A CE2 1 
ATOM   526   C  CZ  . TYR A 1 70  ? 48.652  13.379  29.353 1.00 27.23 ? 723  TYR A CZ  1 
ATOM   527   O  OH  . TYR A 1 70  ? 49.951  13.276  28.863 1.00 23.54 ? 723  TYR A OH  1 
ATOM   528   N  N   . PHE A 1 71  ? 43.333  12.248  28.440 1.00 33.45 ? 724  PHE A N   1 
ATOM   529   C  CA  . PHE A 1 71  ? 43.502  11.401  27.274 1.00 33.64 ? 724  PHE A CA  1 
ATOM   530   C  C   . PHE A 1 71  ? 42.786  11.913  26.061 1.00 34.50 ? 724  PHE A C   1 
ATOM   531   O  O   . PHE A 1 71  ? 43.204  11.614  24.940 1.00 33.91 ? 724  PHE A O   1 
ATOM   532   C  CB  . PHE A 1 71  ? 43.176  9.966   27.624 1.00 33.06 ? 724  PHE A CB  1 
ATOM   533   C  CG  . PHE A 1 71  ? 44.177  9.384   28.597 1.00 34.50 ? 724  PHE A CG  1 
ATOM   534   C  CD1 . PHE A 1 71  ? 45.472  9.080   28.177 1.00 33.96 ? 724  PHE A CD1 1 
ATOM   535   C  CD2 . PHE A 1 71  ? 43.872  9.262   29.952 1.00 33.90 ? 724  PHE A CD2 1 
ATOM   536   C  CE1 . PHE A 1 71  ? 46.439  8.671   29.079 1.00 34.62 ? 724  PHE A CE1 1 
ATOM   537   C  CE2 . PHE A 1 71  ? 44.838  8.851   30.869 1.00 33.44 ? 724  PHE A CE2 1 
ATOM   538   C  CZ  . PHE A 1 71  ? 46.126  8.558   30.428 1.00 36.00 ? 724  PHE A CZ  1 
ATOM   539   N  N   . ARG A 1 72  ? 41.738  12.718  26.258 1.00 34.94 ? 725  ARG A N   1 
ATOM   540   C  CA  . ARG A 1 72  ? 41.065  13.319  25.110 1.00 35.30 ? 725  ARG A CA  1 
ATOM   541   C  C   . ARG A 1 72  ? 41.994  14.388  24.539 1.00 33.66 ? 725  ARG A C   1 
ATOM   542   O  O   . ARG A 1 72  ? 42.118  14.522  23.338 1.00 34.31 ? 725  ARG A O   1 
ATOM   543   C  CB  . ARG A 1 72  ? 39.748  13.949  25.528 1.00 39.23 ? 725  ARG A CB  1 
ATOM   544   C  CG  . ARG A 1 72  ? 38.616  12.949  25.609 1.00 42.72 ? 725  ARG A CG  1 
ATOM   545   C  CD  . ARG A 1 72  ? 37.349  13.619  26.069 1.00 45.03 ? 725  ARG A CD  1 
ATOM   546   N  NE  . ARG A 1 72  ? 36.270  12.643  26.218 1.00 49.06 ? 725  ARG A NE  1 
ATOM   547   C  CZ  . ARG A 1 72  ? 35.246  12.769  27.064 1.00 48.91 ? 725  ARG A CZ  1 
ATOM   548   N  NH1 . ARG A 1 72  ? 35.157  13.839  27.851 1.00 45.61 ? 725  ARG A NH1 1 
ATOM   549   N  NH2 . ARG A 1 72  ? 34.320  11.811  27.127 1.00 49.28 ? 725  ARG A NH2 1 
ATOM   550   N  N   . ALA A 1 73  ? 42.662  15.140  25.415 1.00 33.31 ? 726  ALA A N   1 
ATOM   551   C  CA  . ALA A 1 73  ? 43.593  16.170  24.983 1.00 30.65 ? 726  ALA A CA  1 
ATOM   552   C  C   . ALA A 1 73  ? 44.857  15.562  24.356 1.00 31.59 ? 726  ALA A C   1 
ATOM   553   O  O   . ALA A 1 73  ? 45.409  16.105  23.388 1.00 32.91 ? 726  ALA A O   1 
ATOM   554   C  CB  . ALA A 1 73  ? 43.950  17.030  26.133 1.00 29.80 ? 726  ALA A CB  1 
ATOM   555   N  N   . LEU A 1 74  ? 45.316  14.439  24.902 1.00 30.46 ? 727  LEU A N   1 
ATOM   556   C  CA  . LEU A 1 74  ? 46.497  13.749  24.383 1.00 30.39 ? 727  LEU A CA  1 
ATOM   557   C  C   . LEU A 1 74  ? 46.229  13.303  22.953 1.00 32.01 ? 727  LEU A C   1 
ATOM   558   O  O   . LEU A 1 74  ? 47.053  13.518  22.077 1.00 33.31 ? 727  LEU A O   1 
ATOM   559   C  CB  . LEU A 1 74  ? 46.835  12.507  25.249 1.00 27.92 ? 727  LEU A CB  1 
ATOM   560   C  CG  . LEU A 1 74  ? 48.112  11.701  24.938 1.00 26.10 ? 727  LEU A CG  1 
ATOM   561   C  CD1 . LEU A 1 74  ? 49.348  12.579  25.191 1.00 27.21 ? 727  LEU A CD1 1 
ATOM   562   C  CD2 . LEU A 1 74  ? 48.190  10.449  25.792 1.00 25.75 ? 727  LEU A CD2 1 
ATOM   563   N  N   . GLU A 1 75  ? 45.071  12.674  22.736 1.00 34.98 ? 728  GLU A N   1 
ATOM   564   C  CA  . GLU A 1 75  ? 44.663  12.176  21.421 1.00 37.24 ? 728  GLU A CA  1 
ATOM   565   C  C   . GLU A 1 75  ? 44.872  13.201  20.334 1.00 38.11 ? 728  GLU A C   1 
ATOM   566   O  O   . GLU A 1 75  ? 45.548  12.934  19.330 1.00 40.04 ? 728  GLU A O   1 
ATOM   567   C  CB  . GLU A 1 75  ? 43.168  11.836  21.390 1.00 38.58 ? 728  GLU A CB  1 
ATOM   568   C  CG  . GLU A 1 75  ? 42.804  10.553  22.004 1.00 43.26 ? 728  GLU A CG  1 
ATOM   569   C  CD  . GLU A 1 75  ? 41.313  10.295  21.974 1.00 44.78 ? 728  GLU A CD  1 
ATOM   570   O  OE1 . GLU A 1 75  ? 40.515  11.171  22.410 1.00 43.43 ? 728  GLU A OE1 1 
ATOM   571   O  OE2 . GLU A 1 75  ? 40.959  9.186   21.521 1.00 46.87 ? 728  GLU A OE2 1 
ATOM   572   N  N   . ASN A 1 76  ? 44.238  14.357  20.533 1.00 38.09 ? 729  ASN A N   1 
ATOM   573   C  CA  . ASN A 1 76  ? 44.288  15.447  19.586 1.00 38.95 ? 729  ASN A CA  1 
ATOM   574   C  C   . ASN A 1 76  ? 45.701  15.975  19.397 1.00 38.21 ? 729  ASN A C   1 
ATOM   575   O  O   . ASN A 1 76  ? 45.902  16.923  18.639 1.00 38.70 ? 729  ASN A O   1 
ATOM   576   C  CB  . ASN A 1 76  ? 43.348  16.580  20.033 1.00 41.31 ? 729  ASN A CB  1 
ATOM   577   C  CG  . ASN A 1 76  ? 41.897  16.117  20.167 1.00 43.11 ? 729  ASN A CG  1 
ATOM   578   O  OD1 . ASN A 1 76  ? 41.418  15.323  19.364 1.00 46.44 ? 729  ASN A OD1 1 
ATOM   579   N  ND2 . ASN A 1 76  ? 41.201  16.610  21.182 1.00 43.29 ? 729  ASN A ND2 1 
ATOM   580   N  N   . GLY A 1 77  ? 46.665  15.363  20.094 1.00 35.84 ? 730  GLY A N   1 
ATOM   581   C  CA  . GLY A 1 77  ? 48.054  15.766  19.978 1.00 34.52 ? 730  GLY A CA  1 
ATOM   582   C  C   . GLY A 1 77  ? 48.754  14.948  18.916 1.00 32.71 ? 730  GLY A C   1 
ATOM   583   O  O   . GLY A 1 77  ? 49.853  15.254  18.478 1.00 31.43 ? 730  GLY A O   1 
ATOM   584   N  N   . TYR A 1 78  ? 48.097  13.875  18.515 1.00 33.37 ? 731  TYR A N   1 
ATOM   585   C  CA  . TYR A 1 78  ? 48.609  13.019  17.473 1.00 33.43 ? 731  TYR A CA  1 
ATOM   586   C  C   . TYR A 1 78  ? 48.236  13.602  16.121 1.00 35.23 ? 731  TYR A C   1 
ATOM   587   O  O   . TYR A 1 78  ? 47.089  13.991  15.888 1.00 35.53 ? 731  TYR A O   1 
ATOM   588   C  CB  . TYR A 1 78  ? 48.040  11.618  17.616 1.00 30.77 ? 731  TYR A CB  1 
ATOM   589   C  CG  . TYR A 1 78  ? 48.824  10.795  18.581 1.00 26.45 ? 731  TYR A CG  1 
ATOM   590   C  CD1 . TYR A 1 78  ? 48.519  10.795  19.944 1.00 24.09 ? 731  TYR A CD1 1 
ATOM   591   C  CD2 . TYR A 1 78  ? 49.916  10.044  18.140 1.00 24.20 ? 731  TYR A CD2 1 
ATOM   592   C  CE1 . TYR A 1 78  ? 49.295  10.063  20.840 1.00 26.69 ? 731  TYR A CE1 1 
ATOM   593   C  CE2 . TYR A 1 78  ? 50.695  9.312   19.017 1.00 23.83 ? 731  TYR A CE2 1 
ATOM   594   C  CZ  . TYR A 1 78  ? 50.385  9.322   20.356 1.00 26.06 ? 731  TYR A CZ  1 
ATOM   595   O  OH  . TYR A 1 78  ? 51.155  8.581   21.213 1.00 28.69 ? 731  TYR A OH  1 
ATOM   596   N  N   . ARG A 1 79  ? 49.222  13.670  15.231 1.00 36.80 ? 732  ARG A N   1 
ATOM   597   C  CA  . ARG A 1 79  ? 49.019  14.236  13.911 1.00 37.23 ? 732  ARG A CA  1 
ATOM   598   C  C   . ARG A 1 79  ? 48.343  13.271  12.943 1.00 38.94 ? 732  ARG A C   1 
ATOM   599   O  O   . ARG A 1 79  ? 48.265  12.055  13.170 1.00 37.77 ? 732  ARG A O   1 
ATOM   600   C  CB  . ARG A 1 79  ? 50.351  14.721  13.328 1.00 35.01 ? 732  ARG A CB  1 
ATOM   601   C  CG  . ARG A 1 79  ? 51.085  15.718  14.206 1.00 36.30 ? 732  ARG A CG  1 
ATOM   602   C  CD  . ARG A 1 79  ? 52.088  16.555  13.425 1.00 37.03 ? 732  ARG A CD  1 
ATOM   603   N  NE  . ARG A 1 79  ? 53.044  17.200  14.311 1.00 41.34 ? 732  ARG A NE  1 
ATOM   604   C  CZ  . ARG A 1 79  ? 53.998  18.046  13.917 1.00 43.61 ? 732  ARG A CZ  1 
ATOM   605   N  NH1 . ARG A 1 79  ? 54.125  18.365  12.634 1.00 45.69 ? 732  ARG A NH1 1 
ATOM   606   N  NH2 . ARG A 1 79  ? 54.844  18.555  14.809 1.00 44.19 ? 732  ARG A NH2 1 
ATOM   607   N  N   . ASP A 1 80  ? 47.824  13.833  11.861 1.00 41.36 ? 733  ASP A N   1 
ATOM   608   C  CA  . ASP A 1 80  ? 47.165  13.020  10.867 1.00 42.30 ? 733  ASP A CA  1 
ATOM   609   C  C   . ASP A 1 80  ? 48.196  12.638  9.834  1.00 41.55 ? 733  ASP A C   1 
ATOM   610   O  O   . ASP A 1 80  ? 48.335  13.290  8.800  1.00 41.11 ? 733  ASP A O   1 
ATOM   611   C  CB  . ASP A 1 80  ? 46.024  13.778  10.207 1.00 46.64 ? 733  ASP A CB  1 
ATOM   612   C  CG  . ASP A 1 80  ? 45.189  12.876  9.309  1.00 49.95 ? 733  ASP A CG  1 
ATOM   613   O  OD1 . ASP A 1 80  ? 43.950  12.824  9.493  1.00 52.20 ? 733  ASP A OD1 1 
ATOM   614   O  OD2 . ASP A 1 80  ? 45.778  12.207  8.424  1.00 50.81 ? 733  ASP A OD2 1 
ATOM   615   N  N   . ILE A 1 81  ? 48.951  11.597  10.165 1.00 41.16 ? 734  ILE A N   1 
ATOM   616   C  CA  . ILE A 1 81  ? 49.985  11.065  9.309  1.00 39.34 ? 734  ILE A CA  1 
ATOM   617   C  C   . ILE A 1 81  ? 49.721  9.578   9.152  1.00 38.65 ? 734  ILE A C   1 
ATOM   618   O  O   . ILE A 1 81  ? 49.043  8.972   9.966  1.00 38.78 ? 734  ILE A O   1 
ATOM   619   C  CB  . ILE A 1 81  ? 51.404  11.336  9.888  1.00 41.14 ? 734  ILE A CB  1 
ATOM   620   C  CG1 . ILE A 1 81  ? 51.504  10.918  11.367 1.00 38.49 ? 734  ILE A CG1 1 
ATOM   621   C  CG2 . ILE A 1 81  ? 51.741  12.813  9.727  1.00 39.99 ? 734  ILE A CG2 1 
ATOM   622   C  CD1 . ILE A 1 81  ? 52.883  11.197  11.949 1.00 35.91 ? 734  ILE A CD1 1 
ATOM   623   N  N   . PRO A 1 82  ? 50.261  8.968   8.095  1.00 38.81 ? 735  PRO A N   1 
ATOM   624   C  CA  . PRO A 1 82  ? 50.043  7.539   7.850  1.00 37.94 ? 735  PRO A CA  1 
ATOM   625   C  C   . PRO A 1 82  ? 50.355  6.493   8.919  1.00 38.12 ? 735  PRO A C   1 
ATOM   626   O  O   . PRO A 1 82  ? 49.617  5.492   9.049  1.00 39.19 ? 735  PRO A O   1 
ATOM   627   C  CB  . PRO A 1 82  ? 50.790  7.281   6.535  1.00 35.90 ? 735  PRO A CB  1 
ATOM   628   C  CG  . PRO A 1 82  ? 51.665  8.460   6.353  1.00 40.07 ? 735  PRO A CG  1 
ATOM   629   C  CD  . PRO A 1 82  ? 50.968  9.607   6.976  1.00 39.49 ? 735  PRO A CD  1 
ATOM   630   N  N   . TYR A 1 83  ? 51.400  6.710   9.709  1.00 34.61 ? 736  TYR A N   1 
ATOM   631   C  CA  . TYR A 1 83  ? 51.753  5.706   10.682 1.00 31.97 ? 736  TYR A CA  1 
ATOM   632   C  C   . TYR A 1 83  ? 51.739  6.082   12.168 1.00 31.91 ? 736  TYR A C   1 
ATOM   633   O  O   . TYR A 1 83  ? 51.038  5.457   12.969 1.00 32.18 ? 736  TYR A O   1 
ATOM   634   C  CB  . TYR A 1 83  ? 53.108  5.133   10.296 1.00 32.11 ? 736  TYR A CB  1 
ATOM   635   C  CG  . TYR A 1 83  ? 53.479  3.915   11.075 1.00 33.43 ? 736  TYR A CG  1 
ATOM   636   C  CD1 . TYR A 1 83  ? 52.975  2.666   10.726 1.00 31.51 ? 736  TYR A CD1 1 
ATOM   637   C  CD2 . TYR A 1 83  ? 54.306  4.010   12.198 1.00 31.86 ? 736  TYR A CD2 1 
ATOM   638   C  CE1 . TYR A 1 83  ? 53.284  1.533   11.470 1.00 32.95 ? 736  TYR A CE1 1 
ATOM   639   C  CE2 . TYR A 1 83  ? 54.618  2.883   12.956 1.00 33.40 ? 736  TYR A CE2 1 
ATOM   640   C  CZ  . TYR A 1 83  ? 54.100  1.644   12.586 1.00 33.80 ? 736  TYR A CZ  1 
ATOM   641   O  OH  . TYR A 1 83  ? 54.372  0.527   13.335 1.00 34.77 ? 736  TYR A OH  1 
ATOM   642   N  N   . HIS A 1 84  ? 52.506  7.102   12.531 1.00 31.85 ? 737  HIS A N   1 
ATOM   643   C  CA  . HIS A 1 84  ? 52.618  7.526   13.915 1.00 30.96 ? 737  HIS A CA  1 
ATOM   644   C  C   . HIS A 1 84  ? 51.455  8.426   14.365 1.00 32.43 ? 737  HIS A C   1 
ATOM   645   O  O   . HIS A 1 84  ? 51.644  9.610   14.686 1.00 32.23 ? 737  HIS A O   1 
ATOM   646   C  CB  . HIS A 1 84  ? 53.998  8.206   14.117 1.00 28.01 ? 737  HIS A CB  1 
ATOM   647   C  CG  . HIS A 1 84  ? 55.168  7.309   13.828 1.00 26.30 ? 737  HIS A CG  1 
ATOM   648   N  ND1 . HIS A 1 84  ? 55.952  7.433   12.697 1.00 26.75 ? 737  HIS A ND1 1 
ATOM   649   C  CD2 . HIS A 1 84  ? 55.675  6.250   14.508 1.00 24.13 ? 737  HIS A CD2 1 
ATOM   650   C  CE1 . HIS A 1 84  ? 56.886  6.498   12.697 1.00 23.94 ? 737  HIS A CE1 1 
ATOM   651   N  NE2 . HIS A 1 84  ? 56.737  5.765   13.781 1.00 22.36 ? 737  HIS A NE2 1 
ATOM   652   N  N   . ASN A 1 85  ? 50.261  7.822   14.435 1.00 32.93 ? 738  ASN A N   1 
ATOM   653   C  CA  . ASN A 1 85  ? 49.000  8.502   14.806 1.00 32.07 ? 738  ASN A CA  1 
ATOM   654   C  C   . ASN A 1 85  ? 48.259  7.855   15.989 1.00 31.26 ? 738  ASN A C   1 
ATOM   655   O  O   . ASN A 1 85  ? 48.749  6.889   16.574 1.00 30.32 ? 738  ASN A O   1 
ATOM   656   C  CB  . ASN A 1 85  ? 48.076  8.523   13.578 1.00 33.73 ? 738  ASN A CB  1 
ATOM   657   C  CG  . ASN A 1 85  ? 47.829  7.111   13.023 1.00 31.51 ? 738  ASN A CG  1 
ATOM   658   O  OD1 . ASN A 1 85  ? 47.396  6.202   13.771 1.00 33.15 ? 738  ASN A OD1 1 
ATOM   659   N  ND2 . ASN A 1 85  ? 48.109  6.916   11.737 1.00 29.85 ? 738  ASN A ND2 1 
ATOM   660   N  N   . ARG A 1 86  ? 47.088  8.410   16.332 1.00 30.85 ? 739  ARG A N   1 
ATOM   661   C  CA  . ARG A 1 86  ? 46.229  7.903   17.435 1.00 32.41 ? 739  ARG A CA  1 
ATOM   662   C  C   . ARG A 1 86  ? 46.021  6.399   17.334 1.00 32.03 ? 739  ARG A C   1 
ATOM   663   O  O   . ARG A 1 86  ? 45.931  5.723   18.354 1.00 31.58 ? 739  ARG A O   1 
ATOM   664   C  CB  . ARG A 1 86  ? 44.787  8.451   17.368 1.00 34.49 ? 739  ARG A CB  1 
ATOM   665   C  CG  . ARG A 1 86  ? 44.636  9.924   17.341 1.00 39.07 ? 739  ARG A CG  1 
ATOM   666   C  CD  . ARG A 1 86  ? 43.592  10.318  16.366 1.00 39.21 ? 739  ARG A CD  1 
ATOM   667   N  NE  . ARG A 1 86  ? 42.784  11.381  16.918 1.00 42.88 ? 739  ARG A NE  1 
ATOM   668   C  CZ  . ARG A 1 86  ? 43.115  12.663  16.919 1.00 42.98 ? 739  ARG A CZ  1 
ATOM   669   N  NH1 . ARG A 1 86  ? 44.254  13.060  16.375 1.00 40.86 ? 739  ARG A NH1 1 
ATOM   670   N  NH2 . ARG A 1 86  ? 42.311  13.542  17.514 1.00 45.10 ? 739  ARG A NH2 1 
ATOM   671   N  N   . ILE A 1 87  ? 45.863  5.913   16.100 1.00 30.24 ? 740  ILE A N   1 
ATOM   672   C  CA  . ILE A 1 87  ? 45.585  4.511   15.854 1.00 31.81 ? 740  ILE A CA  1 
ATOM   673   C  C   . ILE A 1 87  ? 46.754  3.624   16.214 1.00 31.41 ? 740  ILE A C   1 
ATOM   674   O  O   . ILE A 1 87  ? 46.560  2.590   16.827 1.00 32.63 ? 740  ILE A O   1 
ATOM   675   C  CB  . ILE A 1 87  ? 45.136  4.278   14.371 1.00 30.75 ? 740  ILE A CB  1 
ATOM   676   C  CG1 . ILE A 1 87  ? 43.970  5.197   14.050 1.00 29.81 ? 740  ILE A CG1 1 
ATOM   677   C  CG2 . ILE A 1 87  ? 44.697  2.857   14.179 1.00 30.35 ? 740  ILE A CG2 1 
ATOM   678   C  CD1 . ILE A 1 87  ? 43.650  5.331   12.616 1.00 28.52 ? 740  ILE A CD1 1 
ATOM   679   N  N   . HIS A 1 88  ? 47.958  4.032   15.837 1.00 31.85 ? 741  HIS A N   1 
ATOM   680   C  CA  . HIS A 1 88  ? 49.166  3.282   16.200 1.00 32.25 ? 741  HIS A CA  1 
ATOM   681   C  C   . HIS A 1 88  ? 49.371  3.304   17.711 1.00 32.91 ? 741  HIS A C   1 
ATOM   682   O  O   . HIS A 1 88  ? 49.822  2.304   18.305 1.00 32.21 ? 741  HIS A O   1 
ATOM   683   C  CB  . HIS A 1 88  ? 50.392  3.887   15.525 1.00 33.50 ? 741  HIS A CB  1 
ATOM   684   C  CG  . HIS A 1 88  ? 51.687  3.318   16.000 1.00 35.48 ? 741  HIS A CG  1 
ATOM   685   N  ND1 . HIS A 1 88  ? 51.998  1.978   15.892 1.00 36.35 ? 741  HIS A ND1 1 
ATOM   686   C  CD2 . HIS A 1 88  ? 52.742  3.901   16.619 1.00 34.00 ? 741  HIS A CD2 1 
ATOM   687   C  CE1 . HIS A 1 88  ? 53.184  1.761   16.433 1.00 34.41 ? 741  HIS A CE1 1 
ATOM   688   N  NE2 . HIS A 1 88  ? 53.655  2.910   16.879 1.00 35.83 ? 741  HIS A NE2 1 
ATOM   689   N  N   . ALA A 1 89  ? 49.009  4.425   18.343 1.00 32.85 ? 742  ALA A N   1 
ATOM   690   C  CA  . ALA A 1 89  ? 49.176  4.548   19.789 1.00 33.07 ? 742  ALA A CA  1 
ATOM   691   C  C   . ALA A 1 89  ? 48.211  3.591   20.486 1.00 34.76 ? 742  ALA A C   1 
ATOM   692   O  O   . ALA A 1 89  ? 48.563  2.933   21.468 1.00 35.87 ? 742  ALA A O   1 
ATOM   693   C  CB  . ALA A 1 89  ? 48.921  5.980   20.227 1.00 31.20 ? 742  ALA A CB  1 
ATOM   694   N  N   . THR A 1 90  ? 46.992  3.512   19.965 1.00 34.67 ? 743  THR A N   1 
ATOM   695   C  CA  . THR A 1 90  ? 45.981  2.622   20.525 1.00 34.77 ? 743  THR A CA  1 
ATOM   696   C  C   . THR A 1 90  ? 46.434  1.194   20.294 1.00 34.44 ? 743  THR A C   1 
ATOM   697   O  O   . THR A 1 90  ? 46.257  0.341   21.128 1.00 34.40 ? 743  THR A O   1 
ATOM   698   C  CB  . THR A 1 90  ? 44.625  2.811   19.833 1.00 34.78 ? 743  THR A CB  1 
ATOM   699   O  OG1 . THR A 1 90  ? 44.161  4.153   20.020 1.00 34.06 ? 743  THR A OG1 1 
ATOM   700   C  CG2 . THR A 1 90  ? 43.617  1.852   20.387 1.00 34.18 ? 743  THR A CG2 1 
ATOM   701   N  N   . ASP A 1 91  ? 47.028  0.953   19.144 1.00 33.40 ? 744  ASP A N   1 
ATOM   702   C  CA  . ASP A 1 91  ? 47.495  -0.363  18.817 1.00 34.11 ? 744  ASP A CA  1 
ATOM   703   C  C   . ASP A 1 91  ? 48.557  -0.844  19.801 1.00 35.84 ? 744  ASP A C   1 
ATOM   704   O  O   . ASP A 1 91  ? 48.496  -1.964  20.324 1.00 35.29 ? 744  ASP A O   1 
ATOM   705   C  CB  . ASP A 1 91  ? 48.043  -0.357  17.400 1.00 36.34 ? 744  ASP A CB  1 
ATOM   706   C  CG  . ASP A 1 91  ? 48.253  -1.751  16.868 1.00 39.63 ? 744  ASP A CG  1 
ATOM   707   O  OD1 . ASP A 1 91  ? 49.406  -2.073  16.508 1.00 39.03 ? 744  ASP A OD1 1 
ATOM   708   O  OD2 . ASP A 1 91  ? 47.261  -2.529  16.821 1.00 42.24 ? 744  ASP A OD2 1 
ATOM   709   N  N   . VAL A 1 92  ? 49.540  0.012   20.057 1.00 36.35 ? 745  VAL A N   1 
ATOM   710   C  CA  . VAL A 1 92  ? 50.605  -0.318  20.992 1.00 34.17 ? 745  VAL A CA  1 
ATOM   711   C  C   . VAL A 1 92  ? 50.072  -0.548  22.406 1.00 34.07 ? 745  VAL A C   1 
ATOM   712   O  O   . VAL A 1 92  ? 50.562  -1.405  23.127 1.00 33.76 ? 745  VAL A O   1 
ATOM   713   C  CB  . VAL A 1 92  ? 51.663  0.797   21.028 1.00 37.11 ? 745  VAL A CB  1 
ATOM   714   C  CG1 . VAL A 1 92  ? 52.762  0.458   22.089 1.00 34.90 ? 745  VAL A CG1 1 
ATOM   715   C  CG2 . VAL A 1 92  ? 52.283  0.943   19.625 1.00 36.76 ? 745  VAL A CG2 1 
ATOM   716   N  N   . LEU A 1 93  ? 49.071  0.228   22.793 1.00 33.15 ? 746  LEU A N   1 
ATOM   717   C  CA  . LEU A 1 93  ? 48.451  0.106   24.095 1.00 32.16 ? 746  LEU A CA  1 
ATOM   718   C  C   . LEU A 1 93  ? 47.758  -1.258  24.249 1.00 34.83 ? 746  LEU A C   1 
ATOM   719   O  O   . LEU A 1 93  ? 47.883  -1.949  25.275 1.00 35.16 ? 746  LEU A O   1 
ATOM   720   C  CB  . LEU A 1 93  ? 47.432  1.223   24.243 1.00 30.93 ? 746  LEU A CB  1 
ATOM   721   C  CG  . LEU A 1 93  ? 46.414  1.151   25.372 1.00 28.00 ? 746  LEU A CG  1 
ATOM   722   C  CD1 . LEU A 1 93  ? 47.078  1.128   26.699 1.00 27.75 ? 746  LEU A CD1 1 
ATOM   723   C  CD2 . LEU A 1 93  ? 45.536  2.338   25.250 1.00 29.35 ? 746  LEU A CD2 1 
ATOM   724   N  N   . HIS A 1 94  ? 47.012  -1.634  23.214 1.00 34.87 ? 747  HIS A N   1 
ATOM   725   C  CA  . HIS A 1 94  ? 46.292  -2.897  23.199 1.00 35.21 ? 747  HIS A CA  1 
ATOM   726   C  C   . HIS A 1 94  ? 47.268  -4.053  23.285 1.00 34.34 ? 747  HIS A C   1 
ATOM   727   O  O   . HIS A 1 94  ? 47.018  -5.034  23.971 1.00 34.06 ? 747  HIS A O   1 
ATOM   728   C  CB  . HIS A 1 94  ? 45.443  -3.013  21.929 1.00 35.83 ? 747  HIS A CB  1 
ATOM   729   C  CG  . HIS A 1 94  ? 44.991  -4.411  21.647 1.00 37.80 ? 747  HIS A CG  1 
ATOM   730   N  ND1 . HIS A 1 94  ? 45.751  -5.300  20.916 1.00 36.71 ? 747  HIS A ND1 1 
ATOM   731   C  CD2 . HIS A 1 94  ? 43.923  -5.111  22.100 1.00 34.52 ? 747  HIS A CD2 1 
ATOM   732   C  CE1 . HIS A 1 94  ? 45.172  -6.487  20.939 1.00 36.70 ? 747  HIS A CE1 1 
ATOM   733   N  NE2 . HIS A 1 94  ? 44.063  -6.399  21.651 1.00 35.76 ? 747  HIS A NE2 1 
ATOM   734   N  N   . ALA A 1 95  ? 48.396  -3.915  22.600 1.00 36.12 ? 748  ALA A N   1 
ATOM   735   C  CA  . ALA A 1 95  ? 49.407  -4.954  22.616 1.00 35.32 ? 748  ALA A CA  1 
ATOM   736   C  C   . ALA A 1 95  ? 49.991  -5.177  23.999 1.00 37.68 ? 748  ALA A C   1 
ATOM   737   O  O   . ALA A 1 95  ? 50.001  -6.313  24.475 1.00 40.17 ? 748  ALA A O   1 
ATOM   738   C  CB  . ALA A 1 95  ? 50.493  -4.626  21.649 1.00 34.41 ? 748  ALA A CB  1 
ATOM   739   N  N   . VAL A 1 96  ? 50.470  -4.115  24.659 1.00 37.20 ? 749  VAL A N   1 
ATOM   740   C  CA  . VAL A 1 96  ? 51.061  -4.261  25.989 1.00 35.24 ? 749  VAL A CA  1 
ATOM   741   C  C   . VAL A 1 96  ? 50.058  -4.702  27.018 1.00 34.43 ? 749  VAL A C   1 
ATOM   742   O  O   . VAL A 1 96  ? 50.398  -5.467  27.920 1.00 34.85 ? 749  VAL A O   1 
ATOM   743   C  CB  . VAL A 1 96  ? 51.758  -2.953  26.520 1.00 35.39 ? 749  VAL A CB  1 
ATOM   744   C  CG1 . VAL A 1 96  ? 52.995  -2.666  25.738 1.00 35.40 ? 749  VAL A CG1 1 
ATOM   745   C  CG2 . VAL A 1 96  ? 50.826  -1.784  26.447 1.00 35.84 ? 749  VAL A CG2 1 
ATOM   746   N  N   . TRP A 1 97  ? 48.835  -4.198  26.916 1.00 33.02 ? 750  TRP A N   1 
ATOM   747   C  CA  . TRP A 1 97  ? 47.772  -4.606  27.839 1.00 32.92 ? 750  TRP A CA  1 
ATOM   748   C  C   . TRP A 1 97  ? 47.532  -6.114  27.663 1.00 34.12 ? 750  TRP A C   1 
ATOM   749   O  O   . TRP A 1 97  ? 47.371  -6.842  28.630 1.00 32.73 ? 750  TRP A O   1 
ATOM   750   C  CB  . TRP A 1 97  ? 46.473  -3.862  27.523 1.00 31.47 ? 750  TRP A CB  1 
ATOM   751   C  CG  . TRP A 1 97  ? 45.245  -4.519  28.112 1.00 34.40 ? 750  TRP A CG  1 
ATOM   752   C  CD1 . TRP A 1 97  ? 44.754  -4.370  29.376 1.00 35.36 ? 750  TRP A CD1 1 
ATOM   753   C  CD2 . TRP A 1 97  ? 44.346  -5.407  27.446 1.00 34.38 ? 750  TRP A CD2 1 
ATOM   754   N  NE1 . TRP A 1 97  ? 43.606  -5.101  29.535 1.00 32.55 ? 750  TRP A NE1 1 
ATOM   755   C  CE2 . TRP A 1 97  ? 43.332  -5.750  28.368 1.00 34.76 ? 750  TRP A CE2 1 
ATOM   756   C  CE3 . TRP A 1 97  ? 44.296  -5.946  26.153 1.00 36.38 ? 750  TRP A CE3 1 
ATOM   757   C  CZ2 . TRP A 1 97  ? 42.266  -6.611  28.039 1.00 35.97 ? 750  TRP A CZ2 1 
ATOM   758   C  CZ3 . TRP A 1 97  ? 43.229  -6.804  25.827 1.00 35.56 ? 750  TRP A CZ3 1 
ATOM   759   C  CH2 . TRP A 1 97  ? 42.236  -7.122  26.771 1.00 34.62 ? 750  TRP A CH2 1 
ATOM   760   N  N   . TYR A 1 98  ? 47.497  -6.556  26.410 1.00 35.97 ? 751  TYR A N   1 
ATOM   761   C  CA  . TYR A 1 98  ? 47.289  -7.947  26.110 1.00 39.70 ? 751  TYR A CA  1 
ATOM   762   C  C   . TYR A 1 98  ? 48.484  -8.797  26.569 1.00 39.95 ? 751  TYR A C   1 
ATOM   763   O  O   . TYR A 1 98  ? 48.308  -9.829  27.218 1.00 41.54 ? 751  TYR A O   1 
ATOM   764   C  CB  . TYR A 1 98  ? 47.063  -8.136  24.602 1.00 40.77 ? 751  TYR A CB  1 
ATOM   765   C  CG  . TYR A 1 98  ? 46.738  -9.564  24.187 1.00 41.99 ? 751  TYR A CG  1 
ATOM   766   C  CD1 . TYR A 1 98  ? 45.447  -9.922  23.789 1.00 44.56 ? 751  TYR A CD1 1 
ATOM   767   C  CD2 . TYR A 1 98  ? 47.714  -10.549 24.198 1.00 42.57 ? 751  TYR A CD2 1 
ATOM   768   C  CE1 . TYR A 1 98  ? 45.142  -11.238 23.407 1.00 45.45 ? 751  TYR A CE1 1 
ATOM   769   C  CE2 . TYR A 1 98  ? 47.426  -11.857 23.828 1.00 44.53 ? 751  TYR A CE2 1 
ATOM   770   C  CZ  . TYR A 1 98  ? 46.142  -12.199 23.434 1.00 45.02 ? 751  TYR A CZ  1 
ATOM   771   O  OH  . TYR A 1 98  ? 45.859  -13.490 23.085 1.00 43.43 ? 751  TYR A OH  1 
ATOM   772   N  N   . LEU A 1 99  ? 49.695  -8.366  26.237 1.00 39.57 ? 752  LEU A N   1 
ATOM   773   C  CA  . LEU A 1 99  ? 50.894  -9.120  26.600 1.00 38.02 ? 752  LEU A CA  1 
ATOM   774   C  C   . LEU A 1 99  ? 51.159  -9.223  28.077 1.00 37.55 ? 752  LEU A C   1 
ATOM   775   O  O   . LEU A 1 99  ? 51.857  -10.133 28.518 1.00 37.58 ? 752  LEU A O   1 
ATOM   776   C  CB  . LEU A 1 99  ? 52.139  -8.528  25.934 1.00 38.45 ? 752  LEU A CB  1 
ATOM   777   C  CG  . LEU A 1 99  ? 52.292  -8.780  24.445 1.00 38.56 ? 752  LEU A CG  1 
ATOM   778   C  CD1 . LEU A 1 99  ? 53.491  -8.041  23.917 1.00 39.78 ? 752  LEU A CD1 1 
ATOM   779   C  CD2 . LEU A 1 99  ? 52.436  -10.247 24.201 1.00 39.54 ? 752  LEU A CD2 1 
ATOM   780   N  N   . THR A 1 100 ? 50.626  -8.294  28.850 1.00 37.36 ? 753  THR A N   1 
ATOM   781   C  CA  . THR A 1 100 ? 50.858  -8.339  30.279 1.00 38.65 ? 753  THR A CA  1 
ATOM   782   C  C   . THR A 1 100 ? 49.691  -8.948  31.058 1.00 40.77 ? 753  THR A C   1 
ATOM   783   O  O   . THR A 1 100 ? 49.769  -9.078  32.274 1.00 42.06 ? 753  THR A O   1 
ATOM   784   C  CB  . THR A 1 100 ? 51.186  -6.917  30.850 1.00 37.64 ? 753  THR A CB  1 
ATOM   785   O  OG1 . THR A 1 100 ? 50.171  -5.961  30.488 1.00 35.49 ? 753  THR A OG1 1 
ATOM   786   C  CG2 . THR A 1 100 ? 52.518  -6.448  30.307 1.00 37.37 ? 753  THR A CG2 1 
ATOM   787   N  N   . THR A 1 101 ? 48.617  -9.343  30.383 1.00 40.75 ? 754  THR A N   1 
ATOM   788   C  CA  . THR A 1 101 ? 47.495  -9.890  31.135 1.00 42.16 ? 754  THR A CA  1 
ATOM   789   C  C   . THR A 1 101 ? 47.040  -11.292 30.729 1.00 44.38 ? 754  THR A C   1 
ATOM   790   O  O   . THR A 1 101 ? 46.506  -12.004 31.558 1.00 44.14 ? 754  THR A O   1 
ATOM   791   C  CB  . THR A 1 101 ? 46.225  -8.933  31.093 1.00 41.45 ? 754  THR A CB  1 
ATOM   792   O  OG1 . THR A 1 101 ? 45.675  -8.871  29.761 1.00 39.18 ? 754  THR A OG1 1 
ATOM   793   C  CG2 . THR A 1 101 ? 46.574  -7.534  31.566 1.00 37.88 ? 754  THR A CG2 1 
ATOM   794   N  N   . ARG A 1 102 ? 47.257  -11.691 29.472 1.00 44.57 ? 755  ARG A N   1 
ATOM   795   C  CA  . ARG A 1 102 ? 46.805  -12.998 29.027 1.00 45.41 ? 755  ARG A CA  1 
ATOM   796   C  C   . ARG A 1 102 ? 47.696  -14.138 29.521 1.00 47.21 ? 755  ARG A C   1 
ATOM   797   O  O   . ARG A 1 102 ? 48.889  -13.958 29.779 1.00 47.62 ? 755  ARG A O   1 
ATOM   798   C  CB  . ARG A 1 102 ? 46.711  -13.058 27.502 1.00 44.62 ? 755  ARG A CB  1 
ATOM   799   C  CG  . ARG A 1 102 ? 45.924  -11.937 26.807 1.00 45.16 ? 755  ARG A CG  1 
ATOM   800   C  CD  . ARG A 1 102 ? 44.426  -11.845 27.101 1.00 43.70 ? 755  ARG A CD  1 
ATOM   801   N  NE  . ARG A 1 102 ? 44.144  -10.780 28.043 1.00 46.70 ? 755  ARG A NE  1 
ATOM   802   C  CZ  . ARG A 1 102 ? 42.958  -10.200 28.257 1.00 48.58 ? 755  ARG A CZ  1 
ATOM   803   N  NH1 . ARG A 1 102 ? 41.873  -10.556 27.590 1.00 47.82 ? 755  ARG A NH1 1 
ATOM   804   N  NH2 . ARG A 1 102 ? 42.864  -9.238  29.175 1.00 50.13 ? 755  ARG A NH2 1 
ATOM   805   N  N   . PRO A 1 103 ? 47.111  -15.338 29.663 1.00 47.46 ? 756  PRO A N   1 
ATOM   806   C  CA  . PRO A 1 103 ? 47.811  -16.531 30.127 1.00 47.33 ? 756  PRO A CA  1 
ATOM   807   C  C   . PRO A 1 103 ? 49.069  -16.842 29.359 1.00 48.62 ? 756  PRO A C   1 
ATOM   808   O  O   . PRO A 1 103 ? 49.120  -16.687 28.152 1.00 48.99 ? 756  PRO A O   1 
ATOM   809   C  CB  . PRO A 1 103 ? 46.756  -17.614 29.984 1.00 48.18 ? 756  PRO A CB  1 
ATOM   810   C  CG  . PRO A 1 103 ? 45.511  -16.882 30.376 1.00 48.36 ? 756  PRO A CG  1 
ATOM   811   C  CD  . PRO A 1 103 ? 45.656  -15.579 29.610 1.00 47.48 ? 756  PRO A CD  1 
ATOM   812   N  N   . VAL A 1 104 ? 50.085  -17.283 30.082 1.00 49.53 ? 757  VAL A N   1 
ATOM   813   C  CA  . VAL A 1 104 ? 51.356  -17.640 29.492 1.00 50.58 ? 757  VAL A CA  1 
ATOM   814   C  C   . VAL A 1 104 ? 51.734  -19.029 30.003 1.00 52.30 ? 757  VAL A C   1 
ATOM   815   O  O   . VAL A 1 104 ? 51.838  -19.267 31.214 1.00 52.36 ? 757  VAL A O   1 
ATOM   816   C  CB  . VAL A 1 104 ? 52.450  -16.659 29.907 1.00 50.61 ? 757  VAL A CB  1 
ATOM   817   C  CG1 . VAL A 1 104 ? 53.759  -17.002 29.200 1.00 49.12 ? 757  VAL A CG1 1 
ATOM   818   C  CG2 . VAL A 1 104 ? 52.011  -15.259 29.586 1.00 51.17 ? 757  VAL A CG2 1 
ATOM   819   N  N   . PRO A 1 105 ? 51.952  -19.968 29.086 1.00 53.28 ? 758  PRO A N   1 
ATOM   820   C  CA  . PRO A 1 105 ? 52.312  -21.316 29.525 1.00 54.51 ? 758  PRO A CA  1 
ATOM   821   C  C   . PRO A 1 105 ? 53.613  -21.349 30.311 1.00 54.40 ? 758  PRO A C   1 
ATOM   822   O  O   . PRO A 1 105 ? 54.602  -20.742 29.909 1.00 54.32 ? 758  PRO A O   1 
ATOM   823   C  CB  . PRO A 1 105 ? 52.429  -22.096 28.206 1.00 54.67 ? 758  PRO A CB  1 
ATOM   824   C  CG  . PRO A 1 105 ? 51.543  -21.330 27.251 1.00 54.87 ? 758  PRO A CG  1 
ATOM   825   C  CD  . PRO A 1 105 ? 51.879  -19.894 27.615 1.00 54.21 ? 758  PRO A CD  1 
ATOM   826   N  N   . GLY A 1 106 ? 53.592  -22.052 31.438 1.00 55.57 ? 759  GLY A N   1 
ATOM   827   C  CA  . GLY A 1 106 ? 54.788  -22.220 32.239 1.00 56.54 ? 759  GLY A CA  1 
ATOM   828   C  C   . GLY A 1 106 ? 55.220  -21.094 33.145 1.00 57.80 ? 759  GLY A C   1 
ATOM   829   O  O   . GLY A 1 106 ? 55.934  -21.332 34.117 1.00 58.85 ? 759  GLY A O   1 
ATOM   830   N  N   . LEU A 1 107 ? 54.810  -19.869 32.845 1.00 57.72 ? 760  LEU A N   1 
ATOM   831   C  CA  . LEU A 1 107 ? 55.205  -18.749 33.679 1.00 58.27 ? 760  LEU A CA  1 
ATOM   832   C  C   . LEU A 1 107 ? 54.876  -18.937 35.163 1.00 59.03 ? 760  LEU A C   1 
ATOM   833   O  O   . LEU A 1 107 ? 53.733  -19.222 35.525 1.00 59.54 ? 760  LEU A O   1 
ATOM   834   C  CB  . LEU A 1 107 ? 54.553  -17.454 33.191 1.00 56.41 ? 760  LEU A CB  1 
ATOM   835   C  CG  . LEU A 1 107 ? 55.062  -16.241 33.987 1.00 54.38 ? 760  LEU A CG  1 
ATOM   836   C  CD1 . LEU A 1 107 ? 56.535  -15.952 33.623 1.00 51.94 ? 760  LEU A CD1 1 
ATOM   837   C  CD2 . LEU A 1 107 ? 54.164  -15.051 33.718 1.00 53.66 ? 760  LEU A CD2 1 
ATOM   838   N  N   . GLN A 1 108 ? 55.880  -18.753 36.018 1.00 60.43 ? 761  GLN A N   1 
ATOM   839   C  CA  . GLN A 1 108 ? 55.684  -18.882 37.466 1.00 62.61 ? 761  GLN A CA  1 
ATOM   840   C  C   . GLN A 1 108 ? 55.065  -17.623 38.119 1.00 63.43 ? 761  GLN A C   1 
ATOM   841   O  O   . GLN A 1 108 ? 55.513  -16.502 37.874 1.00 63.37 ? 761  GLN A O   1 
ATOM   842   C  CB  . GLN A 1 108 ? 57.021  -19.243 38.147 1.00 62.04 ? 761  GLN A CB  1 
ATOM   843   C  CG  . GLN A 1 108 ? 57.502  -20.677 37.842 1.00 62.65 ? 761  GLN A CG  1 
ATOM   844   C  CD  . GLN A 1 108 ? 56.435  -21.748 38.177 1.00 63.91 ? 761  GLN A CD  1 
ATOM   845   O  OE1 . GLN A 1 108 ? 56.008  -21.882 39.343 1.00 62.58 ? 761  GLN A OE1 1 
ATOM   846   N  NE2 . GLN A 1 108 ? 55.999  -22.512 37.148 1.00 62.82 ? 761  GLN A NE2 1 
ATOM   847   N  N   . GLN A 1 109 ? 54.027  -17.828 38.935 1.00 64.73 ? 762  GLN A N   1 
ATOM   848   C  CA  . GLN A 1 109 ? 53.338  -16.732 39.632 1.00 66.61 ? 762  GLN A CA  1 
ATOM   849   C  C   . GLN A 1 109 ? 54.004  -16.383 40.978 1.00 67.81 ? 762  GLN A C   1 
ATOM   850   O  O   . GLN A 1 109 ? 54.863  -17.106 41.487 1.00 67.66 ? 762  GLN A O   1 
ATOM   851   C  CB  . GLN A 1 109 ? 51.847  -17.071 39.860 1.00 66.68 ? 762  GLN A CB  1 
ATOM   852   C  CG  . GLN A 1 109 ? 51.066  -17.398 38.563 1.00 67.11 ? 762  GLN A CG  1 
ATOM   853   C  CD  . GLN A 1 109 ? 50.082  -16.299 38.135 1.00 67.13 ? 762  GLN A CD  1 
ATOM   854   O  OE1 . GLN A 1 109 ? 49.084  -16.014 38.827 1.00 67.17 ? 762  GLN A OE1 1 
ATOM   855   N  NE2 . GLN A 1 109 ? 50.355  -15.685 36.992 1.00 65.54 ? 762  GLN A NE2 1 
ATOM   856   N  N   . ILE A 1 110 ? 53.572  -15.277 41.569 1.00 69.66 ? 763  ILE A N   1 
ATOM   857   C  CA  . ILE A 1 110 ? 54.168  -14.803 42.810 1.00 70.27 ? 763  ILE A CA  1 
ATOM   858   C  C   . ILE A 1 110 ? 53.132  -14.162 43.731 1.00 71.89 ? 763  ILE A C   1 
ATOM   859   O  O   . ILE A 1 110 ? 53.061  -14.497 44.925 1.00 72.72 ? 763  ILE A O   1 
ATOM   860   C  CB  . ILE A 1 110 ? 55.286  -13.783 42.460 1.00 69.68 ? 763  ILE A CB  1 
ATOM   861   C  CG1 . ILE A 1 110 ? 56.502  -14.550 41.924 1.00 69.48 ? 763  ILE A CG1 1 
ATOM   862   C  CG2 . ILE A 1 110 ? 55.603  -12.869 43.652 1.00 69.22 ? 763  ILE A CG2 1 
ATOM   863   C  CD1 . ILE A 1 110 ? 57.683  -13.670 41.529 1.00 69.18 ? 763  ILE A CD1 1 
ATOM   864   N  N   . HIS A 1 111 ? 52.329  -13.252 43.168 1.00 72.56 ? 764  HIS A N   1 
ATOM   865   C  CA  . HIS A 1 111 ? 51.300  -12.535 43.932 1.00 73.50 ? 764  HIS A CA  1 
ATOM   866   C  C   . HIS A 1 111 ? 50.218  -11.836 43.073 1.00 73.27 ? 764  HIS A C   1 
ATOM   867   O  O   . HIS A 1 111 ? 50.502  -10.894 42.329 1.00 72.89 ? 764  HIS A O   1 
ATOM   868   C  CB  . HIS A 1 111 ? 51.972  -11.493 44.848 1.00 74.50 ? 764  HIS A CB  1 
ATOM   869   C  CG  . HIS A 1 111 ? 51.017  -10.764 45.752 1.00 75.96 ? 764  HIS A CG  1 
ATOM   870   N  ND1 . HIS A 1 111 ? 51.361  -9.602  46.417 1.00 76.44 ? 764  HIS A ND1 1 
ATOM   871   C  CD2 . HIS A 1 111 ? 49.733  -11.032 46.101 1.00 75.71 ? 764  HIS A CD2 1 
ATOM   872   C  CE1 . HIS A 1 111 ? 50.328  -9.184  47.132 1.00 76.75 ? 764  HIS A CE1 1 
ATOM   873   N  NE2 . HIS A 1 111 ? 49.328  -10.034 46.957 1.00 76.47 ? 764  HIS A NE2 1 
ATOM   874   N  N   . ASN A 1 112 ? 48.977  -12.304 43.215 1.00 74.04 ? 765  ASN A N   1 
ATOM   875   C  CA  . ASN A 1 112 ? 47.811  -11.762 42.500 1.00 74.33 ? 765  ASN A CA  1 
ATOM   876   C  C   . ASN A 1 112 ? 46.938  -10.919 43.464 1.00 74.36 ? 765  ASN A C   1 
ATOM   877   O  O   . ASN A 1 112 ? 46.664  -11.338 44.609 1.00 73.74 ? 765  ASN A O   1 
ATOM   878   C  CB  . ASN A 1 112 ? 46.973  -12.929 41.890 1.00 73.55 ? 765  ASN A CB  1 
ATOM   879   N  N   . GLY A 1 113 ? 46.511  -9.745  42.979 1.00 74.60 ? 766  GLY A N   1 
ATOM   880   C  CA  . GLY A 1 113 ? 45.678  -8.775  43.727 1.00 74.00 ? 766  GLY A CA  1 
ATOM   881   C  C   . GLY A 1 113 ? 46.459  -7.827  44.692 1.00 73.85 ? 766  GLY A C   1 
ATOM   882   O  O   . GLY A 1 113 ? 47.669  -8.060  44.959 1.00 73.56 ? 766  GLY A O   1 
ATOM   883   N  N   . GLY A 1 129 ? 49.066  0.951   51.622 1.00 69.24 ? 782  GLY A N   1 
ATOM   884   C  CA  . GLY A 1 129 ? 50.412  0.385   52.010 1.00 69.65 ? 782  GLY A CA  1 
ATOM   885   C  C   . GLY A 1 129 ? 50.958  -0.755  51.139 1.00 69.66 ? 782  GLY A C   1 
ATOM   886   O  O   . GLY A 1 129 ? 51.928  -0.568  50.397 1.00 69.54 ? 782  GLY A O   1 
ATOM   887   N  N   . ARG A 1 130 ? 50.345  -1.939  51.225 1.00 69.79 ? 783  ARG A N   1 
ATOM   888   C  CA  . ARG A 1 130 ? 50.790  -3.093  50.436 1.00 69.62 ? 783  ARG A CA  1 
ATOM   889   C  C   . ARG A 1 130 ? 50.796  -2.854  48.904 1.00 68.73 ? 783  ARG A C   1 
ATOM   890   O  O   . ARG A 1 130 ? 50.090  -1.967  48.377 1.00 68.47 ? 783  ARG A O   1 
ATOM   891   C  CB  . ARG A 1 130 ? 49.925  -4.334  50.735 1.00 70.71 ? 783  ARG A CB  1 
ATOM   892   C  CG  . ARG A 1 130 ? 50.551  -5.646  50.210 1.00 72.41 ? 783  ARG A CG  1 
ATOM   893   C  CD  . ARG A 1 130 ? 49.519  -6.692  49.804 1.00 72.63 ? 783  ARG A CD  1 
ATOM   894   N  NE  . ARG A 1 130 ? 48.632  -7.079  50.899 1.00 73.04 ? 783  ARG A NE  1 
ATOM   895   C  CZ  . ARG A 1 130 ? 47.666  -7.997  50.791 1.00 74.57 ? 783  ARG A CZ  1 
ATOM   896   N  NH1 . ARG A 1 130 ? 47.468  -8.629  49.627 1.00 73.13 ? 783  ARG A NH1 1 
ATOM   897   N  NH2 . ARG A 1 130 ? 46.882  -8.274  51.845 1.00 74.55 ? 783  ARG A NH2 1 
ATOM   898   N  N   . ILE A 1 131 ? 51.589  -3.678  48.207 1.00 66.56 ? 784  ILE A N   1 
ATOM   899   C  CA  . ILE A 1 131 ? 51.743  -3.621  46.752 1.00 63.59 ? 784  ILE A CA  1 
ATOM   900   C  C   . ILE A 1 131 ? 50.522  -4.254  46.054 1.00 61.97 ? 784  ILE A C   1 
ATOM   901   O  O   . ILE A 1 131 ? 50.240  -5.454  46.202 1.00 62.20 ? 784  ILE A O   1 
ATOM   902   C  CB  . ILE A 1 131 ? 53.039  -4.374  46.309 1.00 63.52 ? 784  ILE A CB  1 
ATOM   903   C  CG1 . ILE A 1 131 ? 54.266  -3.799  47.027 1.00 63.48 ? 784  ILE A CG1 1 
ATOM   904   C  CG2 . ILE A 1 131 ? 53.221  -4.287  44.804 1.00 61.56 ? 784  ILE A CG2 1 
ATOM   905   C  CD1 . ILE A 1 131 ? 54.620  -2.363  46.655 1.00 63.92 ? 784  ILE A CD1 1 
ATOM   906   N  N   . ALA A 1 132 ? 49.802  -3.429  45.297 1.00 59.12 ? 785  ALA A N   1 
ATOM   907   C  CA  . ALA A 1 132 ? 48.632  -3.883  44.563 1.00 56.07 ? 785  ALA A CA  1 
ATOM   908   C  C   . ALA A 1 132 ? 49.022  -4.431  43.198 1.00 53.97 ? 785  ALA A C   1 
ATOM   909   O  O   . ALA A 1 132 ? 50.030  -4.033  42.606 1.00 53.83 ? 785  ALA A O   1 
ATOM   910   C  CB  . ALA A 1 132 ? 47.639  -2.747  44.392 1.00 54.13 ? 785  ALA A CB  1 
ATOM   911   N  N   . TYR A 1 133 ? 48.208  -5.365  42.718 1.00 51.81 ? 786  TYR A N   1 
ATOM   912   C  CA  . TYR A 1 133 ? 48.386  -5.984  41.423 1.00 49.42 ? 786  TYR A CA  1 
ATOM   913   C  C   . TYR A 1 133 ? 47.039  -5.967  40.734 1.00 49.75 ? 786  TYR A C   1 
ATOM   914   O  O   . TYR A 1 133 ? 46.011  -6.121  41.383 1.00 50.11 ? 786  TYR A O   1 
ATOM   915   C  CB  . TYR A 1 133 ? 48.855  -7.423  41.589 1.00 47.14 ? 786  TYR A CB  1 
ATOM   916   C  CG  . TYR A 1 133 ? 50.267  -7.521  42.082 1.00 46.84 ? 786  TYR A CG  1 
ATOM   917   C  CD1 . TYR A 1 133 ? 50.582  -7.325  43.438 1.00 47.37 ? 786  TYR A CD1 1 
ATOM   918   C  CD2 . TYR A 1 133 ? 51.305  -7.759  41.194 1.00 45.95 ? 786  TYR A CD2 1 
ATOM   919   C  CE1 . TYR A 1 133 ? 51.910  -7.366  43.890 1.00 45.93 ? 786  TYR A CE1 1 
ATOM   920   C  CE2 . TYR A 1 133 ? 52.624  -7.799  41.630 1.00 47.02 ? 786  TYR A CE2 1 
ATOM   921   C  CZ  . TYR A 1 133 ? 52.927  -7.602  42.978 1.00 45.76 ? 786  TYR A CZ  1 
ATOM   922   O  OH  . TYR A 1 133 ? 54.249  -7.649  43.382 1.00 44.45 ? 786  TYR A OH  1 
ATOM   923   N  N   . ILE A 1 134 ? 47.027  -5.767  39.423 1.00 50.45 ? 787  ILE A N   1 
ATOM   924   C  CA  . ILE A 1 134 ? 45.762  -5.791  38.690 1.00 50.77 ? 787  ILE A CA  1 
ATOM   925   C  C   . ILE A 1 134 ? 45.471  -7.223  38.252 1.00 50.60 ? 787  ILE A C   1 
ATOM   926   O  O   . ILE A 1 134 ? 46.223  -8.160  38.536 1.00 50.41 ? 787  ILE A O   1 
ATOM   927   C  CB  . ILE A 1 134 ? 45.811  -4.966  37.381 1.00 51.05 ? 787  ILE A CB  1 
ATOM   928   C  CG1 . ILE A 1 134 ? 46.750  -5.662  36.387 1.00 50.08 ? 787  ILE A CG1 1 
ATOM   929   C  CG2 . ILE A 1 134 ? 46.264  -3.537  37.653 1.00 50.54 ? 787  ILE A CG2 1 
ATOM   930   C  CD1 . ILE A 1 134 ? 46.630  -5.170  34.981 1.00 52.05 ? 787  ILE A CD1 1 
ATOM   931   N  N   . SER A 1 135 ? 44.381  -7.360  37.512 1.00 51.43 ? 788  SER A N   1 
ATOM   932   C  CA  . SER A 1 135 ? 43.958  -8.632  36.954 1.00 51.52 ? 788  SER A CA  1 
ATOM   933   C  C   . SER A 1 135 ? 42.836  -8.367  35.961 1.00 51.93 ? 788  SER A C   1 
ATOM   934   O  O   . SER A 1 135 ? 41.782  -7.858  36.345 1.00 52.71 ? 788  SER A O   1 
ATOM   935   C  CB  . SER A 1 135 ? 43.443  -9.573  38.043 1.00 52.20 ? 788  SER A CB  1 
ATOM   936   O  OG  . SER A 1 135 ? 43.024  -10.803 37.465 1.00 52.89 ? 788  SER A OG  1 
ATOM   937   N  N   . SER A 1 136 ? 43.047  -8.699  34.690 1.00 51.06 ? 789  SER A N   1 
ATOM   938   C  CA  . SER A 1 136 ? 42.002  -8.476  33.716 1.00 50.60 ? 789  SER A CA  1 
ATOM   939   C  C   . SER A 1 136 ? 40.759  -9.328  33.988 1.00 51.44 ? 789  SER A C   1 
ATOM   940   O  O   . SER A 1 136 ? 40.840  -10.523 34.326 1.00 52.22 ? 789  SER A O   1 
ATOM   941   C  CB  . SER A 1 136 ? 42.485  -8.763  32.299 1.00 50.09 ? 789  SER A CB  1 
ATOM   942   O  OG  . SER A 1 136 ? 41.450  -8.432  31.372 1.00 46.75 ? 789  SER A OG  1 
ATOM   943   N  N   . LYS A 1 137 ? 39.606  -8.687  33.831 1.00 51.06 ? 790  LYS A N   1 
ATOM   944   C  CA  . LYS A 1 137 ? 38.316  -9.326  34.022 1.00 50.40 ? 790  LYS A CA  1 
ATOM   945   C  C   . LYS A 1 137 ? 37.904  -10.072 32.779 1.00 50.81 ? 790  LYS A C   1 
ATOM   946   O  O   . LYS A 1 137 ? 36.991  -10.882 32.830 1.00 51.45 ? 790  LYS A O   1 
ATOM   947   C  CB  . LYS A 1 137 ? 37.252  -8.281  34.300 1.00 50.04 ? 790  LYS A CB  1 
ATOM   948   C  CG  . LYS A 1 137 ? 37.522  -7.476  35.531 1.00 49.05 ? 790  LYS A CG  1 
ATOM   949   C  CD  . LYS A 1 137 ? 36.537  -6.338  35.630 1.00 48.35 ? 790  LYS A CD  1 
ATOM   950   C  CE  . LYS A 1 137 ? 37.024  -5.290  36.605 1.00 50.03 ? 790  LYS A CE  1 
ATOM   951   N  NZ  . LYS A 1 137 ? 36.078  -4.133  36.613 1.00 54.19 ? 790  LYS A NZ  1 
ATOM   952   N  N   . SER A 1 138 ? 38.555  -9.784  31.658 1.00 49.80 ? 791  SER A N   1 
ATOM   953   C  CA  . SER A 1 138 ? 38.205  -10.430 30.411 1.00 48.20 ? 791  SER A CA  1 
ATOM   954   C  C   . SER A 1 138 ? 39.033  -11.664 30.097 1.00 48.11 ? 791  SER A C   1 
ATOM   955   O  O   . SER A 1 138 ? 38.960  -12.205 28.991 1.00 46.89 ? 791  SER A O   1 
ATOM   956   C  CB  . SER A 1 138 ? 38.274  -9.412  29.260 1.00 49.61 ? 791  SER A CB  1 
ATOM   957   O  OG  . SER A 1 138 ? 39.522  -8.735  29.223 1.00 51.90 ? 791  SER A OG  1 
ATOM   958   N  N   . CYS A 1 139 ? 39.810  -12.124 31.069 1.00 48.41 ? 792  CYS A N   1 
ATOM   959   C  CA  . CYS A 1 139 ? 40.617  -13.319 30.869 1.00 51.03 ? 792  CYS A CA  1 
ATOM   960   C  C   . CYS A 1 139 ? 41.142  -13.870 32.201 1.00 53.08 ? 792  CYS A C   1 
ATOM   961   O  O   . CYS A 1 139 ? 41.219  -13.150 33.205 1.00 53.83 ? 792  CYS A O   1 
ATOM   962   C  CB  . CYS A 1 139 ? 41.791  -13.030 29.923 1.00 53.45 ? 792  CYS A CB  1 
ATOM   963   S  SG  . CYS A 1 139 ? 43.357  -12.668 30.740 1.00 55.48 ? 792  CYS A SG  1 
ATOM   964   N  N   . SER A 1 140 ? 41.501  -15.151 32.209 1.00 54.66 ? 793  SER A N   1 
ATOM   965   C  CA  . SER A 1 140 ? 42.003  -15.800 33.421 1.00 55.99 ? 793  SER A CA  1 
ATOM   966   C  C   . SER A 1 140 ? 42.909  -16.941 33.023 1.00 56.58 ? 793  SER A C   1 
ATOM   967   O  O   . SER A 1 140 ? 42.791  -17.473 31.927 1.00 56.91 ? 793  SER A O   1 
ATOM   968   C  CB  . SER A 1 140 ? 40.847  -16.364 34.246 1.00 56.01 ? 793  SER A CB  1 
ATOM   969   O  OG  . SER A 1 140 ? 40.222  -17.418 33.536 1.00 57.47 ? 793  SER A OG  1 
ATOM   970   N  N   . ASN A 1 141 ? 43.820  -17.322 33.908 1.00 57.68 ? 794  ASN A N   1 
ATOM   971   C  CA  . ASN A 1 141 ? 44.720  -18.425 33.594 1.00 59.04 ? 794  ASN A CA  1 
ATOM   972   C  C   . ASN A 1 141 ? 43.928  -19.727 33.772 1.00 59.35 ? 794  ASN A C   1 
ATOM   973   O  O   . ASN A 1 141 ? 43.333  -19.967 34.833 1.00 60.34 ? 794  ASN A O   1 
ATOM   974   C  CB  . ASN A 1 141 ? 45.952  -18.361 34.500 1.00 59.62 ? 794  ASN A CB  1 
ATOM   975   C  CG  . ASN A 1 141 ? 46.816  -17.118 34.222 1.00 60.65 ? 794  ASN A CG  1 
ATOM   976   O  OD1 . ASN A 1 141 ? 47.119  -16.801 33.060 1.00 60.68 ? 794  ASN A OD1 1 
ATOM   977   N  ND2 . ASN A 1 141 ? 47.221  -16.420 35.285 1.00 59.78 ? 794  ASN A ND2 1 
ATOM   978   N  N   . PRO A 1 142 ? 43.887  -20.572 32.721 1.00 58.70 ? 795  PRO A N   1 
ATOM   979   C  CA  . PRO A 1 142 ? 43.171  -21.859 32.688 1.00 58.77 ? 795  PRO A CA  1 
ATOM   980   C  C   . PRO A 1 142 ? 43.415  -22.737 33.900 1.00 58.42 ? 795  PRO A C   1 
ATOM   981   O  O   . PRO A 1 142 ? 42.477  -23.269 34.503 1.00 58.77 ? 795  PRO A O   1 
ATOM   982   C  CB  . PRO A 1 142 ? 43.686  -22.514 31.404 1.00 58.26 ? 795  PRO A CB  1 
ATOM   983   C  CG  . PRO A 1 142 ? 43.953  -21.340 30.517 1.00 57.89 ? 795  PRO A CG  1 
ATOM   984   C  CD  . PRO A 1 142 ? 44.644  -20.374 31.473 1.00 58.96 ? 795  PRO A CD  1 
ATOM   985   N  N   . ASP A 1 143 ? 44.684  -22.868 34.259 1.00 57.97 ? 796  ASP A N   1 
ATOM   986   C  CA  . ASP A 1 143 ? 45.076  -23.692 35.383 1.00 57.73 ? 796  ASP A CA  1 
ATOM   987   C  C   . ASP A 1 143 ? 46.448  -23.233 35.883 1.00 57.96 ? 796  ASP A C   1 
ATOM   988   O  O   . ASP A 1 143 ? 47.079  -22.359 35.283 1.00 57.47 ? 796  ASP A O   1 
ATOM   989   C  CB  . ASP A 1 143 ? 45.140  -25.143 34.916 1.00 56.82 ? 796  ASP A CB  1 
ATOM   990   C  CG  . ASP A 1 143 ? 46.067  -25.322 33.727 1.00 57.43 ? 796  ASP A CG  1 
ATOM   991   O  OD1 . ASP A 1 143 ? 47.292  -25.224 33.918 1.00 57.60 ? 796  ASP A OD1 1 
ATOM   992   O  OD2 . ASP A 1 143 ? 45.581  -25.540 32.600 1.00 58.12 ? 796  ASP A OD2 1 
ATOM   993   N  N   . GLU A 1 144 ? 46.906  -23.839 36.975 1.00 58.18 ? 797  GLU A N   1 
ATOM   994   C  CA  . GLU A 1 144 ? 48.198  -23.510 37.570 1.00 56.57 ? 797  GLU A CA  1 
ATOM   995   C  C   . GLU A 1 144 ? 49.389  -23.666 36.615 1.00 56.13 ? 797  GLU A C   1 
ATOM   996   O  O   . GLU A 1 144 ? 50.513  -23.288 36.965 1.00 55.03 ? 797  GLU A O   1 
ATOM   997   C  CB  . GLU A 1 144 ? 48.417  -24.356 38.814 1.00 57.38 ? 797  GLU A CB  1 
ATOM   998   N  N   . SER A 1 145 ? 49.158  -24.212 35.418 1.00 55.45 ? 798  SER A N   1 
ATOM   999   C  CA  . SER A 1 145 ? 50.250  -24.385 34.447 1.00 55.16 ? 798  SER A CA  1 
ATOM   1000  C  C   . SER A 1 145 ? 50.477  -23.127 33.602 1.00 54.64 ? 798  SER A C   1 
ATOM   1001  O  O   . SER A 1 145 ? 51.359  -23.088 32.745 1.00 53.37 ? 798  SER A O   1 
ATOM   1002  C  CB  . SER A 1 145 ? 50.002  -25.605 33.539 1.00 56.13 ? 798  SER A CB  1 
ATOM   1003  O  OG  . SER A 1 145 ? 48.949  -25.403 32.614 1.00 58.14 ? 798  SER A OG  1 
ATOM   1004  N  N   . TYR A 1 146 ? 49.662  -22.106 33.848 1.00 54.99 ? 799  TYR A N   1 
ATOM   1005  C  CA  . TYR A 1 146 ? 49.807  -20.823 33.176 1.00 55.29 ? 799  TYR A CA  1 
ATOM   1006  C  C   . TYR A 1 146 ? 50.128  -19.757 34.219 1.00 55.39 ? 799  TYR A C   1 
ATOM   1007  O  O   . TYR A 1 146 ? 50.194  -20.028 35.408 1.00 55.85 ? 799  TYR A O   1 
ATOM   1008  C  CB  . TYR A 1 146 ? 48.531  -20.422 32.446 1.00 53.62 ? 799  TYR A CB  1 
ATOM   1009  C  CG  . TYR A 1 146 ? 48.267  -21.222 31.197 1.00 53.62 ? 799  TYR A CG  1 
ATOM   1010  C  CD1 . TYR A 1 146 ? 47.467  -22.356 31.237 1.00 52.50 ? 799  TYR A CD1 1 
ATOM   1011  C  CD2 . TYR A 1 146 ? 48.797  -20.823 29.965 1.00 53.61 ? 799  TYR A CD2 1 
ATOM   1012  C  CE1 . TYR A 1 146 ? 47.181  -23.078 30.086 1.00 52.07 ? 799  TYR A CE1 1 
ATOM   1013  C  CE2 . TYR A 1 146 ? 48.526  -21.538 28.798 1.00 52.67 ? 799  TYR A CE2 1 
ATOM   1014  C  CZ  . TYR A 1 146 ? 47.702  -22.674 28.869 1.00 52.51 ? 799  TYR A CZ  1 
ATOM   1015  O  OH  . TYR A 1 146 ? 47.375  -23.391 27.728 1.00 50.76 ? 799  TYR A OH  1 
ATOM   1016  N  N   . GLY A 1 147 ? 50.331  -18.539 33.748 1.00 55.30 ? 800  GLY A N   1 
ATOM   1017  C  CA  . GLY A 1 147 ? 50.620  -17.433 34.633 1.00 53.34 ? 800  GLY A CA  1 
ATOM   1018  C  C   . GLY A 1 147 ? 50.547  -16.187 33.776 1.00 52.13 ? 800  GLY A C   1 
ATOM   1019  O  O   . GLY A 1 147 ? 50.555  -16.312 32.539 1.00 52.42 ? 800  GLY A O   1 
ATOM   1020  N  N   . CYS A 1 148 ? 50.432  -15.012 34.400 1.00 49.99 ? 801  CYS A N   1 
ATOM   1021  C  CA  . CYS A 1 148 ? 50.411  -13.752 33.663 1.00 48.27 ? 801  CYS A CA  1 
ATOM   1022  C  C   . CYS A 1 148 ? 51.356  -12.748 34.326 1.00 47.04 ? 801  CYS A C   1 
ATOM   1023  O  O   . CYS A 1 148 ? 51.569  -12.783 35.539 1.00 44.50 ? 801  CYS A O   1 
ATOM   1024  C  CB  . CYS A 1 148 ? 48.992  -13.209 33.576 1.00 49.15 ? 801  CYS A CB  1 
ATOM   1025  S  SG  . CYS A 1 148 ? 48.195  -13.098 35.143 1.00 50.89 ? 801  CYS A SG  1 
ATOM   1026  N  N   . LEU A 1 149 ? 51.955  -11.878 33.513 1.00 46.42 ? 802  LEU A N   1 
ATOM   1027  C  CA  . LEU A 1 149 ? 52.899  -10.894 34.035 1.00 46.30 ? 802  LEU A CA  1 
ATOM   1028  C  C   . LEU A 1 149 ? 52.254  -9.982  35.056 1.00 46.20 ? 802  LEU A C   1 
ATOM   1029  O  O   . LEU A 1 149 ? 52.940  -9.458  35.930 1.00 46.71 ? 802  LEU A O   1 
ATOM   1030  C  CB  . LEU A 1 149 ? 53.484  -10.044 32.909 1.00 45.51 ? 802  LEU A CB  1 
ATOM   1031  C  CG  . LEU A 1 149 ? 54.163  -10.757 31.741 1.00 45.11 ? 802  LEU A CG  1 
ATOM   1032  C  CD1 . LEU A 1 149 ? 54.960  -9.752  30.972 1.00 45.27 ? 802  LEU A CD1 1 
ATOM   1033  C  CD2 . LEU A 1 149 ? 55.097  -11.825 32.214 1.00 45.28 ? 802  LEU A CD2 1 
ATOM   1034  N  N   . SER A 1 150 ? 50.936  -9.802  34.947 1.00 46.21 ? 803  SER A N   1 
ATOM   1035  C  CA  . SER A 1 150 ? 50.206  -8.946  35.862 1.00 46.84 ? 803  SER A CA  1 
ATOM   1036  C  C   . SER A 1 150 ? 50.237  -9.443  37.312 1.00 47.37 ? 803  SER A C   1 
ATOM   1037  O  O   . SER A 1 150 ? 49.919  -8.692  38.235 1.00 48.32 ? 803  SER A O   1 
ATOM   1038  C  CB  . SER A 1 150 ? 48.763  -8.761  35.387 1.00 45.78 ? 803  SER A CB  1 
ATOM   1039  O  OG  . SER A 1 150 ? 48.064  -9.983  35.355 1.00 46.41 ? 803  SER A OG  1 
ATOM   1040  N  N   . SER A 1 151 ? 50.616  -10.700 37.518 1.00 47.67 ? 804  SER A N   1 
ATOM   1041  C  CA  . SER A 1 151 ? 50.724  -11.234 38.876 1.00 48.19 ? 804  SER A CA  1 
ATOM   1042  C  C   . SER A 1 151 ? 52.140  -10.999 39.389 1.00 47.75 ? 804  SER A C   1 
ATOM   1043  O  O   . SER A 1 151 ? 52.397  -11.109 40.584 1.00 47.38 ? 804  SER A O   1 
ATOM   1044  C  CB  . SER A 1 151 ? 50.403  -12.729 38.926 1.00 47.87 ? 804  SER A CB  1 
ATOM   1045  O  OG  . SER A 1 151 ? 49.014  -12.930 38.758 1.00 50.82 ? 804  SER A OG  1 
ATOM   1046  N  N   . ASN A 1 152 ? 53.050  -10.644 38.484 1.00 47.75 ? 805  ASN A N   1 
ATOM   1047  C  CA  . ASN A 1 152 ? 54.433  -10.391 38.870 1.00 47.60 ? 805  ASN A CA  1 
ATOM   1048  C  C   . ASN A 1 152 ? 54.859  -8.935  38.770 1.00 46.87 ? 805  ASN A C   1 
ATOM   1049  O  O   . ASN A 1 152 ? 55.896  -8.547  39.294 1.00 47.33 ? 805  ASN A O   1 
ATOM   1050  C  CB  . ASN A 1 152 ? 55.369  -11.253 38.026 1.00 48.76 ? 805  ASN A CB  1 
ATOM   1051  C  CG  . ASN A 1 152 ? 55.138  -12.733 38.235 1.00 50.22 ? 805  ASN A CG  1 
ATOM   1052  O  OD1 . ASN A 1 152 ? 55.863  -13.571 37.690 1.00 51.95 ? 805  ASN A OD1 1 
ATOM   1053  N  ND2 . ASN A 1 152 ? 54.128  -13.068 39.028 1.00 50.17 ? 805  ASN A ND2 1 
ATOM   1054  N  N   . ILE A 1 153 ? 54.079  -8.127  38.075 1.00 46.16 ? 806  ILE A N   1 
ATOM   1055  C  CA  . ILE A 1 153 ? 54.437  -6.723  37.941 1.00 45.44 ? 806  ILE A CA  1 
ATOM   1056  C  C   . ILE A 1 153 ? 53.338  -5.911  38.595 1.00 44.74 ? 806  ILE A C   1 
ATOM   1057  O  O   . ILE A 1 153 ? 52.178  -5.961  38.190 1.00 45.69 ? 806  ILE A O   1 
ATOM   1058  C  CB  . ILE A 1 153 ? 54.594  -6.307  36.457 1.00 45.95 ? 806  ILE A CB  1 
ATOM   1059  C  CG1 . ILE A 1 153 ? 55.636  -7.207  35.772 1.00 45.74 ? 806  ILE A CG1 1 
ATOM   1060  C  CG2 . ILE A 1 153 ? 55.054  -4.853  36.376 1.00 44.78 ? 806  ILE A CG2 1 
ATOM   1061  C  CD1 . ILE A 1 153 ? 55.830  -6.910  34.297 1.00 44.72 ? 806  ILE A CD1 1 
ATOM   1062  N  N   . PRO A 1 154 ? 53.690  -5.157  39.630 1.00 41.98 ? 807  PRO A N   1 
ATOM   1063  C  CA  . PRO A 1 154 ? 52.705  -4.345  40.335 1.00 41.55 ? 807  PRO A CA  1 
ATOM   1064  C  C   . PRO A 1 154 ? 51.844  -3.443  39.459 1.00 40.09 ? 807  PRO A C   1 
ATOM   1065  O  O   . PRO A 1 154 ? 52.241  -3.055  38.361 1.00 39.15 ? 807  PRO A O   1 
ATOM   1066  C  CB  . PRO A 1 154 ? 53.553  -3.570  41.351 1.00 42.32 ? 807  PRO A CB  1 
ATOM   1067  C  CG  . PRO A 1 154 ? 54.948  -3.665  40.829 1.00 42.17 ? 807  PRO A CG  1 
ATOM   1068  C  CD  . PRO A 1 154 ? 55.040  -4.990  40.187 1.00 42.01 ? 807  PRO A CD  1 
ATOM   1069  N  N   . ALA A 1 155 ? 50.660  -3.118  39.970 1.00 37.75 ? 808  ALA A N   1 
ATOM   1070  C  CA  . ALA A 1 155 ? 49.704  -2.273  39.273 1.00 37.07 ? 808  ALA A CA  1 
ATOM   1071  C  C   . ALA A 1 155 ? 50.266  -0.929  38.772 1.00 37.64 ? 808  ALA A C   1 
ATOM   1072  O  O   . ALA A 1 155 ? 50.092  -0.552  37.608 1.00 37.16 ? 808  ALA A O   1 
ATOM   1073  C  CB  . ALA A 1 155 ? 48.494  -2.036  40.170 1.00 35.41 ? 808  ALA A CB  1 
ATOM   1074  N  N   . LEU A 1 156 ? 50.955  -0.221  39.658 1.00 38.62 ? 809  LEU A N   1 
ATOM   1075  C  CA  . LEU A 1 156 ? 51.536  1.089   39.363 1.00 38.29 ? 809  LEU A CA  1 
ATOM   1076  C  C   . LEU A 1 156 ? 52.479  1.066   38.179 1.00 39.39 ? 809  LEU A C   1 
ATOM   1077  O  O   . LEU A 1 156 ? 52.507  1.993   37.372 1.00 40.51 ? 809  LEU A O   1 
ATOM   1078  C  CB  . LEU A 1 156 ? 52.298  1.583   40.583 1.00 36.99 ? 809  LEU A CB  1 
ATOM   1079  C  CG  . LEU A 1 156 ? 52.976  2.936   40.485 1.00 37.32 ? 809  LEU A CG  1 
ATOM   1080  C  CD1 . LEU A 1 156 ? 51.963  4.040   40.806 1.00 38.09 ? 809  LEU A CD1 1 
ATOM   1081  C  CD2 . LEU A 1 156 ? 54.112  2.991   41.469 1.00 36.88 ? 809  LEU A CD2 1 
ATOM   1082  N  N   . GLU A 1 157 ? 53.266  -0.001  38.103 1.00 39.19 ? 810  GLU A N   1 
ATOM   1083  C  CA  . GLU A 1 157 ? 54.250  -0.194  37.056 1.00 37.33 ? 810  GLU A CA  1 
ATOM   1084  C  C   . GLU A 1 157 ? 53.649  -0.536  35.724 1.00 37.45 ? 810  GLU A C   1 
ATOM   1085  O  O   . GLU A 1 157 ? 54.202  -0.176  34.694 1.00 37.96 ? 810  GLU A O   1 
ATOM   1086  C  CB  . GLU A 1 157 ? 55.229  -1.289  37.470 1.00 39.37 ? 810  GLU A CB  1 
ATOM   1087  C  CG  . GLU A 1 157 ? 56.318  -0.788  38.401 1.00 40.59 ? 810  GLU A CG  1 
ATOM   1088  C  CD  . GLU A 1 157 ? 57.142  -1.887  39.044 1.00 40.84 ? 810  GLU A CD  1 
ATOM   1089  O  OE1 . GLU A 1 157 ? 57.685  -2.770  38.349 1.00 42.25 ? 810  GLU A OE1 1 
ATOM   1090  O  OE2 . GLU A 1 157 ? 57.253  -1.843  40.269 1.00 42.01 ? 810  GLU A OE2 1 
ATOM   1091  N  N   . LEU A 1 158 ? 52.542  -1.266  35.751 1.00 36.38 ? 811  LEU A N   1 
ATOM   1092  C  CA  . LEU A 1 158 ? 51.838  -1.638  34.533 1.00 35.92 ? 811  LEU A CA  1 
ATOM   1093  C  C   . LEU A 1 158 ? 51.001  -0.434  34.095 1.00 36.45 ? 811  LEU A C   1 
ATOM   1094  O  O   . LEU A 1 158 ? 50.807  -0.197  32.908 1.00 35.71 ? 811  LEU A O   1 
ATOM   1095  C  CB  . LEU A 1 158 ? 50.938  -2.858  34.787 1.00 36.03 ? 811  LEU A CB  1 
ATOM   1096  C  CG  . LEU A 1 158 ? 51.700  -4.190  34.862 1.00 34.01 ? 811  LEU A CG  1 
ATOM   1097  C  CD1 . LEU A 1 158 ? 50.721  -5.353  34.893 1.00 30.94 ? 811  LEU A CD1 1 
ATOM   1098  C  CD2 . LEU A 1 158 ? 52.627  -4.299  33.651 1.00 30.70 ? 811  LEU A CD2 1 
ATOM   1099  N  N   . MET A 1 159 ? 50.514  0.327   35.070 1.00 35.88 ? 812  MET A N   1 
ATOM   1100  C  CA  . MET A 1 159 ? 49.755  1.497   34.746 1.00 35.80 ? 812  MET A CA  1 
ATOM   1101  C  C   . MET A 1 159 ? 50.710  2.446   34.054 1.00 38.07 ? 812  MET A C   1 
ATOM   1102  O  O   . MET A 1 159 ? 50.328  3.109   33.074 1.00 40.01 ? 812  MET A O   1 
ATOM   1103  C  CB  . MET A 1 159 ? 49.182  2.160   35.981 1.00 35.51 ? 812  MET A CB  1 
ATOM   1104  C  CG  . MET A 1 159 ? 48.334  3.364   35.612 1.00 35.91 ? 812  MET A CG  1 
ATOM   1105  S  SD  . MET A 1 159 ? 47.295  4.005   36.948 1.00 38.55 ? 812  MET A SD  1 
ATOM   1106  C  CE  . MET A 1 159 ? 48.519  4.885   37.944 1.00 34.33 ? 812  MET A CE  1 
ATOM   1107  N  N   . ALA A 1 160 ? 51.954  2.507   34.536 1.00 36.19 ? 813  ALA A N   1 
ATOM   1108  C  CA  . ALA A 1 160 ? 52.948  3.378   33.915 1.00 35.44 ? 813  ALA A CA  1 
ATOM   1109  C  C   . ALA A 1 160 ? 53.175  2.901   32.492 1.00 34.92 ? 813  ALA A C   1 
ATOM   1110  O  O   . ALA A 1 160 ? 53.287  3.702   31.561 1.00 34.50 ? 813  ALA A O   1 
ATOM   1111  C  CB  . ALA A 1 160 ? 54.276  3.344   34.693 1.00 34.31 ? 813  ALA A CB  1 
ATOM   1112  N  N   . LEU A 1 161 ? 53.238  1.586   32.313 1.00 35.98 ? 814  LEU A N   1 
ATOM   1113  C  CA  . LEU A 1 161 ? 53.445  1.036   30.975 1.00 36.30 ? 814  LEU A CA  1 
ATOM   1114  C  C   . LEU A 1 161 ? 52.284  1.383   30.032 1.00 35.71 ? 814  LEU A C   1 
ATOM   1115  O  O   . LEU A 1 161 ? 52.509  1.770   28.892 1.00 37.02 ? 814  LEU A O   1 
ATOM   1116  C  CB  . LEU A 1 161 ? 53.636  -0.489  31.037 1.00 36.00 ? 814  LEU A CB  1 
ATOM   1117  C  CG  . LEU A 1 161 ? 53.990  -1.196  29.707 1.00 35.48 ? 814  LEU A CG  1 
ATOM   1118  C  CD1 . LEU A 1 161 ? 55.284  -0.638  29.133 1.00 35.89 ? 814  LEU A CD1 1 
ATOM   1119  C  CD2 . LEU A 1 161 ? 54.123  -2.678  29.947 1.00 33.72 ? 814  LEU A CD2 1 
ATOM   1120  N  N   . TYR A 1 162 ? 51.048  1.270   30.503 1.00 34.28 ? 815  TYR A N   1 
ATOM   1121  C  CA  . TYR A 1 162 ? 49.907  1.584   29.643 1.00 34.11 ? 815  TYR A CA  1 
ATOM   1122  C  C   . TYR A 1 162 ? 49.882  3.051   29.235 1.00 33.02 ? 815  TYR A C   1 
ATOM   1123  O  O   . TYR A 1 162 ? 49.678  3.392   28.065 1.00 33.05 ? 815  TYR A O   1 
ATOM   1124  C  CB  . TYR A 1 162 ? 48.611  1.204   30.350 1.00 33.04 ? 815  TYR A CB  1 
ATOM   1125  C  CG  . TYR A 1 162 ? 48.571  -0.257  30.716 1.00 33.39 ? 815  TYR A CG  1 
ATOM   1126  C  CD1 . TYR A 1 162 ? 47.776  -0.708  31.764 1.00 33.38 ? 815  TYR A CD1 1 
ATOM   1127  C  CD2 . TYR A 1 162 ? 49.344  -1.192  30.017 1.00 31.93 ? 815  TYR A CD2 1 
ATOM   1128  C  CE1 . TYR A 1 162 ? 47.749  -2.061  32.119 1.00 34.76 ? 815  TYR A CE1 1 
ATOM   1129  C  CE2 . TYR A 1 162 ? 49.326  -2.534  30.353 1.00 33.98 ? 815  TYR A CE2 1 
ATOM   1130  C  CZ  . TYR A 1 162 ? 48.523  -2.971  31.410 1.00 35.35 ? 815  TYR A CZ  1 
ATOM   1131  O  OH  . TYR A 1 162 ? 48.479  -4.303  31.757 1.00 34.41 ? 815  TYR A OH  1 
ATOM   1132  N  N   . VAL A 1 163 ? 50.106  3.909   30.220 1.00 32.55 ? 816  VAL A N   1 
ATOM   1133  C  CA  . VAL A 1 163 ? 50.143  5.348   30.020 1.00 31.32 ? 816  VAL A CA  1 
ATOM   1134  C  C   . VAL A 1 163 ? 51.274  5.747   29.047 1.00 30.51 ? 816  VAL A C   1 
ATOM   1135  O  O   . VAL A 1 163 ? 51.091  6.594   28.183 1.00 29.76 ? 816  VAL A O   1 
ATOM   1136  C  CB  . VAL A 1 163 ? 50.298  6.043   31.365 1.00 30.23 ? 816  VAL A CB  1 
ATOM   1137  C  CG1 . VAL A 1 163 ? 50.617  7.473   31.168 1.00 31.63 ? 816  VAL A CG1 1 
ATOM   1138  C  CG2 . VAL A 1 163 ? 49.007  5.907   32.152 1.00 29.96 ? 816  VAL A CG2 1 
ATOM   1139  N  N   . ALA A 1 164 ? 52.422  5.099   29.165 1.00 29.78 ? 817  ALA A N   1 
ATOM   1140  C  CA  . ALA A 1 164 ? 53.534  5.392   28.271 1.00 27.59 ? 817  ALA A CA  1 
ATOM   1141  C  C   . ALA A 1 164 ? 53.171  5.049   26.832 1.00 28.29 ? 817  ALA A C   1 
ATOM   1142  O  O   . ALA A 1 164 ? 53.591  5.742   25.912 1.00 29.14 ? 817  ALA A O   1 
ATOM   1143  C  CB  . ALA A 1 164 ? 54.789  4.615   28.702 1.00 25.44 ? 817  ALA A CB  1 
ATOM   1144  N  N   . ALA A 1 165 ? 52.412  3.974   26.626 1.00 27.93 ? 818  ALA A N   1 
ATOM   1145  C  CA  . ALA A 1 165 ? 52.025  3.569   25.266 1.00 27.45 ? 818  ALA A CA  1 
ATOM   1146  C  C   . ALA A 1 165 ? 51.129  4.640   24.648 1.00 27.19 ? 818  ALA A C   1 
ATOM   1147  O  O   . ALA A 1 165 ? 51.293  5.016   23.501 1.00 26.74 ? 818  ALA A O   1 
ATOM   1148  C  CB  . ALA A 1 165 ? 51.286  2.242   25.301 1.00 25.56 ? 818  ALA A CB  1 
ATOM   1149  N  N   . ALA A 1 166 ? 50.189  5.126   25.441 1.00 27.79 ? 819  ALA A N   1 
ATOM   1150  C  CA  . ALA A 1 166 ? 49.269  6.151   24.992 1.00 28.67 ? 819  ALA A CA  1 
ATOM   1151  C  C   . ALA A 1 166 ? 50.058  7.417   24.588 1.00 30.35 ? 819  ALA A C   1 
ATOM   1152  O  O   . ALA A 1 166 ? 49.793  8.020   23.558 1.00 32.29 ? 819  ALA A O   1 
ATOM   1153  C  CB  . ALA A 1 166 ? 48.276  6.462   26.107 1.00 25.25 ? 819  ALA A CB  1 
ATOM   1154  N  N   . MET A 1 167 ? 51.052  7.803   25.376 1.00 30.39 ? 820  MET A N   1 
ATOM   1155  C  CA  . MET A 1 167 ? 51.803  8.996   25.044 1.00 29.33 ? 820  MET A CA  1 
ATOM   1156  C  C   . MET A 1 167 ? 53.047  8.814   24.201 1.00 30.29 ? 820  MET A C   1 
ATOM   1157  O  O   . MET A 1 167 ? 53.596  9.800   23.727 1.00 31.83 ? 820  MET A O   1 
ATOM   1158  C  CB  . MET A 1 167 ? 52.271  9.734   26.303 1.00 28.57 ? 820  MET A CB  1 
ATOM   1159  C  CG  . MET A 1 167 ? 51.801  9.266   27.654 1.00 27.26 ? 820  MET A CG  1 
ATOM   1160  S  SD  . MET A 1 167 ? 52.712  10.187  28.999 1.00 34.67 ? 820  MET A SD  1 
ATOM   1161  C  CE  . MET A 1 167 ? 51.478  10.655  30.023 1.00 29.04 ? 820  MET A CE  1 
ATOM   1162  N  N   . HIS A 1 168 ? 53.477  7.583   23.953 1.00 30.07 ? 821  HIS A N   1 
ATOM   1163  C  CA  . HIS A 1 168 ? 54.782  7.397   23.319 1.00 30.43 ? 821  HIS A CA  1 
ATOM   1164  C  C   . HIS A 1 168 ? 55.198  7.991   21.972 1.00 31.31 ? 821  HIS A C   1 
ATOM   1165  O  O   . HIS A 1 168 ? 56.388  8.043   21.683 1.00 32.27 ? 821  HIS A O   1 
ATOM   1166  C  CB  . HIS A 1 168 ? 55.169  5.904   23.397 1.00 30.21 ? 821  HIS A CB  1 
ATOM   1167  C  CG  . HIS A 1 168 ? 54.805  5.113   22.180 1.00 31.87 ? 821  HIS A CG  1 
ATOM   1168  N  ND1 . HIS A 1 168 ? 53.569  4.524   22.014 1.00 31.17 ? 821  HIS A ND1 1 
ATOM   1169  C  CD2 . HIS A 1 168 ? 55.509  4.838   21.054 1.00 31.34 ? 821  HIS A CD2 1 
ATOM   1170  C  CE1 . HIS A 1 168 ? 53.526  3.922   20.840 1.00 32.08 ? 821  HIS A CE1 1 
ATOM   1171  N  NE2 . HIS A 1 168 ? 54.687  4.096   20.237 1.00 35.85 ? 821  HIS A NE2 1 
ATOM   1172  N  N   . ASP A 1 169 ? 54.253  8.433   21.149 1.00 32.64 ? 822  ASP A N   1 
ATOM   1173  C  CA  . ASP A 1 169 ? 54.578  9.028   19.859 1.00 32.30 ? 822  ASP A CA  1 
ATOM   1174  C  C   . ASP A 1 169 ? 53.785  10.317  19.705 1.00 33.40 ? 822  ASP A C   1 
ATOM   1175  O  O   . ASP A 1 169 ? 53.494  10.746  18.585 1.00 32.01 ? 822  ASP A O   1 
ATOM   1176  C  CB  . ASP A 1 169 ? 54.224  8.086   18.693 1.00 34.09 ? 822  ASP A CB  1 
ATOM   1177  C  CG  . ASP A 1 169 ? 55.337  7.086   18.368 1.00 36.34 ? 822  ASP A CG  1 
ATOM   1178  O  OD1 . ASP A 1 169 ? 56.513  7.499   18.264 1.00 36.92 ? 822  ASP A OD1 1 
ATOM   1179  O  OD2 . ASP A 1 169 ? 55.038  5.875   18.185 1.00 39.56 ? 822  ASP A OD2 1 
ATOM   1180  N  N   . TYR A 1 170 ? 53.421  10.908  20.844 1.00 32.84 ? 823  TYR A N   1 
ATOM   1181  C  CA  . TYR A 1 170 ? 52.658  12.149  20.896 1.00 34.12 ? 823  TYR A CA  1 
ATOM   1182  C  C   . TYR A 1 170 ? 53.340  13.264  20.087 1.00 34.21 ? 823  TYR A C   1 
ATOM   1183  O  O   . TYR A 1 170 ? 54.533  13.527  20.234 1.00 35.14 ? 823  TYR A O   1 
ATOM   1184  C  CB  . TYR A 1 170 ? 52.489  12.581  22.362 1.00 33.64 ? 823  TYR A CB  1 
ATOM   1185  C  CG  . TYR A 1 170 ? 51.856  13.953  22.554 1.00 33.96 ? 823  TYR A CG  1 
ATOM   1186  C  CD1 . TYR A 1 170 ? 50.477  14.154  22.372 1.00 34.20 ? 823  TYR A CD1 1 
ATOM   1187  C  CD2 . TYR A 1 170 ? 52.633  15.050  22.922 1.00 33.77 ? 823  TYR A CD2 1 
ATOM   1188  C  CE1 . TYR A 1 170 ? 49.894  15.421  22.562 1.00 33.68 ? 823  TYR A CE1 1 
ATOM   1189  C  CE2 . TYR A 1 170 ? 52.067  16.311  23.104 1.00 32.79 ? 823  TYR A CE2 1 
ATOM   1190  C  CZ  . TYR A 1 170 ? 50.708  16.498  22.929 1.00 35.58 ? 823  TYR A CZ  1 
ATOM   1191  O  OH  . TYR A 1 170 ? 50.171  17.757  23.128 1.00 37.10 ? 823  TYR A OH  1 
ATOM   1192  N  N   . ASP A 1 171 ? 52.571  13.915  19.226 1.00 34.89 ? 824  ASP A N   1 
ATOM   1193  C  CA  . ASP A 1 171 ? 53.091  14.977  18.379 1.00 32.86 ? 824  ASP A CA  1 
ATOM   1194  C  C   . ASP A 1 171 ? 54.245  14.554  17.459 1.00 33.25 ? 824  ASP A C   1 
ATOM   1195  O  O   . ASP A 1 171 ? 55.177  15.326  17.228 1.00 33.63 ? 824  ASP A O   1 
ATOM   1196  C  CB  . ASP A 1 171 ? 53.515  16.155  19.241 1.00 32.97 ? 824  ASP A CB  1 
ATOM   1197  C  CG  . ASP A 1 171 ? 53.813  17.395  18.426 1.00 33.80 ? 824  ASP A CG  1 
ATOM   1198  O  OD1 . ASP A 1 171 ? 53.096  17.659  17.438 1.00 35.31 ? 824  ASP A OD1 1 
ATOM   1199  O  OD2 . ASP A 1 171 ? 54.760  18.120  18.785 1.00 35.31 ? 824  ASP A OD2 1 
ATOM   1200  N  N   . HIS A 1 172 ? 54.182  13.331  16.934 1.00 32.04 ? 825  HIS A N   1 
ATOM   1201  C  CA  . HIS A 1 172 ? 55.199  12.829  16.005 1.00 31.14 ? 825  HIS A CA  1 
ATOM   1202  C  C   . HIS A 1 172 ? 55.024  13.579  14.656 1.00 32.30 ? 825  HIS A C   1 
ATOM   1203  O  O   . HIS A 1 172 ? 53.913  13.685  14.149 1.00 31.76 ? 825  HIS A O   1 
ATOM   1204  C  CB  . HIS A 1 172 ? 55.018  11.311  15.804 1.00 27.38 ? 825  HIS A CB  1 
ATOM   1205  C  CG  . HIS A 1 172 ? 56.211  10.616  15.203 1.00 25.19 ? 825  HIS A CG  1 
ATOM   1206  N  ND1 . HIS A 1 172 ? 56.731  10.943  13.971 1.00 23.63 ? 825  HIS A ND1 1 
ATOM   1207  C  CD2 . HIS A 1 172 ? 56.953  9.570   15.656 1.00 25.60 ? 825  HIS A CD2 1 
ATOM   1208  C  CE1 . HIS A 1 172 ? 57.734  10.129  13.686 1.00 26.00 ? 825  HIS A CE1 1 
ATOM   1209  N  NE2 . HIS A 1 172 ? 57.888  9.284   14.695 1.00 25.02 ? 825  HIS A NE2 1 
ATOM   1210  N  N   . PRO A 1 173 ? 56.122  14.103  14.071 1.00 33.28 ? 826  PRO A N   1 
ATOM   1211  C  CA  . PRO A 1 173 ? 56.085  14.835  12.800 1.00 31.84 ? 826  PRO A CA  1 
ATOM   1212  C  C   . PRO A 1 173 ? 56.130  13.954  11.540 1.00 34.25 ? 826  PRO A C   1 
ATOM   1213  O  O   . PRO A 1 173 ? 56.030  14.457  10.413 1.00 34.10 ? 826  PRO A O   1 
ATOM   1214  C  CB  . PRO A 1 173 ? 57.319  15.716  12.893 1.00 31.13 ? 826  PRO A CB  1 
ATOM   1215  C  CG  . PRO A 1 173 ? 58.324  14.768  13.542 1.00 30.44 ? 826  PRO A CG  1 
ATOM   1216  C  CD  . PRO A 1 173 ? 57.481  14.147  14.661 1.00 31.59 ? 826  PRO A CD  1 
ATOM   1217  N  N   . GLY A 1 174 ? 56.326  12.657  11.727 1.00 33.10 ? 827  GLY A N   1 
ATOM   1218  C  CA  . GLY A 1 174 ? 56.395  11.779  10.589 1.00 33.81 ? 827  GLY A CA  1 
ATOM   1219  C  C   . GLY A 1 174 ? 57.794  11.780  10.021 1.00 34.44 ? 827  GLY A C   1 
ATOM   1220  O  O   . GLY A 1 174 ? 58.035  11.346  8.899  1.00 37.18 ? 827  GLY A O   1 
ATOM   1221  N  N   . ARG A 1 175 ? 58.739  12.268  10.791 1.00 32.84 ? 828  ARG A N   1 
ATOM   1222  C  CA  . ARG A 1 175 ? 60.089  12.288  10.298 1.00 30.66 ? 828  ARG A CA  1 
ATOM   1223  C  C   . ARG A 1 175 ? 61.023  11.554  11.271 1.00 28.86 ? 828  ARG A C   1 
ATOM   1224  O  O   . ARG A 1 175 ? 60.691  11.383  12.429 1.00 30.44 ? 828  ARG A O   1 
ATOM   1225  C  CB  . ARG A 1 175 ? 60.469  13.735  10.007 1.00 29.62 ? 828  ARG A CB  1 
ATOM   1226  C  CG  . ARG A 1 175 ? 60.825  13.905  8.546  1.00 35.22 ? 828  ARG A CG  1 
ATOM   1227  C  CD  . ARG A 1 175 ? 59.997  14.891  7.742  1.00 34.57 ? 828  ARG A CD  1 
ATOM   1228  N  NE  . ARG A 1 175 ? 58.785  14.268  7.236  1.00 40.74 ? 828  ARG A NE  1 
ATOM   1229  C  CZ  . ARG A 1 175 ? 57.899  14.876  6.465  1.00 39.17 ? 828  ARG A CZ  1 
ATOM   1230  N  NH1 . ARG A 1 175 ? 58.072  16.129  6.076  1.00 37.11 ? 828  ARG A NH1 1 
ATOM   1231  N  NH2 . ARG A 1 175 ? 56.803  14.239  6.137  1.00 43.14 ? 828  ARG A NH2 1 
ATOM   1232  N  N   . THR A 1 176 ? 62.158  11.047  10.816 1.00 28.06 ? 829  THR A N   1 
ATOM   1233  C  CA  . THR A 1 176 ? 63.017  10.330  11.749 1.00 28.01 ? 829  THR A CA  1 
ATOM   1234  C  C   . THR A 1 176 ? 63.965  11.254  12.539 1.00 30.42 ? 829  THR A C   1 
ATOM   1235  O  O   . THR A 1 176 ? 64.039  12.477  12.296 1.00 29.38 ? 829  THR A O   1 
ATOM   1236  C  CB  . THR A 1 176 ? 63.843  9.275   11.034 1.00 28.67 ? 829  THR A CB  1 
ATOM   1237  O  OG1 . THR A 1 176 ? 64.778  9.910   10.154 1.00 29.86 ? 829  THR A OG1 1 
ATOM   1238  C  CG2 . THR A 1 176 ? 62.937  8.354   10.201 1.00 28.16 ? 829  THR A CG2 1 
ATOM   1239  N  N   . ASN A 1 177 ? 64.679  10.673  13.496 1.00 30.84 ? 830  ASN A N   1 
ATOM   1240  C  CA  . ASN A 1 177 ? 65.614  11.440  14.307 1.00 30.89 ? 830  ASN A CA  1 
ATOM   1241  C  C   . ASN A 1 177 ? 66.767  11.909  13.416 1.00 33.54 ? 830  ASN A C   1 
ATOM   1242  O  O   . ASN A 1 177 ? 67.176  13.073  13.500 1.00 31.83 ? 830  ASN A O   1 
ATOM   1243  C  CB  . ASN A 1 177 ? 66.115  10.613  15.510 1.00 27.95 ? 830  ASN A CB  1 
ATOM   1244  C  CG  . ASN A 1 177 ? 65.114  10.591  16.656 1.00 25.51 ? 830  ASN A CG  1 
ATOM   1245  O  OD1 . ASN A 1 177 ? 64.420  11.571  16.927 1.00 25.55 ? 830  ASN A OD1 1 
ATOM   1246  N  ND2 . ASN A 1 177 ? 65.034  9.478   17.333 1.00 26.43 ? 830  ASN A ND2 1 
ATOM   1247  N  N   . ALA A 1 178 ? 67.255  11.022  12.543 1.00 33.01 ? 831  ALA A N   1 
ATOM   1248  C  CA  . ALA A 1 178 ? 68.340  11.373  11.635 1.00 33.04 ? 831  ALA A CA  1 
ATOM   1249  C  C   . ALA A 1 178 ? 67.916  12.529  10.733 1.00 34.43 ? 831  ALA A C   1 
ATOM   1250  O  O   . ALA A 1 178 ? 68.715  13.402  10.376 1.00 35.34 ? 831  ALA A O   1 
ATOM   1251  C  CB  . ALA A 1 178 ? 68.735  10.175  10.799 1.00 30.38 ? 831  ALA A CB  1 
ATOM   1252  N  N   . PHE A 1 179 ? 66.647  12.547  10.365 1.00 34.72 ? 832  PHE A N   1 
ATOM   1253  C  CA  . PHE A 1 179 ? 66.170  13.633  9.524  1.00 34.10 ? 832  PHE A CA  1 
ATOM   1254  C  C   . PHE A 1 179 ? 66.226  14.929  10.317 1.00 33.57 ? 832  PHE A C   1 
ATOM   1255  O  O   . PHE A 1 179 ? 66.743  15.926  9.846  1.00 35.52 ? 832  PHE A O   1 
ATOM   1256  C  CB  . PHE A 1 179 ? 64.733  13.398  9.090  1.00 29.87 ? 832  PHE A CB  1 
ATOM   1257  C  CG  . PHE A 1 179 ? 64.143  14.551  8.331  1.00 29.86 ? 832  PHE A CG  1 
ATOM   1258  C  CD1 . PHE A 1 179 ? 64.360  14.685  6.963  1.00 27.57 ? 832  PHE A CD1 1 
ATOM   1259  C  CD2 . PHE A 1 179 ? 63.369  15.515  8.984  1.00 27.01 ? 832  PHE A CD2 1 
ATOM   1260  C  CE1 . PHE A 1 179 ? 63.810  15.760  6.261  1.00 30.92 ? 832  PHE A CE1 1 
ATOM   1261  C  CE2 . PHE A 1 179 ? 62.821  16.579  8.292  1.00 26.29 ? 832  PHE A CE2 1 
ATOM   1262  C  CZ  . PHE A 1 179 ? 63.037  16.710  6.922  1.00 28.69 ? 832  PHE A CZ  1 
ATOM   1263  N  N   . LEU A 1 180 ? 65.661  14.904  11.516 1.00 33.72 ? 833  LEU A N   1 
ATOM   1264  C  CA  . LEU A 1 180 ? 65.620  16.069  12.366 1.00 33.38 ? 833  LEU A CA  1 
ATOM   1265  C  C   . LEU A 1 180 ? 67.039  16.608  12.595 1.00 35.64 ? 833  LEU A C   1 
ATOM   1266  O  O   . LEU A 1 180 ? 67.300  17.826  12.524 1.00 35.62 ? 833  LEU A O   1 
ATOM   1267  C  CB  . LEU A 1 180 ? 64.969  15.698  13.700 1.00 30.83 ? 833  LEU A CB  1 
ATOM   1268  C  CG  . LEU A 1 180 ? 63.509  15.260  13.699 1.00 31.48 ? 833  LEU A CG  1 
ATOM   1269  C  CD1 . LEU A 1 180 ? 63.068  14.934  15.089 1.00 30.08 ? 833  LEU A CD1 1 
ATOM   1270  C  CD2 . LEU A 1 180 ? 62.629  16.370  13.116 1.00 30.99 ? 833  LEU A CD2 1 
ATOM   1271  N  N   . VAL A 1 181 ? 67.937  15.665  12.864 1.00 35.94 ? 834  VAL A N   1 
ATOM   1272  C  CA  . VAL A 1 181 ? 69.325  15.929  13.127 1.00 37.05 ? 834  VAL A CA  1 
ATOM   1273  C  C   . VAL A 1 181 ? 70.045  16.496  11.921 1.00 39.65 ? 834  VAL A C   1 
ATOM   1274  O  O   . VAL A 1 181 ? 70.705  17.533  12.017 1.00 40.12 ? 834  VAL A O   1 
ATOM   1275  C  CB  . VAL A 1 181 ? 70.038  14.655  13.571 1.00 36.38 ? 834  VAL A CB  1 
ATOM   1276  C  CG1 . VAL A 1 181 ? 71.539  14.811  13.372 1.00 34.72 ? 834  VAL A CG1 1 
ATOM   1277  C  CG2 . VAL A 1 181 ? 69.718  14.374  15.014 1.00 33.76 ? 834  VAL A CG2 1 
ATOM   1278  N  N   . ALA A 1 182 ? 69.906  15.817  10.790 1.00 40.30 ? 835  ALA A N   1 
ATOM   1279  C  CA  . ALA A 1 182 ? 70.541  16.244  9.551  1.00 41.48 ? 835  ALA A CA  1 
ATOM   1280  C  C   . ALA A 1 182 ? 70.069  17.606  9.047  1.00 43.45 ? 835  ALA A C   1 
ATOM   1281  O  O   . ALA A 1 182 ? 70.803  18.263  8.324  1.00 45.66 ? 835  ALA A O   1 
ATOM   1282  C  CB  . ALA A 1 182 ? 70.313  15.208  8.487  1.00 39.88 ? 835  ALA A CB  1 
ATOM   1283  N  N   . THR A 1 183 ? 68.855  18.025  9.410  1.00 44.73 ? 836  THR A N   1 
ATOM   1284  C  CA  . THR A 1 183 ? 68.317  19.319  8.975  1.00 44.99 ? 836  THR A CA  1 
ATOM   1285  C  C   . THR A 1 183 ? 68.393  20.366  10.101 1.00 45.39 ? 836  THR A C   1 
ATOM   1286  O  O   . THR A 1 183 ? 67.766  21.422  10.023 1.00 44.56 ? 836  THR A O   1 
ATOM   1287  C  CB  . THR A 1 183 ? 66.821  19.201  8.544  1.00 46.63 ? 836  THR A CB  1 
ATOM   1288  O  OG1 . THR A 1 183 ? 66.026  18.719  9.642  1.00 46.46 ? 836  THR A OG1 1 
ATOM   1289  C  CG2 . THR A 1 183 ? 66.668  18.248  7.362  1.00 46.32 ? 836  THR A CG2 1 
ATOM   1290  N  N   . ASN A 1 184 ? 69.151  20.056  11.153 1.00 45.43 ? 837  ASN A N   1 
ATOM   1291  C  CA  . ASN A 1 184 ? 69.301  20.943  12.307 1.00 45.08 ? 837  ASN A CA  1 
ATOM   1292  C  C   . ASN A 1 184 ? 67.974  21.464  12.818 1.00 44.18 ? 837  ASN A C   1 
ATOM   1293  O  O   . ASN A 1 184 ? 67.844  22.631  13.162 1.00 45.31 ? 837  ASN A O   1 
ATOM   1294  C  CB  . ASN A 1 184 ? 70.209  22.132  11.974 1.00 45.76 ? 837  ASN A CB  1 
ATOM   1295  C  CG  . ASN A 1 184 ? 71.649  21.717  11.754 1.00 47.51 ? 837  ASN A CG  1 
ATOM   1296  O  OD1 . ASN A 1 184 ? 72.253  21.015  12.590 1.00 47.19 ? 837  ASN A OD1 1 
ATOM   1297  N  ND2 . ASN A 1 184 ? 72.219  22.149  10.627 1.00 49.01 ? 837  ASN A ND2 1 
ATOM   1298  N  N   . ALA A 1 185 ? 66.974  20.605  12.856 1.00 42.77 ? 838  ALA A N   1 
ATOM   1299  C  CA  . ALA A 1 185 ? 65.686  21.043  13.349 1.00 42.21 ? 838  ALA A CA  1 
ATOM   1300  C  C   . ALA A 1 185 ? 65.881  21.563  14.775 1.00 41.29 ? 838  ALA A C   1 
ATOM   1301  O  O   . ALA A 1 185 ? 66.696  21.031  15.530 1.00 42.56 ? 838  ALA A O   1 
ATOM   1302  C  CB  . ALA A 1 185 ? 64.696  19.882  13.334 1.00 39.35 ? 838  ALA A CB  1 
ATOM   1303  N  N   . PRO A 1 186 ? 65.146  22.625  15.152 1.00 41.17 ? 839  PRO A N   1 
ATOM   1304  C  CA  . PRO A 1 186 ? 65.257  23.189  16.500 1.00 40.33 ? 839  PRO A CA  1 
ATOM   1305  C  C   . PRO A 1 186 ? 65.131  22.151  17.610 1.00 39.19 ? 839  PRO A C   1 
ATOM   1306  O  O   . PRO A 1 186 ? 65.787  22.262  18.635 1.00 39.59 ? 839  PRO A O   1 
ATOM   1307  C  CB  . PRO A 1 186 ? 64.136  24.254  16.528 1.00 39.99 ? 839  PRO A CB  1 
ATOM   1308  C  CG  . PRO A 1 186 ? 63.238  23.874  15.422 1.00 40.28 ? 839  PRO A CG  1 
ATOM   1309  C  CD  . PRO A 1 186 ? 64.191  23.418  14.358 1.00 39.89 ? 839  PRO A CD  1 
ATOM   1310  N  N   . GLN A 1 187 ? 64.268  21.163  17.389 1.00 37.89 ? 840  GLN A N   1 
ATOM   1311  C  CA  . GLN A 1 187 ? 64.033  20.070  18.312 1.00 37.04 ? 840  GLN A CA  1 
ATOM   1312  C  C   . GLN A 1 187 ? 65.298  19.199  18.510 1.00 36.63 ? 840  GLN A C   1 
ATOM   1313  O  O   . GLN A 1 187 ? 65.572  18.691  19.598 1.00 35.48 ? 840  GLN A O   1 
ATOM   1314  C  CB  . GLN A 1 187 ? 62.923  19.191  17.769 1.00 41.07 ? 840  GLN A CB  1 
ATOM   1315  C  CG  . GLN A 1 187 ? 61.512  19.480  18.240 1.00 47.77 ? 840  GLN A CG  1 
ATOM   1316  C  CD  . GLN A 1 187 ? 60.548  18.345  17.828 1.00 52.81 ? 840  GLN A CD  1 
ATOM   1317  O  OE1 . GLN A 1 187 ? 60.656  17.205  18.317 1.00 55.48 ? 840  GLN A OE1 1 
ATOM   1318  N  NE2 . GLN A 1 187 ? 59.617  18.648  16.915 1.00 55.05 ? 840  GLN A NE2 1 
ATOM   1319  N  N   . ALA A 1 188 ? 66.068  19.031  17.449 1.00 34.62 ? 841  ALA A N   1 
ATOM   1320  C  CA  . ALA A 1 188 ? 67.270  18.234  17.524 1.00 34.26 ? 841  ALA A CA  1 
ATOM   1321  C  C   . ALA A 1 188 ? 68.338  18.991  18.305 1.00 35.44 ? 841  ALA A C   1 
ATOM   1322  O  O   . ALA A 1 188 ? 69.086  18.412  19.096 1.00 33.77 ? 841  ALA A O   1 
ATOM   1323  C  CB  . ALA A 1 188 ? 67.758  17.944  16.141 1.00 32.31 ? 841  ALA A CB  1 
ATOM   1324  N  N   . VAL A 1 189 ? 68.404  20.296  18.065 1.00 35.20 ? 842  VAL A N   1 
ATOM   1325  C  CA  . VAL A 1 189 ? 69.385  21.136  18.733 1.00 34.92 ? 842  VAL A CA  1 
ATOM   1326  C  C   . VAL A 1 189 ? 69.038  21.231  20.201 1.00 35.25 ? 842  VAL A C   1 
ATOM   1327  O  O   . VAL A 1 189 ? 69.909  21.201  21.058 1.00 35.72 ? 842  VAL A O   1 
ATOM   1328  C  CB  . VAL A 1 189 ? 69.403  22.528  18.123 1.00 34.03 ? 842  VAL A CB  1 
ATOM   1329  C  CG1 . VAL A 1 189 ? 70.385  23.409  18.871 1.00 32.87 ? 842  VAL A CG1 1 
ATOM   1330  C  CG2 . VAL A 1 189 ? 69.771  22.418  16.643 1.00 31.79 ? 842  VAL A CG2 1 
ATOM   1331  N  N   . LEU A 1 190 ? 67.746  21.314  20.474 1.00 34.37 ? 843  LEU A N   1 
ATOM   1332  C  CA  . LEU A 1 190 ? 67.242  21.412  21.825 1.00 33.44 ? 843  LEU A CA  1 
ATOM   1333  C  C   . LEU A 1 190 ? 67.612  20.194  22.652 1.00 33.63 ? 843  LEU A C   1 
ATOM   1334  O  O   . LEU A 1 190 ? 67.966  20.301  23.839 1.00 35.56 ? 843  LEU A O   1 
ATOM   1335  C  CB  . LEU A 1 190 ? 65.735  21.555  21.796 1.00 32.49 ? 843  LEU A CB  1 
ATOM   1336  C  CG  . LEU A 1 190 ? 65.089  21.800  23.152 1.00 35.04 ? 843  LEU A CG  1 
ATOM   1337  C  CD1 . LEU A 1 190 ? 65.657  23.080  23.742 1.00 30.88 ? 843  LEU A CD1 1 
ATOM   1338  C  CD2 . LEU A 1 190 ? 63.563  21.913  22.987 1.00 31.12 ? 843  LEU A CD2 1 
ATOM   1339  N  N   . TYR A 1 191 ? 67.566  19.035  22.015 1.00 32.00 ? 844  TYR A N   1 
ATOM   1340  C  CA  . TYR A 1 191 ? 67.863  17.791  22.694 1.00 30.54 ? 844  TYR A CA  1 
ATOM   1341  C  C   . TYR A 1 191 ? 69.259  17.234  22.426 1.00 30.20 ? 844  TYR A C   1 
ATOM   1342  O  O   . TYR A 1 191 ? 69.529  16.064  22.691 1.00 29.14 ? 844  TYR A O   1 
ATOM   1343  C  CB  . TYR A 1 191 ? 66.770  16.752  22.349 1.00 28.26 ? 844  TYR A CB  1 
ATOM   1344  C  CG  . TYR A 1 191 ? 65.467  17.044  23.050 1.00 26.73 ? 844  TYR A CG  1 
ATOM   1345  C  CD1 . TYR A 1 191 ? 64.347  17.510  22.354 1.00 28.17 ? 844  TYR A CD1 1 
ATOM   1346  C  CD2 . TYR A 1 191 ? 65.373  16.922  24.424 1.00 26.72 ? 844  TYR A CD2 1 
ATOM   1347  C  CE1 . TYR A 1 191 ? 63.168  17.846  23.022 1.00 27.92 ? 844  TYR A CE1 1 
ATOM   1348  C  CE2 . TYR A 1 191 ? 64.219  17.251  25.106 1.00 28.41 ? 844  TYR A CE2 1 
ATOM   1349  C  CZ  . TYR A 1 191 ? 63.109  17.709  24.402 1.00 31.25 ? 844  TYR A CZ  1 
ATOM   1350  O  OH  . TYR A 1 191 ? 61.945  17.970  25.092 1.00 32.88 ? 844  TYR A OH  1 
ATOM   1351  N  N   . ASN A 1 192 ? 70.142  18.081  21.920 1.00 31.06 ? 845  ASN A N   1 
ATOM   1352  C  CA  . ASN A 1 192 ? 71.517  17.688  21.616 1.00 32.39 ? 845  ASN A CA  1 
ATOM   1353  C  C   . ASN A 1 192 ? 71.645  16.415  20.787 1.00 33.57 ? 845  ASN A C   1 
ATOM   1354  O  O   . ASN A 1 192 ? 72.595  15.640  20.944 1.00 33.18 ? 845  ASN A O   1 
ATOM   1355  C  CB  . ASN A 1 192 ? 72.309  17.564  22.907 1.00 32.50 ? 845  ASN A CB  1 
ATOM   1356  C  CG  . ASN A 1 192 ? 72.347  18.872  23.659 1.00 34.08 ? 845  ASN A CG  1 
ATOM   1357  O  OD1 . ASN A 1 192 ? 72.833  19.889  23.132 1.00 34.81 ? 845  ASN A OD1 1 
ATOM   1358  N  ND2 . ASN A 1 192 ? 71.813  18.873  24.878 1.00 33.89 ? 845  ASN A ND2 1 
ATOM   1359  N  N   . ASP A 1 193 ? 70.663  16.219  19.908 1.00 32.88 ? 846  ASP A N   1 
ATOM   1360  C  CA  . ASP A 1 193 ? 70.643  15.094  19.019 1.00 32.89 ? 846  ASP A CA  1 
ATOM   1361  C  C   . ASP A 1 193 ? 70.408  13.747  19.647 1.00 32.77 ? 846  ASP A C   1 
ATOM   1362  O  O   . ASP A 1 193 ? 70.541  12.749  18.969 1.00 33.02 ? 846  ASP A O   1 
ATOM   1363  C  CB  . ASP A 1 193 ? 71.947  15.029  18.230 1.00 31.75 ? 846  ASP A CB  1 
ATOM   1364  C  CG  . ASP A 1 193 ? 72.155  16.235  17.340 1.00 34.95 ? 846  ASP A CG  1 
ATOM   1365  O  OD1 . ASP A 1 193 ? 71.222  17.063  17.193 1.00 35.71 ? 846  ASP A OD1 1 
ATOM   1366  O  OD2 . ASP A 1 193 ? 73.260  16.358  16.771 1.00 37.11 ? 846  ASP A OD2 1 
ATOM   1367  N  N   . ARG A 1 194 ? 70.057  13.693  20.922 1.00 33.18 ? 847  ARG A N   1 
ATOM   1368  C  CA  . ARG A 1 194 ? 69.849  12.398  21.560 1.00 33.84 ? 847  ARG A CA  1 
ATOM   1369  C  C   . ARG A 1 194 ? 68.395  12.037  21.690 1.00 32.29 ? 847  ARG A C   1 
ATOM   1370  O  O   . ARG A 1 194 ? 67.658  12.748  22.383 1.00 32.72 ? 847  ARG A O   1 
ATOM   1371  C  CB  . ARG A 1 194 ? 70.443  12.395  22.969 1.00 36.68 ? 847  ARG A CB  1 
ATOM   1372  C  CG  . ARG A 1 194 ? 71.886  12.823  23.045 1.00 40.76 ? 847  ARG A CG  1 
ATOM   1373  C  CD  . ARG A 1 194 ? 72.259  13.003  24.479 1.00 44.40 ? 847  ARG A CD  1 
ATOM   1374  N  NE  . ARG A 1 194 ? 73.682  12.824  24.669 1.00 48.76 ? 847  ARG A NE  1 
ATOM   1375  C  CZ  . ARG A 1 194 ? 74.238  12.551  25.842 1.00 51.26 ? 847  ARG A CZ  1 
ATOM   1376  N  NH1 . ARG A 1 194 ? 73.463  12.427  26.918 1.00 52.84 ? 847  ARG A NH1 1 
ATOM   1377  N  NH2 . ARG A 1 194 ? 75.562  12.420  25.942 1.00 50.01 ? 847  ARG A NH2 1 
ATOM   1378  N  N   . SER A 1 195 ? 67.979  10.937  21.046 1.00 30.64 ? 848  SER A N   1 
ATOM   1379  C  CA  . SER A 1 195 ? 66.590  10.459  21.131 1.00 25.92 ? 848  SER A CA  1 
ATOM   1380  C  C   . SER A 1 195 ? 65.687  11.656  21.025 1.00 24.56 ? 848  SER A C   1 
ATOM   1381  O  O   . SER A 1 195 ? 64.779  11.849  21.856 1.00 21.03 ? 848  SER A O   1 
ATOM   1382  C  CB  . SER A 1 195 ? 66.328  9.831   22.495 1.00 25.87 ? 848  SER A CB  1 
ATOM   1383  O  OG  . SER A 1 195 ? 67.195  8.752   22.748 1.00 30.21 ? 848  SER A OG  1 
ATOM   1384  N  N   . VAL A 1 196 ? 65.948  12.471  20.013 1.00 24.59 ? 849  VAL A N   1 
ATOM   1385  C  CA  . VAL A 1 196 ? 65.193  13.708  19.853 1.00 25.40 ? 849  VAL A CA  1 
ATOM   1386  C  C   . VAL A 1 196 ? 63.694  13.511  19.972 1.00 26.75 ? 849  VAL A C   1 
ATOM   1387  O  O   . VAL A 1 196 ? 63.057  14.064  20.868 1.00 28.54 ? 849  VAL A O   1 
ATOM   1388  C  CB  . VAL A 1 196 ? 65.567  14.403  18.534 1.00 27.52 ? 849  VAL A CB  1 
ATOM   1389  C  CG1 . VAL A 1 196 ? 64.756  15.739  18.367 1.00 27.37 ? 849  VAL A CG1 1 
ATOM   1390  C  CG2 . VAL A 1 196 ? 67.084  14.640  18.530 1.00 25.87 ? 849  VAL A CG2 1 
ATOM   1391  N  N   . LEU A 1 197 ? 63.143  12.674  19.099 1.00 28.55 ? 850  LEU A N   1 
ATOM   1392  C  CA  . LEU A 1 197 ? 61.720  12.397  19.087 1.00 25.70 ? 850  LEU A CA  1 
ATOM   1393  C  C   . LEU A 1 197 ? 61.158  11.867  20.371 1.00 25.16 ? 850  LEU A C   1 
ATOM   1394  O  O   . LEU A 1 197 ? 60.131  12.359  20.888 1.00 25.45 ? 850  LEU A O   1 
ATOM   1395  C  CB  . LEU A 1 197 ? 61.393  11.444  17.942 1.00 28.70 ? 850  LEU A CB  1 
ATOM   1396  C  CG  . LEU A 1 197 ? 61.353  12.059  16.534 1.00 29.29 ? 850  LEU A CG  1 
ATOM   1397  C  CD1 . LEU A 1 197 ? 61.186  10.968  15.480 1.00 32.47 ? 850  LEU A CD1 1 
ATOM   1398  C  CD2 . LEU A 1 197 ? 60.229  13.030  16.445 1.00 30.13 ? 850  LEU A CD2 1 
ATOM   1399  N  N   . GLU A 1 198 ? 61.836  10.867  20.906 1.00 24.80 ? 851  GLU A N   1 
ATOM   1400  C  CA  . GLU A 1 198 ? 61.391  10.239  22.141 1.00 24.35 ? 851  GLU A CA  1 
ATOM   1401  C  C   . GLU A 1 198 ? 61.362  11.194  23.337 1.00 26.64 ? 851  GLU A C   1 
ATOM   1402  O  O   . GLU A 1 198 ? 60.452  11.115  24.185 1.00 26.77 ? 851  GLU A O   1 
ATOM   1403  C  CB  . GLU A 1 198 ? 62.269  9.014   22.424 1.00 25.51 ? 851  GLU A CB  1 
ATOM   1404  C  CG  . GLU A 1 198 ? 62.089  7.887   21.390 1.00 27.10 ? 851  GLU A CG  1 
ATOM   1405  C  CD  . GLU A 1 198 ? 62.853  8.135   20.071 1.00 26.78 ? 851  GLU A CD  1 
ATOM   1406  O  OE1 . GLU A 1 198 ? 63.892  8.843   20.078 1.00 24.11 ? 851  GLU A OE1 1 
ATOM   1407  O  OE2 . GLU A 1 198 ? 62.427  7.594   19.022 1.00 26.43 ? 851  GLU A OE2 1 
ATOM   1408  N  N   . ASN A 1 199 ? 62.359  12.091  23.403 1.00 27.40 ? 852  ASN A N   1 
ATOM   1409  C  CA  . ASN A 1 199 ? 62.426  13.099  24.458 1.00 26.04 ? 852  ASN A CA  1 
ATOM   1410  C  C   . ASN A 1 199 ? 61.271  14.073  24.289 1.00 26.69 ? 852  ASN A C   1 
ATOM   1411  O  O   . ASN A 1 199 ? 60.650  14.448  25.259 1.00 28.04 ? 852  ASN A O   1 
ATOM   1412  C  CB  . ASN A 1 199 ? 63.752  13.874  24.400 1.00 26.96 ? 852  ASN A CB  1 
ATOM   1413  C  CG  . ASN A 1 199 ? 64.805  13.260  25.264 1.00 24.62 ? 852  ASN A CG  1 
ATOM   1414  O  OD1 . ASN A 1 199 ? 64.533  12.939  26.414 1.00 26.76 ? 852  ASN A OD1 1 
ATOM   1415  N  ND2 . ASN A 1 199 ? 66.010  13.076  24.729 1.00 24.42 ? 852  ASN A ND2 1 
ATOM   1416  N  N   . HIS A 1 200 ? 60.991  14.485  23.051 1.00 29.20 ? 853  HIS A N   1 
ATOM   1417  C  CA  . HIS A 1 200 ? 59.885  15.394  22.795 1.00 28.92 ? 853  HIS A CA  1 
ATOM   1418  C  C   . HIS A 1 200 ? 58.513  14.752  23.111 1.00 31.09 ? 853  HIS A C   1 
ATOM   1419  O  O   . HIS A 1 200 ? 57.645  15.404  23.677 1.00 30.84 ? 853  HIS A O   1 
ATOM   1420  C  CB  . HIS A 1 200 ? 59.911  15.870  21.347 1.00 30.91 ? 853  HIS A CB  1 
ATOM   1421  C  CG  . HIS A 1 200 ? 58.719  16.697  20.972 1.00 31.32 ? 853  HIS A CG  1 
ATOM   1422  N  ND1 . HIS A 1 200 ? 58.524  17.975  21.449 1.00 30.86 ? 853  HIS A ND1 1 
ATOM   1423  C  CD2 . HIS A 1 200 ? 57.639  16.413  20.209 1.00 30.47 ? 853  HIS A CD2 1 
ATOM   1424  C  CE1 . HIS A 1 200 ? 57.376  18.443  20.997 1.00 30.14 ? 853  HIS A CE1 1 
ATOM   1425  N  NE2 . HIS A 1 200 ? 56.819  17.514  20.243 1.00 32.08 ? 853  HIS A NE2 1 
ATOM   1426  N  N   . HIS A 1 201 ? 58.307  13.481  22.773 1.00 29.56 ? 854  HIS A N   1 
ATOM   1427  C  CA  . HIS A 1 201 ? 56.999  12.891  23.078 1.00 28.62 ? 854  HIS A CA  1 
ATOM   1428  C  C   . HIS A 1 201 ? 56.753  12.938  24.586 1.00 30.49 ? 854  HIS A C   1 
ATOM   1429  O  O   . HIS A 1 201 ? 55.681  13.361  25.039 1.00 31.67 ? 854  HIS A O   1 
ATOM   1430  C  CB  . HIS A 1 201 ? 56.888  11.412  22.640 1.00 25.26 ? 854  HIS A CB  1 
ATOM   1431  C  CG  . HIS A 1 201 ? 57.256  11.153  21.214 1.00 24.50 ? 854  HIS A CG  1 
ATOM   1432  N  ND1 . HIS A 1 201 ? 56.758  11.897  20.159 1.00 25.25 ? 854  HIS A ND1 1 
ATOM   1433  C  CD2 . HIS A 1 201 ? 58.087  10.235  20.663 1.00 21.72 ? 854  HIS A CD2 1 
ATOM   1434  C  CE1 . HIS A 1 201 ? 57.276  11.449  19.028 1.00 23.00 ? 854  HIS A CE1 1 
ATOM   1435  N  NE2 . HIS A 1 201 ? 58.086  10.442  19.307 1.00 23.13 ? 854  HIS A NE2 1 
ATOM   1436  N  N   . ALA A 1 202 ? 57.746  12.481  25.358 1.00 31.56 ? 855  ALA A N   1 
ATOM   1437  C  CA  . ALA A 1 202 ? 57.631  12.421  26.812 1.00 30.73 ? 855  ALA A CA  1 
ATOM   1438  C  C   . ALA A 1 202 ? 57.525  13.800  27.455 1.00 31.00 ? 855  ALA A C   1 
ATOM   1439  O  O   . ALA A 1 202 ? 56.688  14.028  28.313 1.00 30.83 ? 855  ALA A O   1 
ATOM   1440  C  CB  . ALA A 1 202 ? 58.821  11.641  27.406 1.00 29.55 ? 855  ALA A CB  1 
ATOM   1441  N  N   . ALA A 1 203 ? 58.358  14.733  27.015 1.00 32.00 ? 856  ALA A N   1 
ATOM   1442  C  CA  . ALA A 1 203 ? 58.326  16.058  27.610 1.00 31.41 ? 856  ALA A CA  1 
ATOM   1443  C  C   . ALA A 1 203 ? 57.022  16.789  27.328 1.00 31.45 ? 856  ALA A C   1 
ATOM   1444  O  O   . ALA A 1 203 ? 56.455  17.413  28.223 1.00 31.75 ? 856  ALA A O   1 
ATOM   1445  C  CB  . ALA A 1 203 ? 59.509  16.870  27.128 1.00 32.10 ? 856  ALA A CB  1 
ATOM   1446  N  N   . SER A 1 204 ? 56.549  16.711  26.088 1.00 30.93 ? 857  SER A N   1 
ATOM   1447  C  CA  . SER A 1 204 ? 55.301  17.366  25.699 1.00 31.41 ? 857  SER A CA  1 
ATOM   1448  C  C   . SER A 1 204 ? 54.073  16.795  26.364 1.00 29.85 ? 857  SER A C   1 
ATOM   1449  O  O   . SER A 1 204 ? 53.172  17.550  26.732 1.00 30.63 ? 857  SER A O   1 
ATOM   1450  C  CB  . SER A 1 204 ? 55.078  17.285  24.206 1.00 32.52 ? 857  SER A CB  1 
ATOM   1451  O  OG  . SER A 1 204 ? 56.029  18.045  23.540 1.00 38.43 ? 857  SER A OG  1 
ATOM   1452  N  N   . ALA A 1 205 ? 54.022  15.476  26.496 1.00 27.77 ? 858  ALA A N   1 
ATOM   1453  C  CA  . ALA A 1 205 ? 52.864  14.845  27.127 1.00 29.15 ? 858  ALA A CA  1 
ATOM   1454  C  C   . ALA A 1 205 ? 52.871  15.124  28.639 1.00 27.70 ? 858  ALA A C   1 
ATOM   1455  O  O   . ALA A 1 205 ? 51.831  15.274  29.275 1.00 30.17 ? 858  ALA A O   1 
ATOM   1456  C  CB  . ALA A 1 205 ? 52.832  13.303  26.820 1.00 25.74 ? 858  ALA A CB  1 
ATOM   1457  N  N   . TRP A 1 206 ? 54.040  15.200  29.236 1.00 29.60 ? 859  TRP A N   1 
ATOM   1458  C  CA  . TRP A 1 206 ? 54.048  15.518  30.655 1.00 31.67 ? 859  TRP A CA  1 
ATOM   1459  C  C   . TRP A 1 206 ? 53.749  16.995  30.807 1.00 29.95 ? 859  TRP A C   1 
ATOM   1460  O  O   . TRP A 1 206 ? 53.104  17.395  31.751 1.00 28.10 ? 859  TRP A O   1 
ATOM   1461  C  CB  . TRP A 1 206 ? 55.382  15.164  31.303 1.00 31.57 ? 859  TRP A CB  1 
ATOM   1462  C  CG  . TRP A 1 206 ? 55.378  13.737  31.732 1.00 32.93 ? 859  TRP A CG  1 
ATOM   1463  C  CD1 . TRP A 1 206 ? 56.124  12.719  31.215 1.00 32.00 ? 859  TRP A CD1 1 
ATOM   1464  C  CD2 . TRP A 1 206 ? 54.527  13.150  32.713 1.00 32.00 ? 859  TRP A CD2 1 
ATOM   1465  N  NE1 . TRP A 1 206 ? 55.789  11.536  31.812 1.00 33.81 ? 859  TRP A NE1 1 
ATOM   1466  C  CE2 . TRP A 1 206 ? 54.810  11.768  32.737 1.00 32.87 ? 859  TRP A CE2 1 
ATOM   1467  C  CE3 . TRP A 1 206 ? 53.545  13.656  33.572 1.00 33.58 ? 859  TRP A CE3 1 
ATOM   1468  C  CZ2 . TRP A 1 206 ? 54.155  10.882  33.590 1.00 33.14 ? 859  TRP A CZ2 1 
ATOM   1469  C  CZ3 . TRP A 1 206 ? 52.890  12.781  34.419 1.00 32.61 ? 859  TRP A CZ3 1 
ATOM   1470  C  CH2 . TRP A 1 206 ? 53.197  11.404  34.421 1.00 34.34 ? 859  TRP A CH2 1 
ATOM   1471  N  N   . ASN A 1 207 ? 54.215  17.793  29.857 1.00 31.13 ? 860  ASN A N   1 
ATOM   1472  C  CA  . ASN A 1 207 ? 53.946  19.215  29.908 1.00 33.10 ? 860  ASN A CA  1 
ATOM   1473  C  C   . ASN A 1 207 ? 52.449  19.394  29.845 1.00 32.52 ? 860  ASN A C   1 
ATOM   1474  O  O   . ASN A 1 207 ? 51.872  20.180  30.584 1.00 31.99 ? 860  ASN A O   1 
ATOM   1475  C  CB  . ASN A 1 207 ? 54.575  19.959  28.737 1.00 35.84 ? 860  ASN A CB  1 
ATOM   1476  C  CG  . ASN A 1 207 ? 54.348  21.460  28.836 1.00 39.70 ? 860  ASN A CG  1 
ATOM   1477  O  OD1 . ASN A 1 207 ? 54.893  22.105  29.711 1.00 41.90 ? 860  ASN A OD1 1 
ATOM   1478  N  ND2 . ASN A 1 207 ? 53.530  22.012  27.942 1.00 42.02 ? 860  ASN A ND2 1 
ATOM   1479  N  N   . LEU A 1 208 ? 51.813  18.631  28.966 1.00 33.39 ? 861  LEU A N   1 
ATOM   1480  C  CA  . LEU A 1 208 ? 50.375  18.725  28.817 1.00 32.61 ? 861  LEU A CA  1 
ATOM   1481  C  C   . LEU A 1 208 ? 49.699  18.362  30.114 1.00 32.32 ? 861  LEU A C   1 
ATOM   1482  O  O   . LEU A 1 208 ? 48.811  19.077  30.556 1.00 33.28 ? 861  LEU A O   1 
ATOM   1483  C  CB  . LEU A 1 208 ? 49.877  17.796  27.714 1.00 31.52 ? 861  LEU A CB  1 
ATOM   1484  C  CG  . LEU A 1 208 ? 48.375  17.867  27.446 1.00 29.32 ? 861  LEU A CG  1 
ATOM   1485  C  CD1 . LEU A 1 208 ? 47.988  19.282  27.032 1.00 28.64 ? 861  LEU A CD1 1 
ATOM   1486  C  CD2 . LEU A 1 208 ? 48.003  16.854  26.381 1.00 26.50 ? 861  LEU A CD2 1 
ATOM   1487  N  N   . TYR A 1 209 ? 50.116  17.253  30.718 1.00 31.32 ? 862  TYR A N   1 
ATOM   1488  C  CA  . TYR A 1 209 ? 49.523  16.792  31.974 1.00 30.21 ? 862  TYR A CA  1 
ATOM   1489  C  C   . TYR A 1 209 ? 49.581  17.849  33.091 1.00 31.10 ? 862  TYR A C   1 
ATOM   1490  O  O   . TYR A 1 209 ? 48.624  18.038  33.816 1.00 29.82 ? 862  TYR A O   1 
ATOM   1491  C  CB  . TYR A 1 209 ? 50.228  15.505  32.454 1.00 28.81 ? 862  TYR A CB  1 
ATOM   1492  C  CG  . TYR A 1 209 ? 49.659  14.947  33.747 1.00 26.75 ? 862  TYR A CG  1 
ATOM   1493  C  CD1 . TYR A 1 209 ? 48.667  13.958  33.740 1.00 25.45 ? 862  TYR A CD1 1 
ATOM   1494  C  CD2 . TYR A 1 209 ? 50.065  15.451  34.981 1.00 24.79 ? 862  TYR A CD2 1 
ATOM   1495  C  CE1 . TYR A 1 209 ? 48.102  13.495  34.939 1.00 26.03 ? 862  TYR A CE1 1 
ATOM   1496  C  CE2 . TYR A 1 209 ? 49.504  15.001  36.163 1.00 21.59 ? 862  TYR A CE2 1 
ATOM   1497  C  CZ  . TYR A 1 209 ? 48.531  14.028  36.144 1.00 24.59 ? 862  TYR A CZ  1 
ATOM   1498  O  OH  . TYR A 1 209 ? 48.011  13.558  37.343 1.00 28.49 ? 862  TYR A OH  1 
ATOM   1499  N  N   . LEU A 1 210 ? 50.707  18.546  33.204 1.00 32.37 ? 863  LEU A N   1 
ATOM   1500  C  CA  . LEU A 1 210 ? 50.890  19.521  34.266 1.00 33.39 ? 863  LEU A CA  1 
ATOM   1501  C  C   . LEU A 1 210 ? 50.435  20.936  33.970 1.00 34.83 ? 863  LEU A C   1 
ATOM   1502  O  O   . LEU A 1 210 ? 50.606  21.847  34.800 1.00 34.30 ? 863  LEU A O   1 
ATOM   1503  C  CB  . LEU A 1 210 ? 52.358  19.551  34.648 1.00 31.34 ? 863  LEU A CB  1 
ATOM   1504  C  CG  . LEU A 1 210 ? 52.899  18.191  35.087 1.00 32.68 ? 863  LEU A CG  1 
ATOM   1505  C  CD1 . LEU A 1 210 ? 54.403  18.089  34.796 1.00 32.16 ? 863  LEU A CD1 1 
ATOM   1506  C  CD2 . LEU A 1 210 ? 52.586  17.985  36.554 1.00 28.78 ? 863  LEU A CD2 1 
ATOM   1507  N  N   . SER A 1 211 ? 49.850  21.126  32.795 1.00 34.97 ? 864  SER A N   1 
ATOM   1508  C  CA  . SER A 1 211 ? 49.445  22.457  32.372 1.00 34.36 ? 864  SER A CA  1 
ATOM   1509  C  C   . SER A 1 211 ? 48.079  22.882  32.826 1.00 35.13 ? 864  SER A C   1 
ATOM   1510  O  O   . SER A 1 211 ? 47.775  24.061  32.817 1.00 38.57 ? 864  SER A O   1 
ATOM   1511  C  CB  . SER A 1 211 ? 49.546  22.551  30.857 1.00 31.82 ? 864  SER A CB  1 
ATOM   1512  O  OG  . SER A 1 211 ? 48.650  21.618  30.254 1.00 34.49 ? 864  SER A OG  1 
ATOM   1513  N  N   . ARG A 1 212 ? 47.253  21.934  33.232 1.00 36.61 ? 865  ARG A N   1 
ATOM   1514  C  CA  . ARG A 1 212 ? 45.903  22.248  33.662 1.00 37.34 ? 865  ARG A CA  1 
ATOM   1515  C  C   . ARG A 1 212 ? 45.483  21.366  34.826 1.00 39.03 ? 865  ARG A C   1 
ATOM   1516  O  O   . ARG A 1 212 ? 45.753  20.155  34.855 1.00 40.63 ? 865  ARG A O   1 
ATOM   1517  C  CB  . ARG A 1 212 ? 44.922  22.037  32.511 1.00 37.76 ? 865  ARG A CB  1 
ATOM   1518  C  CG  . ARG A 1 212 ? 45.195  22.855  31.276 1.00 39.76 ? 865  ARG A CG  1 
ATOM   1519  C  CD  . ARG A 1 212 ? 44.764  24.294  31.436 1.00 41.87 ? 865  ARG A CD  1 
ATOM   1520  N  NE  . ARG A 1 212 ? 45.727  25.194  30.816 1.00 47.12 ? 865  ARG A NE  1 
ATOM   1521  C  CZ  . ARG A 1 212 ? 45.875  25.377  29.509 1.00 49.76 ? 865  ARG A CZ  1 
ATOM   1522  N  NH1 . ARG A 1 212 ? 45.105  24.726  28.645 1.00 53.07 ? 865  ARG A NH1 1 
ATOM   1523  N  NH2 . ARG A 1 212 ? 46.818  26.197  29.065 1.00 50.14 ? 865  ARG A NH2 1 
ATOM   1524  N  N   . PRO A 1 213 ? 44.817  21.958  35.816 1.00 39.32 ? 866  PRO A N   1 
ATOM   1525  C  CA  . PRO A 1 213 ? 44.386  21.152  36.952 1.00 39.40 ? 866  PRO A CA  1 
ATOM   1526  C  C   . PRO A 1 213 ? 43.362  20.103  36.522 1.00 40.10 ? 866  PRO A C   1 
ATOM   1527  O  O   . PRO A 1 213 ? 43.351  18.988  37.053 1.00 40.07 ? 866  PRO A O   1 
ATOM   1528  C  CB  . PRO A 1 213 ? 43.794  22.189  37.897 1.00 39.47 ? 866  PRO A CB  1 
ATOM   1529  C  CG  . PRO A 1 213 ? 43.318  23.254  36.955 1.00 41.04 ? 866  PRO A CG  1 
ATOM   1530  C  CD  . PRO A 1 213 ? 44.477  23.369  36.018 1.00 39.65 ? 866  PRO A CD  1 
ATOM   1531  N  N   . GLU A 1 214 ? 42.522  20.438  35.545 1.00 40.31 ? 867  GLU A N   1 
ATOM   1532  C  CA  . GLU A 1 214 ? 41.492  19.486  35.112 1.00 41.33 ? 867  GLU A CA  1 
ATOM   1533  C  C   . GLU A 1 214 ? 42.036  18.180  34.533 1.00 41.80 ? 867  GLU A C   1 
ATOM   1534  O  O   . GLU A 1 214 ? 41.277  17.244  34.336 1.00 43.50 ? 867  GLU A O   1 
ATOM   1535  C  CB  . GLU A 1 214 ? 40.495  20.134  34.125 1.00 40.98 ? 867  GLU A CB  1 
ATOM   1536  C  CG  . GLU A 1 214 ? 41.071  20.488  32.766 1.00 42.50 ? 867  GLU A CG  1 
ATOM   1537  C  CD  . GLU A 1 214 ? 41.247  21.981  32.557 1.00 42.26 ? 867  GLU A CD  1 
ATOM   1538  O  OE1 . GLU A 1 214 ? 41.579  22.690  33.537 1.00 44.10 ? 867  GLU A OE1 1 
ATOM   1539  O  OE2 . GLU A 1 214 ? 41.064  22.436  31.403 1.00 43.40 ? 867  GLU A OE2 1 
ATOM   1540  N  N   . TYR A 1 215 ? 43.345  18.102  34.298 1.00 42.18 ? 868  TYR A N   1 
ATOM   1541  C  CA  . TYR A 1 215 ? 43.961  16.885  33.774 1.00 41.55 ? 868  TYR A CA  1 
ATOM   1542  C  C   . TYR A 1 215 ? 44.499  15.961  34.865 1.00 42.81 ? 868  TYR A C   1 
ATOM   1543  O  O   . TYR A 1 215 ? 44.754  14.786  34.624 1.00 41.55 ? 868  TYR A O   1 
ATOM   1544  C  CB  . TYR A 1 215 ? 45.129  17.244  32.868 1.00 41.97 ? 868  TYR A CB  1 
ATOM   1545  C  CG  . TYR A 1 215 ? 44.742  17.976  31.625 1.00 42.07 ? 868  TYR A CG  1 
ATOM   1546  C  CD1 . TYR A 1 215 ? 45.646  18.821  30.981 1.00 41.54 ? 868  TYR A CD1 1 
ATOM   1547  C  CD2 . TYR A 1 215 ? 43.462  17.844  31.094 1.00 41.68 ? 868  TYR A CD2 1 
ATOM   1548  C  CE1 . TYR A 1 215 ? 45.265  19.531  29.826 1.00 42.78 ? 868  TYR A CE1 1 
ATOM   1549  C  CE2 . TYR A 1 215 ? 43.074  18.536  29.957 1.00 42.60 ? 868  TYR A CE2 1 
ATOM   1550  C  CZ  . TYR A 1 215 ? 43.968  19.382  29.325 1.00 44.08 ? 868  TYR A CZ  1 
ATOM   1551  O  OH  . TYR A 1 215 ? 43.545  20.108  28.229 1.00 44.95 ? 868  TYR A OH  1 
ATOM   1552  N  N   . ASN A 1 216 ? 44.672  16.507  36.063 1.00 44.43 ? 869  ASN A N   1 
ATOM   1553  C  CA  . ASN A 1 216 ? 45.257  15.789  37.203 1.00 45.42 ? 869  ASN A CA  1 
ATOM   1554  C  C   . ASN A 1 216 ? 44.512  14.541  37.675 1.00 43.89 ? 869  ASN A C   1 
ATOM   1555  O  O   . ASN A 1 216 ? 43.968  14.509  38.771 1.00 44.70 ? 869  ASN A O   1 
ATOM   1556  C  CB  . ASN A 1 216 ? 45.421  16.783  38.354 1.00 47.35 ? 869  ASN A CB  1 
ATOM   1557  C  CG  . ASN A 1 216 ? 46.327  16.269  39.454 1.00 49.94 ? 869  ASN A CG  1 
ATOM   1558  O  OD1 . ASN A 1 216 ? 47.287  15.523  39.198 1.00 53.56 ? 869  ASN A OD1 1 
ATOM   1559  N  ND2 . ASN A 1 216 ? 46.046  16.686  40.692 1.00 49.49 ? 869  ASN A ND2 1 
ATOM   1560  N  N   . PHE A 1 217 ? 44.529  13.497  36.863 1.00 41.51 ? 870  PHE A N   1 
ATOM   1561  C  CA  . PHE A 1 217 ? 43.802  12.306  37.235 1.00 40.49 ? 870  PHE A CA  1 
ATOM   1562  C  C   . PHE A 1 217 ? 44.588  11.410  38.181 1.00 41.68 ? 870  PHE A C   1 
ATOM   1563  O  O   . PHE A 1 217 ? 44.064  10.427  38.713 1.00 43.38 ? 870  PHE A O   1 
ATOM   1564  C  CB  . PHE A 1 217 ? 43.321  11.539  35.979 1.00 36.97 ? 870  PHE A CB  1 
ATOM   1565  C  CG  . PHE A 1 217 ? 44.413  10.867  35.199 1.00 35.56 ? 870  PHE A CG  1 
ATOM   1566  C  CD1 . PHE A 1 217 ? 44.890  9.610   35.575 1.00 34.02 ? 870  PHE A CD1 1 
ATOM   1567  C  CD2 . PHE A 1 217 ? 44.993  11.499  34.109 1.00 34.66 ? 870  PHE A CD2 1 
ATOM   1568  C  CE1 . PHE A 1 217 ? 45.917  9.002   34.886 1.00 31.37 ? 870  PHE A CE1 1 
ATOM   1569  C  CE2 . PHE A 1 217 ? 46.034  10.897  33.407 1.00 34.85 ? 870  PHE A CE2 1 
ATOM   1570  C  CZ  . PHE A 1 217 ? 46.499  9.646   33.796 1.00 32.94 ? 870  PHE A CZ  1 
ATOM   1571  N  N   . LEU A 1 218 ? 45.845  11.739  38.411 1.00 41.85 ? 871  LEU A N   1 
ATOM   1572  C  CA  . LEU A 1 218 ? 46.626  10.925  39.327 1.00 42.35 ? 871  LEU A CA  1 
ATOM   1573  C  C   . LEU A 1 218 ? 46.740  11.577  40.720 1.00 41.47 ? 871  LEU A C   1 
ATOM   1574  O  O   . LEU A 1 218 ? 47.576  11.186  41.521 1.00 39.93 ? 871  LEU A O   1 
ATOM   1575  C  CB  . LEU A 1 218 ? 48.021  10.664  38.748 1.00 41.33 ? 871  LEU A CB  1 
ATOM   1576  C  CG  . LEU A 1 218 ? 48.084  9.872   37.446 1.00 39.91 ? 871  LEU A CG  1 
ATOM   1577  C  CD1 . LEU A 1 218 ? 49.497  9.921   36.919 1.00 41.63 ? 871  LEU A CD1 1 
ATOM   1578  C  CD2 . LEU A 1 218 ? 47.649  8.441   37.657 1.00 39.95 ? 871  LEU A CD2 1 
ATOM   1579  N  N   . LEU A 1 219 ? 45.878  12.553  40.999 1.00 41.77 ? 872  LEU A N   1 
ATOM   1580  C  CA  . LEU A 1 219 ? 45.900  13.244  42.278 1.00 43.16 ? 872  LEU A CA  1 
ATOM   1581  C  C   . LEU A 1 219 ? 45.917  12.361  43.538 1.00 43.01 ? 872  LEU A C   1 
ATOM   1582  O  O   . LEU A 1 219 ? 46.331  12.808  44.604 1.00 42.43 ? 872  LEU A O   1 
ATOM   1583  C  CB  . LEU A 1 219 ? 44.730  14.236  42.371 1.00 44.13 ? 872  LEU A CB  1 
ATOM   1584  C  CG  . LEU A 1 219 ? 43.266  13.827  42.160 1.00 45.57 ? 872  LEU A CG  1 
ATOM   1585  C  CD1 . LEU A 1 219 ? 43.113  12.349  42.076 1.00 45.55 ? 872  LEU A CD1 1 
ATOM   1586  C  CD2 . LEU A 1 219 ? 42.444  14.379  43.305 1.00 45.13 ? 872  LEU A CD2 1 
ATOM   1587  N  N   . HIS A 1 220 ? 45.492  11.113  43.434 1.00 42.05 ? 873  HIS A N   1 
ATOM   1588  C  CA  . HIS A 1 220 ? 45.493  10.300  44.628 1.00 43.52 ? 873  HIS A CA  1 
ATOM   1589  C  C   . HIS A 1 220 ? 46.771  9.524   44.903 1.00 43.60 ? 873  HIS A C   1 
ATOM   1590  O  O   . HIS A 1 220 ? 46.845  8.760   45.859 1.00 44.59 ? 873  HIS A O   1 
ATOM   1591  C  CB  . HIS A 1 220 ? 44.257  9.392   44.637 1.00 44.15 ? 873  HIS A CB  1 
ATOM   1592  C  CG  . HIS A 1 220 ? 42.976  10.156  44.807 1.00 46.60 ? 873  HIS A CG  1 
ATOM   1593  N  ND1 . HIS A 1 220 ? 41.827  9.860   44.106 1.00 47.63 ? 873  HIS A ND1 1 
ATOM   1594  C  CD2 . HIS A 1 220 ? 42.694  11.262  45.539 1.00 46.66 ? 873  HIS A CD2 1 
ATOM   1595  C  CE1 . HIS A 1 220 ? 40.898  10.755  44.390 1.00 47.10 ? 873  HIS A CE1 1 
ATOM   1596  N  NE2 . HIS A 1 220 ? 41.399  11.616  45.256 1.00 47.32 ? 873  HIS A NE2 1 
ATOM   1597  N  N   . LEU A 1 221 ? 47.786  9.729   44.078 1.00 42.06 ? 874  LEU A N   1 
ATOM   1598  C  CA  . LEU A 1 221 ? 49.054  9.067   44.305 1.00 41.40 ? 874  LEU A CA  1 
ATOM   1599  C  C   . LEU A 1 221 ? 49.850  9.952   45.278 1.00 42.84 ? 874  LEU A C   1 
ATOM   1600  O  O   . LEU A 1 221 ? 49.823  11.181  45.157 1.00 42.82 ? 874  LEU A O   1 
ATOM   1601  C  CB  . LEU A 1 221 ? 49.843  8.944   43.005 1.00 38.24 ? 874  LEU A CB  1 
ATOM   1602  C  CG  . LEU A 1 221 ? 49.293  8.154   41.829 1.00 37.29 ? 874  LEU A CG  1 
ATOM   1603  C  CD1 . LEU A 1 221 ? 50.416  7.913   40.833 1.00 34.69 ? 874  LEU A CD1 1 
ATOM   1604  C  CD2 . LEU A 1 221 ? 48.736  6.842   42.299 1.00 36.96 ? 874  LEU A CD2 1 
ATOM   1605  N  N   . ASP A 1 222 ? 50.554  9.348   46.236 1.00 42.41 ? 875  ASP A N   1 
ATOM   1606  C  CA  . ASP A 1 222 ? 51.352  10.151  47.156 1.00 41.94 ? 875  ASP A CA  1 
ATOM   1607  C  C   . ASP A 1 222 ? 52.560  10.654  46.351 1.00 42.59 ? 875  ASP A C   1 
ATOM   1608  O  O   . ASP A 1 222 ? 52.831  10.158  45.243 1.00 43.08 ? 875  ASP A O   1 
ATOM   1609  C  CB  . ASP A 1 222 ? 51.791  9.327   48.380 1.00 42.39 ? 875  ASP A CB  1 
ATOM   1610  C  CG  . ASP A 1 222 ? 52.859  8.307   48.058 1.00 44.18 ? 875  ASP A CG  1 
ATOM   1611  O  OD1 . ASP A 1 222 ? 52.707  7.157   48.497 1.00 47.42 ? 875  ASP A OD1 1 
ATOM   1612  O  OD2 . ASP A 1 222 ? 53.858  8.632   47.382 1.00 45.22 ? 875  ASP A OD2 1 
ATOM   1613  N  N   . HIS A 1 223 ? 53.269  11.636  46.895 1.00 41.95 ? 876  HIS A N   1 
ATOM   1614  C  CA  . HIS A 1 223 ? 54.419  12.242  46.246 1.00 42.37 ? 876  HIS A CA  1 
ATOM   1615  C  C   . HIS A 1 223 ? 55.481  11.238  45.770 1.00 41.59 ? 876  HIS A C   1 
ATOM   1616  O  O   . HIS A 1 223 ? 56.053  11.400  44.684 1.00 40.05 ? 876  HIS A O   1 
ATOM   1617  C  CB  . HIS A 1 223 ? 55.037  13.265  47.208 1.00 47.80 ? 876  HIS A CB  1 
ATOM   1618  C  CG  . HIS A 1 223 ? 56.182  14.037  46.629 1.00 55.17 ? 876  HIS A CG  1 
ATOM   1619  N  ND1 . HIS A 1 223 ? 57.319  13.429  46.127 1.00 58.87 ? 876  HIS A ND1 1 
ATOM   1620  C  CD2 . HIS A 1 223 ? 56.370  15.371  46.469 1.00 58.01 ? 876  HIS A CD2 1 
ATOM   1621  C  CE1 . HIS A 1 223 ? 58.154  14.354  45.681 1.00 59.53 ? 876  HIS A CE1 1 
ATOM   1622  N  NE2 . HIS A 1 223 ? 57.602  15.541  45.877 1.00 60.50 ? 876  HIS A NE2 1 
ATOM   1623  N  N   . VAL A 1 224 ? 55.756  10.216  46.579 1.00 39.83 ? 877  VAL A N   1 
ATOM   1624  C  CA  . VAL A 1 224 ? 56.758  9.208   46.219 1.00 40.56 ? 877  VAL A CA  1 
ATOM   1625  C  C   . VAL A 1 224 ? 56.256  8.328   45.071 1.00 41.20 ? 877  VAL A C   1 
ATOM   1626  O  O   . VAL A 1 224 ? 57.012  7.953   44.176 1.00 41.05 ? 877  VAL A O   1 
ATOM   1627  C  CB  . VAL A 1 224 ? 57.121  8.302   47.455 1.00 40.99 ? 877  VAL A CB  1 
ATOM   1628  C  CG1 . VAL A 1 224 ? 57.929  7.080   47.023 1.00 39.62 ? 877  VAL A CG1 1 
ATOM   1629  C  CG2 . VAL A 1 224 ? 57.917  9.102   48.473 1.00 37.34 ? 877  VAL A CG2 1 
ATOM   1630  N  N   . GLU A 1 225 ? 54.973  7.996   45.125 1.00 41.67 ? 878  GLU A N   1 
ATOM   1631  C  CA  . GLU A 1 225 ? 54.357  7.174   44.110 1.00 42.15 ? 878  GLU A CA  1 
ATOM   1632  C  C   . GLU A 1 225 ? 54.313  7.953   42.809 1.00 40.87 ? 878  GLU A C   1 
ATOM   1633  O  O   . GLU A 1 225 ? 54.645  7.428   41.748 1.00 40.37 ? 878  GLU A O   1 
ATOM   1634  C  CB  . GLU A 1 225 ? 52.930  6.793   44.521 1.00 44.20 ? 878  GLU A CB  1 
ATOM   1635  C  CG  . GLU A 1 225 ? 52.842  5.574   45.420 1.00 46.31 ? 878  GLU A CG  1 
ATOM   1636  C  CD  . GLU A 1 225 ? 51.456  5.357   46.004 1.00 49.14 ? 878  GLU A CD  1 
ATOM   1637  O  OE1 . GLU A 1 225 ? 51.205  4.233   46.475 1.00 51.60 ? 878  GLU A OE1 1 
ATOM   1638  O  OE2 . GLU A 1 225 ? 50.618  6.298   46.013 1.00 50.70 ? 878  GLU A OE2 1 
ATOM   1639  N  N   . PHE A 1 226 ? 53.917  9.215   42.887 1.00 39.58 ? 879  PHE A N   1 
ATOM   1640  C  CA  . PHE A 1 226 ? 53.828  9.994   41.672 1.00 38.29 ? 879  PHE A CA  1 
ATOM   1641  C  C   . PHE A 1 226 ? 55.189  10.141  40.998 1.00 39.12 ? 879  PHE A C   1 
ATOM   1642  O  O   . PHE A 1 226 ? 55.298  10.021  39.776 1.00 40.56 ? 879  PHE A O   1 
ATOM   1643  C  CB  . PHE A 1 226 ? 53.245  11.376  41.936 1.00 34.86 ? 879  PHE A CB  1 
ATOM   1644  C  CG  . PHE A 1 226 ? 53.135  12.204  40.693 1.00 33.26 ? 879  PHE A CG  1 
ATOM   1645  C  CD1 . PHE A 1 226 ? 52.117  11.955  39.769 1.00 31.90 ? 879  PHE A CD1 1 
ATOM   1646  C  CD2 . PHE A 1 226 ? 54.114  13.146  40.383 1.00 30.22 ? 879  PHE A CD2 1 
ATOM   1647  C  CE1 . PHE A 1 226 ? 52.085  12.629  38.548 1.00 34.49 ? 879  PHE A CE1 1 
ATOM   1648  C  CE2 . PHE A 1 226 ? 54.094  13.822  39.180 1.00 34.33 ? 879  PHE A CE2 1 
ATOM   1649  C  CZ  . PHE A 1 226 ? 53.077  13.572  38.244 1.00 34.69 ? 879  PHE A CZ  1 
ATOM   1650  N  N   . LYS A 1 227 ? 56.218  10.395  41.794 1.00 39.85 ? 880  LYS A N   1 
ATOM   1651  C  CA  . LYS A 1 227 ? 57.566  10.564  41.271 1.00 42.11 ? 880  LYS A CA  1 
ATOM   1652  C  C   . LYS A 1 227 ? 58.102  9.295   40.587 1.00 40.80 ? 880  LYS A C   1 
ATOM   1653  O  O   . LYS A 1 227 ? 58.798  9.351   39.570 1.00 40.63 ? 880  LYS A O   1 
ATOM   1654  C  CB  . LYS A 1 227 ? 58.514  10.968  42.400 1.00 43.65 ? 880  LYS A CB  1 
ATOM   1655  C  CG  . LYS A 1 227 ? 59.881  11.386  41.916 1.00 47.55 ? 880  LYS A CG  1 
ATOM   1656  C  CD  . LYS A 1 227 ? 60.880  11.429  43.074 1.00 53.46 ? 880  LYS A CD  1 
ATOM   1657  C  CE  . LYS A 1 227 ? 62.318  11.749  42.599 1.00 55.09 ? 880  LYS A CE  1 
ATOM   1658  N  NZ  . LYS A 1 227 ? 63.301  11.620  43.722 1.00 56.11 ? 880  LYS A NZ  1 
ATOM   1659  N  N   . ARG A 1 228 ? 57.775  8.148   41.147 1.00 39.03 ? 881  ARG A N   1 
ATOM   1660  C  CA  . ARG A 1 228 ? 58.237  6.906   40.571 1.00 39.26 ? 881  ARG A CA  1 
ATOM   1661  C  C   . ARG A 1 228 ? 57.505  6.606   39.259 1.00 38.48 ? 881  ARG A C   1 
ATOM   1662  O  O   . ARG A 1 228 ? 58.093  6.086   38.303 1.00 38.45 ? 881  ARG A O   1 
ATOM   1663  C  CB  . ARG A 1 228 ? 58.027  5.794   41.577 1.00 38.79 ? 881  ARG A CB  1 
ATOM   1664  C  CG  . ARG A 1 228 ? 58.336  4.456   41.033 1.00 40.53 ? 881  ARG A CG  1 
ATOM   1665  C  CD  . ARG A 1 228 ? 58.377  3.447   42.149 1.00 40.38 ? 881  ARG A CD  1 
ATOM   1666  N  NE  . ARG A 1 228 ? 58.565  2.113   41.608 1.00 43.53 ? 881  ARG A NE  1 
ATOM   1667  C  CZ  . ARG A 1 228 ? 59.598  1.748   40.856 1.00 44.78 ? 881  ARG A CZ  1 
ATOM   1668  N  NH1 . ARG A 1 228 ? 60.559  2.618   40.546 1.00 44.00 ? 881  ARG A NH1 1 
ATOM   1669  N  NH2 . ARG A 1 228 ? 59.655  0.502   40.403 1.00 46.22 ? 881  ARG A NH2 1 
ATOM   1670  N  N   . PHE A 1 229 ? 56.223  6.966   39.228 1.00 38.05 ? 882  PHE A N   1 
ATOM   1671  C  CA  . PHE A 1 229 ? 55.359  6.771   38.064 1.00 37.95 ? 882  PHE A CA  1 
ATOM   1672  C  C   . PHE A 1 229 ? 55.875  7.595   36.879 1.00 37.53 ? 882  PHE A C   1 
ATOM   1673  O  O   . PHE A 1 229 ? 55.912  7.114   35.743 1.00 37.23 ? 882  PHE A O   1 
ATOM   1674  C  CB  . PHE A 1 229 ? 53.908  7.190   38.407 1.00 37.73 ? 882  PHE A CB  1 
ATOM   1675  C  CG  . PHE A 1 229 ? 52.910  6.990   37.271 1.00 36.96 ? 882  PHE A CG  1 
ATOM   1676  C  CD1 . PHE A 1 229 ? 52.294  5.753   37.069 1.00 35.92 ? 882  PHE A CD1 1 
ATOM   1677  C  CD2 . PHE A 1 229 ? 52.613  8.034   36.392 1.00 35.59 ? 882  PHE A CD2 1 
ATOM   1678  C  CE1 . PHE A 1 229 ? 51.400  5.561   36.008 1.00 36.15 ? 882  PHE A CE1 1 
ATOM   1679  C  CE2 . PHE A 1 229 ? 51.730  7.859   35.331 1.00 34.27 ? 882  PHE A CE2 1 
ATOM   1680  C  CZ  . PHE A 1 229 ? 51.121  6.622   35.139 1.00 35.93 ? 882  PHE A CZ  1 
ATOM   1681  N  N   . ARG A 1 230 ? 56.262  8.840   37.159 1.00 34.97 ? 883  ARG A N   1 
ATOM   1682  C  CA  . ARG A 1 230 ? 56.769  9.725   36.128 1.00 33.21 ? 883  ARG A CA  1 
ATOM   1683  C  C   . ARG A 1 230 ? 58.051  9.132   35.537 1.00 31.49 ? 883  ARG A C   1 
ATOM   1684  O  O   . ARG A 1 230 ? 58.258  9.089   34.310 1.00 31.64 ? 883  ARG A O   1 
ATOM   1685  C  CB  . ARG A 1 230 ? 57.032  11.090  36.740 1.00 35.28 ? 883  ARG A CB  1 
ATOM   1686  C  CG  . ARG A 1 230 ? 57.797  12.049  35.871 1.00 39.03 ? 883  ARG A CG  1 
ATOM   1687  C  CD  . ARG A 1 230 ? 56.903  13.063  35.161 1.00 41.34 ? 883  ARG A CD  1 
ATOM   1688  N  NE  . ARG A 1 230 ? 57.704  13.943  34.297 1.00 41.98 ? 883  ARG A NE  1 
ATOM   1689  C  CZ  . ARG A 1 230 ? 58.714  14.675  34.751 1.00 41.64 ? 883  ARG A CZ  1 
ATOM   1690  N  NH1 . ARG A 1 230 ? 58.999  14.612  36.046 1.00 43.45 ? 883  ARG A NH1 1 
ATOM   1691  N  NH2 . ARG A 1 230 ? 59.446  15.428  33.931 1.00 39.07 ? 883  ARG A NH2 1 
ATOM   1692  N  N   . PHE A 1 231 ? 58.906  8.656   36.429 1.00 30.16 ? 884  PHE A N   1 
ATOM   1693  C  CA  . PHE A 1 231 ? 60.169  8.054   36.055 1.00 28.01 ? 884  PHE A CA  1 
ATOM   1694  C  C   . PHE A 1 231 ? 59.931  6.842   35.145 1.00 27.79 ? 884  PHE A C   1 
ATOM   1695  O  O   . PHE A 1 231 ? 60.575  6.695   34.110 1.00 28.88 ? 884  PHE A O   1 
ATOM   1696  C  CB  . PHE A 1 231 ? 60.927  7.650   37.330 1.00 26.53 ? 884  PHE A CB  1 
ATOM   1697  C  CG  . PHE A 1 231 ? 62.047  6.663   37.091 1.00 25.54 ? 884  PHE A CG  1 
ATOM   1698  C  CD1 . PHE A 1 231 ? 63.206  7.044   36.416 1.00 25.16 ? 884  PHE A CD1 1 
ATOM   1699  C  CD2 . PHE A 1 231 ? 61.921  5.351   37.521 1.00 24.75 ? 884  PHE A CD2 1 
ATOM   1700  C  CE1 . PHE A 1 231 ? 64.232  6.128   36.173 1.00 27.06 ? 884  PHE A CE1 1 
ATOM   1701  C  CE2 . PHE A 1 231 ? 62.927  4.419   37.291 1.00 26.03 ? 884  PHE A CE2 1 
ATOM   1702  C  CZ  . PHE A 1 231 ? 64.094  4.809   36.608 1.00 27.72 ? 884  PHE A CZ  1 
ATOM   1703  N  N   . LEU A 1 232 ? 59.008  5.979   35.542 1.00 28.38 ? 885  LEU A N   1 
ATOM   1704  C  CA  . LEU A 1 232 ? 58.686  4.775   34.771 1.00 27.91 ? 885  LEU A CA  1 
ATOM   1705  C  C   . LEU A 1 232 ? 58.176  5.089   33.369 1.00 27.33 ? 885  LEU A C   1 
ATOM   1706  O  O   . LEU A 1 232 ? 58.696  4.538   32.392 1.00 27.30 ? 885  LEU A O   1 
ATOM   1707  C  CB  . LEU A 1 232 ? 57.664  3.945   35.540 1.00 27.33 ? 885  LEU A CB  1 
ATOM   1708  C  CG  . LEU A 1 232 ? 58.196  3.479   36.902 1.00 28.61 ? 885  LEU A CG  1 
ATOM   1709  C  CD1 . LEU A 1 232 ? 57.080  2.904   37.745 1.00 27.13 ? 885  LEU A CD1 1 
ATOM   1710  C  CD2 . LEU A 1 232 ? 59.326  2.465   36.693 1.00 26.58 ? 885  LEU A CD2 1 
ATOM   1711  N  N   . VAL A 1 233 ? 57.175  5.971   33.272 1.00 26.01 ? 886  VAL A N   1 
ATOM   1712  C  CA  . VAL A 1 233 ? 56.613  6.392   31.989 1.00 24.88 ? 886  VAL A CA  1 
ATOM   1713  C  C   . VAL A 1 233 ? 57.729  6.900   31.071 1.00 26.00 ? 886  VAL A C   1 
ATOM   1714  O  O   . VAL A 1 233 ? 57.876  6.447   29.936 1.00 26.40 ? 886  VAL A O   1 
ATOM   1715  C  CB  . VAL A 1 233 ? 55.582  7.506   32.198 1.00 29.37 ? 886  VAL A CB  1 
ATOM   1716  C  CG1 . VAL A 1 233 ? 55.139  8.093   30.826 1.00 28.55 ? 886  VAL A CG1 1 
ATOM   1717  C  CG2 . VAL A 1 233 ? 54.382  6.938   32.944 1.00 26.51 ? 886  VAL A CG2 1 
ATOM   1718  N  N   . ILE A 1 234 ? 58.525  7.838   31.569 1.00 26.13 ? 887  ILE A N   1 
ATOM   1719  C  CA  . ILE A 1 234 ? 59.658  8.339   30.809 1.00 26.65 ? 887  ILE A CA  1 
ATOM   1720  C  C   . ILE A 1 234 ? 60.570  7.175   30.336 1.00 28.68 ? 887  ILE A C   1 
ATOM   1721  O  O   . ILE A 1 234 ? 60.939  7.095   29.139 1.00 27.63 ? 887  ILE A O   1 
ATOM   1722  C  CB  . ILE A 1 234 ? 60.491  9.380   31.681 1.00 27.97 ? 887  ILE A CB  1 
ATOM   1723  C  CG1 . ILE A 1 234 ? 59.622  10.617  31.980 1.00 29.58 ? 887  ILE A CG1 1 
ATOM   1724  C  CG2 . ILE A 1 234 ? 61.746  9.827   30.964 1.00 24.07 ? 887  ILE A CG2 1 
ATOM   1725  C  CD1 . ILE A 1 234 ? 60.275  11.695  32.843 1.00 29.81 ? 887  ILE A CD1 1 
ATOM   1726  N  N   . GLU A 1 235 ? 60.927  6.270   31.260 1.00 28.64 ? 888  GLU A N   1 
ATOM   1727  C  CA  . GLU A 1 235 ? 61.817  5.147   30.921 1.00 30.12 ? 888  GLU A CA  1 
ATOM   1728  C  C   . GLU A 1 235 ? 61.248  4.233   29.816 1.00 32.53 ? 888  GLU A C   1 
ATOM   1729  O  O   . GLU A 1 235 ? 62.007  3.717   28.996 1.00 33.30 ? 888  GLU A O   1 
ATOM   1730  C  CB  . GLU A 1 235 ? 62.123  4.320   32.167 1.00 30.29 ? 888  GLU A CB  1 
ATOM   1731  C  CG  . GLU A 1 235 ? 63.099  4.929   33.144 1.00 32.90 ? 888  GLU A CG  1 
ATOM   1732  C  CD  . GLU A 1 235 ? 64.484  5.096   32.541 1.00 36.52 ? 888  GLU A CD  1 
ATOM   1733  O  OE1 . GLU A 1 235 ? 64.795  6.211   32.071 1.00 37.99 ? 888  GLU A OE1 1 
ATOM   1734  O  OE2 . GLU A 1 235 ? 65.261  4.109   32.511 1.00 38.67 ? 888  GLU A OE2 1 
ATOM   1735  N  N   . ALA A 1 236 ? 59.926  4.028   29.810 1.00 31.71 ? 889  ALA A N   1 
ATOM   1736  C  CA  . ALA A 1 236 ? 59.284  3.213   28.769 1.00 32.03 ? 889  ALA A CA  1 
ATOM   1737  C  C   . ALA A 1 236 ? 59.270  3.990   27.456 1.00 31.52 ? 889  ALA A C   1 
ATOM   1738  O  O   . ALA A 1 236 ? 59.634  3.449   26.431 1.00 31.82 ? 889  ALA A O   1 
ATOM   1739  C  CB  . ALA A 1 236 ? 57.845  2.842   29.160 1.00 30.49 ? 889  ALA A CB  1 
ATOM   1740  N  N   . ILE A 1 237 ? 58.855  5.261   27.489 1.00 31.07 ? 890  ILE A N   1 
ATOM   1741  C  CA  . ILE A 1 237 ? 58.844  6.045   26.272 1.00 27.02 ? 890  ILE A CA  1 
ATOM   1742  C  C   . ILE A 1 237 ? 60.235  6.145   25.635 1.00 28.69 ? 890  ILE A C   1 
ATOM   1743  O  O   . ILE A 1 237 ? 60.361  5.931   24.438 1.00 30.71 ? 890  ILE A O   1 
ATOM   1744  C  CB  . ILE A 1 237 ? 58.239  7.459   26.495 1.00 26.66 ? 890  ILE A CB  1 
ATOM   1745  C  CG1 . ILE A 1 237 ? 56.745  7.342   26.789 1.00 24.93 ? 890  ILE A CG1 1 
ATOM   1746  C  CG2 . ILE A 1 237 ? 58.468  8.363   25.232 1.00 22.05 ? 890  ILE A CG2 1 
ATOM   1747  C  CD1 . ILE A 1 237 ? 56.117  8.611   27.255 1.00 27.09 ? 890  ILE A CD1 1 
ATOM   1748  N  N   . LEU A 1 238 ? 61.281  6.436   26.397 1.00 27.85 ? 891  LEU A N   1 
ATOM   1749  C  CA  . LEU A 1 238 ? 62.604  6.525   25.783 1.00 28.39 ? 891  LEU A CA  1 
ATOM   1750  C  C   . LEU A 1 238 ? 63.137  5.205   25.258 1.00 28.20 ? 891  LEU A C   1 
ATOM   1751  O  O   . LEU A 1 238 ? 63.979  5.187   24.359 1.00 25.79 ? 891  LEU A O   1 
ATOM   1752  C  CB  . LEU A 1 238 ? 63.635  7.143   26.749 1.00 27.60 ? 891  LEU A CB  1 
ATOM   1753  C  CG  . LEU A 1 238 ? 63.360  8.632   26.931 1.00 29.17 ? 891  LEU A CG  1 
ATOM   1754  C  CD1 . LEU A 1 238 ? 64.188  9.127   28.053 1.00 33.10 ? 891  LEU A CD1 1 
ATOM   1755  C  CD2 . LEU A 1 238 ? 63.658  9.416   25.676 1.00 28.48 ? 891  LEU A CD2 1 
ATOM   1756  N  N   . ALA A 1 239 ? 62.647  4.102   25.819 1.00 30.08 ? 892  ALA A N   1 
ATOM   1757  C  CA  . ALA A 1 239 ? 63.090  2.761   25.403 1.00 29.02 ? 892  ALA A CA  1 
ATOM   1758  C  C   . ALA A 1 239 ? 62.661  2.477   23.967 1.00 28.99 ? 892  ALA A C   1 
ATOM   1759  O  O   . ALA A 1 239 ? 63.164  1.553   23.320 1.00 26.54 ? 892  ALA A O   1 
ATOM   1760  C  CB  . ALA A 1 239 ? 62.507  1.681   26.343 1.00 31.22 ? 892  ALA A CB  1 
ATOM   1761  N  N   . THR A 1 240 ? 61.750  3.296   23.459 1.00 27.18 ? 893  THR A N   1 
ATOM   1762  C  CA  . THR A 1 240 ? 61.287  3.085   22.102 1.00 25.95 ? 893  THR A CA  1 
ATOM   1763  C  C   . THR A 1 240 ? 62.209  3.677   21.019 1.00 28.89 ? 893  THR A C   1 
ATOM   1764  O  O   . THR A 1 240 ? 61.949  3.501   19.842 1.00 26.50 ? 893  THR A O   1 
ATOM   1765  C  CB  . THR A 1 240 ? 59.833  3.599   21.933 1.00 26.96 ? 893  THR A CB  1 
ATOM   1766  O  OG1 . THR A 1 240 ? 59.775  5.011   22.168 1.00 24.39 ? 893  THR A OG1 1 
ATOM   1767  C  CG2 . THR A 1 240 ? 58.882  2.869   22.909 1.00 23.60 ? 893  THR A CG2 1 
ATOM   1768  N  N   . ASP A 1 241 ? 63.284  4.384   21.387 1.00 30.15 ? 894  ASP A N   1 
ATOM   1769  C  CA  . ASP A 1 241 ? 64.174  4.898   20.348 1.00 29.84 ? 894  ASP A CA  1 
ATOM   1770  C  C   . ASP A 1 241 ? 64.926  3.706   19.757 1.00 33.46 ? 894  ASP A C   1 
ATOM   1771  O  O   . ASP A 1 241 ? 65.759  3.089   20.436 1.00 33.63 ? 894  ASP A O   1 
ATOM   1772  C  CB  . ASP A 1 241 ? 65.196  5.885   20.886 1.00 30.49 ? 894  ASP A CB  1 
ATOM   1773  C  CG  . ASP A 1 241 ? 66.190  6.320   19.815 1.00 33.12 ? 894  ASP A CG  1 
ATOM   1774  O  OD1 . ASP A 1 241 ? 66.162  5.762   18.701 1.00 34.90 ? 894  ASP A OD1 1 
ATOM   1775  O  OD2 . ASP A 1 241 ? 67.002  7.222   20.068 1.00 36.20 ? 894  ASP A OD2 1 
ATOM   1776  N  N   . LEU A 1 242 ? 64.651  3.378   18.498 1.00 34.57 ? 895  LEU A N   1 
ATOM   1777  C  CA  . LEU A 1 242 ? 65.321  2.243   17.867 1.00 36.14 ? 895  LEU A CA  1 
ATOM   1778  C  C   . LEU A 1 242 ? 66.845  2.280   17.888 1.00 38.45 ? 895  LEU A C   1 
ATOM   1779  O  O   . LEU A 1 242 ? 67.493  1.239   17.803 1.00 36.70 ? 895  LEU A O   1 
ATOM   1780  C  CB  . LEU A 1 242 ? 64.801  2.052   16.432 1.00 36.77 ? 895  LEU A CB  1 
ATOM   1781  C  CG  . LEU A 1 242 ? 63.365  1.482   16.475 1.00 34.89 ? 895  LEU A CG  1 
ATOM   1782  C  CD1 . LEU A 1 242 ? 62.849  1.283   15.093 1.00 33.54 ? 895  LEU A CD1 1 
ATOM   1783  C  CD2 . LEU A 1 242 ? 63.360  0.164   17.268 1.00 31.55 ? 895  LEU A CD2 1 
ATOM   1784  N  N   . LYS A 1 243 ? 67.417  3.470   18.034 1.00 40.37 ? 896  LYS A N   1 
ATOM   1785  C  CA  . LYS A 1 243 ? 68.868  3.605   18.101 1.00 41.95 ? 896  LYS A CA  1 
ATOM   1786  C  C   . LYS A 1 243 ? 69.470  2.751   19.252 1.00 41.83 ? 896  LYS A C   1 
ATOM   1787  O  O   . LYS A 1 243 ? 70.588  2.251   19.148 1.00 39.32 ? 896  LYS A O   1 
ATOM   1788  C  CB  . LYS A 1 243 ? 69.227  5.076   18.293 1.00 45.48 ? 896  LYS A CB  1 
ATOM   1789  C  CG  . LYS A 1 243 ? 70.714  5.386   18.178 1.00 51.30 ? 896  LYS A CG  1 
ATOM   1790  C  CD  . LYS A 1 243 ? 70.949  6.868   17.852 1.00 55.52 ? 896  LYS A CD  1 
ATOM   1791  C  CE  . LYS A 1 243 ? 70.272  7.280   16.517 1.00 58.51 ? 896  LYS A CE  1 
ATOM   1792  N  NZ  . LYS A 1 243 ? 70.496  8.727   16.147 1.00 60.71 ? 896  LYS A NZ  1 
ATOM   1793  N  N   . LYS A 1 244 ? 68.713  2.575   20.331 1.00 41.41 ? 897  LYS A N   1 
ATOM   1794  C  CA  . LYS A 1 244 ? 69.177  1.807   21.480 1.00 41.46 ? 897  LYS A CA  1 
ATOM   1795  C  C   . LYS A 1 244 ? 68.637  0.389   21.462 1.00 40.09 ? 897  LYS A C   1 
ATOM   1796  O  O   . LYS A 1 244 ? 68.750  -0.366  22.436 1.00 37.43 ? 897  LYS A O   1 
ATOM   1797  C  CB  . LYS A 1 244 ? 68.742  2.502   22.783 1.00 43.14 ? 897  LYS A CB  1 
ATOM   1798  C  CG  . LYS A 1 244 ? 69.490  3.784   23.075 1.00 45.11 ? 897  LYS A CG  1 
ATOM   1799  C  CD  . LYS A 1 244 ? 68.563  4.995   23.043 1.00 48.56 ? 897  LYS A CD  1 
ATOM   1800  C  CE  . LYS A 1 244 ? 67.940  5.316   24.424 1.00 49.68 ? 897  LYS A CE  1 
ATOM   1801  N  NZ  . LYS A 1 244 ? 67.028  6.555   24.407 1.00 46.96 ? 897  LYS A NZ  1 
ATOM   1802  N  N   . HIS A 1 245 ? 68.041  0.032   20.333 1.00 40.25 ? 898  HIS A N   1 
ATOM   1803  C  CA  . HIS A 1 245 ? 67.441  -1.284  20.195 1.00 38.30 ? 898  HIS A CA  1 
ATOM   1804  C  C   . HIS A 1 245 ? 68.393  -2.418  20.545 1.00 38.07 ? 898  HIS A C   1 
ATOM   1805  O  O   . HIS A 1 245 ? 68.019  -3.319  21.284 1.00 38.37 ? 898  HIS A O   1 
ATOM   1806  C  CB  . HIS A 1 245 ? 66.905  -1.471  18.781 1.00 38.26 ? 898  HIS A CB  1 
ATOM   1807  C  CG  . HIS A 1 245 ? 66.433  -2.859  18.501 1.00 38.41 ? 898  HIS A CG  1 
ATOM   1808  N  ND1 . HIS A 1 245 ? 65.223  -3.339  18.957 1.00 36.94 ? 898  HIS A ND1 1 
ATOM   1809  C  CD2 . HIS A 1 245 ? 67.050  -3.901  17.893 1.00 37.07 ? 898  HIS A CD2 1 
ATOM   1810  C  CE1 . HIS A 1 245 ? 65.121  -4.619  18.649 1.00 35.93 ? 898  HIS A CE1 1 
ATOM   1811  N  NE2 . HIS A 1 245 ? 66.215  -4.984  18.007 1.00 37.41 ? 898  HIS A NE2 1 
ATOM   1812  N  N   . PHE A 1 246 ? 69.624  -2.381  20.044 1.00 38.33 ? 899  PHE A N   1 
ATOM   1813  C  CA  . PHE A 1 246 ? 70.558  -3.468  20.340 1.00 39.28 ? 899  PHE A CA  1 
ATOM   1814  C  C   . PHE A 1 246 ? 71.089  -3.485  21.771 1.00 40.63 ? 899  PHE A C   1 
ATOM   1815  O  O   . PHE A 1 246 ? 71.415  -4.554  22.284 1.00 42.40 ? 899  PHE A O   1 
ATOM   1816  C  CB  . PHE A 1 246 ? 71.729  -3.457  19.373 1.00 39.23 ? 899  PHE A CB  1 
ATOM   1817  C  CG  . PHE A 1 246 ? 71.326  -3.648  17.958 1.00 41.13 ? 899  PHE A CG  1 
ATOM   1818  C  CD1 . PHE A 1 246 ? 71.066  -2.552  17.146 1.00 40.61 ? 899  PHE A CD1 1 
ATOM   1819  C  CD2 . PHE A 1 246 ? 71.121  -4.933  17.446 1.00 41.81 ? 899  PHE A CD2 1 
ATOM   1820  C  CE1 . PHE A 1 246 ? 70.603  -2.729  15.847 1.00 40.28 ? 899  PHE A CE1 1 
ATOM   1821  C  CE2 . PHE A 1 246 ? 70.657  -5.118  16.145 1.00 41.66 ? 899  PHE A CE2 1 
ATOM   1822  C  CZ  . PHE A 1 246 ? 70.396  -4.013  15.344 1.00 39.61 ? 899  PHE A CZ  1 
ATOM   1823  N  N   . ASP A 1 247 ? 71.194  -2.331  22.422 1.00 39.86 ? 900  ASP A N   1 
ATOM   1824  C  CA  . ASP A 1 247 ? 71.675  -2.361  23.784 1.00 39.50 ? 900  ASP A CA  1 
ATOM   1825  C  C   . ASP A 1 247 ? 70.592  -3.010  24.603 1.00 40.44 ? 900  ASP A C   1 
ATOM   1826  O  O   . ASP A 1 247 ? 70.856  -3.898  25.393 1.00 42.30 ? 900  ASP A O   1 
ATOM   1827  C  CB  . ASP A 1 247 ? 71.950  -0.975  24.345 1.00 38.77 ? 900  ASP A CB  1 
ATOM   1828  C  CG  . ASP A 1 247 ? 72.935  -0.192  23.515 1.00 40.13 ? 900  ASP A CG  1 
ATOM   1829  O  OD1 . ASP A 1 247 ? 73.938  -0.767  23.083 1.00 41.40 ? 900  ASP A OD1 1 
ATOM   1830  O  OD2 . ASP A 1 247 ? 72.704  1.017   23.284 1.00 42.99 ? 900  ASP A OD2 1 
ATOM   1831  N  N   . PHE A 1 248 ? 69.355  -2.593  24.410 1.00 40.71 ? 901  PHE A N   1 
ATOM   1832  C  CA  . PHE A 1 248 ? 68.278  -3.188  25.191 1.00 41.50 ? 901  PHE A CA  1 
ATOM   1833  C  C   . PHE A 1 248 ? 68.140  -4.688  25.074 1.00 41.88 ? 901  PHE A C   1 
ATOM   1834  O  O   . PHE A 1 248 ? 67.946  -5.371  26.069 1.00 41.80 ? 901  PHE A O   1 
ATOM   1835  C  CB  . PHE A 1 248 ? 66.958  -2.548  24.830 1.00 39.80 ? 901  PHE A CB  1 
ATOM   1836  C  CG  . PHE A 1 248 ? 66.729  -1.255  25.517 1.00 40.40 ? 901  PHE A CG  1 
ATOM   1837  C  CD1 . PHE A 1 248 ? 66.653  -0.069  24.790 1.00 38.59 ? 901  PHE A CD1 1 
ATOM   1838  C  CD2 . PHE A 1 248 ? 66.535  -1.218  26.909 1.00 38.88 ? 901  PHE A CD2 1 
ATOM   1839  C  CE1 . PHE A 1 248 ? 66.383  1.128   25.434 1.00 37.32 ? 901  PHE A CE1 1 
ATOM   1840  C  CE2 . PHE A 1 248 ? 66.262  -0.018  27.556 1.00 36.80 ? 901  PHE A CE2 1 
ATOM   1841  C  CZ  . PHE A 1 248 ? 66.183  1.155   26.824 1.00 36.89 ? 901  PHE A CZ  1 
ATOM   1842  N  N   . LEU A 1 249 ? 68.210  -5.187  23.848 1.00 43.74 ? 902  LEU A N   1 
ATOM   1843  C  CA  . LEU A 1 249 ? 68.106  -6.621  23.589 1.00 45.81 ? 902  LEU A CA  1 
ATOM   1844  C  C   . LEU A 1 249 ? 69.234  -7.362  24.315 1.00 46.35 ? 902  LEU A C   1 
ATOM   1845  O  O   . LEU A 1 249 ? 69.023  -8.403  24.953 1.00 46.06 ? 902  LEU A O   1 
ATOM   1846  C  CB  . LEU A 1 249 ? 68.211  -6.865  22.085 1.00 46.92 ? 902  LEU A CB  1 
ATOM   1847  C  CG  . LEU A 1 249 ? 68.202  -8.294  21.563 1.00 47.65 ? 902  LEU A CG  1 
ATOM   1848  C  CD1 . LEU A 1 249 ? 66.932  -9.022  22.017 1.00 48.97 ? 902  LEU A CD1 1 
ATOM   1849  C  CD2 . LEU A 1 249 ? 68.273  -8.251  20.048 1.00 47.17 ? 902  LEU A CD2 1 
ATOM   1850  N  N   . ALA A 1 250 ? 70.440  -6.812  24.212 1.00 46.33 ? 903  ALA A N   1 
ATOM   1851  C  CA  . ALA A 1 250 ? 71.588  -7.418  24.850 1.00 45.89 ? 903  ALA A CA  1 
ATOM   1852  C  C   . ALA A 1 250 ? 71.315  -7.577  26.341 1.00 47.01 ? 903  ALA A C   1 
ATOM   1853  O  O   . ALA A 1 250 ? 71.427  -8.679  26.894 1.00 48.99 ? 903  ALA A O   1 
ATOM   1854  C  CB  . ALA A 1 250 ? 72.810  -6.566  24.616 1.00 42.64 ? 903  ALA A CB  1 
ATOM   1855  N  N   . GLU A 1 251 ? 70.939  -6.482  26.993 1.00 47.70 ? 904  GLU A N   1 
ATOM   1856  C  CA  . GLU A 1 251 ? 70.661  -6.510  28.426 1.00 48.88 ? 904  GLU A CA  1 
ATOM   1857  C  C   . GLU A 1 251 ? 69.623  -7.562  28.769 1.00 47.23 ? 904  GLU A C   1 
ATOM   1858  O  O   . GLU A 1 251 ? 69.863  -8.443  29.588 1.00 47.47 ? 904  GLU A O   1 
ATOM   1859  C  CB  . GLU A 1 251 ? 70.171  -5.139  28.919 1.00 51.49 ? 904  GLU A CB  1 
ATOM   1860  C  CG  . GLU A 1 251 ? 71.189  -4.005  28.763 1.00 57.22 ? 904  GLU A CG  1 
ATOM   1861  C  CD  . GLU A 1 251 ? 70.648  -2.625  29.179 1.00 61.28 ? 904  GLU A CD  1 
ATOM   1862  O  OE1 . GLU A 1 251 ? 71.260  -1.587  28.782 1.00 62.99 ? 904  GLU A OE1 1 
ATOM   1863  O  OE2 . GLU A 1 251 ? 69.615  -2.567  29.904 1.00 63.28 ? 904  GLU A OE2 1 
ATOM   1864  N  N   . PHE A 1 252 ? 68.463  -7.470  28.139 1.00 45.22 ? 905  PHE A N   1 
ATOM   1865  C  CA  . PHE A 1 252 ? 67.404  -8.424  28.410 1.00 43.97 ? 905  PHE A CA  1 
ATOM   1866  C  C   . PHE A 1 252 ? 67.939  -9.845  28.242 1.00 43.13 ? 905  PHE A C   1 
ATOM   1867  O  O   . PHE A 1 252 ? 67.735  -10.700 29.098 1.00 42.06 ? 905  PHE A O   1 
ATOM   1868  C  CB  . PHE A 1 252 ? 66.233  -8.192  27.455 1.00 41.44 ? 905  PHE A CB  1 
ATOM   1869  C  CG  . PHE A 1 252 ? 65.067  -9.123  27.671 1.00 40.77 ? 905  PHE A CG  1 
ATOM   1870  C  CD1 . PHE A 1 252 ? 64.243  -8.979  28.785 1.00 38.91 ? 905  PHE A CD1 1 
ATOM   1871  C  CD2 . PHE A 1 252 ? 64.784  -10.143 26.751 1.00 39.82 ? 905  PHE A CD2 1 
ATOM   1872  C  CE1 . PHE A 1 252 ? 63.145  -9.817  28.982 1.00 38.01 ? 905  PHE A CE1 1 
ATOM   1873  C  CE2 . PHE A 1 252 ? 63.683  -10.988 26.941 1.00 39.63 ? 905  PHE A CE2 1 
ATOM   1874  C  CZ  . PHE A 1 252 ? 62.862  -10.827 28.066 1.00 38.81 ? 905  PHE A CZ  1 
ATOM   1875  N  N   . ASN A 1 253 ? 68.623  -10.083 27.132 1.00 43.55 ? 906  ASN A N   1 
ATOM   1876  C  CA  . ASN A 1 253 ? 69.167  -11.405 26.868 1.00 45.20 ? 906  ASN A CA  1 
ATOM   1877  C  C   . ASN A 1 253 ? 70.088  -11.853 27.988 1.00 45.88 ? 906  ASN A C   1 
ATOM   1878  O  O   . ASN A 1 253 ? 69.976  -12.977 28.478 1.00 46.49 ? 906  ASN A O   1 
ATOM   1879  C  CB  . ASN A 1 253 ? 69.924  -11.422 25.542 1.00 43.93 ? 906  ASN A CB  1 
ATOM   1880  C  CG  . ASN A 1 253 ? 69.042  -11.817 24.379 1.00 44.19 ? 906  ASN A CG  1 
ATOM   1881  O  OD1 . ASN A 1 253 ? 68.021  -12.509 24.551 1.00 42.82 ? 906  ASN A OD1 1 
ATOM   1882  N  ND2 . ASN A 1 253 ? 69.439  -11.404 23.177 1.00 44.76 ? 906  ASN A ND2 1 
ATOM   1883  N  N   . ALA A 1 254 ? 70.984  -10.961 28.396 1.00 45.63 ? 907  ALA A N   1 
ATOM   1884  C  CA  . ALA A 1 254 ? 71.923  -11.256 29.470 1.00 47.29 ? 907  ALA A CA  1 
ATOM   1885  C  C   . ALA A 1 254 ? 71.190  -11.608 30.762 1.00 48.83 ? 907  ALA A C   1 
ATOM   1886  O  O   . ALA A 1 254 ? 71.666  -12.415 31.550 1.00 49.63 ? 907  ALA A O   1 
ATOM   1887  C  CB  . ALA A 1 254 ? 72.844  -10.054 29.707 1.00 45.87 ? 907  ALA A CB  1 
ATOM   1888  N  N   . LYS A 1 255 ? 70.027  -11.001 30.974 1.00 50.27 ? 908  LYS A N   1 
ATOM   1889  C  CA  . LYS A 1 255 ? 69.241  -11.254 32.173 1.00 50.78 ? 908  LYS A CA  1 
ATOM   1890  C  C   . LYS A 1 255 ? 68.450  -12.556 32.241 1.00 51.52 ? 908  LYS A C   1 
ATOM   1891  O  O   . LYS A 1 255 ? 68.322  -13.148 33.316 1.00 51.19 ? 908  LYS A O   1 
ATOM   1892  C  CB  . LYS A 1 255 ? 68.267  -10.101 32.412 1.00 52.04 ? 908  LYS A CB  1 
ATOM   1893  C  CG  . LYS A 1 255 ? 68.792  -9.052  33.372 1.00 54.65 ? 908  LYS A CG  1 
ATOM   1894  C  CD  . LYS A 1 255 ? 69.153  -9.677  34.718 1.00 56.06 ? 908  LYS A CD  1 
ATOM   1895  C  CE  . LYS A 1 255 ? 70.100  -8.780  35.511 1.00 57.59 ? 908  LYS A CE  1 
ATOM   1896  N  NZ  . LYS A 1 255 ? 70.484  -9.380  36.838 1.00 59.90 ? 908  LYS A NZ  1 
ATOM   1897  N  N   . ALA A 1 256 ? 67.904  -13.017 31.119 1.00 52.69 ? 909  ALA A N   1 
ATOM   1898  C  CA  . ALA A 1 256 ? 67.087  -14.234 31.185 1.00 52.86 ? 909  ALA A CA  1 
ATOM   1899  C  C   . ALA A 1 256 ? 67.399  -15.339 30.209 1.00 52.87 ? 909  ALA A C   1 
ATOM   1900  O  O   . ALA A 1 256 ? 67.105  -16.500 30.481 1.00 53.46 ? 909  ALA A O   1 
ATOM   1901  C  CB  . ALA A 1 256 ? 65.627  -13.865 31.053 1.00 52.88 ? 909  ALA A CB  1 
ATOM   1902  N  N   . ASN A 1 257 ? 67.997  -14.996 29.080 1.00 53.72 ? 910  ASN A N   1 
ATOM   1903  C  CA  . ASN A 1 257 ? 68.268  -16.008 28.070 1.00 55.67 ? 910  ASN A CA  1 
ATOM   1904  C  C   . ASN A 1 257 ? 69.683  -16.563 28.012 1.00 56.87 ? 910  ASN A C   1 
ATOM   1905  O  O   . ASN A 1 257 ? 69.871  -17.744 27.743 1.00 56.65 ? 910  ASN A O   1 
ATOM   1906  C  CB  . ASN A 1 257 ? 67.888  -15.483 26.685 1.00 54.29 ? 910  ASN A CB  1 
ATOM   1907  C  CG  . ASN A 1 257 ? 66.426  -15.077 26.590 1.00 55.91 ? 910  ASN A CG  1 
ATOM   1908  O  OD1 . ASN A 1 257 ? 65.534  -15.805 27.052 1.00 57.43 ? 910  ASN A OD1 1 
ATOM   1909  N  ND2 . ASN A 1 257 ? 66.166  -13.916 25.974 1.00 55.23 ? 910  ASN A ND2 1 
ATOM   1910  N  N   . ASP A 1 258 ? 70.675  -15.715 28.242 1.00 58.94 ? 911  ASP A N   1 
ATOM   1911  C  CA  . ASP A 1 258 ? 72.054  -16.161 28.178 1.00 62.02 ? 911  ASP A CA  1 
ATOM   1912  C  C   . ASP A 1 258 ? 72.345  -17.224 29.247 1.00 64.33 ? 911  ASP A C   1 
ATOM   1913  O  O   . ASP A 1 258 ? 71.657  -17.295 30.282 1.00 63.15 ? 911  ASP A O   1 
ATOM   1914  C  CB  . ASP A 1 258 ? 72.997  -14.952 28.299 1.00 62.68 ? 911  ASP A CB  1 
ATOM   1915  C  CG  . ASP A 1 258 ? 72.912  -14.029 27.078 1.00 63.81 ? 911  ASP A CG  1 
ATOM   1916  O  OD1 . ASP A 1 258 ? 72.230  -14.403 26.089 1.00 64.38 ? 911  ASP A OD1 1 
ATOM   1917  O  OD2 . ASP A 1 258 ? 73.525  -12.937 27.088 1.00 63.95 ? 911  ASP A OD2 1 
ATOM   1918  N  N   . VAL A 1 259 ? 73.341  -18.073 28.980 1.00 66.53 ? 912  VAL A N   1 
ATOM   1919  C  CA  . VAL A 1 259 ? 73.675  -19.122 29.940 1.00 68.44 ? 912  VAL A CA  1 
ATOM   1920  C  C   . VAL A 1 259 ? 74.261  -18.446 31.164 1.00 69.75 ? 912  VAL A C   1 
ATOM   1921  O  O   . VAL A 1 259 ? 74.704  -17.286 31.093 1.00 69.89 ? 912  VAL A O   1 
ATOM   1922  C  CB  . VAL A 1 259 ? 74.696  -20.129 29.376 1.00 69.24 ? 912  VAL A CB  1 
ATOM   1923  C  CG1 . VAL A 1 259 ? 74.733  -21.373 30.274 1.00 69.02 ? 912  VAL A CG1 1 
ATOM   1924  C  CG2 . VAL A 1 259 ? 74.334  -20.502 27.933 1.00 68.76 ? 912  VAL A CG2 1 
ATOM   1925  N  N   . ASN A 1 260 ? 74.253  -19.157 32.286 1.00 70.51 ? 913  ASN A N   1 
ATOM   1926  C  CA  . ASN A 1 260 ? 74.771  -18.596 33.529 1.00 71.77 ? 913  ASN A CA  1 
ATOM   1927  C  C   . ASN A 1 260 ? 73.732  -17.687 34.175 1.00 71.94 ? 913  ASN A C   1 
ATOM   1928  O  O   . ASN A 1 260 ? 73.397  -17.869 35.355 1.00 72.95 ? 913  ASN A O   1 
ATOM   1929  C  CB  . ASN A 1 260 ? 76.029  -17.768 33.274 1.00 72.82 ? 913  ASN A CB  1 
ATOM   1930  C  CG  . ASN A 1 260 ? 77.045  -18.507 32.442 1.00 74.20 ? 913  ASN A CG  1 
ATOM   1931  O  OD1 . ASN A 1 260 ? 77.488  -19.605 32.811 1.00 73.59 ? 913  ASN A OD1 1 
ATOM   1932  N  ND2 . ASN A 1 260 ? 77.427  -17.914 31.306 1.00 74.60 ? 913  ASN A ND2 1 
ATOM   1933  N  N   . SER A 1 261 ? 73.241  -16.704 33.409 1.00 70.58 ? 914  SER A N   1 
ATOM   1934  C  CA  . SER A 1 261 ? 72.239  -15.757 33.909 1.00 68.70 ? 914  SER A CA  1 
ATOM   1935  C  C   . SER A 1 261 ? 71.256  -16.479 34.818 1.00 66.98 ? 914  SER A C   1 
ATOM   1936  O  O   . SER A 1 261 ? 70.723  -17.538 34.466 1.00 66.11 ? 914  SER A O   1 
ATOM   1937  C  CB  . SER A 1 261 ? 71.480  -15.095 32.745 1.00 69.13 ? 914  SER A CB  1 
ATOM   1938  O  OG  . SER A 1 261 ? 70.641  -16.021 32.068 1.00 68.83 ? 914  SER A OG  1 
ATOM   1939  N  N   . ASN A 1 262 ? 71.033  -15.903 35.995 1.00 65.75 ? 915  ASN A N   1 
ATOM   1940  C  CA  . ASN A 1 262 ? 70.122  -16.484 36.977 1.00 65.01 ? 915  ASN A CA  1 
ATOM   1941  C  C   . ASN A 1 262 ? 68.688  -16.387 36.483 1.00 63.38 ? 915  ASN A C   1 
ATOM   1942  O  O   . ASN A 1 262 ? 67.828  -17.142 36.929 1.00 63.97 ? 915  ASN A O   1 
ATOM   1943  C  CB  . ASN A 1 262 ? 70.222  -15.731 38.312 1.00 67.15 ? 915  ASN A CB  1 
ATOM   1944  C  CG  . ASN A 1 262 ? 71.597  -15.122 38.540 1.00 68.82 ? 915  ASN A CG  1 
ATOM   1945  O  OD1 . ASN A 1 262 ? 72.608  -15.842 38.637 1.00 68.85 ? 915  ASN A OD1 1 
ATOM   1946  N  ND2 . ASN A 1 262 ? 71.645  -13.782 38.621 1.00 68.35 ? 915  ASN A ND2 1 
ATOM   1947  N  N   . GLY A 1 263 ? 68.436  -15.446 35.575 1.00 61.43 ? 916  GLY A N   1 
ATOM   1948  C  CA  . GLY A 1 263 ? 67.095  -15.247 35.064 1.00 58.85 ? 916  GLY A CA  1 
ATOM   1949  C  C   . GLY A 1 263 ? 66.471  -13.950 35.570 1.00 57.73 ? 916  GLY A C   1 
ATOM   1950  O  O   . GLY A 1 263 ? 67.146  -13.113 36.178 1.00 58.47 ? 916  GLY A O   1 
ATOM   1951  N  N   . ILE A 1 264 ? 65.179  -13.774 35.314 1.00 55.43 ? 917  ILE A N   1 
ATOM   1952  C  CA  . ILE A 1 264 ? 64.479  -12.574 35.740 1.00 54.01 ? 917  ILE A CA  1 
ATOM   1953  C  C   . ILE A 1 264 ? 64.066  -12.692 37.199 1.00 54.73 ? 917  ILE A C   1 
ATOM   1954  O  O   . ILE A 1 264 ? 63.448  -13.681 37.577 1.00 54.29 ? 917  ILE A O   1 
ATOM   1955  C  CB  . ILE A 1 264 ? 63.162  -12.339 34.924 1.00 53.40 ? 917  ILE A CB  1 
ATOM   1956  C  CG1 . ILE A 1 264 ? 63.455  -12.072 33.440 1.00 53.14 ? 917  ILE A CG1 1 
ATOM   1957  C  CG2 . ILE A 1 264 ? 62.385  -11.188 35.525 1.00 51.79 ? 917  ILE A CG2 1 
ATOM   1958  C  CD1 . ILE A 1 264 ? 64.407  -10.906 33.182 1.00 53.24 ? 917  ILE A CD1 1 
ATOM   1959  N  N   . GLU A 1 265 ? 64.405  -11.698 38.019 1.00 54.71 ? 918  GLU A N   1 
ATOM   1960  C  CA  . GLU A 1 265 ? 63.988  -11.704 39.420 1.00 55.14 ? 918  GLU A CA  1 
ATOM   1961  C  C   . GLU A 1 265 ? 62.790  -10.768 39.493 1.00 54.25 ? 918  GLU A C   1 
ATOM   1962  O  O   . GLU A 1 265 ? 62.953  -9.550  39.445 1.00 54.22 ? 918  GLU A O   1 
ATOM   1963  C  CB  . GLU A 1 265 ? 65.060  -11.133 40.341 1.00 58.26 ? 918  GLU A CB  1 
ATOM   1964  C  CG  . GLU A 1 265 ? 65.825  -12.139 41.175 1.00 63.32 ? 918  GLU A CG  1 
ATOM   1965  C  CD  . GLU A 1 265 ? 67.161  -12.513 40.530 1.00 67.10 ? 918  GLU A CD  1 
ATOM   1966  O  OE1 . GLU A 1 265 ? 67.843  -11.603 39.973 1.00 69.23 ? 918  GLU A OE1 1 
ATOM   1967  O  OE2 . GLU A 1 265 ? 67.540  -13.710 40.584 1.00 69.54 ? 918  GLU A OE2 1 
ATOM   1968  N  N   . TRP A 1 266 ? 61.594  -11.321 39.620 1.00 52.60 ? 919  TRP A N   1 
ATOM   1969  C  CA  . TRP A 1 266 ? 60.416  -10.485 39.684 1.00 51.20 ? 919  TRP A CA  1 
ATOM   1970  C  C   . TRP A 1 266 ? 60.357  -9.592  40.904 1.00 50.72 ? 919  TRP A C   1 
ATOM   1971  O  O   . TRP A 1 266 ? 59.542  -8.664  40.950 1.00 51.83 ? 919  TRP A O   1 
ATOM   1972  C  CB  . TRP A 1 266 ? 59.153  -11.334 39.599 1.00 51.36 ? 919  TRP A CB  1 
ATOM   1973  C  CG  . TRP A 1 266 ? 59.070  -12.073 38.306 1.00 51.81 ? 919  TRP A CG  1 
ATOM   1974  C  CD1 . TRP A 1 266 ? 59.373  -13.381 38.099 1.00 51.43 ? 919  TRP A CD1 1 
ATOM   1975  C  CD2 . TRP A 1 266 ? 58.804  -11.510 37.010 1.00 51.86 ? 919  TRP A CD2 1 
ATOM   1976  N  NE1 . TRP A 1 266 ? 59.329  -13.673 36.760 1.00 52.91 ? 919  TRP A NE1 1 
ATOM   1977  C  CE2 . TRP A 1 266 ? 58.985  -12.543 36.065 1.00 53.00 ? 919  TRP A CE2 1 
ATOM   1978  C  CE3 . TRP A 1 266 ? 58.439  -10.235 36.555 1.00 51.61 ? 919  TRP A CE3 1 
ATOM   1979  C  CZ2 . TRP A 1 266 ? 58.819  -12.338 34.679 1.00 52.26 ? 919  TRP A CZ2 1 
ATOM   1980  C  CZ3 . TRP A 1 266 ? 58.273  -10.031 35.177 1.00 50.57 ? 919  TRP A CZ3 1 
ATOM   1981  C  CH2 . TRP A 1 266 ? 58.466  -11.078 34.260 1.00 51.04 ? 919  TRP A CH2 1 
ATOM   1982  N  N   . SER A 1 267 ? 61.208  -9.845  41.899 1.00 49.08 ? 920  SER A N   1 
ATOM   1983  C  CA  . SER A 1 267 ? 61.191  -8.998  43.101 1.00 46.35 ? 920  SER A CA  1 
ATOM   1984  C  C   . SER A 1 267 ? 62.180  -7.858  42.931 1.00 44.61 ? 920  SER A C   1 
ATOM   1985  O  O   . SER A 1 267 ? 62.282  -6.992  43.787 1.00 43.37 ? 920  SER A O   1 
ATOM   1986  C  CB  . SER A 1 267 ? 61.525  -9.806  44.363 1.00 44.42 ? 920  SER A CB  1 
ATOM   1987  O  OG  . SER A 1 267 ? 62.779  -10.460 44.238 1.00 46.40 ? 920  SER A OG  1 
ATOM   1988  N  N   . ASN A 1 268 ? 62.881  -7.855  41.802 1.00 44.02 ? 921  ASN A N   1 
ATOM   1989  C  CA  . ASN A 1 268 ? 63.870  -6.831  41.511 1.00 44.65 ? 921  ASN A CA  1 
ATOM   1990  C  C   . ASN A 1 268 ? 63.355  -5.720  40.566 1.00 44.32 ? 921  ASN A C   1 
ATOM   1991  O  O   . ASN A 1 268 ? 63.102  -5.961  39.389 1.00 44.55 ? 921  ASN A O   1 
ATOM   1992  C  CB  . ASN A 1 268 ? 65.096  -7.501  40.912 1.00 44.65 ? 921  ASN A CB  1 
ATOM   1993  C  CG  . ASN A 1 268 ? 66.227  -6.540  40.674 1.00 46.95 ? 921  ASN A CG  1 
ATOM   1994  O  OD1 . ASN A 1 268 ? 66.075  -5.539  39.981 1.00 48.95 ? 921  ASN A OD1 1 
ATOM   1995  N  ND2 . ASN A 1 268 ? 67.380  -6.842  41.242 1.00 47.95 ? 921  ASN A ND2 1 
ATOM   1996  N  N   . GLU A 1 269 ? 63.217  -4.520  41.125 1.00 45.30 ? 922  GLU A N   1 
ATOM   1997  C  CA  . GLU A 1 269 ? 62.763  -3.293  40.454 1.00 47.03 ? 922  GLU A CA  1 
ATOM   1998  C  C   . GLU A 1 269 ? 63.333  -3.102  39.040 1.00 45.80 ? 922  GLU A C   1 
ATOM   1999  O  O   . GLU A 1 269 ? 62.592  -2.837  38.096 1.00 45.28 ? 922  GLU A O   1 
ATOM   2000  C  CB  . GLU A 1 269 ? 63.169  -2.084  41.308 1.00 47.51 ? 922  GLU A CB  1 
ATOM   2001  C  CG  . GLU A 1 269 ? 62.046  -1.160  41.769 1.00 49.93 ? 922  GLU A CG  1 
ATOM   2002  C  CD  . GLU A 1 269 ? 62.542  -0.045  42.736 1.00 52.61 ? 922  GLU A CD  1 
ATOM   2003  O  OE1 . GLU A 1 269 ? 63.749  0.311   42.660 1.00 50.21 ? 922  GLU A OE1 1 
ATOM   2004  O  OE2 . GLU A 1 269 ? 61.724  0.478   43.552 1.00 52.77 ? 922  GLU A OE2 1 
ATOM   2005  N  N   . ASN A 1 270 ? 64.648  -3.233  38.905 1.00 45.45 ? 923  ASN A N   1 
ATOM   2006  C  CA  . ASN A 1 270 ? 65.310  -3.055  37.621 1.00 45.29 ? 923  ASN A CA  1 
ATOM   2007  C  C   . ASN A 1 270 ? 64.977  -4.166  36.622 1.00 44.31 ? 923  ASN A C   1 
ATOM   2008  O  O   . ASN A 1 270 ? 64.981  -3.955  35.413 1.00 43.27 ? 923  ASN A O   1 
ATOM   2009  C  CB  . ASN A 1 270 ? 66.831  -2.960  37.829 1.00 47.13 ? 923  ASN A CB  1 
ATOM   2010  C  CG  . ASN A 1 270 ? 67.239  -1.821  38.768 1.00 47.60 ? 923  ASN A CG  1 
ATOM   2011  O  OD1 . ASN A 1 270 ? 68.403  -1.702  39.137 1.00 49.97 ? 923  ASN A OD1 1 
ATOM   2012  N  ND2 . ASN A 1 270 ? 66.286  -0.991  39.152 1.00 48.44 ? 923  ASN A ND2 1 
ATOM   2013  N  N   . ASP A 1 271 ? 64.698  -5.358  37.122 1.00 44.67 ? 924  ASP A N   1 
ATOM   2014  C  CA  . ASP A 1 271 ? 64.353  -6.462  36.241 1.00 44.53 ? 924  ASP A CA  1 
ATOM   2015  C  C   . ASP A 1 271 ? 62.954  -6.206  35.677 1.00 43.03 ? 924  ASP A C   1 
ATOM   2016  O  O   . ASP A 1 271 ? 62.734  -6.366  34.480 1.00 42.98 ? 924  ASP A O   1 
ATOM   2017  C  CB  . ASP A 1 271 ? 64.428  -7.798  37.008 1.00 48.25 ? 924  ASP A CB  1 
ATOM   2018  C  CG  . ASP A 1 271 ? 65.862  -8.387  37.050 1.00 50.76 ? 924  ASP A CG  1 
ATOM   2019  O  OD1 . ASP A 1 271 ? 66.839  -7.603  37.056 1.00 51.18 ? 924  ASP A OD1 1 
ATOM   2020  O  OD2 . ASP A 1 271 ? 66.018  -9.636  37.085 1.00 53.62 ? 924  ASP A OD2 1 
ATOM   2021  N  N   . ARG A 1 272 ? 62.026  -5.769  36.527 1.00 40.74 ? 925  ARG A N   1 
ATOM   2022  C  CA  . ARG A 1 272 ? 60.659  -5.478  36.096 1.00 39.51 ? 925  ARG A CA  1 
ATOM   2023  C  C   . ARG A 1 272 ? 60.623  -4.408  35.003 1.00 38.47 ? 925  ARG A C   1 
ATOM   2024  O  O   . ARG A 1 272 ? 60.003  -4.578  33.961 1.00 38.59 ? 925  ARG A O   1 
ATOM   2025  C  CB  . ARG A 1 272 ? 59.817  -4.998  37.278 1.00 42.22 ? 925  ARG A CB  1 
ATOM   2026  C  CG  . ARG A 1 272 ? 59.433  -6.078  38.282 1.00 41.59 ? 925  ARG A CG  1 
ATOM   2027  C  CD  . ARG A 1 272 ? 58.387  -5.583  39.263 1.00 43.45 ? 925  ARG A CD  1 
ATOM   2028  N  NE  . ARG A 1 272 ? 58.764  -5.973  40.603 1.00 46.84 ? 925  ARG A NE  1 
ATOM   2029  C  CZ  . ARG A 1 272 ? 59.177  -5.135  41.547 1.00 47.77 ? 925  ARG A CZ  1 
ATOM   2030  N  NH1 . ARG A 1 272 ? 59.247  -3.834  41.314 1.00 48.06 ? 925  ARG A NH1 1 
ATOM   2031  N  NH2 . ARG A 1 272 ? 59.589  -5.615  42.713 1.00 49.08 ? 925  ARG A NH2 1 
ATOM   2032  N  N   . LEU A 1 273 ? 61.301  -3.303  35.264 1.00 36.57 ? 926  LEU A N   1 
ATOM   2033  C  CA  . LEU A 1 273 ? 61.366  -2.204  34.335 1.00 34.93 ? 926  LEU A CA  1 
ATOM   2034  C  C   . LEU A 1 273 ? 61.862  -2.653  32.960 1.00 34.71 ? 926  LEU A C   1 
ATOM   2035  O  O   . LEU A 1 273 ? 61.266  -2.337  31.920 1.00 35.02 ? 926  LEU A O   1 
ATOM   2036  C  CB  . LEU A 1 273 ? 62.298  -1.111  34.891 1.00 31.44 ? 926  LEU A CB  1 
ATOM   2037  C  CG  . LEU A 1 273 ? 62.560  0.046   33.902 1.00 32.87 ? 926  LEU A CG  1 
ATOM   2038  C  CD1 . LEU A 1 273 ? 61.269  0.793   33.614 1.00 27.93 ? 926  LEU A CD1 1 
ATOM   2039  C  CD2 . LEU A 1 273 ? 63.627  0.986   34.446 1.00 30.32 ? 926  LEU A CD2 1 
ATOM   2040  N  N   . LEU A 1 274 ? 62.967  -3.382  32.979 1.00 33.67 ? 927  LEU A N   1 
ATOM   2041  C  CA  . LEU A 1 274 ? 63.604  -3.870  31.778 1.00 33.37 ? 927  LEU A CA  1 
ATOM   2042  C  C   . LEU A 1 274 ? 62.627  -4.704  30.984 1.00 34.41 ? 927  LEU A C   1 
ATOM   2043  O  O   . LEU A 1 274 ? 62.537  -4.576  29.755 1.00 32.87 ? 927  LEU A O   1 
ATOM   2044  C  CB  . LEU A 1 274 ? 64.825  -4.707  32.146 1.00 34.31 ? 927  LEU A CB  1 
ATOM   2045  C  CG  . LEU A 1 274 ? 65.534  -5.401  30.986 1.00 33.61 ? 927  LEU A CG  1 
ATOM   2046  C  CD1 . LEU A 1 274 ? 66.035  -4.368  30.000 1.00 33.86 ? 927  LEU A CD1 1 
ATOM   2047  C  CD2 . LEU A 1 274 ? 66.678  -6.215  31.523 1.00 35.36 ? 927  LEU A CD2 1 
ATOM   2048  N  N   . VAL A 1 275 ? 61.911  -5.573  31.697 1.00 33.69 ? 928  VAL A N   1 
ATOM   2049  C  CA  . VAL A 1 275 ? 60.917  -6.424  31.083 1.00 32.52 ? 928  VAL A CA  1 
ATOM   2050  C  C   . VAL A 1 275 ? 59.887  -5.515  30.453 1.00 33.05 ? 928  VAL A C   1 
ATOM   2051  O  O   . VAL A 1 275 ? 59.569  -5.643  29.279 1.00 34.19 ? 928  VAL A O   1 
ATOM   2052  C  CB  . VAL A 1 275 ? 60.248  -7.359  32.141 1.00 33.83 ? 928  VAL A CB  1 
ATOM   2053  C  CG1 . VAL A 1 275 ? 59.084  -8.138  31.503 1.00 30.94 ? 928  VAL A CG1 1 
ATOM   2054  C  CG2 . VAL A 1 275 ? 61.298  -8.349  32.698 1.00 32.57 ? 928  VAL A CG2 1 
ATOM   2055  N  N   . CYS A 1 276 ? 59.367  -4.579  31.227 1.00 33.13 ? 929  CYS A N   1 
ATOM   2056  C  CA  . CYS A 1 276 ? 58.367  -3.676  30.698 1.00 33.89 ? 929  CYS A CA  1 
ATOM   2057  C  C   . CYS A 1 276 ? 58.870  -2.934  29.459 1.00 34.96 ? 929  CYS A C   1 
ATOM   2058  O  O   . CYS A 1 276 ? 58.124  -2.773  28.484 1.00 34.31 ? 929  CYS A O   1 
ATOM   2059  C  CB  . CYS A 1 276 ? 57.954  -2.662  31.756 1.00 35.27 ? 929  CYS A CB  1 
ATOM   2060  S  SG  . CYS A 1 276 ? 56.917  -3.277  33.118 1.00 38.78 ? 929  CYS A SG  1 
ATOM   2061  N  N   . GLN A 1 277 ? 60.133  -2.493  29.488 1.00 34.42 ? 930  GLN A N   1 
ATOM   2062  C  CA  . GLN A 1 277 ? 60.684  -1.741  28.366 1.00 34.75 ? 930  GLN A CA  1 
ATOM   2063  C  C   . GLN A 1 277 ? 60.703  -2.555  27.098 1.00 35.29 ? 930  GLN A C   1 
ATOM   2064  O  O   . GLN A 1 277 ? 60.386  -2.058  26.012 1.00 36.45 ? 930  GLN A O   1 
ATOM   2065  C  CB  . GLN A 1 277 ? 62.098  -1.237  28.663 1.00 34.61 ? 930  GLN A CB  1 
ATOM   2066  C  CG  . GLN A 1 277 ? 62.135  -0.128  29.695 1.00 34.73 ? 930  GLN A CG  1 
ATOM   2067  C  CD  . GLN A 1 277 ? 63.542  0.195   30.142 1.00 34.21 ? 930  GLN A CD  1 
ATOM   2068  O  OE1 . GLN A 1 277 ? 64.282  -0.689  30.525 1.00 34.17 ? 930  GLN A OE1 1 
ATOM   2069  N  NE2 . GLN A 1 277 ? 63.910  1.461   30.097 1.00 34.03 ? 930  GLN A NE2 1 
ATOM   2070  N  N   . VAL A 1 278 ? 61.083  -3.811  27.256 1.00 36.19 ? 931  VAL A N   1 
ATOM   2071  C  CA  . VAL A 1 278 ? 61.155  -4.772  26.170 1.00 37.67 ? 931  VAL A CA  1 
ATOM   2072  C  C   . VAL A 1 278 ? 59.740  -5.008  25.658 1.00 37.55 ? 931  VAL A C   1 
ATOM   2073  O  O   . VAL A 1 278 ? 59.519  -5.130  24.464 1.00 36.56 ? 931  VAL A O   1 
ATOM   2074  C  CB  . VAL A 1 278 ? 61.766  -6.106  26.696 1.00 39.57 ? 931  VAL A CB  1 
ATOM   2075  C  CG1 . VAL A 1 278 ? 61.484  -7.248  25.735 1.00 39.59 ? 931  VAL A CG1 1 
ATOM   2076  C  CG2 . VAL A 1 278 ? 63.268  -5.925  26.891 1.00 38.81 ? 931  VAL A CG2 1 
ATOM   2077  N  N   . CYS A 1 279 ? 58.793  -5.049  26.588 1.00 37.34 ? 932  CYS A N   1 
ATOM   2078  C  CA  . CYS A 1 279 ? 57.406  -5.272  26.255 1.00 37.78 ? 932  CYS A CA  1 
ATOM   2079  C  C   . CYS A 1 279 ? 56.845  -4.149  25.372 1.00 38.13 ? 932  CYS A C   1 
ATOM   2080  O  O   . CYS A 1 279 ? 56.179  -4.414  24.374 1.00 37.56 ? 932  CYS A O   1 
ATOM   2081  C  CB  . CYS A 1 279 ? 56.586  -5.397  27.526 1.00 36.97 ? 932  CYS A CB  1 
ATOM   2082  S  SG  . CYS A 1 279 ? 54.908  -5.934  27.247 1.00 39.80 ? 932  CYS A SG  1 
ATOM   2083  N  N   . ILE A 1 280 ? 57.120  -2.899  25.720 1.00 36.44 ? 933  ILE A N   1 
ATOM   2084  C  CA  . ILE A 1 280 ? 56.605  -1.815  24.908 1.00 33.84 ? 933  ILE A CA  1 
ATOM   2085  C  C   . ILE A 1 280 ? 57.360  -1.787  23.577 1.00 33.13 ? 933  ILE A C   1 
ATOM   2086  O  O   . ILE A 1 280 ? 56.803  -1.412  22.553 1.00 32.14 ? 933  ILE A O   1 
ATOM   2087  C  CB  . ILE A 1 280 ? 56.671  -0.430  25.693 1.00 33.38 ? 933  ILE A CB  1 
ATOM   2088  C  CG1 . ILE A 1 280 ? 55.848  0.629   24.959 1.00 31.89 ? 933  ILE A CG1 1 
ATOM   2089  C  CG2 . ILE A 1 280 ? 58.104  0.027   25.889 1.00 28.70 ? 933  ILE A CG2 1 
ATOM   2090  C  CD1 . ILE A 1 280 ? 55.708  1.924   25.761 1.00 31.85 ? 933  ILE A CD1 1 
ATOM   2091  N  N   . LYS A 1 281 ? 58.620  -2.213  23.586 1.00 32.05 ? 934  LYS A N   1 
ATOM   2092  C  CA  . LYS A 1 281 ? 59.397  -2.221  22.356 1.00 31.92 ? 934  LYS A CA  1 
ATOM   2093  C  C   . LYS A 1 281 ? 58.790  -3.192  21.368 1.00 34.20 ? 934  LYS A C   1 
ATOM   2094  O  O   . LYS A 1 281 ? 58.697  -2.895  20.171 1.00 34.87 ? 934  LYS A O   1 
ATOM   2095  C  CB  . LYS A 1 281 ? 60.843  -2.616  22.595 1.00 30.65 ? 934  LYS A CB  1 
ATOM   2096  C  CG  . LYS A 1 281 ? 61.757  -1.440  22.828 1.00 30.58 ? 934  LYS A CG  1 
ATOM   2097  C  CD  . LYS A 1 281 ? 63.203  -1.876  22.978 1.00 28.65 ? 934  LYS A CD  1 
ATOM   2098  C  CE  . LYS A 1 281 ? 63.731  -2.589  21.746 1.00 27.56 ? 934  LYS A CE  1 
ATOM   2099  N  NZ  . LYS A 1 281 ? 63.742  -1.719  20.551 1.00 27.04 ? 934  LYS A NZ  1 
ATOM   2100  N  N   . LEU A 1 282 ? 58.391  -4.361  21.865 1.00 34.53 ? 935  LEU A N   1 
ATOM   2101  C  CA  . LEU A 1 282 ? 57.777  -5.368  21.025 1.00 34.33 ? 935  LEU A CA  1 
ATOM   2102  C  C   . LEU A 1 282 ? 56.431  -4.835  20.539 1.00 33.64 ? 935  LEU A C   1 
ATOM   2103  O  O   . LEU A 1 282 ? 56.142  -4.877  19.356 1.00 35.22 ? 935  LEU A O   1 
ATOM   2104  C  CB  . LEU A 1 282 ? 57.599  -6.658  21.813 1.00 35.54 ? 935  LEU A CB  1 
ATOM   2105  C  CG  . LEU A 1 282 ? 57.228  -7.908  21.010 1.00 37.14 ? 935  LEU A CG  1 
ATOM   2106  C  CD1 . LEU A 1 282 ? 57.706  -9.149  21.748 1.00 36.73 ? 935  LEU A CD1 1 
ATOM   2107  C  CD2 . LEU A 1 282 ? 55.733  -7.961  20.807 1.00 38.41 ? 935  LEU A CD2 1 
ATOM   2108  N  N   . ALA A 1 283 ? 55.615  -4.325  21.450 1.00 33.11 ? 936  ALA A N   1 
ATOM   2109  C  CA  . ALA A 1 283 ? 54.330  -3.771  21.067 1.00 33.62 ? 936  ALA A CA  1 
ATOM   2110  C  C   . ALA A 1 283 ? 54.469  -2.671  20.002 1.00 33.75 ? 936  ALA A C   1 
ATOM   2111  O  O   . ALA A 1 283 ? 53.741  -2.674  19.026 1.00 36.69 ? 936  ALA A O   1 
ATOM   2112  C  CB  . ALA A 1 283 ? 53.592  -3.236  22.306 1.00 32.37 ? 936  ALA A CB  1 
ATOM   2113  N  N   . ASP A 1 284 ? 55.412  -1.750  20.182 1.00 34.43 ? 937  ASP A N   1 
ATOM   2114  C  CA  . ASP A 1 284 ? 55.625  -0.648  19.254 1.00 32.70 ? 937  ASP A CA  1 
ATOM   2115  C  C   . ASP A 1 284 ? 55.893  -1.071  17.818 1.00 32.82 ? 937  ASP A C   1 
ATOM   2116  O  O   . ASP A 1 284 ? 55.553  -0.335  16.880 1.00 31.67 ? 937  ASP A O   1 
ATOM   2117  C  CB  . ASP A 1 284 ? 56.771  0.238   19.756 1.00 34.40 ? 937  ASP A CB  1 
ATOM   2118  C  CG  . ASP A 1 284 ? 56.913  1.552   18.967 1.00 34.60 ? 937  ASP A CG  1 
ATOM   2119  O  OD1 . ASP A 1 284 ? 55.899  2.275   18.728 1.00 32.52 ? 937  ASP A OD1 1 
ATOM   2120  O  OD2 . ASP A 1 284 ? 58.072  1.871   18.612 1.00 36.95 ? 937  ASP A OD2 1 
ATOM   2121  N  N   . ILE A 1 285 ? 56.534  -2.224  17.635 1.00 31.75 ? 938  ILE A N   1 
ATOM   2122  C  CA  . ILE A 1 285 ? 56.788  -2.725  16.286 1.00 31.41 ? 938  ILE A CA  1 
ATOM   2123  C  C   . ILE A 1 285 ? 56.053  -4.062  16.008 1.00 32.92 ? 938  ILE A C   1 
ATOM   2124  O  O   . ILE A 1 285 ? 56.534  -4.879  15.230 1.00 32.84 ? 938  ILE A O   1 
ATOM   2125  C  CB  . ILE A 1 285 ? 58.326  -2.894  15.985 1.00 29.36 ? 938  ILE A CB  1 
ATOM   2126  C  CG1 . ILE A 1 285 ? 58.992  -3.854  16.964 1.00 28.12 ? 938  ILE A CG1 1 
ATOM   2127  C  CG2 . ILE A 1 285 ? 59.027  -1.542  16.040 1.00 27.32 ? 938  ILE A CG2 1 
ATOM   2128  C  CD1 . ILE A 1 285 ? 60.462  -4.065  16.670 1.00 26.78 ? 938  ILE A CD1 1 
ATOM   2129  N  N   . ASN A 1 286 ? 54.881  -4.254  16.625 1.00 33.30 ? 939  ASN A N   1 
ATOM   2130  C  CA  . ASN A 1 286 ? 54.105  -5.508  16.503 1.00 34.85 ? 939  ASN A CA  1 
ATOM   2131  C  C   . ASN A 1 286 ? 53.529  -5.925  15.138 1.00 35.07 ? 939  ASN A C   1 
ATOM   2132  O  O   . ASN A 1 286 ? 53.198  -7.085  14.953 1.00 35.25 ? 939  ASN A O   1 
ATOM   2133  C  CB  . ASN A 1 286 ? 52.955  -5.530  17.530 1.00 33.87 ? 939  ASN A CB  1 
ATOM   2134  C  CG  . ASN A 1 286 ? 51.702  -4.872  17.020 1.00 34.05 ? 939  ASN A CG  1 
ATOM   2135  O  OD1 . ASN A 1 286 ? 51.125  -4.032  17.682 1.00 37.46 ? 939  ASN A OD1 1 
ATOM   2136  N  ND2 . ASN A 1 286 ? 51.262  -5.265  15.841 1.00 36.07 ? 939  ASN A ND2 1 
ATOM   2137  N  N   . GLY A 1 287 ? 53.396  -4.986  14.205 1.00 36.39 ? 940  GLY A N   1 
ATOM   2138  C  CA  . GLY A 1 287 ? 52.842  -5.298  12.907 1.00 35.98 ? 940  GLY A CA  1 
ATOM   2139  C  C   . GLY A 1 287 ? 53.075  -6.695  12.339 1.00 37.23 ? 940  GLY A C   1 
ATOM   2140  O  O   . GLY A 1 287 ? 52.114  -7.464  12.166 1.00 35.34 ? 940  GLY A O   1 
ATOM   2141  N  N   . PRO A 1 288 ? 54.343  -7.061  12.042 1.00 37.42 ? 941  PRO A N   1 
ATOM   2142  C  CA  . PRO A 1 288 ? 54.598  -8.384  11.482 1.00 35.79 ? 941  PRO A CA  1 
ATOM   2143  C  C   . PRO A 1 288 ? 54.256  -9.617  12.305 1.00 36.22 ? 941  PRO A C   1 
ATOM   2144  O  O   . PRO A 1 288 ? 54.368  -10.728 11.806 1.00 37.23 ? 941  PRO A O   1 
ATOM   2145  C  CB  . PRO A 1 288 ? 56.067  -8.305  11.051 1.00 35.44 ? 941  PRO A CB  1 
ATOM   2146  C  CG  . PRO A 1 288 ? 56.611  -7.220  11.799 1.00 35.82 ? 941  PRO A CG  1 
ATOM   2147  C  CD  . PRO A 1 288 ? 55.529  -6.205  11.886 1.00 35.96 ? 941  PRO A CD  1 
ATOM   2148  N  N   . ALA A 1 289 ? 53.815  -9.438  13.540 1.00 35.85 ? 942  ALA A N   1 
ATOM   2149  C  CA  . ALA A 1 289 ? 53.439  -10.572 14.362 1.00 35.11 ? 942  ALA A CA  1 
ATOM   2150  C  C   . ALA A 1 289 ? 51.926  -10.625 14.438 1.00 36.35 ? 942  ALA A C   1 
ATOM   2151  O  O   . ALA A 1 289 ? 51.367  -11.283 15.311 1.00 37.27 ? 942  ALA A O   1 
ATOM   2152  C  CB  . ALA A 1 289 ? 54.024  -10.434 15.741 1.00 34.83 ? 942  ALA A CB  1 
ATOM   2153  N  N   . LYS A 1 290 ? 51.271  -9.899  13.533 1.00 37.58 ? 943  LYS A N   1 
ATOM   2154  C  CA  . LYS A 1 290 ? 49.808  -9.868  13.443 1.00 38.94 ? 943  LYS A CA  1 
ATOM   2155  C  C   . LYS A 1 290 ? 49.361  -10.540 12.147 1.00 40.24 ? 943  LYS A C   1 
ATOM   2156  O  O   . LYS A 1 290 ? 50.159  -10.741 11.227 1.00 41.09 ? 943  LYS A O   1 
ATOM   2157  C  CB  . LYS A 1 290 ? 49.271  -8.432  13.466 1.00 38.67 ? 943  LYS A CB  1 
ATOM   2158  C  CG  . LYS A 1 290 ? 49.346  -7.725  14.821 1.00 39.56 ? 943  LYS A CG  1 
ATOM   2159  C  CD  . LYS A 1 290 ? 48.316  -8.245  15.801 1.00 40.05 ? 943  LYS A CD  1 
ATOM   2160  C  CE  . LYS A 1 290 ? 48.435  -7.508  17.144 1.00 41.92 ? 943  LYS A CE  1 
ATOM   2161  N  NZ  . LYS A 1 290 ? 48.164  -6.041  17.062 1.00 41.72 ? 943  LYS A NZ  1 
ATOM   2162  N  N   . VAL A 1 291 ? 48.086  -10.897 12.073 1.00 40.20 ? 944  VAL A N   1 
ATOM   2163  C  CA  . VAL A 1 291 ? 47.587  -11.530 10.867 1.00 40.17 ? 944  VAL A CA  1 
ATOM   2164  C  C   . VAL A 1 291 ? 47.912  -10.655 9.646  1.00 40.26 ? 944  VAL A C   1 
ATOM   2165  O  O   . VAL A 1 291 ? 47.814  -9.428  9.703  1.00 40.07 ? 944  VAL A O   1 
ATOM   2166  C  CB  . VAL A 1 291 ? 46.044  -11.801 10.967 1.00 40.59 ? 944  VAL A CB  1 
ATOM   2167  C  CG1 . VAL A 1 291 ? 45.254  -10.482 10.990 1.00 37.98 ? 944  VAL A CG1 1 
ATOM   2168  C  CG2 . VAL A 1 291 ? 45.610  -12.713 9.821  1.00 39.60 ? 944  VAL A CG2 1 
ATOM   2169  N  N   . ARG A 1 292 ? 48.320  -11.316 8.564  1.00 40.12 ? 945  ARG A N   1 
ATOM   2170  C  CA  . ARG A 1 292 ? 48.692  -10.711 7.284  1.00 38.63 ? 945  ARG A CA  1 
ATOM   2171  C  C   . ARG A 1 292 ? 47.934  -9.437  6.942  1.00 40.55 ? 945  ARG A C   1 
ATOM   2172  O  O   . ARG A 1 292 ? 48.500  -8.413  6.581  1.00 41.13 ? 945  ARG A O   1 
ATOM   2173  C  CB  . ARG A 1 292 ? 48.440  -11.741 6.175  1.00 37.90 ? 945  ARG A CB  1 
ATOM   2174  C  CG  . ARG A 1 292 ? 48.483  -11.195 4.757  1.00 34.72 ? 945  ARG A CG  1 
ATOM   2175  C  CD  . ARG A 1 292 ? 47.987  -12.217 3.704  1.00 34.43 ? 945  ARG A CD  1 
ATOM   2176  N  NE  . ARG A 1 292 ? 47.910  -11.563 2.391  1.00 32.73 ? 945  ARG A NE  1 
ATOM   2177  C  CZ  . ARG A 1 292 ? 48.822  -11.676 1.432  1.00 31.36 ? 945  ARG A CZ  1 
ATOM   2178  N  NH1 . ARG A 1 292 ? 49.889  -12.450 1.585  1.00 31.04 ? 945  ARG A NH1 1 
ATOM   2179  N  NH2 . ARG A 1 292 ? 48.724  -10.923 0.357  1.00 31.64 ? 945  ARG A NH2 1 
ATOM   2180  N  N   . ASP A 1 293 ? 46.626  -9.518  7.028  1.00 40.55 ? 946  ASP A N   1 
ATOM   2181  C  CA  . ASP A 1 293 ? 45.772  -8.397  6.690  1.00 42.36 ? 946  ASP A CA  1 
ATOM   2182  C  C   . ASP A 1 293 ? 46.067  -7.145  7.506  1.00 41.40 ? 946  ASP A C   1 
ATOM   2183  O  O   . ASP A 1 293 ? 46.015  -6.038  6.979  1.00 41.82 ? 946  ASP A O   1 
ATOM   2184  C  CB  . ASP A 1 293 ? 44.321  -8.857  6.860  1.00 46.50 ? 946  ASP A CB  1 
ATOM   2185  C  CG  . ASP A 1 293 ? 44.083  -10.243 6.221  1.00 50.16 ? 946  ASP A CG  1 
ATOM   2186  O  OD1 . ASP A 1 293 ? 44.036  -10.313 4.960  1.00 49.02 ? 946  ASP A OD1 1 
ATOM   2187  O  OD2 . ASP A 1 293 ? 43.977  -11.248 6.981  1.00 49.87 ? 946  ASP A OD2 1 
ATOM   2188  N  N   . LEU A 1 294 ? 46.355  -7.333  8.797  1.00 40.21 ? 947  LEU A N   1 
ATOM   2189  C  CA  . LEU A 1 294 ? 46.689  -6.242  9.732  1.00 37.08 ? 947  LEU A CA  1 
ATOM   2190  C  C   . LEU A 1 294 ? 48.110  -5.735  9.426  1.00 36.39 ? 947  LEU A C   1 
ATOM   2191  O  O   . LEU A 1 294 ? 48.349  -4.534  9.324  1.00 33.66 ? 947  LEU A O   1 
ATOM   2192  C  CB  . LEU A 1 294 ? 46.619  -6.770  11.169 1.00 36.09 ? 947  LEU A CB  1 
ATOM   2193  C  CG  . LEU A 1 294 ? 45.530  -6.336  12.156 1.00 35.05 ? 947  LEU A CG  1 
ATOM   2194  C  CD1 . LEU A 1 294 ? 44.365  -5.711  11.433 1.00 34.11 ? 947  LEU A CD1 1 
ATOM   2195  C  CD2 . LEU A 1 294 ? 45.113  -7.540  13.001 1.00 34.34 ? 947  LEU A CD2 1 
ATOM   2196  N  N   . HIS A 1 295 ? 49.030  -6.685  9.270  1.00 36.06 ? 948  HIS A N   1 
ATOM   2197  C  CA  . HIS A 1 295 ? 50.429  -6.430  8.950  1.00 37.43 ? 948  HIS A CA  1 
ATOM   2198  C  C   . HIS A 1 295 ? 50.590  -5.562  7.711  1.00 38.11 ? 948  HIS A C   1 
ATOM   2199  O  O   . HIS A 1 295 ? 51.279  -4.532  7.729  1.00 39.00 ? 948  HIS A O   1 
ATOM   2200  C  CB  . HIS A 1 295 ? 51.154  -7.771  8.762  1.00 36.58 ? 948  HIS A CB  1 
ATOM   2201  C  CG  . HIS A 1 295 ? 52.449  -7.677  8.022  1.00 36.87 ? 948  HIS A CG  1 
ATOM   2202  N  ND1 . HIS A 1 295 ? 53.431  -6.761  8.343  1.00 39.61 ? 948  HIS A ND1 1 
ATOM   2203  C  CD2 . HIS A 1 295 ? 52.949  -8.421  7.007  1.00 38.29 ? 948  HIS A CD2 1 
ATOM   2204  C  CE1 . HIS A 1 295 ? 54.481  -6.948  7.560  1.00 37.91 ? 948  HIS A CE1 1 
ATOM   2205  N  NE2 . HIS A 1 295 ? 54.214  -7.951  6.741  1.00 39.82 ? 948  HIS A NE2 1 
ATOM   2206  N  N   . LEU A 1 296 ? 49.952  -5.984  6.630  1.00 38.75 ? 949  LEU A N   1 
ATOM   2207  C  CA  . LEU A 1 296 ? 49.999  -5.260  5.367  1.00 39.14 ? 949  LEU A CA  1 
ATOM   2208  C  C   . LEU A 1 296 ? 49.380  -3.866  5.504  1.00 40.38 ? 949  LEU A C   1 
ATOM   2209  O  O   . LEU A 1 296 ? 49.676  -2.952  4.734  1.00 41.87 ? 949  LEU A O   1 
ATOM   2210  C  CB  . LEU A 1 296 ? 49.235  -6.048  4.308  1.00 39.17 ? 949  LEU A CB  1 
ATOM   2211  C  CG  . LEU A 1 296 ? 49.802  -7.424  3.980  1.00 39.32 ? 949  LEU A CG  1 
ATOM   2212  C  CD1 . LEU A 1 296 ? 48.945  -8.103  2.921  1.00 37.61 ? 949  LEU A CD1 1 
ATOM   2213  C  CD2 . LEU A 1 296 ? 51.242  -7.259  3.503  1.00 38.15 ? 949  LEU A CD2 1 
ATOM   2214  N  N   . LYS A 1 297 ? 48.508  -3.706  6.486  1.00 40.78 ? 950  LYS A N   1 
ATOM   2215  C  CA  . LYS A 1 297 ? 47.874  -2.423  6.703  1.00 42.09 ? 950  LYS A CA  1 
ATOM   2216  C  C   . LYS A 1 297 ? 48.877  -1.474  7.385  1.00 40.26 ? 950  LYS A C   1 
ATOM   2217  O  O   . LYS A 1 297 ? 48.960  -0.293  7.029  1.00 40.77 ? 950  LYS A O   1 
ATOM   2218  C  CB  . LYS A 1 297 ? 46.607  -2.629  7.551  1.00 45.33 ? 950  LYS A CB  1 
ATOM   2219  C  CG  . LYS A 1 297 ? 45.572  -1.507  7.534  1.00 47.82 ? 950  LYS A CG  1 
ATOM   2220  C  CD  . LYS A 1 297 ? 44.810  -1.420  6.232  1.00 48.87 ? 950  LYS A CD  1 
ATOM   2221  C  CE  . LYS A 1 297 ? 43.656  -0.407  6.328  1.00 50.20 ? 950  LYS A CE  1 
ATOM   2222  N  NZ  . LYS A 1 297 ? 44.116  0.963   6.665  1.00 51.43 ? 950  LYS A NZ  1 
ATOM   2223  N  N   . TRP A 1 298 ? 49.658  -1.975  8.342  1.00 38.80 ? 951  TRP A N   1 
ATOM   2224  C  CA  . TRP A 1 298 ? 50.628  -1.092  9.021  1.00 38.37 ? 951  TRP A CA  1 
ATOM   2225  C  C   . TRP A 1 298 ? 51.844  -0.904  8.130  1.00 37.29 ? 951  TRP A C   1 
ATOM   2226  O  O   . TRP A 1 298 ? 52.559  0.109   8.203  1.00 36.04 ? 951  TRP A O   1 
ATOM   2227  C  CB  . TRP A 1 298 ? 51.054  -1.639  10.390 1.00 36.00 ? 951  TRP A CB  1 
ATOM   2228  C  CG  . TRP A 1 298 ? 49.931  -1.648  11.383 1.00 35.72 ? 951  TRP A CG  1 
ATOM   2229  C  CD1 . TRP A 1 298 ? 49.225  -2.727  11.797 1.00 34.93 ? 951  TRP A CD1 1 
ATOM   2230  C  CD2 . TRP A 1 298 ? 49.373  -0.517  12.065 1.00 35.96 ? 951  TRP A CD2 1 
ATOM   2231  N  NE1 . TRP A 1 298 ? 48.263  -2.351  12.693 1.00 36.79 ? 951  TRP A NE1 1 
ATOM   2232  C  CE2 . TRP A 1 298 ? 48.327  -0.998  12.879 1.00 35.74 ? 951  TRP A CE2 1 
ATOM   2233  C  CE3 . TRP A 1 298 ? 49.663  0.859   12.072 1.00 37.01 ? 951  TRP A CE3 1 
ATOM   2234  C  CZ2 . TRP A 1 298 ? 47.550  -0.157  13.694 1.00 35.48 ? 951  TRP A CZ2 1 
ATOM   2235  C  CZ3 . TRP A 1 298 ? 48.896  1.700   12.881 1.00 35.07 ? 951  TRP A CZ3 1 
ATOM   2236  C  CH2 . TRP A 1 298 ? 47.848  1.183   13.685 1.00 36.49 ? 951  TRP A CH2 1 
ATOM   2237  N  N   . THR A 1 299 ? 52.058  -1.872  7.257  1.00 36.64 ? 952  THR A N   1 
ATOM   2238  C  CA  . THR A 1 299 ? 53.170  -1.769  6.350  1.00 37.06 ? 952  THR A CA  1 
ATOM   2239  C  C   . THR A 1 299 ? 52.926  -0.590  5.408  1.00 37.26 ? 952  THR A C   1 
ATOM   2240  O  O   . THR A 1 299 ? 53.829  0.238   5.154  1.00 37.45 ? 952  THR A O   1 
ATOM   2241  C  CB  . THR A 1 299 ? 53.318  -3.066  5.573  1.00 35.40 ? 952  THR A CB  1 
ATOM   2242  O  OG1 . THR A 1 299 ? 53.733  -4.099  6.479  1.00 32.79 ? 952  THR A OG1 1 
ATOM   2243  C  CG2 . THR A 1 299 ? 54.317  -2.906  4.441  1.00 34.23 ? 952  THR A CG2 1 
ATOM   2244  N  N   . GLU A 1 300 ? 51.696  -0.499  4.916  1.00 36.16 ? 953  GLU A N   1 
ATOM   2245  C  CA  . GLU A 1 300 ? 51.358  0.577   4.000  1.00 37.88 ? 953  GLU A CA  1 
ATOM   2246  C  C   . GLU A 1 300 ? 51.562  1.954   4.659  1.00 36.88 ? 953  GLU A C   1 
ATOM   2247  O  O   . GLU A 1 300 ? 52.038  2.895   4.026  1.00 35.00 ? 953  GLU A O   1 
ATOM   2248  C  CB  . GLU A 1 300 ? 49.920  0.427   3.494  1.00 36.70 ? 953  GLU A CB  1 
ATOM   2249  C  CG  . GLU A 1 300 ? 49.483  1.556   2.604  1.00 38.00 ? 953  GLU A CG  1 
ATOM   2250  C  CD  . GLU A 1 300 ? 48.022  1.449   2.229  1.00 42.71 ? 953  GLU A CD  1 
ATOM   2251  O  OE1 . GLU A 1 300 ? 47.496  2.358   1.538  1.00 42.67 ? 953  GLU A OE1 1 
ATOM   2252  O  OE2 . GLU A 1 300 ? 47.396  0.445   2.632  1.00 43.24 ? 953  GLU A OE2 1 
ATOM   2253  N  N   . GLY A 1 301 ? 51.210  2.049   5.937  1.00 37.72 ? 954  GLY A N   1 
ATOM   2254  C  CA  . GLY A 1 301 ? 51.371  3.294   6.656  1.00 34.82 ? 954  GLY A CA  1 
ATOM   2255  C  C   . GLY A 1 301 ? 52.804  3.796   6.791  1.00 34.77 ? 954  GLY A C   1 
ATOM   2256  O  O   . GLY A 1 301 ? 53.073  4.967   6.527  1.00 32.56 ? 954  GLY A O   1 
ATOM   2257  N  N   . ILE A 1 302 ? 53.722  2.922   7.192  1.00 33.50 ? 955  ILE A N   1 
ATOM   2258  C  CA  . ILE A 1 302 ? 55.082  3.349   7.383  1.00 33.00 ? 955  ILE A CA  1 
ATOM   2259  C  C   . ILE A 1 302 ? 55.751  3.744   6.055  1.00 35.43 ? 955  ILE A C   1 
ATOM   2260  O  O   . ILE A 1 302 ? 56.492  4.731   5.995  1.00 35.04 ? 955  ILE A O   1 
ATOM   2261  C  CB  . ILE A 1 302 ? 55.907  2.276   8.195  1.00 33.00 ? 955  ILE A CB  1 
ATOM   2262  C  CG1 . ILE A 1 302 ? 57.234  2.891   8.676  1.00 34.35 ? 955  ILE A CG1 1 
ATOM   2263  C  CG2 . ILE A 1 302 ? 56.166  1.037   7.391  1.00 32.81 ? 955  ILE A CG2 1 
ATOM   2264  C  CD1 . ILE A 1 302 ? 57.065  4.009   9.730  1.00 33.40 ? 955  ILE A CD1 1 
ATOM   2265  N  N   . VAL A 1 303 ? 55.457  3.019   4.977  1.00 35.18 ? 956  VAL A N   1 
ATOM   2266  C  CA  . VAL A 1 303 ? 56.058  3.356   3.694  1.00 34.06 ? 956  VAL A CA  1 
ATOM   2267  C  C   . VAL A 1 303 ? 55.494  4.662   3.161  1.00 34.05 ? 956  VAL A C   1 
ATOM   2268  O  O   . VAL A 1 303 ? 56.207  5.419   2.536  1.00 36.22 ? 956  VAL A O   1 
ATOM   2269  C  CB  . VAL A 1 303 ? 55.857  2.228   2.641  1.00 34.39 ? 956  VAL A CB  1 
ATOM   2270  C  CG1 . VAL A 1 303 ? 56.109  0.892   3.278  1.00 35.69 ? 956  VAL A CG1 1 
ATOM   2271  C  CG2 . VAL A 1 303 ? 54.501  2.264   2.063  1.00 35.09 ? 956  VAL A CG2 1 
ATOM   2272  N  N   . ASN A 1 304 ? 54.225  4.937   3.411  1.00 33.83 ? 957  ASN A N   1 
ATOM   2273  C  CA  . ASN A 1 304 ? 53.636  6.176   2.943  1.00 35.09 ? 957  ASN A CA  1 
ATOM   2274  C  C   . ASN A 1 304 ? 54.245  7.346   3.718  1.00 36.87 ? 957  ASN A C   1 
ATOM   2275  O  O   . ASN A 1 304 ? 54.439  8.449   3.174  1.00 37.22 ? 957  ASN A O   1 
ATOM   2276  C  CB  . ASN A 1 304 ? 52.123  6.138   3.132  1.00 36.31 ? 957  ASN A CB  1 
ATOM   2277  C  CG  . ASN A 1 304 ? 51.390  5.532   1.921  1.00 39.70 ? 957  ASN A CG  1 
ATOM   2278  O  OD1 . ASN A 1 304 ? 51.947  4.739   1.172  1.00 40.57 ? 957  ASN A OD1 1 
ATOM   2279  N  ND2 . ASN A 1 304 ? 50.136  5.910   1.743  1.00 40.63 ? 957  ASN A ND2 1 
ATOM   2280  N  N   . GLU A 1 305 ? 54.563  7.098   4.988  1.00 35.73 ? 958  GLU A N   1 
ATOM   2281  C  CA  . GLU A 1 305 ? 55.160  8.122   5.823  1.00 36.64 ? 958  GLU A CA  1 
ATOM   2282  C  C   . GLU A 1 305 ? 56.609  8.364   5.373  1.00 35.29 ? 958  GLU A C   1 
ATOM   2283  O  O   . GLU A 1 305 ? 57.055  9.494   5.318  1.00 35.92 ? 958  GLU A O   1 
ATOM   2284  C  CB  . GLU A 1 305 ? 55.100  7.708   7.291  1.00 37.00 ? 958  GLU A CB  1 
ATOM   2285  C  CG  . GLU A 1 305 ? 55.376  8.849   8.252  1.00 38.32 ? 958  GLU A CG  1 
ATOM   2286  C  CD  . GLU A 1 305 ? 54.985  8.516   9.679  1.00 38.91 ? 958  GLU A CD  1 
ATOM   2287  O  OE1 . GLU A 1 305 ? 53.790  8.254   9.931  1.00 38.94 ? 958  GLU A OE1 1 
ATOM   2288  O  OE2 . GLU A 1 305 ? 55.880  8.508   10.548 1.00 42.32 ? 958  GLU A OE2 1 
ATOM   2289  N  N   . PHE A 1 306 ? 57.328  7.300   5.039  1.00 34.51 ? 959  PHE A N   1 
ATOM   2290  C  CA  . PHE A 1 306 ? 58.693  7.431   4.564  1.00 33.35 ? 959  PHE A CA  1 
ATOM   2291  C  C   . PHE A 1 306 ? 58.771  8.255   3.280  1.00 33.62 ? 959  PHE A C   1 
ATOM   2292  O  O   . PHE A 1 306 ? 59.639  9.117   3.134  1.00 33.52 ? 959  PHE A O   1 
ATOM   2293  C  CB  . PHE A 1 306 ? 59.322  6.059   4.303  1.00 29.98 ? 959  PHE A CB  1 
ATOM   2294  C  CG  . PHE A 1 306 ? 59.839  5.378   5.527  1.00 28.46 ? 959  PHE A CG  1 
ATOM   2295  C  CD1 . PHE A 1 306 ? 60.670  4.261   5.416  1.00 28.61 ? 959  PHE A CD1 1 
ATOM   2296  C  CD2 . PHE A 1 306 ? 59.520  5.840   6.800  1.00 26.75 ? 959  PHE A CD2 1 
ATOM   2297  C  CE1 . PHE A 1 306 ? 61.176  3.615   6.561  1.00 28.25 ? 959  PHE A CE1 1 
ATOM   2298  C  CE2 . PHE A 1 306 ? 60.020  5.202   7.937  1.00 26.29 ? 959  PHE A CE2 1 
ATOM   2299  C  CZ  . PHE A 1 306 ? 60.850  4.088   7.817  1.00 25.11 ? 959  PHE A CZ  1 
ATOM   2300  N  N   . TYR A 1 307 ? 57.876  7.972   2.342  1.00 34.47 ? 960  TYR A N   1 
ATOM   2301  C  CA  . TYR A 1 307 ? 57.849  8.701   1.067  1.00 36.41 ? 960  TYR A CA  1 
ATOM   2302  C  C   . TYR A 1 307 ? 57.675  10.170  1.327  1.00 36.85 ? 960  TYR A C   1 
ATOM   2303  O  O   . TYR A 1 307 ? 58.311  11.001  0.678  1.00 37.94 ? 960  TYR A O   1 
ATOM   2304  C  CB  . TYR A 1 307 ? 56.730  8.171   0.164  1.00 35.16 ? 960  TYR A CB  1 
ATOM   2305  C  CG  . TYR A 1 307 ? 57.053  6.796   -0.351 1.00 34.64 ? 960  TYR A CG  1 
ATOM   2306  C  CD1 . TYR A 1 307 ? 56.051  5.942   -0.819 1.00 37.59 ? 960  TYR A CD1 1 
ATOM   2307  C  CD2 . TYR A 1 307 ? 58.374  6.342   -0.364 1.00 34.78 ? 960  TYR A CD2 1 
ATOM   2308  C  CE1 . TYR A 1 307 ? 56.359  4.671   -1.284 1.00 36.88 ? 960  TYR A CE1 1 
ATOM   2309  C  CE2 . TYR A 1 307 ? 58.698  5.092   -0.821 1.00 36.19 ? 960  TYR A CE2 1 
ATOM   2310  C  CZ  . TYR A 1 307 ? 57.687  4.253   -1.279 1.00 37.61 ? 960  TYR A CZ  1 
ATOM   2311  O  OH  . TYR A 1 307 ? 58.009  2.997   -1.696 1.00 37.45 ? 960  TYR A OH  1 
ATOM   2312  N  N   . GLU A 1 308 ? 56.833  10.491  2.304  1.00 37.36 ? 961  GLU A N   1 
ATOM   2313  C  CA  . GLU A 1 308 ? 56.634  11.878  2.669  1.00 38.18 ? 961  GLU A CA  1 
ATOM   2314  C  C   . GLU A 1 308 ? 57.954  12.516  3.156  1.00 37.38 ? 961  GLU A C   1 
ATOM   2315  O  O   . GLU A 1 308 ? 58.236  13.666  2.807  1.00 37.09 ? 961  GLU A O   1 
ATOM   2316  C  CB  . GLU A 1 308 ? 55.522  11.996  3.712  1.00 38.24 ? 961  GLU A CB  1 
ATOM   2317  C  CG  . GLU A 1 308 ? 54.115  11.926  3.115  1.00 42.64 ? 961  GLU A CG  1 
ATOM   2318  C  CD  . GLU A 1 308 ? 53.020  12.315  4.126  1.00 47.73 ? 961  GLU A CD  1 
ATOM   2319  O  OE1 . GLU A 1 308 ? 53.161  13.350  4.819  1.00 51.21 ? 961  GLU A OE1 1 
ATOM   2320  O  OE2 . GLU A 1 308 ? 52.006  11.604  4.228  1.00 48.44 ? 961  GLU A OE2 1 
ATOM   2321  N  N   . GLN A 1 309 ? 58.766  11.786  3.938  1.00 36.29 ? 962  GLN A N   1 
ATOM   2322  C  CA  . GLN A 1 309 ? 60.054  12.334  4.412  1.00 34.94 ? 962  GLN A CA  1 
ATOM   2323  C  C   . GLN A 1 309 ? 60.988  12.495  3.219  1.00 34.71 ? 962  GLN A C   1 
ATOM   2324  O  O   . GLN A 1 309 ? 61.766  13.449  3.155  1.00 35.26 ? 962  GLN A O   1 
ATOM   2325  C  CB  . GLN A 1 309 ? 60.734  11.414  5.437  1.00 36.14 ? 962  GLN A CB  1 
ATOM   2326  C  CG  . GLN A 1 309 ? 62.139  11.902  5.886  1.00 34.71 ? 962  GLN A CG  1 
ATOM   2327  C  CD  . GLN A 1 309 ? 62.738  11.050  6.987  1.00 34.19 ? 962  GLN A CD  1 
ATOM   2328  O  OE1 . GLN A 1 309 ? 62.062  10.720  7.950  1.00 36.62 ? 962  GLN A OE1 1 
ATOM   2329  N  NE2 . GLN A 1 309 ? 64.006  10.689  6.850  1.00 33.24 ? 962  GLN A NE2 1 
ATOM   2330  N  N   . GLY A 1 310 ? 60.892  11.542  2.295  1.00 33.05 ? 963  GLY A N   1 
ATOM   2331  C  CA  . GLY A 1 310 ? 61.672  11.561  1.079  1.00 34.74 ? 963  GLY A CA  1 
ATOM   2332  C  C   . GLY A 1 310 ? 61.327  12.747  0.193  1.00 36.50 ? 963  GLY A C   1 
ATOM   2333  O  O   . GLY A 1 310 ? 62.246  13.335  -0.378 1.00 37.60 ? 963  GLY A O   1 
ATOM   2334  N  N   . ASP A 1 311 ? 60.041  13.113  0.068  1.00 36.22 ? 964  ASP A N   1 
ATOM   2335  C  CA  . ASP A 1 311 ? 59.664  14.266  -0.765 1.00 35.72 ? 964  ASP A CA  1 
ATOM   2336  C  C   . ASP A 1 311 ? 60.256  15.520  -0.144 1.00 37.24 ? 964  ASP A C   1 
ATOM   2337  O  O   . ASP A 1 311 ? 60.678  16.455  -0.845 1.00 36.57 ? 964  ASP A O   1 
ATOM   2338  C  CB  . ASP A 1 311 ? 58.145  14.503  -0.836 1.00 35.47 ? 964  ASP A CB  1 
ATOM   2339  C  CG  . ASP A 1 311 ? 57.346  13.276  -1.293 1.00 35.74 ? 964  ASP A CG  1 
ATOM   2340  O  OD1 . ASP A 1 311 ? 57.854  12.429  -2.075 1.00 34.97 ? 964  ASP A OD1 1 
ATOM   2341  O  OD2 . ASP A 1 311 ? 56.173  13.185  -0.860 1.00 35.85 ? 964  ASP A OD2 1 
ATOM   2342  N  N   . GLU A 1 312 ? 60.271  15.554  1.186  1.00 38.08 ? 965  GLU A N   1 
ATOM   2343  C  CA  . GLU A 1 312 ? 60.799  16.722  1.853  1.00 37.73 ? 965  GLU A CA  1 
ATOM   2344  C  C   . GLU A 1 312 ? 62.305  16.753  1.779  1.00 37.24 ? 965  GLU A C   1 
ATOM   2345  O  O   . GLU A 1 312 ? 62.872  17.821  1.631  1.00 38.03 ? 965  GLU A O   1 
ATOM   2346  C  CB  . GLU A 1 312 ? 60.336  16.823  3.313  1.00 39.44 ? 965  GLU A CB  1 
ATOM   2347  C  CG  . GLU A 1 312 ? 60.032  18.288  3.672  1.00 42.52 ? 965  GLU A CG  1 
ATOM   2348  C  CD  . GLU A 1 312 ? 60.326  18.701  5.109  1.00 42.80 ? 965  GLU A CD  1 
ATOM   2349  O  OE1 . GLU A 1 312 ? 59.762  18.128  6.068  1.00 42.84 ? 965  GLU A OE1 1 
ATOM   2350  O  OE2 . GLU A 1 312 ? 61.129  19.641  5.272  1.00 45.13 ? 965  GLU A OE2 1 
ATOM   2351  N  N   . GLU A 1 313 ? 62.957  15.601  1.864  1.00 36.35 ? 966  GLU A N   1 
ATOM   2352  C  CA  . GLU A 1 313 ? 64.408  15.582  1.772  1.00 37.52 ? 966  GLU A CA  1 
ATOM   2353  C  C   . GLU A 1 313 ? 64.853  16.135  0.443  1.00 38.74 ? 966  GLU A C   1 
ATOM   2354  O  O   . GLU A 1 313 ? 65.799  16.919  0.376  1.00 40.47 ? 966  GLU A O   1 
ATOM   2355  C  CB  . GLU A 1 313 ? 64.952  14.166  1.900  1.00 37.11 ? 966  GLU A CB  1 
ATOM   2356  C  CG  . GLU A 1 313 ? 64.737  13.561  3.251  1.00 37.36 ? 966  GLU A CG  1 
ATOM   2357  C  CD  . GLU A 1 313 ? 65.129  12.120  3.294  1.00 35.60 ? 966  GLU A CD  1 
ATOM   2358  O  OE1 . GLU A 1 313 ? 64.867  11.425  2.298  1.00 37.48 ? 966  GLU A OE1 1 
ATOM   2359  O  OE2 . GLU A 1 313 ? 65.681  11.679  4.313  1.00 35.51 ? 966  GLU A OE2 1 
ATOM   2360  N  N   . ALA A 1 314 ? 64.176  15.706  -0.620 1.00 40.41 ? 967  ALA A N   1 
ATOM   2361  C  CA  . ALA A 1 314 ? 64.494  16.163  -1.973 1.00 40.33 ? 967  ALA A CA  1 
ATOM   2362  C  C   . ALA A 1 314 ? 64.213  17.649  -2.121 1.00 41.03 ? 967  ALA A C   1 
ATOM   2363  O  O   . ALA A 1 314 ? 64.987  18.351  -2.746 1.00 43.10 ? 967  ALA A O   1 
ATOM   2364  C  CB  . ALA A 1 314 ? 63.679  15.372  -3.018 1.00 39.32 ? 967  ALA A CB  1 
ATOM   2365  N  N   . ASN A 1 315 ? 63.112  18.137  -1.561 1.00 40.95 ? 968  ASN A N   1 
ATOM   2366  C  CA  . ASN A 1 315 ? 62.827  19.552  -1.687 1.00 42.38 ? 968  ASN A CA  1 
ATOM   2367  C  C   . ASN A 1 315 ? 63.860  20.415  -0.970 1.00 43.12 ? 968  ASN A C   1 
ATOM   2368  O  O   . ASN A 1 315 ? 64.056  21.578  -1.318 1.00 43.05 ? 968  ASN A O   1 
ATOM   2369  C  CB  . ASN A 1 315 ? 61.439  19.880  -1.158 1.00 42.94 ? 968  ASN A CB  1 
ATOM   2370  C  CG  . ASN A 1 315 ? 60.332  19.294  -2.016 1.00 44.82 ? 968  ASN A CG  1 
ATOM   2371  O  OD1 . ASN A 1 315 ? 60.502  19.096  -3.225 1.00 45.90 ? 968  ASN A OD1 1 
ATOM   2372  N  ND2 . ASN A 1 315 ? 59.181  19.038  -1.401 1.00 42.74 ? 968  ASN A ND2 1 
ATOM   2373  N  N   . LEU A 1 316 ? 64.518  19.836  0.029  1.00 43.56 ? 969  LEU A N   1 
ATOM   2374  C  CA  . LEU A 1 316 ? 65.528  20.540  0.793  1.00 44.47 ? 969  LEU A CA  1 
ATOM   2375  C  C   . LEU A 1 316 ? 66.923  20.356  0.190  1.00 45.92 ? 969  LEU A C   1 
ATOM   2376  O  O   . LEU A 1 316 ? 67.924  20.754  0.790  1.00 46.50 ? 969  LEU A O   1 
ATOM   2377  C  CB  . LEU A 1 316 ? 65.522  20.053  2.244  1.00 43.54 ? 969  LEU A CB  1 
ATOM   2378  C  CG  . LEU A 1 316 ? 64.387  20.594  3.110  1.00 44.34 ? 969  LEU A CG  1 
ATOM   2379  C  CD1 . LEU A 1 316 ? 64.390  19.886  4.466  1.00 43.36 ? 969  LEU A CD1 1 
ATOM   2380  C  CD2 . LEU A 1 316 ? 64.552  22.111  3.280  1.00 42.19 ? 969  LEU A CD2 1 
ATOM   2381  N  N   . GLY A 1 317 ? 66.990  19.747  -0.989 1.00 45.91 ? 970  GLY A N   1 
ATOM   2382  C  CA  . GLY A 1 317 ? 68.275  19.538  -1.622 1.00 45.16 ? 970  GLY A CA  1 
ATOM   2383  C  C   . GLY A 1 317 ? 69.018  18.337  -1.061 1.00 46.07 ? 970  GLY A C   1 
ATOM   2384  O  O   . GLY A 1 317 ? 70.082  17.962  -1.564 1.00 46.03 ? 970  GLY A O   1 
ATOM   2385  N  N   . LEU A 1 318 ? 68.468  17.713  -0.028 1.00 45.74 ? 971  LEU A N   1 
ATOM   2386  C  CA  . LEU A 1 318 ? 69.134  16.563  0.558  1.00 45.67 ? 971  LEU A CA  1 
ATOM   2387  C  C   . LEU A 1 318 ? 68.896  15.299  -0.220 1.00 44.29 ? 971  LEU A C   1 
ATOM   2388  O  O   . LEU A 1 318 ? 67.921  15.169  -0.943 1.00 45.90 ? 971  LEU A O   1 
ATOM   2389  C  CB  . LEU A 1 318 ? 68.673  16.340  1.998  1.00 46.64 ? 971  LEU A CB  1 
ATOM   2390  C  CG  . LEU A 1 318 ? 68.688  17.612  2.836  1.00 48.50 ? 971  LEU A CG  1 
ATOM   2391  C  CD1 . LEU A 1 318 ? 68.188  17.309  4.235  1.00 49.21 ? 971  LEU A CD1 1 
ATOM   2392  C  CD2 . LEU A 1 318 ? 70.084  18.180  2.877  1.00 48.71 ? 971  LEU A CD2 1 
ATOM   2393  N  N   . PRO A 1 319 ? 69.811  14.345  -0.084 1.00 43.87 ? 972  PRO A N   1 
ATOM   2394  C  CA  . PRO A 1 319 ? 69.725  13.054  -0.757 1.00 42.79 ? 972  PRO A CA  1 
ATOM   2395  C  C   . PRO A 1 319 ? 68.603  12.290  -0.074 1.00 43.10 ? 972  PRO A C   1 
ATOM   2396  O  O   . PRO A 1 319 ? 68.484  12.319  1.159  1.00 42.92 ? 972  PRO A O   1 
ATOM   2397  C  CB  . PRO A 1 319 ? 71.074  12.412  -0.461 1.00 44.27 ? 972  PRO A CB  1 
ATOM   2398  C  CG  . PRO A 1 319 ? 71.966  13.586  -0.083 1.00 44.22 ? 972  PRO A CG  1 
ATOM   2399  C  CD  . PRO A 1 319 ? 71.063  14.464  0.679  1.00 42.91 ? 972  PRO A CD  1 
ATOM   2400  N  N   . ILE A 1 320 ? 67.784  11.605  -0.868 1.00 42.61 ? 973  ILE A N   1 
ATOM   2401  C  CA  . ILE A 1 320 ? 66.683  10.833  -0.326 1.00 39.68 ? 973  ILE A CA  1 
ATOM   2402  C  C   . ILE A 1 320 ? 67.234  9.635   0.451  1.00 40.90 ? 973  ILE A C   1 
ATOM   2403  O  O   . ILE A 1 320 ? 68.108  8.893   -0.015 1.00 40.61 ? 973  ILE A O   1 
ATOM   2404  C  CB  . ILE A 1 320 ? 65.777  10.355  -1.439 1.00 39.39 ? 973  ILE A CB  1 
ATOM   2405  C  CG1 . ILE A 1 320 ? 65.360  11.563  -2.283 1.00 39.84 ? 973  ILE A CG1 1 
ATOM   2406  C  CG2 . ILE A 1 320 ? 64.596  9.601   -0.856 1.00 33.46 ? 973  ILE A CG2 1 
ATOM   2407  C  CD1 . ILE A 1 320 ? 64.503  11.212  -3.478 1.00 39.60 ? 973  ILE A CD1 1 
ATOM   2408  N  N   . SER A 1 321 ? 66.723  9.440   1.653  1.00 39.62 ? 974  SER A N   1 
ATOM   2409  C  CA  . SER A 1 321 ? 67.203  8.346   2.444  1.00 38.54 ? 974  SER A CA  1 
ATOM   2410  C  C   . SER A 1 321 ? 66.793  7.034   1.822  1.00 38.17 ? 974  SER A C   1 
ATOM   2411  O  O   . SER A 1 321 ? 65.865  6.984   0.999  1.00 37.71 ? 974  SER A O   1 
ATOM   2412  C  CB  . SER A 1 321 ? 66.633  8.445   3.860  1.00 39.53 ? 974  SER A CB  1 
ATOM   2413  O  OG  . SER A 1 321 ? 67.139  9.591   4.515  1.00 42.58 ? 974  SER A OG  1 
ATOM   2414  N  N   . PRO A 1 322 ? 67.476  5.945   2.210  1.00 37.38 ? 975  PRO A N   1 
ATOM   2415  C  CA  . PRO A 1 322 ? 67.184  4.594   1.706  1.00 36.20 ? 975  PRO A CA  1 
ATOM   2416  C  C   . PRO A 1 322 ? 65.766  4.167   2.106  1.00 36.26 ? 975  PRO A C   1 
ATOM   2417  O  O   . PRO A 1 322 ? 65.354  4.340   3.259  1.00 35.85 ? 975  PRO A O   1 
ATOM   2418  C  CB  . PRO A 1 322 ? 68.254  3.732   2.377  1.00 36.31 ? 975  PRO A CB  1 
ATOM   2419  C  CG  . PRO A 1 322 ? 69.431  4.743   2.546  1.00 35.67 ? 975  PRO A CG  1 
ATOM   2420  C  CD  . PRO A 1 322 ? 68.680  5.949   3.063  1.00 35.15 ? 975  PRO A CD  1 
ATOM   2421  N  N   . PHE A 1 323 ? 65.045  3.611   1.132  1.00 36.52 ? 976  PHE A N   1 
ATOM   2422  C  CA  . PHE A 1 323 ? 63.670  3.142   1.280  1.00 36.04 ? 976  PHE A CA  1 
ATOM   2423  C  C   . PHE A 1 323 ? 62.631  4.261   1.303  1.00 36.30 ? 976  PHE A C   1 
ATOM   2424  O  O   . PHE A 1 323 ? 61.464  4.005   1.541  1.00 37.23 ? 976  PHE A O   1 
ATOM   2425  C  CB  . PHE A 1 323 ? 63.504  2.296   2.546  1.00 34.33 ? 976  PHE A CB  1 
ATOM   2426  C  CG  . PHE A 1 323 ? 64.385  1.098   2.598  1.00 35.71 ? 976  PHE A CG  1 
ATOM   2427  C  CD1 . PHE A 1 323 ? 65.357  0.971   3.599  1.00 36.09 ? 976  PHE A CD1 1 
ATOM   2428  C  CD2 . PHE A 1 323 ? 64.212  0.053   1.694  1.00 36.40 ? 976  PHE A CD2 1 
ATOM   2429  C  CE1 . PHE A 1 323 ? 66.136  -0.195  3.687  1.00 37.05 ? 976  PHE A CE1 1 
ATOM   2430  C  CE2 . PHE A 1 323 ? 64.984  -1.116  1.775  1.00 34.93 ? 976  PHE A CE2 1 
ATOM   2431  C  CZ  . PHE A 1 323 ? 65.943  -1.248  2.769  1.00 36.63 ? 976  PHE A CZ  1 
ATOM   2432  N  N   . MET A 1 324 ? 63.031  5.496   1.039  1.00 36.61 ? 977  MET A N   1 
ATOM   2433  C  CA  . MET A 1 324 ? 62.079  6.602   1.100  1.00 36.30 ? 977  MET A CA  1 
ATOM   2434  C  C   . MET A 1 324 ? 61.827  7.353   -0.219 1.00 36.02 ? 977  MET A C   1 
ATOM   2435  O  O   . MET A 1 324 ? 61.113  8.366   -0.251 1.00 33.83 ? 977  MET A O   1 
ATOM   2436  C  CB  . MET A 1 324 ? 62.514  7.577   2.202  1.00 37.82 ? 977  MET A CB  1 
ATOM   2437  C  CG  . MET A 1 324 ? 62.627  6.895   3.571  1.00 38.98 ? 977  MET A CG  1 
ATOM   2438  S  SD  . MET A 1 324 ? 62.797  7.966   5.012  1.00 39.29 ? 977  MET A SD  1 
ATOM   2439  C  CE  . MET A 1 324 ? 63.503  6.733   6.262  1.00 38.43 ? 977  MET A CE  1 
ATOM   2440  N  N   . ASP A 1 325 ? 62.403  6.836   -1.304 1.00 36.56 ? 978  ASP A N   1 
ATOM   2441  C  CA  . ASP A 1 325 ? 62.229  7.418   -2.631 1.00 38.07 ? 978  ASP A CA  1 
ATOM   2442  C  C   . ASP A 1 325 ? 61.089  6.647   -3.325 1.00 39.26 ? 978  ASP A C   1 
ATOM   2443  O  O   . ASP A 1 325 ? 61.250  5.486   -3.706 1.00 40.41 ? 978  ASP A O   1 
ATOM   2444  C  CB  . ASP A 1 325 ? 63.538  7.305   -3.443 1.00 35.61 ? 978  ASP A CB  1 
ATOM   2445  C  CG  . ASP A 1 325 ? 63.435  7.963   -4.813 1.00 36.68 ? 978  ASP A CG  1 
ATOM   2446  O  OD1 . ASP A 1 325 ? 62.328  8.416   -5.175 1.00 36.56 ? 978  ASP A OD1 1 
ATOM   2447  O  OD2 . ASP A 1 325 ? 64.452  8.029   -5.537 1.00 38.38 ? 978  ASP A OD2 1 
ATOM   2448  N  N   . ARG A 1 326 ? 59.933  7.292   -3.464 1.00 40.78 ? 979  ARG A N   1 
ATOM   2449  C  CA  . ARG A 1 326 ? 58.788  6.657   -4.110 1.00 42.82 ? 979  ARG A CA  1 
ATOM   2450  C  C   . ARG A 1 326 ? 59.023  6.263   -5.569 1.00 44.63 ? 979  ARG A C   1 
ATOM   2451  O  O   . ARG A 1 326 ? 58.378  5.342   -6.086 1.00 46.44 ? 979  ARG A O   1 
ATOM   2452  C  CB  . ARG A 1 326 ? 57.549  7.547   -4.013 1.00 40.29 ? 979  ARG A CB  1 
ATOM   2453  C  CG  . ARG A 1 326 ? 57.721  8.945   -4.539 1.00 38.64 ? 979  ARG A CG  1 
ATOM   2454  C  CD  . ARG A 1 326 ? 56.410  9.746   -4.449 1.00 37.64 ? 979  ARG A CD  1 
ATOM   2455  N  NE  . ARG A 1 326 ? 56.133  10.373  -3.149 1.00 38.09 ? 979  ARG A NE  1 
ATOM   2456  C  CZ  . ARG A 1 326 ? 55.226  9.950   -2.264 1.00 36.75 ? 979  ARG A CZ  1 
ATOM   2457  N  NH1 . ARG A 1 326 ? 54.498  8.875   -2.512 1.00 37.17 ? 979  ARG A NH1 1 
ATOM   2458  N  NH2 . ARG A 1 326 ? 55.000  10.646  -1.152 1.00 33.29 ? 979  ARG A NH2 1 
ATOM   2459  N  N   . SER A 1 327 ? 59.949  6.941   -6.230 1.00 45.03 ? 980  SER A N   1 
ATOM   2460  C  CA  . SER A 1 327 ? 60.236  6.644   -7.626 1.00 45.62 ? 980  SER A CA  1 
ATOM   2461  C  C   . SER A 1 327 ? 61.277  5.529   -7.754 1.00 45.14 ? 980  SER A C   1 
ATOM   2462  O  O   . SER A 1 327 ? 61.659  5.136   -8.854 1.00 44.56 ? 980  SER A O   1 
ATOM   2463  C  CB  . SER A 1 327 ? 60.737  7.911   -8.325 1.00 46.85 ? 980  SER A CB  1 
ATOM   2464  O  OG  . SER A 1 327 ? 61.938  8.378   -7.721 1.00 50.28 ? 980  SER A OG  1 
ATOM   2465  N  N   . SER A 1 328 ? 61.718  5.007   -6.620 1.00 44.59 ? 981  SER A N   1 
ATOM   2466  C  CA  . SER A 1 328 ? 62.724  3.966   -6.620 1.00 45.19 ? 981  SER A CA  1 
ATOM   2467  C  C   . SER A 1 328 ? 62.531  3.147   -5.335 1.00 46.63 ? 981  SER A C   1 
ATOM   2468  O  O   . SER A 1 328 ? 63.448  2.971   -4.540 1.00 47.33 ? 981  SER A O   1 
ATOM   2469  C  CB  . SER A 1 328 ? 64.095  4.638   -6.660 1.00 46.58 ? 981  SER A CB  1 
ATOM   2470  O  OG  . SER A 1 328 ? 65.137  3.697   -6.624 1.00 47.38 ? 981  SER A OG  1 
ATOM   2471  N  N   . PRO A 1 329 ? 61.319  2.617   -5.133 1.00 45.90 ? 982  PRO A N   1 
ATOM   2472  C  CA  . PRO A 1 329 ? 60.975  1.826   -3.953 1.00 45.08 ? 982  PRO A CA  1 
ATOM   2473  C  C   . PRO A 1 329 ? 61.621  0.450   -3.815 1.00 44.67 ? 982  PRO A C   1 
ATOM   2474  O  O   . PRO A 1 329 ? 61.907  -0.215  -4.799 1.00 44.21 ? 982  PRO A O   1 
ATOM   2475  C  CB  . PRO A 1 329 ? 59.469  1.731   -4.066 1.00 45.05 ? 982  PRO A CB  1 
ATOM   2476  C  CG  . PRO A 1 329 ? 59.286  1.576   -5.533 1.00 44.20 ? 982  PRO A CG  1 
ATOM   2477  C  CD  . PRO A 1 329 ? 60.202  2.618   -6.098 1.00 44.51 ? 982  PRO A CD  1 
ATOM   2478  N  N   . GLN A 1 330 ? 61.826  0.032   -2.572 1.00 44.03 ? 983  GLN A N   1 
ATOM   2479  C  CA  . GLN A 1 330 ? 62.401  -1.276  -2.261 1.00 44.09 ? 983  GLN A CA  1 
ATOM   2480  C  C   . GLN A 1 330 ? 61.586  -1.854  -1.110 1.00 43.77 ? 983  GLN A C   1 
ATOM   2481  O  O   . GLN A 1 330 ? 62.141  -2.308  -0.119 1.00 43.07 ? 983  GLN A O   1 
ATOM   2482  C  CB  . GLN A 1 330 ? 63.860  -1.150  -1.822 1.00 44.20 ? 983  GLN A CB  1 
ATOM   2483  C  CG  . GLN A 1 330 ? 64.851  -0.855  -2.935 1.00 46.00 ? 983  GLN A CG  1 
ATOM   2484  C  CD  . GLN A 1 330 ? 64.868  -1.928  -4.013 1.00 47.67 ? 983  GLN A CD  1 
ATOM   2485  O  OE1 . GLN A 1 330 ? 64.540  -3.101  -3.757 1.00 48.66 ? 983  GLN A OE1 1 
ATOM   2486  N  NE2 . GLN A 1 330 ? 65.267  -1.541  -5.227 1.00 47.39 ? 983  GLN A NE2 1 
ATOM   2487  N  N   . LEU A 1 331 ? 60.266  -1.840  -1.265 1.00 43.35 ? 984  LEU A N   1 
ATOM   2488  C  CA  . LEU A 1 331 ? 59.340  -2.322  -0.240 1.00 43.72 ? 984  LEU A CA  1 
ATOM   2489  C  C   . LEU A 1 331 ? 59.604  -3.689  0.370  1.00 43.42 ? 984  LEU A C   1 
ATOM   2490  O  O   . LEU A 1 331 ? 59.500  -3.851  1.576  1.00 44.06 ? 984  LEU A O   1 
ATOM   2491  C  CB  . LEU A 1 331 ? 57.914  -2.283  -0.774 1.00 43.77 ? 984  LEU A CB  1 
ATOM   2492  C  CG  . LEU A 1 331 ? 56.837  -2.779  0.180  1.00 44.23 ? 984  LEU A CG  1 
ATOM   2493  C  CD1 . LEU A 1 331 ? 56.973  -2.085  1.514  1.00 44.40 ? 984  LEU A CD1 1 
ATOM   2494  C  CD2 . LEU A 1 331 ? 55.476  -2.506  -0.425 1.00 44.30 ? 984  LEU A CD2 1 
ATOM   2495  N  N   . ALA A 1 332 ? 59.944  -4.677  -0.442 1.00 43.85 ? 985  ALA A N   1 
ATOM   2496  C  CA  . ALA A 1 332 ? 60.213  -5.998  0.099  1.00 43.95 ? 985  ALA A CA  1 
ATOM   2497  C  C   . ALA A 1 332 ? 61.533  -6.038  0.873  1.00 43.32 ? 985  ALA A C   1 
ATOM   2498  O  O   . ALA A 1 332 ? 61.629  -6.726  1.901  1.00 42.41 ? 985  ALA A O   1 
ATOM   2499  C  CB  . ALA A 1 332 ? 60.220  -7.042  -1.018 1.00 42.16 ? 985  ALA A CB  1 
ATOM   2500  N  N   . LYS A 1 333 ? 62.552  -5.333  0.371  1.00 43.42 ? 986  LYS A N   1 
ATOM   2501  C  CA  . LYS A 1 333 ? 63.848  -5.290  1.055  1.00 43.54 ? 986  LYS A CA  1 
ATOM   2502  C  C   . LYS A 1 333 ? 63.616  -4.749  2.469  1.00 42.03 ? 986  LYS A C   1 
ATOM   2503  O  O   . LYS A 1 333 ? 64.075  -5.337  3.461  1.00 42.58 ? 986  LYS A O   1 
ATOM   2504  C  CB  . LYS A 1 333 ? 64.829  -4.388  0.300  1.00 45.86 ? 986  LYS A CB  1 
ATOM   2505  C  CG  . LYS A 1 333 ? 65.901  -5.137  -0.470 1.00 49.21 ? 986  LYS A CG  1 
ATOM   2506  C  CD  . LYS A 1 333 ? 66.509  -4.317  -1.641 1.00 52.90 ? 986  LYS A CD  1 
ATOM   2507  C  CE  . LYS A 1 333 ? 67.548  -3.248  -1.193 1.00 55.93 ? 986  LYS A CE  1 
ATOM   2508  N  NZ  . LYS A 1 333 ? 68.320  -2.640  -2.352 1.00 55.87 ? 986  LYS A NZ  1 
ATOM   2509  N  N   . LEU A 1 334 ? 62.878  -3.647  2.556  1.00 40.77 ? 987  LEU A N   1 
ATOM   2510  C  CA  . LEU A 1 334 ? 62.554  -3.017  3.836  1.00 42.21 ? 987  LEU A CA  1 
ATOM   2511  C  C   . LEU A 1 334 ? 61.924  -3.988  4.841  1.00 41.49 ? 987  LEU A C   1 
ATOM   2512  O  O   . LEU A 1 334 ? 62.430  -4.155  5.944  1.00 42.48 ? 987  LEU A O   1 
ATOM   2513  C  CB  . LEU A 1 334 ? 61.612  -1.817  3.616  1.00 40.86 ? 987  LEU A CB  1 
ATOM   2514  C  CG  . LEU A 1 334 ? 61.089  -1.156  4.905  1.00 41.28 ? 987  LEU A CG  1 
ATOM   2515  C  CD1 . LEU A 1 334 ? 62.269  -0.734  5.782  1.00 38.57 ? 987  LEU A CD1 1 
ATOM   2516  C  CD2 . LEU A 1 334 ? 60.234  0.040   4.579  1.00 38.65 ? 987  LEU A CD2 1 
ATOM   2517  N  N   . GLN A 1 335 ? 60.823  -4.628  4.463  1.00 40.89 ? 988  GLN A N   1 
ATOM   2518  C  CA  . GLN A 1 335 ? 60.152  -5.576  5.355  1.00 39.47 ? 988  GLN A CA  1 
ATOM   2519  C  C   . GLN A 1 335 ? 60.992  -6.818  5.617  1.00 39.52 ? 988  GLN A C   1 
ATOM   2520  O  O   . GLN A 1 335 ? 61.024  -7.355  6.727  1.00 39.89 ? 988  GLN A O   1 
ATOM   2521  C  CB  . GLN A 1 335 ? 58.812  -5.988  4.770  1.00 37.01 ? 988  GLN A CB  1 
ATOM   2522  C  CG  . GLN A 1 335 ? 57.837  -4.823  4.625  1.00 38.46 ? 988  GLN A CG  1 
ATOM   2523  C  CD  . GLN A 1 335 ? 57.577  -4.120  5.961  1.00 37.55 ? 988  GLN A CD  1 
ATOM   2524  O  OE1 . GLN A 1 335 ? 57.300  -4.766  6.972  1.00 38.26 ? 988  GLN A OE1 1 
ATOM   2525  N  NE2 . GLN A 1 335 ? 57.665  -2.801  5.962  1.00 37.39 ? 988  GLN A NE2 1 
ATOM   2526  N  N   . GLU A 1 336 ? 61.669  -7.295  4.590  1.00 40.38 ? 989  GLU A N   1 
ATOM   2527  C  CA  . GLU A 1 336 ? 62.496  -8.470  4.788  1.00 41.72 ? 989  GLU A CA  1 
ATOM   2528  C  C   . GLU A 1 336 ? 63.539  -8.074  5.811  1.00 40.04 ? 989  GLU A C   1 
ATOM   2529  O  O   . GLU A 1 336 ? 63.666  -8.707  6.851  1.00 40.04 ? 989  GLU A O   1 
ATOM   2530  C  CB  . GLU A 1 336 ? 63.171  -8.894  3.473  1.00 43.20 ? 989  GLU A CB  1 
ATOM   2531  C  CG  . GLU A 1 336 ? 63.781  -10.319 3.502  1.00 46.51 ? 989  GLU A CG  1 
ATOM   2532  C  CD  . GLU A 1 336 ? 65.019  -10.442 4.372  1.00 49.04 ? 989  GLU A CD  1 
ATOM   2533  O  OE1 . GLU A 1 336 ? 65.958  -9.630  4.192  1.00 51.28 ? 989  GLU A OE1 1 
ATOM   2534  O  OE2 . GLU A 1 336 ? 65.063  -11.353 5.232  1.00 50.16 ? 989  GLU A OE2 1 
ATOM   2535  N  N   . SER A 1 337 ? 64.263  -7.003  5.517  1.00 39.29 ? 990  SER A N   1 
ATOM   2536  C  CA  . SER A 1 337 ? 65.329  -6.527  6.414  1.00 40.16 ? 990  SER A CA  1 
ATOM   2537  C  C   . SER A 1 337 ? 64.881  -6.256  7.836  1.00 38.43 ? 990  SER A C   1 
ATOM   2538  O  O   . SER A 1 337 ? 65.327  -6.917  8.782  1.00 39.54 ? 990  SER A O   1 
ATOM   2539  C  CB  . SER A 1 337 ? 65.975  -5.262  5.864  1.00 40.61 ? 990  SER A CB  1 
ATOM   2540  O  OG  . SER A 1 337 ? 67.090  -4.975  6.656  1.00 44.52 ? 990  SER A OG  1 
ATOM   2541  N  N   . PHE A 1 338 ? 63.978  -5.299  7.979  1.00 37.57 ? 991  PHE A N   1 
ATOM   2542  C  CA  . PHE A 1 338 ? 63.471  -4.941  9.279  1.00 38.39 ? 991  PHE A CA  1 
ATOM   2543  C  C   . PHE A 1 338 ? 62.943  -6.119  10.099 1.00 39.25 ? 991  PHE A C   1 
ATOM   2544  O  O   . PHE A 1 338 ? 62.977  -6.075  11.325 1.00 42.11 ? 991  PHE A O   1 
ATOM   2545  C  CB  . PHE A 1 338 ? 62.374  -3.913  9.129  1.00 37.35 ? 991  PHE A CB  1 
ATOM   2546  C  CG  . PHE A 1 338 ? 62.024  -3.218  10.405 1.00 37.52 ? 991  PHE A CG  1 
ATOM   2547  C  CD1 . PHE A 1 338 ? 62.839  -2.183  10.895 1.00 36.84 ? 991  PHE A CD1 1 
ATOM   2548  C  CD2 . PHE A 1 338 ? 60.903  -3.593  11.136 1.00 36.14 ? 991  PHE A CD2 1 
ATOM   2549  C  CE1 . PHE A 1 338 ? 62.521  -1.528  12.080 1.00 35.54 ? 991  PHE A CE1 1 
ATOM   2550  C  CE2 . PHE A 1 338 ? 60.585  -2.936  12.327 1.00 36.07 ? 991  PHE A CE2 1 
ATOM   2551  C  CZ  . PHE A 1 338 ? 61.402  -1.914  12.796 1.00 35.57 ? 991  PHE A CZ  1 
ATOM   2552  N  N   . ILE A 1 339 ? 62.418  -7.155  9.454  1.00 40.65 ? 992  ILE A N   1 
ATOM   2553  C  CA  . ILE A 1 339 ? 61.918  -8.303  10.203 1.00 42.73 ? 992  ILE A CA  1 
ATOM   2554  C  C   . ILE A 1 339 ? 63.070  -9.207  10.652 1.00 42.99 ? 992  ILE A C   1 
ATOM   2555  O  O   . ILE A 1 339 ? 63.086  -9.717  11.779 1.00 43.97 ? 992  ILE A O   1 
ATOM   2556  C  CB  . ILE A 1 339 ? 60.946  -9.157  9.367  1.00 43.68 ? 992  ILE A CB  1 
ATOM   2557  C  CG1 . ILE A 1 339 ? 59.636  -8.409  9.165  1.00 44.29 ? 992  ILE A CG1 1 
ATOM   2558  C  CG2 . ILE A 1 339 ? 60.658  -10.493 10.080 1.00 43.91 ? 992  ILE A CG2 1 
ATOM   2559  C  CD1 . ILE A 1 339 ? 58.675  -9.100  8.210  1.00 43.71 ? 992  ILE A CD1 1 
ATOM   2560  N  N   . THR A 1 340 ? 64.037  -9.394  9.763  1.00 43.48 ? 993  THR A N   1 
ATOM   2561  C  CA  . THR A 1 340 ? 65.171  -10.246 10.047 1.00 43.79 ? 993  THR A CA  1 
ATOM   2562  C  C   . THR A 1 340 ? 66.083  -9.718  11.118 1.00 43.60 ? 993  THR A C   1 
ATOM   2563  O  O   . THR A 1 340 ? 66.580  -10.489 11.943 1.00 41.85 ? 993  THR A O   1 
ATOM   2564  C  CB  . THR A 1 340 ? 66.027  -10.474 8.771  1.00 44.36 ? 993  THR A CB  1 
ATOM   2565  O  OG1 . THR A 1 340 ? 65.312  -11.325 7.880  1.00 44.13 ? 993  THR A OG1 1 
ATOM   2566  C  CG2 . THR A 1 340 ? 67.403  -11.111 9.106  1.00 43.38 ? 993  THR A CG2 1 
ATOM   2567  N  N   . HIS A 1 341 ? 66.282  -8.400  11.101 1.00 45.57 ? 994  HIS A N   1 
ATOM   2568  C  CA  . HIS A 1 341 ? 67.210  -7.712  12.017 1.00 46.89 ? 994  HIS A CA  1 
ATOM   2569  C  C   . HIS A 1 341 ? 66.702  -7.069  13.307 1.00 46.39 ? 994  HIS A C   1 
ATOM   2570  O  O   . HIS A 1 341 ? 67.493  -6.846  14.236 1.00 46.76 ? 994  HIS A O   1 
ATOM   2571  C  CB  . HIS A 1 341 ? 67.966  -6.618  11.253 1.00 47.68 ? 994  HIS A CB  1 
ATOM   2572  C  CG  . HIS A 1 341 ? 68.793  -7.123  10.110 1.00 49.88 ? 994  HIS A CG  1 
ATOM   2573  N  ND1 . HIS A 1 341 ? 69.706  -8.150  10.239 1.00 50.41 ? 994  HIS A ND1 1 
ATOM   2574  C  CD2 . HIS A 1 341 ? 68.839  -6.741  8.811  1.00 51.54 ? 994  HIS A CD2 1 
ATOM   2575  C  CE1 . HIS A 1 341 ? 70.274  -8.382  9.068  1.00 51.56 ? 994  HIS A CE1 1 
ATOM   2576  N  NE2 . HIS A 1 341 ? 69.765  -7.541  8.184  1.00 52.18 ? 994  HIS A NE2 1 
ATOM   2577  N  N   . ILE A 1 342 ? 65.413  -6.735  13.360 1.00 44.31 ? 995  ILE A N   1 
ATOM   2578  C  CA  . ILE A 1 342 ? 64.857  -6.075  14.538 1.00 42.35 ? 995  ILE A CA  1 
ATOM   2579  C  C   . ILE A 1 342 ? 63.725  -6.824  15.206 1.00 42.24 ? 995  ILE A C   1 
ATOM   2580  O  O   . ILE A 1 342 ? 63.833  -7.212  16.368 1.00 43.14 ? 995  ILE A O   1 
ATOM   2581  C  CB  . ILE A 1 342 ? 64.320  -4.664  14.201 1.00 41.93 ? 995  ILE A CB  1 
ATOM   2582  C  CG1 . ILE A 1 342 ? 65.428  -3.791  13.616 1.00 43.67 ? 995  ILE A CG1 1 
ATOM   2583  C  CG2 . ILE A 1 342 ? 63.771  -4.007  15.455 1.00 42.22 ? 995  ILE A CG2 1 
ATOM   2584  C  CD1 . ILE A 1 342 ? 65.756  -4.105  12.195 1.00 46.03 ? 995  ILE A CD1 1 
ATOM   2585  N  N   . VAL A 1 343 ? 62.626  -7.007  14.476 1.00 41.55 ? 996  VAL A N   1 
ATOM   2586  C  CA  . VAL A 1 343 ? 61.459  -7.685  15.026 1.00 40.40 ? 996  VAL A CA  1 
ATOM   2587  C  C   . VAL A 1 343 ? 61.766  -9.123  15.395 1.00 39.79 ? 996  VAL A C   1 
ATOM   2588  O  O   . VAL A 1 343 ? 61.567  -9.524  16.532 1.00 39.52 ? 996  VAL A O   1 
ATOM   2589  C  CB  . VAL A 1 343 ? 60.278  -7.662  14.047 1.00 39.45 ? 996  VAL A CB  1 
ATOM   2590  C  CG1 . VAL A 1 343 ? 59.011  -7.950  14.787 1.00 39.86 ? 996  VAL A CG1 1 
ATOM   2591  C  CG2 . VAL A 1 343 ? 60.187  -6.331  13.374 1.00 40.25 ? 996  VAL A CG2 1 
ATOM   2592  N  N   . GLY A 1 344 ? 62.266  -9.892  14.435 1.00 40.74 ? 997  GLY A N   1 
ATOM   2593  C  CA  . GLY A 1 344 ? 62.595  -11.295 14.687 1.00 40.07 ? 997  GLY A CA  1 
ATOM   2594  C  C   . GLY A 1 344 ? 63.371  -11.576 15.961 1.00 38.48 ? 997  GLY A C   1 
ATOM   2595  O  O   . GLY A 1 344 ? 62.840  -12.185 16.897 1.00 37.42 ? 997  GLY A O   1 
ATOM   2596  N  N   . PRO A 1 345 ? 64.633  -11.145 16.035 1.00 38.23 ? 998  PRO A N   1 
ATOM   2597  C  CA  . PRO A 1 345 ? 65.416  -11.400 17.254 1.00 38.75 ? 998  PRO A CA  1 
ATOM   2598  C  C   . PRO A 1 345 ? 64.728  -10.958 18.537 1.00 39.33 ? 998  PRO A C   1 
ATOM   2599  O  O   . PRO A 1 345 ? 64.823  -11.630 19.567 1.00 39.61 ? 998  PRO A O   1 
ATOM   2600  C  CB  . PRO A 1 345 ? 66.737  -10.671 16.989 1.00 38.83 ? 998  PRO A CB  1 
ATOM   2601  C  CG  . PRO A 1 345 ? 66.474  -9.810  15.780 1.00 39.45 ? 998  PRO A CG  1 
ATOM   2602  C  CD  . PRO A 1 345 ? 65.464  -10.555 14.981 1.00 37.87 ? 998  PRO A CD  1 
ATOM   2603  N  N   . LEU A 1 346 ? 64.017  -9.836  18.463 1.00 39.49 ? 999  LEU A N   1 
ATOM   2604  C  CA  . LEU A 1 346 ? 63.304  -9.313  19.610 1.00 39.41 ? 999  LEU A CA  1 
ATOM   2605  C  C   . LEU A 1 346 ? 62.243  -10.303 20.086 1.00 41.09 ? 999  LEU A C   1 
ATOM   2606  O  O   . LEU A 1 346 ? 62.224  -10.681 21.265 1.00 41.52 ? 999  LEU A O   1 
ATOM   2607  C  CB  . LEU A 1 346 ? 62.662  -7.961  19.267 1.00 40.04 ? 999  LEU A CB  1 
ATOM   2608  C  CG  . LEU A 1 346 ? 61.962  -7.221  20.418 1.00 38.68 ? 999  LEU A CG  1 
ATOM   2609  C  CD1 . LEU A 1 346 ? 62.923  -7.029  21.582 1.00 36.70 ? 999  LEU A CD1 1 
ATOM   2610  C  CD2 . LEU A 1 346 ? 61.473  -5.881  19.931 1.00 40.10 ? 999  LEU A CD2 1 
ATOM   2611  N  N   . CYS A 1 347 ? 61.354  -10.735 19.193 1.00 42.65 ? 1000 CYS A N   1 
ATOM   2612  C  CA  . CYS A 1 347 ? 60.327  -11.712 19.597 1.00 44.41 ? 1000 CYS A CA  1 
ATOM   2613  C  C   . CYS A 1 347 ? 61.004  -13.008 20.030 1.00 44.33 ? 1000 CYS A C   1 
ATOM   2614  O  O   . CYS A 1 347 ? 60.570  -13.640 20.981 1.00 43.09 ? 1000 CYS A O   1 
ATOM   2615  C  CB  . CYS A 1 347 ? 59.358  -11.985 18.443 1.00 46.33 ? 1000 CYS A CB  1 
ATOM   2616  S  SG  . CYS A 1 347 ? 58.445  -10.517 17.897 1.00 48.98 ? 1000 CYS A SG  1 
ATOM   2617  N  N   . ASN A 1 348 ? 62.077  -13.380 19.324 1.00 45.13 ? 1001 ASN A N   1 
ATOM   2618  C  CA  . ASN A 1 348 ? 62.845  -14.574 19.644 1.00 46.04 ? 1001 ASN A CA  1 
ATOM   2619  C  C   . ASN A 1 348 ? 63.283  -14.550 21.081 1.00 46.24 ? 1001 ASN A C   1 
ATOM   2620  O  O   . ASN A 1 348 ? 63.080  -15.532 21.804 1.00 46.93 ? 1001 ASN A O   1 
ATOM   2621  C  CB  . ASN A 1 348 ? 64.105  -14.689 18.798 1.00 48.44 ? 1001 ASN A CB  1 
ATOM   2622  C  CG  . ASN A 1 348 ? 63.822  -15.123 17.381 1.00 50.99 ? 1001 ASN A CG  1 
ATOM   2623  O  OD1 . ASN A 1 348 ? 62.847  -15.843 17.120 1.00 51.30 ? 1001 ASN A OD1 1 
ATOM   2624  N  ND2 . ASN A 1 348 ? 64.696  -14.711 16.445 1.00 52.30 ? 1001 ASN A ND2 1 
ATOM   2625  N  N   . SER A 1 349 ? 63.914  -13.443 21.489 1.00 45.98 ? 1002 SER A N   1 
ATOM   2626  C  CA  . SER A 1 349 ? 64.379  -13.276 22.877 1.00 45.34 ? 1002 SER A CA  1 
ATOM   2627  C  C   . SER A 1 349 ? 63.239  -13.309 23.901 1.00 44.40 ? 1002 SER A C   1 
ATOM   2628  O  O   . SER A 1 349 ? 63.327  -14.009 24.911 1.00 44.43 ? 1002 SER A O   1 
ATOM   2629  C  CB  . SER A 1 349 ? 65.107  -11.946 23.039 1.00 45.49 ? 1002 SER A CB  1 
ATOM   2630  O  OG  . SER A 1 349 ? 66.226  -11.892 22.193 1.00 49.18 ? 1002 SER A OG  1 
ATOM   2631  N  N   . TYR A 1 350 ? 62.186  -12.533 23.647 1.00 43.10 ? 1003 TYR A N   1 
ATOM   2632  C  CA  . TYR A 1 350 ? 61.054  -12.452 24.560 1.00 43.86 ? 1003 TYR A CA  1 
ATOM   2633  C  C   . TYR A 1 350 ? 60.462  -13.840 24.762 1.00 44.41 ? 1003 TYR A C   1 
ATOM   2634  O  O   . TYR A 1 350 ? 60.147  -14.259 25.885 1.00 42.93 ? 1003 TYR A O   1 
ATOM   2635  C  CB  . TYR A 1 350 ? 59.993  -11.502 23.990 1.00 44.44 ? 1003 TYR A CB  1 
ATOM   2636  C  CG  . TYR A 1 350 ? 59.023  -10.921 25.002 1.00 45.16 ? 1003 TYR A CG  1 
ATOM   2637  C  CD1 . TYR A 1 350 ? 59.395  -9.844  25.823 1.00 46.14 ? 1003 TYR A CD1 1 
ATOM   2638  C  CD2 . TYR A 1 350 ? 57.719  -11.415 25.113 1.00 46.89 ? 1003 TYR A CD2 1 
ATOM   2639  C  CE1 . TYR A 1 350 ? 58.495  -9.266  26.719 1.00 44.58 ? 1003 TYR A CE1 1 
ATOM   2640  C  CE2 . TYR A 1 350 ? 56.806  -10.844 26.007 1.00 47.19 ? 1003 TYR A CE2 1 
ATOM   2641  C  CZ  . TYR A 1 350 ? 57.211  -9.769  26.798 1.00 47.09 ? 1003 TYR A CZ  1 
ATOM   2642  O  OH  . TYR A 1 350 ? 56.303  -9.187  27.629 1.00 48.13 ? 1003 TYR A OH  1 
ATOM   2643  N  N   . ASP A 1 351 ? 60.317  -14.554 23.649 1.00 46.42 ? 1004 ASP A N   1 
ATOM   2644  C  CA  . ASP A 1 351 ? 59.773  -15.899 23.653 1.00 46.66 ? 1004 ASP A CA  1 
ATOM   2645  C  C   . ASP A 1 351 ? 60.688  -16.900 24.369 1.00 47.64 ? 1004 ASP A C   1 
ATOM   2646  O  O   . ASP A 1 351 ? 60.222  -17.752 25.141 1.00 47.82 ? 1004 ASP A O   1 
ATOM   2647  C  CB  . ASP A 1 351 ? 59.563  -16.355 22.226 1.00 46.82 ? 1004 ASP A CB  1 
ATOM   2648  C  CG  . ASP A 1 351 ? 58.932  -17.720 22.150 1.00 45.83 ? 1004 ASP A CG  1 
ATOM   2649  O  OD1 . ASP A 1 351 ? 59.485  -18.569 21.431 1.00 45.85 ? 1004 ASP A OD1 1 
ATOM   2650  O  OD2 . ASP A 1 351 ? 57.891  -17.927 22.814 1.00 45.74 ? 1004 ASP A OD2 1 
ATOM   2651  N  N   . ALA A 1 352 ? 61.985  -16.809 24.096 1.00 46.60 ? 1005 ALA A N   1 
ATOM   2652  C  CA  . ALA A 1 352 ? 62.936  -17.711 24.723 1.00 46.87 ? 1005 ALA A CA  1 
ATOM   2653  C  C   . ALA A 1 352 ? 62.982  -17.444 26.216 1.00 47.61 ? 1005 ALA A C   1 
ATOM   2654  O  O   . ALA A 1 352 ? 63.539  -18.239 26.969 1.00 49.25 ? 1005 ALA A O   1 
ATOM   2655  C  CB  . ALA A 1 352 ? 64.332  -17.532 24.112 1.00 45.94 ? 1005 ALA A CB  1 
ATOM   2656  N  N   . ALA A 1 353 ? 62.399  -16.335 26.661 1.00 47.51 ? 1006 ALA A N   1 
ATOM   2657  C  CA  . ALA A 1 353 ? 62.425  -16.031 28.086 1.00 48.11 ? 1006 ALA A CA  1 
ATOM   2658  C  C   . ALA A 1 353 ? 61.177  -16.575 28.751 1.00 48.45 ? 1006 ALA A C   1 
ATOM   2659  O  O   . ALA A 1 353 ? 61.037  -16.493 29.964 1.00 49.79 ? 1006 ALA A O   1 
ATOM   2660  C  CB  . ALA A 1 353 ? 62.539  -14.520 28.314 1.00 47.13 ? 1006 ALA A CB  1 
ATOM   2661  N  N   . GLY A 1 354 ? 60.273  -17.129 27.954 1.00 48.76 ? 1007 GLY A N   1 
ATOM   2662  C  CA  . GLY A 1 354 ? 59.038  -17.694 28.485 1.00 49.76 ? 1007 GLY A CA  1 
ATOM   2663  C  C   . GLY A 1 354 ? 57.942  -16.686 28.810 1.00 50.37 ? 1007 GLY A C   1 
ATOM   2664  O  O   . GLY A 1 354 ? 57.042  -16.975 29.607 1.00 51.01 ? 1007 GLY A O   1 
ATOM   2665  N  N   . LEU A 1 355 ? 57.985  -15.519 28.169 1.00 49.64 ? 1008 LEU A N   1 
ATOM   2666  C  CA  . LEU A 1 355 ? 57.016  -14.457 28.449 1.00 46.93 ? 1008 LEU A CA  1 
ATOM   2667  C  C   . LEU A 1 355 ? 55.894  -14.306 27.429 1.00 46.54 ? 1008 LEU A C   1 
ATOM   2668  O  O   . LEU A 1 355 ? 54.967  -13.535 27.641 1.00 46.46 ? 1008 LEU A O   1 
ATOM   2669  C  CB  . LEU A 1 355 ? 57.745  -13.111 28.597 1.00 45.51 ? 1008 LEU A CB  1 
ATOM   2670  C  CG  . LEU A 1 355 ? 59.042  -13.032 29.414 1.00 44.51 ? 1008 LEU A CG  1 
ATOM   2671  C  CD1 . LEU A 1 355 ? 59.399  -11.588 29.617 1.00 45.46 ? 1008 LEU A CD1 1 
ATOM   2672  C  CD2 . LEU A 1 355 ? 58.904  -13.700 30.761 1.00 44.30 ? 1008 LEU A CD2 1 
ATOM   2673  N  N   . LEU A 1 356 ? 55.956  -15.023 26.317 1.00 46.52 ? 1009 LEU A N   1 
ATOM   2674  C  CA  . LEU A 1 356 ? 54.889  -14.883 25.348 1.00 47.32 ? 1009 LEU A CA  1 
ATOM   2675  C  C   . LEU A 1 356 ? 53.636  -15.624 25.757 1.00 49.95 ? 1009 LEU A C   1 
ATOM   2676  O  O   . LEU A 1 356 ? 53.684  -16.788 26.206 1.00 50.39 ? 1009 LEU A O   1 
ATOM   2677  C  CB  . LEU A 1 356 ? 55.325  -15.343 23.959 1.00 45.70 ? 1009 LEU A CB  1 
ATOM   2678  C  CG  . LEU A 1 356 ? 56.216  -14.360 23.197 1.00 46.98 ? 1009 LEU A CG  1 
ATOM   2679  C  CD1 . LEU A 1 356 ? 56.608  -14.932 21.852 1.00 46.21 ? 1009 LEU A CD1 1 
ATOM   2680  C  CD2 . LEU A 1 356 ? 55.484  -13.041 23.012 1.00 47.12 ? 1009 LEU A CD2 1 
ATOM   2681  N  N   . PRO A 1 357 ? 52.489  -14.939 25.656 1.00 50.09 ? 1010 PRO A N   1 
ATOM   2682  C  CA  . PRO A 1 357 ? 51.224  -15.584 26.016 1.00 51.27 ? 1010 PRO A CA  1 
ATOM   2683  C  C   . PRO A 1 357 ? 50.901  -16.568 24.888 1.00 51.62 ? 1010 PRO A C   1 
ATOM   2684  O  O   . PRO A 1 357 ? 51.097  -16.259 23.719 1.00 51.12 ? 1010 PRO A O   1 
ATOM   2685  C  CB  . PRO A 1 357 ? 50.236  -14.407 26.140 1.00 50.86 ? 1010 PRO A CB  1 
ATOM   2686  C  CG  . PRO A 1 357 ? 50.852  -13.305 25.354 1.00 51.17 ? 1010 PRO A CG  1 
ATOM   2687  C  CD  . PRO A 1 357 ? 52.342  -13.482 25.487 1.00 51.27 ? 1010 PRO A CD  1 
ATOM   2688  N  N   . GLY A 1 358 ? 50.478  -17.775 25.255 1.00 52.88 ? 1011 GLY A N   1 
ATOM   2689  C  CA  . GLY A 1 358 ? 50.162  -18.796 24.269 1.00 54.57 ? 1011 GLY A CA  1 
ATOM   2690  C  C   . GLY A 1 358 ? 49.383  -19.953 24.880 1.00 56.39 ? 1011 GLY A C   1 
ATOM   2691  O  O   . GLY A 1 358 ? 48.711  -19.798 25.896 1.00 56.24 ? 1011 GLY A O   1 
ATOM   2692  N  N   . GLN A 1 359 ? 49.474  -21.132 24.283 1.00 58.14 ? 1012 GLN A N   1 
ATOM   2693  C  CA  . GLN A 1 359 ? 48.731  -22.268 24.818 1.00 60.49 ? 1012 GLN A CA  1 
ATOM   2694  C  C   . GLN A 1 359 ? 49.453  -23.600 24.646 1.00 60.24 ? 1012 GLN A C   1 
ATOM   2695  O  O   . GLN A 1 359 ? 50.216  -23.793 23.687 1.00 59.56 ? 1012 GLN A O   1 
ATOM   2696  C  CB  . GLN A 1 359 ? 47.371  -22.351 24.130 1.00 62.32 ? 1012 GLN A CB  1 
ATOM   2697  C  CG  . GLN A 1 359 ? 47.526  -22.656 22.656 1.00 65.40 ? 1012 GLN A CG  1 
ATOM   2698  C  CD  . GLN A 1 359 ? 46.234  -22.555 21.897 1.00 68.05 ? 1012 GLN A CD  1 
ATOM   2699  O  OE1 . GLN A 1 359 ? 45.224  -23.159 22.282 1.00 70.40 ? 1012 GLN A OE1 1 
ATOM   2700  N  NE2 . GLN A 1 359 ? 46.250  -21.797 20.802 1.00 68.32 ? 1012 GLN A NE2 1 
ATOM   2701  N  N   . TRP A 1 360 ? 49.194  -24.511 25.585 1.00 61.10 ? 1013 TRP A N   1 
ATOM   2702  C  CA  . TRP A 1 360 ? 49.774  -25.854 25.551 1.00 62.04 ? 1013 TRP A CA  1 
ATOM   2703  C  C   . TRP A 1 360 ? 49.093  -26.676 24.456 1.00 63.42 ? 1013 TRP A C   1 
ATOM   2704  O  O   . TRP A 1 360 ? 47.924  -26.443 24.116 1.00 62.37 ? 1013 TRP A O   1 
ATOM   2705  C  CB  . TRP A 1 360 ? 49.560  -26.578 26.877 1.00 60.85 ? 1013 TRP A CB  1 
ATOM   2706  C  CG  . TRP A 1 360 ? 50.202  -25.955 28.051 1.00 59.32 ? 1013 TRP A CG  1 
ATOM   2707  C  CD1 . TRP A 1 360 ? 49.572  -25.428 29.144 1.00 58.90 ? 1013 TRP A CD1 1 
ATOM   2708  C  CD2 . TRP A 1 360 ? 51.607  -25.823 28.292 1.00 58.20 ? 1013 TRP A CD2 1 
ATOM   2709  N  NE1 . TRP A 1 360 ? 50.500  -24.979 30.055 1.00 59.12 ? 1013 TRP A NE1 1 
ATOM   2710  C  CE2 . TRP A 1 360 ? 51.758  -25.211 29.556 1.00 57.83 ? 1013 TRP A CE2 1 
ATOM   2711  C  CE3 . TRP A 1 360 ? 52.757  -26.168 27.562 1.00 58.02 ? 1013 TRP A CE3 1 
ATOM   2712  C  CZ2 . TRP A 1 360 ? 53.004  -24.931 30.105 1.00 56.70 ? 1013 TRP A CZ2 1 
ATOM   2713  C  CZ3 . TRP A 1 360 ? 54.001  -25.892 28.105 1.00 56.59 ? 1013 TRP A CZ3 1 
ATOM   2714  C  CH2 . TRP A 1 360 ? 54.113  -25.279 29.369 1.00 57.09 ? 1013 TRP A CH2 1 
ATOM   2715  N  N   . LEU A 1 361 ? 49.838  -27.640 23.922 1.00 65.51 ? 1014 LEU A N   1 
ATOM   2716  C  CA  . LEU A 1 361 ? 49.336  -28.526 22.884 1.00 68.10 ? 1014 LEU A CA  1 
ATOM   2717  C  C   . LEU A 1 361 ? 49.371  -29.987 23.324 1.00 70.37 ? 1014 LEU A C   1 
ATOM   2718  O  O   . LEU A 1 361 ? 48.381  -30.714 23.169 1.00 70.62 ? 1014 LEU A O   1 
ATOM   2719  C  CB  . LEU A 1 361 ? 50.159  -28.378 21.610 1.00 67.17 ? 1014 LEU A CB  1 
ATOM   2720  C  CG  . LEU A 1 361 ? 49.892  -27.133 20.780 1.00 67.21 ? 1014 LEU A CG  1 
ATOM   2721  C  CD1 . LEU A 1 361 ? 50.642  -27.307 19.457 1.00 66.16 ? 1014 LEU A CD1 1 
ATOM   2722  C  CD2 . LEU A 1 361 ? 48.374  -26.942 20.542 1.00 66.18 ? 1014 LEU A CD2 1 
ATOM   2723  N  N   . GLU A 1 362 ? 50.516  -30.415 23.862 1.00 72.60 ? 1015 GLU A N   1 
ATOM   2724  C  CA  . GLU A 1 362 ? 50.682  -31.798 24.315 1.00 74.45 ? 1015 GLU A CA  1 
ATOM   2725  C  C   . GLU A 1 362 ? 50.671  -32.751 23.108 1.00 75.18 ? 1015 GLU A C   1 
ATOM   2726  O  O   . GLU A 1 362 ? 51.351  -32.416 22.100 1.00 75.73 ? 1015 GLU A O   1 
ATOM   2727  C  CB  . GLU A 1 362 ? 49.554  -32.181 25.285 1.00 75.70 ? 1015 GLU A CB  1 
ATOM   2728  C  CG  . GLU A 1 362 ? 49.379  -31.229 26.450 1.00 76.69 ? 1015 GLU A CG  1 
ATOM   2729  C  CD  . GLU A 1 362 ? 47.915  -30.996 26.773 1.00 78.20 ? 1015 GLU A CD  1 
ATOM   2730  O  OE1 . GLU A 1 362 ? 47.173  -31.996 26.958 1.00 78.78 ? 1015 GLU A OE1 1 
ATOM   2731  O  OE2 . GLU A 1 362 ? 47.501  -29.814 26.844 1.00 78.09 ? 1015 GLU A OE2 1 
ATOM   2732  N  N   . SER A 1 400 ? 50.672  -29.587 16.504 1.00 74.32 ? 1053 SER A N   1 
ATOM   2733  C  CA  . SER A 1 400 ? 51.966  -29.814 15.771 1.00 75.64 ? 1053 SER A CA  1 
ATOM   2734  C  C   . SER A 1 400 ? 52.937  -30.713 16.584 1.00 76.05 ? 1053 SER A C   1 
ATOM   2735  O  O   . SER A 1 400 ? 52.496  -31.604 17.325 1.00 76.07 ? 1053 SER A O   1 
ATOM   2736  C  CB  . SER A 1 400 ? 52.632  -28.445 15.450 1.00 74.89 ? 1053 SER A CB  1 
ATOM   2737  N  N   . ARG A 1 401 ? 54.249  -30.489 16.431 1.00 76.17 ? 1054 ARG A N   1 
ATOM   2738  C  CA  . ARG A 1 401 ? 55.268  -31.265 17.168 1.00 75.87 ? 1054 ARG A CA  1 
ATOM   2739  C  C   . ARG A 1 401 ? 55.666  -30.614 18.512 1.00 75.40 ? 1054 ARG A C   1 
ATOM   2740  O  O   . ARG A 1 401 ? 55.978  -31.328 19.469 1.00 75.23 ? 1054 ARG A O   1 
ATOM   2741  C  CB  . ARG A 1 401 ? 56.531  -31.476 16.305 1.00 75.08 ? 1054 ARG A CB  1 
ATOM   2742  C  CG  . ARG A 1 401 ? 56.325  -32.413 15.112 1.00 75.11 ? 1054 ARG A CG  1 
ATOM   2743  C  CD  . ARG A 1 401 ? 56.021  -33.851 15.563 1.00 74.40 ? 1054 ARG A CD  1 
ATOM   2744  N  NE  . ARG A 1 401 ? 55.270  -34.614 14.559 1.00 74.10 ? 1054 ARG A NE  1 
ATOM   2745  C  CZ  . ARG A 1 401 ? 53.941  -34.739 14.546 1.00 74.32 ? 1054 ARG A CZ  1 
ATOM   2746  N  NH1 . ARG A 1 401 ? 53.207  -34.153 15.485 1.00 75.05 ? 1054 ARG A NH1 1 
ATOM   2747  N  NH2 . ARG A 1 401 ? 53.338  -35.450 13.595 1.00 73.78 ? 1054 ARG A NH2 1 
ATOM   2748  N  N   . ARG A 1 402 ? 55.650  -29.273 18.575 1.00 74.72 ? 1055 ARG A N   1 
ATOM   2749  C  CA  . ARG A 1 402 ? 55.998  -28.519 19.799 1.00 73.66 ? 1055 ARG A CA  1 
ATOM   2750  C  C   . ARG A 1 402 ? 54.838  -28.522 20.831 1.00 72.75 ? 1055 ARG A C   1 
ATOM   2751  O  O   . ARG A 1 402 ? 53.663  -28.701 20.460 1.00 72.85 ? 1055 ARG A O   1 
ATOM   2752  C  CB  . ARG A 1 402 ? 56.393  -27.068 19.429 1.00 73.09 ? 1055 ARG A CB  1 
ATOM   2753  N  N   . ARG A 1 403 ? 55.155  -28.314 22.115 1.00 70.71 ? 1056 ARG A N   1 
ATOM   2754  C  CA  . ARG A 1 403 ? 54.118  -28.347 23.150 1.00 68.73 ? 1056 ARG A CA  1 
ATOM   2755  C  C   . ARG A 1 403 ? 53.383  -27.022 23.358 1.00 67.35 ? 1056 ARG A C   1 
ATOM   2756  O  O   . ARG A 1 403 ? 52.331  -26.977 24.008 1.00 67.45 ? 1056 ARG A O   1 
ATOM   2757  C  CB  . ARG A 1 403 ? 54.692  -28.836 24.497 1.00 69.22 ? 1056 ARG A CB  1 
ATOM   2758  C  CG  . ARG A 1 403 ? 53.665  -29.646 25.321 1.00 68.93 ? 1056 ARG A CG  1 
ATOM   2759  C  CD  . ARG A 1 403 ? 54.013  -29.759 26.811 1.00 69.48 ? 1056 ARG A CD  1 
ATOM   2760  N  NE  . ARG A 1 403 ? 52.793  -29.740 27.640 1.00 69.47 ? 1056 ARG A NE  1 
ATOM   2761  C  CZ  . ARG A 1 403 ? 52.769  -29.501 28.954 1.00 68.54 ? 1056 ARG A CZ  1 
ATOM   2762  N  NH1 . ARG A 1 403 ? 53.905  -29.264 29.610 1.00 66.68 ? 1056 ARG A NH1 1 
ATOM   2763  N  NH2 . ARG A 1 403 ? 51.604  -29.465 29.604 1.00 67.44 ? 1056 ARG A NH2 1 
ATOM   2764  N  N   . ILE A 1 404 ? 53.920  -25.943 22.797 1.00 65.40 ? 1057 ILE A N   1 
ATOM   2765  C  CA  . ILE A 1 404 ? 53.284  -24.633 22.946 1.00 62.56 ? 1057 ILE A CA  1 
ATOM   2766  C  C   . ILE A 1 404 ? 52.991  -23.950 21.608 1.00 60.91 ? 1057 ILE A C   1 
ATOM   2767  O  O   . ILE A 1 404 ? 53.856  -23.869 20.732 1.00 59.27 ? 1057 ILE A O   1 
ATOM   2768  C  CB  . ILE A 1 404 ? 54.169  -23.674 23.817 1.00 61.94 ? 1057 ILE A CB  1 
ATOM   2769  C  CG1 . ILE A 1 404 ? 54.338  -24.265 25.216 1.00 60.66 ? 1057 ILE A CG1 1 
ATOM   2770  C  CG2 . ILE A 1 404 ? 53.523  -22.264 23.903 1.00 61.27 ? 1057 ILE A CG2 1 
ATOM   2771  C  CD1 . ILE A 1 404 ? 55.293  -23.478 26.091 1.00 59.87 ? 1057 ILE A CD1 1 
ATOM   2772  N  N   . PHE A 1 405 ? 51.762  -23.464 21.453 1.00 59.31 ? 1058 PHE A N   1 
ATOM   2773  C  CA  . PHE A 1 405 ? 51.398  -22.748 20.227 1.00 57.88 ? 1058 PHE A CA  1 
ATOM   2774  C  C   . PHE A 1 405 ? 51.381  -21.243 20.530 1.00 57.15 ? 1058 PHE A C   1 
ATOM   2775  O  O   . PHE A 1 405 ? 50.614  -20.784 21.382 1.00 56.60 ? 1058 PHE A O   1 
ATOM   2776  C  CB  . PHE A 1 405 ? 50.013  -23.180 19.703 1.00 54.82 ? 1058 PHE A CB  1 
ATOM   2777  C  CG  . PHE A 1 405 ? 49.519  -22.325 18.570 1.00 52.68 ? 1058 PHE A CG  1 
ATOM   2778  C  CD1 . PHE A 1 405 ? 50.159  -22.350 17.342 1.00 51.18 ? 1058 PHE A CD1 1 
ATOM   2779  C  CD2 . PHE A 1 405 ? 48.470  -21.429 18.762 1.00 52.69 ? 1058 PHE A CD2 1 
ATOM   2780  C  CE1 . PHE A 1 405 ? 49.774  -21.492 16.320 1.00 50.04 ? 1058 PHE A CE1 1 
ATOM   2781  C  CE2 . PHE A 1 405 ? 48.076  -20.566 17.747 1.00 52.11 ? 1058 PHE A CE2 1 
ATOM   2782  C  CZ  . PHE A 1 405 ? 48.735  -20.599 16.520 1.00 50.52 ? 1058 PHE A CZ  1 
ATOM   2783  N  N   . CYS A 1 406 ? 52.234  -20.483 19.844 1.00 56.89 ? 1059 CYS A N   1 
ATOM   2784  C  CA  . CYS A 1 406 ? 52.295  -19.048 20.072 1.00 55.50 ? 1059 CYS A CA  1 
ATOM   2785  C  C   . CYS A 1 406 ? 51.895  -18.349 18.791 1.00 54.04 ? 1059 CYS A C   1 
ATOM   2786  O  O   . CYS A 1 406 ? 52.636  -18.349 17.817 1.00 53.13 ? 1059 CYS A O   1 
ATOM   2787  C  CB  . CYS A 1 406 ? 53.705  -18.628 20.473 1.00 56.42 ? 1059 CYS A CB  1 
ATOM   2788  S  SG  . CYS A 1 406 ? 53.774  -16.870 20.902 1.00 59.16 ? 1059 CYS A SG  1 
ATOM   2789  N  N   . GLN A 1 407 ? 50.720  -17.741 18.818 1.00 52.45 ? 1060 GLN A N   1 
ATOM   2790  C  CA  . GLN A 1 407 ? 50.168  -17.071 17.662 1.00 52.76 ? 1060 GLN A CA  1 
ATOM   2791  C  C   . GLN A 1 407 ? 51.059  -16.057 16.950 1.00 52.71 ? 1060 GLN A C   1 
ATOM   2792  O  O   . GLN A 1 407 ? 51.194  -16.125 15.724 1.00 52.55 ? 1060 GLN A O   1 
ATOM   2793  C  CB  . GLN A 1 407 ? 48.837  -16.439 18.052 1.00 54.37 ? 1060 GLN A CB  1 
ATOM   2794  C  CG  . GLN A 1 407 ? 48.081  -15.804 16.914 1.00 58.16 ? 1060 GLN A CG  1 
ATOM   2795  C  CD  . GLN A 1 407 ? 46.597  -15.643 17.232 1.00 60.34 ? 1060 GLN A CD  1 
ATOM   2796  O  OE1 . GLN A 1 407 ? 46.224  -15.223 18.339 1.00 61.57 ? 1060 GLN A OE1 1 
ATOM   2797  N  NE2 . GLN A 1 407 ? 45.742  -15.974 16.261 1.00 60.93 ? 1060 GLN A NE2 1 
ATOM   2798  N  N   . LEU A 1 408 ? 51.677  -15.118 17.680 1.00 52.85 ? 1061 LEU A N   1 
ATOM   2799  C  CA  . LEU A 1 408 ? 52.530  -14.120 17.010 1.00 51.94 ? 1061 LEU A CA  1 
ATOM   2800  C  C   . LEU A 1 408 ? 53.737  -14.737 16.365 1.00 50.98 ? 1061 LEU A C   1 
ATOM   2801  O  O   . LEU A 1 408 ? 54.138  -14.329 15.276 1.00 51.49 ? 1061 LEU A O   1 
ATOM   2802  C  CB  . LEU A 1 408 ? 52.969  -12.995 17.946 1.00 51.72 ? 1061 LEU A CB  1 
ATOM   2803  C  CG  . LEU A 1 408 ? 53.227  -13.218 19.422 1.00 53.06 ? 1061 LEU A CG  1 
ATOM   2804  C  CD1 . LEU A 1 408 ? 53.797  -11.922 19.987 1.00 52.28 ? 1061 LEU A CD1 1 
ATOM   2805  C  CD2 . LEU A 1 408 ? 51.922  -13.611 20.152 1.00 52.70 ? 1061 LEU A CD2 1 
ATOM   2806  N  N   . MET A 1 409 ? 54.324  -15.724 17.025 1.00 50.74 ? 1062 MET A N   1 
ATOM   2807  C  CA  . MET A 1 409 ? 55.477  -16.402 16.448 1.00 50.76 ? 1062 MET A CA  1 
ATOM   2808  C  C   . MET A 1 409 ? 55.114  -16.992 15.078 1.00 50.59 ? 1062 MET A C   1 
ATOM   2809  O  O   . MET A 1 409 ? 55.924  -16.953 14.152 1.00 49.70 ? 1062 MET A O   1 
ATOM   2810  C  CB  . MET A 1 409 ? 55.968  -17.496 17.395 1.00 51.48 ? 1062 MET A CB  1 
ATOM   2811  C  CG  . MET A 1 409 ? 56.516  -16.934 18.707 1.00 52.44 ? 1062 MET A CG  1 
ATOM   2812  S  SD  . MET A 1 409 ? 57.836  -15.758 18.387 1.00 55.85 ? 1062 MET A SD  1 
ATOM   2813  C  CE  . MET A 1 409 ? 59.295  -16.892 18.240 1.00 50.83 ? 1062 MET A CE  1 
ATOM   2814  N  N   . HIS A 1 410 ? 53.907  -17.545 14.945 1.00 50.66 ? 1063 HIS A N   1 
ATOM   2815  C  CA  . HIS A 1 410 ? 53.501  -18.091 13.659 1.00 51.82 ? 1063 HIS A CA  1 
ATOM   2816  C  C   . HIS A 1 410 ? 53.240  -16.982 12.635 1.00 50.27 ? 1063 HIS A C   1 
ATOM   2817  O  O   . HIS A 1 410 ? 53.722  -17.074 11.508 1.00 50.54 ? 1063 HIS A O   1 
ATOM   2818  C  CB  . HIS A 1 410 ? 52.267  -18.987 13.810 1.00 56.29 ? 1063 HIS A CB  1 
ATOM   2819  C  CG  . HIS A 1 410 ? 52.603  -20.415 14.135 1.00 61.85 ? 1063 HIS A CG  1 
ATOM   2820  N  ND1 . HIS A 1 410 ? 53.137  -20.804 15.351 1.00 62.59 ? 1063 HIS A ND1 1 
ATOM   2821  C  CD2 . HIS A 1 410 ? 52.517  -21.544 13.385 1.00 62.46 ? 1063 HIS A CD2 1 
ATOM   2822  C  CE1 . HIS A 1 410 ? 53.365  -22.106 15.336 1.00 62.56 ? 1063 HIS A CE1 1 
ATOM   2823  N  NE2 . HIS A 1 410 ? 52.999  -22.579 14.157 1.00 63.69 ? 1063 HIS A NE2 1 
ATOM   2824  N  N   . HIS A 1 411 ? 52.497  -15.938 13.012 1.00 48.70 ? 1064 HIS A N   1 
ATOM   2825  C  CA  . HIS A 1 411 ? 52.240  -14.832 12.090 1.00 47.99 ? 1064 HIS A CA  1 
ATOM   2826  C  C   . HIS A 1 411 ? 53.565  -14.313 11.553 1.00 48.38 ? 1064 HIS A C   1 
ATOM   2827  O  O   . HIS A 1 411 ? 53.744  -14.120 10.347 1.00 47.44 ? 1064 HIS A O   1 
ATOM   2828  C  CB  . HIS A 1 411 ? 51.530  -13.666 12.783 1.00 47.44 ? 1064 HIS A CB  1 
ATOM   2829  C  CG  . HIS A 1 411 ? 50.131  -13.969 13.218 1.00 46.98 ? 1064 HIS A CG  1 
ATOM   2830  N  ND1 . HIS A 1 411 ? 49.225  -14.616 12.410 1.00 46.17 ? 1064 HIS A ND1 1 
ATOM   2831  C  CD2 . HIS A 1 411 ? 49.468  -13.667 14.361 1.00 47.79 ? 1064 HIS A CD2 1 
ATOM   2832  C  CE1 . HIS A 1 411 ? 48.062  -14.700 13.033 1.00 47.96 ? 1064 HIS A CE1 1 
ATOM   2833  N  NE2 . HIS A 1 411 ? 48.182  -14.130 14.220 1.00 48.42 ? 1064 HIS A NE2 1 
ATOM   2834  N  N   . LEU A 1 412 ? 54.502  -14.098 12.466 1.00 49.04 ? 1065 LEU A N   1 
ATOM   2835  C  CA  . LEU A 1 412 ? 55.819  -13.593 12.108 1.00 49.94 ? 1065 LEU A CA  1 
ATOM   2836  C  C   . LEU A 1 412 ? 56.456  -14.418 11.011 1.00 50.22 ? 1065 LEU A C   1 
ATOM   2837  O  O   . LEU A 1 412 ? 56.954  -13.872 10.030 1.00 50.87 ? 1065 LEU A O   1 
ATOM   2838  C  CB  . LEU A 1 412 ? 56.714  -13.588 13.341 1.00 51.03 ? 1065 LEU A CB  1 
ATOM   2839  C  CG  . LEU A 1 412 ? 57.975  -12.742 13.269 1.00 51.57 ? 1065 LEU A CG  1 
ATOM   2840  C  CD1 . LEU A 1 412 ? 57.616  -11.258 13.181 1.00 50.32 ? 1065 LEU A CD1 1 
ATOM   2841  C  CD2 . LEU A 1 412 ? 58.814  -13.027 14.518 1.00 52.69 ? 1065 LEU A CD2 1 
ATOM   2842  N  N   . THR A 1 413 ? 56.450  -15.738 11.182 1.00 51.51 ? 1066 THR A N   1 
ATOM   2843  C  CA  . THR A 1 413 ? 57.023  -16.663 10.192 1.00 52.25 ? 1066 THR A CA  1 
ATOM   2844  C  C   . THR A 1 413 ? 56.313  -16.573 8.858  1.00 52.04 ? 1066 THR A C   1 
ATOM   2845  O  O   . THR A 1 413 ? 56.949  -16.551 7.810  1.00 52.48 ? 1066 THR A O   1 
ATOM   2846  C  CB  . THR A 1 413 ? 56.878  -18.132 10.604 1.00 52.72 ? 1066 THR A CB  1 
ATOM   2847  O  OG1 . THR A 1 413 ? 57.618  -18.371 11.793 1.00 54.92 ? 1066 THR A OG1 1 
ATOM   2848  C  CG2 . THR A 1 413 ? 57.406  -19.040 9.506  1.00 51.92 ? 1066 THR A CG2 1 
ATOM   2849  N  N   . GLU A 1 414 ? 54.988  -16.575 8.920  1.00 51.35 ? 1067 GLU A N   1 
ATOM   2850  C  CA  . GLU A 1 414 ? 54.187  -16.516 7.726  1.00 51.76 ? 1067 GLU A CA  1 
ATOM   2851  C  C   . GLU A 1 414 ? 54.437  -15.240 6.981  1.00 50.46 ? 1067 GLU A C   1 
ATOM   2852  O  O   . GLU A 1 414 ? 54.750  -15.271 5.796  1.00 50.93 ? 1067 GLU A O   1 
ATOM   2853  C  CB  . GLU A 1 414 ? 52.713  -16.594 8.067  1.00 53.55 ? 1067 GLU A CB  1 
ATOM   2854  C  CG  . GLU A 1 414 ? 52.368  -17.707 9.004  1.00 57.20 ? 1067 GLU A CG  1 
ATOM   2855  C  CD  . GLU A 1 414 ? 50.914  -17.632 9.417  1.00 60.48 ? 1067 GLU A CD  1 
ATOM   2856  O  OE1 . GLU A 1 414 ? 50.512  -16.558 9.925  1.00 61.59 ? 1067 GLU A OE1 1 
ATOM   2857  O  OE2 . GLU A 1 414 ? 50.168  -18.629 9.226  1.00 62.35 ? 1067 GLU A OE2 1 
ATOM   2858  N  N   . ASN A 1 415 ? 54.321  -14.111 7.678  1.00 49.77 ? 1068 ASN A N   1 
ATOM   2859  C  CA  . ASN A 1 415 ? 54.508  -12.802 7.037  1.00 47.50 ? 1068 ASN A CA  1 
ATOM   2860  C  C   . ASN A 1 415 ? 55.901  -12.608 6.469  1.00 46.15 ? 1068 ASN A C   1 
ATOM   2861  O  O   . ASN A 1 415 ? 56.120  -11.829 5.537  1.00 44.82 ? 1068 ASN A O   1 
ATOM   2862  C  CB  . ASN A 1 415 ? 54.162  -11.684 8.016  1.00 46.02 ? 1068 ASN A CB  1 
ATOM   2863  C  CG  . ASN A 1 415 ? 52.683  -11.650 8.349  1.00 45.22 ? 1068 ASN A CG  1 
ATOM   2864  O  OD1 . ASN A 1 415 ? 51.840  -11.813 7.466  1.00 47.77 ? 1068 ASN A OD1 1 
ATOM   2865  N  ND2 . ASN A 1 415 ? 52.357  -11.425 9.616  1.00 46.04 ? 1068 ASN A ND2 1 
ATOM   2866  N  N   . HIS A 1 416 ? 56.841  -13.353 7.022  1.00 46.78 ? 1069 HIS A N   1 
ATOM   2867  C  CA  . HIS A 1 416 ? 58.207  -13.275 6.568  1.00 47.23 ? 1069 HIS A CA  1 
ATOM   2868  C  C   . HIS A 1 416 ? 58.363  -13.880 5.180  1.00 46.94 ? 1069 HIS A C   1 
ATOM   2869  O  O   . HIS A 1 416 ? 59.233  -13.445 4.421  1.00 46.93 ? 1069 HIS A O   1 
ATOM   2870  C  CB  . HIS A 1 416 ? 59.118  -13.975 7.571  1.00 48.81 ? 1069 HIS A CB  1 
ATOM   2871  C  CG  . HIS A 1 416 ? 60.528  -13.476 7.553  1.00 50.15 ? 1069 HIS A CG  1 
ATOM   2872  N  ND1 . HIS A 1 416 ? 60.910  -12.344 6.862  1.00 51.56 ? 1069 HIS A ND1 1 
ATOM   2873  C  CD2 . HIS A 1 416 ? 61.641  -13.934 8.168  1.00 50.05 ? 1069 HIS A CD2 1 
ATOM   2874  C  CE1 . HIS A 1 416 ? 62.198  -12.125 7.051  1.00 51.40 ? 1069 HIS A CE1 1 
ATOM   2875  N  NE2 . HIS A 1 416 ? 62.665  -13.077 7.840  1.00 52.56 ? 1069 HIS A NE2 1 
ATOM   2876  N  N   . LYS A 1 417 ? 57.536  -14.875 4.832  1.00 46.74 ? 1070 LYS A N   1 
ATOM   2877  C  CA  . LYS A 1 417 ? 57.644  -15.484 3.495  1.00 46.77 ? 1070 LYS A CA  1 
ATOM   2878  C  C   . LYS A 1 417 ? 57.181  -14.514 2.401  1.00 44.82 ? 1070 LYS A C   1 
ATOM   2879  O  O   . LYS A 1 417 ? 57.685  -14.526 1.278  1.00 45.18 ? 1070 LYS A O   1 
ATOM   2880  C  CB  . LYS A 1 417 ? 56.845  -16.783 3.407  1.00 48.63 ? 1070 LYS A CB  1 
ATOM   2881  C  CG  . LYS A 1 417 ? 57.292  -17.847 4.401  1.00 52.76 ? 1070 LYS A CG  1 
ATOM   2882  C  CD  . LYS A 1 417 ? 56.782  -19.247 3.995  1.00 55.63 ? 1070 LYS A CD  1 
ATOM   2883  C  CE  . LYS A 1 417 ? 56.904  -20.256 5.140  1.00 55.44 ? 1070 LYS A CE  1 
ATOM   2884  N  NZ  . LYS A 1 417 ? 55.864  -20.095 6.203  1.00 57.28 ? 1070 LYS A NZ  1 
ATOM   2885  N  N   . ILE A 1 418 ? 56.231  -13.658 2.738  1.00 42.55 ? 1071 ILE A N   1 
ATOM   2886  C  CA  . ILE A 1 418 ? 55.743  -12.693 1.787  1.00 40.72 ? 1071 ILE A CA  1 
ATOM   2887  C  C   . ILE A 1 418 ? 56.883  -11.948 1.126  1.00 41.28 ? 1071 ILE A C   1 
ATOM   2888  O  O   . ILE A 1 418 ? 56.917  -11.803 -0.092 1.00 42.28 ? 1071 ILE A O   1 
ATOM   2889  C  CB  . ILE A 1 418 ? 54.850  -11.649 2.467  1.00 39.75 ? 1071 ILE A CB  1 
ATOM   2890  C  CG1 . ILE A 1 418 ? 53.679  -12.333 3.167  1.00 38.81 ? 1071 ILE A CG1 1 
ATOM   2891  C  CG2 . ILE A 1 418 ? 54.389  -10.611 1.443  1.00 39.65 ? 1071 ILE A CG2 1 
ATOM   2892  C  CD1 . ILE A 1 418 ? 52.627  -11.356 3.714  1.00 36.28 ? 1071 ILE A CD1 1 
ATOM   2893  N  N   . TRP A 1 419 ? 57.833  -11.493 1.944  1.00 42.49 ? 1072 TRP A N   1 
ATOM   2894  C  CA  . TRP A 1 419 ? 58.961  -10.681 1.477  1.00 41.97 ? 1072 TRP A CA  1 
ATOM   2895  C  C   . TRP A 1 419 ? 60.337  -11.328 1.264  1.00 45.01 ? 1072 TRP A C   1 
ATOM   2896  O  O   . TRP A 1 419 ? 61.196  -10.752 0.601  1.00 44.24 ? 1072 TRP A O   1 
ATOM   2897  C  CB  . TRP A 1 419 ? 59.131  -9.504  2.430  1.00 38.41 ? 1072 TRP A CB  1 
ATOM   2898  C  CG  . TRP A 1 419 ? 57.843  -8.940  2.949  1.00 33.28 ? 1072 TRP A CG  1 
ATOM   2899  C  CD1 . TRP A 1 419 ? 57.313  -9.128  4.186  1.00 34.07 ? 1072 TRP A CD1 1 
ATOM   2900  C  CD2 . TRP A 1 419 ? 56.956  -8.044  2.266  1.00 31.43 ? 1072 TRP A CD2 1 
ATOM   2901  N  NE1 . TRP A 1 419 ? 56.155  -8.394  4.327  1.00 31.57 ? 1072 TRP A NE1 1 
ATOM   2902  C  CE2 . TRP A 1 419 ? 55.919  -7.716  3.159  1.00 30.89 ? 1072 TRP A CE2 1 
ATOM   2903  C  CE3 . TRP A 1 419 ? 56.951  -7.470  0.990  1.00 30.40 ? 1072 TRP A CE3 1 
ATOM   2904  C  CZ2 . TRP A 1 419 ? 54.873  -6.852  2.817  1.00 30.76 ? 1072 TRP A CZ2 1 
ATOM   2905  C  CZ3 . TRP A 1 419 ? 55.913  -6.604  0.648  1.00 31.02 ? 1072 TRP A CZ3 1 
ATOM   2906  C  CH2 . TRP A 1 419 ? 54.889  -6.301  1.565  1.00 29.92 ? 1072 TRP A CH2 1 
ATOM   2907  N  N   . LYS A 1 420 ? 60.559  -12.509 1.832  1.00 49.73 ? 1073 LYS A N   1 
ATOM   2908  C  CA  . LYS A 1 420 ? 61.847  -13.192 1.692  1.00 53.16 ? 1073 LYS A CA  1 
ATOM   2909  C  C   . LYS A 1 420 ? 61.947  -13.870 0.317  1.00 55.77 ? 1073 LYS A C   1 
ATOM   2910  O  O   . LYS A 1 420 ? 62.934  -13.623 -0.422 1.00 56.87 ? 1073 LYS A O   1 
ATOM   2911  C  CB  . LYS A 1 420 ? 61.983  -14.219 2.817  1.00 55.46 ? 1073 LYS A CB  1 
ATOM   2912  C  CG  . LYS A 1 420 ? 63.299  -14.949 2.873  1.00 59.39 ? 1073 LYS A CG  1 
ATOM   2913  C  CD  . LYS A 1 420 ? 63.309  -15.995 3.997  1.00 62.45 ? 1073 LYS A CD  1 
ATOM   2914  C  CE  . LYS A 1 420 ? 64.669  -16.708 4.051  1.00 64.78 ? 1073 LYS A CE  1 
ATOM   2915  N  NZ  . LYS A 1 420 ? 64.631  -18.023 4.782  1.00 65.68 ? 1073 LYS A NZ  1 
ATOM   2916  O  OXT . LYS A 1 420 ? 61.019  -14.646 -0.014 1.00 58.01 ? 1073 LYS A OXT 1 
ATOM   2917  N  N   . LEU B 1 6   ? 101.208 51.382  15.234 1.00 75.47 ? 659  LEU B N   1 
ATOM   2918  C  CA  . LEU B 1 6   ? 99.716  51.322  15.030 1.00 76.20 ? 659  LEU B CA  1 
ATOM   2919  C  C   . LEU B 1 6   ? 99.042  50.192  15.833 1.00 76.83 ? 659  LEU B C   1 
ATOM   2920  O  O   . LEU B 1 6   ? 97.826  50.239  16.081 1.00 76.24 ? 659  LEU B O   1 
ATOM   2921  C  CB  . LEU B 1 6   ? 99.395  51.166  13.532 1.00 75.28 ? 659  LEU B CB  1 
ATOM   2922  N  N   . ASP B 1 7   ? 99.832  49.186  16.230 1.00 77.29 ? 660  ASP B N   1 
ATOM   2923  C  CA  . ASP B 1 7   ? 99.329  48.052  17.021 1.00 77.70 ? 660  ASP B CA  1 
ATOM   2924  C  C   . ASP B 1 7   ? 100.488 47.248  17.649 1.00 77.59 ? 660  ASP B C   1 
ATOM   2925  O  O   . ASP B 1 7   ? 100.736 46.083  17.291 1.00 77.42 ? 660  ASP B O   1 
ATOM   2926  C  CB  . ASP B 1 7   ? 98.428  47.123  16.140 1.00 77.59 ? 660  ASP B CB  1 
ATOM   2927  N  N   . LEU B 1 8   ? 101.188 47.885  18.589 1.00 77.24 ? 661  LEU B N   1 
ATOM   2928  C  CA  . LEU B 1 8   ? 102.321 47.271  19.280 1.00 77.06 ? 661  LEU B CA  1 
ATOM   2929  C  C   . LEU B 1 8   ? 101.897 46.694  20.642 1.00 76.91 ? 661  LEU B C   1 
ATOM   2930  O  O   . LEU B 1 8   ? 102.394 45.633  21.078 1.00 76.49 ? 661  LEU B O   1 
ATOM   2931  C  CB  . LEU B 1 8   ? 103.432 48.321  19.469 1.00 76.69 ? 661  LEU B CB  1 
ATOM   2932  N  N   . ILE B 1 9   ? 100.984 47.407  21.311 1.00 76.65 ? 662  ILE B N   1 
ATOM   2933  C  CA  . ILE B 1 9   ? 100.467 46.998  22.625 1.00 75.65 ? 662  ILE B CA  1 
ATOM   2934  C  C   . ILE B 1 9   ? 99.436  45.879  22.435 1.00 75.04 ? 662  ILE B C   1 
ATOM   2935  O  O   . ILE B 1 9   ? 98.218  46.101  22.510 1.00 75.39 ? 662  ILE B O   1 
ATOM   2936  C  CB  . ILE B 1 9   ? 99.825  48.204  23.345 1.00 74.96 ? 662  ILE B CB  1 
ATOM   2937  N  N   . LEU B 1 10  ? 99.950  44.681  22.167 1.00 73.89 ? 663  LEU B N   1 
ATOM   2938  C  CA  . LEU B 1 10  ? 99.133  43.495  21.936 1.00 72.61 ? 663  LEU B CA  1 
ATOM   2939  C  C   . LEU B 1 10  ? 99.976  42.283  22.334 1.00 71.62 ? 663  LEU B C   1 
ATOM   2940  O  O   . LEU B 1 10  ? 99.562  41.481  23.163 1.00 72.14 ? 663  LEU B O   1 
ATOM   2941  C  CB  . LEU B 1 10  ? 98.716  43.408  20.440 1.00 72.20 ? 663  LEU B CB  1 
ATOM   2942  C  CG  . LEU B 1 10  ? 97.606  44.348  19.898 1.00 72.06 ? 663  LEU B CG  1 
ATOM   2943  C  CD1 . LEU B 1 10  ? 97.834  44.654  18.404 1.00 69.98 ? 663  LEU B CD1 1 
ATOM   2944  C  CD2 . LEU B 1 10  ? 96.206  43.705  20.133 1.00 71.07 ? 663  LEU B CD2 1 
ATOM   2945  N  N   . VAL B 1 11  ? 101.174 42.175  21.763 1.00 71.06 ? 664  VAL B N   1 
ATOM   2946  C  CA  . VAL B 1 11  ? 102.080 41.056  22.047 1.00 70.74 ? 664  VAL B CA  1 
ATOM   2947  C  C   . VAL B 1 11  ? 102.566 41.043  23.496 1.00 70.79 ? 664  VAL B C   1 
ATOM   2948  O  O   . VAL B 1 11  ? 102.840 39.980  24.074 1.00 70.18 ? 664  VAL B O   1 
ATOM   2949  C  CB  . VAL B 1 11  ? 103.328 41.090  21.116 1.00 70.13 ? 664  VAL B CB  1 
ATOM   2950  C  CG1 . VAL B 1 11  ? 104.167 39.827  21.318 1.00 68.96 ? 664  VAL B CG1 1 
ATOM   2951  C  CG2 . VAL B 1 11  ? 102.884 41.241  19.643 1.00 69.46 ? 664  VAL B CG2 1 
ATOM   2952  N  N   . GLU B 1 12  ? 102.693 42.233  24.073 1.00 71.65 ? 665  GLU B N   1 
ATOM   2953  C  CA  . GLU B 1 12  ? 103.140 42.365  25.455 1.00 72.15 ? 665  GLU B CA  1 
ATOM   2954  C  C   . GLU B 1 12  ? 102.150 41.582  26.313 1.00 71.35 ? 665  GLU B C   1 
ATOM   2955  O  O   . GLU B 1 12  ? 102.543 40.745  27.146 1.00 71.06 ? 665  GLU B O   1 
ATOM   2956  C  CB  . GLU B 1 12  ? 103.125 43.837  25.859 1.00 73.89 ? 665  GLU B CB  1 
ATOM   2957  C  CG  . GLU B 1 12  ? 104.435 44.347  26.415 1.00 76.20 ? 665  GLU B CG  1 
ATOM   2958  C  CD  . GLU B 1 12  ? 104.406 45.857  26.610 1.00 78.34 ? 665  GLU B CD  1 
ATOM   2959  O  OE1 . GLU B 1 12  ? 105.454 46.429  27.005 1.00 78.42 ? 665  GLU B OE1 1 
ATOM   2960  O  OE2 . GLU B 1 12  ? 103.326 46.467  26.365 1.00 79.21 ? 665  GLU B OE2 1 
ATOM   2961  N  N   . GLU B 1 13  ? 100.866 41.868  26.089 1.00 69.86 ? 666  GLU B N   1 
ATOM   2962  C  CA  . GLU B 1 13  ? 99.784  41.206  26.808 1.00 68.26 ? 666  GLU B CA  1 
ATOM   2963  C  C   . GLU B 1 13  ? 99.953  39.703  26.634 1.00 66.64 ? 666  GLU B C   1 
ATOM   2964  O  O   . GLU B 1 13  ? 100.196 38.975  27.608 1.00 67.02 ? 666  GLU B O   1 
ATOM   2965  C  CB  . GLU B 1 13  ? 98.433  41.608  26.225 1.00 69.24 ? 666  GLU B CB  1 
ATOM   2966  C  CG  . GLU B 1 13  ? 98.299  43.073  25.915 1.00 71.34 ? 666  GLU B CG  1 
ATOM   2967  C  CD  . GLU B 1 13  ? 96.999  43.368  25.197 1.00 73.39 ? 666  GLU B CD  1 
ATOM   2968  O  OE1 . GLU B 1 13  ? 96.772  42.818  24.079 1.00 73.40 ? 666  GLU B OE1 1 
ATOM   2969  O  OE2 . GLU B 1 13  ? 96.190  44.149  25.759 1.00 75.10 ? 666  GLU B OE2 1 
ATOM   2970  N  N   . TYR B 1 14  ? 99.832  39.259  25.383 1.00 63.22 ? 667  TYR B N   1 
ATOM   2971  C  CA  . TYR B 1 14  ? 99.958  37.854  25.038 1.00 61.10 ? 667  TYR B CA  1 
ATOM   2972  C  C   . TYR B 1 14  ? 101.063 37.115  25.795 1.00 60.78 ? 667  TYR B C   1 
ATOM   2973  O  O   . TYR B 1 14  ? 100.788 36.158  26.529 1.00 60.65 ? 667  TYR B O   1 
ATOM   2974  C  CB  . TYR B 1 14  ? 100.190 37.698  23.528 1.00 60.92 ? 667  TYR B CB  1 
ATOM   2975  C  CG  . TYR B 1 14  ? 100.242 36.248  23.068 1.00 59.81 ? 667  TYR B CG  1 
ATOM   2976  C  CD1 . TYR B 1 14  ? 99.066  35.511  22.839 1.00 58.81 ? 667  TYR B CD1 1 
ATOM   2977  C  CD2 . TYR B 1 14  ? 101.470 35.592  22.906 1.00 59.06 ? 667  TYR B CD2 1 
ATOM   2978  C  CE1 . TYR B 1 14  ? 99.115  34.136  22.454 1.00 57.53 ? 667  TYR B CE1 1 
ATOM   2979  C  CE2 . TYR B 1 14  ? 101.533 34.230  22.527 1.00 58.40 ? 667  TYR B CE2 1 
ATOM   2980  C  CZ  . TYR B 1 14  ? 100.354 33.508  22.305 1.00 57.67 ? 667  TYR B CZ  1 
ATOM   2981  O  OH  . TYR B 1 14  ? 100.449 32.173  21.966 1.00 54.80 ? 667  TYR B OH  1 
ATOM   2982  N  N   . ASP B 1 15  ? 102.309 37.547  25.618 1.00 59.71 ? 668  ASP B N   1 
ATOM   2983  C  CA  . ASP B 1 15  ? 103.426 36.886  26.285 1.00 58.60 ? 668  ASP B CA  1 
ATOM   2984  C  C   . ASP B 1 15  ? 103.296 36.903  27.801 1.00 57.45 ? 668  ASP B C   1 
ATOM   2985  O  O   . ASP B 1 15  ? 103.792 36.001  28.497 1.00 57.32 ? 668  ASP B O   1 
ATOM   2986  C  CB  . ASP B 1 15  ? 104.736 37.536  25.862 1.00 60.40 ? 668  ASP B CB  1 
ATOM   2987  C  CG  . ASP B 1 15  ? 104.875 37.605  24.367 1.00 62.42 ? 668  ASP B CG  1 
ATOM   2988  O  OD1 . ASP B 1 15  ? 104.732 36.543  23.717 1.00 63.50 ? 668  ASP B OD1 1 
ATOM   2989  O  OD2 . ASP B 1 15  ? 105.120 38.713  23.835 1.00 63.97 ? 668  ASP B OD2 1 
ATOM   2990  N  N   . SER B 1 16  ? 102.618 37.921  28.311 1.00 55.57 ? 669  SER B N   1 
ATOM   2991  C  CA  . SER B 1 16  ? 102.422 38.059  29.749 1.00 54.39 ? 669  SER B CA  1 
ATOM   2992  C  C   . SER B 1 16  ? 101.556 36.906  30.228 1.00 52.92 ? 669  SER B C   1 
ATOM   2993  O  O   . SER B 1 16  ? 101.999 35.989  30.934 1.00 51.41 ? 669  SER B O   1 
ATOM   2994  C  CB  . SER B 1 16  ? 101.717 39.394  30.044 1.00 55.22 ? 669  SER B CB  1 
ATOM   2995  O  OG  . SER B 1 16  ? 101.484 39.579  31.433 1.00 57.23 ? 669  SER B OG  1 
ATOM   2996  N  N   . LEU B 1 17  ? 100.294 36.984  29.828 1.00 52.10 ? 670  LEU B N   1 
ATOM   2997  C  CA  . LEU B 1 17  ? 99.295  35.991  30.169 1.00 50.04 ? 670  LEU B CA  1 
ATOM   2998  C  C   . LEU B 1 17  ? 99.780  34.556  29.952 1.00 49.88 ? 670  LEU B C   1 
ATOM   2999  O  O   . LEU B 1 17  ? 99.577  33.691  30.815 1.00 49.77 ? 670  LEU B O   1 
ATOM   3000  C  CB  . LEU B 1 17  ? 98.048  36.257  29.354 1.00 49.84 ? 670  LEU B CB  1 
ATOM   3001  C  CG  . LEU B 1 17  ? 96.877  35.346  29.689 1.00 50.75 ? 670  LEU B CG  1 
ATOM   3002  C  CD1 . LEU B 1 17  ? 96.582  35.451  31.171 1.00 51.32 ? 670  LEU B CD1 1 
ATOM   3003  C  CD2 . LEU B 1 17  ? 95.668  35.731  28.842 1.00 48.61 ? 670  LEU B CD2 1 
ATOM   3004  N  N   . ILE B 1 18  ? 100.415 34.295  28.816 1.00 48.11 ? 671  ILE B N   1 
ATOM   3005  C  CA  . ILE B 1 18  ? 100.904 32.952  28.564 1.00 49.08 ? 671  ILE B CA  1 
ATOM   3006  C  C   . ILE B 1 18  ? 101.874 32.496  29.645 1.00 49.64 ? 671  ILE B C   1 
ATOM   3007  O  O   . ILE B 1 18  ? 101.879 31.333  30.082 1.00 48.48 ? 671  ILE B O   1 
ATOM   3008  C  CB  . ILE B 1 18  ? 101.614 32.860  27.199 1.00 49.56 ? 671  ILE B CB  1 
ATOM   3009  C  CG1 . ILE B 1 18  ? 100.577 32.745  26.081 1.00 49.94 ? 671  ILE B CG1 1 
ATOM   3010  C  CG2 . ILE B 1 18  ? 102.533 31.640  27.168 1.00 49.20 ? 671  ILE B CG2 1 
ATOM   3011  C  CD1 . ILE B 1 18  ? 99.690  31.515  26.185 1.00 48.16 ? 671  ILE B CD1 1 
ATOM   3012  N  N   . GLU B 1 19  ? 102.717 33.431  30.058 1.00 51.48 ? 672  GLU B N   1 
ATOM   3013  C  CA  . GLU B 1 19  ? 103.721 33.176  31.078 1.00 51.42 ? 672  GLU B CA  1 
ATOM   3014  C  C   . GLU B 1 19  ? 103.034 32.803  32.385 1.00 50.39 ? 672  GLU B C   1 
ATOM   3015  O  O   . GLU B 1 19  ? 103.445 31.858  33.060 1.00 49.22 ? 672  GLU B O   1 
ATOM   3016  C  CB  . GLU B 1 19  ? 104.568 34.435  31.221 1.00 53.31 ? 672  GLU B CB  1 
ATOM   3017  C  CG  . GLU B 1 19  ? 105.382 34.563  32.467 1.00 56.24 ? 672  GLU B CG  1 
ATOM   3018  C  CD  . GLU B 1 19  ? 105.485 36.021  32.871 1.00 60.61 ? 672  GLU B CD  1 
ATOM   3019  O  OE1 . GLU B 1 19  ? 104.478 36.577  33.405 1.00 60.56 ? 672  GLU B OE1 1 
ATOM   3020  O  OE2 . GLU B 1 19  ? 106.568 36.629  32.634 1.00 62.37 ? 672  GLU B OE2 1 
ATOM   3021  N  N   . LYS B 1 20  ? 101.976 33.535  32.720 1.00 49.98 ? 673  LYS B N   1 
ATOM   3022  C  CA  . LYS B 1 20  ? 101.218 33.292  33.948 1.00 51.03 ? 673  LYS B CA  1 
ATOM   3023  C  C   . LYS B 1 20  ? 100.371 32.015  33.921 1.00 50.54 ? 673  LYS B C   1 
ATOM   3024  O  O   . LYS B 1 20  ? 100.228 31.331  34.941 1.00 49.71 ? 673  LYS B O   1 
ATOM   3025  C  CB  . LYS B 1 20  ? 100.318 34.489  34.241 1.00 53.05 ? 673  LYS B CB  1 
ATOM   3026  C  CG  . LYS B 1 20  ? 101.073 35.674  34.813 1.00 54.64 ? 673  LYS B CG  1 
ATOM   3027  C  CD  . LYS B 1 20  ? 100.118 36.788  35.211 1.00 58.58 ? 673  LYS B CD  1 
ATOM   3028  C  CE  . LYS B 1 20  ? 100.117 37.941  34.206 1.00 59.66 ? 673  LYS B CE  1 
ATOM   3029  N  NZ  . LYS B 1 20  ? 99.799  37.473  32.837 1.00 61.10 ? 673  LYS B NZ  1 
ATOM   3030  N  N   . MET B 1 21  ? 99.814  31.695  32.755 1.00 49.83 ? 674  MET B N   1 
ATOM   3031  C  CA  . MET B 1 21  ? 99.003  30.503  32.634 1.00 48.69 ? 674  MET B CA  1 
ATOM   3032  C  C   . MET B 1 21  ? 99.869  29.247  32.601 1.00 49.01 ? 674  MET B C   1 
ATOM   3033  O  O   . MET B 1 21  ? 99.382  28.162  32.901 1.00 49.26 ? 674  MET B O   1 
ATOM   3034  C  CB  . MET B 1 21  ? 98.138  30.567  31.384 1.00 48.13 ? 674  MET B CB  1 
ATOM   3035  C  CG  . MET B 1 21  ? 97.230  31.767  31.319 1.00 48.80 ? 674  MET B CG  1 
ATOM   3036  S  SD  . MET B 1 21  ? 96.076  31.624  29.906 1.00 50.68 ? 674  MET B SD  1 
ATOM   3037  C  CE  . MET B 1 21  ? 94.611  31.919  30.680 1.00 48.99 ? 674  MET B CE  1 
ATOM   3038  N  N   . SER B 1 22  ? 101.151 29.372  32.261 1.00 48.80 ? 675  SER B N   1 
ATOM   3039  C  CA  . SER B 1 22  ? 102.018 28.189  32.226 1.00 49.94 ? 675  SER B CA  1 
ATOM   3040  C  C   . SER B 1 22  ? 102.152 27.572  33.619 1.00 50.24 ? 675  SER B C   1 
ATOM   3041  O  O   . SER B 1 22  ? 102.818 26.558  33.830 1.00 51.22 ? 675  SER B O   1 
ATOM   3042  C  CB  . SER B 1 22  ? 103.396 28.546  31.676 1.00 49.33 ? 675  SER B CB  1 
ATOM   3043  O  OG  . SER B 1 22  ? 103.259 29.059  30.372 1.00 51.10 ? 675  SER B OG  1 
ATOM   3044  N  N   . ASN B 1 23  ? 101.495 28.194  34.576 1.00 50.99 ? 676  ASN B N   1 
ATOM   3045  C  CA  . ASN B 1 23  ? 101.520 27.721  35.940 1.00 49.77 ? 676  ASN B CA  1 
ATOM   3046  C  C   . ASN B 1 23  ? 100.162 27.144  36.304 1.00 47.77 ? 676  ASN B C   1 
ATOM   3047  O  O   . ASN B 1 23  ? 99.120  27.781  36.078 1.00 46.63 ? 676  ASN B O   1 
ATOM   3048  C  CB  . ASN B 1 23  ? 101.868 28.874  36.876 1.00 51.16 ? 676  ASN B CB  1 
ATOM   3049  C  CG  . ASN B 1 23  ? 101.716 28.489  38.324 1.00 54.28 ? 676  ASN B CG  1 
ATOM   3050  O  OD1 . ASN B 1 23  ? 101.795 27.297  38.664 1.00 57.39 ? 676  ASN B OD1 1 
ATOM   3051  N  ND2 . ASN B 1 23  ? 101.517 29.484  39.200 1.00 55.17 ? 676  ASN B ND2 1 
ATOM   3052  N  N   . TRP B 1 24  ? 100.187 25.931  36.851 1.00 46.61 ? 677  TRP B N   1 
ATOM   3053  C  CA  . TRP B 1 24  ? 98.975  25.232  37.300 1.00 44.43 ? 677  TRP B CA  1 
ATOM   3054  C  C   . TRP B 1 24  ? 98.150  26.181  38.136 1.00 43.99 ? 677  TRP B C   1 
ATOM   3055  O  O   . TRP B 1 24  ? 96.956  26.353  37.909 1.00 43.88 ? 677  TRP B O   1 
ATOM   3056  C  CB  . TRP B 1 24  ? 99.362  24.039  38.153 1.00 42.80 ? 677  TRP B CB  1 
ATOM   3057  C  CG  . TRP B 1 24  ? 98.224  23.359  38.812 1.00 43.71 ? 677  TRP B CG  1 
ATOM   3058  C  CD1 . TRP B 1 24  ? 98.044  23.164  40.155 1.00 41.73 ? 677  TRP B CD1 1 
ATOM   3059  C  CD2 . TRP B 1 24  ? 97.139  22.691  38.164 1.00 44.46 ? 677  TRP B CD2 1 
ATOM   3060  N  NE1 . TRP B 1 24  ? 96.919  22.413  40.382 1.00 42.49 ? 677  TRP B NE1 1 
ATOM   3061  C  CE2 . TRP B 1 24  ? 96.341  22.109  39.176 1.00 44.41 ? 677  TRP B CE2 1 
ATOM   3062  C  CE3 . TRP B 1 24  ? 96.756  22.531  36.824 1.00 44.13 ? 677  TRP B CE3 1 
ATOM   3063  C  CZ2 . TRP B 1 24  ? 95.186  21.369  38.888 1.00 44.21 ? 677  TRP B CZ2 1 
ATOM   3064  C  CZ3 . TRP B 1 24  ? 95.605  21.796  36.538 1.00 44.08 ? 677  TRP B CZ3 1 
ATOM   3065  C  CH2 . TRP B 1 24  ? 94.834  21.229  37.569 1.00 43.13 ? 677  TRP B CH2 1 
ATOM   3066  N  N   . ASN B 1 25  ? 98.816  26.801  39.105 1.00 44.29 ? 678  ASN B N   1 
ATOM   3067  C  CA  . ASN B 1 25  ? 98.186  27.736  40.001 1.00 43.95 ? 678  ASN B CA  1 
ATOM   3068  C  C   . ASN B 1 25  ? 98.144  29.088  39.355 1.00 43.89 ? 678  ASN B C   1 
ATOM   3069  O  O   . ASN B 1 25  ? 98.562  30.080  39.941 1.00 45.19 ? 678  ASN B O   1 
ATOM   3070  C  CB  . ASN B 1 25  ? 98.935  27.792  41.328 1.00 44.30 ? 678  ASN B CB  1 
ATOM   3071  C  CG  . ASN B 1 25  ? 98.863  26.481  42.077 1.00 46.38 ? 678  ASN B CG  1 
ATOM   3072  O  OD1 . ASN B 1 25  ? 97.777  25.947  42.288 1.00 47.30 ? 678  ASN B OD1 1 
ATOM   3073  N  ND2 . ASN B 1 25  ? 100.017 25.944  42.476 1.00 46.91 ? 678  ASN B ND2 1 
ATOM   3074  N  N   . PHE B 1 26  ? 97.652  29.101  38.122 1.00 44.29 ? 679  PHE B N   1 
ATOM   3075  C  CA  . PHE B 1 26  ? 97.486  30.329  37.369 1.00 44.06 ? 679  PHE B CA  1 
ATOM   3076  C  C   . PHE B 1 26  ? 96.660  31.259  38.249 1.00 43.30 ? 679  PHE B C   1 
ATOM   3077  O  O   . PHE B 1 26  ? 95.554  30.922  38.628 1.00 44.46 ? 679  PHE B O   1 
ATOM   3078  C  CB  . PHE B 1 26  ? 96.742  30.034  36.065 1.00 43.44 ? 679  PHE B CB  1 
ATOM   3079  C  CG  . PHE B 1 26  ? 96.053  31.230  35.466 1.00 42.76 ? 679  PHE B CG  1 
ATOM   3080  C  CD1 . PHE B 1 26  ? 96.705  32.461  35.370 1.00 44.44 ? 679  PHE B CD1 1 
ATOM   3081  C  CD2 . PHE B 1 26  ? 94.769  31.121  34.960 1.00 41.86 ? 679  PHE B CD2 1 
ATOM   3082  C  CE1 . PHE B 1 26  ? 96.078  33.566  34.777 1.00 43.49 ? 679  PHE B CE1 1 
ATOM   3083  C  CE2 . PHE B 1 26  ? 94.133  32.221  34.365 1.00 42.63 ? 679  PHE B CE2 1 
ATOM   3084  C  CZ  . PHE B 1 26  ? 94.797  33.446  34.275 1.00 43.62 ? 679  PHE B CZ  1 
ATOM   3085  N  N   . PRO B 1 27  ? 97.206  32.433  38.599 1.00 44.18 ? 680  PRO B N   1 
ATOM   3086  C  CA  . PRO B 1 27  ? 96.541  33.435  39.437 1.00 42.24 ? 680  PRO B CA  1 
ATOM   3087  C  C   . PRO B 1 27  ? 95.451  34.121  38.665 1.00 41.75 ? 680  PRO B C   1 
ATOM   3088  O  O   . PRO B 1 27  ? 95.583  35.306  38.344 1.00 41.04 ? 680  PRO B O   1 
ATOM   3089  C  CB  . PRO B 1 27  ? 97.659  34.393  39.775 1.00 41.53 ? 680  PRO B CB  1 
ATOM   3090  C  CG  . PRO B 1 27  ? 98.483  34.347  38.555 1.00 43.21 ? 680  PRO B CG  1 
ATOM   3091  C  CD  . PRO B 1 27  ? 98.569  32.875  38.261 1.00 43.89 ? 680  PRO B CD  1 
ATOM   3092  N  N   . ILE B 1 28  ? 94.371  33.377  38.414 1.00 39.82 ? 681  ILE B N   1 
ATOM   3093  C  CA  . ILE B 1 28  ? 93.244  33.860  37.649 1.00 39.90 ? 681  ILE B CA  1 
ATOM   3094  C  C   . ILE B 1 28  ? 92.514  35.040  38.254 1.00 40.40 ? 681  ILE B C   1 
ATOM   3095  O  O   . ILE B 1 28  ? 91.903  35.839  37.543 1.00 38.83 ? 681  ILE B O   1 
ATOM   3096  C  CB  . ILE B 1 28  ? 92.205  32.720  37.388 1.00 40.10 ? 681  ILE B CB  1 
ATOM   3097  C  CG1 . ILE B 1 28  ? 91.204  33.171  36.315 1.00 37.73 ? 681  ILE B CG1 1 
ATOM   3098  C  CG2 . ILE B 1 28  ? 91.456  32.362  38.687 1.00 35.80 ? 681  ILE B CG2 1 
ATOM   3099  C  CD1 . ILE B 1 28  ? 90.265  32.068  35.834 1.00 39.93 ? 681  ILE B CD1 1 
ATOM   3100  N  N   . PHE B 1 29  ? 92.549  35.152  39.571 1.00 42.78 ? 682  PHE B N   1 
ATOM   3101  C  CA  . PHE B 1 29  ? 91.854  36.263  40.201 1.00 45.02 ? 682  PHE B CA  1 
ATOM   3102  C  C   . PHE B 1 29  ? 92.624  37.573  40.057 1.00 46.37 ? 682  PHE B C   1 
ATOM   3103  O  O   . PHE B 1 29  ? 92.019  38.664  40.015 1.00 47.18 ? 682  PHE B O   1 
ATOM   3104  C  CB  . PHE B 1 29  ? 91.552  35.935  41.670 1.00 45.07 ? 682  PHE B CB  1 
ATOM   3105  C  CG  . PHE B 1 29  ? 90.557  34.809  41.832 1.00 43.54 ? 682  PHE B CG  1 
ATOM   3106  C  CD1 . PHE B 1 29  ? 90.971  33.549  42.247 1.00 44.65 ? 682  PHE B CD1 1 
ATOM   3107  C  CD2 . PHE B 1 29  ? 89.222  34.997  41.490 1.00 43.31 ? 682  PHE B CD2 1 
ATOM   3108  C  CE1 . PHE B 1 29  ? 90.072  32.494  42.318 1.00 45.69 ? 682  PHE B CE1 1 
ATOM   3109  C  CE2 . PHE B 1 29  ? 88.310  33.954  41.551 1.00 43.18 ? 682  PHE B CE2 1 
ATOM   3110  C  CZ  . PHE B 1 29  ? 88.730  32.704  41.963 1.00 45.96 ? 682  PHE B CZ  1 
ATOM   3111  N  N   . GLU B 1 30  ? 93.947  37.478  39.962 1.00 47.01 ? 683  GLU B N   1 
ATOM   3112  C  CA  . GLU B 1 30  ? 94.739  38.685  39.789 1.00 50.04 ? 683  GLU B CA  1 
ATOM   3113  C  C   . GLU B 1 30  ? 94.421  39.238  38.416 1.00 50.30 ? 683  GLU B C   1 
ATOM   3114  O  O   . GLU B 1 30  ? 94.319  40.456  38.243 1.00 51.63 ? 683  GLU B O   1 
ATOM   3115  C  CB  . GLU B 1 30  ? 96.215  38.378  39.885 1.00 50.49 ? 683  GLU B CB  1 
ATOM   3116  C  CG  . GLU B 1 30  ? 96.789  38.687  41.231 1.00 52.70 ? 683  GLU B CG  1 
ATOM   3117  C  CD  . GLU B 1 30  ? 98.148  38.058  41.392 1.00 53.87 ? 683  GLU B CD  1 
ATOM   3118  O  OE1 . GLU B 1 30  ? 98.919  38.084  40.404 1.00 53.63 ? 683  GLU B OE1 1 
ATOM   3119  O  OE2 . GLU B 1 30  ? 98.439  37.544  42.498 1.00 55.02 ? 683  GLU B OE2 1 
ATOM   3120  N  N   . LEU B 1 31  ? 94.261  38.331  37.449 1.00 49.16 ? 684  LEU B N   1 
ATOM   3121  C  CA  . LEU B 1 31  ? 93.923  38.708  36.079 1.00 49.33 ? 684  LEU B CA  1 
ATOM   3122  C  C   . LEU B 1 31  ? 92.531  39.343  35.980 1.00 48.63 ? 684  LEU B C   1 
ATOM   3123  O  O   . LEU B 1 31  ? 92.244  40.102  35.060 1.00 47.87 ? 684  LEU B O   1 
ATOM   3124  C  CB  . LEU B 1 31  ? 93.978  37.480  35.159 1.00 49.72 ? 684  LEU B CB  1 
ATOM   3125  C  CG  . LEU B 1 31  ? 93.298  37.630  33.785 1.00 50.78 ? 684  LEU B CG  1 
ATOM   3126  C  CD1 . LEU B 1 31  ? 94.089  38.597  32.895 1.00 49.01 ? 684  LEU B CD1 1 
ATOM   3127  C  CD2 . LEU B 1 31  ? 93.176  36.258  33.129 1.00 50.55 ? 684  LEU B CD2 1 
ATOM   3128  N  N   . VAL B 1 32  ? 91.650  39.009  36.907 1.00 50.06 ? 685  VAL B N   1 
ATOM   3129  C  CA  . VAL B 1 32  ? 90.321  39.583  36.859 1.00 51.33 ? 685  VAL B CA  1 
ATOM   3130  C  C   . VAL B 1 32  ? 90.482  41.037  37.269 1.00 52.72 ? 685  VAL B C   1 
ATOM   3131  O  O   . VAL B 1 32  ? 89.860  41.934  36.689 1.00 52.82 ? 685  VAL B O   1 
ATOM   3132  C  CB  . VAL B 1 32  ? 89.363  38.876  37.831 1.00 50.72 ? 685  VAL B CB  1 
ATOM   3133  C  CG1 . VAL B 1 32  ? 87.960  39.403  37.648 1.00 49.12 ? 685  VAL B CG1 1 
ATOM   3134  C  CG2 . VAL B 1 32  ? 89.412  37.387  37.600 1.00 50.77 ? 685  VAL B CG2 1 
ATOM   3135  N  N   . GLU B 1 33  ? 91.329  41.249  38.278 1.00 54.69 ? 686  GLU B N   1 
ATOM   3136  C  CA  . GLU B 1 33  ? 91.640  42.589  38.807 1.00 55.76 ? 686  GLU B CA  1 
ATOM   3137  C  C   . GLU B 1 33  ? 92.306  43.414  37.695 1.00 53.98 ? 686  GLU B C   1 
ATOM   3138  O  O   . GLU B 1 33  ? 91.822  44.475  37.312 1.00 52.46 ? 686  GLU B O   1 
ATOM   3139  C  CB  . GLU B 1 33  ? 92.605  42.463  39.998 1.00 58.27 ? 686  GLU B CB  1 
ATOM   3140  C  CG  . GLU B 1 33  ? 92.735  43.720  40.839 1.00 63.60 ? 686  GLU B CG  1 
ATOM   3141  C  CD  . GLU B 1 33  ? 91.676  43.797  41.939 1.00 67.15 ? 686  GLU B CD  1 
ATOM   3142  O  OE1 . GLU B 1 33  ? 90.529  43.309  41.724 1.00 68.66 ? 686  GLU B OE1 1 
ATOM   3143  O  OE2 . GLU B 1 33  ? 91.992  44.360  43.018 1.00 68.54 ? 686  GLU B OE2 1 
ATOM   3144  N  N   . LYS B 1 34  ? 93.411  42.898  37.171 1.00 52.99 ? 687  LYS B N   1 
ATOM   3145  C  CA  . LYS B 1 34  ? 94.118  43.585  36.112 1.00 53.18 ? 687  LYS B CA  1 
ATOM   3146  C  C   . LYS B 1 34  ? 93.207  43.993  34.952 1.00 54.06 ? 687  LYS B C   1 
ATOM   3147  O  O   . LYS B 1 34  ? 93.385  45.058  34.370 1.00 55.23 ? 687  LYS B O   1 
ATOM   3148  C  CB  . LYS B 1 34  ? 95.272  42.729  35.608 1.00 52.21 ? 687  LYS B CB  1 
ATOM   3149  N  N   . MET B 1 35  ? 92.216  43.176  34.611 1.00 55.14 ? 688  MET B N   1 
ATOM   3150  C  CA  . MET B 1 35  ? 91.332  43.521  33.493 1.00 55.26 ? 688  MET B CA  1 
ATOM   3151  C  C   . MET B 1 35  ? 90.311  44.611  33.848 1.00 55.74 ? 688  MET B C   1 
ATOM   3152  O  O   . MET B 1 35  ? 89.624  45.148  32.972 1.00 55.82 ? 688  MET B O   1 
ATOM   3153  C  CB  . MET B 1 35  ? 90.622  42.265  32.979 1.00 54.45 ? 688  MET B CB  1 
ATOM   3154  C  CG  . MET B 1 35  ? 91.532  41.307  32.231 1.00 52.50 ? 688  MET B CG  1 
ATOM   3155  S  SD  . MET B 1 35  ? 90.599  39.950  31.472 1.00 51.82 ? 688  MET B SD  1 
ATOM   3156  C  CE  . MET B 1 35  ? 89.728  40.796  30.158 1.00 49.29 ? 688  MET B CE  1 
ATOM   3157  N  N   . GLY B 1 36  ? 90.222  44.936  35.131 1.00 56.24 ? 689  GLY B N   1 
ATOM   3158  C  CA  . GLY B 1 36  ? 89.309  45.971  35.589 1.00 57.85 ? 689  GLY B CA  1 
ATOM   3159  C  C   . GLY B 1 36  ? 87.885  45.974  35.061 1.00 59.00 ? 689  GLY B C   1 
ATOM   3160  O  O   . GLY B 1 36  ? 87.041  45.220  35.544 1.00 59.76 ? 689  GLY B O   1 
ATOM   3161  N  N   . GLU B 1 37  ? 87.596  46.835  34.088 1.00 59.88 ? 690  GLU B N   1 
ATOM   3162  C  CA  . GLU B 1 37  ? 86.245  46.912  33.542 1.00 61.57 ? 690  GLU B CA  1 
ATOM   3163  C  C   . GLU B 1 37  ? 86.031  45.969  32.370 1.00 60.51 ? 690  GLU B C   1 
ATOM   3164  O  O   . GLU B 1 37  ? 84.905  45.544  32.090 1.00 60.87 ? 690  GLU B O   1 
ATOM   3165  C  CB  . GLU B 1 37  ? 85.921  48.328  33.090 1.00 63.82 ? 690  GLU B CB  1 
ATOM   3166  C  CG  . GLU B 1 37  ? 86.001  49.371  34.175 1.00 67.59 ? 690  GLU B CG  1 
ATOM   3167  C  CD  . GLU B 1 37  ? 85.444  50.716  33.706 1.00 70.49 ? 690  GLU B CD  1 
ATOM   3168  O  OE1 . GLU B 1 37  ? 84.188  50.865  33.652 1.00 71.16 ? 690  GLU B OE1 1 
ATOM   3169  O  OE2 . GLU B 1 37  ? 86.265  51.613  33.383 1.00 70.28 ? 690  GLU B OE2 1 
ATOM   3170  N  N   . LYS B 1 38  ? 87.107  45.646  31.670 1.00 59.77 ? 691  LYS B N   1 
ATOM   3171  C  CA  . LYS B 1 38  ? 86.985  44.731  30.547 1.00 59.07 ? 691  LYS B CA  1 
ATOM   3172  C  C   . LYS B 1 38  ? 87.047  43.282  31.022 1.00 56.90 ? 691  LYS B C   1 
ATOM   3173  O  O   . LYS B 1 38  ? 87.140  42.368  30.203 1.00 56.35 ? 691  LYS B O   1 
ATOM   3174  C  CB  . LYS B 1 38  ? 88.094  44.989  29.513 1.00 61.19 ? 691  LYS B CB  1 
ATOM   3175  C  CG  . LYS B 1 38  ? 87.701  45.907  28.330 1.00 64.54 ? 691  LYS B CG  1 
ATOM   3176  C  CD  . LYS B 1 38  ? 88.698  45.755  27.135 1.00 66.83 ? 691  LYS B CD  1 
ATOM   3177  C  CE  . LYS B 1 38  ? 88.719  44.308  26.561 1.00 68.29 ? 691  LYS B CE  1 
ATOM   3178  N  NZ  . LYS B 1 38  ? 89.882  43.976  25.644 1.00 66.95 ? 691  LYS B NZ  1 
ATOM   3179  N  N   . SER B 1 39  ? 86.995  43.064  32.337 1.00 54.40 ? 692  SER B N   1 
ATOM   3180  C  CA  . SER B 1 39  ? 87.053  41.699  32.861 1.00 52.38 ? 692  SER B CA  1 
ATOM   3181  C  C   . SER B 1 39  ? 85.866  40.801  32.406 1.00 49.99 ? 692  SER B C   1 
ATOM   3182  O  O   . SER B 1 39  ? 85.996  39.584  32.350 1.00 49.86 ? 692  SER B O   1 
ATOM   3183  C  CB  . SER B 1 39  ? 87.164  41.719  34.404 1.00 52.41 ? 692  SER B CB  1 
ATOM   3184  O  OG  . SER B 1 39  ? 86.009  42.270  35.030 1.00 53.14 ? 692  SER B OG  1 
ATOM   3185  N  N   . GLY B 1 40  ? 84.724  41.400  32.066 1.00 48.52 ? 693  GLY B N   1 
ATOM   3186  C  CA  . GLY B 1 40  ? 83.572  40.623  31.631 1.00 44.05 ? 693  GLY B CA  1 
ATOM   3187  C  C   . GLY B 1 40  ? 83.851  39.883  30.339 1.00 43.47 ? 693  GLY B C   1 
ATOM   3188  O  O   . GLY B 1 40  ? 83.038  39.079  29.868 1.00 43.42 ? 693  GLY B O   1 
ATOM   3189  N  N   . ARG B 1 41  ? 85.008  40.160  29.755 1.00 40.86 ? 694  ARG B N   1 
ATOM   3190  C  CA  . ARG B 1 41  ? 85.412  39.509  28.525 1.00 39.94 ? 694  ARG B CA  1 
ATOM   3191  C  C   . ARG B 1 41  ? 86.639  38.640  28.793 1.00 38.15 ? 694  ARG B C   1 
ATOM   3192  O  O   . ARG B 1 41  ? 87.420  38.356  27.896 1.00 38.00 ? 694  ARG B O   1 
ATOM   3193  C  CB  . ARG B 1 41  ? 85.701  40.550  27.433 1.00 41.62 ? 694  ARG B CB  1 
ATOM   3194  C  CG  . ARG B 1 41  ? 84.632  41.647  27.392 1.00 46.62 ? 694  ARG B CG  1 
ATOM   3195  C  CD  . ARG B 1 41  ? 84.425  42.246  26.022 1.00 50.84 ? 694  ARG B CD  1 
ATOM   3196  N  NE  . ARG B 1 41  ? 85.649  42.809  25.464 1.00 55.43 ? 694  ARG B NE  1 
ATOM   3197  C  CZ  . ARG B 1 41  ? 85.721  43.375  24.259 1.00 57.16 ? 694  ARG B CZ  1 
ATOM   3198  N  NH1 . ARG B 1 41  ? 84.626  43.454  23.498 1.00 57.77 ? 694  ARG B NH1 1 
ATOM   3199  N  NH2 . ARG B 1 41  ? 86.888  43.832  23.806 1.00 55.62 ? 694  ARG B NH2 1 
ATOM   3200  N  N   . ILE B 1 42  ? 86.786  38.189  30.033 1.00 36.35 ? 695  ILE B N   1 
ATOM   3201  C  CA  . ILE B 1 42  ? 87.915  37.344  30.392 1.00 34.42 ? 695  ILE B CA  1 
ATOM   3202  C  C   . ILE B 1 42  ? 87.939  35.996  29.634 1.00 34.64 ? 695  ILE B C   1 
ATOM   3203  O  O   . ILE B 1 42  ? 88.984  35.565  29.180 1.00 35.29 ? 695  ILE B O   1 
ATOM   3204  C  CB  . ILE B 1 42  ? 87.957  37.095  31.946 1.00 32.49 ? 695  ILE B CB  1 
ATOM   3205  C  CG1 . ILE B 1 42  ? 89.116  36.145  32.278 1.00 32.87 ? 695  ILE B CG1 1 
ATOM   3206  C  CG2 . ILE B 1 42  ? 86.637  36.533  32.434 1.00 33.12 ? 695  ILE B CG2 1 
ATOM   3207  C  CD1 . ILE B 1 42  ? 89.394  35.939  33.757 1.00 28.21 ? 695  ILE B CD1 1 
ATOM   3208  N  N   . LEU B 1 43  ? 86.788  35.343  29.474 1.00 35.42 ? 696  LEU B N   1 
ATOM   3209  C  CA  . LEU B 1 43  ? 86.760  34.055  28.806 1.00 33.84 ? 696  LEU B CA  1 
ATOM   3210  C  C   . LEU B 1 43  ? 87.130  34.167  27.329 1.00 34.78 ? 696  LEU B C   1 
ATOM   3211  O  O   . LEU B 1 43  ? 87.952  33.400  26.839 1.00 33.81 ? 696  LEU B O   1 
ATOM   3212  C  CB  . LEU B 1 43  ? 85.382  33.373  28.996 1.00 33.57 ? 696  LEU B CB  1 
ATOM   3213  C  CG  . LEU B 1 43  ? 85.140  31.986  28.336 1.00 33.58 ? 696  LEU B CG  1 
ATOM   3214  C  CD1 . LEU B 1 43  ? 86.190  30.946  28.809 1.00 31.09 ? 696  LEU B CD1 1 
ATOM   3215  C  CD2 . LEU B 1 43  ? 83.727  31.529  28.646 1.00 31.68 ? 696  LEU B CD2 1 
ATOM   3216  N  N   . SER B 1 44  ? 86.535  35.107  26.605 1.00 36.55 ? 697  SER B N   1 
ATOM   3217  C  CA  . SER B 1 44  ? 86.880  35.273  25.189 1.00 38.85 ? 697  SER B CA  1 
ATOM   3218  C  C   . SER B 1 44  ? 88.363  35.575  25.008 1.00 41.45 ? 697  SER B C   1 
ATOM   3219  O  O   . SER B 1 44  ? 88.998  35.091  24.069 1.00 42.57 ? 697  SER B O   1 
ATOM   3220  C  CB  . SER B 1 44  ? 86.073  36.415  24.570 1.00 40.17 ? 697  SER B CB  1 
ATOM   3221  O  OG  . SER B 1 44  ? 86.208  37.598  25.326 1.00 40.95 ? 697  SER B OG  1 
ATOM   3222  N  N   . GLN B 1 45  ? 88.919  36.381  25.905 1.00 42.79 ? 698  GLN B N   1 
ATOM   3223  C  CA  . GLN B 1 45  ? 90.309  36.721  25.780 1.00 45.02 ? 698  GLN B CA  1 
ATOM   3224  C  C   . GLN B 1 45  ? 91.177  35.501  26.034 1.00 44.41 ? 698  GLN B C   1 
ATOM   3225  O  O   . GLN B 1 45  ? 92.156  35.262  25.320 1.00 45.94 ? 698  GLN B O   1 
ATOM   3226  C  CB  . GLN B 1 45  ? 90.666  37.874  26.730 1.00 47.08 ? 698  GLN B CB  1 
ATOM   3227  C  CG  . GLN B 1 45  ? 89.951  39.217  26.398 1.00 51.98 ? 698  GLN B CG  1 
ATOM   3228  C  CD  . GLN B 1 45  ? 90.098  39.664  24.920 1.00 53.77 ? 698  GLN B CD  1 
ATOM   3229  O  OE1 . GLN B 1 45  ? 91.030  39.254  24.223 1.00 55.26 ? 698  GLN B OE1 1 
ATOM   3230  N  NE2 . GLN B 1 45  ? 89.178  40.516  24.455 1.00 54.42 ? 698  GLN B NE2 1 
ATOM   3231  N  N   . VAL B 1 46  ? 90.826  34.712  27.034 1.00 41.54 ? 699  VAL B N   1 
ATOM   3232  C  CA  . VAL B 1 46  ? 91.629  33.532  27.303 1.00 41.52 ? 699  VAL B CA  1 
ATOM   3233  C  C   . VAL B 1 46  ? 91.534  32.529  26.145 1.00 42.81 ? 699  VAL B C   1 
ATOM   3234  O  O   . VAL B 1 46  ? 92.529  31.899  25.787 1.00 42.69 ? 699  VAL B O   1 
ATOM   3235  C  CB  . VAL B 1 46  ? 91.205  32.861  28.624 1.00 40.44 ? 699  VAL B CB  1 
ATOM   3236  C  CG1 . VAL B 1 46  ? 91.985  31.578  28.825 1.00 37.06 ? 699  VAL B CG1 1 
ATOM   3237  C  CG2 . VAL B 1 46  ? 91.458  33.833  29.789 1.00 40.45 ? 699  VAL B CG2 1 
ATOM   3238  N  N   . MET B 1 47  ? 90.345  32.385  25.560 1.00 42.48 ? 700  MET B N   1 
ATOM   3239  C  CA  . MET B 1 47  ? 90.160  31.468  24.444 1.00 42.77 ? 700  MET B CA  1 
ATOM   3240  C  C   . MET B 1 47  ? 91.131  31.831  23.337 1.00 43.59 ? 700  MET B C   1 
ATOM   3241  O  O   . MET B 1 47  ? 91.919  31.000  22.878 1.00 43.29 ? 700  MET B O   1 
ATOM   3242  C  CB  . MET B 1 47  ? 88.727  31.546  23.936 1.00 43.05 ? 700  MET B CB  1 
ATOM   3243  C  CG  . MET B 1 47  ? 87.752  30.797  24.808 1.00 43.49 ? 700  MET B CG  1 
ATOM   3244  S  SD  . MET B 1 47  ? 87.644  29.060  24.356 1.00 48.28 ? 700  MET B SD  1 
ATOM   3245  C  CE  . MET B 1 47  ? 88.885  28.410  25.128 1.00 44.78 ? 700  MET B CE  1 
ATOM   3246  N  N   . TYR B 1 48  ? 91.086  33.091  22.916 1.00 45.01 ? 701  TYR B N   1 
ATOM   3247  C  CA  . TYR B 1 48  ? 91.977  33.575  21.860 1.00 43.88 ? 701  TYR B CA  1 
ATOM   3248  C  C   . TYR B 1 48  ? 93.453  33.262  22.171 1.00 43.61 ? 701  TYR B C   1 
ATOM   3249  O  O   . TYR B 1 48  ? 94.180  32.761  21.310 1.00 43.42 ? 701  TYR B O   1 
ATOM   3250  C  CB  . TYR B 1 48  ? 91.775  35.078  21.668 1.00 45.43 ? 701  TYR B CB  1 
ATOM   3251  C  CG  . TYR B 1 48  ? 92.529  35.660  20.489 1.00 48.78 ? 701  TYR B CG  1 
ATOM   3252  C  CD1 . TYR B 1 48  ? 92.160  35.363  19.176 1.00 49.28 ? 701  TYR B CD1 1 
ATOM   3253  C  CD2 . TYR B 1 48  ? 93.642  36.473  20.684 1.00 49.25 ? 701  TYR B CD2 1 
ATOM   3254  C  CE1 . TYR B 1 48  ? 92.886  35.859  18.090 1.00 51.20 ? 701  TYR B CE1 1 
ATOM   3255  C  CE2 . TYR B 1 48  ? 94.372  36.968  19.610 1.00 52.15 ? 701  TYR B CE2 1 
ATOM   3256  C  CZ  . TYR B 1 48  ? 93.997  36.659  18.315 1.00 52.89 ? 701  TYR B CZ  1 
ATOM   3257  O  OH  . TYR B 1 48  ? 94.761  37.123  17.251 1.00 55.44 ? 701  TYR B OH  1 
ATOM   3258  N  N   . THR B 1 49  ? 93.887  33.538  23.397 1.00 42.16 ? 702  THR B N   1 
ATOM   3259  C  CA  . THR B 1 49  ? 95.269  33.285  23.795 1.00 41.46 ? 702  THR B CA  1 
ATOM   3260  C  C   . THR B 1 49  ? 95.657  31.821  23.698 1.00 42.42 ? 702  THR B C   1 
ATOM   3261  O  O   . THR B 1 49  ? 96.730  31.490  23.187 1.00 43.68 ? 702  THR B O   1 
ATOM   3262  C  CB  . THR B 1 49  ? 95.533  33.759  25.234 1.00 41.57 ? 702  THR B CB  1 
ATOM   3263  O  OG1 . THR B 1 49  ? 95.254  35.166  25.330 1.00 39.11 ? 702  THR B OG1 1 
ATOM   3264  C  CG2 . THR B 1 49  ? 97.001  33.483  25.640 1.00 39.89 ? 702  THR B CG2 1 
ATOM   3265  N  N   . LEU B 1 50  ? 94.797  30.941  24.198 1.00 41.74 ? 703  LEU B N   1 
ATOM   3266  C  CA  . LEU B 1 50  ? 95.043  29.501  24.130 1.00 39.46 ? 703  LEU B CA  1 
ATOM   3267  C  C   . LEU B 1 50  ? 94.946  28.972  22.695 1.00 38.84 ? 703  LEU B C   1 
ATOM   3268  O  O   . LEU B 1 50  ? 95.678  28.059  22.307 1.00 37.99 ? 703  LEU B O   1 
ATOM   3269  C  CB  . LEU B 1 50  ? 94.055  28.770  25.034 1.00 40.14 ? 703  LEU B CB  1 
ATOM   3270  C  CG  . LEU B 1 50  ? 94.263  29.030  26.523 1.00 39.69 ? 703  LEU B CG  1 
ATOM   3271  C  CD1 . LEU B 1 50  ? 93.363  28.085  27.328 1.00 38.71 ? 703  LEU B CD1 1 
ATOM   3272  C  CD2 . LEU B 1 50  ? 95.749  28.822  26.877 1.00 40.39 ? 703  LEU B CD2 1 
ATOM   3273  N  N   . PHE B 1 51  ? 94.057  29.541  21.894 1.00 39.35 ? 704  PHE B N   1 
ATOM   3274  C  CA  . PHE B 1 51  ? 93.962  29.085  20.514 1.00 40.83 ? 704  PHE B CA  1 
ATOM   3275  C  C   . PHE B 1 51  ? 95.205  29.486  19.709 1.00 41.76 ? 704  PHE B C   1 
ATOM   3276  O  O   . PHE B 1 51  ? 95.557  28.826  18.732 1.00 43.49 ? 704  PHE B O   1 
ATOM   3277  C  CB  . PHE B 1 51  ? 92.655  29.586  19.872 1.00 40.37 ? 704  PHE B CB  1 
ATOM   3278  C  CG  . PHE B 1 51  ? 91.467  28.673  20.118 1.00 39.63 ? 704  PHE B CG  1 
ATOM   3279  C  CD1 . PHE B 1 51  ? 91.253  28.103  21.379 1.00 38.72 ? 704  PHE B CD1 1 
ATOM   3280  C  CD2 . PHE B 1 51  ? 90.605  28.321  19.076 1.00 39.06 ? 704  PHE B CD2 1 
ATOM   3281  C  CE1 . PHE B 1 51  ? 90.197  27.185  21.588 1.00 40.37 ? 704  PHE B CE1 1 
ATOM   3282  C  CE2 . PHE B 1 51  ? 89.542  27.404  19.273 1.00 37.70 ? 704  PHE B CE2 1 
ATOM   3283  C  CZ  . PHE B 1 51  ? 89.341  26.833  20.523 1.00 38.60 ? 704  PHE B CZ  1 
ATOM   3284  N  N   . GLN B 1 52  ? 95.884  30.555  20.117 1.00 43.83 ? 705  GLN B N   1 
ATOM   3285  C  CA  . GLN B 1 52  ? 97.130  30.984  19.440 1.00 44.50 ? 705  GLN B CA  1 
ATOM   3286  C  C   . GLN B 1 52  ? 98.227  30.054  19.948 1.00 44.14 ? 705  GLN B C   1 
ATOM   3287  O  O   . GLN B 1 52  ? 99.027  29.503  19.190 1.00 42.78 ? 705  GLN B O   1 
ATOM   3288  C  CB  . GLN B 1 52  ? 97.531  32.393  19.860 1.00 47.55 ? 705  GLN B CB  1 
ATOM   3289  C  CG  . GLN B 1 52  ? 96.770  33.535  19.241 1.00 52.81 ? 705  GLN B CG  1 
ATOM   3290  C  CD  . GLN B 1 52  ? 97.360  33.961  17.906 1.00 57.87 ? 705  GLN B CD  1 
ATOM   3291  O  OE1 . GLN B 1 52  ? 97.041  35.053  17.388 1.00 60.35 ? 705  GLN B OE1 1 
ATOM   3292  N  NE2 . GLN B 1 52  ? 98.222  33.104  17.329 1.00 57.51 ? 705  GLN B NE2 1 
ATOM   3293  N  N   . ASP B 1 53  ? 98.263  29.903  21.262 1.00 42.00 ? 706  ASP B N   1 
ATOM   3294  C  CA  . ASP B 1 53  ? 99.255  29.063  21.863 1.00 41.97 ? 706  ASP B CA  1 
ATOM   3295  C  C   . ASP B 1 53  ? 99.288  27.690  21.211 1.00 42.94 ? 706  ASP B C   1 
ATOM   3296  O  O   . ASP B 1 53  ? 100.360 27.187  20.871 1.00 43.66 ? 706  ASP B O   1 
ATOM   3297  C  CB  . ASP B 1 53  ? 99.000  28.938  23.362 1.00 40.67 ? 706  ASP B CB  1 
ATOM   3298  C  CG  . ASP B 1 53  ? 100.049 28.091  24.058 1.00 41.99 ? 706  ASP B CG  1 
ATOM   3299  O  OD1 . ASP B 1 53  ? 99.761  26.925  24.364 1.00 40.96 ? 706  ASP B OD1 1 
ATOM   3300  O  OD2 . ASP B 1 53  ? 101.172 28.590  24.303 1.00 45.11 ? 706  ASP B OD2 1 
ATOM   3301  N  N   . THR B 1 54  ? 98.118  27.084  21.023 1.00 43.06 ? 707  THR B N   1 
ATOM   3302  C  CA  . THR B 1 54  ? 98.057  25.744  20.435 1.00 42.65 ? 707  THR B CA  1 
ATOM   3303  C  C   . THR B 1 54  ? 98.157  25.726  18.906 1.00 43.66 ? 707  THR B C   1 
ATOM   3304  O  O   . THR B 1 54  ? 98.668  24.767  18.323 1.00 44.05 ? 707  THR B O   1 
ATOM   3305  C  CB  . THR B 1 54  ? 96.762  24.979  20.891 1.00 42.39 ? 707  THR B CB  1 
ATOM   3306  O  OG1 . THR B 1 54  ? 95.594  25.710  20.515 1.00 40.21 ? 707  THR B OG1 1 
ATOM   3307  C  CG2 . THR B 1 54  ? 96.755  24.805  22.403 1.00 41.34 ? 707  THR B CG2 1 
ATOM   3308  N  N   . GLY B 1 55  ? 97.682  26.787  18.260 1.00 43.82 ? 708  GLY B N   1 
ATOM   3309  C  CA  . GLY B 1 55  ? 97.745  26.841  16.814 1.00 43.85 ? 708  GLY B CA  1 
ATOM   3310  C  C   . GLY B 1 55  ? 96.450  26.406  16.144 1.00 45.64 ? 708  GLY B C   1 
ATOM   3311  O  O   . GLY B 1 55  ? 96.405  26.175  14.936 1.00 44.75 ? 708  GLY B O   1 
ATOM   3312  N  N   . LEU B 1 56  ? 95.390  26.305  16.939 1.00 46.13 ? 709  LEU B N   1 
ATOM   3313  C  CA  . LEU B 1 56  ? 94.090  25.904  16.438 1.00 46.61 ? 709  LEU B CA  1 
ATOM   3314  C  C   . LEU B 1 56  ? 93.565  26.904  15.394 1.00 46.95 ? 709  LEU B C   1 
ATOM   3315  O  O   . LEU B 1 56  ? 92.873  26.522  14.454 1.00 47.36 ? 709  LEU B O   1 
ATOM   3316  C  CB  . LEU B 1 56  ? 93.103  25.765  17.616 1.00 45.61 ? 709  LEU B CB  1 
ATOM   3317  C  CG  . LEU B 1 56  ? 93.386  24.615  18.608 1.00 44.78 ? 709  LEU B CG  1 
ATOM   3318  C  CD1 . LEU B 1 56  ? 92.421  24.678  19.793 1.00 43.54 ? 709  LEU B CD1 1 
ATOM   3319  C  CD2 . LEU B 1 56  ? 93.255  23.268  17.900 1.00 43.83 ? 709  LEU B CD2 1 
ATOM   3320  N  N   . LEU B 1 57  ? 93.894  28.178  15.562 1.00 47.99 ? 710  LEU B N   1 
ATOM   3321  C  CA  . LEU B 1 57  ? 93.442  29.204  14.622 1.00 49.86 ? 710  LEU B CA  1 
ATOM   3322  C  C   . LEU B 1 57  ? 94.038  28.913  13.270 1.00 51.04 ? 710  LEU B C   1 
ATOM   3323  O  O   . LEU B 1 57  ? 93.364  29.031  12.243 1.00 52.40 ? 710  LEU B O   1 
ATOM   3324  C  CB  . LEU B 1 57  ? 93.886  30.597  15.075 1.00 48.32 ? 710  LEU B CB  1 
ATOM   3325  C  CG  . LEU B 1 57  ? 93.403  30.951  16.477 1.00 48.12 ? 710  LEU B CG  1 
ATOM   3326  C  CD1 . LEU B 1 57  ? 94.054  32.252  16.940 1.00 47.11 ? 710  LEU B CD1 1 
ATOM   3327  C  CD2 . LEU B 1 57  ? 91.883  31.041  16.480 1.00 46.80 ? 710  LEU B CD2 1 
ATOM   3328  N  N   . GLU B 1 58  ? 95.302  28.502  13.282 1.00 52.22 ? 711  GLU B N   1 
ATOM   3329  C  CA  . GLU B 1 58  ? 96.014  28.185  12.055 1.00 53.50 ? 711  GLU B CA  1 
ATOM   3330  C  C   . GLU B 1 58  ? 95.563  26.846  11.457 1.00 51.84 ? 711  GLU B C   1 
ATOM   3331  O  O   . GLU B 1 58  ? 95.269  26.744  10.271 1.00 52.09 ? 711  GLU B O   1 
ATOM   3332  C  CB  . GLU B 1 58  ? 97.522  28.162  12.324 1.00 55.97 ? 711  GLU B CB  1 
ATOM   3333  C  CG  . GLU B 1 58  ? 98.324  29.102  11.423 1.00 61.77 ? 711  GLU B CG  1 
ATOM   3334  C  CD  . GLU B 1 58  ? 98.268  28.666  9.961  1.00 65.23 ? 711  GLU B CD  1 
ATOM   3335  O  OE1 . GLU B 1 58  ? 98.850  27.590  9.648  1.00 66.79 ? 711  GLU B OE1 1 
ATOM   3336  O  OE2 . GLU B 1 58  ? 97.642  29.380  9.128  1.00 65.77 ? 711  GLU B OE2 1 
ATOM   3337  N  N   . ILE B 1 59  ? 95.491  25.823  12.295 1.00 50.74 ? 712  ILE B N   1 
ATOM   3338  C  CA  . ILE B 1 59  ? 95.103  24.486  11.858 1.00 48.77 ? 712  ILE B CA  1 
ATOM   3339  C  C   . ILE B 1 59  ? 93.742  24.422  11.184 1.00 46.26 ? 712  ILE B C   1 
ATOM   3340  O  O   . ILE B 1 59  ? 93.601  23.778  10.153 1.00 45.70 ? 712  ILE B O   1 
ATOM   3341  C  CB  . ILE B 1 59  ? 95.124  23.506  13.051 1.00 47.14 ? 712  ILE B CB  1 
ATOM   3342  C  CG1 . ILE B 1 59  ? 96.565  23.356  13.561 1.00 46.33 ? 712  ILE B CG1 1 
ATOM   3343  C  CG2 . ILE B 1 59  ? 94.550  22.168  12.645 1.00 47.72 ? 712  ILE B CG2 1 
ATOM   3344  C  CD1 . ILE B 1 59  ? 96.728  22.676  14.925 1.00 44.35 ? 712  ILE B CD1 1 
ATOM   3345  N  N   . PHE B 1 60  ? 92.756  25.112  11.747 1.00 45.28 ? 713  PHE B N   1 
ATOM   3346  C  CA  . PHE B 1 60  ? 91.399  25.083  11.203 1.00 44.51 ? 713  PHE B CA  1 
ATOM   3347  C  C   . PHE B 1 60  ? 90.975  26.340  10.523 1.00 42.92 ? 713  PHE B C   1 
ATOM   3348  O  O   . PHE B 1 60  ? 89.785  26.579  10.360 1.00 40.09 ? 713  PHE B O   1 
ATOM   3349  C  CB  . PHE B 1 60  ? 90.382  24.722  12.305 1.00 44.03 ? 713  PHE B CB  1 
ATOM   3350  C  CG  . PHE B 1 60  ? 90.587  23.337  12.869 1.00 43.26 ? 713  PHE B CG  1 
ATOM   3351  C  CD1 . PHE B 1 60  ? 91.208  23.153  14.108 1.00 41.97 ? 713  PHE B CD1 1 
ATOM   3352  C  CD2 . PHE B 1 60  ? 90.296  22.216  12.091 1.00 41.55 ? 713  PHE B CD2 1 
ATOM   3353  C  CE1 . PHE B 1 60  ? 91.537  21.880  14.557 1.00 42.50 ? 713  PHE B CE1 1 
ATOM   3354  C  CE2 . PHE B 1 60  ? 90.624  20.935  12.534 1.00 41.79 ? 713  PHE B CE2 1 
ATOM   3355  C  CZ  . PHE B 1 60  ? 91.252  20.765  13.763 1.00 43.46 ? 713  PHE B CZ  1 
ATOM   3356  N  N   . LYS B 1 61  ? 91.965  27.138  10.142 1.00 45.56 ? 714  LYS B N   1 
ATOM   3357  C  CA  . LYS B 1 61  ? 91.736  28.396  9.437  1.00 47.06 ? 714  LYS B CA  1 
ATOM   3358  C  C   . LYS B 1 61  ? 90.597  29.174  10.067 1.00 47.10 ? 714  LYS B C   1 
ATOM   3359  O  O   . LYS B 1 61  ? 89.691  29.614  9.363  1.00 46.10 ? 714  LYS B O   1 
ATOM   3360  C  CB  . LYS B 1 61  ? 91.379  28.109  7.979  1.00 49.12 ? 714  LYS B CB  1 
ATOM   3361  C  CG  . LYS B 1 61  ? 92.393  27.256  7.196  1.00 51.70 ? 714  LYS B CG  1 
ATOM   3362  C  CD  . LYS B 1 61  ? 93.488  28.108  6.558  1.00 54.90 ? 714  LYS B CD  1 
ATOM   3363  C  CE  . LYS B 1 61  ? 94.537  28.586  7.560  1.00 57.42 ? 714  LYS B CE  1 
ATOM   3364  N  NZ  . LYS B 1 61  ? 95.829  27.858  7.355  1.00 59.87 ? 714  LYS B NZ  1 
ATOM   3365  N  N   . ILE B 1 62  ? 90.641  29.328  11.392 1.00 47.21 ? 715  ILE B N   1 
ATOM   3366  C  CA  . ILE B 1 62  ? 89.596  30.042  12.117 1.00 46.28 ? 715  ILE B CA  1 
ATOM   3367  C  C   . ILE B 1 62  ? 89.713  31.564  11.958 1.00 47.01 ? 715  ILE B C   1 
ATOM   3368  O  O   . ILE B 1 62  ? 90.750  32.151  12.258 1.00 47.18 ? 715  ILE B O   1 
ATOM   3369  C  CB  . ILE B 1 62  ? 89.640  29.708  13.643 1.00 44.39 ? 715  ILE B CB  1 
ATOM   3370  C  CG1 . ILE B 1 62  ? 89.455  28.206  13.860 1.00 43.70 ? 715  ILE B CG1 1 
ATOM   3371  C  CG2 . ILE B 1 62  ? 88.546  30.457  14.378 1.00 43.31 ? 715  ILE B CG2 1 
ATOM   3372  C  CD1 . ILE B 1 62  ? 89.614  27.756  15.298 1.00 42.12 ? 715  ILE B CD1 1 
ATOM   3373  N  N   . PRO B 1 63  ? 88.651  32.217  11.464 1.00 47.94 ? 716  PRO B N   1 
ATOM   3374  C  CA  . PRO B 1 63  ? 88.643  33.677  11.280 1.00 47.22 ? 716  PRO B CA  1 
ATOM   3375  C  C   . PRO B 1 63  ? 88.439  34.390  12.625 1.00 48.30 ? 716  PRO B C   1 
ATOM   3376  O  O   . PRO B 1 63  ? 87.411  34.205  13.277 1.00 48.43 ? 716  PRO B O   1 
ATOM   3377  C  CB  . PRO B 1 63  ? 87.477  33.894  10.321 1.00 47.76 ? 716  PRO B CB  1 
ATOM   3378  C  CG  . PRO B 1 63  ? 86.532  32.754  10.665 1.00 48.20 ? 716  PRO B CG  1 
ATOM   3379  C  CD  . PRO B 1 63  ? 87.488  31.588  10.809 1.00 47.83 ? 716  PRO B CD  1 
ATOM   3380  N  N   . THR B 1 64  ? 89.418  35.200  13.029 1.00 47.20 ? 717  THR B N   1 
ATOM   3381  C  CA  . THR B 1 64  ? 89.378  35.926  14.293 1.00 46.38 ? 717  THR B CA  1 
ATOM   3382  C  C   . THR B 1 64  ? 88.093  36.682  14.616 1.00 46.90 ? 717  THR B C   1 
ATOM   3383  O  O   . THR B 1 64  ? 87.598  36.635  15.748 1.00 46.89 ? 717  THR B O   1 
ATOM   3384  C  CB  . THR B 1 64  ? 90.542  36.956  14.396 1.00 47.76 ? 717  THR B CB  1 
ATOM   3385  O  OG1 . THR B 1 64  ? 91.799  36.298  14.204 1.00 46.45 ? 717  THR B OG1 1 
ATOM   3386  C  CG2 . THR B 1 64  ? 90.536  37.634  15.778 1.00 45.98 ? 717  THR B CG2 1 
ATOM   3387  N  N   . GLN B 1 65  ? 87.564  37.393  13.635 1.00 46.23 ? 718  GLN B N   1 
ATOM   3388  C  CA  . GLN B 1 65  ? 86.354  38.172  13.835 1.00 45.83 ? 718  GLN B CA  1 
ATOM   3389  C  C   . GLN B 1 65  ? 85.172  37.360  14.398 1.00 46.06 ? 718  GLN B C   1 
ATOM   3390  O  O   . GLN B 1 65  ? 84.679  37.668  15.478 1.00 45.68 ? 718  GLN B O   1 
ATOM   3391  C  CB  . GLN B 1 65  ? 85.955  38.857  12.512 1.00 47.03 ? 718  GLN B CB  1 
ATOM   3392  C  CG  . GLN B 1 65  ? 84.781  39.827  12.639 1.00 48.12 ? 718  GLN B CG  1 
ATOM   3393  C  CD  . GLN B 1 65  ? 85.075  40.937  13.627 1.00 50.21 ? 718  GLN B CD  1 
ATOM   3394  O  OE1 . GLN B 1 65  ? 86.024  41.701  13.452 1.00 53.67 ? 718  GLN B OE1 1 
ATOM   3395  N  NE2 . GLN B 1 65  ? 84.273  41.025  14.679 1.00 50.39 ? 718  GLN B NE2 1 
ATOM   3396  N  N   . GLN B 1 66  ? 84.718  36.344  13.661 1.00 45.41 ? 719  GLN B N   1 
ATOM   3397  C  CA  . GLN B 1 66  ? 83.598  35.495  14.084 1.00 45.27 ? 719  GLN B CA  1 
ATOM   3398  C  C   . GLN B 1 66  ? 83.892  34.772  15.400 1.00 45.97 ? 719  GLN B C   1 
ATOM   3399  O  O   . GLN B 1 66  ? 83.006  34.606  16.240 1.00 45.56 ? 719  GLN B O   1 
ATOM   3400  C  CB  . GLN B 1 66  ? 83.281  34.426  13.026 1.00 44.80 ? 719  GLN B CB  1 
ATOM   3401  C  CG  . GLN B 1 66  ? 82.639  34.933  11.750 1.00 44.20 ? 719  GLN B CG  1 
ATOM   3402  C  CD  . GLN B 1 66  ? 83.668  35.321  10.713 1.00 44.40 ? 719  GLN B CD  1 
ATOM   3403  O  OE1 . GLN B 1 66  ? 83.533  34.975  9.544  1.00 44.95 ? 719  GLN B OE1 1 
ATOM   3404  N  NE2 . GLN B 1 66  ? 84.702  36.038  11.133 1.00 43.17 ? 719  GLN B NE2 1 
ATOM   3405  N  N   . PHE B 1 67  ? 85.136  34.320  15.549 1.00 45.46 ? 720  PHE B N   1 
ATOM   3406  C  CA  . PHE B 1 67  ? 85.558  33.621  16.744 1.00 46.56 ? 720  PHE B CA  1 
ATOM   3407  C  C   . PHE B 1 67  ? 85.292  34.521  17.952 1.00 46.56 ? 720  PHE B C   1 
ATOM   3408  O  O   . PHE B 1 67  ? 84.574  34.131  18.872 1.00 46.74 ? 720  PHE B O   1 
ATOM   3409  C  CB  . PHE B 1 67  ? 87.048  33.288  16.636 1.00 46.73 ? 720  PHE B CB  1 
ATOM   3410  C  CG  . PHE B 1 67  ? 87.617  32.574  17.838 1.00 48.00 ? 720  PHE B CG  1 
ATOM   3411  C  CD1 . PHE B 1 67  ? 87.673  31.185  17.875 1.00 47.41 ? 720  PHE B CD1 1 
ATOM   3412  C  CD2 . PHE B 1 67  ? 88.153  33.288  18.912 1.00 48.46 ? 720  PHE B CD2 1 
ATOM   3413  C  CE1 . PHE B 1 67  ? 88.251  30.523  18.944 1.00 45.43 ? 720  PHE B CE1 1 
ATOM   3414  C  CE2 . PHE B 1 67  ? 88.738  32.614  19.998 1.00 47.52 ? 720  PHE B CE2 1 
ATOM   3415  C  CZ  . PHE B 1 67  ? 88.784  31.234  20.004 1.00 46.35 ? 720  PHE B CZ  1 
ATOM   3416  N  N   . MET B 1 68  ? 85.845  35.735  17.934 1.00 45.86 ? 721  MET B N   1 
ATOM   3417  C  CA  . MET B 1 68  ? 85.652  36.655  19.055 1.00 45.70 ? 721  MET B CA  1 
ATOM   3418  C  C   . MET B 1 68  ? 84.188  37.044  19.218 1.00 43.67 ? 721  MET B C   1 
ATOM   3419  O  O   . MET B 1 68  ? 83.712  37.195  20.336 1.00 43.52 ? 721  MET B O   1 
ATOM   3420  C  CB  . MET B 1 68  ? 86.522  37.913  18.897 1.00 45.79 ? 721  MET B CB  1 
ATOM   3421  C  CG  . MET B 1 68  ? 88.012  37.661  18.917 1.00 45.67 ? 721  MET B CG  1 
ATOM   3422  S  SD  . MET B 1 68  ? 88.655  36.820  20.414 1.00 50.93 ? 721  MET B SD  1 
ATOM   3423  C  CE  . MET B 1 68  ? 88.258  37.975  21.697 1.00 46.92 ? 721  MET B CE  1 
ATOM   3424  N  N   . ASN B 1 69  ? 83.470  37.187  18.112 1.00 42.63 ? 722  ASN B N   1 
ATOM   3425  C  CA  . ASN B 1 69  ? 82.063  37.539  18.199 1.00 43.86 ? 722  ASN B CA  1 
ATOM   3426  C  C   . ASN B 1 69  ? 81.310  36.491  19.021 1.00 43.51 ? 722  ASN B C   1 
ATOM   3427  O  O   . ASN B 1 69  ? 80.552  36.822  19.958 1.00 43.04 ? 722  ASN B O   1 
ATOM   3428  C  CB  . ASN B 1 69  ? 81.397  37.613  16.802 1.00 45.23 ? 722  ASN B CB  1 
ATOM   3429  C  CG  . ASN B 1 69  ? 81.919  38.766  15.941 1.00 46.39 ? 722  ASN B CG  1 
ATOM   3430  O  OD1 . ASN B 1 69  ? 82.199  39.857  16.435 1.00 46.08 ? 722  ASN B OD1 1 
ATOM   3431  N  ND2 . ASN B 1 69  ? 82.028  38.524  14.641 1.00 47.60 ? 722  ASN B ND2 1 
ATOM   3432  N  N   . TYR B 1 70  ? 81.521  35.223  18.657 1.00 42.84 ? 723  TYR B N   1 
ATOM   3433  C  CA  . TYR B 1 70  ? 80.830  34.124  19.315 1.00 42.15 ? 723  TYR B CA  1 
ATOM   3434  C  C   . TYR B 1 70  ? 81.240  33.951  20.755 1.00 40.80 ? 723  TYR B C   1 
ATOM   3435  O  O   . TYR B 1 70  ? 80.391  33.831  21.625 1.00 41.73 ? 723  TYR B O   1 
ATOM   3436  C  CB  . TYR B 1 70  ? 81.010  32.799  18.564 1.00 39.63 ? 723  TYR B CB  1 
ATOM   3437  C  CG  . TYR B 1 70  ? 80.305  31.670  19.275 1.00 39.56 ? 723  TYR B CG  1 
ATOM   3438  C  CD1 . TYR B 1 70  ? 78.903  31.617  19.331 1.00 39.42 ? 723  TYR B CD1 1 
ATOM   3439  C  CD2 . TYR B 1 70  ? 81.030  30.708  19.994 1.00 39.20 ? 723  TYR B CD2 1 
ATOM   3440  C  CE1 . TYR B 1 70  ? 78.243  30.643  20.099 1.00 38.77 ? 723  TYR B CE1 1 
ATOM   3441  C  CE2 . TYR B 1 70  ? 80.380  29.727  20.763 1.00 36.83 ? 723  TYR B CE2 1 
ATOM   3442  C  CZ  . TYR B 1 70  ? 79.001  29.703  20.812 1.00 37.67 ? 723  TYR B CZ  1 
ATOM   3443  O  OH  . TYR B 1 70  ? 78.365  28.750  21.547 1.00 35.79 ? 723  TYR B OH  1 
ATOM   3444  N  N   . PHE B 1 71  ? 82.526  33.945  21.032 1.00 39.89 ? 724  PHE B N   1 
ATOM   3445  C  CA  . PHE B 1 71  ? 82.893  33.772  22.423 1.00 41.99 ? 724  PHE B CA  1 
ATOM   3446  C  C   . PHE B 1 71  ? 82.585  34.992  23.303 1.00 41.64 ? 724  PHE B C   1 
ATOM   3447  O  O   . PHE B 1 71  ? 82.528  34.877  24.525 1.00 42.49 ? 724  PHE B O   1 
ATOM   3448  C  CB  . PHE B 1 71  ? 84.346  33.281  22.523 1.00 41.78 ? 724  PHE B CB  1 
ATOM   3449  C  CG  . PHE B 1 71  ? 84.509  31.877  22.010 1.00 42.30 ? 724  PHE B CG  1 
ATOM   3450  C  CD1 . PHE B 1 71  ? 83.987  30.794  22.730 1.00 43.99 ? 724  PHE B CD1 1 
ATOM   3451  C  CD2 . PHE B 1 71  ? 85.049  31.637  20.753 1.00 41.79 ? 724  PHE B CD2 1 
ATOM   3452  C  CE1 . PHE B 1 71  ? 83.998  29.490  22.196 1.00 43.09 ? 724  PHE B CE1 1 
ATOM   3453  C  CE2 . PHE B 1 71  ? 85.068  30.346  20.209 1.00 41.81 ? 724  PHE B CE2 1 
ATOM   3454  C  CZ  . PHE B 1 71  ? 84.538  29.271  20.933 1.00 42.96 ? 724  PHE B CZ  1 
ATOM   3455  N  N   . ARG B 1 72  ? 82.341  36.148  22.691 1.00 42.10 ? 725  ARG B N   1 
ATOM   3456  C  CA  . ARG B 1 72  ? 81.976  37.321  23.478 1.00 42.24 ? 725  ARG B CA  1 
ATOM   3457  C  C   . ARG B 1 72  ? 80.501  37.169  23.786 1.00 40.61 ? 725  ARG B C   1 
ATOM   3458  O  O   . ARG B 1 72  ? 80.055  37.517  24.879 1.00 40.20 ? 725  ARG B O   1 
ATOM   3459  C  CB  . ARG B 1 72  ? 82.245  38.623  22.725 1.00 43.15 ? 725  ARG B CB  1 
ATOM   3460  C  CG  . ARG B 1 72  ? 83.702  39.014  22.794 1.00 45.68 ? 725  ARG B CG  1 
ATOM   3461  C  CD  . ARG B 1 72  ? 83.977  40.282  22.037 1.00 50.96 ? 725  ARG B CD  1 
ATOM   3462  N  NE  . ARG B 1 72  ? 85.412  40.589  22.001 1.00 56.79 ? 725  ARG B NE  1 
ATOM   3463  C  CZ  . ARG B 1 72  ? 85.995  41.389  21.102 1.00 58.97 ? 725  ARG B CZ  1 
ATOM   3464  N  NH1 . ARG B 1 72  ? 85.271  41.977  20.147 1.00 59.89 ? 725  ARG B NH1 1 
ATOM   3465  N  NH2 . ARG B 1 72  ? 87.310  41.589  21.145 1.00 60.08 ? 725  ARG B NH2 1 
ATOM   3466  N  N   . ALA B 1 73  ? 79.749  36.626  22.828 1.00 39.08 ? 726  ALA B N   1 
ATOM   3467  C  CA  . ALA B 1 73  ? 78.325  36.388  23.049 1.00 37.45 ? 726  ALA B CA  1 
ATOM   3468  C  C   . ALA B 1 73  ? 78.168  35.285  24.098 1.00 36.50 ? 726  ALA B C   1 
ATOM   3469  O  O   . ALA B 1 73  ? 77.327  35.399  24.989 1.00 36.66 ? 726  ALA B O   1 
ATOM   3470  C  CB  . ALA B 1 73  ? 77.619  35.979  21.747 1.00 35.89 ? 726  ALA B CB  1 
ATOM   3471  N  N   . LEU B 1 74  ? 78.990  34.235  24.010 1.00 35.11 ? 727  LEU B N   1 
ATOM   3472  C  CA  . LEU B 1 74  ? 78.903  33.111  24.962 1.00 34.87 ? 727  LEU B CA  1 
ATOM   3473  C  C   . LEU B 1 74  ? 79.058  33.574  26.397 1.00 34.46 ? 727  LEU B C   1 
ATOM   3474  O  O   . LEU B 1 74  ? 78.269  33.170  27.260 1.00 33.45 ? 727  LEU B O   1 
ATOM   3475  C  CB  . LEU B 1 74  ? 79.977  32.044  24.660 1.00 34.31 ? 727  LEU B CB  1 
ATOM   3476  C  CG  . LEU B 1 74  ? 79.890  30.700  25.406 1.00 33.08 ? 727  LEU B CG  1 
ATOM   3477  C  CD1 . LEU B 1 74  ? 78.648  29.947  24.947 1.00 32.62 ? 727  LEU B CD1 1 
ATOM   3478  C  CD2 . LEU B 1 74  ? 81.135  29.853  25.153 1.00 32.53 ? 727  LEU B CD2 1 
ATOM   3479  N  N   . GLU B 1 75  ? 80.082  34.413  26.621 1.00 35.32 ? 728  GLU B N   1 
ATOM   3480  C  CA  . GLU B 1 75  ? 80.441  35.016  27.927 1.00 36.56 ? 728  GLU B CA  1 
ATOM   3481  C  C   . GLU B 1 75  ? 79.296  35.740  28.617 1.00 37.72 ? 728  GLU B C   1 
ATOM   3482  O  O   . GLU B 1 75  ? 79.084  35.561  29.809 1.00 37.32 ? 728  GLU B O   1 
ATOM   3483  C  CB  . GLU B 1 75  ? 81.540  36.078  27.777 1.00 36.93 ? 728  GLU B CB  1 
ATOM   3484  C  CG  . GLU B 1 75  ? 82.924  35.581  27.716 1.00 40.28 ? 728  GLU B CG  1 
ATOM   3485  C  CD  . GLU B 1 75  ? 83.951  36.709  27.559 1.00 43.03 ? 728  GLU B CD  1 
ATOM   3486  O  OE1 . GLU B 1 75  ? 83.685  37.687  26.806 1.00 42.30 ? 728  GLU B OE1 1 
ATOM   3487  O  OE2 . GLU B 1 75  ? 85.040  36.577  28.167 1.00 43.15 ? 728  GLU B OE2 1 
ATOM   3488  N  N   . ASN B 1 76  ? 78.603  36.595  27.855 1.00 38.73 ? 729  ASN B N   1 
ATOM   3489  C  CA  . ASN B 1 76  ? 77.517  37.403  28.375 1.00 39.23 ? 729  ASN B CA  1 
ATOM   3490  C  C   . ASN B 1 76  ? 76.327  36.541  28.686 1.00 39.99 ? 729  ASN B C   1 
ATOM   3491  O  O   . ASN B 1 76  ? 75.292  37.029  29.148 1.00 40.45 ? 729  ASN B O   1 
ATOM   3492  C  CB  . ASN B 1 76  ? 77.119  38.500  27.368 1.00 41.58 ? 729  ASN B CB  1 
ATOM   3493  C  CG  . ASN B 1 76  ? 78.227  39.535  27.140 1.00 42.87 ? 729  ASN B CG  1 
ATOM   3494  O  OD1 . ASN B 1 76  ? 78.961  39.903  28.071 1.00 43.03 ? 729  ASN B OD1 1 
ATOM   3495  N  ND2 . ASN B 1 76  ? 78.341  40.021  25.899 1.00 42.37 ? 729  ASN B ND2 1 
ATOM   3496  N  N   . GLY B 1 77  ? 76.469  35.254  28.401 1.00 39.74 ? 730  GLY B N   1 
ATOM   3497  C  CA  . GLY B 1 77  ? 75.400  34.308  28.661 1.00 37.82 ? 730  GLY B CA  1 
ATOM   3498  C  C   . GLY B 1 77  ? 75.553  33.756  30.060 1.00 37.91 ? 730  GLY B C   1 
ATOM   3499  O  O   . GLY B 1 77  ? 74.649  33.101  30.580 1.00 37.23 ? 730  GLY B O   1 
ATOM   3500  N  N   . TYR B 1 78  ? 76.713  33.991  30.668 1.00 37.61 ? 731  TYR B N   1 
ATOM   3501  C  CA  . TYR B 1 78  ? 76.904  33.516  32.025 1.00 39.58 ? 731  TYR B CA  1 
ATOM   3502  C  C   . TYR B 1 78  ? 76.395  34.597  32.967 1.00 40.74 ? 731  TYR B C   1 
ATOM   3503  O  O   . TYR B 1 78  ? 76.752  35.780  32.846 1.00 41.36 ? 731  TYR B O   1 
ATOM   3504  C  CB  . TYR B 1 78  ? 78.366  33.179  32.336 1.00 36.08 ? 731  TYR B CB  1 
ATOM   3505  C  CG  . TYR B 1 78  ? 78.868  31.835  31.789 1.00 34.86 ? 731  TYR B CG  1 
ATOM   3506  C  CD1 . TYR B 1 78  ? 79.066  31.628  30.421 1.00 32.60 ? 731  TYR B CD1 1 
ATOM   3507  C  CD2 . TYR B 1 78  ? 79.198  30.794  32.655 1.00 31.84 ? 731  TYR B CD2 1 
ATOM   3508  C  CE1 . TYR B 1 78  ? 79.586  30.413  29.932 1.00 31.97 ? 731  TYR B CE1 1 
ATOM   3509  C  CE2 . TYR B 1 78  ? 79.715  29.593  32.189 1.00 31.00 ? 731  TYR B CE2 1 
ATOM   3510  C  CZ  . TYR B 1 78  ? 79.909  29.394  30.833 1.00 31.86 ? 731  TYR B CZ  1 
ATOM   3511  O  OH  . TYR B 1 78  ? 80.432  28.191  30.388 1.00 28.58 ? 731  TYR B OH  1 
ATOM   3512  N  N   . ARG B 1 79  ? 75.545  34.164  33.898 1.00 41.33 ? 732  ARG B N   1 
ATOM   3513  C  CA  . ARG B 1 79  ? 74.942  35.042  34.873 1.00 41.55 ? 732  ARG B CA  1 
ATOM   3514  C  C   . ARG B 1 79  ? 75.963  35.489  35.873 1.00 42.58 ? 732  ARG B C   1 
ATOM   3515  O  O   . ARG B 1 79  ? 77.036  34.907  36.020 1.00 42.30 ? 732  ARG B O   1 
ATOM   3516  C  CB  . ARG B 1 79  ? 73.793  34.360  35.621 1.00 38.60 ? 732  ARG B CB  1 
ATOM   3517  C  CG  . ARG B 1 79  ? 72.652  33.912  34.754 1.00 37.39 ? 732  ARG B CG  1 
ATOM   3518  C  CD  . ARG B 1 79  ? 71.505  33.404  35.597 1.00 36.41 ? 732  ARG B CD  1 
ATOM   3519  N  NE  . ARG B 1 79  ? 70.511  32.803  34.737 1.00 39.16 ? 732  ARG B NE  1 
ATOM   3520  C  CZ  . ARG B 1 79  ? 69.328  32.369  35.146 1.00 41.90 ? 732  ARG B CZ  1 
ATOM   3521  N  NH1 . ARG B 1 79  ? 68.999  32.476  36.420 1.00 43.02 ? 732  ARG B NH1 1 
ATOM   3522  N  NH2 . ARG B 1 79  ? 68.473  31.831  34.279 1.00 42.51 ? 732  ARG B NH2 1 
ATOM   3523  N  N   . ASP B 1 80  ? 75.604  36.543  36.579 1.00 44.81 ? 733  ASP B N   1 
ATOM   3524  C  CA  . ASP B 1 80  ? 76.485  37.068  37.579 1.00 46.55 ? 733  ASP B CA  1 
ATOM   3525  C  C   . ASP B 1 80  ? 76.202  36.394  38.909 1.00 46.19 ? 733  ASP B C   1 
ATOM   3526  O  O   . ASP B 1 80  ? 75.542  36.971  39.768 1.00 44.54 ? 733  ASP B O   1 
ATOM   3527  C  CB  . ASP B 1 80  ? 76.286  38.556  37.702 1.00 49.79 ? 733  ASP B CB  1 
ATOM   3528  C  CG  . ASP B 1 80  ? 77.342  39.176  38.530 1.00 53.77 ? 733  ASP B CG  1 
ATOM   3529  O  OD1 . ASP B 1 80  ? 78.537  38.975  38.201 1.00 56.59 ? 733  ASP B OD1 1 
ATOM   3530  O  OD2 . ASP B 1 80  ? 76.990  39.849  39.515 1.00 56.50 ? 733  ASP B OD2 1 
ATOM   3531  N  N   . ILE B 1 81  ? 76.683  35.156  39.059 1.00 45.24 ? 734  ILE B N   1 
ATOM   3532  C  CA  . ILE B 1 81  ? 76.492  34.400  40.289 1.00 41.87 ? 734  ILE B CA  1 
ATOM   3533  C  C   . ILE B 1 81  ? 77.865  34.112  40.917 1.00 40.56 ? 734  ILE B C   1 
ATOM   3534  O  O   . ILE B 1 81  ? 78.902  34.257  40.266 1.00 40.02 ? 734  ILE B O   1 
ATOM   3535  C  CB  . ILE B 1 81  ? 75.638  33.137  40.022 1.00 42.06 ? 734  ILE B CB  1 
ATOM   3536  C  CG1 . ILE B 1 81  ? 76.160  32.354  38.813 1.00 41.08 ? 734  ILE B CG1 1 
ATOM   3537  C  CG2 . ILE B 1 81  ? 74.208  33.567  39.706 1.00 40.37 ? 734  ILE B CG2 1 
ATOM   3538  C  CD1 . ILE B 1 81  ? 75.426  31.038  38.584 1.00 37.74 ? 734  ILE B CD1 1 
ATOM   3539  N  N   . PRO B 1 82  ? 77.891  33.697  42.184 1.00 38.20 ? 735  PRO B N   1 
ATOM   3540  C  CA  . PRO B 1 82  ? 79.187  33.449  42.824 1.00 36.92 ? 735  PRO B CA  1 
ATOM   3541  C  C   . PRO B 1 82  ? 80.132  32.338  42.380 1.00 36.32 ? 735  PRO B C   1 
ATOM   3542  O  O   . PRO B 1 82  ? 81.361  32.436  42.581 1.00 35.87 ? 735  PRO B O   1 
ATOM   3543  C  CB  . PRO B 1 82  ? 78.834  33.402  44.315 1.00 37.46 ? 735  PRO B CB  1 
ATOM   3544  C  CG  . PRO B 1 82  ? 77.407  32.960  44.340 1.00 39.21 ? 735  PRO B CG  1 
ATOM   3545  C  CD  . PRO B 1 82  ? 76.764  33.559  43.125 1.00 39.80 ? 735  PRO B CD  1 
ATOM   3546  N  N   . TYR B 1 83  ? 79.604  31.295  41.756 1.00 33.89 ? 736  TYR B N   1 
ATOM   3547  C  CA  . TYR B 1 83  ? 80.493  30.240  41.328 1.00 31.64 ? 736  TYR B CA  1 
ATOM   3548  C  C   . TYR B 1 83  ? 80.361  29.831  39.855 1.00 30.77 ? 736  TYR B C   1 
ATOM   3549  O  O   . TYR B 1 83  ? 81.342  29.870  39.129 1.00 28.46 ? 736  TYR B O   1 
ATOM   3550  C  CB  . TYR B 1 83  ? 80.347  29.028  42.256 1.00 31.58 ? 736  TYR B CB  1 
ATOM   3551  C  CG  . TYR B 1 83  ? 81.297  27.891  41.941 1.00 32.89 ? 736  TYR B CG  1 
ATOM   3552  C  CD1 . TYR B 1 83  ? 82.532  27.773  42.586 1.00 33.33 ? 736  TYR B CD1 1 
ATOM   3553  C  CD2 . TYR B 1 83  ? 80.933  26.895  41.035 1.00 31.20 ? 736  TYR B CD2 1 
ATOM   3554  C  CE1 . TYR B 1 83  ? 83.382  26.673  42.343 1.00 34.50 ? 736  TYR B CE1 1 
ATOM   3555  C  CE2 . TYR B 1 83  ? 81.764  25.808  40.779 1.00 33.56 ? 736  TYR B CE2 1 
ATOM   3556  C  CZ  . TYR B 1 83  ? 82.987  25.688  41.429 1.00 35.36 ? 736  TYR B CZ  1 
ATOM   3557  O  OH  . TYR B 1 83  ? 83.810  24.606  41.160 1.00 35.64 ? 736  TYR B OH  1 
ATOM   3558  N  N   . HIS B 1 84  ? 79.173  29.450  39.400 1.00 31.01 ? 737  HIS B N   1 
ATOM   3559  C  CA  . HIS B 1 84  ? 79.050  29.036  38.008 1.00 31.69 ? 737  HIS B CA  1 
ATOM   3560  C  C   . HIS B 1 84  ? 78.977  30.210  37.045 1.00 32.97 ? 737  HIS B C   1 
ATOM   3561  O  O   . HIS B 1 84  ? 77.952  30.445  36.411 1.00 31.86 ? 737  HIS B O   1 
ATOM   3562  C  CB  . HIS B 1 84  ? 77.839  28.098  37.831 1.00 29.56 ? 737  HIS B CB  1 
ATOM   3563  C  CG  . HIS B 1 84  ? 77.931  26.849  38.656 1.00 26.46 ? 737  HIS B CG  1 
ATOM   3564  N  ND1 . HIS B 1 84  ? 77.244  26.685  39.840 1.00 26.10 ? 737  HIS B ND1 1 
ATOM   3565  C  CD2 . HIS B 1 84  ? 78.679  25.731  38.501 1.00 23.25 ? 737  HIS B CD2 1 
ATOM   3566  C  CE1 . HIS B 1 84  ? 77.567  25.524  40.380 1.00 24.79 ? 737  HIS B CE1 1 
ATOM   3567  N  NE2 . HIS B 1 84  ? 78.436  24.926  39.588 1.00 24.99 ? 737  HIS B NE2 1 
ATOM   3568  N  N   . ASN B 1 85  ? 80.100  30.914  36.916 1.00 32.97 ? 738  ASN B N   1 
ATOM   3569  C  CA  . ASN B 1 85  ? 80.191  32.084  36.051 1.00 33.10 ? 738  ASN B CA  1 
ATOM   3570  C  C   . ASN B 1 85  ? 81.305  31.989  35.024 1.00 33.42 ? 738  ASN B C   1 
ATOM   3571  O  O   . ASN B 1 85  ? 81.976  30.957  34.943 1.00 32.58 ? 738  ASN B O   1 
ATOM   3572  C  CB  . ASN B 1 85  ? 80.394  33.331  36.917 1.00 33.78 ? 738  ASN B CB  1 
ATOM   3573  C  CG  . ASN B 1 85  ? 81.506  33.158  37.946 1.00 30.98 ? 738  ASN B CG  1 
ATOM   3574  O  OD1 . ASN B 1 85  ? 82.665  32.917  37.609 1.00 32.33 ? 738  ASN B OD1 1 
ATOM   3575  N  ND2 . ASN B 1 85  ? 81.152  33.284  39.202 1.00 33.51 ? 738  ASN B ND2 1 
ATOM   3576  N  N   . ARG B 1 86  ? 81.499  33.087  34.268 1.00 34.57 ? 739  ARG B N   1 
ATOM   3577  C  CA  . ARG B 1 86  ? 82.546  33.245  33.216 1.00 34.30 ? 739  ARG B CA  1 
ATOM   3578  C  C   . ARG B 1 86  ? 83.932  32.866  33.707 1.00 34.13 ? 739  ARG B C   1 
ATOM   3579  O  O   . ARG B 1 86  ? 84.717  32.289  32.966 1.00 35.09 ? 739  ARG B O   1 
ATOM   3580  C  CB  . ARG B 1 86  ? 82.681  34.708  32.757 1.00 36.03 ? 739  ARG B CB  1 
ATOM   3581  C  CG  . ARG B 1 86  ? 81.413  35.421  32.380 1.00 40.23 ? 739  ARG B CG  1 
ATOM   3582  C  CD  . ARG B 1 86  ? 81.619  36.882  32.587 1.00 38.56 ? 739  ARG B CD  1 
ATOM   3583  N  NE  . ARG B 1 86  ? 81.052  37.717  31.538 1.00 38.57 ? 739  ARG B NE  1 
ATOM   3584  C  CZ  . ARG B 1 86  ? 79.772  38.011  31.423 1.00 37.54 ? 739  ARG B CZ  1 
ATOM   3585  N  NH1 . ARG B 1 86  ? 78.890  37.539  32.280 1.00 37.39 ? 739  ARG B NH1 1 
ATOM   3586  N  NH2 . ARG B 1 86  ? 79.382  38.815  30.451 1.00 43.62 ? 739  ARG B NH2 1 
ATOM   3587  N  N   . ILE B 1 87  ? 84.245  33.266  34.938 1.00 32.71 ? 740  ILE B N   1 
ATOM   3588  C  CA  . ILE B 1 87  ? 85.542  32.990  35.553 1.00 33.69 ? 740  ILE B CA  1 
ATOM   3589  C  C   . ILE B 1 87  ? 85.737  31.497  35.766 1.00 33.60 ? 740  ILE B C   1 
ATOM   3590  O  O   . ILE B 1 87  ? 86.790  30.941  35.478 1.00 33.29 ? 740  ILE B O   1 
ATOM   3591  C  CB  . ILE B 1 87  ? 85.654  33.645  36.932 1.00 34.53 ? 740  ILE B CB  1 
ATOM   3592  C  CG1 . ILE B 1 87  ? 85.239  35.111  36.840 1.00 33.83 ? 740  ILE B CG1 1 
ATOM   3593  C  CG2 . ILE B 1 87  ? 87.046  33.439  37.477 1.00 32.45 ? 740  ILE B CG2 1 
ATOM   3594  C  CD1 . ILE B 1 87  ? 85.003  35.722  38.181 1.00 36.02 ? 740  ILE B CD1 1 
ATOM   3595  N  N   . HIS B 1 88  ? 84.720  30.871  36.337 1.00 33.34 ? 741  HIS B N   1 
ATOM   3596  C  CA  . HIS B 1 88  ? 84.770  29.458  36.551 1.00 32.86 ? 741  HIS B CA  1 
ATOM   3597  C  C   . HIS B 1 88  ? 84.999  28.785  35.208 1.00 32.05 ? 741  HIS B C   1 
ATOM   3598  O  O   . HIS B 1 88  ? 85.823  27.864  35.091 1.00 32.89 ? 741  HIS B O   1 
ATOM   3599  C  CB  . HIS B 1 88  ? 83.472  28.989  37.155 1.00 32.38 ? 741  HIS B CB  1 
ATOM   3600  C  CG  . HIS B 1 88  ? 83.355  27.511  37.198 1.00 33.96 ? 741  HIS B CG  1 
ATOM   3601  N  ND1 . HIS B 1 88  ? 84.240  26.720  37.902 1.00 33.81 ? 741  HIS B ND1 1 
ATOM   3602  C  CD2 . HIS B 1 88  ? 82.483  26.668  36.596 1.00 32.58 ? 741  HIS B CD2 1 
ATOM   3603  C  CE1 . HIS B 1 88  ? 83.912  25.452  37.733 1.00 33.02 ? 741  HIS B CE1 1 
ATOM   3604  N  NE2 . HIS B 1 88  ? 82.853  25.394  36.948 1.00 35.04 ? 741  HIS B NE2 1 
ATOM   3605  N  N   . ALA B 1 89  ? 84.298  29.255  34.181 1.00 33.31 ? 742  ALA B N   1 
ATOM   3606  C  CA  . ALA B 1 89  ? 84.456  28.662  32.835 1.00 34.49 ? 742  ALA B CA  1 
ATOM   3607  C  C   . ALA B 1 89  ? 85.882  28.882  32.316 1.00 36.23 ? 742  ALA B C   1 
ATOM   3608  O  O   . ALA B 1 89  ? 86.463  28.022  31.631 1.00 36.37 ? 742  ALA B O   1 
ATOM   3609  C  CB  . ALA B 1 89  ? 83.429  29.255  31.852 1.00 30.74 ? 742  ALA B CB  1 
ATOM   3610  N  N   . THR B 1 90  ? 86.454  30.034  32.664 1.00 36.23 ? 743  THR B N   1 
ATOM   3611  C  CA  . THR B 1 90  ? 87.809  30.342  32.244 1.00 34.86 ? 743  THR B CA  1 
ATOM   3612  C  C   . THR B 1 90  ? 88.759  29.412  32.966 1.00 34.44 ? 743  THR B C   1 
ATOM   3613  O  O   . THR B 1 90  ? 89.739  28.941  32.392 1.00 34.73 ? 743  THR B O   1 
ATOM   3614  C  CB  . THR B 1 90  ? 88.174  31.774  32.588 1.00 37.02 ? 743  THR B CB  1 
ATOM   3615  O  OG1 . THR B 1 90  ? 87.315  32.676  31.866 1.00 40.17 ? 743  THR B OG1 1 
ATOM   3616  C  CG2 . THR B 1 90  ? 89.649  32.038  32.244 1.00 36.70 ? 743  THR B CG2 1 
ATOM   3617  N  N   . ASP B 1 91  ? 88.457  29.156  34.234 1.00 33.06 ? 744  ASP B N   1 
ATOM   3618  C  CA  . ASP B 1 91  ? 89.257  28.274  35.068 1.00 34.56 ? 744  ASP B CA  1 
ATOM   3619  C  C   . ASP B 1 91  ? 89.298  26.853  34.498 1.00 34.38 ? 744  ASP B C   1 
ATOM   3620  O  O   . ASP B 1 91  ? 90.371  26.262  34.343 1.00 34.59 ? 744  ASP B O   1 
ATOM   3621  C  CB  . ASP B 1 91  ? 88.686  28.236  36.497 1.00 36.43 ? 744  ASP B CB  1 
ATOM   3622  C  CG  . ASP B 1 91  ? 89.554  27.421  37.439 1.00 38.88 ? 744  ASP B CG  1 
ATOM   3623  O  OD1 . ASP B 1 91  ? 89.028  26.546  38.171 1.00 40.40 ? 744  ASP B OD1 1 
ATOM   3624  O  OD2 . ASP B 1 91  ? 90.778  27.661  37.450 1.00 41.08 ? 744  ASP B OD2 1 
ATOM   3625  N  N   . VAL B 1 92  ? 88.114  26.314  34.199 1.00 33.13 ? 745  VAL B N   1 
ATOM   3626  C  CA  . VAL B 1 92  ? 88.004  24.977  33.634 1.00 32.62 ? 745  VAL B CA  1 
ATOM   3627  C  C   . VAL B 1 92  ? 88.741  24.933  32.294 1.00 32.32 ? 745  VAL B C   1 
ATOM   3628  O  O   . VAL B 1 92  ? 89.450  23.969  31.979 1.00 31.03 ? 745  VAL B O   1 
ATOM   3629  C  CB  . VAL B 1 92  ? 86.516  24.593  33.422 1.00 34.10 ? 745  VAL B CB  1 
ATOM   3630  C  CG1 . VAL B 1 92  ? 86.416  23.205  32.802 1.00 34.09 ? 745  VAL B CG1 1 
ATOM   3631  C  CG2 . VAL B 1 92  ? 85.769  24.662  34.748 1.00 34.17 ? 745  VAL B CG2 1 
ATOM   3632  N  N   . LEU B 1 93  ? 88.563  25.980  31.504 1.00 31.70 ? 746  LEU B N   1 
ATOM   3633  C  CA  . LEU B 1 93  ? 89.235  26.074  30.221 1.00 33.88 ? 746  LEU B CA  1 
ATOM   3634  C  C   . LEU B 1 93  ? 90.747  25.995  30.398 1.00 35.94 ? 746  LEU B C   1 
ATOM   3635  O  O   . LEU B 1 93  ? 91.430  25.248  29.695 1.00 37.46 ? 746  LEU B O   1 
ATOM   3636  C  CB  . LEU B 1 93  ? 88.896  27.398  29.552 1.00 34.73 ? 746  LEU B CB  1 
ATOM   3637  C  CG  . LEU B 1 93  ? 89.877  27.841  28.461 1.00 35.68 ? 746  LEU B CG  1 
ATOM   3638  C  CD1 . LEU B 1 93  ? 89.877  26.793  27.341 1.00 33.77 ? 746  LEU B CD1 1 
ATOM   3639  C  CD2 . LEU B 1 93  ? 89.491  29.239  27.952 1.00 34.19 ? 746  LEU B CD2 1 
ATOM   3640  N  N   . HIS B 1 94  ? 91.274  26.789  31.330 1.00 35.51 ? 747  HIS B N   1 
ATOM   3641  C  CA  . HIS B 1 94  ? 92.697  26.795  31.582 1.00 33.47 ? 747  HIS B CA  1 
ATOM   3642  C  C   . HIS B 1 94  ? 93.207  25.422  31.982 1.00 33.92 ? 747  HIS B C   1 
ATOM   3643  O  O   . HIS B 1 94  ? 94.273  24.992  31.540 1.00 33.99 ? 747  HIS B O   1 
ATOM   3644  C  CB  . HIS B 1 94  ? 93.046  27.802  32.683 1.00 33.83 ? 747  HIS B CB  1 
ATOM   3645  C  CG  . HIS B 1 94  ? 94.447  27.660  33.186 1.00 32.92 ? 747  HIS B CG  1 
ATOM   3646  N  ND1 . HIS B 1 94  ? 94.764  26.911  34.299 1.00 32.75 ? 747  HIS B ND1 1 
ATOM   3647  C  CD2 . HIS B 1 94  ? 95.627  28.058  32.654 1.00 31.44 ? 747  HIS B CD2 1 
ATOM   3648  C  CE1 . HIS B 1 94  ? 96.076  26.848  34.428 1.00 31.02 ? 747  HIS B CE1 1 
ATOM   3649  N  NE2 . HIS B 1 94  ? 96.622  27.534  33.442 1.00 33.45 ? 747  HIS B NE2 1 
ATOM   3650  N  N   . ALA B 1 95  ? 92.440  24.744  32.828 1.00 33.64 ? 748  ALA B N   1 
ATOM   3651  C  CA  . ALA B 1 95  ? 92.808  23.416  33.315 1.00 33.51 ? 748  ALA B CA  1 
ATOM   3652  C  C   . ALA B 1 95  ? 92.809  22.295  32.247 1.00 34.07 ? 748  ALA B C   1 
ATOM   3653  O  O   . ALA B 1 95  ? 93.644  21.400  32.306 1.00 35.18 ? 748  ALA B O   1 
ATOM   3654  C  CB  . ALA B 1 95  ? 91.909  23.040  34.479 1.00 30.39 ? 748  ALA B CB  1 
ATOM   3655  N  N   . VAL B 1 96  ? 91.892  22.320  31.282 1.00 34.75 ? 749  VAL B N   1 
ATOM   3656  C  CA  . VAL B 1 96  ? 91.930  21.280  30.259 1.00 34.01 ? 749  VAL B CA  1 
ATOM   3657  C  C   . VAL B 1 96  ? 93.081  21.528  29.287 1.00 34.32 ? 749  VAL B C   1 
ATOM   3658  O  O   . VAL B 1 96  ? 93.706  20.587  28.783 1.00 34.16 ? 749  VAL B O   1 
ATOM   3659  C  CB  . VAL B 1 96  ? 90.591  21.130  29.476 1.00 32.82 ? 749  VAL B CB  1 
ATOM   3660  C  CG1 . VAL B 1 96  ? 89.546  20.517  30.393 1.00 33.16 ? 749  VAL B CG1 1 
ATOM   3661  C  CG2 . VAL B 1 96  ? 90.134  22.462  28.895 1.00 29.27 ? 749  VAL B CG2 1 
ATOM   3662  N  N   . TRP B 1 97  ? 93.384  22.789  29.032 1.00 34.64 ? 750  TRP B N   1 
ATOM   3663  C  CA  . TRP B 1 97  ? 94.486  23.088  28.134 1.00 35.40 ? 750  TRP B CA  1 
ATOM   3664  C  C   . TRP B 1 97  ? 95.779  22.603  28.769 1.00 36.38 ? 750  TRP B C   1 
ATOM   3665  O  O   . TRP B 1 97  ? 96.583  21.926  28.133 1.00 35.72 ? 750  TRP B O   1 
ATOM   3666  C  CB  . TRP B 1 97  ? 94.538  24.582  27.890 1.00 37.99 ? 750  TRP B CB  1 
ATOM   3667  C  CG  . TRP B 1 97  ? 95.851  25.086  27.399 1.00 40.85 ? 750  TRP B CG  1 
ATOM   3668  C  CD1 . TRP B 1 97  ? 96.336  25.017  26.129 1.00 42.47 ? 750  TRP B CD1 1 
ATOM   3669  C  CD2 . TRP B 1 97  ? 96.842  25.774  28.172 1.00 41.88 ? 750  TRP B CD2 1 
ATOM   3670  N  NE1 . TRP B 1 97  ? 97.567  25.627  26.057 1.00 42.21 ? 750  TRP B NE1 1 
ATOM   3671  C  CE2 . TRP B 1 97  ? 97.902  26.101  27.296 1.00 42.44 ? 750  TRP B CE2 1 
ATOM   3672  C  CE3 . TRP B 1 97  ? 96.934  26.151  29.521 1.00 41.51 ? 750  TRP B CE3 1 
ATOM   3673  C  CZ2 . TRP B 1 97  ? 99.048  26.796  27.722 1.00 42.33 ? 750  TRP B CZ2 1 
ATOM   3674  C  CZ3 . TRP B 1 97  ? 98.074  26.843  29.947 1.00 40.81 ? 750  TRP B CZ3 1 
ATOM   3675  C  CH2 . TRP B 1 97  ? 99.113  27.156  29.045 1.00 41.45 ? 750  TRP B CH2 1 
ATOM   3676  N  N   . TYR B 1 98  ? 95.949  22.938  30.046 1.00 37.55 ? 751  TYR B N   1 
ATOM   3677  C  CA  . TYR B 1 98  ? 97.128  22.585  30.808 1.00 37.15 ? 751  TYR B CA  1 
ATOM   3678  C  C   . TYR B 1 98  ? 97.291  21.086  30.975 1.00 38.23 ? 751  TYR B C   1 
ATOM   3679  O  O   . TYR B 1 98  ? 98.381  20.538  30.781 1.00 38.56 ? 751  TYR B O   1 
ATOM   3680  C  CB  . TYR B 1 98  ? 97.079  23.258  32.186 1.00 37.87 ? 751  TYR B CB  1 
ATOM   3681  C  CG  . TYR B 1 98  ? 98.342  23.070  32.994 1.00 39.03 ? 751  TYR B CG  1 
ATOM   3682  C  CD1 . TYR B 1 98  ? 99.251  24.126  33.183 1.00 38.48 ? 751  TYR B CD1 1 
ATOM   3683  C  CD2 . TYR B 1 98  ? 98.657  21.812  33.535 1.00 39.48 ? 751  TYR B CD2 1 
ATOM   3684  C  CE1 . TYR B 1 98  ? 100.450 23.928  33.896 1.00 38.58 ? 751  TYR B CE1 1 
ATOM   3685  C  CE2 . TYR B 1 98  ? 99.832  21.592  34.233 1.00 39.88 ? 751  TYR B CE2 1 
ATOM   3686  C  CZ  . TYR B 1 98  ? 100.737 22.653  34.420 1.00 41.57 ? 751  TYR B CZ  1 
ATOM   3687  O  OH  . TYR B 1 98  ? 101.900 22.402  35.138 1.00 39.24 ? 751  TYR B OH  1 
ATOM   3688  N  N   . LEU B 1 99  ? 96.227  20.409  31.374 1.00 38.34 ? 752  LEU B N   1 
ATOM   3689  C  CA  . LEU B 1 99  ? 96.310  18.966  31.529 1.00 38.24 ? 752  LEU B CA  1 
ATOM   3690  C  C   . LEU B 1 99  ? 96.677  18.313  30.202 1.00 38.04 ? 752  LEU B C   1 
ATOM   3691  O  O   . LEU B 1 99  ? 97.392  17.312  30.168 1.00 39.95 ? 752  LEU B O   1 
ATOM   3692  C  CB  . LEU B 1 99  ? 94.971  18.414  32.014 1.00 38.57 ? 752  LEU B CB  1 
ATOM   3693  C  CG  . LEU B 1 99  ? 94.733  18.736  33.486 1.00 38.41 ? 752  LEU B CG  1 
ATOM   3694  C  CD1 . LEU B 1 99  ? 93.335  18.360  33.902 1.00 39.25 ? 752  LEU B CD1 1 
ATOM   3695  C  CD2 . LEU B 1 99  ? 95.762  17.996  34.306 1.00 38.15 ? 752  LEU B CD2 1 
ATOM   3696  N  N   . THR B 1 100 ? 96.206  18.893  29.107 1.00 38.26 ? 753  THR B N   1 
ATOM   3697  C  CA  . THR B 1 100 ? 96.476  18.317  27.814 1.00 39.59 ? 753  THR B CA  1 
ATOM   3698  C  C   . THR B 1 100 ? 97.775  18.711  27.153 1.00 41.69 ? 753  THR B C   1 
ATOM   3699  O  O   . THR B 1 100 ? 98.238  17.980  26.296 1.00 43.51 ? 753  THR B O   1 
ATOM   3700  C  CB  . THR B 1 100 ? 95.287  18.560  26.795 1.00 39.46 ? 753  THR B CB  1 
ATOM   3701  O  OG1 . THR B 1 100 ? 95.005  19.954  26.663 1.00 36.67 ? 753  THR B OG1 1 
ATOM   3702  C  CG2 . THR B 1 100 ? 94.016  17.852  27.268 1.00 38.48 ? 753  THR B CG2 1 
ATOM   3703  N  N   . THR B 1 101 ? 98.393  19.829  27.524 1.00 43.68 ? 754  THR B N   1 
ATOM   3704  C  CA  . THR B 1 101 ? 99.643  20.175  26.837 1.00 44.88 ? 754  THR B CA  1 
ATOM   3705  C  C   . THR B 1 101 ? 100.953 19.940  27.548 1.00 46.18 ? 754  THR B C   1 
ATOM   3706  O  O   . THR B 1 101 ? 101.922 19.600  26.882 1.00 45.93 ? 754  THR B O   1 
ATOM   3707  C  CB  . THR B 1 101 ? 99.685  21.643  26.347 1.00 44.07 ? 754  THR B CB  1 
ATOM   3708  O  OG1 . THR B 1 101 ? 99.557  22.529  27.460 1.00 42.26 ? 754  THR B OG1 1 
ATOM   3709  C  CG2 . THR B 1 101 ? 98.608  21.899  25.351 1.00 43.63 ? 754  THR B CG2 1 
ATOM   3710  N  N   . ARG B 1 102 ? 100.993 20.115  28.875 1.00 47.91 ? 755  ARG B N   1 
ATOM   3711  C  CA  . ARG B 1 102 ? 102.244 19.949  29.640 1.00 48.83 ? 755  ARG B CA  1 
ATOM   3712  C  C   . ARG B 1 102 ? 102.780 18.518  29.702 1.00 50.27 ? 755  ARG B C   1 
ATOM   3713  O  O   . ARG B 1 102 ? 102.044 17.554  29.450 1.00 51.79 ? 755  ARG B O   1 
ATOM   3714  C  CB  . ARG B 1 102 ? 102.119 20.452  31.083 1.00 48.84 ? 755  ARG B CB  1 
ATOM   3715  C  CG  . ARG B 1 102 ? 101.447 21.804  31.328 1.00 49.65 ? 755  ARG B CG  1 
ATOM   3716  C  CD  . ARG B 1 102 ? 102.169 23.027  30.827 1.00 48.18 ? 755  ARG B CD  1 
ATOM   3717  N  NE  . ARG B 1 102 ? 101.738 23.392  29.481 1.00 50.83 ? 755  ARG B NE  1 
ATOM   3718  C  CZ  . ARG B 1 102 ? 101.700 24.632  28.993 1.00 50.84 ? 755  ARG B CZ  1 
ATOM   3719  N  NH1 . ARG B 1 102 ? 102.049 25.676  29.732 1.00 51.45 ? 755  ARG B NH1 1 
ATOM   3720  N  NH2 . ARG B 1 102 ? 101.356 24.825  27.732 1.00 50.69 ? 755  ARG B NH2 1 
ATOM   3721  N  N   . PRO B 1 103 ? 104.083 18.366  30.041 1.00 50.89 ? 756  PRO B N   1 
ATOM   3722  C  CA  . PRO B 1 103 ? 104.811 17.092  30.161 1.00 51.41 ? 756  PRO B CA  1 
ATOM   3723  C  C   . PRO B 1 103 ? 104.276 16.030  31.129 1.00 52.38 ? 756  PRO B C   1 
ATOM   3724  O  O   . PRO B 1 103 ? 104.005 16.290  32.301 1.00 52.78 ? 756  PRO B O   1 
ATOM   3725  C  CB  . PRO B 1 103 ? 106.229 17.541  30.524 1.00 50.67 ? 756  PRO B CB  1 
ATOM   3726  C  CG  . PRO B 1 103 ? 106.378 18.770  29.723 1.00 51.34 ? 756  PRO B CG  1 
ATOM   3727  C  CD  . PRO B 1 103 ? 105.043 19.488  29.956 1.00 50.13 ? 756  PRO B CD  1 
ATOM   3728  N  N   . VAL B 1 104 ? 104.172 14.810  30.622 1.00 54.07 ? 757  VAL B N   1 
ATOM   3729  C  CA  . VAL B 1 104 ? 103.678 13.688  31.401 1.00 54.72 ? 757  VAL B CA  1 
ATOM   3730  C  C   . VAL B 1 104 ? 104.733 12.578  31.457 1.00 55.48 ? 757  VAL B C   1 
ATOM   3731  O  O   . VAL B 1 104 ? 105.052 11.945  30.439 1.00 55.04 ? 757  VAL B O   1 
ATOM   3732  C  CB  . VAL B 1 104 ? 102.379 13.113  30.777 1.00 53.83 ? 757  VAL B CB  1 
ATOM   3733  C  CG1 . VAL B 1 104 ? 101.798 12.055  31.688 1.00 53.59 ? 757  VAL B CG1 1 
ATOM   3734  C  CG2 . VAL B 1 104 ? 101.379 14.224  30.531 1.00 53.85 ? 757  VAL B CG2 1 
ATOM   3735  N  N   . PRO B 1 105 ? 105.293 12.336  32.650 1.00 56.54 ? 758  PRO B N   1 
ATOM   3736  C  CA  . PRO B 1 105 ? 106.318 11.299  32.859 1.00 57.17 ? 758  PRO B CA  1 
ATOM   3737  C  C   . PRO B 1 105 ? 105.842 9.917   32.421 1.00 58.01 ? 758  PRO B C   1 
ATOM   3738  O  O   . PRO B 1 105 ? 104.775 9.458   32.847 1.00 58.21 ? 758  PRO B O   1 
ATOM   3739  C  CB  . PRO B 1 105 ? 106.558 11.330  34.372 1.00 56.66 ? 758  PRO B CB  1 
ATOM   3740  C  CG  . PRO B 1 105 ? 106.265 12.763  34.729 1.00 57.65 ? 758  PRO B CG  1 
ATOM   3741  C  CD  . PRO B 1 105 ? 105.034 13.093  33.889 1.00 55.99 ? 758  PRO B CD  1 
ATOM   3742  N  N   . GLY B 1 106 ? 106.630 9.260   31.574 1.00 58.22 ? 759  GLY B N   1 
ATOM   3743  C  CA  . GLY B 1 106 ? 106.287 7.916   31.139 1.00 58.19 ? 759  GLY B CA  1 
ATOM   3744  C  C   . GLY B 1 106 ? 105.379 7.812   29.932 1.00 58.75 ? 759  GLY B C   1 
ATOM   3745  O  O   . GLY B 1 106 ? 105.252 6.738   29.334 1.00 58.80 ? 759  GLY B O   1 
ATOM   3746  N  N   . LEU B 1 107 ? 104.736 8.918   29.577 1.00 59.31 ? 760  LEU B N   1 
ATOM   3747  C  CA  . LEU B 1 107 ? 103.840 8.944   28.427 1.00 60.13 ? 760  LEU B CA  1 
ATOM   3748  C  C   . LEU B 1 107 ? 104.606 8.802   27.098 1.00 61.42 ? 760  LEU B C   1 
ATOM   3749  O  O   . LEU B 1 107 ? 105.353 9.697   26.684 1.00 60.72 ? 760  LEU B O   1 
ATOM   3750  C  CB  . LEU B 1 107 ? 103.011 10.245  28.445 1.00 60.01 ? 760  LEU B CB  1 
ATOM   3751  C  CG  . LEU B 1 107 ? 101.954 10.426  27.346 1.00 60.49 ? 760  LEU B CG  1 
ATOM   3752  C  CD1 . LEU B 1 107 ? 101.022 9.201   27.306 1.00 59.58 ? 760  LEU B CD1 1 
ATOM   3753  C  CD2 . LEU B 1 107 ? 101.171 11.721  27.591 1.00 60.54 ? 760  LEU B CD2 1 
ATOM   3754  N  N   . GLN B 1 108 ? 104.411 7.668   26.431 1.00 63.89 ? 761  GLN B N   1 
ATOM   3755  C  CA  . GLN B 1 108 ? 105.084 7.398   25.161 1.00 66.43 ? 761  GLN B CA  1 
ATOM   3756  C  C   . GLN B 1 108 ? 104.720 8.434   24.118 1.00 68.68 ? 761  GLN B C   1 
ATOM   3757  O  O   . GLN B 1 108 ? 103.533 8.704   23.886 1.00 69.18 ? 761  GLN B O   1 
ATOM   3758  C  CB  . GLN B 1 108 ? 104.710 6.006   24.650 1.00 66.04 ? 761  GLN B CB  1 
ATOM   3759  N  N   . GLN B 1 109 ? 105.744 9.010   23.489 1.00 71.16 ? 762  GLN B N   1 
ATOM   3760  C  CA  . GLN B 1 109 ? 105.539 10.022  22.448 1.00 73.18 ? 762  GLN B CA  1 
ATOM   3761  C  C   . GLN B 1 109 ? 105.125 9.406   21.116 1.00 74.38 ? 762  GLN B C   1 
ATOM   3762  O  O   . GLN B 1 109 ? 105.816 9.596   20.106 1.00 74.71 ? 762  GLN B O   1 
ATOM   3763  C  CB  . GLN B 1 109 ? 106.817 10.852  22.230 1.00 74.47 ? 762  GLN B CB  1 
ATOM   3764  C  CG  . GLN B 1 109 ? 106.886 12.124  23.079 1.00 75.68 ? 762  GLN B CG  1 
ATOM   3765  C  CD  . GLN B 1 109 ? 105.574 12.928  23.064 1.00 75.99 ? 762  GLN B CD  1 
ATOM   3766  O  OE1 . GLN B 1 109 ? 104.564 12.529  23.680 1.00 75.62 ? 762  GLN B OE1 1 
ATOM   3767  N  NE2 . GLN B 1 109 ? 105.586 14.061  22.354 1.00 75.28 ? 762  GLN B NE2 1 
ATOM   3768  N  N   . ILE B 1 110 ? 103.997 8.689   21.110 1.00 75.20 ? 763  ILE B N   1 
ATOM   3769  C  CA  . ILE B 1 110 ? 103.502 8.044   19.888 1.00 75.57 ? 763  ILE B CA  1 
ATOM   3770  C  C   . ILE B 1 110 ? 103.596 8.987   18.690 1.00 76.37 ? 763  ILE B C   1 
ATOM   3771  O  O   . ILE B 1 110 ? 104.429 8.781   17.790 1.00 76.48 ? 763  ILE B O   1 
ATOM   3772  C  CB  . ILE B 1 110 ? 102.040 7.559   20.074 1.00 75.72 ? 763  ILE B CB  1 
ATOM   3773  N  N   . HIS B 1 111 ? 102.768 10.032  18.672 1.00 76.47 ? 764  HIS B N   1 
ATOM   3774  C  CA  . HIS B 1 111 ? 102.813 10.956  17.542 1.00 76.89 ? 764  HIS B CA  1 
ATOM   3775  C  C   . HIS B 1 111 ? 103.925 11.995  17.630 1.00 77.75 ? 764  HIS B C   1 
ATOM   3776  O  O   . HIS B 1 111 ? 103.667 13.208  17.762 1.00 77.99 ? 764  HIS B O   1 
ATOM   3777  C  CB  . HIS B 1 111 ? 101.461 11.638  17.337 1.00 76.39 ? 764  HIS B CB  1 
ATOM   3778  C  CG  . HIS B 1 111 ? 100.380 10.689  16.910 1.00 76.57 ? 764  HIS B CG  1 
ATOM   3779  N  ND1 . HIS B 1 111 ? 100.345 10.123  15.653 1.00 76.02 ? 764  HIS B ND1 1 
ATOM   3780  C  CD2 . HIS B 1 111 ? 99.332  10.160  17.592 1.00 75.99 ? 764  HIS B CD2 1 
ATOM   3781  C  CE1 . HIS B 1 111 ? 99.324  9.286   15.576 1.00 76.07 ? 764  HIS B CE1 1 
ATOM   3782  N  NE2 . HIS B 1 111 ? 98.692  9.289   16.740 1.00 76.54 ? 764  HIS B NE2 1 
ATOM   3783  N  N   . ASN B 1 112 ? 105.164 11.496  17.544 1.00 78.10 ? 765  ASN B N   1 
ATOM   3784  C  CA  . ASN B 1 112 ? 106.364 12.335  17.558 1.00 78.26 ? 765  ASN B CA  1 
ATOM   3785  C  C   . ASN B 1 112 ? 106.589 12.874  16.123 1.00 79.03 ? 765  ASN B C   1 
ATOM   3786  O  O   . ASN B 1 112 ? 107.726 12.923  15.627 1.00 79.47 ? 765  ASN B O   1 
ATOM   3787  C  CB  . ASN B 1 112 ? 107.579 11.508  18.020 1.00 77.09 ? 765  ASN B CB  1 
ATOM   3788  N  N   . GLY B 1 113 ? 105.488 13.260  15.469 1.00 79.50 ? 766  GLY B N   1 
ATOM   3789  C  CA  . GLY B 1 113 ? 105.498 13.795  14.095 1.00 79.58 ? 766  GLY B CA  1 
ATOM   3790  C  C   . GLY B 1 113 ? 106.024 12.770  13.081 1.00 79.53 ? 766  GLY B C   1 
ATOM   3791  O  O   . GLY B 1 113 ? 106.107 13.119  11.876 1.00 79.27 ? 766  GLY B O   1 
ATOM   3792  N  N   . GLY B 1 129 ? 100.733 13.820  8.703  1.00 63.86 ? 782  GLY B N   1 
ATOM   3793  C  CA  . GLY B 1 129 ? 99.738  13.158  7.796  1.00 63.21 ? 782  GLY B CA  1 
ATOM   3794  C  C   . GLY B 1 129 ? 98.502  14.010  7.542  1.00 63.31 ? 782  GLY B C   1 
ATOM   3795  O  O   . GLY B 1 129 ? 98.585  15.241  7.413  1.00 62.92 ? 782  GLY B O   1 
ATOM   3796  N  N   . ARG B 1 130 ? 97.351  13.341  7.474  1.00 62.19 ? 783  ARG B N   1 
ATOM   3797  C  CA  . ARG B 1 130 ? 96.058  13.986  7.229  1.00 60.96 ? 783  ARG B CA  1 
ATOM   3798  C  C   . ARG B 1 130 ? 95.414  14.506  8.518  1.00 60.15 ? 783  ARG B C   1 
ATOM   3799  O  O   . ARG B 1 130 ? 94.718  15.531  8.510  1.00 61.12 ? 783  ARG B O   1 
ATOM   3800  C  CB  . ARG B 1 130 ? 95.109  12.995  6.523  1.00 60.57 ? 783  ARG B CB  1 
ATOM   3801  C  CG  . ARG B 1 130 ? 95.510  12.718  5.063  1.00 59.15 ? 783  ARG B CG  1 
ATOM   3802  C  CD  . ARG B 1 130 ? 94.911  11.437  4.445  1.00 57.91 ? 783  ARG B CD  1 
ATOM   3803  N  NE  . ARG B 1 130 ? 95.508  11.225  3.128  1.00 54.77 ? 783  ARG B NE  1 
ATOM   3804  C  CZ  . ARG B 1 130 ? 95.349  12.069  2.110  1.00 55.42 ? 783  ARG B CZ  1 
ATOM   3805  N  NH1 . ARG B 1 130 ? 94.597  13.151  2.269  1.00 54.30 ? 783  ARG B NH1 1 
ATOM   3806  N  NH2 . ARG B 1 130 ? 95.980  11.873  0.955  1.00 54.23 ? 783  ARG B NH2 1 
ATOM   3807  N  N   . ILE B 1 131 ? 95.654  13.804  9.622  1.00 57.72 ? 784  ILE B N   1 
ATOM   3808  C  CA  . ILE B 1 131 ? 95.107  14.195  10.913 1.00 55.00 ? 784  ILE B CA  1 
ATOM   3809  C  C   . ILE B 1 131 ? 96.064  15.155  11.603 1.00 52.80 ? 784  ILE B C   1 
ATOM   3810  O  O   . ILE B 1 131 ? 97.220  14.817  11.828 1.00 52.81 ? 784  ILE B O   1 
ATOM   3811  C  CB  . ILE B 1 131 ? 94.918  12.970  11.804 1.00 55.17 ? 784  ILE B CB  1 
ATOM   3812  C  CG1 . ILE B 1 131 ? 93.957  11.994  11.130 1.00 55.45 ? 784  ILE B CG1 1 
ATOM   3813  C  CG2 . ILE B 1 131 ? 94.374  13.382  13.147 1.00 55.28 ? 784  ILE B CG2 1 
ATOM   3814  C  CD1 . ILE B 1 131 ? 93.733  10.698  11.913 1.00 56.81 ? 784  ILE B CD1 1 
ATOM   3815  N  N   . ALA B 1 132 ? 95.575  16.343  11.948 1.00 50.85 ? 785  ALA B N   1 
ATOM   3816  C  CA  . ALA B 1 132 ? 96.385  17.354  12.615 1.00 49.27 ? 785  ALA B CA  1 
ATOM   3817  C  C   . ALA B 1 132 ? 96.448  17.204  14.140 1.00 48.89 ? 785  ALA B C   1 
ATOM   3818  O  O   . ALA B 1 132 ? 95.508  16.729  14.786 1.00 48.42 ? 785  ALA B O   1 
ATOM   3819  C  CB  . ALA B 1 132 ? 95.878  18.762  12.252 1.00 48.11 ? 785  ALA B CB  1 
ATOM   3820  N  N   . TYR B 1 133 ? 97.584  17.602  14.697 1.00 48.30 ? 786  TYR B N   1 
ATOM   3821  C  CA  . TYR B 1 133 ? 97.821  17.568  16.141 1.00 48.57 ? 786  TYR B CA  1 
ATOM   3822  C  C   . TYR B 1 133 ? 98.317  18.952  16.541 1.00 48.73 ? 786  TYR B C   1 
ATOM   3823  O  O   . TYR B 1 133 ? 99.017  19.600  15.769 1.00 47.12 ? 786  TYR B O   1 
ATOM   3824  C  CB  . TYR B 1 133 ? 98.883  16.518  16.499 1.00 47.27 ? 786  TYR B CB  1 
ATOM   3825  C  CG  . TYR B 1 133 ? 98.361  15.122  16.396 1.00 46.17 ? 786  TYR B CG  1 
ATOM   3826  C  CD1 . TYR B 1 133 ? 98.261  14.487  15.154 1.00 47.09 ? 786  TYR B CD1 1 
ATOM   3827  C  CD2 . TYR B 1 133 ? 97.853  14.473  17.515 1.00 45.00 ? 786  TYR B CD2 1 
ATOM   3828  C  CE1 . TYR B 1 133 ? 97.652  13.237  15.030 1.00 47.33 ? 786  TYR B CE1 1 
ATOM   3829  C  CE2 . TYR B 1 133 ? 97.235  13.229  17.411 1.00 46.31 ? 786  TYR B CE2 1 
ATOM   3830  C  CZ  . TYR B 1 133 ? 97.132  12.615  16.167 1.00 47.45 ? 786  TYR B CZ  1 
ATOM   3831  O  OH  . TYR B 1 133 ? 96.473  11.406  16.042 1.00 48.39 ? 786  TYR B OH  1 
ATOM   3832  N  N   . ILE B 1 134 ? 97.950  19.413  17.732 1.00 48.87 ? 787  ILE B N   1 
ATOM   3833  C  CA  . ILE B 1 134 ? 98.404  20.735  18.173 1.00 48.00 ? 787  ILE B CA  1 
ATOM   3834  C  C   . ILE B 1 134 ? 99.651  20.584  19.020 1.00 47.96 ? 787  ILE B C   1 
ATOM   3835  O  O   . ILE B 1 134 ? 99.959  19.497  19.510 1.00 45.67 ? 787  ILE B O   1 
ATOM   3836  C  CB  . ILE B 1 134 ? 97.389  21.457  19.098 1.00 48.39 ? 787  ILE B CB  1 
ATOM   3837  C  CG1 . ILE B 1 134 ? 97.180  20.620  20.358 1.00 46.27 ? 787  ILE B CG1 1 
ATOM   3838  C  CG2 . ILE B 1 134 ? 96.087  21.735  18.381 1.00 48.89 ? 787  ILE B CG2 1 
ATOM   3839  C  CD1 . ILE B 1 134 ? 96.382  21.328  21.408 1.00 48.48 ? 787  ILE B CD1 1 
ATOM   3840  N  N   . SER B 1 135 ? 100.342 21.696  19.218 1.00 48.70 ? 788  SER B N   1 
ATOM   3841  C  CA  . SER B 1 135 ? 101.521 21.707  20.079 1.00 50.19 ? 788  SER B CA  1 
ATOM   3842  C  C   . SER B 1 135 ? 101.600 23.037  20.801 1.00 49.38 ? 788  SER B C   1 
ATOM   3843  O  O   . SER B 1 135 ? 101.718 24.088  20.156 1.00 49.95 ? 788  SER B O   1 
ATOM   3844  C  CB  . SER B 1 135 ? 102.812 21.531  19.280 1.00 51.90 ? 788  SER B CB  1 
ATOM   3845  O  OG  . SER B 1 135 ? 103.882 21.393  20.191 1.00 53.69 ? 788  SER B OG  1 
ATOM   3846  N  N   . SER B 1 136 ? 101.541 23.015  22.130 1.00 48.18 ? 789  SER B N   1 
ATOM   3847  C  CA  . SER B 1 136 ? 101.627 24.279  22.860 1.00 47.71 ? 789  SER B CA  1 
ATOM   3848  C  C   . SER B 1 136 ? 102.979 24.923  22.663 1.00 48.70 ? 789  SER B C   1 
ATOM   3849  O  O   . SER B 1 136 ? 104.036 24.272  22.774 1.00 49.00 ? 789  SER B O   1 
ATOM   3850  C  CB  . SER B 1 136 ? 101.407 24.111  24.354 1.00 45.18 ? 789  SER B CB  1 
ATOM   3851  O  OG  . SER B 1 136 ? 101.493 25.388  24.951 1.00 41.98 ? 789  SER B OG  1 
ATOM   3852  N  N   . LYS B 1 137 ? 102.940 26.214  22.368 1.00 49.68 ? 790  LYS B N   1 
ATOM   3853  C  CA  . LYS B 1 137 ? 104.160 26.969  22.149 1.00 50.12 ? 790  LYS B CA  1 
ATOM   3854  C  C   . LYS B 1 137 ? 104.804 27.347  23.463 1.00 50.42 ? 790  LYS B C   1 
ATOM   3855  O  O   . LYS B 1 137 ? 105.962 27.719  23.472 1.00 52.08 ? 790  LYS B O   1 
ATOM   3856  C  CB  . LYS B 1 137 ? 103.874 28.233  21.335 1.00 48.68 ? 790  LYS B CB  1 
ATOM   3857  C  CG  . LYS B 1 137 ? 103.625 27.953  19.878 1.00 47.68 ? 790  LYS B CG  1 
ATOM   3858  C  CD  . LYS B 1 137 ? 102.868 29.094  19.197 1.00 47.48 ? 790  LYS B CD  1 
ATOM   3859  C  CE  . LYS B 1 137 ? 102.098 28.540  18.000 1.00 49.05 ? 790  LYS B CE  1 
ATOM   3860  N  NZ  . LYS B 1 137 ? 101.232 29.543  17.317 1.00 51.36 ? 790  LYS B NZ  1 
ATOM   3861  N  N   . SER B 1 138 ? 104.069 27.233  24.569 1.00 49.97 ? 791  SER B N   1 
ATOM   3862  C  CA  . SER B 1 138 ? 104.620 27.612  25.860 1.00 49.19 ? 791  SER B CA  1 
ATOM   3863  C  C   . SER B 1 138 ? 105.284 26.493  26.678 1.00 49.43 ? 791  SER B C   1 
ATOM   3864  O  O   . SER B 1 138 ? 105.527 26.659  27.874 1.00 48.30 ? 791  SER B O   1 
ATOM   3865  C  CB  . SER B 1 138 ? 103.546 28.318  26.691 1.00 50.55 ? 791  SER B CB  1 
ATOM   3866  O  OG  . SER B 1 138 ? 102.413 27.491  26.902 1.00 53.39 ? 791  SER B OG  1 
ATOM   3867  N  N   . CYS B 1 139 ? 105.583 25.360  26.050 1.00 49.22 ? 792  CYS B N   1 
ATOM   3868  C  CA  . CYS B 1 139 ? 106.266 24.278  26.762 1.00 50.85 ? 792  CYS B CA  1 
ATOM   3869  C  C   . CYS B 1 139 ? 106.703 23.154  25.829 1.00 50.51 ? 792  CYS B C   1 
ATOM   3870  O  O   . CYS B 1 139 ? 106.454 23.206  24.621 1.00 49.34 ? 792  CYS B O   1 
ATOM   3871  C  CB  . CYS B 1 139 ? 105.398 23.702  27.914 1.00 52.30 ? 792  CYS B CB  1 
ATOM   3872  S  SG  . CYS B 1 139 ? 104.058 22.472  27.516 1.00 57.29 ? 792  CYS B SG  1 
ATOM   3873  N  N   . SER B 1 140 ? 107.386 22.159  26.396 1.00 50.83 ? 793  SER B N   1 
ATOM   3874  C  CA  . SER B 1 140 ? 107.842 21.010  25.630 1.00 52.16 ? 793  SER B CA  1 
ATOM   3875  C  C   . SER B 1 140 ? 108.324 19.927  26.569 1.00 53.44 ? 793  SER B C   1 
ATOM   3876  O  O   . SER B 1 140 ? 108.647 20.185  27.724 1.00 52.12 ? 793  SER B O   1 
ATOM   3877  C  CB  . SER B 1 140 ? 108.988 21.382  24.693 1.00 52.48 ? 793  SER B CB  1 
ATOM   3878  O  OG  . SER B 1 140 ? 110.186 21.506  25.437 1.00 54.30 ? 793  SER B OG  1 
ATOM   3879  N  N   . ASN B 1 141 ? 108.361 18.705  26.050 1.00 55.80 ? 794  ASN B N   1 
ATOM   3880  C  CA  . ASN B 1 141 ? 108.805 17.554  26.813 1.00 57.86 ? 794  ASN B CA  1 
ATOM   3881  C  C   . ASN B 1 141 ? 110.324 17.625  26.892 1.00 59.79 ? 794  ASN B C   1 
ATOM   3882  O  O   . ASN B 1 141 ? 111.015 17.561  25.867 1.00 61.28 ? 794  ASN B O   1 
ATOM   3883  C  CB  . ASN B 1 141 ? 108.367 16.263  26.117 1.00 58.71 ? 794  ASN B CB  1 
ATOM   3884  C  CG  . ASN B 1 141 ? 106.876 16.231  25.841 1.00 58.65 ? 794  ASN B CG  1 
ATOM   3885  O  OD1 . ASN B 1 141 ? 106.072 16.558  26.714 1.00 59.92 ? 794  ASN B OD1 1 
ATOM   3886  N  ND2 . ASN B 1 141 ? 106.497 15.820  24.631 1.00 58.61 ? 794  ASN B ND2 1 
ATOM   3887  N  N   . PRO B 1 142 ? 110.870 17.763  28.112 1.00 59.38 ? 795  PRO B N   1 
ATOM   3888  C  CA  . PRO B 1 142 ? 112.322 17.844  28.267 1.00 58.76 ? 795  PRO B CA  1 
ATOM   3889  C  C   . PRO B 1 142 ? 113.020 16.712  27.507 1.00 60.10 ? 795  PRO B C   1 
ATOM   3890  O  O   . PRO B 1 142 ? 114.104 16.907  26.950 1.00 60.31 ? 795  PRO B O   1 
ATOM   3891  C  CB  . PRO B 1 142 ? 112.515 17.727  29.777 1.00 59.04 ? 795  PRO B CB  1 
ATOM   3892  C  CG  . PRO B 1 142 ? 111.193 18.215  30.350 1.00 59.22 ? 795  PRO B CG  1 
ATOM   3893  C  CD  . PRO B 1 142 ? 110.206 17.594  29.419 1.00 59.33 ? 795  PRO B CD  1 
ATOM   3894  N  N   . ASP B 1 143 ? 112.396 15.536  27.469 1.00 59.28 ? 796  ASP B N   1 
ATOM   3895  C  CA  . ASP B 1 143 ? 113.000 14.403  26.784 1.00 59.10 ? 796  ASP B CA  1 
ATOM   3896  C  C   . ASP B 1 143 ? 112.087 13.193  26.665 1.00 59.54 ? 796  ASP B C   1 
ATOM   3897  O  O   . ASP B 1 143 ? 110.909 13.253  26.990 1.00 58.69 ? 796  ASP B O   1 
ATOM   3898  C  CB  . ASP B 1 143 ? 114.271 14.000  27.515 1.00 59.28 ? 796  ASP B CB  1 
ATOM   3899  C  CG  . ASP B 1 143 ? 114.036 13.789  28.999 1.00 60.94 ? 796  ASP B CG  1 
ATOM   3900  O  OD1 . ASP B 1 143 ? 113.375 12.781  29.369 1.00 59.36 ? 796  ASP B OD1 1 
ATOM   3901  O  OD2 . ASP B 1 143 ? 114.499 14.651  29.797 1.00 60.82 ? 796  ASP B OD2 1 
ATOM   3902  N  N   . GLU B 1 144 ? 112.668 12.088  26.208 1.00 60.47 ? 797  GLU B N   1 
ATOM   3903  C  CA  . GLU B 1 144 ? 111.958 10.823  26.000 1.00 60.95 ? 797  GLU B CA  1 
ATOM   3904  C  C   . GLU B 1 144 ? 111.206 10.283  27.216 1.00 60.46 ? 797  GLU B C   1 
ATOM   3905  O  O   . GLU B 1 144 ? 110.195 9.603   27.066 1.00 61.44 ? 797  GLU B O   1 
ATOM   3906  C  CB  . GLU B 1 144 ? 112.951 9.747   25.471 1.00 60.53 ? 797  GLU B CB  1 
ATOM   3907  N  N   . SER B 1 145 ? 111.692 10.561  28.418 1.00 60.49 ? 798  SER B N   1 
ATOM   3908  C  CA  . SER B 1 145 ? 111.004 10.075  29.603 1.00 60.03 ? 798  SER B CA  1 
ATOM   3909  C  C   . SER B 1 145 ? 109.702 10.875  29.861 1.00 59.96 ? 798  SER B C   1 
ATOM   3910  O  O   . SER B 1 145 ? 108.995 10.624  30.835 1.00 60.24 ? 798  SER B O   1 
ATOM   3911  C  CB  . SER B 1 145 ? 111.936 10.147  30.818 1.00 60.28 ? 798  SER B CB  1 
ATOM   3912  O  OG  . SER B 1 145 ? 112.382 11.479  31.055 1.00 60.93 ? 798  SER B OG  1 
ATOM   3913  N  N   . TYR B 1 146 ? 109.399 11.833  28.987 1.00 59.09 ? 799  TYR B N   1 
ATOM   3914  C  CA  . TYR B 1 146 ? 108.192 12.650  29.102 1.00 58.94 ? 799  TYR B CA  1 
ATOM   3915  C  C   . TYR B 1 146 ? 107.353 12.531  27.855 1.00 58.24 ? 799  TYR B C   1 
ATOM   3916  O  O   . TYR B 1 146 ? 107.821 12.074  26.818 1.00 58.32 ? 799  TYR B O   1 
ATOM   3917  C  CB  . TYR B 1 146 ? 108.512 14.141  29.300 1.00 58.86 ? 799  TYR B CB  1 
ATOM   3918  C  CG  . TYR B 1 146 ? 109.051 14.447  30.660 1.00 60.36 ? 799  TYR B CG  1 
ATOM   3919  C  CD1 . TYR B 1 146 ? 110.407 14.289  30.936 1.00 61.48 ? 799  TYR B CD1 1 
ATOM   3920  C  CD2 . TYR B 1 146 ? 108.200 14.830  31.706 1.00 60.89 ? 799  TYR B CD2 1 
ATOM   3921  C  CE1 . TYR B 1 146 ? 110.917 14.500  32.218 1.00 61.12 ? 799  TYR B CE1 1 
ATOM   3922  C  CE2 . TYR B 1 146 ? 108.700 15.043  32.999 1.00 61.59 ? 799  TYR B CE2 1 
ATOM   3923  C  CZ  . TYR B 1 146 ? 110.066 14.873  33.240 1.00 61.61 ? 799  TYR B CZ  1 
ATOM   3924  O  OH  . TYR B 1 146 ? 110.591 15.071  34.497 1.00 61.85 ? 799  TYR B OH  1 
ATOM   3925  N  N   . GLY B 1 147 ? 106.109 12.973  27.975 1.00 58.14 ? 800  GLY B N   1 
ATOM   3926  C  CA  . GLY B 1 147 ? 105.181 12.950  26.864 1.00 57.09 ? 800  GLY B CA  1 
ATOM   3927  C  C   . GLY B 1 147 ? 104.097 13.968  27.151 1.00 56.46 ? 800  GLY B C   1 
ATOM   3928  O  O   . GLY B 1 147 ? 104.199 14.730  28.114 1.00 56.09 ? 800  GLY B O   1 
ATOM   3929  N  N   . CYS B 1 148 ? 103.063 13.991  26.317 1.00 55.78 ? 801  CYS B N   1 
ATOM   3930  C  CA  . CYS B 1 148 ? 101.947 14.919  26.502 1.00 54.20 ? 801  CYS B CA  1 
ATOM   3931  C  C   . CYS B 1 148 ? 100.776 14.433  25.664 1.00 52.79 ? 801  CYS B C   1 
ATOM   3932  O  O   . CYS B 1 148 ? 100.968 13.896  24.567 1.00 52.05 ? 801  CYS B O   1 
ATOM   3933  C  CB  . CYS B 1 148 ? 102.347 16.340  26.103 1.00 53.39 ? 801  CYS B CB  1 
ATOM   3934  S  SG  . CYS B 1 148 ? 102.909 16.508  24.396 1.00 58.04 ? 801  CYS B SG  1 
ATOM   3935  N  N   . LEU B 1 149 ? 99.568  14.607  26.195 1.00 51.54 ? 802  LEU B N   1 
ATOM   3936  C  CA  . LEU B 1 149 ? 98.361  14.167  25.511 1.00 50.09 ? 802  LEU B CA  1 
ATOM   3937  C  C   . LEU B 1 149 ? 98.119  14.845  24.183 1.00 49.32 ? 802  LEU B C   1 
ATOM   3938  O  O   . LEU B 1 149 ? 97.403  14.306  23.330 1.00 49.17 ? 802  LEU B O   1 
ATOM   3939  C  CB  . LEU B 1 149 ? 97.129  14.373  26.389 1.00 51.04 ? 802  LEU B CB  1 
ATOM   3940  C  CG  . LEU B 1 149 ? 96.946  13.411  27.560 1.00 50.41 ? 802  LEU B CG  1 
ATOM   3941  C  CD1 . LEU B 1 149 ? 98.006  13.633  28.601 1.00 50.33 ? 802  LEU B CD1 1 
ATOM   3942  C  CD2 . LEU B 1 149 ? 95.585  13.649  28.161 1.00 51.40 ? 802  LEU B CD2 1 
ATOM   3943  N  N   . SER B 1 150 ? 98.701  16.022  23.996 1.00 47.77 ? 803  SER B N   1 
ATOM   3944  C  CA  . SER B 1 150 ? 98.505  16.729  22.745 1.00 48.12 ? 803  SER B CA  1 
ATOM   3945  C  C   . SER B 1 150 ? 99.070  15.905  21.583 1.00 48.13 ? 803  SER B C   1 
ATOM   3946  O  O   . SER B 1 150 ? 98.750  16.146  20.419 1.00 47.55 ? 803  SER B O   1 
ATOM   3947  C  CB  . SER B 1 150 ? 99.158  18.111  22.812 1.00 47.65 ? 803  SER B CB  1 
ATOM   3948  O  OG  . SER B 1 150 ? 100.481 18.016  23.298 1.00 50.64 ? 803  SER B OG  1 
ATOM   3949  N  N   . SER B 1 151 ? 99.892  14.912  21.909 1.00 48.34 ? 804  SER B N   1 
ATOM   3950  C  CA  . SER B 1 151 ? 100.501 14.057  20.889 1.00 49.31 ? 804  SER B CA  1 
ATOM   3951  C  C   . SER B 1 151 ? 99.738  12.755  20.625 1.00 49.11 ? 804  SER B C   1 
ATOM   3952  O  O   . SER B 1 151 ? 100.042 12.053  19.672 1.00 49.73 ? 804  SER B O   1 
ATOM   3953  C  CB  . SER B 1 151 ? 101.958 13.718  21.256 1.00 49.52 ? 804  SER B CB  1 
ATOM   3954  O  OG  . SER B 1 151 ? 102.811 14.841  21.068 1.00 51.79 ? 804  SER B OG  1 
ATOM   3955  N  N   . ASN B 1 152 ? 98.752  12.435  21.457 1.00 48.22 ? 805  ASN B N   1 
ATOM   3956  C  CA  . ASN B 1 152 ? 97.967  11.214  21.275 1.00 47.19 ? 805  ASN B CA  1 
ATOM   3957  C  C   . ASN B 1 152 ? 96.517  11.519  20.927 1.00 45.29 ? 805  ASN B C   1 
ATOM   3958  O  O   . ASN B 1 152 ? 95.782  10.619  20.528 1.00 46.45 ? 805  ASN B O   1 
ATOM   3959  C  CB  . ASN B 1 152 ? 97.965  10.376  22.557 1.00 50.10 ? 805  ASN B CB  1 
ATOM   3960  C  CG  . ASN B 1 152 ? 99.354  10.126  23.115 1.00 52.06 ? 805  ASN B CG  1 
ATOM   3961  O  OD1 . ASN B 1 152 ? 99.481  9.605   24.222 1.00 55.10 ? 805  ASN B OD1 1 
ATOM   3962  N  ND2 . ASN B 1 152 ? 100.392 10.486  22.367 1.00 52.28 ? 805  ASN B ND2 1 
ATOM   3963  N  N   . ILE B 1 153 ? 96.101  12.774  21.098 1.00 42.20 ? 806  ILE B N   1 
ATOM   3964  C  CA  . ILE B 1 153 ? 94.718  13.184  20.809 1.00 40.40 ? 806  ILE B CA  1 
ATOM   3965  C  C   . ILE B 1 153 ? 94.681  14.265  19.739 1.00 39.28 ? 806  ILE B C   1 
ATOM   3966  O  O   . ILE B 1 153 ? 95.133  15.371  19.962 1.00 38.34 ? 806  ILE B O   1 
ATOM   3967  C  CB  . ILE B 1 153 ? 94.013  13.727  22.093 1.00 40.08 ? 806  ILE B CB  1 
ATOM   3968  C  CG1 . ILE B 1 153 ? 94.021  12.650  23.171 1.00 37.55 ? 806  ILE B CG1 1 
ATOM   3969  C  CG2 . ILE B 1 153 ? 92.576  14.188  21.785 1.00 38.49 ? 806  ILE B CG2 1 
ATOM   3970  C  CD1 . ILE B 1 153 ? 93.526  13.144  24.492 1.00 39.02 ? 806  ILE B CD1 1 
ATOM   3971  N  N   . PRO B 1 154 ? 94.115  13.960  18.568 1.00 38.54 ? 807  PRO B N   1 
ATOM   3972  C  CA  . PRO B 1 154 ? 94.033  14.926  17.474 1.00 39.23 ? 807  PRO B CA  1 
ATOM   3973  C  C   . PRO B 1 154 ? 93.506  16.338  17.796 1.00 38.85 ? 807  PRO B C   1 
ATOM   3974  O  O   . PRO B 1 154 ? 92.681  16.531  18.680 1.00 38.38 ? 807  PRO B O   1 
ATOM   3975  C  CB  . PRO B 1 154 ? 93.177  14.190  16.429 1.00 37.73 ? 807  PRO B CB  1 
ATOM   3976  C  CG  . PRO B 1 154 ? 92.407  13.275  17.208 1.00 39.07 ? 807  PRO B CG  1 
ATOM   3977  C  CD  . PRO B 1 154 ? 93.359  12.751  18.233 1.00 38.58 ? 807  PRO B CD  1 
ATOM   3978  N  N   . ALA B 1 155 ? 94.017  17.315  17.058 1.00 38.35 ? 808  ALA B N   1 
ATOM   3979  C  CA  . ALA B 1 155 ? 93.630  18.714  17.202 1.00 39.52 ? 808  ALA B CA  1 
ATOM   3980  C  C   . ALA B 1 155 ? 92.113  18.927  17.306 1.00 39.15 ? 808  ALA B C   1 
ATOM   3981  O  O   . ALA B 1 155 ? 91.626  19.640  18.188 1.00 41.21 ? 808  ALA B O   1 
ATOM   3982  C  CB  . ALA B 1 155 ? 94.181  19.524  16.015 1.00 38.11 ? 808  ALA B CB  1 
ATOM   3983  N  N   . LEU B 1 156 ? 91.367  18.319  16.395 1.00 38.27 ? 809  LEU B N   1 
ATOM   3984  C  CA  . LEU B 1 156 ? 89.921  18.473  16.392 1.00 37.81 ? 809  LEU B CA  1 
ATOM   3985  C  C   . LEU B 1 156 ? 89.272  18.060  17.725 1.00 36.95 ? 809  LEU B C   1 
ATOM   3986  O  O   . LEU B 1 156 ? 88.312  18.686  18.179 1.00 35.96 ? 809  LEU B O   1 
ATOM   3987  C  CB  . LEU B 1 156 ? 89.317  17.657  15.252 1.00 37.97 ? 809  LEU B CB  1 
ATOM   3988  C  CG  . LEU B 1 156 ? 87.806  17.806  15.081 1.00 38.92 ? 809  LEU B CG  1 
ATOM   3989  C  CD1 . LEU B 1 156 ? 87.487  19.190  14.532 1.00 37.61 ? 809  LEU B CD1 1 
ATOM   3990  C  CD2 . LEU B 1 156 ? 87.295  16.731  14.155 1.00 40.30 ? 809  LEU B CD2 1 
ATOM   3991  N  N   . GLU B 1 157 ? 89.794  17.004  18.341 1.00 36.14 ? 810  GLU B N   1 
ATOM   3992  C  CA  . GLU B 1 157 ? 89.257  16.526  19.593 1.00 36.55 ? 810  GLU B CA  1 
ATOM   3993  C  C   . GLU B 1 157 ? 89.623  17.400  20.782 1.00 35.72 ? 810  GLU B C   1 
ATOM   3994  O  O   . GLU B 1 157 ? 88.796  17.625  21.667 1.00 36.32 ? 810  GLU B O   1 
ATOM   3995  C  CB  . GLU B 1 157 ? 89.681  15.079  19.800 1.00 37.42 ? 810  GLU B CB  1 
ATOM   3996  C  CG  . GLU B 1 157 ? 88.927  14.140  18.859 1.00 40.04 ? 810  GLU B CG  1 
ATOM   3997  C  CD  . GLU B 1 157 ? 89.525  12.746  18.790 1.00 40.49 ? 810  GLU B CD  1 
ATOM   3998  O  OE1 . GLU B 1 157 ? 90.017  12.252  19.825 1.00 41.94 ? 810  GLU B OE1 1 
ATOM   3999  O  OE2 . GLU B 1 157 ? 89.477  12.146  17.699 1.00 41.66 ? 810  GLU B OE2 1 
ATOM   4000  N  N   . LEU B 1 158 ? 90.843  17.918  20.808 1.00 34.47 ? 811  LEU B N   1 
ATOM   4001  C  CA  . LEU B 1 158 ? 91.208  18.793  21.902 1.00 33.13 ? 811  LEU B CA  1 
ATOM   4002  C  C   . LEU B 1 158 ? 90.459  20.116  21.718 1.00 31.71 ? 811  LEU B C   1 
ATOM   4003  O  O   . LEU B 1 158 ? 90.033  20.736  22.690 1.00 30.66 ? 811  LEU B O   1 
ATOM   4004  C  CB  . LEU B 1 158 ? 92.722  19.019  21.949 1.00 34.06 ? 811  LEU B CB  1 
ATOM   4005  C  CG  . LEU B 1 158 ? 93.517  17.811  22.463 1.00 35.12 ? 811  LEU B CG  1 
ATOM   4006  C  CD1 . LEU B 1 158 ? 95.005  18.114  22.483 1.00 35.53 ? 811  LEU B CD1 1 
ATOM   4007  C  CD2 . LEU B 1 158 ? 93.044  17.439  23.845 1.00 35.56 ? 811  LEU B CD2 1 
ATOM   4008  N  N   . MET B 1 159 ? 90.266  20.533  20.475 1.00 30.68 ? 812  MET B N   1 
ATOM   4009  C  CA  . MET B 1 159 ? 89.543  21.764  20.258 1.00 31.20 ? 812  MET B CA  1 
ATOM   4010  C  C   . MET B 1 159 ? 88.115  21.625  20.780 1.00 32.43 ? 812  MET B C   1 
ATOM   4011  O  O   . MET B 1 159 ? 87.569  22.564  21.356 1.00 32.98 ? 812  MET B O   1 
ATOM   4012  C  CB  . MET B 1 159 ? 89.521  22.147  18.787 1.00 31.73 ? 812  MET B CB  1 
ATOM   4013  C  CG  . MET B 1 159 ? 88.617  23.368  18.527 1.00 33.51 ? 812  MET B CG  1 
ATOM   4014  S  SD  . MET B 1 159 ? 89.002  24.146  16.953 1.00 37.06 ? 812  MET B SD  1 
ATOM   4015  C  CE  . MET B 1 159 ? 88.152  22.946  15.769 1.00 32.95 ? 812  MET B CE  1 
ATOM   4016  N  N   . ALA B 1 160 ? 87.510  20.457  20.579 1.00 31.49 ? 813  ALA B N   1 
ATOM   4017  C  CA  . ALA B 1 160 ? 86.164  20.230  21.070 1.00 31.01 ? 813  ALA B CA  1 
ATOM   4018  C  C   . ALA B 1 160 ? 86.187  20.334  22.581 1.00 29.87 ? 813  ALA B C   1 
ATOM   4019  O  O   . ALA B 1 160 ? 85.295  20.933  23.159 1.00 30.93 ? 813  ALA B O   1 
ATOM   4020  C  CB  . ALA B 1 160 ? 85.639  18.843  20.640 1.00 28.95 ? 813  ALA B CB  1 
ATOM   4021  N  N   . LEU B 1 161 ? 87.188  19.724  23.213 1.00 29.06 ? 814  LEU B N   1 
ATOM   4022  C  CA  . LEU B 1 161 ? 87.330  19.776  24.661 1.00 28.99 ? 814  LEU B CA  1 
ATOM   4023  C  C   . LEU B 1 161 ? 87.457  21.227  25.171 1.00 29.45 ? 814  LEU B C   1 
ATOM   4024  O  O   . LEU B 1 161 ? 86.864  21.572  26.181 1.00 28.26 ? 814  LEU B O   1 
ATOM   4025  C  CB  . LEU B 1 161 ? 88.564  18.956  25.095 1.00 28.29 ? 814  LEU B CB  1 
ATOM   4026  C  CG  . LEU B 1 161 ? 88.948  18.820  26.587 1.00 28.96 ? 814  LEU B CG  1 
ATOM   4027  C  CD1 . LEU B 1 161 ? 87.775  18.329  27.415 1.00 25.41 ? 814  LEU B CD1 1 
ATOM   4028  C  CD2 . LEU B 1 161 ? 90.134  17.842  26.714 1.00 26.76 ? 814  LEU B CD2 1 
ATOM   4029  N  N   . TYR B 1 162 ? 88.196  22.079  24.461 1.00 28.02 ? 815  TYR B N   1 
ATOM   4030  C  CA  . TYR B 1 162 ? 88.363  23.447  24.922 1.00 29.43 ? 815  TYR B CA  1 
ATOM   4031  C  C   . TYR B 1 162 ? 87.082  24.256  24.722 1.00 31.46 ? 815  TYR B C   1 
ATOM   4032  O  O   . TYR B 1 162 ? 86.671  25.055  25.578 1.00 33.82 ? 815  TYR B O   1 
ATOM   4033  C  CB  . TYR B 1 162 ? 89.523  24.119  24.193 1.00 27.85 ? 815  TYR B CB  1 
ATOM   4034  C  CG  . TYR B 1 162 ? 90.859  23.411  24.329 1.00 29.15 ? 815  TYR B CG  1 
ATOM   4035  C  CD1 . TYR B 1 162 ? 91.909  23.693  23.451 1.00 30.34 ? 815  TYR B CD1 1 
ATOM   4036  C  CD2 . TYR B 1 162 ? 91.079  22.461  25.337 1.00 28.77 ? 815  TYR B CD2 1 
ATOM   4037  C  CE1 . TYR B 1 162 ? 93.143  23.046  23.564 1.00 32.20 ? 815  TYR B CE1 1 
ATOM   4038  C  CE2 . TYR B 1 162 ? 92.305  21.803  25.461 1.00 29.93 ? 815  TYR B CE2 1 
ATOM   4039  C  CZ  . TYR B 1 162 ? 93.333  22.100  24.561 1.00 32.75 ? 815  TYR B CZ  1 
ATOM   4040  O  OH  . TYR B 1 162 ? 94.517  21.404  24.608 1.00 35.11 ? 815  TYR B OH  1 
ATOM   4041  N  N   . VAL B 1 163 ? 86.430  24.048  23.595 1.00 30.55 ? 816  VAL B N   1 
ATOM   4042  C  CA  . VAL B 1 163 ? 85.218  24.782  23.342 1.00 30.59 ? 816  VAL B CA  1 
ATOM   4043  C  C   . VAL B 1 163 ? 84.135  24.384  24.335 1.00 31.36 ? 816  VAL B C   1 
ATOM   4044  O  O   . VAL B 1 163 ? 83.328  25.218  24.738 1.00 30.60 ? 816  VAL B O   1 
ATOM   4045  C  CB  . VAL B 1 163 ? 84.755  24.587  21.899 1.00 31.21 ? 816  VAL B CB  1 
ATOM   4046  C  CG1 . VAL B 1 163 ? 83.357  25.194  21.699 1.00 30.99 ? 816  VAL B CG1 1 
ATOM   4047  C  CG2 . VAL B 1 163 ? 85.739  25.275  20.968 1.00 28.14 ? 816  VAL B CG2 1 
ATOM   4048  N  N   . ALA B 1 164 ? 84.151  23.123  24.764 1.00 31.13 ? 817  ALA B N   1 
ATOM   4049  C  CA  . ALA B 1 164 ? 83.161  22.635  25.728 1.00 30.13 ? 817  ALA B CA  1 
ATOM   4050  C  C   . ALA B 1 164 ? 83.408  23.231  27.115 1.00 29.13 ? 817  ALA B C   1 
ATOM   4051  O  O   . ALA B 1 164 ? 82.470  23.547  27.827 1.00 29.65 ? 817  ALA B O   1 
ATOM   4052  C  CB  . ALA B 1 164 ? 83.172  21.100  25.794 1.00 26.80 ? 817  ALA B CB  1 
ATOM   4053  N  N   . ALA B 1 165 ? 84.671  23.392  27.484 1.00 30.02 ? 818  ALA B N   1 
ATOM   4054  C  CA  . ALA B 1 165 ? 85.009  23.983  28.779 1.00 30.33 ? 818  ALA B CA  1 
ATOM   4055  C  C   . ALA B 1 165 ? 84.403  25.382  28.733 1.00 28.64 ? 818  ALA B C   1 
ATOM   4056  O  O   . ALA B 1 165 ? 83.808  25.859  29.692 1.00 30.18 ? 818  ALA B O   1 
ATOM   4057  C  CB  . ALA B 1 165 ? 86.539  24.043  28.957 1.00 27.80 ? 818  ALA B CB  1 
ATOM   4058  N  N   . ALA B 1 166 ? 84.534  26.013  27.585 1.00 28.63 ? 819  ALA B N   1 
ATOM   4059  C  CA  . ALA B 1 166 ? 83.998  27.351  27.368 1.00 29.28 ? 819  ALA B CA  1 
ATOM   4060  C  C   . ALA B 1 166 ? 82.486  27.374  27.590 1.00 28.51 ? 819  ALA B C   1 
ATOM   4061  O  O   . ALA B 1 166 ? 81.987  28.131  28.416 1.00 29.14 ? 819  ALA B O   1 
ATOM   4062  C  CB  . ALA B 1 166 ? 84.332  27.813  25.946 1.00 25.09 ? 819  ALA B CB  1 
ATOM   4063  N  N   . MET B 1 167 ? 81.767  26.495  26.918 1.00 28.68 ? 820  MET B N   1 
ATOM   4064  C  CA  . MET B 1 167 ? 80.325  26.506  27.034 1.00 28.81 ? 820  MET B CA  1 
ATOM   4065  C  C   . MET B 1 167 ? 79.671  25.688  28.117 1.00 30.17 ? 820  MET B C   1 
ATOM   4066  O  O   . MET B 1 167 ? 78.473  25.846  28.355 1.00 30.19 ? 820  MET B O   1 
ATOM   4067  C  CB  . MET B 1 167 ? 79.679  26.031  25.731 1.00 31.05 ? 820  MET B CB  1 
ATOM   4068  C  CG  . MET B 1 167 ? 80.448  26.156  24.423 1.00 27.78 ? 820  MET B CG  1 
ATOM   4069  S  SD  . MET B 1 167 ? 79.647  24.978  23.224 1.00 32.85 ? 820  MET B SD  1 
ATOM   4070  C  CE  . MET B 1 167 ? 80.019  25.741  21.693 1.00 26.58 ? 820  MET B CE  1 
ATOM   4071  N  N   . HIS B 1 168 ? 80.433  24.835  28.791 1.00 30.21 ? 821  HIS B N   1 
ATOM   4072  C  CA  . HIS B 1 168 ? 79.844  23.896  29.749 1.00 30.81 ? 821  HIS B CA  1 
ATOM   4073  C  C   . HIS B 1 168 ? 78.878  24.308  30.864 1.00 31.75 ? 821  HIS B C   1 
ATOM   4074  O  O   . HIS B 1 168 ? 78.076  23.471  31.291 1.00 29.93 ? 821  HIS B O   1 
ATOM   4075  C  CB  . HIS B 1 168 ? 80.934  22.968  30.315 1.00 28.66 ? 821  HIS B CB  1 
ATOM   4076  C  CG  . HIS B 1 168 ? 81.476  23.389  31.638 1.00 26.95 ? 821  HIS B CG  1 
ATOM   4077  N  ND1 . HIS B 1 168 ? 82.379  24.415  31.775 1.00 30.23 ? 821  HIS B ND1 1 
ATOM   4078  C  CD2 . HIS B 1 168 ? 81.225  22.942  32.886 1.00 27.27 ? 821  HIS B CD2 1 
ATOM   4079  C  CE1 . HIS B 1 168 ? 82.659  24.588  33.056 1.00 28.76 ? 821  HIS B CE1 1 
ATOM   4080  N  NE2 . HIS B 1 168 ? 81.970  23.705  33.752 1.00 30.45 ? 821  HIS B NE2 1 
ATOM   4081  N  N   . ASP B 1 169 ? 78.932  25.550  31.350 1.00 31.70 ? 822  ASP B N   1 
ATOM   4082  C  CA  . ASP B 1 169 ? 77.981  25.964  32.389 1.00 31.52 ? 822  ASP B CA  1 
ATOM   4083  C  C   . ASP B 1 169 ? 77.154  27.185  31.923 1.00 32.99 ? 822  ASP B C   1 
ATOM   4084  O  O   . ASP B 1 169 ? 76.562  27.894  32.733 1.00 33.01 ? 822  ASP B O   1 
ATOM   4085  C  CB  . ASP B 1 169 ? 78.707  26.274  33.717 1.00 31.35 ? 822  ASP B CB  1 
ATOM   4086  C  CG  . ASP B 1 169 ? 78.920  25.035  34.605 1.00 30.96 ? 822  ASP B CG  1 
ATOM   4087  O  OD1 . ASP B 1 169 ? 77.945  24.329  34.905 1.00 31.06 ? 822  ASP B OD1 1 
ATOM   4088  O  OD2 . ASP B 1 169 ? 80.070  24.771  35.037 1.00 36.95 ? 822  ASP B OD2 1 
ATOM   4089  N  N   . TYR B 1 170 ? 77.112  27.404  30.610 1.00 34.05 ? 823  TYR B N   1 
ATOM   4090  C  CA  . TYR B 1 170 ? 76.378  28.520  29.994 1.00 34.82 ? 823  TYR B CA  1 
ATOM   4091  C  C   . TYR B 1 170 ? 74.933  28.706  30.476 1.00 35.14 ? 823  TYR B C   1 
ATOM   4092  O  O   . TYR B 1 170 ? 74.108  27.794  30.398 1.00 37.73 ? 823  TYR B O   1 
ATOM   4093  C  CB  . TYR B 1 170 ? 76.388  28.349  28.464 1.00 35.84 ? 823  TYR B CB  1 
ATOM   4094  C  CG  . TYR B 1 170 ? 75.679  29.444  27.680 1.00 36.53 ? 823  TYR B CG  1 
ATOM   4095  C  CD1 . TYR B 1 170 ? 76.322  30.641  27.376 1.00 35.02 ? 823  TYR B CD1 1 
ATOM   4096  C  CD2 . TYR B 1 170 ? 74.363  29.276  27.247 1.00 36.23 ? 823  TYR B CD2 1 
ATOM   4097  C  CE1 . TYR B 1 170 ? 75.683  31.636  26.663 1.00 36.99 ? 823  TYR B CE1 1 
ATOM   4098  C  CE2 . TYR B 1 170 ? 73.707  30.272  26.531 1.00 38.05 ? 823  TYR B CE2 1 
ATOM   4099  C  CZ  . TYR B 1 170 ? 74.377  31.451  26.241 1.00 39.42 ? 823  TYR B CZ  1 
ATOM   4100  O  OH  . TYR B 1 170 ? 73.732  32.434  25.532 1.00 40.91 ? 823  TYR B OH  1 
ATOM   4101  N  N   . ASP B 1 171 ? 74.624  29.907  30.944 1.00 35.09 ? 824  ASP B N   1 
ATOM   4102  C  CA  . ASP B 1 171 ? 73.292  30.250  31.449 1.00 33.06 ? 824  ASP B CA  1 
ATOM   4103  C  C   . ASP B 1 171 ? 72.877  29.404  32.656 1.00 31.90 ? 824  ASP B C   1 
ATOM   4104  O  O   . ASP B 1 171 ? 71.737  28.968  32.770 1.00 34.15 ? 824  ASP B O   1 
ATOM   4105  C  CB  . ASP B 1 171 ? 72.230  30.192  30.320 1.00 31.39 ? 824  ASP B CB  1 
ATOM   4106  C  CG  . ASP B 1 171 ? 70.881  30.740  30.771 1.00 33.05 ? 824  ASP B CG  1 
ATOM   4107  O  OD1 . ASP B 1 171 ? 70.886  31.762  31.485 1.00 32.46 ? 824  ASP B OD1 1 
ATOM   4108  O  OD2 . ASP B 1 171 ? 69.818  30.166  30.436 1.00 33.51 ? 824  ASP B OD2 1 
ATOM   4109  N  N   . HIS B 1 172 ? 73.824  29.189  33.566 1.00 32.25 ? 825  HIS B N   1 
ATOM   4110  C  CA  . HIS B 1 172 ? 73.595  28.418  34.799 1.00 30.24 ? 825  HIS B CA  1 
ATOM   4111  C  C   . HIS B 1 172 ? 72.796  29.310  35.749 1.00 30.47 ? 825  HIS B C   1 
ATOM   4112  O  O   . HIS B 1 172 ? 73.160  30.463  35.973 1.00 28.81 ? 825  HIS B O   1 
ATOM   4113  C  CB  . HIS B 1 172 ? 74.930  28.051  35.413 1.00 26.94 ? 825  HIS B CB  1 
ATOM   4114  C  CG  . HIS B 1 172 ? 74.866  26.943  36.406 1.00 27.14 ? 825  HIS B CG  1 
ATOM   4115  N  ND1 . HIS B 1 172 ? 74.097  27.011  37.547 1.00 27.31 ? 825  HIS B ND1 1 
ATOM   4116  C  CD2 . HIS B 1 172 ? 75.542  25.767  36.475 1.00 26.39 ? 825  HIS B CD2 1 
ATOM   4117  C  CE1 . HIS B 1 172 ? 74.306  25.928  38.279 1.00 28.09 ? 825  HIS B CE1 1 
ATOM   4118  N  NE2 . HIS B 1 172 ? 75.180  25.157  37.654 1.00 27.69 ? 825  HIS B NE2 1 
ATOM   4119  N  N   . PRO B 1 173 ? 71.701  28.778  36.330 1.00 30.19 ? 826  PRO B N   1 
ATOM   4120  C  CA  . PRO B 1 173 ? 70.858  29.546  37.241 1.00 30.67 ? 826  PRO B CA  1 
ATOM   4121  C  C   . PRO B 1 173 ? 71.274  29.566  38.685 1.00 33.05 ? 826  PRO B C   1 
ATOM   4122  O  O   . PRO B 1 173 ? 70.576  30.165  39.504 1.00 33.98 ? 826  PRO B O   1 
ATOM   4123  C  CB  . PRO B 1 173 ? 69.504  28.874  37.090 1.00 32.00 ? 826  PRO B CB  1 
ATOM   4124  C  CG  . PRO B 1 173 ? 69.877  27.428  36.982 1.00 28.10 ? 826  PRO B CG  1 
ATOM   4125  C  CD  . PRO B 1 173 ? 71.085  27.462  36.051 1.00 28.94 ? 826  PRO B CD  1 
ATOM   4126  N  N   . GLY B 1 174 ? 72.370  28.894  39.024 1.00 33.48 ? 827  GLY B N   1 
ATOM   4127  C  CA  . GLY B 1 174 ? 72.801  28.876  40.407 1.00 31.27 ? 827  GLY B CA  1 
ATOM   4128  C  C   . GLY B 1 174 ? 71.956  27.939  41.246 1.00 32.70 ? 827  GLY B C   1 
ATOM   4129  O  O   . GLY B 1 174 ? 71.821  28.092  42.465 1.00 33.76 ? 827  GLY B O   1 
ATOM   4130  N  N   . ARG B 1 175 ? 71.363  26.951  40.598 1.00 33.64 ? 828  ARG B N   1 
ATOM   4131  C  CA  . ARG B 1 175 ? 70.542  25.983  41.324 1.00 32.40 ? 828  ARG B CA  1 
ATOM   4132  C  C   . ARG B 1 175 ? 70.894  24.548  40.857 1.00 30.19 ? 828  ARG B C   1 
ATOM   4133  O  O   . ARG B 1 175 ? 71.437  24.374  39.781 1.00 28.86 ? 828  ARG B O   1 
ATOM   4134  C  CB  . ARG B 1 175 ? 69.060  26.353  41.146 1.00 32.88 ? 828  ARG B CB  1 
ATOM   4135  C  CG  . ARG B 1 175 ? 68.358  26.527  42.504 1.00 39.92 ? 828  ARG B CG  1 
ATOM   4136  C  CD  . ARG B 1 175 ? 67.849  27.936  42.865 1.00 39.23 ? 828  ARG B CD  1 
ATOM   4137  N  NE  . ARG B 1 175 ? 68.982  28.825  43.031 1.00 44.10 ? 828  ARG B NE  1 
ATOM   4138  C  CZ  . ARG B 1 175 ? 68.931  30.079  43.444 1.00 42.01 ? 828  ARG B CZ  1 
ATOM   4139  N  NH1 . ARG B 1 175 ? 67.785  30.660  43.766 1.00 39.98 ? 828  ARG B NH1 1 
ATOM   4140  N  NH2 . ARG B 1 175 ? 70.057  30.751  43.492 1.00 44.98 ? 828  ARG B NH2 1 
ATOM   4141  N  N   . THR B 1 176 ? 70.633  23.533  41.670 1.00 28.68 ? 829  THR B N   1 
ATOM   4142  C  CA  . THR B 1 176 ? 70.997  22.164  41.289 1.00 27.55 ? 829  THR B CA  1 
ATOM   4143  C  C   . THR B 1 176 ? 69.938  21.477  40.392 1.00 29.37 ? 829  THR B C   1 
ATOM   4144  O  O   . THR B 1 176 ? 68.818  21.981  40.237 1.00 29.20 ? 829  THR B O   1 
ATOM   4145  C  CB  . THR B 1 176 ? 71.276  21.263  42.542 1.00 26.77 ? 829  THR B CB  1 
ATOM   4146  O  OG1 . THR B 1 176 ? 70.078  21.060  43.276 1.00 28.58 ? 829  THR B OG1 1 
ATOM   4147  C  CG2 . THR B 1 176 ? 72.252  21.920  43.479 1.00 27.81 ? 829  THR B CG2 1 
ATOM   4148  N  N   . ASN B 1 177 ? 70.291  20.337  39.796 1.00 28.87 ? 830  ASN B N   1 
ATOM   4149  C  CA  . ASN B 1 177 ? 69.326  19.610  38.948 1.00 26.73 ? 830  ASN B CA  1 
ATOM   4150  C  C   . ASN B 1 177 ? 68.229  19.147  39.898 1.00 28.97 ? 830  ASN B C   1 
ATOM   4151  O  O   . ASN B 1 177 ? 67.042  19.254  39.600 1.00 29.48 ? 830  ASN B O   1 
ATOM   4152  C  CB  . ASN B 1 177 ? 69.984  18.404  38.275 1.00 24.64 ? 830  ASN B CB  1 
ATOM   4153  C  CG  . ASN B 1 177 ? 70.736  18.782  37.021 1.00 23.54 ? 830  ASN B CG  1 
ATOM   4154  O  OD1 . ASN B 1 177 ? 70.313  19.691  36.291 1.00 26.73 ? 830  ASN B OD1 1 
ATOM   4155  N  ND2 . ASN B 1 177 ? 71.818  18.074  36.722 1.00 20.56 ? 830  ASN B ND2 1 
ATOM   4156  N  N   . ALA B 1 178 ? 68.632  18.662  41.070 1.00 29.88 ? 831  ALA B N   1 
ATOM   4157  C  CA  . ALA B 1 178 ? 67.666  18.192  42.062 1.00 29.75 ? 831  ALA B CA  1 
ATOM   4158  C  C   . ALA B 1 178 ? 66.636  19.274  42.414 1.00 30.81 ? 831  ALA B C   1 
ATOM   4159  O  O   . ALA B 1 178 ? 65.460  18.988  42.586 1.00 32.17 ? 831  ALA B O   1 
ATOM   4160  C  CB  . ALA B 1 178 ? 68.390  17.744  43.317 1.00 26.08 ? 831  ALA B CB  1 
ATOM   4161  N  N   . PHE B 1 179 ? 67.097  20.510  42.530 1.00 33.17 ? 832  PHE B N   1 
ATOM   4162  C  CA  . PHE B 1 179 ? 66.233  21.617  42.883 1.00 33.06 ? 832  PHE B CA  1 
ATOM   4163  C  C   . PHE B 1 179 ? 65.259  21.853  41.751 1.00 32.93 ? 832  PHE B C   1 
ATOM   4164  O  O   . PHE B 1 179 ? 64.086  22.100  41.977 1.00 35.36 ? 832  PHE B O   1 
ATOM   4165  C  CB  . PHE B 1 179 ? 67.056  22.902  43.119 1.00 31.22 ? 832  PHE B CB  1 
ATOM   4166  C  CG  . PHE B 1 179 ? 66.203  24.141  43.262 1.00 27.83 ? 832  PHE B CG  1 
ATOM   4167  C  CD1 . PHE B 1 179 ? 65.677  24.511  44.495 1.00 29.50 ? 832  PHE B CD1 1 
ATOM   4168  C  CD2 . PHE B 1 179 ? 65.876  24.903  42.154 1.00 29.07 ? 832  PHE B CD2 1 
ATOM   4169  C  CE1 . PHE B 1 179 ? 64.832  25.630  44.618 1.00 31.84 ? 832  PHE B CE1 1 
ATOM   4170  C  CE2 . PHE B 1 179 ? 65.036  26.023  42.256 1.00 27.89 ? 832  PHE B CE2 1 
ATOM   4171  C  CZ  . PHE B 1 179 ? 64.515  26.385  43.488 1.00 29.58 ? 832  PHE B CZ  1 
ATOM   4172  N  N   . LEU B 1 180 ? 65.778  21.795  40.532 1.00 33.33 ? 833  LEU B N   1 
ATOM   4173  C  CA  . LEU B 1 180 ? 65.000  22.006  39.331 1.00 31.91 ? 833  LEU B CA  1 
ATOM   4174  C  C   . LEU B 1 180 ? 63.928  20.947  39.229 1.00 33.78 ? 833  LEU B C   1 
ATOM   4175  O  O   . LEU B 1 180 ? 62.756  21.246  39.014 1.00 34.33 ? 833  LEU B O   1 
ATOM   4176  C  CB  . LEU B 1 180 ? 65.907  21.945  38.100 1.00 29.13 ? 833  LEU B CB  1 
ATOM   4177  C  CG  . LEU B 1 180 ? 66.808  23.172  37.903 1.00 29.19 ? 833  LEU B CG  1 
ATOM   4178  C  CD1 . LEU B 1 180 ? 67.761  22.960  36.749 1.00 24.46 ? 833  LEU B CD1 1 
ATOM   4179  C  CD2 . LEU B 1 180 ? 65.907  24.414  37.677 1.00 27.81 ? 833  LEU B CD2 1 
ATOM   4180  N  N   . VAL B 1 181 ? 64.333  19.700  39.397 1.00 34.76 ? 834  VAL B N   1 
ATOM   4181  C  CA  . VAL B 1 181 ? 63.388  18.605  39.314 1.00 35.86 ? 834  VAL B CA  1 
ATOM   4182  C  C   . VAL B 1 181 ? 62.300  18.700  40.378 1.00 39.22 ? 834  VAL B C   1 
ATOM   4183  O  O   . VAL B 1 181 ? 61.141  18.393  40.120 1.00 40.23 ? 834  VAL B O   1 
ATOM   4184  C  CB  . VAL B 1 181 ? 64.095  17.260  39.487 1.00 33.19 ? 834  VAL B CB  1 
ATOM   4185  C  CG1 . VAL B 1 181 ? 63.071  16.180  39.733 1.00 30.33 ? 834  VAL B CG1 1 
ATOM   4186  C  CG2 . VAL B 1 181 ? 64.930  16.947  38.262 1.00 31.01 ? 834  VAL B CG2 1 
ATOM   4187  N  N   . ALA B 1 182 ? 62.687  19.135  41.570 1.00 40.32 ? 835  ALA B N   1 
ATOM   4188  C  CA  . ALA B 1 182 ? 61.770  19.210  42.691 1.00 42.41 ? 835  ALA B CA  1 
ATOM   4189  C  C   . ALA B 1 182 ? 60.759  20.327  42.562 1.00 44.47 ? 835  ALA B C   1 
ATOM   4190  O  O   . ALA B 1 182 ? 59.591  20.140  42.858 1.00 46.35 ? 835  ALA B O   1 
ATOM   4191  C  CB  . ALA B 1 182 ? 62.552  19.343  43.995 1.00 42.01 ? 835  ALA B CB  1 
ATOM   4192  N  N   . THR B 1 183 ? 61.200  21.492  42.124 1.00 45.07 ? 836  THR B N   1 
ATOM   4193  C  CA  . THR B 1 183 ? 60.285  22.598  41.954 1.00 44.68 ? 836  THR B CA  1 
ATOM   4194  C  C   . THR B 1 183 ? 59.574  22.419  40.606 1.00 46.59 ? 836  THR B C   1 
ATOM   4195  O  O   . THR B 1 183 ? 58.830  23.295  40.153 1.00 45.06 ? 836  THR B O   1 
ATOM   4196  C  CB  . THR B 1 183 ? 61.047  23.935  41.962 1.00 44.81 ? 836  THR B CB  1 
ATOM   4197  O  OG1 . THR B 1 183 ? 62.018  23.932  40.908 1.00 42.27 ? 836  THR B OG1 1 
ATOM   4198  C  CG2 . THR B 1 183 ? 61.744  24.143  43.305 1.00 43.09 ? 836  THR B CG2 1 
ATOM   4199  N  N   . ASN B 1 184 ? 59.819  21.275  39.971 1.00 47.66 ? 837  ASN B N   1 
ATOM   4200  C  CA  . ASN B 1 184 ? 59.238  20.966  38.671 1.00 49.30 ? 837  ASN B CA  1 
ATOM   4201  C  C   . ASN B 1 184 ? 59.424  22.061  37.627 1.00 49.95 ? 837  ASN B C   1 
ATOM   4202  O  O   . ASN B 1 184 ? 58.536  22.338  36.827 1.00 50.92 ? 837  ASN B O   1 
ATOM   4203  C  CB  . ASN B 1 184 ? 57.755  20.630  38.819 1.00 51.56 ? 837  ASN B CB  1 
ATOM   4204  C  CG  . ASN B 1 184 ? 57.497  19.130  38.757 1.00 53.22 ? 837  ASN B CG  1 
ATOM   4205  O  OD1 . ASN B 1 184 ? 57.703  18.504  37.709 1.00 53.74 ? 837  ASN B OD1 1 
ATOM   4206  N  ND2 . ASN B 1 184 ? 57.067  18.539  39.886 1.00 53.38 ? 837  ASN B ND2 1 
ATOM   4207  N  N   . ALA B 1 185 ? 60.600  22.676  37.641 1.00 48.63 ? 838  ALA B N   1 
ATOM   4208  C  CA  . ALA B 1 185 ? 60.933  23.727  36.700 1.00 44.97 ? 838  ALA B CA  1 
ATOM   4209  C  C   . ALA B 1 185 ? 60.642  23.295  35.262 1.00 43.44 ? 838  ALA B C   1 
ATOM   4210  O  O   . ALA B 1 185 ? 60.773  22.117  34.907 1.00 42.02 ? 838  ALA B O   1 
ATOM   4211  C  CB  . ALA B 1 185 ? 62.392  24.081  36.841 1.00 42.20 ? 838  ALA B CB  1 
ATOM   4212  N  N   . PRO B 1 186 ? 60.247  24.257  34.413 1.00 43.02 ? 839  PRO B N   1 
ATOM   4213  C  CA  . PRO B 1 186 ? 59.952  23.937  33.015 1.00 41.91 ? 839  PRO B CA  1 
ATOM   4214  C  C   . PRO B 1 186 ? 61.072  23.176  32.345 1.00 40.01 ? 839  PRO B C   1 
ATOM   4215  O  O   . PRO B 1 186 ? 60.817  22.221  31.618 1.00 41.20 ? 839  PRO B O   1 
ATOM   4216  C  CB  . PRO B 1 186 ? 59.695  25.304  32.376 1.00 40.54 ? 839  PRO B CB  1 
ATOM   4217  C  CG  . PRO B 1 186 ? 60.171  26.288  33.388 1.00 43.56 ? 839  PRO B CG  1 
ATOM   4218  C  CD  . PRO B 1 186 ? 59.893  25.651  34.707 1.00 40.81 ? 839  PRO B CD  1 
ATOM   4219  N  N   . GLN B 1 187 ? 62.307  23.592  32.594 1.00 38.03 ? 840  GLN B N   1 
ATOM   4220  C  CA  . GLN B 1 187 ? 63.449  22.924  31.999 1.00 35.62 ? 840  GLN B CA  1 
ATOM   4221  C  C   . GLN B 1 187 ? 63.586  21.500  32.517 1.00 32.69 ? 840  GLN B C   1 
ATOM   4222  O  O   . GLN B 1 187 ? 64.102  20.647  31.822 1.00 30.06 ? 840  GLN B O   1 
ATOM   4223  C  CB  . GLN B 1 187 ? 64.734  23.686  32.296 1.00 39.95 ? 840  GLN B CB  1 
ATOM   4224  C  CG  . GLN B 1 187 ? 64.569  25.179  32.269 1.00 46.97 ? 840  GLN B CG  1 
ATOM   4225  C  CD  . GLN B 1 187 ? 65.904  25.900  32.119 1.00 51.60 ? 840  GLN B CD  1 
ATOM   4226  O  OE1 . GLN B 1 187 ? 66.721  25.944  33.056 1.00 53.10 ? 840  GLN B OE1 1 
ATOM   4227  N  NE2 . GLN B 1 187 ? 66.134  26.470  30.932 1.00 53.59 ? 840  GLN B NE2 1 
ATOM   4228  N  N   . ALA B 1 188 ? 63.129  21.239  33.733 1.00 29.88 ? 841  ALA B N   1 
ATOM   4229  C  CA  . ALA B 1 188 ? 63.233  19.891  34.260 1.00 31.96 ? 841  ALA B CA  1 
ATOM   4230  C  C   . ALA B 1 188 ? 62.286  18.969  33.473 1.00 32.59 ? 841  ALA B C   1 
ATOM   4231  O  O   . ALA B 1 188 ? 62.624  17.822  33.137 1.00 30.84 ? 841  ALA B O   1 
ATOM   4232  C  CB  . ALA B 1 188 ? 62.853  19.867  35.714 1.00 31.09 ? 841  ALA B CB  1 
ATOM   4233  N  N   . VAL B 1 189 ? 61.098  19.502  33.205 1.00 31.14 ? 842  VAL B N   1 
ATOM   4234  C  CA  . VAL B 1 189 ? 60.063  18.791  32.485 1.00 31.17 ? 842  VAL B CA  1 
ATOM   4235  C  C   . VAL B 1 189 ? 60.447  18.679  31.018 1.00 30.56 ? 842  VAL B C   1 
ATOM   4236  O  O   . VAL B 1 189 ? 60.135  17.699  30.370 1.00 28.57 ? 842  VAL B O   1 
ATOM   4237  C  CB  . VAL B 1 189 ? 58.697  19.541  32.625 1.00 32.67 ? 842  VAL B CB  1 
ATOM   4238  C  CG1 . VAL B 1 189 ? 57.688  19.013  31.623 1.00 28.38 ? 842  VAL B CG1 1 
ATOM   4239  C  CG2 . VAL B 1 189 ? 58.178  19.379  34.031 1.00 29.09 ? 842  VAL B CG2 1 
ATOM   4240  N  N   . LEU B 1 190 ? 61.163  19.688  30.531 1.00 29.44 ? 843  LEU B N   1 
ATOM   4241  C  CA  . LEU B 1 190 ? 61.573  19.741  29.138 1.00 28.94 ? 843  LEU B CA  1 
ATOM   4242  C  C   . LEU B 1 190 ? 62.643  18.695  28.805 1.00 28.79 ? 843  LEU B C   1 
ATOM   4243  O  O   . LEU B 1 190 ? 62.772  18.249  27.669 1.00 30.42 ? 843  LEU B O   1 
ATOM   4244  C  CB  . LEU B 1 190 ? 62.090  21.149  28.812 1.00 28.52 ? 843  LEU B CB  1 
ATOM   4245  C  CG  . LEU B 1 190 ? 62.507  21.441  27.364 1.00 29.11 ? 843  LEU B CG  1 
ATOM   4246  C  CD1 . LEU B 1 190 ? 61.262  21.481  26.537 1.00 27.11 ? 843  LEU B CD1 1 
ATOM   4247  C  CD2 . LEU B 1 190 ? 63.272  22.765  27.234 1.00 27.36 ? 843  LEU B CD2 1 
ATOM   4248  N  N   . TYR B 1 191 ? 63.394  18.291  29.807 1.00 27.33 ? 844  TYR B N   1 
ATOM   4249  C  CA  . TYR B 1 191 ? 64.439  17.310  29.608 1.00 28.60 ? 844  TYR B CA  1 
ATOM   4250  C  C   . TYR B 1 191 ? 64.148  16.002  30.305 1.00 28.88 ? 844  TYR B C   1 
ATOM   4251  O  O   . TYR B 1 191 ? 65.002  15.144  30.404 1.00 28.61 ? 844  TYR B O   1 
ATOM   4252  C  CB  . TYR B 1 191 ? 65.774  17.890  30.078 1.00 27.33 ? 844  TYR B CB  1 
ATOM   4253  C  CG  . TYR B 1 191 ? 66.306  18.886  29.084 1.00 27.21 ? 844  TYR B CG  1 
ATOM   4254  C  CD1 . TYR B 1 191 ? 66.468  20.230  29.420 1.00 24.18 ? 844  TYR B CD1 1 
ATOM   4255  C  CD2 . TYR B 1 191 ? 66.625  18.485  27.778 1.00 25.82 ? 844  TYR B CD2 1 
ATOM   4256  C  CE1 . TYR B 1 191 ? 66.941  21.147  28.494 1.00 23.23 ? 844  TYR B CE1 1 
ATOM   4257  C  CE2 . TYR B 1 191 ? 67.091  19.403  26.842 1.00 27.10 ? 844  TYR B CE2 1 
ATOM   4258  C  CZ  . TYR B 1 191 ? 67.252  20.728  27.216 1.00 26.70 ? 844  TYR B CZ  1 
ATOM   4259  O  OH  . TYR B 1 191 ? 67.756  21.601  26.304 1.00 28.51 ? 844  TYR B OH  1 
ATOM   4260  N  N   . ASN B 1 192 ? 62.933  15.861  30.806 1.00 29.58 ? 845  ASN B N   1 
ATOM   4261  C  CA  . ASN B 1 192 ? 62.567  14.622  31.466 1.00 29.60 ? 845  ASN B CA  1 
ATOM   4262  C  C   . ASN B 1 192 ? 63.418  14.243  32.663 1.00 30.28 ? 845  ASN B C   1 
ATOM   4263  O  O   . ASN B 1 192 ? 63.655  13.057  32.896 1.00 28.61 ? 845  ASN B O   1 
ATOM   4264  C  CB  . ASN B 1 192 ? 62.571  13.494  30.439 1.00 28.43 ? 845  ASN B CB  1 
ATOM   4265  C  CG  . ASN B 1 192 ? 61.554  13.726  29.405 1.00 23.82 ? 845  ASN B CG  1 
ATOM   4266  O  OD1 . ASN B 1 192 ? 60.404  13.954  29.739 1.00 25.43 ? 845  ASN B OD1 1 
ATOM   4267  N  ND2 . ASN B 1 192 ? 61.955  13.732  28.150 1.00 22.36 ? 845  ASN B ND2 1 
ATOM   4268  N  N   . ASP B 1 193 ? 63.836  15.276  33.406 1.00 28.74 ? 846  ASP B N   1 
ATOM   4269  C  CA  . ASP B 1 193 ? 64.622  15.156  34.613 1.00 28.00 ? 846  ASP B CA  1 
ATOM   4270  C  C   . ASP B 1 193 ? 66.023  14.591  34.432 1.00 28.24 ? 846  ASP B C   1 
ATOM   4271  O  O   . ASP B 1 193 ? 66.690  14.276  35.398 1.00 27.00 ? 846  ASP B O   1 
ATOM   4272  C  CB  . ASP B 1 193 ? 63.887  14.294  35.641 1.00 29.97 ? 846  ASP B CB  1 
ATOM   4273  C  CG  . ASP B 1 193 ? 62.547  14.855  36.044 1.00 32.77 ? 846  ASP B CG  1 
ATOM   4274  O  OD1 . ASP B 1 193 ? 62.264  16.063  35.796 1.00 35.34 ? 846  ASP B OD1 1 
ATOM   4275  O  OD2 . ASP B 1 193 ? 61.762  14.074  36.634 1.00 33.36 ? 846  ASP B OD2 1 
ATOM   4276  N  N   . ARG B 1 194 ? 66.461  14.466  33.192 1.00 28.75 ? 847  ARG B N   1 
ATOM   4277  C  CA  . ARG B 1 194 ? 67.769  13.911  32.891 1.00 28.96 ? 847  ARG B CA  1 
ATOM   4278  C  C   . ARG B 1 194 ? 68.842  14.961  32.595 1.00 27.81 ? 847  ARG B C   1 
ATOM   4279  O  O   . ARG B 1 194 ? 68.730  15.678  31.600 1.00 27.68 ? 847  ARG B O   1 
ATOM   4280  C  CB  . ARG B 1 194 ? 67.657  13.014  31.661 1.00 30.60 ? 847  ARG B CB  1 
ATOM   4281  C  CG  . ARG B 1 194 ? 66.816  11.775  31.816 1.00 33.69 ? 847  ARG B CG  1 
ATOM   4282  C  CD  . ARG B 1 194 ? 66.994  11.030  30.541 1.00 38.05 ? 847  ARG B CD  1 
ATOM   4283  N  NE  . ARG B 1 194 ? 66.634  9.634   30.614 1.00 42.06 ? 847  ARG B NE  1 
ATOM   4284  C  CZ  . ARG B 1 194 ? 66.814  8.798   29.597 1.00 46.11 ? 847  ARG B CZ  1 
ATOM   4285  N  NH1 . ARG B 1 194 ? 67.357  9.258   28.468 1.00 46.59 ? 847  ARG B NH1 1 
ATOM   4286  N  NH2 . ARG B 1 194 ? 66.414  7.528   29.680 1.00 46.50 ? 847  ARG B NH2 1 
ATOM   4287  N  N   . SER B 1 195 ? 69.905  15.008  33.398 1.00 26.91 ? 848  SER B N   1 
ATOM   4288  C  CA  . SER B 1 195 ? 70.984  15.996  33.208 1.00 24.30 ? 848  SER B CA  1 
ATOM   4289  C  C   . SER B 1 195 ? 70.404  17.339  32.708 1.00 25.56 ? 848  SER B C   1 
ATOM   4290  O  O   . SER B 1 195 ? 70.885  17.930  31.729 1.00 24.56 ? 848  SER B O   1 
ATOM   4291  C  CB  . SER B 1 195 ? 72.013  15.480  32.197 1.00 25.21 ? 848  SER B CB  1 
ATOM   4292  O  OG  . SER B 1 195 ? 72.627  14.277  32.645 1.00 29.14 ? 848  SER B OG  1 
ATOM   4293  N  N   . VAL B 1 196 ? 69.367  17.805  33.395 1.00 24.24 ? 849  VAL B N   1 
ATOM   4294  C  CA  . VAL B 1 196 ? 68.659  19.028  33.049 1.00 23.33 ? 849  VAL B CA  1 
ATOM   4295  C  C   . VAL B 1 196 ? 69.576  20.166  32.646 1.00 25.51 ? 849  VAL B C   1 
ATOM   4296  O  O   . VAL B 1 196 ? 69.588  20.601  31.495 1.00 24.28 ? 849  VAL B O   1 
ATOM   4297  C  CB  . VAL B 1 196 ? 67.799  19.444  34.244 1.00 26.18 ? 849  VAL B CB  1 
ATOM   4298  C  CG1 . VAL B 1 196 ? 66.899  20.628  33.890 1.00 24.33 ? 849  VAL B CG1 1 
ATOM   4299  C  CG2 . VAL B 1 196 ? 66.980  18.256  34.684 1.00 27.95 ? 849  VAL B CG2 1 
ATOM   4300  N  N   . LEU B 1 197 ? 70.363  20.625  33.613 1.00 24.90 ? 850  LEU B N   1 
ATOM   4301  C  CA  . LEU B 1 197 ? 71.290  21.724  33.406 1.00 26.03 ? 850  LEU B CA  1 
ATOM   4302  C  C   . LEU B 1 197 ? 72.269  21.534  32.292 1.00 26.68 ? 850  LEU B C   1 
ATOM   4303  O  O   . LEU B 1 197 ? 72.415  22.402  31.434 1.00 27.41 ? 850  LEU B O   1 
ATOM   4304  C  CB  . LEU B 1 197 ? 72.070  21.995  34.667 1.00 26.80 ? 850  LEU B CB  1 
ATOM   4305  C  CG  . LEU B 1 197 ? 71.254  22.726  35.694 1.00 27.43 ? 850  LEU B CG  1 
ATOM   4306  C  CD1 . LEU B 1 197 ? 71.994  22.760  37.050 1.00 29.57 ? 850  LEU B CD1 1 
ATOM   4307  C  CD2 . LEU B 1 197 ? 70.989  24.105  35.134 1.00 29.89 ? 850  LEU B CD2 1 
ATOM   4308  N  N   . GLU B 1 198 ? 72.952  20.402  32.312 1.00 24.78 ? 851  GLU B N   1 
ATOM   4309  C  CA  . GLU B 1 198 ? 73.940  20.113  31.295 1.00 25.69 ? 851  GLU B CA  1 
ATOM   4310  C  C   . GLU B 1 198 ? 73.351  20.064  29.904 1.00 26.29 ? 851  GLU B C   1 
ATOM   4311  O  O   . GLU B 1 198 ? 73.952  20.566  28.954 1.00 26.63 ? 851  GLU B O   1 
ATOM   4312  C  CB  . GLU B 1 198 ? 74.655  18.801  31.639 1.00 28.88 ? 851  GLU B CB  1 
ATOM   4313  C  CG  . GLU B 1 198 ? 75.471  18.832  32.981 1.00 28.28 ? 851  GLU B CG  1 
ATOM   4314  C  CD  . GLU B 1 198 ? 74.598  18.864  34.214 1.00 30.94 ? 851  GLU B CD  1 
ATOM   4315  O  OE1 . GLU B 1 198 ? 73.478  18.281  34.195 1.00 32.43 ? 851  GLU B OE1 1 
ATOM   4316  O  OE2 . GLU B 1 198 ? 75.042  19.450  35.224 1.00 31.77 ? 851  GLU B OE2 1 
ATOM   4317  N  N   . ASN B 1 199 ? 72.180  19.443  29.763 1.00 27.77 ? 852  ASN B N   1 
ATOM   4318  C  CA  . ASN B 1 199 ? 71.557  19.417  28.459 1.00 26.49 ? 852  ASN B CA  1 
ATOM   4319  C  C   . ASN B 1 199 ? 71.283  20.830  27.997 1.00 28.58 ? 852  ASN B C   1 
ATOM   4320  O  O   . ASN B 1 199 ? 71.466  21.149  26.820 1.00 27.04 ? 852  ASN B O   1 
ATOM   4321  C  CB  . ASN B 1 199 ? 70.238  18.647  28.491 1.00 27.79 ? 852  ASN B CB  1 
ATOM   4322  C  CG  . ASN B 1 199 ? 70.406  17.244  28.020 1.00 22.52 ? 852  ASN B CG  1 
ATOM   4323  O  OD1 . ASN B 1 199 ? 70.857  17.014  26.899 1.00 21.82 ? 852  ASN B OD1 1 
ATOM   4324  N  ND2 . ASN B 1 199 ? 70.057  16.290  28.871 1.00 22.64 ? 852  ASN B ND2 1 
ATOM   4325  N  N   . HIS B 1 200 ? 70.829  21.667  28.933 1.00 29.29 ? 853  HIS B N   1 
ATOM   4326  C  CA  . HIS B 1 200 ? 70.493  23.062  28.635 1.00 30.82 ? 853  HIS B CA  1 
ATOM   4327  C  C   . HIS B 1 200 ? 71.741  23.881  28.322 1.00 31.96 ? 853  HIS B C   1 
ATOM   4328  O  O   . HIS B 1 200 ? 71.703  24.748  27.450 1.00 32.45 ? 853  HIS B O   1 
ATOM   4329  C  CB  . HIS B 1 200 ? 69.726  23.702  29.811 1.00 34.17 ? 853  HIS B CB  1 
ATOM   4330  C  CG  . HIS B 1 200 ? 69.513  25.182  29.661 1.00 35.86 ? 853  HIS B CG  1 
ATOM   4331  N  ND1 . HIS B 1 200 ? 68.569  25.719  28.810 1.00 33.84 ? 853  HIS B ND1 1 
ATOM   4332  C  CD2 . HIS B 1 200 ? 70.197  26.233  30.178 1.00 33.49 ? 853  HIS B CD2 1 
ATOM   4333  C  CE1 . HIS B 1 200 ? 68.686  27.033  28.805 1.00 33.68 ? 853  HIS B CE1 1 
ATOM   4334  N  NE2 . HIS B 1 200 ? 69.667  27.370  29.624 1.00 32.97 ? 853  HIS B NE2 1 
ATOM   4335  N  N   . HIS B 1 201 ? 72.857  23.610  29.003 1.00 31.02 ? 854  HIS B N   1 
ATOM   4336  C  CA  . HIS B 1 201 ? 74.066  24.391  28.720 1.00 30.63 ? 854  HIS B CA  1 
ATOM   4337  C  C   . HIS B 1 201 ? 74.494  24.136  27.278 1.00 31.01 ? 854  HIS B C   1 
ATOM   4338  O  O   . HIS B 1 201 ? 74.837  25.058  26.545 1.00 30.69 ? 854  HIS B O   1 
ATOM   4339  C  CB  . HIS B 1 201 ? 75.250  24.024  29.641 1.00 28.65 ? 854  HIS B CB  1 
ATOM   4340  C  CG  . HIS B 1 201 ? 74.978  24.176  31.109 1.00 29.54 ? 854  HIS B CG  1 
ATOM   4341  N  ND1 . HIS B 1 201 ? 74.301  25.255  31.648 1.00 26.89 ? 854  HIS B ND1 1 
ATOM   4342  C  CD2 . HIS B 1 201 ? 75.305  23.371  32.152 1.00 26.48 ? 854  HIS B CD2 1 
ATOM   4343  C  CE1 . HIS B 1 201 ? 74.222  25.101  32.958 1.00 27.62 ? 854  HIS B CE1 1 
ATOM   4344  N  NE2 . HIS B 1 201 ? 74.825  23.969  33.289 1.00 26.08 ? 854  HIS B NE2 1 
ATOM   4345  N  N   . ALA B 1 202 ? 74.456  22.870  26.878 1.00 32.25 ? 855  ALA B N   1 
ATOM   4346  C  CA  . ALA B 1 202 ? 74.858  22.488  25.537 1.00 30.68 ? 855  ALA B CA  1 
ATOM   4347  C  C   . ALA B 1 202 ? 73.828  22.898  24.470 1.00 30.27 ? 855  ALA B C   1 
ATOM   4348  O  O   . ALA B 1 202 ? 74.198  23.362  23.416 1.00 30.01 ? 855  ALA B O   1 
ATOM   4349  C  CB  . ALA B 1 202 ? 75.124  21.009  25.489 1.00 27.74 ? 855  ALA B CB  1 
ATOM   4350  N  N   . ALA B 1 203 ? 72.547  22.729  24.754 1.00 30.35 ? 856  ALA B N   1 
ATOM   4351  C  CA  . ALA B 1 203 ? 71.527  23.109  23.799 1.00 30.98 ? 856  ALA B CA  1 
ATOM   4352  C  C   . ALA B 1 203 ? 71.487  24.645  23.575 1.00 30.92 ? 856  ALA B C   1 
ATOM   4353  O  O   . ALA B 1 203 ? 71.366  25.113  22.455 1.00 29.77 ? 856  ALA B O   1 
ATOM   4354  C  CB  . ALA B 1 203 ? 70.181  22.605  24.267 1.00 31.04 ? 856  ALA B CB  1 
ATOM   4355  N  N   . SER B 1 204 ? 71.575  25.417  24.645 1.00 31.81 ? 857  SER B N   1 
ATOM   4356  C  CA  . SER B 1 204 ? 71.580  26.875  24.536 1.00 34.00 ? 857  SER B CA  1 
ATOM   4357  C  C   . SER B 1 204 ? 72.785  27.426  23.792 1.00 33.43 ? 857  SER B C   1 
ATOM   4358  O  O   . SER B 1 204 ? 72.660  28.369  22.993 1.00 34.18 ? 857  SER B O   1 
ATOM   4359  C  CB  . SER B 1 204 ? 71.566  27.515  25.919 1.00 33.36 ? 857  SER B CB  1 
ATOM   4360  O  OG  . SER B 1 204 ? 70.259  27.562  26.417 1.00 39.25 ? 857  SER B OG  1 
ATOM   4361  N  N   . ALA B 1 205 ? 73.947  26.843  24.066 1.00 32.12 ? 858  ALA B N   1 
ATOM   4362  C  CA  . ALA B 1 205 ? 75.179  27.310  23.456 1.00 31.38 ? 858  ALA B CA  1 
ATOM   4363  C  C   . ALA B 1 205 ? 75.268  26.957  22.004 1.00 29.86 ? 858  ALA B C   1 
ATOM   4364  O  O   . ALA B 1 205 ? 75.909  27.676  21.247 1.00 31.92 ? 858  ALA B O   1 
ATOM   4365  C  CB  . ALA B 1 205 ? 76.407  26.777  24.225 1.00 31.15 ? 858  ALA B CB  1 
ATOM   4366  N  N   . TRP B 1 206 ? 74.665  25.854  21.586 1.00 30.23 ? 859  TRP B N   1 
ATOM   4367  C  CA  . TRP B 1 206 ? 74.712  25.537  20.153 1.00 30.81 ? 859  TRP B CA  1 
ATOM   4368  C  C   . TRP B 1 206 ? 73.646  26.370  19.439 1.00 30.16 ? 859  TRP B C   1 
ATOM   4369  O  O   . TRP B 1 206 ? 73.850  26.811  18.320 1.00 28.86 ? 859  TRP B O   1 
ATOM   4370  C  CB  . TRP B 1 206 ? 74.520  24.038  19.901 1.00 31.30 ? 859  TRP B CB  1 
ATOM   4371  C  CG  . TRP B 1 206 ? 75.804  23.286  19.987 1.00 30.72 ? 859  TRP B CG  1 
ATOM   4372  C  CD1 . TRP B 1 206 ? 76.186  22.405  20.961 1.00 29.26 ? 859  TRP B CD1 1 
ATOM   4373  C  CD2 . TRP B 1 206 ? 76.921  23.422  19.122 1.00 31.46 ? 859  TRP B CD2 1 
ATOM   4374  N  NE1 . TRP B 1 206 ? 77.471  21.997  20.756 1.00 29.57 ? 859  TRP B NE1 1 
ATOM   4375  C  CE2 . TRP B 1 206 ? 77.954  22.614  19.635 1.00 30.13 ? 859  TRP B CE2 1 
ATOM   4376  C  CE3 . TRP B 1 206 ? 77.159  24.170  17.966 1.00 32.60 ? 859  TRP B CE3 1 
ATOM   4377  C  CZ2 . TRP B 1 206 ? 79.200  22.512  19.024 1.00 32.54 ? 859  TRP B CZ2 1 
ATOM   4378  C  CZ3 . TRP B 1 206 ? 78.395  24.071  17.353 1.00 31.37 ? 859  TRP B CZ3 1 
ATOM   4379  C  CH2 . TRP B 1 206 ? 79.405  23.252  17.885 1.00 33.35 ? 859  TRP B CH2 1 
ATOM   4380  N  N   . ASN B 1 207 ? 72.525  26.614  20.108 1.00 32.92 ? 860  ASN B N   1 
ATOM   4381  C  CA  . ASN B 1 207 ? 71.482  27.430  19.521 1.00 35.18 ? 860  ASN B CA  1 
ATOM   4382  C  C   . ASN B 1 207 ? 72.111  28.787  19.276 1.00 36.31 ? 860  ASN B C   1 
ATOM   4383  O  O   . ASN B 1 207 ? 72.025  29.325  18.172 1.00 37.77 ? 860  ASN B O   1 
ATOM   4384  C  CB  . ASN B 1 207 ? 70.276  27.551  20.454 1.00 36.60 ? 860  ASN B CB  1 
ATOM   4385  C  CG  . ASN B 1 207 ? 69.166  28.412  19.857 1.00 40.65 ? 860  ASN B CG  1 
ATOM   4386  O  OD1 . ASN B 1 207 ? 68.867  28.315  18.674 1.00 42.77 ? 860  ASN B OD1 1 
ATOM   4387  N  ND2 . ASN B 1 207 ? 68.554  29.254  20.679 1.00 42.85 ? 860  ASN B ND2 1 
ATOM   4388  N  N   . LEU B 1 208 ? 72.776  29.338  20.290 1.00 36.92 ? 861  LEU B N   1 
ATOM   4389  C  CA  . LEU B 1 208 ? 73.436  30.643  20.126 1.00 36.32 ? 861  LEU B CA  1 
ATOM   4390  C  C   . LEU B 1 208 ? 74.357  30.603  18.904 1.00 35.93 ? 861  LEU B C   1 
ATOM   4391  O  O   . LEU B 1 208 ? 74.175  31.349  17.953 1.00 36.41 ? 861  LEU B O   1 
ATOM   4392  C  CB  . LEU B 1 208 ? 74.250  30.990  21.373 1.00 35.15 ? 861  LEU B CB  1 
ATOM   4393  C  CG  . LEU B 1 208 ? 75.098  32.262  21.318 1.00 35.51 ? 861  LEU B CG  1 
ATOM   4394  C  CD1 . LEU B 1 208 ? 74.180  33.455  21.151 1.00 36.07 ? 861  LEU B CD1 1 
ATOM   4395  C  CD2 . LEU B 1 208 ? 75.937  32.391  22.582 1.00 33.28 ? 861  LEU B CD2 1 
ATOM   4396  N  N   . TYR B 1 209 ? 75.345  29.720  18.938 1.00 35.79 ? 862  TYR B N   1 
ATOM   4397  C  CA  . TYR B 1 209 ? 76.255  29.577  17.825 1.00 35.71 ? 862  TYR B CA  1 
ATOM   4398  C  C   . TYR B 1 209 ? 75.587  29.625  16.444 1.00 37.76 ? 862  TYR B C   1 
ATOM   4399  O  O   . TYR B 1 209 ? 76.075  30.300  15.532 1.00 36.55 ? 862  TYR B O   1 
ATOM   4400  C  CB  . TYR B 1 209 ? 77.009  28.259  17.923 1.00 33.78 ? 862  TYR B CB  1 
ATOM   4401  C  CG  . TYR B 1 209 ? 77.974  28.044  16.777 1.00 32.34 ? 862  TYR B CG  1 
ATOM   4402  C  CD1 . TYR B 1 209 ? 79.242  28.607  16.803 1.00 33.20 ? 862  TYR B CD1 1 
ATOM   4403  C  CD2 . TYR B 1 209 ? 77.605  27.320  15.655 1.00 32.07 ? 862  TYR B CD2 1 
ATOM   4404  C  CE1 . TYR B 1 209 ? 80.123  28.456  15.738 1.00 35.64 ? 862  TYR B CE1 1 
ATOM   4405  C  CE2 . TYR B 1 209 ? 78.477  27.166  14.584 1.00 35.76 ? 862  TYR B CE2 1 
ATOM   4406  C  CZ  . TYR B 1 209 ? 79.740  27.737  14.630 1.00 35.29 ? 862  TYR B CZ  1 
ATOM   4407  O  OH  . TYR B 1 209 ? 80.621  27.567  13.588 1.00 36.96 ? 862  TYR B OH  1 
ATOM   4408  N  N   . LEU B 1 210 ? 74.480  28.901  16.283 1.00 38.08 ? 863  LEU B N   1 
ATOM   4409  C  CA  . LEU B 1 210 ? 73.808  28.841  14.983 1.00 38.62 ? 863  LEU B CA  1 
ATOM   4410  C  C   . LEU B 1 210 ? 72.864  30.006  14.682 1.00 39.45 ? 863  LEU B C   1 
ATOM   4411  O  O   . LEU B 1 210 ? 72.503  30.220  13.534 1.00 40.02 ? 863  LEU B O   1 
ATOM   4412  C  CB  . LEU B 1 210 ? 73.026  27.519  14.866 1.00 35.75 ? 863  LEU B CB  1 
ATOM   4413  C  CG  . LEU B 1 210 ? 73.767  26.197  15.115 1.00 35.87 ? 863  LEU B CG  1 
ATOM   4414  C  CD1 . LEU B 1 210 ? 72.773  25.069  15.410 1.00 32.27 ? 863  LEU B CD1 1 
ATOM   4415  C  CD2 . LEU B 1 210 ? 74.625  25.856  13.924 1.00 32.17 ? 863  LEU B CD2 1 
ATOM   4416  N  N   . SER B 1 211 ? 72.475  30.749  15.711 1.00 39.90 ? 864  SER B N   1 
ATOM   4417  C  CA  . SER B 1 211 ? 71.541  31.866  15.564 1.00 40.38 ? 864  SER B CA  1 
ATOM   4418  C  C   . SER B 1 211 ? 71.974  32.953  14.576 1.00 43.97 ? 864  SER B C   1 
ATOM   4419  O  O   . SER B 1 211 ? 71.126  33.619  13.985 1.00 44.61 ? 864  SER B O   1 
ATOM   4420  C  CB  . SER B 1 211 ? 71.285  32.534  16.922 1.00 37.61 ? 864  SER B CB  1 
ATOM   4421  O  OG  . SER B 1 211 ? 72.369  33.402  17.293 1.00 35.71 ? 864  SER B OG  1 
ATOM   4422  N  N   . ARG B 1 212 ? 73.282  33.147  14.409 1.00 46.62 ? 865  ARG B N   1 
ATOM   4423  C  CA  . ARG B 1 212 ? 73.775  34.187  13.525 1.00 47.56 ? 865  ARG B CA  1 
ATOM   4424  C  C   . ARG B 1 212 ? 74.990  33.728  12.775 1.00 48.46 ? 865  ARG B C   1 
ATOM   4425  O  O   . ARG B 1 212 ? 75.813  33.007  13.308 1.00 49.93 ? 865  ARG B O   1 
ATOM   4426  C  CB  . ARG B 1 212 ? 74.124  35.414  14.339 1.00 50.30 ? 865  ARG B CB  1 
ATOM   4427  C  CG  . ARG B 1 212 ? 72.963  35.994  15.113 1.00 53.46 ? 865  ARG B CG  1 
ATOM   4428  C  CD  . ARG B 1 212 ? 73.419  37.235  15.886 1.00 57.72 ? 865  ARG B CD  1 
ATOM   4429  N  NE  . ARG B 1 212 ? 72.300  38.100  16.282 1.00 63.39 ? 865  ARG B NE  1 
ATOM   4430  C  CZ  . ARG B 1 212 ? 71.268  37.716  17.036 1.00 66.21 ? 865  ARG B CZ  1 
ATOM   4431  N  NH1 . ARG B 1 212 ? 71.194  36.465  17.485 1.00 67.97 ? 865  ARG B NH1 1 
ATOM   4432  N  NH2 . ARG B 1 212 ? 70.313  38.591  17.365 1.00 67.81 ? 865  ARG B NH2 1 
ATOM   4433  N  N   . PRO B 1 213 ? 75.127  34.151  11.514 1.00 49.03 ? 866  PRO B N   1 
ATOM   4434  C  CA  . PRO B 1 213 ? 76.275  33.761  10.693 1.00 49.13 ? 866  PRO B CA  1 
ATOM   4435  C  C   . PRO B 1 213 ? 77.575  34.418  11.122 1.00 49.14 ? 866  PRO B C   1 
ATOM   4436  O  O   . PRO B 1 213 ? 78.648  33.858  10.908 1.00 50.01 ? 866  PRO B O   1 
ATOM   4437  C  CB  . PRO B 1 213 ? 75.849  34.168  9.291  1.00 48.27 ? 866  PRO B CB  1 
ATOM   4438  C  CG  . PRO B 1 213 ? 75.090  35.433  9.568  1.00 50.49 ? 866  PRO B CG  1 
ATOM   4439  C  CD  . PRO B 1 213 ? 74.235  35.058  10.768 1.00 49.98 ? 866  PRO B CD  1 
ATOM   4440  N  N   . GLU B 1 214 ? 77.507  35.592  11.736 1.00 49.59 ? 867  GLU B N   1 
ATOM   4441  C  CA  . GLU B 1 214 ? 78.749  36.221  12.169 1.00 50.33 ? 867  GLU B CA  1 
ATOM   4442  C  C   . GLU B 1 214 ? 79.360  35.514  13.375 1.00 49.25 ? 867  GLU B C   1 
ATOM   4443  O  O   . GLU B 1 214 ? 80.291  36.031  13.982 1.00 50.22 ? 867  GLU B O   1 
ATOM   4444  C  CB  . GLU B 1 214 ? 78.566  37.716  12.485 1.00 52.12 ? 867  GLU B CB  1 
ATOM   4445  C  CG  . GLU B 1 214 ? 77.593  38.041  13.601 1.00 56.13 ? 867  GLU B CG  1 
ATOM   4446  C  CD  . GLU B 1 214 ? 76.165  38.195  13.096 1.00 56.24 ? 867  GLU B CD  1 
ATOM   4447  O  OE1 . GLU B 1 214 ? 75.894  37.839  11.925 1.00 56.95 ? 867  GLU B OE1 1 
ATOM   4448  O  OE2 . GLU B 1 214 ? 75.319  38.666  13.884 1.00 58.89 ? 867  GLU B OE2 1 
ATOM   4449  N  N   . TYR B 1 215 ? 78.839  34.338  13.714 1.00 48.27 ? 868  TYR B N   1 
ATOM   4450  C  CA  . TYR B 1 215 ? 79.363  33.557  14.837 1.00 47.60 ? 868  TYR B CA  1 
ATOM   4451  C  C   . TYR B 1 215 ? 80.055  32.290  14.322 1.00 47.99 ? 868  TYR B C   1 
ATOM   4452  O  O   . TYR B 1 215 ? 80.773  31.607  15.065 1.00 47.07 ? 868  TYR B O   1 
ATOM   4453  C  CB  . TYR B 1 215 ? 78.236  33.113  15.772 1.00 45.36 ? 868  TYR B CB  1 
ATOM   4454  C  CG  . TYR B 1 215 ? 77.605  34.177  16.628 1.00 44.19 ? 868  TYR B CG  1 
ATOM   4455  C  CD1 . TYR B 1 215 ? 76.362  33.951  17.229 1.00 42.24 ? 868  TYR B CD1 1 
ATOM   4456  C  CD2 . TYR B 1 215 ? 78.246  35.407  16.859 1.00 43.43 ? 868  TYR B CD2 1 
ATOM   4457  C  CE1 . TYR B 1 215 ? 75.767  34.918  18.033 1.00 43.53 ? 868  TYR B CE1 1 
ATOM   4458  C  CE2 . TYR B 1 215 ? 77.661  36.376  17.662 1.00 42.26 ? 868  TYR B CE2 1 
ATOM   4459  C  CZ  . TYR B 1 215 ? 76.423  36.129  18.248 1.00 43.24 ? 868  TYR B CZ  1 
ATOM   4460  O  OH  . TYR B 1 215 ? 75.829  37.078  19.053 1.00 43.96 ? 868  TYR B OH  1 
ATOM   4461  N  N   . ASN B 1 216 ? 79.820  31.997  13.042 1.00 48.20 ? 869  ASN B N   1 
ATOM   4462  C  CA  . ASN B 1 216 ? 80.321  30.802  12.362 1.00 47.33 ? 869  ASN B CA  1 
ATOM   4463  C  C   . ASN B 1 216 ? 81.826  30.732  12.151 1.00 46.17 ? 869  ASN B C   1 
ATOM   4464  O  O   . ASN B 1 216 ? 82.303  30.757  11.016 1.00 46.32 ? 869  ASN B O   1 
ATOM   4465  C  CB  . ASN B 1 216 ? 79.597  30.682  11.020 1.00 48.44 ? 869  ASN B CB  1 
ATOM   4466  C  CG  . ASN B 1 216 ? 79.816  29.337  10.339 1.00 49.61 ? 869  ASN B CG  1 
ATOM   4467  O  OD1 . ASN B 1 216 ? 79.911  29.277  9.107  1.00 50.58 ? 869  ASN B OD1 1 
ATOM   4468  N  ND2 . ASN B 1 216 ? 79.879  28.254  11.124 1.00 49.40 ? 869  ASN B ND2 1 
ATOM   4469  N  N   . PHE B 1 217 ? 82.585  30.602  13.236 1.00 44.37 ? 870  PHE B N   1 
ATOM   4470  C  CA  . PHE B 1 217 ? 84.038  30.560  13.101 1.00 44.02 ? 870  PHE B CA  1 
ATOM   4471  C  C   . PHE B 1 217 ? 84.545  29.213  12.641 1.00 43.78 ? 870  PHE B C   1 
ATOM   4472  O  O   . PHE B 1 217 ? 85.728  29.034  12.397 1.00 45.72 ? 870  PHE B O   1 
ATOM   4473  C  CB  . PHE B 1 217 ? 84.724  30.977  14.419 1.00 40.46 ? 870  PHE B CB  1 
ATOM   4474  C  CG  . PHE B 1 217 ? 84.528  30.011  15.569 1.00 39.29 ? 870  PHE B CG  1 
ATOM   4475  C  CD1 . PHE B 1 217 ? 85.468  29.007  15.823 1.00 37.09 ? 870  PHE B CD1 1 
ATOM   4476  C  CD2 . PHE B 1 217 ? 83.433  30.133  16.431 1.00 35.61 ? 870  PHE B CD2 1 
ATOM   4477  C  CE1 . PHE B 1 217 ? 85.328  28.146  16.914 1.00 34.62 ? 870  PHE B CE1 1 
ATOM   4478  C  CE2 . PHE B 1 217 ? 83.293  29.270  17.523 1.00 37.08 ? 870  PHE B CE2 1 
ATOM   4479  C  CZ  . PHE B 1 217 ? 84.243  28.275  17.765 1.00 33.20 ? 870  PHE B CZ  1 
ATOM   4480  N  N   . LEU B 1 218 ? 83.634  28.269  12.501 1.00 44.18 ? 871  LEU B N   1 
ATOM   4481  C  CA  . LEU B 1 218 ? 84.002  26.931  12.095 1.00 44.40 ? 871  LEU B CA  1 
ATOM   4482  C  C   . LEU B 1 218 ? 83.674  26.651  10.626 1.00 44.51 ? 871  LEU B C   1 
ATOM   4483  O  O   . LEU B 1 218 ? 83.704  25.504  10.190 1.00 43.56 ? 871  LEU B O   1 
ATOM   4484  C  CB  . LEU B 1 218 ? 83.282  25.938  13.005 1.00 44.84 ? 871  LEU B CB  1 
ATOM   4485  C  CG  . LEU B 1 218 ? 83.824  25.912  14.445 1.00 44.34 ? 871  LEU B CG  1 
ATOM   4486  C  CD1 . LEU B 1 218 ? 82.909  25.101  15.341 1.00 43.42 ? 871  LEU B CD1 1 
ATOM   4487  C  CD2 . LEU B 1 218 ? 85.220  25.312  14.441 1.00 43.80 ? 871  LEU B CD2 1 
ATOM   4488  N  N   . LEU B 1 219 ? 83.386  27.709  9.871  1.00 44.54 ? 872  LEU B N   1 
ATOM   4489  C  CA  . LEU B 1 219 ? 83.036  27.590  8.467  1.00 43.69 ? 872  LEU B CA  1 
ATOM   4490  C  C   . LEU B 1 219 ? 84.048  26.847  7.623  1.00 43.91 ? 872  LEU B C   1 
ATOM   4491  O  O   . LEU B 1 219 ? 83.741  26.476  6.508  1.00 45.16 ? 872  LEU B O   1 
ATOM   4492  C  CB  . LEU B 1 219 ? 82.796  28.967  7.840  1.00 43.06 ? 872  LEU B CB  1 
ATOM   4493  C  CG  . LEU B 1 219 ? 83.999  29.836  7.433  1.00 41.69 ? 872  LEU B CG  1 
ATOM   4494  C  CD1 . LEU B 1 219 ? 83.472  31.157  6.954  1.00 41.16 ? 872  LEU B CD1 1 
ATOM   4495  C  CD2 . LEU B 1 219 ? 84.959  30.044  8.605  1.00 41.11 ? 872  LEU B CD2 1 
ATOM   4496  N  N   . HIS B 1 220 ? 85.251  26.614  8.121  1.00 44.65 ? 873  HIS B N   1 
ATOM   4497  C  CA  . HIS B 1 220 ? 86.220  25.896  7.300  1.00 44.32 ? 873  HIS B CA  1 
ATOM   4498  C  C   . HIS B 1 220 ? 86.386  24.424  7.596  1.00 43.18 ? 873  HIS B C   1 
ATOM   4499  O  O   . HIS B 1 220 ? 87.288  23.771  7.080  1.00 43.75 ? 873  HIS B O   1 
ATOM   4500  C  CB  . HIS B 1 220 ? 87.563  26.619  7.314  1.00 46.32 ? 873  HIS B CB  1 
ATOM   4501  C  CG  . HIS B 1 220 ? 87.521  27.915  6.576  1.00 49.13 ? 873  HIS B CG  1 
ATOM   4502  N  ND1 . HIS B 1 220 ? 88.117  29.062  7.052  1.00 50.79 ? 873  HIS B ND1 1 
ATOM   4503  C  CD2 . HIS B 1 220 ? 86.892  28.264  5.427  1.00 49.88 ? 873  HIS B CD2 1 
ATOM   4504  C  CE1 . HIS B 1 220 ? 87.852  30.065  6.230  1.00 51.01 ? 873  HIS B CE1 1 
ATOM   4505  N  NE2 . HIS B 1 220 ? 87.110  29.607  5.237  1.00 50.77 ? 873  HIS B NE2 1 
ATOM   4506  N  N   . LEU B 1 221 ? 85.505  23.907  8.435  1.00 42.42 ? 874  LEU B N   1 
ATOM   4507  C  CA  . LEU B 1 221 ? 85.474  22.491  8.752  1.00 40.19 ? 874  LEU B CA  1 
ATOM   4508  C  C   . LEU B 1 221 ? 84.435  21.939  7.768  1.00 39.28 ? 874  LEU B C   1 
ATOM   4509  O  O   . LEU B 1 221 ? 83.476  22.642  7.420  1.00 40.07 ? 874  LEU B O   1 
ATOM   4510  C  CB  . LEU B 1 221 ? 84.966  22.279  10.177 1.00 40.95 ? 874  LEU B CB  1 
ATOM   4511  C  CG  . LEU B 1 221 ? 85.997  22.357  11.309 1.00 41.93 ? 874  LEU B CG  1 
ATOM   4512  C  CD1 . LEU B 1 221 ? 85.324  22.103  12.636 1.00 40.12 ? 874  LEU B CD1 1 
ATOM   4513  C  CD2 . LEU B 1 221 ? 87.066  21.306  11.085 1.00 42.86 ? 874  LEU B CD2 1 
ATOM   4514  N  N   . ASP B 1 222 ? 84.611  20.719  7.285  1.00 37.68 ? 875  ASP B N   1 
ATOM   4515  C  CA  . ASP B 1 222 ? 83.591  20.188  6.393  1.00 38.93 ? 875  ASP B CA  1 
ATOM   4516  C  C   . ASP B 1 222 ? 82.431  19.654  7.227  1.00 38.98 ? 875  ASP B C   1 
ATOM   4517  O  O   . ASP B 1 222 ? 82.561  19.488  8.448  1.00 37.67 ? 875  ASP B O   1 
ATOM   4518  C  CB  . ASP B 1 222 ? 84.148  19.121  5.436  1.00 39.01 ? 875  ASP B CB  1 
ATOM   4519  C  CG  . ASP B 1 222 ? 84.904  18.027  6.132  1.00 38.39 ? 875  ASP B CG  1 
ATOM   4520  O  OD1 . ASP B 1 222 ? 86.055  17.773  5.719  1.00 38.55 ? 875  ASP B OD1 1 
ATOM   4521  O  OD2 . ASP B 1 222 ? 84.345  17.413  7.068  1.00 41.30 ? 875  ASP B OD2 1 
ATOM   4522  N  N   . HIS B 1 223 ? 81.297  19.392  6.581  1.00 39.76 ? 876  HIS B N   1 
ATOM   4523  C  CA  . HIS B 1 223 ? 80.127  18.945  7.329  1.00 39.80 ? 876  HIS B CA  1 
ATOM   4524  C  C   . HIS B 1 223 ? 80.395  17.699  8.156  1.00 38.55 ? 876  HIS B C   1 
ATOM   4525  O  O   . HIS B 1 223 ? 79.732  17.485  9.163  1.00 37.93 ? 876  HIS B O   1 
ATOM   4526  C  CB  . HIS B 1 223 ? 78.913  18.756  6.404  1.00 41.02 ? 876  HIS B CB  1 
ATOM   4527  C  CG  . HIS B 1 223 ? 78.854  17.430  5.709  1.00 43.54 ? 876  HIS B CG  1 
ATOM   4528  N  ND1 . HIS B 1 223 ? 79.562  17.157  4.556  1.00 44.71 ? 876  HIS B ND1 1 
ATOM   4529  C  CD2 . HIS B 1 223 ? 78.116  16.321  5.969  1.00 44.22 ? 876  HIS B CD2 1 
ATOM   4530  C  CE1 . HIS B 1 223 ? 79.256  15.942  4.130  1.00 45.76 ? 876  HIS B CE1 1 
ATOM   4531  N  NE2 . HIS B 1 223 ? 78.381  15.415  4.969  1.00 47.04 ? 876  HIS B NE2 1 
ATOM   4532  N  N   . VAL B 1 224 ? 81.389  16.904  7.762  1.00 38.71 ? 877  VAL B N   1 
ATOM   4533  C  CA  . VAL B 1 224 ? 81.726  15.684  8.512  1.00 38.87 ? 877  VAL B CA  1 
ATOM   4534  C  C   . VAL B 1 224 ? 82.495  16.028  9.786  1.00 38.52 ? 877  VAL B C   1 
ATOM   4535  O  O   . VAL B 1 224 ? 82.206  15.521  10.862 1.00 38.31 ? 877  VAL B O   1 
ATOM   4536  C  CB  . VAL B 1 224 ? 82.590  14.713  7.674  1.00 39.96 ? 877  VAL B CB  1 
ATOM   4537  C  CG1 . VAL B 1 224 ? 82.965  13.502  8.514  1.00 36.17 ? 877  VAL B CG1 1 
ATOM   4538  C  CG2 . VAL B 1 224 ? 81.826  14.269  6.422  1.00 38.02 ? 877  VAL B CG2 1 
ATOM   4539  N  N   . GLU B 1 225 ? 83.481  16.898  9.641  1.00 38.85 ? 878  GLU B N   1 
ATOM   4540  C  CA  . GLU B 1 225 ? 84.285  17.354  10.757 1.00 38.32 ? 878  GLU B CA  1 
ATOM   4541  C  C   . GLU B 1 225 ? 83.409  18.111  11.767 1.00 36.62 ? 878  GLU B C   1 
ATOM   4542  O  O   . GLU B 1 225 ? 83.490  17.898  12.964 1.00 34.15 ? 878  GLU B O   1 
ATOM   4543  C  CB  . GLU B 1 225 ? 85.378  18.278  10.224 1.00 39.11 ? 878  GLU B CB  1 
ATOM   4544  C  CG  . GLU B 1 225 ? 86.521  17.554  9.538  1.00 40.63 ? 878  GLU B CG  1 
ATOM   4545  C  CD  . GLU B 1 225 ? 87.462  18.497  8.787  1.00 44.59 ? 878  GLU B CD  1 
ATOM   4546  O  OE1 . GLU B 1 225 ? 88.668  18.180  8.662  1.00 47.21 ? 878  GLU B OE1 1 
ATOM   4547  O  OE2 . GLU B 1 225 ? 87.001  19.550  8.302  1.00 45.02 ? 878  GLU B OE2 1 
ATOM   4548  N  N   . PHE B 1 226 ? 82.570  19.001  11.256 1.00 37.19 ? 879  PHE B N   1 
ATOM   4549  C  CA  . PHE B 1 226 ? 81.700  19.799  12.089 1.00 37.02 ? 879  PHE B CA  1 
ATOM   4550  C  C   . PHE B 1 226 ? 80.723  18.918  12.845 1.00 38.07 ? 879  PHE B C   1 
ATOM   4551  O  O   . PHE B 1 226 ? 80.526  19.088  14.041 1.00 37.08 ? 879  PHE B O   1 
ATOM   4552  C  CB  . PHE B 1 226 ? 80.931  20.800  11.234 1.00 38.01 ? 879  PHE B CB  1 
ATOM   4553  C  CG  . PHE B 1 226 ? 80.080  21.739  12.028 1.00 38.73 ? 879  PHE B CG  1 
ATOM   4554  C  CD1 . PHE B 1 226 ? 80.656  22.770  12.736 1.00 38.93 ? 879  PHE B CD1 1 
ATOM   4555  C  CD2 . PHE B 1 226 ? 78.703  21.574  12.089 1.00 40.44 ? 879  PHE B CD2 1 
ATOM   4556  C  CE1 . PHE B 1 226 ? 79.880  23.632  13.502 1.00 39.82 ? 879  PHE B CE1 1 
ATOM   4557  C  CE2 . PHE B 1 226 ? 77.918  22.433  12.855 1.00 41.87 ? 879  PHE B CE2 1 
ATOM   4558  C  CZ  . PHE B 1 226 ? 78.513  23.469  13.563 1.00 38.92 ? 879  PHE B CZ  1 
ATOM   4559  N  N   . LYS B 1 227 ? 80.109  17.973  12.148 1.00 38.57 ? 880  LYS B N   1 
ATOM   4560  C  CA  . LYS B 1 227 ? 79.159  17.079  12.799 1.00 39.88 ? 880  LYS B CA  1 
ATOM   4561  C  C   . LYS B 1 227 ? 79.824  16.339  13.951 1.00 39.75 ? 880  LYS B C   1 
ATOM   4562  O  O   . LYS B 1 227 ? 79.225  16.179  15.022 1.00 40.77 ? 880  LYS B O   1 
ATOM   4563  C  CB  . LYS B 1 227 ? 78.593  16.071  11.791 1.00 42.53 ? 880  LYS B CB  1 
ATOM   4564  C  CG  . LYS B 1 227 ? 77.633  15.030  12.373 1.00 47.37 ? 880  LYS B CG  1 
ATOM   4565  C  CD  . LYS B 1 227 ? 77.304  13.914  11.345 1.00 51.93 ? 880  LYS B CD  1 
ATOM   4566  C  CE  . LYS B 1 227 ? 76.137  13.006  11.792 1.00 52.90 ? 880  LYS B CE  1 
ATOM   4567  N  NZ  . LYS B 1 227 ? 76.345  12.482  13.172 1.00 55.26 ? 880  LYS B NZ  1 
ATOM   4568  N  N   . ARG B 1 228 ? 81.064  15.898  13.741 1.00 38.16 ? 881  ARG B N   1 
ATOM   4569  C  CA  . ARG B 1 228 ? 81.785  15.157  14.780 1.00 36.85 ? 881  ARG B CA  1 
ATOM   4570  C  C   . ARG B 1 228 ? 82.184  16.086  15.927 1.00 37.52 ? 881  ARG B C   1 
ATOM   4571  O  O   . ARG B 1 228 ? 82.117  15.707  17.102 1.00 36.78 ? 881  ARG B O   1 
ATOM   4572  C  CB  . ARG B 1 228 ? 83.025  14.466  14.190 1.00 35.58 ? 881  ARG B CB  1 
ATOM   4573  C  CG  . ARG B 1 228 ? 83.800  13.656  15.219 1.00 37.82 ? 881  ARG B CG  1 
ATOM   4574  C  CD  . ARG B 1 228 ? 84.886  12.797  14.572 1.00 39.19 ? 881  ARG B CD  1 
ATOM   4575  N  NE  . ARG B 1 228 ? 85.920  12.395  15.521 1.00 40.21 ? 881  ARG B NE  1 
ATOM   4576  C  CZ  . ARG B 1 228 ? 85.726  11.608  16.575 1.00 41.27 ? 881  ARG B CZ  1 
ATOM   4577  N  NH1 . ARG B 1 228 ? 84.516  11.119  16.832 1.00 41.24 ? 881  ARG B NH1 1 
ATOM   4578  N  NH2 . ARG B 1 228 ? 86.755  11.307  17.372 1.00 40.25 ? 881  ARG B NH2 1 
ATOM   4579  N  N   . PHE B 1 229 ? 82.600  17.302  15.572 1.00 37.36 ? 882  PHE B N   1 
ATOM   4580  C  CA  . PHE B 1 229 ? 82.980  18.305  16.547 1.00 36.47 ? 882  PHE B CA  1 
ATOM   4581  C  C   . PHE B 1 229 ? 81.790  18.530  17.497 1.00 36.93 ? 882  PHE B C   1 
ATOM   4582  O  O   . PHE B 1 229 ? 81.930  18.464  18.715 1.00 36.18 ? 882  PHE B O   1 
ATOM   4583  C  CB  . PHE B 1 229 ? 83.312  19.618  15.843 1.00 37.82 ? 882  PHE B CB  1 
ATOM   4584  C  CG  . PHE B 1 229 ? 83.821  20.690  16.772 1.00 37.61 ? 882  PHE B CG  1 
ATOM   4585  C  CD1 . PHE B 1 229 ? 85.160  20.731  17.142 1.00 37.99 ? 882  PHE B CD1 1 
ATOM   4586  C  CD2 . PHE B 1 229 ? 82.943  21.621  17.323 1.00 37.24 ? 882  PHE B CD2 1 
ATOM   4587  C  CE1 . PHE B 1 229 ? 85.616  21.687  18.055 1.00 40.31 ? 882  PHE B CE1 1 
ATOM   4588  C  CE2 . PHE B 1 229 ? 83.380  22.573  18.226 1.00 37.03 ? 882  PHE B CE2 1 
ATOM   4589  C  CZ  . PHE B 1 229 ? 84.715  22.610  18.596 1.00 37.77 ? 882  PHE B CZ  1 
ATOM   4590  N  N   . ARG B 1 230 ? 80.619  18.780  16.916 1.00 36.14 ? 883  ARG B N   1 
ATOM   4591  C  CA  . ARG B 1 230 ? 79.412  19.013  17.689 1.00 36.29 ? 883  ARG B CA  1 
ATOM   4592  C  C   . ARG B 1 230 ? 79.199  17.884  18.694 1.00 35.35 ? 883  ARG B C   1 
ATOM   4593  O  O   . ARG B 1 230 ? 78.984  18.129  19.883 1.00 36.25 ? 883  ARG B O   1 
ATOM   4594  C  CB  . ARG B 1 230 ? 78.211  19.134  16.747 1.00 35.44 ? 883  ARG B CB  1 
ATOM   4595  C  CG  . ARG B 1 230 ? 76.868  19.286  17.436 1.00 36.14 ? 883  ARG B CG  1 
ATOM   4596  C  CD  . ARG B 1 230 ? 75.752  19.466  16.390 1.00 37.30 ? 883  ARG B CD  1 
ATOM   4597  N  NE  . ARG B 1 230 ? 74.437  19.077  16.899 1.00 37.53 ? 883  ARG B NE  1 
ATOM   4598  C  CZ  . ARG B 1 230 ? 73.755  19.776  17.795 1.00 36.03 ? 883  ARG B CZ  1 
ATOM   4599  N  NH1 . ARG B 1 230 ? 74.271  20.903  18.269 1.00 36.42 ? 883  ARG B NH1 1 
ATOM   4600  N  NH2 . ARG B 1 230 ? 72.578  19.348  18.230 1.00 32.62 ? 883  ARG B NH2 1 
ATOM   4601  N  N   . PHE B 1 231 ? 79.273  16.648  18.204 1.00 33.83 ? 884  PHE B N   1 
ATOM   4602  C  CA  . PHE B 1 231 ? 79.107  15.446  19.034 1.00 31.07 ? 884  PHE B CA  1 
ATOM   4603  C  C   . PHE B 1 231 ? 80.088  15.432  20.221 1.00 30.28 ? 884  PHE B C   1 
ATOM   4604  O  O   . PHE B 1 231 ? 79.683  15.228  21.367 1.00 30.53 ? 884  PHE B O   1 
ATOM   4605  C  CB  . PHE B 1 231 ? 79.309  14.186  18.159 1.00 29.26 ? 884  PHE B CB  1 
ATOM   4606  C  CG  . PHE B 1 231 ? 79.379  12.893  18.928 1.00 22.88 ? 884  PHE B CG  1 
ATOM   4607  C  CD1 . PHE B 1 231 ? 78.225  12.312  19.452 1.00 23.61 ? 884  PHE B CD1 1 
ATOM   4608  C  CD2 . PHE B 1 231 ? 80.604  12.278  19.153 1.00 20.90 ? 884  PHE B CD2 1 
ATOM   4609  C  CE1 . PHE B 1 231 ? 78.303  11.130  20.198 1.00 25.35 ? 884  PHE B CE1 1 
ATOM   4610  C  CE2 . PHE B 1 231 ? 80.705  11.103  19.892 1.00 21.96 ? 884  PHE B CE2 1 
ATOM   4611  C  CZ  . PHE B 1 231 ? 79.557  10.518  20.426 1.00 23.59 ? 884  PHE B CZ  1 
ATOM   4612  N  N   . LEU B 1 232 ? 81.369  15.643  19.937 1.00 29.67 ? 885  LEU B N   1 
ATOM   4613  C  CA  . LEU B 1 232 ? 82.398  15.650  20.974 1.00 29.84 ? 885  LEU B CA  1 
ATOM   4614  C  C   . LEU B 1 232 ? 82.158  16.723  22.064 1.00 30.35 ? 885  LEU B C   1 
ATOM   4615  O  O   . LEU B 1 232 ? 82.309  16.445  23.263 1.00 30.13 ? 885  LEU B O   1 
ATOM   4616  C  CB  . LEU B 1 232 ? 83.777  15.805  20.302 1.00 30.47 ? 885  LEU B CB  1 
ATOM   4617  C  CG  . LEU B 1 232 ? 84.188  14.589  19.433 1.00 30.77 ? 885  LEU B CG  1 
ATOM   4618  C  CD1 . LEU B 1 232 ? 85.521  14.804  18.751 1.00 29.57 ? 885  LEU B CD1 1 
ATOM   4619  C  CD2 . LEU B 1 232 ? 84.231  13.353  20.326 1.00 30.99 ? 885  LEU B CD2 1 
ATOM   4620  N  N   . VAL B 1 233 ? 81.750  17.928  21.645 1.00 29.07 ? 886  VAL B N   1 
ATOM   4621  C  CA  . VAL B 1 233 ? 81.465  19.029  22.566 1.00 26.77 ? 886  VAL B CA  1 
ATOM   4622  C  C   . VAL B 1 233 ? 80.298  18.659  23.478 1.00 27.74 ? 886  VAL B C   1 
ATOM   4623  O  O   . VAL B 1 233 ? 80.348  18.876  24.692 1.00 30.95 ? 886  VAL B O   1 
ATOM   4624  C  CB  . VAL B 1 233 ? 81.132  20.339  21.799 1.00 26.35 ? 886  VAL B CB  1 
ATOM   4625  C  CG1 . VAL B 1 233 ? 80.606  21.395  22.770 1.00 23.04 ? 886  VAL B CG1 1 
ATOM   4626  C  CG2 . VAL B 1 233 ? 82.384  20.849  21.071 1.00 21.28 ? 886  VAL B CG2 1 
ATOM   4627  N  N   . ILE B 1 234 ? 79.252  18.081  22.897 1.00 26.07 ? 887  ILE B N   1 
ATOM   4628  C  CA  . ILE B 1 234 ? 78.096  17.646  23.672 1.00 22.73 ? 887  ILE B CA  1 
ATOM   4629  C  C   . ILE B 1 234 ? 78.474  16.528  24.622 1.00 24.18 ? 887  ILE B C   1 
ATOM   4630  O  O   . ILE B 1 234 ? 78.053  16.506  25.771 1.00 28.08 ? 887  ILE B O   1 
ATOM   4631  C  CB  . ILE B 1 234 ? 76.997  17.171  22.747 1.00 24.45 ? 887  ILE B CB  1 
ATOM   4632  C  CG1 . ILE B 1 234 ? 76.370  18.393  22.056 1.00 23.31 ? 887  ILE B CG1 1 
ATOM   4633  C  CG2 . ILE B 1 234 ? 75.989  16.345  23.509 1.00 24.07 ? 887  ILE B CG2 1 
ATOM   4634  C  CD1 . ILE B 1 234 ? 75.301  18.061  21.066 1.00 21.79 ? 887  ILE B CD1 1 
ATOM   4635  N  N   . GLU B 1 235 ? 79.286  15.590  24.158 1.00 25.89 ? 888  GLU B N   1 
ATOM   4636  C  CA  . GLU B 1 235 ? 79.721  14.479  25.013 1.00 23.22 ? 888  GLU B CA  1 
ATOM   4637  C  C   . GLU B 1 235 ? 80.485  15.001  26.214 1.00 22.98 ? 888  GLU B C   1 
ATOM   4638  O  O   . GLU B 1 235 ? 80.266  14.543  27.326 1.00 25.85 ? 888  GLU B O   1 
ATOM   4639  C  CB  . GLU B 1 235 ? 80.610  13.497  24.215 1.00 24.19 ? 888  GLU B CB  1 
ATOM   4640  C  CG  . GLU B 1 235 ? 79.842  12.540  23.295 1.00 23.89 ? 888  GLU B CG  1 
ATOM   4641  C  CD  . GLU B 1 235 ? 78.810  11.716  24.033 1.00 26.96 ? 888  GLU B CD  1 
ATOM   4642  O  OE1 . GLU B 1 235 ? 77.616  11.831  23.742 1.00 35.95 ? 888  GLU B OE1 1 
ATOM   4643  O  OE2 . GLU B 1 235 ? 79.167  10.944  24.929 1.00 32.80 ? 888  GLU B OE2 1 
ATOM   4644  N  N   . ALA B 1 236 ? 81.383  15.966  25.985 1.00 23.06 ? 889  ALA B N   1 
ATOM   4645  C  CA  . ALA B 1 236 ? 82.186  16.541  27.067 1.00 21.73 ? 889  ALA B CA  1 
ATOM   4646  C  C   . ALA B 1 236 ? 81.365  17.327  28.058 1.00 23.23 ? 889  ALA B C   1 
ATOM   4647  O  O   . ALA B 1 236 ? 81.558  17.191  29.242 1.00 24.26 ? 889  ALA B O   1 
ATOM   4648  C  CB  . ALA B 1 236 ? 83.318  17.438  26.502 1.00 22.92 ? 889  ALA B CB  1 
ATOM   4649  N  N   . ILE B 1 237 ? 80.425  18.143  27.578 1.00 24.43 ? 890  ILE B N   1 
ATOM   4650  C  CA  . ILE B 1 237 ? 79.613  18.943  28.475 1.00 20.47 ? 890  ILE B CA  1 
ATOM   4651  C  C   . ILE B 1 237 ? 78.682  18.128  29.320 1.00 23.81 ? 890  ILE B C   1 
ATOM   4652  O  O   . ILE B 1 237 ? 78.502  18.425  30.528 1.00 22.30 ? 890  ILE B O   1 
ATOM   4653  C  CB  . ILE B 1 237 ? 78.767  19.964  27.707 1.00 24.27 ? 890  ILE B CB  1 
ATOM   4654  C  CG1 . ILE B 1 237 ? 79.693  20.944  26.985 1.00 22.38 ? 890  ILE B CG1 1 
ATOM   4655  C  CG2 . ILE B 1 237 ? 77.769  20.667  28.680 1.00 19.90 ? 890  ILE B CG2 1 
ATOM   4656  C  CD1 . ILE B 1 237 ? 78.939  21.928  26.209 1.00 23.94 ? 890  ILE B CD1 1 
ATOM   4657  N  N   . LEU B 1 238 ? 78.051  17.126  28.695 1.00 22.18 ? 891  LEU B N   1 
ATOM   4658  C  CA  . LEU B 1 238 ? 77.137  16.269  29.439 1.00 23.45 ? 891  LEU B CA  1 
ATOM   4659  C  C   . LEU B 1 238 ? 77.879  15.435  30.469 1.00 25.73 ? 891  LEU B C   1 
ATOM   4660  O  O   . LEU B 1 238 ? 77.304  15.020  31.463 1.00 26.28 ? 891  LEU B O   1 
ATOM   4661  C  CB  . LEU B 1 238 ? 76.384  15.348  28.494 1.00 24.71 ? 891  LEU B CB  1 
ATOM   4662  C  CG  . LEU B 1 238 ? 75.139  16.018  27.990 1.00 28.04 ? 891  LEU B CG  1 
ATOM   4663  C  CD1 . LEU B 1 238 ? 74.827  15.409  26.677 1.00 35.20 ? 891  LEU B CD1 1 
ATOM   4664  C  CD2 . LEU B 1 238 ? 73.995  15.862  28.959 1.00 29.51 ? 891  LEU B CD2 1 
ATOM   4665  N  N   . ALA B 1 239 ? 79.154  15.162  30.206 1.00 26.07 ? 892  ALA B N   1 
ATOM   4666  C  CA  . ALA B 1 239 ? 79.949  14.393  31.143 1.00 27.26 ? 892  ALA B CA  1 
ATOM   4667  C  C   . ALA B 1 239 ? 80.193  15.162  32.462 1.00 29.25 ? 892  ALA B C   1 
ATOM   4668  O  O   . ALA B 1 239 ? 80.669  14.570  33.434 1.00 28.47 ? 892  ALA B O   1 
ATOM   4669  C  CB  . ALA B 1 239 ? 81.280  14.005  30.499 1.00 27.34 ? 892  ALA B CB  1 
ATOM   4670  N  N   . THR B 1 240 ? 79.871  16.460  32.517 1.00 26.93 ? 893  THR B N   1 
ATOM   4671  C  CA  . THR B 1 240 ? 80.092  17.204  33.758 1.00 22.73 ? 893  THR B CA  1 
ATOM   4672  C  C   . THR B 1 240 ? 78.966  17.062  34.772 1.00 26.36 ? 893  THR B C   1 
ATOM   4673  O  O   . THR B 1 240 ? 79.043  17.645  35.842 1.00 24.66 ? 893  THR B O   1 
ATOM   4674  C  CB  . THR B 1 240 ? 80.340  18.724  33.530 1.00 25.98 ? 893  THR B CB  1 
ATOM   4675  O  OG1 . THR B 1 240 ? 79.202  19.323  32.889 1.00 26.65 ? 893  THR B OG1 1 
ATOM   4676  C  CG2 . THR B 1 240 ? 81.580  18.948  32.665 1.00 22.23 ? 893  THR B CG2 1 
ATOM   4677  N  N   . ASP B 1 241 ? 77.922  16.292  34.456 1.00 26.76 ? 894  ASP B N   1 
ATOM   4678  C  CA  . ASP B 1 241 ? 76.824  16.099  35.407 1.00 26.19 ? 894  ASP B CA  1 
ATOM   4679  C  C   . ASP B 1 241 ? 77.335  15.138  36.506 1.00 28.69 ? 894  ASP B C   1 
ATOM   4680  O  O   . ASP B 1 241 ? 77.594  13.971  36.243 1.00 27.34 ? 894  ASP B O   1 
ATOM   4681  C  CB  . ASP B 1 241 ? 75.616  15.513  34.678 1.00 28.48 ? 894  ASP B CB  1 
ATOM   4682  C  CG  . ASP B 1 241 ? 74.442  15.255  35.595 1.00 27.87 ? 894  ASP B CG  1 
ATOM   4683  O  OD1 . ASP B 1 241 ? 74.523  15.521  36.814 1.00 30.08 ? 894  ASP B OD1 1 
ATOM   4684  O  OD2 . ASP B 1 241 ? 73.423  14.768  35.092 1.00 30.06 ? 894  ASP B OD2 1 
ATOM   4685  N  N   . LEU B 1 242 ? 77.508  15.641  37.728 1.00 30.46 ? 895  LEU B N   1 
ATOM   4686  C  CA  . LEU B 1 242 ? 78.014  14.812  38.821 1.00 31.23 ? 895  LEU B CA  1 
ATOM   4687  C  C   . LEU B 1 242 ? 77.151  13.591  39.142 1.00 33.78 ? 895  LEU B C   1 
ATOM   4688  O  O   . LEU B 1 242 ? 77.579  12.688  39.853 1.00 30.78 ? 895  LEU B O   1 
ATOM   4689  C  CB  . LEU B 1 242 ? 78.213  15.647  40.088 1.00 30.20 ? 895  LEU B CB  1 
ATOM   4690  C  CG  . LEU B 1 242 ? 79.454  16.551  40.079 1.00 29.89 ? 895  LEU B CG  1 
ATOM   4691  C  CD1 . LEU B 1 242 ? 79.486  17.331  41.366 1.00 25.79 ? 895  LEU B CD1 1 
ATOM   4692  C  CD2 . LEU B 1 242 ? 80.726  15.739  39.912 1.00 25.62 ? 895  LEU B CD2 1 
ATOM   4693  N  N   . LYS B 1 243 ? 75.932  13.568  38.622 1.00 34.96 ? 896  LYS B N   1 
ATOM   4694  C  CA  . LYS B 1 243 ? 75.049  12.435  38.871 1.00 37.36 ? 896  LYS B CA  1 
ATOM   4695  C  C   . LYS B 1 243 ? 75.626  11.137  38.269 1.00 37.91 ? 896  LYS B C   1 
ATOM   4696  O  O   . LYS B 1 243 ? 75.409  10.054  38.789 1.00 36.61 ? 896  LYS B O   1 
ATOM   4697  C  CB  . LYS B 1 243 ? 73.687  12.719  38.265 1.00 38.69 ? 896  LYS B CB  1 
ATOM   4698  C  CG  . LYS B 1 243 ? 72.725  11.576  38.331 1.00 41.53 ? 896  LYS B CG  1 
ATOM   4699  C  CD  . LYS B 1 243 ? 72.307  11.327  39.745 1.00 45.92 ? 896  LYS B CD  1 
ATOM   4700  C  CE  . LYS B 1 243 ? 71.110  10.422  39.743 1.00 49.47 ? 896  LYS B CE  1 
ATOM   4701  N  NZ  . LYS B 1 243 ? 70.069  10.946  38.796 1.00 51.99 ? 896  LYS B NZ  1 
ATOM   4702  N  N   . LYS B 1 244 ? 76.373  11.287  37.180 1.00 39.06 ? 897  LYS B N   1 
ATOM   4703  C  CA  . LYS B 1 244 ? 76.991  10.196  36.450 1.00 39.28 ? 897  LYS B CA  1 
ATOM   4704  C  C   . LYS B 1 244 ? 78.469  9.977   36.824 1.00 39.88 ? 897  LYS B C   1 
ATOM   4705  O  O   . LYS B 1 244 ? 79.178  9.200   36.182 1.00 39.71 ? 897  LYS B O   1 
ATOM   4706  C  CB  . LYS B 1 244 ? 76.898  10.492  34.954 1.00 40.53 ? 897  LYS B CB  1 
ATOM   4707  C  CG  . LYS B 1 244 ? 75.490  10.682  34.406 1.00 44.67 ? 897  LYS B CG  1 
ATOM   4708  C  CD  . LYS B 1 244 ? 75.525  10.617  32.874 1.00 49.73 ? 897  LYS B CD  1 
ATOM   4709  C  CE  . LYS B 1 244 ? 75.898  9.188   32.389 1.00 54.36 ? 897  LYS B CE  1 
ATOM   4710  N  NZ  . LYS B 1 244 ? 76.324  9.058   30.956 1.00 55.87 ? 897  LYS B NZ  1 
ATOM   4711  N  N   . HIS B 1 245 ? 78.924  10.664  37.860 1.00 38.25 ? 898  HIS B N   1 
ATOM   4712  C  CA  . HIS B 1 245 ? 80.310  10.603  38.310 1.00 38.02 ? 898  HIS B CA  1 
ATOM   4713  C  C   . HIS B 1 245 ? 80.942  9.228   38.535 1.00 40.03 ? 898  HIS B C   1 
ATOM   4714  O  O   . HIS B 1 245 ? 82.051  8.939   38.046 1.00 39.47 ? 898  HIS B O   1 
ATOM   4715  C  CB  . HIS B 1 245 ? 80.449  11.416  39.602 1.00 36.35 ? 898  HIS B CB  1 
ATOM   4716  C  CG  . HIS B 1 245 ? 81.839  11.476  40.135 1.00 35.54 ? 898  HIS B CG  1 
ATOM   4717  N  ND1 . HIS B 1 245 ? 82.844  12.185  39.511 1.00 36.21 ? 898  HIS B ND1 1 
ATOM   4718  C  CD2 . HIS B 1 245 ? 82.399  10.905  41.228 1.00 36.05 ? 898  HIS B CD2 1 
ATOM   4719  C  CE1 . HIS B 1 245 ? 83.963  12.046  40.198 1.00 37.37 ? 898  HIS B CE1 1 
ATOM   4720  N  NE2 . HIS B 1 245 ? 83.719  11.277  41.246 1.00 36.04 ? 898  HIS B NE2 1 
ATOM   4721  N  N   . PHE B 1 246 ? 80.258  8.386   39.294 1.00 39.66 ? 899  PHE B N   1 
ATOM   4722  C  CA  . PHE B 1 246 ? 80.816  7.088   39.569 1.00 40.64 ? 899  PHE B CA  1 
ATOM   4723  C  C   . PHE B 1 246 ? 80.752  6.202   38.346 1.00 41.91 ? 899  PHE B C   1 
ATOM   4724  O  O   . PHE B 1 246 ? 81.583  5.312   38.191 1.00 43.10 ? 899  PHE B O   1 
ATOM   4725  C  CB  . PHE B 1 246 ? 80.123  6.458   40.768 1.00 39.99 ? 899  PHE B CB  1 
ATOM   4726  C  CG  . PHE B 1 246 ? 80.197  7.303   42.003 1.00 39.64 ? 899  PHE B CG  1 
ATOM   4727  C  CD1 . PHE B 1 246 ? 79.121  8.079   42.389 1.00 40.10 ? 899  PHE B CD1 1 
ATOM   4728  C  CD2 . PHE B 1 246 ? 81.360  7.360   42.756 1.00 41.75 ? 899  PHE B CD2 1 
ATOM   4729  C  CE1 . PHE B 1 246 ? 79.193  8.890   43.501 1.00 40.31 ? 899  PHE B CE1 1 
ATOM   4730  C  CE2 . PHE B 1 246 ? 81.443  8.175   43.879 1.00 40.36 ? 899  PHE B CE2 1 
ATOM   4731  C  CZ  . PHE B 1 246 ? 80.356  8.940   44.246 1.00 40.78 ? 899  PHE B CZ  1 
ATOM   4732  N  N   . ASP B 1 247 ? 79.796  6.449   37.462 1.00 42.59 ? 900  ASP B N   1 
ATOM   4733  C  CA  . ASP B 1 247 ? 79.717  5.644   36.251 1.00 44.02 ? 900  ASP B CA  1 
ATOM   4734  C  C   . ASP B 1 247 ? 80.930  5.959   35.389 1.00 44.48 ? 900  ASP B C   1 
ATOM   4735  O  O   . ASP B 1 247 ? 81.591  5.048   34.904 1.00 45.36 ? 900  ASP B O   1 
ATOM   4736  C  CB  . ASP B 1 247 ? 78.425  5.917   35.463 1.00 45.26 ? 900  ASP B CB  1 
ATOM   4737  C  CG  . ASP B 1 247 ? 77.182  5.467   36.210 1.00 49.09 ? 900  ASP B CG  1 
ATOM   4738  O  OD1 . ASP B 1 247 ? 77.233  4.425   36.900 1.00 52.42 ? 900  ASP B OD1 1 
ATOM   4739  O  OD2 . ASP B 1 247 ? 76.140  6.142   36.113 1.00 52.54 ? 900  ASP B OD2 1 
ATOM   4740  N  N   . PHE B 1 248 ? 81.233  7.242   35.198 1.00 43.90 ? 901  PHE B N   1 
ATOM   4741  C  CA  . PHE B 1 248 ? 82.394  7.611   34.396 1.00 43.06 ? 901  PHE B CA  1 
ATOM   4742  C  C   . PHE B 1 248 ? 83.660  7.104   35.022 1.00 42.40 ? 901  PHE B C   1 
ATOM   4743  O  O   . PHE B 1 248 ? 84.518  6.558   34.350 1.00 42.18 ? 901  PHE B O   1 
ATOM   4744  C  CB  . PHE B 1 248 ? 82.516  9.119   34.235 1.00 40.76 ? 901  PHE B CB  1 
ATOM   4745  C  CG  . PHE B 1 248 ? 81.664  9.662   33.158 1.00 42.91 ? 901  PHE B CG  1 
ATOM   4746  C  CD1 . PHE B 1 248 ? 80.548  10.449  33.458 1.00 42.56 ? 901  PHE B CD1 1 
ATOM   4747  C  CD2 . PHE B 1 248 ? 81.934  9.349   31.823 1.00 42.79 ? 901  PHE B CD2 1 
ATOM   4748  C  CE1 . PHE B 1 248 ? 79.705  10.919  32.441 1.00 41.63 ? 901  PHE B CE1 1 
ATOM   4749  C  CE2 . PHE B 1 248 ? 81.099  9.812   30.794 1.00 42.44 ? 901  PHE B CE2 1 
ATOM   4750  C  CZ  . PHE B 1 248 ? 79.979  10.600  31.107 1.00 42.24 ? 901  PHE B CZ  1 
ATOM   4751  N  N   . LEU B 1 249 ? 83.771  7.285   36.320 1.00 43.40 ? 902  LEU B N   1 
ATOM   4752  C  CA  . LEU B 1 249 ? 84.961  6.842   37.002 1.00 45.33 ? 902  LEU B CA  1 
ATOM   4753  C  C   . LEU B 1 249 ? 85.157  5.345   36.769 1.00 46.61 ? 902  LEU B C   1 
ATOM   4754  O  O   . LEU B 1 249 ? 86.242  4.910   36.388 1.00 46.50 ? 902  LEU B O   1 
ATOM   4755  C  CB  . LEU B 1 249 ? 84.851  7.160   38.487 1.00 45.29 ? 902  LEU B CB  1 
ATOM   4756  C  CG  . LEU B 1 249 ? 86.178  7.403   39.196 1.00 46.27 ? 902  LEU B CG  1 
ATOM   4757  C  CD1 . LEU B 1 249 ? 87.104  8.205   38.281 1.00 46.31 ? 902  LEU B CD1 1 
ATOM   4758  C  CD2 . LEU B 1 249 ? 85.933  8.119   40.528 1.00 45.22 ? 902  LEU B CD2 1 
ATOM   4759  N  N   . ALA B 1 250 ? 84.095  4.568   36.971 1.00 48.02 ? 903  ALA B N   1 
ATOM   4760  C  CA  . ALA B 1 250 ? 84.148  3.124   36.764 1.00 48.74 ? 903  ALA B CA  1 
ATOM   4761  C  C   . ALA B 1 250 ? 84.472  2.761   35.309 1.00 50.54 ? 903  ALA B C   1 
ATOM   4762  O  O   . ALA B 1 250 ? 85.406  2.016   35.022 1.00 51.60 ? 903  ALA B O   1 
ATOM   4763  C  CB  . ALA B 1 250 ? 82.842  2.513   37.156 1.00 46.60 ? 903  ALA B CB  1 
ATOM   4764  N  N   . GLU B 1 251 ? 83.691  3.286   34.382 1.00 53.38 ? 904  GLU B N   1 
ATOM   4765  C  CA  . GLU B 1 251 ? 83.894  3.015   32.958 1.00 54.70 ? 904  GLU B CA  1 
ATOM   4766  C  C   . GLU B 1 251 ? 85.307  3.397   32.521 1.00 54.28 ? 904  GLU B C   1 
ATOM   4767  O  O   . GLU B 1 251 ? 85.808  2.899   31.517 1.00 55.46 ? 904  GLU B O   1 
ATOM   4768  C  CB  . GLU B 1 251 ? 82.866  3.815   32.173 1.00 57.04 ? 904  GLU B CB  1 
ATOM   4769  C  CG  . GLU B 1 251 ? 82.862  3.658   30.675 1.00 61.94 ? 904  GLU B CG  1 
ATOM   4770  C  CD  . GLU B 1 251 ? 81.921  4.677   30.029 1.00 65.79 ? 904  GLU B CD  1 
ATOM   4771  O  OE1 . GLU B 1 251 ? 81.125  5.315   30.782 1.00 66.20 ? 904  GLU B OE1 1 
ATOM   4772  O  OE2 . GLU B 1 251 ? 81.968  4.844   28.778 1.00 67.38 ? 904  GLU B OE2 1 
ATOM   4773  N  N   . PHE B 1 252 ? 85.940  4.288   33.284 1.00 53.09 ? 905  PHE B N   1 
ATOM   4774  C  CA  . PHE B 1 252 ? 87.286  4.748   32.980 1.00 51.33 ? 905  PHE B CA  1 
ATOM   4775  C  C   . PHE B 1 252 ? 88.310  3.770   33.529 1.00 53.01 ? 905  PHE B C   1 
ATOM   4776  O  O   . PHE B 1 252 ? 89.194  3.307   32.803 1.00 53.44 ? 905  PHE B O   1 
ATOM   4777  C  CB  . PHE B 1 252 ? 87.522  6.126   33.597 1.00 46.94 ? 905  PHE B CB  1 
ATOM   4778  C  CG  . PHE B 1 252 ? 88.906  6.666   33.376 1.00 41.88 ? 905  PHE B CG  1 
ATOM   4779  C  CD1 . PHE B 1 252 ? 89.334  7.039   32.104 1.00 42.08 ? 905  PHE B CD1 1 
ATOM   4780  C  CD2 . PHE B 1 252 ? 89.781  6.822   34.443 1.00 41.73 ? 905  PHE B CD2 1 
ATOM   4781  C  CE1 . PHE B 1 252 ? 90.616  7.563   31.904 1.00 39.66 ? 905  PHE B CE1 1 
ATOM   4782  C  CE2 . PHE B 1 252 ? 91.056  7.345   34.258 1.00 36.69 ? 905  PHE B CE2 1 
ATOM   4783  C  CZ  . PHE B 1 252 ? 91.468  7.713   32.991 1.00 38.88 ? 905  PHE B CZ  1 
ATOM   4784  N  N   . ASN B 1 253 ? 88.191  3.475   34.820 1.00 53.81 ? 906  ASN B N   1 
ATOM   4785  C  CA  . ASN B 1 253 ? 89.093  2.548   35.488 1.00 54.91 ? 906  ASN B CA  1 
ATOM   4786  C  C   . ASN B 1 253 ? 89.163  1.195   34.810 1.00 55.42 ? 906  ASN B C   1 
ATOM   4787  O  O   . ASN B 1 253 ? 90.124  0.438   34.991 1.00 55.56 ? 906  ASN B O   1 
ATOM   4788  C  CB  . ASN B 1 253 ? 88.660  2.343   36.916 1.00 53.84 ? 906  ASN B CB  1 
ATOM   4789  C  CG  . ASN B 1 253 ? 89.000  3.503   37.764 1.00 54.66 ? 906  ASN B CG  1 
ATOM   4790  O  OD1 . ASN B 1 253 ? 90.094  4.066   37.634 1.00 55.20 ? 906  ASN B OD1 1 
ATOM   4791  N  ND2 . ASN B 1 253 ? 88.089  3.882   38.656 1.00 54.83 ? 906  ASN B ND2 1 
ATOM   4792  N  N   . ALA B 1 254 ? 88.131  0.889   34.040 1.00 56.12 ? 907  ALA B N   1 
ATOM   4793  C  CA  . ALA B 1 254 ? 88.076  -0.369  33.327 1.00 56.66 ? 907  ALA B CA  1 
ATOM   4794  C  C   . ALA B 1 254 ? 89.084  -0.284  32.205 1.00 57.17 ? 907  ALA B C   1 
ATOM   4795  O  O   . ALA B 1 254 ? 90.072  -1.017  32.179 1.00 57.22 ? 907  ALA B O   1 
ATOM   4796  C  CB  . ALA B 1 254 ? 86.684  -0.582  32.748 1.00 56.01 ? 907  ALA B CB  1 
ATOM   4797  N  N   . LYS B 1 255 ? 88.813  0.635   31.283 1.00 57.36 ? 908  LYS B N   1 
ATOM   4798  C  CA  . LYS B 1 255 ? 89.655  0.829   30.118 1.00 57.49 ? 908  LYS B CA  1 
ATOM   4799  C  C   . LYS B 1 255 ? 91.054  1.357   30.386 1.00 57.52 ? 908  LYS B C   1 
ATOM   4800  O  O   . LYS B 1 255 ? 91.921  1.250   29.522 1.00 58.16 ? 908  LYS B O   1 
ATOM   4801  C  CB  . LYS B 1 255 ? 88.954  1.759   29.120 1.00 57.19 ? 908  LYS B CB  1 
ATOM   4802  C  CG  . LYS B 1 255 ? 87.918  1.091   28.229 1.00 57.29 ? 908  LYS B CG  1 
ATOM   4803  C  CD  . LYS B 1 255 ? 88.492  0.820   26.839 1.00 58.23 ? 908  LYS B CD  1 
ATOM   4804  C  CE  . LYS B 1 255 ? 87.474  0.076   25.957 1.00 58.65 ? 908  LYS B CE  1 
ATOM   4805  N  NZ  . LYS B 1 255 ? 87.871  0.065   24.510 1.00 57.46 ? 908  LYS B NZ  1 
ATOM   4806  N  N   . ALA B 1 256 ? 91.307  1.899   31.569 1.00 58.39 ? 909  ALA B N   1 
ATOM   4807  C  CA  . ALA B 1 256 ? 92.633  2.455   31.805 1.00 59.58 ? 909  ALA B CA  1 
ATOM   4808  C  C   . ALA B 1 256 ? 93.379  2.025   33.051 1.00 60.66 ? 909  ALA B C   1 
ATOM   4809  O  O   . ALA B 1 256 ? 94.589  2.255   33.149 1.00 59.87 ? 909  ALA B O   1 
ATOM   4810  C  CB  . ALA B 1 256 ? 92.554  3.970   31.768 1.00 57.66 ? 909  ALA B CB  1 
ATOM   4811  N  N   . ASN B 1 257 ? 92.691  1.401   34.001 1.00 62.66 ? 910  ASN B N   1 
ATOM   4812  C  CA  . ASN B 1 257 ? 93.391  1.019   35.224 1.00 65.65 ? 910  ASN B CA  1 
ATOM   4813  C  C   . ASN B 1 257 ? 93.252  -0.392  35.763 1.00 67.35 ? 910  ASN B C   1 
ATOM   4814  O  O   . ASN B 1 257 ? 93.646  -0.669  36.912 1.00 67.35 ? 910  ASN B O   1 
ATOM   4815  C  CB  . ASN B 1 257 ? 93.030  1.986   36.334 1.00 65.38 ? 910  ASN B CB  1 
ATOM   4816  C  CG  . ASN B 1 257 ? 93.636  3.320   36.123 1.00 65.55 ? 910  ASN B CG  1 
ATOM   4817  O  OD1 . ASN B 1 257 ? 94.834  3.420   35.855 1.00 66.04 ? 910  ASN B OD1 1 
ATOM   4818  N  ND2 . ASN B 1 257 ? 92.822  4.374   36.239 1.00 66.29 ? 910  ASN B ND2 1 
ATOM   4819  N  N   . ASP B 1 258 ? 92.733  -1.300  34.950 1.00 69.00 ? 911  ASP B N   1 
ATOM   4820  C  CA  . ASP B 1 258 ? 92.567  -2.628  35.476 1.00 71.21 ? 911  ASP B CA  1 
ATOM   4821  C  C   . ASP B 1 258 ? 92.964  -3.827  34.613 1.00 71.58 ? 911  ASP B C   1 
ATOM   4822  O  O   . ASP B 1 258 ? 93.174  -3.727  33.394 1.00 70.44 ? 911  ASP B O   1 
ATOM   4823  C  CB  . ASP B 1 258 ? 91.124  -2.771  36.006 1.00 73.01 ? 911  ASP B CB  1 
ATOM   4824  C  CG  . ASP B 1 258 ? 90.876  -1.955  37.307 1.00 74.80 ? 911  ASP B CG  1 
ATOM   4825  O  OD1 . ASP B 1 258 ? 91.487  -2.297  38.354 1.00 75.37 ? 911  ASP B OD1 1 
ATOM   4826  O  OD2 . ASP B 1 258 ? 90.074  -0.979  37.288 1.00 74.82 ? 911  ASP B OD2 1 
ATOM   4827  N  N   . VAL B 1 259 ? 93.099  -4.936  35.339 1.00 72.28 ? 912  VAL B N   1 
ATOM   4828  C  CA  . VAL B 1 259 ? 93.443  -6.275  34.884 1.00 73.19 ? 912  VAL B CA  1 
ATOM   4829  C  C   . VAL B 1 259 ? 93.593  -6.542  33.390 1.00 73.41 ? 912  VAL B C   1 
ATOM   4830  O  O   . VAL B 1 259 ? 92.864  -5.988  32.552 1.00 73.83 ? 912  VAL B O   1 
ATOM   4831  C  CB  . VAL B 1 259 ? 92.404  -7.293  35.452 1.00 73.54 ? 912  VAL B CB  1 
ATOM   4832  C  CG1 . VAL B 1 259 ? 92.935  -8.731  35.311 1.00 73.03 ? 912  VAL B CG1 1 
ATOM   4833  C  CG2 . VAL B 1 259 ? 92.068  -6.943  36.930 1.00 72.84 ? 912  VAL B CG2 1 
ATOM   4834  N  N   . ASN B 1 260 ? 94.522  -7.444  33.085 1.00 73.99 ? 913  ASN B N   1 
ATOM   4835  C  CA  . ASN B 1 260 ? 94.829  -7.861  31.712 1.00 75.22 ? 913  ASN B CA  1 
ATOM   4836  C  C   . ASN B 1 260 ? 94.587  -6.817  30.624 1.00 74.72 ? 913  ASN B C   1 
ATOM   4837  O  O   . ASN B 1 260 ? 94.111  -7.128  29.526 1.00 76.01 ? 913  ASN B O   1 
ATOM   4838  C  CB  . ASN B 1 260 ? 94.102  -9.193  31.352 1.00 76.05 ? 913  ASN B CB  1 
ATOM   4839  C  CG  . ASN B 1 260 ? 92.725  -9.338  32.009 1.00 76.43 ? 913  ASN B CG  1 
ATOM   4840  O  OD1 . ASN B 1 260 ? 91.838  -8.476  31.849 1.00 77.36 ? 913  ASN B OD1 1 
ATOM   4841  N  ND2 . ASN B 1 260 ? 92.536  -10.444 32.743 1.00 75.15 ? 913  ASN B ND2 1 
ATOM   4842  N  N   . SER B 1 261 ? 94.927  -5.571  30.925 1.00 73.91 ? 914  SER B N   1 
ATOM   4843  C  CA  . SER B 1 261 ? 94.754  -4.500  29.953 1.00 73.16 ? 914  SER B CA  1 
ATOM   4844  C  C   . SER B 1 261 ? 96.013  -3.647  30.027 1.00 72.31 ? 914  SER B C   1 
ATOM   4845  O  O   . SER B 1 261 ? 96.541  -3.398  31.118 1.00 71.89 ? 914  SER B O   1 
ATOM   4846  C  CB  . SER B 1 261 ? 93.512  -3.649  30.294 1.00 73.38 ? 914  SER B CB  1 
ATOM   4847  O  OG  . SER B 1 261 ? 92.301  -4.408  30.218 1.00 73.29 ? 914  SER B OG  1 
ATOM   4848  N  N   . ASN B 1 262 ? 96.521  -3.232  28.872 1.00 71.28 ? 915  ASN B N   1 
ATOM   4849  C  CA  . ASN B 1 262 ? 97.702  -2.382  28.868 1.00 70.31 ? 915  ASN B CA  1 
ATOM   4850  C  C   . ASN B 1 262 ? 97.225  -0.923  28.928 1.00 69.51 ? 915  ASN B C   1 
ATOM   4851  O  O   . ASN B 1 262 ? 98.018  0.021   28.781 1.00 69.92 ? 915  ASN B O   1 
ATOM   4852  C  CB  . ASN B 1 262 ? 98.580  -2.636  27.623 1.00 69.55 ? 915  ASN B CB  1 
ATOM   4853  C  CG  . ASN B 1 262 ? 99.521  -3.850  27.800 1.00 68.98 ? 915  ASN B CG  1 
ATOM   4854  O  OD1 . ASN B 1 262 ? 99.895  -4.198  28.927 1.00 66.69 ? 915  ASN B OD1 1 
ATOM   4855  N  ND2 . ASN B 1 262 ? 99.921  -4.475  26.680 1.00 68.14 ? 915  ASN B ND2 1 
ATOM   4856  N  N   . GLY B 1 263 ? 95.919  -0.753  29.153 1.00 67.94 ? 916  GLY B N   1 
ATOM   4857  C  CA  . GLY B 1 263 ? 95.341  0.584   29.259 1.00 65.41 ? 916  GLY B CA  1 
ATOM   4858  C  C   . GLY B 1 263 ? 94.580  1.152   28.070 1.00 62.90 ? 916  GLY B C   1 
ATOM   4859  O  O   . GLY B 1 263 ? 93.773  0.464   27.423 1.00 62.56 ? 916  GLY B O   1 
ATOM   4860  N  N   . ILE B 1 264 ? 94.847  2.426   27.792 1.00 60.57 ? 917  ILE B N   1 
ATOM   4861  C  CA  . ILE B 1 264 ? 94.188  3.126   26.698 1.00 58.46 ? 917  ILE B CA  1 
ATOM   4862  C  C   . ILE B 1 264 ? 94.768  2.727   25.349 1.00 57.15 ? 917  ILE B C   1 
ATOM   4863  O  O   . ILE B 1 264 ? 95.898  2.275   25.254 1.00 57.16 ? 917  ILE B O   1 
ATOM   4864  C  CB  . ILE B 1 264 ? 94.310  4.671   26.847 1.00 57.10 ? 917  ILE B CB  1 
ATOM   4865  C  CG1 . ILE B 1 264 ? 93.879  5.112   28.253 1.00 55.48 ? 917  ILE B CG1 1 
ATOM   4866  C  CG2 . ILE B 1 264 ? 93.429  5.362   25.796 1.00 57.12 ? 917  ILE B CG2 1 
ATOM   4867  C  CD1 . ILE B 1 264 ? 92.413  4.876   28.572 1.00 53.41 ? 917  ILE B CD1 1 
ATOM   4868  N  N   . GLU B 1 265 ? 93.966  2.899   24.311 1.00 56.88 ? 918  GLU B N   1 
ATOM   4869  C  CA  . GLU B 1 265 ? 94.358  2.587   22.956 1.00 56.87 ? 918  GLU B CA  1 
ATOM   4870  C  C   . GLU B 1 265 ? 94.199  3.903   22.202 1.00 55.59 ? 918  GLU B C   1 
ATOM   4871  O  O   . GLU B 1 265 ? 93.176  4.143   21.562 1.00 56.70 ? 918  GLU B O   1 
ATOM   4872  C  CB  . GLU B 1 265 ? 93.425  1.508   22.398 1.00 58.92 ? 918  GLU B CB  1 
ATOM   4873  C  CG  . GLU B 1 265 ? 93.394  0.266   23.291 1.00 64.50 ? 918  GLU B CG  1 
ATOM   4874  C  CD  . GLU B 1 265 ? 92.282  -0.728  22.949 1.00 68.24 ? 918  GLU B CD  1 
ATOM   4875  O  OE1 . GLU B 1 265 ? 91.081  -0.323  22.928 1.00 68.21 ? 918  GLU B OE1 1 
ATOM   4876  O  OE2 . GLU B 1 265 ? 92.619  -1.926  22.722 1.00 69.33 ? 918  GLU B OE2 1 
ATOM   4877  N  N   . TRP B 1 266 ? 95.210  4.762   22.288 1.00 53.73 ? 919  TRP B N   1 
ATOM   4878  C  CA  . TRP B 1 266 ? 95.170  6.072   21.648 1.00 53.41 ? 919  TRP B CA  1 
ATOM   4879  C  C   . TRP B 1 266 ? 94.626  6.065   20.225 1.00 54.02 ? 919  TRP B C   1 
ATOM   4880  O  O   . TRP B 1 266 ? 94.301  7.114   19.659 1.00 53.65 ? 919  TRP B O   1 
ATOM   4881  C  CB  . TRP B 1 266 ? 96.557  6.708   21.705 1.00 52.22 ? 919  TRP B CB  1 
ATOM   4882  C  CG  . TRP B 1 266 ? 96.984  6.956   23.116 1.00 51.66 ? 919  TRP B CG  1 
ATOM   4883  C  CD1 . TRP B 1 266 ? 97.952  6.294   23.807 1.00 53.27 ? 919  TRP B CD1 1 
ATOM   4884  C  CD2 . TRP B 1 266 ? 96.366  7.854   24.060 1.00 52.79 ? 919  TRP B CD2 1 
ATOM   4885  N  NE1 . TRP B 1 266 ? 97.977  6.709   25.124 1.00 52.65 ? 919  TRP B NE1 1 
ATOM   4886  C  CE2 . TRP B 1 266 ? 97.014  7.667   25.304 1.00 52.01 ? 919  TRP B CE2 1 
ATOM   4887  C  CE3 . TRP B 1 266 ? 95.324  8.796   23.972 1.00 50.99 ? 919  TRP B CE3 1 
ATOM   4888  C  CZ2 . TRP B 1 266 ? 96.658  8.383   26.450 1.00 51.73 ? 919  TRP B CZ2 1 
ATOM   4889  C  CZ3 . TRP B 1 266 ? 94.973  9.508   25.111 1.00 49.97 ? 919  TRP B CZ3 1 
ATOM   4890  C  CH2 . TRP B 1 266 ? 95.638  9.299   26.334 1.00 50.35 ? 919  TRP B CH2 1 
ATOM   4891  N  N   . SER B 1 267 ? 94.499  4.864   19.670 1.00 54.45 ? 920  SER B N   1 
ATOM   4892  C  CA  . SER B 1 267 ? 94.001  4.659   18.313 1.00 53.80 ? 920  SER B CA  1 
ATOM   4893  C  C   . SER B 1 267 ? 92.499  4.484   18.334 1.00 52.78 ? 920  SER B C   1 
ATOM   4894  O  O   . SER B 1 267 ? 91.840  4.536   17.298 1.00 53.36 ? 920  SER B O   1 
ATOM   4895  C  CB  . SER B 1 267 ? 94.664  3.409   17.719 1.00 54.60 ? 920  SER B CB  1 
ATOM   4896  O  OG  . SER B 1 267 ? 94.900  2.414   18.720 1.00 55.64 ? 920  SER B OG  1 
ATOM   4897  N  N   . ASN B 1 268 ? 91.967  4.266   19.530 1.00 52.24 ? 921  ASN B N   1 
ATOM   4898  C  CA  . ASN B 1 268 ? 90.539  4.051   19.722 1.00 51.50 ? 921  ASN B CA  1 
ATOM   4899  C  C   . ASN B 1 268 ? 89.802  5.360   20.024 1.00 51.64 ? 921  ASN B C   1 
ATOM   4900  O  O   . ASN B 1 268 ? 90.077  6.026   21.025 1.00 51.50 ? 921  ASN B O   1 
ATOM   4901  C  CB  . ASN B 1 268 ? 90.321  3.063   20.870 1.00 51.35 ? 921  ASN B CB  1 
ATOM   4902  C  CG  . ASN B 1 268 ? 88.906  2.494   20.892 1.00 53.11 ? 921  ASN B CG  1 
ATOM   4903  O  OD1 . ASN B 1 268 ? 87.932  3.232   20.851 1.00 53.71 ? 921  ASN B OD1 1 
ATOM   4904  N  ND2 . ASN B 1 268 ? 88.795  1.175   20.963 1.00 53.56 ? 921  ASN B ND2 1 
ATOM   4905  N  N   . GLU B 1 269 ? 88.869  5.721   19.147 1.00 50.63 ? 922  GLU B N   1 
ATOM   4906  C  CA  . GLU B 1 269 ? 88.060  6.923   19.318 1.00 49.10 ? 922  GLU B CA  1 
ATOM   4907  C  C   . GLU B 1 269 ? 87.392  6.984   20.707 1.00 47.78 ? 922  GLU B C   1 
ATOM   4908  O  O   . GLU B 1 269 ? 87.511  7.978   21.409 1.00 46.31 ? 922  GLU B O   1 
ATOM   4909  C  CB  . GLU B 1 269 ? 86.975  6.958   18.249 1.00 49.30 ? 922  GLU B CB  1 
ATOM   4910  C  CG  . GLU B 1 269 ? 87.235  7.918   17.123 1.00 50.57 ? 922  GLU B CG  1 
ATOM   4911  C  CD  . GLU B 1 269 ? 86.217  7.771   15.996 1.00 51.37 ? 922  GLU B CD  1 
ATOM   4912  O  OE1 . GLU B 1 269 ? 85.085  7.307   16.290 1.00 51.27 ? 922  GLU B OE1 1 
ATOM   4913  O  OE2 . GLU B 1 269 ? 86.548  8.132   14.830 1.00 51.22 ? 922  GLU B OE2 1 
ATOM   4914  N  N   . ASN B 1 270 ? 86.697  5.914   21.082 1.00 46.86 ? 923  ASN B N   1 
ATOM   4915  C  CA  . ASN B 1 270 ? 85.998  5.837   22.357 1.00 47.64 ? 923  ASN B CA  1 
ATOM   4916  C  C   . ASN B 1 270 ? 86.889  5.987   23.574 1.00 47.07 ? 923  ASN B C   1 
ATOM   4917  O  O   . ASN B 1 270 ? 86.498  6.586   24.560 1.00 45.91 ? 923  ASN B O   1 
ATOM   4918  C  CB  . ASN B 1 270 ? 85.232  4.521   22.467 1.00 48.15 ? 923  ASN B CB  1 
ATOM   4919  C  CG  . ASN B 1 270 ? 84.124  4.409   21.461 1.00 50.23 ? 923  ASN B CG  1 
ATOM   4920  O  OD1 . ASN B 1 270 ? 83.390  3.424   21.453 1.00 52.36 ? 923  ASN B OD1 1 
ATOM   4921  N  ND2 . ASN B 1 270 ? 83.983  5.413   20.603 1.00 50.50 ? 923  ASN B ND2 1 
ATOM   4922  N  N   . ASP B 1 271 ? 88.065  5.382   23.529 1.00 48.42 ? 924  ASP B N   1 
ATOM   4923  C  CA  . ASP B 1 271 ? 89.018  5.508   24.627 1.00 49.10 ? 924  ASP B CA  1 
ATOM   4924  C  C   . ASP B 1 271 ? 89.435  7.004   24.722 1.00 48.03 ? 924  ASP B C   1 
ATOM   4925  O  O   . ASP B 1 271 ? 89.446  7.601   25.802 1.00 46.94 ? 924  ASP B O   1 
ATOM   4926  C  CB  . ASP B 1 271 ? 90.235  4.604   24.348 1.00 53.30 ? 924  ASP B CB  1 
ATOM   4927  C  CG  . ASP B 1 271 ? 89.959  3.125   24.667 1.00 55.49 ? 924  ASP B CG  1 
ATOM   4928  O  OD1 . ASP B 1 271 ? 88.801  2.674   24.473 1.00 57.61 ? 924  ASP B OD1 1 
ATOM   4929  O  OD2 . ASP B 1 271 ? 90.901  2.414   25.100 1.00 56.74 ? 924  ASP B OD2 1 
ATOM   4930  N  N   . ARG B 1 272 ? 89.753  7.599   23.576 1.00 46.39 ? 925  ARG B N   1 
ATOM   4931  C  CA  . ARG B 1 272 ? 90.135  8.999   23.497 1.00 45.10 ? 925  ARG B CA  1 
ATOM   4932  C  C   . ARG B 1 272 ? 89.059  9.891   24.135 1.00 45.36 ? 925  ARG B C   1 
ATOM   4933  O  O   . ARG B 1 272 ? 89.368  10.805  24.902 1.00 46.91 ? 925  ARG B O   1 
ATOM   4934  C  CB  . ARG B 1 272 ? 90.341  9.398   22.030 1.00 45.28 ? 925  ARG B CB  1 
ATOM   4935  C  CG  . ARG B 1 272 ? 91.801  9.522   21.605 1.00 44.27 ? 925  ARG B CG  1 
ATOM   4936  C  CD  . ARG B 1 272 ? 91.926  10.130  20.226 1.00 44.27 ? 925  ARG B CD  1 
ATOM   4937  N  NE  . ARG B 1 272 ? 92.196  9.113   19.223 1.00 48.97 ? 925  ARG B NE  1 
ATOM   4938  C  CZ  . ARG B 1 272 ? 91.515  8.929   18.091 1.00 49.16 ? 925  ARG B CZ  1 
ATOM   4939  N  NH1 . ARG B 1 272 ? 90.475  9.697   17.769 1.00 48.84 ? 925  ARG B NH1 1 
ATOM   4940  N  NH2 . ARG B 1 272 ? 91.893  7.963   17.262 1.00 51.02 ? 925  ARG B NH2 1 
ATOM   4941  N  N   . LEU B 1 273 ? 87.798  9.618   23.823 1.00 42.89 ? 926  LEU B N   1 
ATOM   4942  C  CA  . LEU B 1 273 ? 86.694  10.400  24.356 1.00 39.70 ? 926  LEU B CA  1 
ATOM   4943  C  C   . LEU B 1 273 ? 86.577  10.249  25.865 1.00 39.98 ? 926  LEU B C   1 
ATOM   4944  O  O   . LEU B 1 273 ? 86.331  11.219  26.589 1.00 40.18 ? 926  LEU B O   1 
ATOM   4945  C  CB  . LEU B 1 273 ? 85.380  9.981   23.715 1.00 36.44 ? 926  LEU B CB  1 
ATOM   4946  C  CG  . LEU B 1 273 ? 84.145  10.644  24.339 1.00 36.36 ? 926  LEU B CG  1 
ATOM   4947  C  CD1 . LEU B 1 273 ? 84.204  12.116  24.104 1.00 33.81 ? 926  LEU B CD1 1 
ATOM   4948  C  CD2 . LEU B 1 273 ? 82.847  10.084  23.744 1.00 32.03 ? 926  LEU B CD2 1 
ATOM   4949  N  N   . LEU B 1 274 ? 86.761  9.033   26.350 1.00 38.88 ? 927  LEU B N   1 
ATOM   4950  C  CA  . LEU B 1 274 ? 86.644  8.810   27.779 1.00 38.71 ? 927  LEU B CA  1 
ATOM   4951  C  C   . LEU B 1 274 ? 87.729  9.576   28.540 1.00 37.58 ? 927  LEU B C   1 
ATOM   4952  O  O   . LEU B 1 274 ? 87.493  10.051  29.654 1.00 37.03 ? 927  LEU B O   1 
ATOM   4953  C  CB  . LEU B 1 274 ? 86.727  7.324   28.096 1.00 39.14 ? 927  LEU B CB  1 
ATOM   4954  C  CG  . LEU B 1 274 ? 86.312  7.035   29.534 1.00 41.98 ? 927  LEU B CG  1 
ATOM   4955  C  CD1 . LEU B 1 274 ? 84.828  7.332   29.670 1.00 42.95 ? 927  LEU B CD1 1 
ATOM   4956  C  CD2 . LEU B 1 274 ? 86.622  5.579   29.902 1.00 43.93 ? 927  LEU B CD2 1 
ATOM   4957  N  N   . VAL B 1 275 ? 88.902  9.690   27.918 1.00 36.19 ? 928  VAL B N   1 
ATOM   4958  C  CA  . VAL B 1 275 ? 90.045  10.397  28.487 1.00 34.21 ? 928  VAL B CA  1 
ATOM   4959  C  C   . VAL B 1 275 ? 89.675  11.852  28.565 1.00 33.01 ? 928  VAL B C   1 
ATOM   4960  O  O   . VAL B 1 275 ? 89.886  12.490  29.579 1.00 34.68 ? 928  VAL B O   1 
ATOM   4961  C  CB  . VAL B 1 275 ? 91.305  10.267  27.600 1.00 34.01 ? 928  VAL B CB  1 
ATOM   4962  C  CG1 . VAL B 1 275 ? 92.405  11.175  28.116 1.00 32.30 ? 928  VAL B CG1 1 
ATOM   4963  C  CG2 . VAL B 1 275 ? 91.797  8.851   27.600 1.00 36.03 ? 928  VAL B CG2 1 
ATOM   4964  N  N   . CYS B 1 276 ? 89.130  12.374  27.478 1.00 33.25 ? 929  CYS B N   1 
ATOM   4965  C  CA  . CYS B 1 276 ? 88.693  13.772  27.411 1.00 31.59 ? 929  CYS B CA  1 
ATOM   4966  C  C   . CYS B 1 276 ? 87.617  14.133  28.419 1.00 30.49 ? 929  CYS B C   1 
ATOM   4967  O  O   . CYS B 1 276 ? 87.617  15.228  28.968 1.00 29.92 ? 929  CYS B O   1 
ATOM   4968  C  CB  . CYS B 1 276 ? 88.168  14.085  26.020 1.00 32.07 ? 929  CYS B CB  1 
ATOM   4969  S  SG  . CYS B 1 276 ? 89.469  14.320  24.750 1.00 36.05 ? 929  CYS B SG  1 
ATOM   4970  N  N   . GLN B 1 277 ? 86.700  13.202  28.644 1.00 29.25 ? 930  GLN B N   1 
ATOM   4971  C  CA  . GLN B 1 277 ? 85.613  13.397  29.569 1.00 28.72 ? 930  GLN B CA  1 
ATOM   4972  C  C   . GLN B 1 277 ? 86.086  13.414  31.017 1.00 29.69 ? 930  GLN B C   1 
ATOM   4973  O  O   . GLN B 1 277 ? 85.528  14.134  31.860 1.00 30.47 ? 930  GLN B O   1 
ATOM   4974  C  CB  . GLN B 1 277 ? 84.589  12.292  29.391 1.00 28.63 ? 930  GLN B CB  1 
ATOM   4975  C  CG  . GLN B 1 277 ? 83.951  12.289  28.041 1.00 30.78 ? 930  GLN B CG  1 
ATOM   4976  C  CD  . GLN B 1 277 ? 82.913  11.214  27.907 1.00 31.27 ? 930  GLN B CD  1 
ATOM   4977  O  OE1 . GLN B 1 277 ? 83.226  10.038  28.030 1.00 34.07 ? 930  GLN B OE1 1 
ATOM   4978  N  NE2 . GLN B 1 277 ? 81.660  11.612  27.655 1.00 32.12 ? 930  GLN B NE2 1 
ATOM   4979  N  N   . VAL B 1 278 ? 87.096  12.607  31.316 1.00 29.16 ? 931  VAL B N   1 
ATOM   4980  C  CA  . VAL B 1 278 ? 87.610  12.561  32.667 1.00 30.38 ? 931  VAL B CA  1 
ATOM   4981  C  C   . VAL B 1 278 ? 88.460  13.804  32.836 1.00 30.32 ? 931  VAL B C   1 
ATOM   4982  O  O   . VAL B 1 278 ? 88.521  14.379  33.914 1.00 30.33 ? 931  VAL B O   1 
ATOM   4983  C  CB  . VAL B 1 278 ? 88.431  11.231  32.913 1.00 33.05 ? 931  VAL B CB  1 
ATOM   4984  C  CG1 . VAL B 1 278 ? 89.163  11.271  34.255 1.00 32.64 ? 931  VAL B CG1 1 
ATOM   4985  C  CG2 . VAL B 1 278 ? 87.456  10.048  32.934 1.00 34.56 ? 931  VAL B CG2 1 
ATOM   4986  N  N   . CYS B 1 279 ? 89.088  14.248  31.756 1.00 30.22 ? 932  CYS B N   1 
ATOM   4987  C  CA  . CYS B 1 279 ? 89.903  15.432  31.869 1.00 32.04 ? 932  CYS B CA  1 
ATOM   4988  C  C   . CYS B 1 279 ? 89.020  16.648  32.186 1.00 33.00 ? 932  CYS B C   1 
ATOM   4989  O  O   . CYS B 1 279 ? 89.341  17.411  33.092 1.00 33.45 ? 932  CYS B O   1 
ATOM   4990  C  CB  . CYS B 1 279 ? 90.719  15.660  30.590 1.00 33.04 ? 932  CYS B CB  1 
ATOM   4991  S  SG  . CYS B 1 279 ? 91.731  17.128  30.688 1.00 35.82 ? 932  CYS B SG  1 
ATOM   4992  N  N   . ILE B 1 280 ? 87.891  16.803  31.491 1.00 30.70 ? 933  ILE B N   1 
ATOM   4993  C  CA  . ILE B 1 280 ? 87.062  17.958  31.779 1.00 31.25 ? 933  ILE B CA  1 
ATOM   4994  C  C   . ILE B 1 280 ? 86.350  17.815  33.134 1.00 31.57 ? 933  ILE B C   1 
ATOM   4995  O  O   . ILE B 1 280 ? 86.015  18.810  33.761 1.00 31.80 ? 933  ILE B O   1 
ATOM   4996  C  CB  . ILE B 1 280 ? 86.035  18.279  30.609 1.00 28.75 ? 933  ILE B CB  1 
ATOM   4997  C  CG1 . ILE B 1 280 ? 85.376  19.642  30.867 1.00 26.65 ? 933  ILE B CG1 1 
ATOM   4998  C  CG2 . ILE B 1 280 ? 84.993  17.180  30.487 1.00 25.08 ? 933  ILE B CG2 1 
ATOM   4999  C  CD1 . ILE B 1 280 ? 84.547  20.219  29.692 1.00 25.61 ? 933  ILE B CD1 1 
ATOM   5000  N  N   . LYS B 1 281 ? 86.137  16.584  33.597 1.00 32.50 ? 934  LYS B N   1 
ATOM   5001  C  CA  . LYS B 1 281 ? 85.499  16.391  34.906 1.00 31.49 ? 934  LYS B CA  1 
ATOM   5002  C  C   . LYS B 1 281 ? 86.452  16.872  36.014 1.00 32.15 ? 934  LYS B C   1 
ATOM   5003  O  O   . LYS B 1 281 ? 86.041  17.494  36.987 1.00 31.78 ? 934  LYS B O   1 
ATOM   5004  C  CB  . LYS B 1 281 ? 85.144  14.918  35.137 1.00 28.17 ? 934  LYS B CB  1 
ATOM   5005  C  CG  . LYS B 1 281 ? 83.976  14.420  34.319 1.00 27.99 ? 934  LYS B CG  1 
ATOM   5006  C  CD  . LYS B 1 281 ? 83.504  13.010  34.696 1.00 25.10 ? 934  LYS B CD  1 
ATOM   5007  C  CE  . LYS B 1 281 ? 83.428  12.780  36.211 1.00 28.24 ? 934  LYS B CE  1 
ATOM   5008  N  NZ  . LYS B 1 281 ? 82.291  13.400  36.932 1.00 32.67 ? 934  LYS B NZ  1 
ATOM   5009  N  N   . LEU B 1 282 ? 87.733  16.568  35.858 1.00 34.50 ? 935  LEU B N   1 
ATOM   5010  C  CA  . LEU B 1 282 ? 88.724  16.960  36.838 1.00 34.63 ? 935  LEU B CA  1 
ATOM   5011  C  C   . LEU B 1 282 ? 88.806  18.483  36.857 1.00 32.94 ? 935  LEU B C   1 
ATOM   5012  O  O   . LEU B 1 282 ? 88.667  19.115  37.905 1.00 33.99 ? 935  LEU B O   1 
ATOM   5013  C  CB  . LEU B 1 282 ? 90.071  16.331  36.480 1.00 35.09 ? 935  LEU B CB  1 
ATOM   5014  C  CG  . LEU B 1 282 ? 91.117  16.263  37.597 1.00 36.83 ? 935  LEU B CG  1 
ATOM   5015  C  CD1 . LEU B 1 282 ? 92.168  15.221  37.247 1.00 37.07 ? 935  LEU B CD1 1 
ATOM   5016  C  CD2 . LEU B 1 282 ? 91.764  17.618  37.798 1.00 37.14 ? 935  LEU B CD2 1 
ATOM   5017  N  N   . ALA B 1 283 ? 89.014  19.063  35.679 1.00 33.15 ? 936  ALA B N   1 
ATOM   5018  C  CA  . ALA B 1 283 ? 89.101  20.514  35.532 1.00 32.44 ? 936  ALA B CA  1 
ATOM   5019  C  C   . ALA B 1 283 ? 87.869  21.223  36.071 1.00 31.79 ? 936  ALA B C   1 
ATOM   5020  O  O   . ALA B 1 283 ? 87.967  22.340  36.550 1.00 32.54 ? 936  ALA B O   1 
ATOM   5021  C  CB  . ALA B 1 283 ? 89.291  20.874  34.088 1.00 30.18 ? 936  ALA B CB  1 
ATOM   5022  N  N   . ASP B 1 284 ? 86.717  20.566  36.011 1.00 30.77 ? 937  ASP B N   1 
ATOM   5023  C  CA  . ASP B 1 284 ? 85.488  21.169  36.477 1.00 30.97 ? 937  ASP B CA  1 
ATOM   5024  C  C   . ASP B 1 284 ? 85.412  21.334  37.992 1.00 30.38 ? 937  ASP B C   1 
ATOM   5025  O  O   . ASP B 1 284 ? 84.766  22.257  38.500 1.00 30.49 ? 937  ASP B O   1 
ATOM   5026  C  CB  . ASP B 1 284 ? 84.283  20.365  35.965 1.00 31.87 ? 937  ASP B CB  1 
ATOM   5027  C  CG  . ASP B 1 284 ? 82.976  21.148  36.071 1.00 32.49 ? 937  ASP B CG  1 
ATOM   5028  O  OD1 . ASP B 1 284 ? 83.043  22.401  35.934 1.00 34.75 ? 937  ASP B OD1 1 
ATOM   5029  O  OD2 . ASP B 1 284 ? 81.891  20.520  36.254 1.00 31.03 ? 937  ASP B OD2 1 
ATOM   5030  N  N   . ILE B 1 285 ? 86.053  20.428  38.712 1.00 29.56 ? 938  ILE B N   1 
ATOM   5031  C  CA  . ILE B 1 285 ? 86.080  20.499  40.155 1.00 29.78 ? 938  ILE B CA  1 
ATOM   5032  C  C   . ILE B 1 285 ? 87.533  20.636  40.651 1.00 31.45 ? 938  ILE B C   1 
ATOM   5033  O  O   . ILE B 1 285 ? 87.896  20.076  41.697 1.00 30.38 ? 938  ILE B O   1 
ATOM   5034  C  CB  . ILE B 1 285 ? 85.446  19.238  40.765 1.00 28.97 ? 938  ILE B CB  1 
ATOM   5035  C  CG1 . ILE B 1 285 ? 86.147  17.990  40.242 1.00 28.41 ? 938  ILE B CG1 1 
ATOM   5036  C  CG2 . ILE B 1 285 ? 83.950  19.202  40.433 1.00 26.89 ? 938  ILE B CG2 1 
ATOM   5037  C  CD1 . ILE B 1 285 ? 85.634  16.702  40.870 1.00 27.53 ? 938  ILE B CD1 1 
ATOM   5038  N  N   . ASN B 1 286 ? 88.354  21.392  39.918 1.00 31.87 ? 939  ASN B N   1 
ATOM   5039  C  CA  . ASN B 1 286 ? 89.770  21.499  40.264 1.00 35.10 ? 939  ASN B CA  1 
ATOM   5040  C  C   . ASN B 1 286 ? 90.159  22.241  41.556 1.00 36.65 ? 939  ASN B C   1 
ATOM   5041  O  O   . ASN B 1 286 ? 91.258  22.033  42.070 1.00 36.40 ? 939  ASN B O   1 
ATOM   5042  C  CB  . ASN B 1 286 ? 90.562  22.084  39.077 1.00 35.70 ? 939  ASN B CB  1 
ATOM   5043  C  CG  . ASN B 1 286 ? 90.484  23.593  38.995 1.00 35.20 ? 939  ASN B CG  1 
ATOM   5044  O  OD1 . ASN B 1 286 ? 90.328  24.147  37.919 1.00 38.74 ? 939  ASN B OD1 1 
ATOM   5045  N  ND2 . ASN B 1 286 ? 90.606  24.264  40.124 1.00 36.42 ? 939  ASN B ND2 1 
ATOM   5046  N  N   . GLY B 1 287 ? 89.272  23.096  42.061 1.00 37.34 ? 940  GLY B N   1 
ATOM   5047  C  CA  . GLY B 1 287 ? 89.550  23.851  43.262 1.00 38.88 ? 940  GLY B CA  1 
ATOM   5048  C  C   . GLY B 1 287 ? 90.468  23.246  44.310 1.00 40.71 ? 940  GLY B C   1 
ATOM   5049  O  O   . GLY B 1 287 ? 91.581  23.721  44.513 1.00 40.40 ? 940  GLY B O   1 
ATOM   5050  N  N   . PRO B 1 288 ? 90.037  22.185  44.997 1.00 41.05 ? 941  PRO B N   1 
ATOM   5051  C  CA  . PRO B 1 288 ? 90.898  21.586  46.021 1.00 40.34 ? 941  PRO B CA  1 
ATOM   5052  C  C   . PRO B 1 288 ? 92.239  20.978  45.593 1.00 41.16 ? 941  PRO B C   1 
ATOM   5053  O  O   . PRO B 1 288 ? 92.995  20.481  46.436 1.00 41.20 ? 941  PRO B O   1 
ATOM   5054  C  CB  . PRO B 1 288 ? 89.973  20.573  46.693 1.00 39.48 ? 941  PRO B CB  1 
ATOM   5055  C  CG  . PRO B 1 288 ? 88.942  20.277  45.650 1.00 39.12 ? 941  PRO B CG  1 
ATOM   5056  C  CD  . PRO B 1 288 ? 88.697  21.578  45.000 1.00 40.14 ? 941  PRO B CD  1 
ATOM   5057  N  N   . ALA B 1 289 ? 92.553  21.009  44.304 1.00 40.25 ? 942  ALA B N   1 
ATOM   5058  C  CA  . ALA B 1 289 ? 93.836  20.460  43.847 1.00 40.02 ? 942  ALA B CA  1 
ATOM   5059  C  C   . ALA B 1 289 ? 94.751  21.602  43.385 1.00 40.27 ? 942  ALA B C   1 
ATOM   5060  O  O   . ALA B 1 289 ? 95.746  21.398  42.683 1.00 39.73 ? 942  ALA B O   1 
ATOM   5061  C  CB  . ALA B 1 289 ? 93.611  19.466  42.724 1.00 37.71 ? 942  ALA B CB  1 
ATOM   5062  N  N   . LYS B 1 290 ? 94.364  22.805  43.782 1.00 40.22 ? 943  LYS B N   1 
ATOM   5063  C  CA  . LYS B 1 290 ? 95.085  24.017  43.481 1.00 41.07 ? 943  LYS B CA  1 
ATOM   5064  C  C   . LYS B 1 290 ? 95.669  24.463  44.813 1.00 42.31 ? 943  LYS B C   1 
ATOM   5065  O  O   . LYS B 1 290 ? 95.398  23.855  45.846 1.00 43.16 ? 943  LYS B O   1 
ATOM   5066  C  CB  . LYS B 1 290 ? 94.128  25.101  42.950 1.00 40.37 ? 943  LYS B CB  1 
ATOM   5067  C  CG  . LYS B 1 290 ? 93.574  24.876  41.538 1.00 38.98 ? 943  LYS B CG  1 
ATOM   5068  C  CD  . LYS B 1 290 ? 94.661  25.031  40.481 1.00 36.79 ? 943  LYS B CD  1 
ATOM   5069  C  CE  . LYS B 1 290 ? 94.119  24.869  39.043 1.00 36.64 ? 943  LYS B CE  1 
ATOM   5070  N  NZ  . LYS B 1 290 ? 93.151  25.930  38.593 1.00 31.61 ? 943  LYS B NZ  1 
ATOM   5071  N  N   . VAL B 1 291 ? 96.467  25.525  44.787 1.00 42.92 ? 944  VAL B N   1 
ATOM   5072  C  CA  . VAL B 1 291 ? 97.075  26.056  45.992 1.00 41.94 ? 944  VAL B CA  1 
ATOM   5073  C  C   . VAL B 1 291 ? 95.990  26.568  46.946 1.00 42.55 ? 944  VAL B C   1 
ATOM   5074  O  O   . VAL B 1 291 ? 94.956  27.073  46.520 1.00 43.70 ? 944  VAL B O   1 
ATOM   5075  C  CB  . VAL B 1 291 ? 98.098  27.181  45.616 1.00 40.43 ? 944  VAL B CB  1 
ATOM   5076  C  CG1 . VAL B 1 291 ? 97.375  28.381  45.013 1.00 40.16 ? 944  VAL B CG1 1 
ATOM   5077  C  CG2 . VAL B 1 291 ? 98.928  27.566  46.823 1.00 39.00 ? 944  VAL B CG2 1 
ATOM   5078  N  N   . ARG B 1 292 ? 96.237  26.424  48.241 1.00 43.49 ? 945  ARG B N   1 
ATOM   5079  C  CA  . ARG B 1 292 ? 95.303  26.857  49.272 1.00 43.71 ? 945  ARG B CA  1 
ATOM   5080  C  C   . ARG B 1 292 ? 94.546  28.183  49.017 1.00 44.15 ? 945  ARG B C   1 
ATOM   5081  O  O   . ARG B 1 292 ? 93.362  28.295  49.310 1.00 44.70 ? 945  ARG B O   1 
ATOM   5082  C  CB  . ARG B 1 292 ? 96.057  26.939  50.603 1.00 44.25 ? 945  ARG B CB  1 
ATOM   5083  C  CG  . ARG B 1 292 ? 95.310  27.675  51.706 1.00 45.39 ? 945  ARG B CG  1 
ATOM   5084  C  CD  . ARG B 1 292 ? 96.248  28.194  52.802 1.00 43.30 ? 945  ARG B CD  1 
ATOM   5085  N  NE  . ARG B 1 292 ? 95.487  28.869  53.847 1.00 42.18 ? 945  ARG B NE  1 
ATOM   5086  C  CZ  . ARG B 1 292 ? 95.007  28.272  54.937 1.00 43.84 ? 945  ARG B CZ  1 
ATOM   5087  N  NH1 . ARG B 1 292 ? 95.226  26.976  55.147 1.00 44.16 ? 945  ARG B NH1 1 
ATOM   5088  N  NH2 . ARG B 1 292 ? 94.264  28.959  55.800 1.00 43.10 ? 945  ARG B NH2 1 
ATOM   5089  N  N   . ASP B 1 293 ? 95.216  29.186  48.476 1.00 44.58 ? 946  ASP B N   1 
ATOM   5090  C  CA  . ASP B 1 293 ? 94.565  30.479  48.248 1.00 45.89 ? 946  ASP B CA  1 
ATOM   5091  C  C   . ASP B 1 293 ? 93.534  30.424  47.136 1.00 44.72 ? 946  ASP B C   1 
ATOM   5092  O  O   . ASP B 1 293 ? 92.516  31.097  47.186 1.00 43.66 ? 946  ASP B O   1 
ATOM   5093  C  CB  . ASP B 1 293 ? 95.608  31.552  47.903 1.00 50.40 ? 946  ASP B CB  1 
ATOM   5094  C  CG  . ASP B 1 293 ? 97.019  31.153  48.326 1.00 54.79 ? 946  ASP B CG  1 
ATOM   5095  O  OD1 . ASP B 1 293 ? 97.257  30.982  49.549 1.00 55.94 ? 946  ASP B OD1 1 
ATOM   5096  O  OD2 . ASP B 1 293 ? 97.889  31.001  47.425 1.00 58.14 ? 946  ASP B OD2 1 
ATOM   5097  N  N   . LEU B 1 294 ? 93.819  29.640  46.110 1.00 43.14 ? 947  LEU B N   1 
ATOM   5098  C  CA  . LEU B 1 294 ? 92.888  29.501  45.006 1.00 40.97 ? 947  LEU B CA  1 
ATOM   5099  C  C   . LEU B 1 294 ? 91.714  28.648  45.530 1.00 39.52 ? 947  LEU B C   1 
ATOM   5100  O  O   . LEU B 1 294 ? 90.561  29.030  45.404 1.00 38.77 ? 947  LEU B O   1 
ATOM   5101  C  CB  . LEU B 1 294 ? 93.605  28.832  43.823 1.00 39.65 ? 947  LEU B CB  1 
ATOM   5102  C  CG  . LEU B 1 294 ? 93.836  29.606  42.514 1.00 38.65 ? 947  LEU B CG  1 
ATOM   5103  C  CD1 . LEU B 1 294 ? 93.890  31.084  42.723 1.00 35.48 ? 947  LEU B CD1 1 
ATOM   5104  C  CD2 . LEU B 1 294 ? 95.118  29.117  41.862 1.00 37.70 ? 947  LEU B CD2 1 
ATOM   5105  N  N   . HIS B 1 295 ? 92.042  27.526  46.164 1.00 38.18 ? 948  HIS B N   1 
ATOM   5106  C  CA  . HIS B 1 295 ? 91.069  26.596  46.734 1.00 37.47 ? 948  HIS B CA  1 
ATOM   5107  C  C   . HIS B 1 295 ? 89.978  27.216  47.583 1.00 38.04 ? 948  HIS B C   1 
ATOM   5108  O  O   . HIS B 1 295 ? 88.811  26.828  47.466 1.00 37.05 ? 948  HIS B O   1 
ATOM   5109  C  CB  . HIS B 1 295 ? 91.794  25.537  47.561 1.00 37.70 ? 948  HIS B CB  1 
ATOM   5110  C  CG  . HIS B 1 295 ? 90.909  24.773  48.499 1.00 40.75 ? 948  HIS B CG  1 
ATOM   5111  N  ND1 . HIS B 1 295 ? 89.701  24.225  48.114 1.00 42.06 ? 948  HIS B ND1 1 
ATOM   5112  C  CD2 . HIS B 1 295 ? 91.082  24.420  49.796 1.00 41.38 ? 948  HIS B CD2 1 
ATOM   5113  C  CE1 . HIS B 1 295 ? 89.170  23.569  49.130 1.00 40.81 ? 948  HIS B CE1 1 
ATOM   5114  N  NE2 . HIS B 1 295 ? 89.988  23.669  50.162 1.00 44.02 ? 948  HIS B NE2 1 
ATOM   5115  N  N   . LEU B 1 296 ? 90.356  28.160  48.444 1.00 38.18 ? 949  LEU B N   1 
ATOM   5116  C  CA  . LEU B 1 296 ? 89.418  28.822  49.343 1.00 38.10 ? 949  LEU B CA  1 
ATOM   5117  C  C   . LEU B 1 296 ? 88.570  29.885  48.638 1.00 38.41 ? 949  LEU B C   1 
ATOM   5118  O  O   . LEU B 1 296 ? 87.440  30.173  49.046 1.00 38.69 ? 949  LEU B O   1 
ATOM   5119  C  CB  . LEU B 1 296 ? 90.180  29.453  50.509 1.00 37.87 ? 949  LEU B CB  1 
ATOM   5120  C  CG  . LEU B 1 296 ? 91.128  28.515  51.245 1.00 39.21 ? 949  LEU B CG  1 
ATOM   5121  C  CD1 . LEU B 1 296 ? 92.046  29.349  52.143 1.00 41.06 ? 949  LEU B CD1 1 
ATOM   5122  C  CD2 . LEU B 1 296 ? 90.353  27.484  52.055 1.00 38.69 ? 949  LEU B CD2 1 
ATOM   5123  N  N   . LYS B 1 297 ? 89.122  30.475  47.589 1.00 37.95 ? 950  LYS B N   1 
ATOM   5124  C  CA  . LYS B 1 297 ? 88.391  31.473  46.838 1.00 40.58 ? 950  LYS B CA  1 
ATOM   5125  C  C   . LYS B 1 297 ? 87.201  30.773  46.097 1.00 40.07 ? 950  LYS B C   1 
ATOM   5126  O  O   . LYS B 1 297 ? 86.072  31.287  46.054 1.00 38.77 ? 950  LYS B O   1 
ATOM   5127  C  CB  . LYS B 1 297 ? 89.340  32.166  45.859 1.00 41.53 ? 950  LYS B CB  1 
ATOM   5128  C  CG  . LYS B 1 297 ? 88.792  33.458  45.334 1.00 45.08 ? 950  LYS B CG  1 
ATOM   5129  C  CD  . LYS B 1 297 ? 88.885  34.594  46.343 1.00 45.24 ? 950  LYS B CD  1 
ATOM   5130  C  CE  . LYS B 1 297 ? 88.091  35.822  45.846 1.00 47.92 ? 950  LYS B CE  1 
ATOM   5131  N  NZ  . LYS B 1 297 ? 86.623  35.797  46.241 1.00 50.09 ? 950  LYS B NZ  1 
ATOM   5132  N  N   . TRP B 1 298 ? 87.455  29.586  45.553 1.00 38.05 ? 951  TRP B N   1 
ATOM   5133  C  CA  . TRP B 1 298 ? 86.411  28.812  44.866 1.00 38.03 ? 951  TRP B CA  1 
ATOM   5134  C  C   . TRP B 1 298 ? 85.410  28.210  45.875 1.00 37.48 ? 951  TRP B C   1 
ATOM   5135  O  O   . TRP B 1 298 ? 84.189  28.191  45.638 1.00 37.31 ? 951  TRP B O   1 
ATOM   5136  C  CB  . TRP B 1 298 ? 87.056  27.719  44.000 1.00 35.98 ? 951  TRP B CB  1 
ATOM   5137  C  CG  . TRP B 1 298 ? 87.734  28.318  42.787 1.00 35.16 ? 951  TRP B CG  1 
ATOM   5138  C  CD1 . TRP B 1 298 ? 89.063  28.288  42.492 1.00 32.48 ? 951  TRP B CD1 1 
ATOM   5139  C  CD2 . TRP B 1 298 ? 87.105  29.100  41.745 1.00 36.26 ? 951  TRP B CD2 1 
ATOM   5140  N  NE1 . TRP B 1 298 ? 89.306  29.013  41.340 1.00 36.75 ? 951  TRP B NE1 1 
ATOM   5141  C  CE2 . TRP B 1 298 ? 88.121  29.518  40.864 1.00 36.31 ? 951  TRP B CE2 1 
ATOM   5142  C  CE3 . TRP B 1 298 ? 85.776  29.487  41.478 1.00 37.61 ? 951  TRP B CE3 1 
ATOM   5143  C  CZ2 . TRP B 1 298 ? 87.858  30.295  39.730 1.00 35.62 ? 951  TRP B CZ2 1 
ATOM   5144  C  CZ3 . TRP B 1 298 ? 85.518  30.268  40.343 1.00 37.02 ? 951  TRP B CZ3 1 
ATOM   5145  C  CH2 . TRP B 1 298 ? 86.553  30.661  39.492 1.00 36.52 ? 951  TRP B CH2 1 
ATOM   5146  N  N   . THR B 1 299 ? 85.935  27.772  47.017 1.00 35.22 ? 952  THR B N   1 
ATOM   5147  C  CA  . THR B 1 299 ? 85.116  27.213  48.074 1.00 33.96 ? 952  THR B CA  1 
ATOM   5148  C  C   . THR B 1 299 ? 84.130  28.250  48.525 1.00 33.88 ? 952  THR B C   1 
ATOM   5149  O  O   . THR B 1 299 ? 82.971  27.953  48.723 1.00 35.42 ? 952  THR B O   1 
ATOM   5150  C  CB  . THR B 1 299 ? 85.950  26.811  49.256 1.00 31.54 ? 952  THR B CB  1 
ATOM   5151  O  OG1 . THR B 1 299 ? 86.856  25.806  48.842 1.00 30.65 ? 952  THR B OG1 1 
ATOM   5152  C  CG2 . THR B 1 299 ? 85.101  26.274  50.358 1.00 30.68 ? 952  THR B CG2 1 
ATOM   5153  N  N   . GLU B 1 300 ? 84.605  29.470  48.696 1.00 34.46 ? 953  GLU B N   1 
ATOM   5154  C  CA  . GLU B 1 300 ? 83.746  30.581  49.094 1.00 35.28 ? 953  GLU B CA  1 
ATOM   5155  C  C   . GLU B 1 300 ? 82.626  30.799  48.075 1.00 34.54 ? 953  GLU B C   1 
ATOM   5156  O  O   . GLU B 1 300 ? 81.493  31.070  48.448 1.00 35.56 ? 953  GLU B O   1 
ATOM   5157  C  CB  . GLU B 1 300 ? 84.574  31.863  49.223 1.00 34.27 ? 953  GLU B CB  1 
ATOM   5158  C  CG  . GLU B 1 300 ? 83.749  33.127  49.381 1.00 37.09 ? 953  GLU B CG  1 
ATOM   5159  C  CD  . GLU B 1 300 ? 84.602  34.363  49.704 1.00 39.98 ? 953  GLU B CD  1 
ATOM   5160  O  OE1 . GLU B 1 300 ? 84.014  35.422  50.023 1.00 39.49 ? 953  GLU B OE1 1 
ATOM   5161  O  OE2 . GLU B 1 300 ? 85.854  34.272  49.634 1.00 40.53 ? 953  GLU B OE2 1 
ATOM   5162  N  N   . GLY B 1 301 ? 82.950  30.678  46.788 1.00 35.14 ? 954  GLY B N   1 
ATOM   5163  C  CA  . GLY B 1 301 ? 81.956  30.869  45.744 1.00 32.68 ? 954  GLY B CA  1 
ATOM   5164  C  C   . GLY B 1 301 ? 80.844  29.829  45.748 1.00 32.83 ? 954  GLY B C   1 
ATOM   5165  O  O   . GLY B 1 301 ? 79.646  30.164  45.620 1.00 30.61 ? 954  GLY B O   1 
ATOM   5166  N  N   . ILE B 1 302 ? 81.228  28.568  45.912 1.00 31.46 ? 955  ILE B N   1 
ATOM   5167  C  CA  . ILE B 1 302 ? 80.242  27.512  45.921 1.00 32.44 ? 955  ILE B CA  1 
ATOM   5168  C  C   . ILE B 1 302 ? 79.334  27.588  47.170 1.00 33.48 ? 955  ILE B C   1 
ATOM   5169  O  O   . ILE B 1 302 ? 78.140  27.301  47.097 1.00 34.44 ? 955  ILE B O   1 
ATOM   5170  C  CB  . ILE B 1 302 ? 80.936  26.122  45.768 1.00 31.10 ? 955  ILE B CB  1 
ATOM   5171  C  CG1 . ILE B 1 302 ? 79.893  25.037  45.430 1.00 31.11 ? 955  ILE B CG1 1 
ATOM   5172  C  CG2 . ILE B 1 302 ? 81.656  25.752  47.050 1.00 32.08 ? 955  ILE B CG2 1 
ATOM   5173  C  CD1 . ILE B 1 302 ? 79.056  25.277  44.184 1.00 26.58 ? 955  ILE B CD1 1 
ATOM   5174  N  N   . VAL B 1 303 ? 79.870  28.015  48.310 1.00 35.17 ? 956  VAL B N   1 
ATOM   5175  C  CA  . VAL B 1 303 ? 79.032  28.097  49.501 1.00 35.91 ? 956  VAL B CA  1 
ATOM   5176  C  C   . VAL B 1 303 ? 78.027  29.229  49.385 1.00 36.15 ? 956  VAL B C   1 
ATOM   5177  O  O   . VAL B 1 303 ? 76.882  29.082  49.794 1.00 37.04 ? 956  VAL B O   1 
ATOM   5178  C  CB  . VAL B 1 303 ? 79.836  28.301  50.803 1.00 35.72 ? 956  VAL B CB  1 
ATOM   5179  C  CG1 . VAL B 1 303 ? 80.758  27.151  51.036 1.00 37.20 ? 956  VAL B CG1 1 
ATOM   5180  C  CG2 . VAL B 1 303 ? 80.611  29.548  50.721 1.00 40.42 ? 956  VAL B CG2 1 
ATOM   5181  N  N   . ASN B 1 304 ? 78.435  30.361  48.836 1.00 36.22 ? 957  ASN B N   1 
ATOM   5182  C  CA  . ASN B 1 304 ? 77.491  31.450  48.707 1.00 36.41 ? 957  ASN B CA  1 
ATOM   5183  C  C   . ASN B 1 304 ? 76.384  31.051  47.735 1.00 36.30 ? 957  ASN B C   1 
ATOM   5184  O  O   . ASN B 1 304 ? 75.229  31.415  47.921 1.00 37.67 ? 957  ASN B O   1 
ATOM   5185  C  CB  . ASN B 1 304 ? 78.198  32.748  48.250 1.00 36.13 ? 957  ASN B CB  1 
ATOM   5186  C  CG  . ASN B 1 304 ? 79.166  33.312  49.319 1.00 35.54 ? 957  ASN B CG  1 
ATOM   5187  O  OD1 . ASN B 1 304 ? 78.950  33.160  50.507 1.00 36.89 ? 957  ASN B OD1 1 
ATOM   5188  N  ND2 . ASN B 1 304 ? 80.209  33.980  48.879 1.00 36.82 ? 957  ASN B ND2 1 
ATOM   5189  N  N   . GLU B 1 305 ? 76.727  30.280  46.706 1.00 36.35 ? 958  GLU B N   1 
ATOM   5190  C  CA  . GLU B 1 305 ? 75.719  29.871  45.734 1.00 35.01 ? 958  GLU B CA  1 
ATOM   5191  C  C   . GLU B 1 305 ? 74.705  28.901  46.384 1.00 34.44 ? 958  GLU B C   1 
ATOM   5192  O  O   . GLU B 1 305 ? 73.507  29.039  46.208 1.00 31.92 ? 958  GLU B O   1 
ATOM   5193  C  CB  . GLU B 1 305 ? 76.393  29.266  44.495 1.00 33.96 ? 958  GLU B CB  1 
ATOM   5194  C  CG  . GLU B 1 305 ? 75.564  29.490  43.266 1.00 36.61 ? 958  GLU B CG  1 
ATOM   5195  C  CD  . GLU B 1 305 ? 76.208  29.023  41.991 1.00 37.85 ? 958  GLU B CD  1 
ATOM   5196  O  OE1 . GLU B 1 305 ? 77.115  29.731  41.479 1.00 40.41 ? 958  GLU B OE1 1 
ATOM   5197  O  OE2 . GLU B 1 305 ? 75.803  27.939  41.494 1.00 39.72 ? 958  GLU B OE2 1 
ATOM   5198  N  N   . PHE B 1 306 ? 75.196  27.953  47.169 1.00 34.10 ? 959  PHE B N   1 
ATOM   5199  C  CA  . PHE B 1 306 ? 74.320  27.035  47.872 1.00 34.60 ? 959  PHE B CA  1 
ATOM   5200  C  C   . PHE B 1 306 ? 73.382  27.785  48.831 1.00 34.68 ? 959  PHE B C   1 
ATOM   5201  O  O   . PHE B 1 306 ? 72.251  27.372  49.056 1.00 36.34 ? 959  PHE B O   1 
ATOM   5202  C  CB  . PHE B 1 306 ? 75.141  26.006  48.689 1.00 30.68 ? 959  PHE B CB  1 
ATOM   5203  C  CG  . PHE B 1 306 ? 75.735  24.872  47.872 1.00 28.73 ? 959  PHE B CG  1 
ATOM   5204  C  CD1 . PHE B 1 306 ? 76.494  23.866  48.501 1.00 28.00 ? 959  PHE B CD1 1 
ATOM   5205  C  CD2 . PHE B 1 306 ? 75.554  24.794  46.499 1.00 26.07 ? 959  PHE B CD2 1 
ATOM   5206  C  CE1 . PHE B 1 306 ? 77.066  22.802  47.758 1.00 25.63 ? 959  PHE B CE1 1 
ATOM   5207  C  CE2 . PHE B 1 306 ? 76.117  23.737  45.751 1.00 27.63 ? 959  PHE B CE2 1 
ATOM   5208  C  CZ  . PHE B 1 306 ? 76.880  22.739  46.396 1.00 25.74 ? 959  PHE B CZ  1 
ATOM   5209  N  N   . TYR B 1 307 ? 73.860  28.876  49.416 1.00 36.68 ? 960  TYR B N   1 
ATOM   5210  C  CA  . TYR B 1 307 ? 73.059  29.644  50.362 1.00 37.39 ? 960  TYR B CA  1 
ATOM   5211  C  C   . TYR B 1 307 ? 71.954  30.383  49.638 1.00 37.53 ? 960  TYR B C   1 
ATOM   5212  O  O   . TYR B 1 307 ? 70.871  30.521  50.168 1.00 37.71 ? 960  TYR B O   1 
ATOM   5213  C  CB  . TYR B 1 307 ? 73.940  30.635  51.160 1.00 38.11 ? 960  TYR B CB  1 
ATOM   5214  C  CG  . TYR B 1 307 ? 74.846  29.989  52.199 1.00 35.73 ? 960  TYR B CG  1 
ATOM   5215  C  CD1 . TYR B 1 307 ? 75.882  30.707  52.794 1.00 36.37 ? 960  TYR B CD1 1 
ATOM   5216  C  CD2 . TYR B 1 307 ? 74.654  28.673  52.597 1.00 36.06 ? 960  TYR B CD2 1 
ATOM   5217  C  CE1 . TYR B 1 307 ? 76.703  30.120  53.760 1.00 36.71 ? 960  TYR B CE1 1 
ATOM   5218  C  CE2 . TYR B 1 307 ? 75.462  28.078  53.549 1.00 35.19 ? 960  TYR B CE2 1 
ATOM   5219  C  CZ  . TYR B 1 307 ? 76.494  28.802  54.125 1.00 37.51 ? 960  TYR B CZ  1 
ATOM   5220  O  OH  . TYR B 1 307 ? 77.369  28.173  54.992 1.00 37.25 ? 960  TYR B OH  1 
ATOM   5221  N  N   . GLU B 1 308 ? 72.218  30.867  48.432 1.00 39.41 ? 961  GLU B N   1 
ATOM   5222  C  CA  . GLU B 1 308 ? 71.158  31.545  47.703 1.00 40.94 ? 961  GLU B CA  1 
ATOM   5223  C  C   . GLU B 1 308 ? 70.084  30.538  47.355 1.00 39.51 ? 961  GLU B C   1 
ATOM   5224  O  O   . GLU B 1 308 ? 68.898  30.842  47.456 1.00 40.43 ? 961  GLU B O   1 
ATOM   5225  C  CB  . GLU B 1 308 ? 71.698  32.219  46.458 1.00 42.44 ? 961  GLU B CB  1 
ATOM   5226  C  CG  . GLU B 1 308 ? 72.247  33.578  46.763 1.00 47.62 ? 961  GLU B CG  1 
ATOM   5227  C  CD  . GLU B 1 308 ? 73.088  34.136  45.650 1.00 52.04 ? 961  GLU B CD  1 
ATOM   5228  O  OE1 . GLU B 1 308 ? 72.721  33.964  44.460 1.00 53.61 ? 961  GLU B OE1 1 
ATOM   5229  O  OE2 . GLU B 1 308 ? 74.129  34.762  45.973 1.00 56.49 ? 961  GLU B OE2 1 
ATOM   5230  N  N   . GLN B 1 309 ? 70.495  29.327  46.990 1.00 38.14 ? 962  GLN B N   1 
ATOM   5231  C  CA  . GLN B 1 309 ? 69.528  28.267  46.676 1.00 37.53 ? 962  GLN B CA  1 
ATOM   5232  C  C   . GLN B 1 309 ? 68.709  27.886  47.913 1.00 38.25 ? 962  GLN B C   1 
ATOM   5233  O  O   . GLN B 1 309 ? 67.500  27.678  47.821 1.00 37.82 ? 962  GLN B O   1 
ATOM   5234  C  CB  . GLN B 1 309 ? 70.209  26.998  46.155 1.00 35.48 ? 962  GLN B CB  1 
ATOM   5235  C  CG  . GLN B 1 309 ? 69.167  25.872  45.880 1.00 36.62 ? 962  GLN B CG  1 
ATOM   5236  C  CD  . GLN B 1 309 ? 69.757  24.588  45.298 1.00 34.47 ? 962  GLN B CD  1 
ATOM   5237  O  OE1 . GLN B 1 309 ? 70.571  24.613  44.362 1.00 35.34 ? 962  GLN B OE1 1 
ATOM   5238  N  NE2 . GLN B 1 309 ? 69.336  23.459  45.841 1.00 33.36 ? 962  GLN B NE2 1 
ATOM   5239  N  N   . GLY B 1 310 ? 69.380  27.778  49.060 1.00 38.51 ? 963  GLY B N   1 
ATOM   5240  C  CA  . GLY B 1 310 ? 68.710  27.424  50.299 1.00 38.44 ? 963  GLY B CA  1 
ATOM   5241  C  C   . GLY B 1 310 ? 67.672  28.455  50.736 1.00 39.97 ? 963  GLY B C   1 
ATOM   5242  O  O   . GLY B 1 310 ? 66.637  28.104  51.307 1.00 38.56 ? 963  GLY B O   1 
ATOM   5243  N  N   . ASP B 1 311 ? 67.942  29.734  50.474 1.00 41.14 ? 964  ASP B N   1 
ATOM   5244  C  CA  . ASP B 1 311 ? 67.003  30.794  50.836 1.00 39.91 ? 964  ASP B CA  1 
ATOM   5245  C  C   . ASP B 1 311 ? 65.742  30.589  50.009 1.00 39.11 ? 964  ASP B C   1 
ATOM   5246  O  O   . ASP B 1 311 ? 64.648  30.584  50.553 1.00 39.29 ? 964  ASP B O   1 
ATOM   5247  C  CB  . ASP B 1 311 ? 67.605  32.182  50.559 1.00 40.92 ? 964  ASP B CB  1 
ATOM   5248  C  CG  . ASP B 1 311 ? 68.847  32.488  51.428 1.00 41.75 ? 964  ASP B CG  1 
ATOM   5249  O  OD1 . ASP B 1 311 ? 69.027  31.863  52.501 1.00 42.64 ? 964  ASP B OD1 1 
ATOM   5250  O  OD2 . ASP B 1 311 ? 69.635  33.375  51.037 1.00 41.50 ? 964  ASP B OD2 1 
ATOM   5251  N  N   . GLU B 1 312 ? 65.889  30.402  48.698 1.00 39.31 ? 965  GLU B N   1 
ATOM   5252  C  CA  . GLU B 1 312 ? 64.717  30.170  47.848 1.00 40.01 ? 965  GLU B CA  1 
ATOM   5253  C  C   . GLU B 1 312 ? 63.953  28.926  48.280 1.00 39.59 ? 965  GLU B C   1 
ATOM   5254  O  O   . GLU B 1 312 ? 62.739  28.951  48.300 1.00 39.92 ? 965  GLU B O   1 
ATOM   5255  C  CB  . GLU B 1 312 ? 65.097  30.044  46.365 1.00 41.86 ? 965  GLU B CB  1 
ATOM   5256  C  CG  . GLU B 1 312 ? 63.866  29.827  45.451 1.00 45.44 ? 965  GLU B CG  1 
ATOM   5257  C  CD  . GLU B 1 312 ? 64.157  29.965  43.950 1.00 48.42 ? 965  GLU B CD  1 
ATOM   5258  O  OE1 . GLU B 1 312 ? 65.336  29.839  43.531 1.00 51.81 ? 965  GLU B OE1 1 
ATOM   5259  O  OE2 . GLU B 1 312 ? 63.198  30.188  43.167 1.00 50.92 ? 965  GLU B OE2 1 
ATOM   5260  N  N   . GLU B 1 313 ? 64.665  27.852  48.637 1.00 40.41 ? 966  GLU B N   1 
ATOM   5261  C  CA  . GLU B 1 313 ? 64.033  26.608  49.084 1.00 41.88 ? 966  GLU B CA  1 
ATOM   5262  C  C   . GLU B 1 313 ? 63.143  26.880  50.309 1.00 44.98 ? 966  GLU B C   1 
ATOM   5263  O  O   . GLU B 1 313 ? 61.989  26.446  50.365 1.00 45.23 ? 966  GLU B O   1 
ATOM   5264  C  CB  . GLU B 1 313 ? 65.087  25.543  49.460 1.00 39.03 ? 966  GLU B CB  1 
ATOM   5265  C  CG  . GLU B 1 313 ? 66.001  25.046  48.332 1.00 36.73 ? 966  GLU B CG  1 
ATOM   5266  C  CD  . GLU B 1 313 ? 66.961  23.907  48.778 1.00 36.99 ? 966  GLU B CD  1 
ATOM   5267  O  OE1 . GLU B 1 313 ? 67.524  24.026  49.873 1.00 32.73 ? 966  GLU B OE1 1 
ATOM   5268  O  OE2 . GLU B 1 313 ? 67.155  22.906  48.036 1.00 33.56 ? 966  GLU B OE2 1 
ATOM   5269  N  N   . ALA B 1 314 ? 63.695  27.598  51.288 1.00 47.10 ? 967  ALA B N   1 
ATOM   5270  C  CA  . ALA B 1 314 ? 62.971  27.953  52.506 1.00 49.60 ? 967  ALA B CA  1 
ATOM   5271  C  C   . ALA B 1 314 ? 61.788  28.834  52.136 1.00 51.44 ? 967  ALA B C   1 
ATOM   5272  O  O   . ALA B 1 314 ? 60.674  28.676  52.653 1.00 52.12 ? 967  ALA B O   1 
ATOM   5273  C  CB  . ALA B 1 314 ? 63.901  28.710  53.495 1.00 48.01 ? 967  ALA B CB  1 
ATOM   5274  N  N   . ASN B 1 315 ? 62.034  29.779  51.244 1.00 53.70 ? 968  ASN B N   1 
ATOM   5275  C  CA  . ASN B 1 315 ? 60.975  30.671  50.827 1.00 55.64 ? 968  ASN B CA  1 
ATOM   5276  C  C   . ASN B 1 315 ? 59.829  29.928  50.201 1.00 55.36 ? 968  ASN B C   1 
ATOM   5277  O  O   . ASN B 1 315 ? 58.678  30.329  50.350 1.00 56.49 ? 968  ASN B O   1 
ATOM   5278  C  CB  . ASN B 1 315 ? 61.514  31.710  49.864 1.00 58.10 ? 968  ASN B CB  1 
ATOM   5279  C  CG  . ASN B 1 315 ? 61.889  32.984  50.569 1.00 61.45 ? 968  ASN B CG  1 
ATOM   5280  O  OD1 . ASN B 1 315 ? 61.046  33.876  50.760 1.00 63.56 ? 968  ASN B OD1 1 
ATOM   5281  N  ND2 . ASN B 1 315 ? 63.147  33.074  51.000 1.00 61.90 ? 968  ASN B ND2 1 
ATOM   5282  N  N   . LEU B 1 316 ? 60.137  28.829  49.520 1.00 53.98 ? 969  LEU B N   1 
ATOM   5283  C  CA  . LEU B 1 316 ? 59.097  28.026  48.871 1.00 52.13 ? 969  LEU B CA  1 
ATOM   5284  C  C   . LEU B 1 316 ? 58.499  26.982  49.814 1.00 51.20 ? 969  LEU B C   1 
ATOM   5285  O  O   . LEU B 1 316 ? 57.723  26.128  49.401 1.00 51.55 ? 969  LEU B O   1 
ATOM   5286  C  CB  . LEU B 1 316 ? 59.670  27.329  47.630 1.00 50.62 ? 969  LEU B CB  1 
ATOM   5287  C  CG  . LEU B 1 316 ? 60.068  28.203  46.432 1.00 50.00 ? 969  LEU B CG  1 
ATOM   5288  C  CD1 . LEU B 1 316 ? 60.687  27.332  45.333 1.00 47.06 ? 969  LEU B CD1 1 
ATOM   5289  C  CD2 . LEU B 1 316 ? 58.838  28.938  45.907 1.00 48.48 ? 969  LEU B CD2 1 
ATOM   5290  N  N   . GLY B 1 317 ? 58.869  27.047  51.084 1.00 51.35 ? 970  GLY B N   1 
ATOM   5291  C  CA  . GLY B 1 317 ? 58.355  26.092  52.032 1.00 49.46 ? 970  GLY B CA  1 
ATOM   5292  C  C   . GLY B 1 317 ? 58.954  24.738  51.772 1.00 49.65 ? 970  GLY B C   1 
ATOM   5293  O  O   . GLY B 1 317 ? 58.436  23.719  52.230 1.00 50.60 ? 970  GLY B O   1 
ATOM   5294  N  N   . LEU B 1 318 ? 60.044  24.698  51.025 1.00 48.84 ? 971  LEU B N   1 
ATOM   5295  C  CA  . LEU B 1 318 ? 60.663  23.416  50.763 1.00 49.55 ? 971  LEU B CA  1 
ATOM   5296  C  C   . LEU B 1 318 ? 61.700  23.145  51.838 1.00 50.31 ? 971  LEU B C   1 
ATOM   5297  O  O   . LEU B 1 318 ? 62.162  24.065  52.523 1.00 51.35 ? 971  LEU B O   1 
ATOM   5298  C  CB  . LEU B 1 318 ? 61.315  23.412  49.381 1.00 49.86 ? 971  LEU B CB  1 
ATOM   5299  C  CG  . LEU B 1 318 ? 60.349  23.475  48.188 1.00 51.70 ? 971  LEU B CG  1 
ATOM   5300  C  CD1 . LEU B 1 318 ? 61.141  23.470  46.885 1.00 51.34 ? 971  LEU B CD1 1 
ATOM   5301  C  CD2 . LEU B 1 318 ? 59.406  22.295  48.231 1.00 50.46 ? 971  LEU B CD2 1 
ATOM   5302  N  N   . PRO B 1 319 ? 62.055  21.874  52.041 1.00 49.87 ? 972  PRO B N   1 
ATOM   5303  C  CA  . PRO B 1 319 ? 63.063  21.551  53.059 1.00 48.68 ? 972  PRO B CA  1 
ATOM   5304  C  C   . PRO B 1 319 ? 64.385  22.038  52.500 1.00 48.29 ? 972  PRO B C   1 
ATOM   5305  O  O   . PRO B 1 319 ? 64.682  21.781  51.332 1.00 47.16 ? 972  PRO B O   1 
ATOM   5306  C  CB  . PRO B 1 319 ? 63.035  20.037  53.107 1.00 49.88 ? 972  PRO B CB  1 
ATOM   5307  C  CG  . PRO B 1 319 ? 61.652  19.696  52.614 1.00 50.53 ? 972  PRO B CG  1 
ATOM   5308  C  CD  . PRO B 1 319 ? 61.461  20.652  51.483 1.00 50.14 ? 972  PRO B CD  1 
ATOM   5309  N  N   . ILE B 1 320 ? 65.159  22.742  53.322 1.00 46.38 ? 973  ILE B N   1 
ATOM   5310  C  CA  . ILE B 1 320 ? 66.452  23.259  52.912 1.00 44.47 ? 973  ILE B CA  1 
ATOM   5311  C  C   . ILE B 1 320 ? 67.419  22.101  52.733 1.00 44.22 ? 973  ILE B C   1 
ATOM   5312  O  O   . ILE B 1 320 ? 67.523  21.230  53.598 1.00 43.82 ? 973  ILE B O   1 
ATOM   5313  C  CB  . ILE B 1 320 ? 67.018  24.225  53.968 1.00 46.69 ? 973  ILE B CB  1 
ATOM   5314  C  CG1 . ILE B 1 320 ? 66.001  25.341  54.234 1.00 47.48 ? 973  ILE B CG1 1 
ATOM   5315  C  CG2 . ILE B 1 320 ? 68.344  24.815  53.482 1.00 44.37 ? 973  ILE B CG2 1 
ATOM   5316  C  CD1 . ILE B 1 320 ? 66.375  26.247  55.385 1.00 49.10 ? 973  ILE B CD1 1 
ATOM   5317  N  N   . SER B 1 321 ? 68.134  22.104  51.612 1.00 42.95 ? 974  SER B N   1 
ATOM   5318  C  CA  . SER B 1 321 ? 69.074  21.040  51.296 1.00 41.62 ? 974  SER B CA  1 
ATOM   5319  C  C   . SER B 1 321 ? 70.280  21.011  52.226 1.00 41.69 ? 974  SER B C   1 
ATOM   5320  O  O   . SER B 1 321 ? 70.629  22.025  52.858 1.00 42.80 ? 974  SER B O   1 
ATOM   5321  C  CB  . SER B 1 321 ? 69.580  21.166  49.840 1.00 41.33 ? 974  SER B CB  1 
ATOM   5322  O  OG  . SER B 1 321 ? 68.533  21.138  48.901 1.00 44.30 ? 974  SER B OG  1 
ATOM   5323  N  N   . PRO B 1 322 ? 70.936  19.836  52.316 1.00 39.55 ? 975  PRO B N   1 
ATOM   5324  C  CA  . PRO B 1 322 ? 72.121  19.633  53.149 1.00 36.46 ? 975  PRO B CA  1 
ATOM   5325  C  C   . PRO B 1 322 ? 73.179  20.616  52.701 1.00 35.43 ? 975  PRO B C   1 
ATOM   5326  O  O   . PRO B 1 322 ? 73.366  20.818  51.508 1.00 31.74 ? 975  PRO B O   1 
ATOM   5327  C  CB  . PRO B 1 322 ? 72.531  18.200  52.829 1.00 36.32 ? 975  PRO B CB  1 
ATOM   5328  C  CG  . PRO B 1 322 ? 71.229  17.535  52.527 1.00 37.47 ? 975  PRO B CG  1 
ATOM   5329  C  CD  . PRO B 1 322 ? 70.500  18.569  51.701 1.00 38.01 ? 975  PRO B CD  1 
ATOM   5330  N  N   . PHE B 1 323 ? 73.853  21.219  53.675 1.00 35.74 ? 976  PHE B N   1 
ATOM   5331  C  CA  . PHE B 1 323 ? 74.924  22.170  53.416 1.00 35.87 ? 976  PHE B CA  1 
ATOM   5332  C  C   . PHE B 1 323 ? 74.484  23.498  52.823 1.00 36.69 ? 976  PHE B C   1 
ATOM   5333  O  O   . PHE B 1 323 ? 75.319  24.328  52.525 1.00 38.85 ? 976  PHE B O   1 
ATOM   5334  C  CB  . PHE B 1 323 ? 75.969  21.565  52.468 1.00 33.21 ? 976  PHE B CB  1 
ATOM   5335  C  CG  . PHE B 1 323 ? 76.573  20.281  52.953 1.00 32.48 ? 976  PHE B CG  1 
ATOM   5336  C  CD1 . PHE B 1 323 ? 76.428  19.109  52.208 1.00 32.39 ? 976  PHE B CD1 1 
ATOM   5337  C  CD2 . PHE B 1 323 ? 77.300  20.235  54.135 1.00 30.23 ? 976  PHE B CD2 1 
ATOM   5338  C  CE1 . PHE B 1 323 ? 77.007  17.919  52.639 1.00 31.60 ? 976  PHE B CE1 1 
ATOM   5339  C  CE2 . PHE B 1 323 ? 77.882  19.045  54.572 1.00 31.50 ? 976  PHE B CE2 1 
ATOM   5340  C  CZ  . PHE B 1 323 ? 77.737  17.884  53.823 1.00 31.41 ? 976  PHE B CZ  1 
ATOM   5341  N  N   . MET B 1 324 ? 73.191  23.726  52.680 1.00 36.93 ? 977  MET B N   1 
ATOM   5342  C  CA  . MET B 1 324 ? 72.739  24.950  52.050 1.00 35.76 ? 977  MET B CA  1 
ATOM   5343  C  C   . MET B 1 324 ? 71.988  25.902  52.959 1.00 34.84 ? 977  MET B C   1 
ATOM   5344  O  O   . MET B 1 324 ? 71.403  26.878  52.515 1.00 34.01 ? 977  MET B O   1 
ATOM   5345  C  CB  . MET B 1 324 ? 71.884  24.590  50.827 1.00 37.56 ? 977  MET B CB  1 
ATOM   5346  C  CG  . MET B 1 324 ? 72.589  23.694  49.830 1.00 34.96 ? 977  MET B CG  1 
ATOM   5347  S  SD  . MET B 1 324 ? 71.832  23.723  48.189 1.00 39.63 ? 977  MET B SD  1 
ATOM   5348  C  CE  . MET B 1 324 ? 72.804  22.490  47.402 1.00 37.25 ? 977  MET B CE  1 
ATOM   5349  N  N   . ASP B 1 325 ? 72.022  25.608  54.247 1.00 35.94 ? 978  ASP B N   1 
ATOM   5350  C  CA  . ASP B 1 325 ? 71.357  26.424  55.265 1.00 36.20 ? 978  ASP B CA  1 
ATOM   5351  C  C   . ASP B 1 325 ? 72.395  27.405  55.849 1.00 36.73 ? 978  ASP B C   1 
ATOM   5352  O  O   . ASP B 1 325 ? 73.253  26.987  56.640 1.00 37.51 ? 978  ASP B O   1 
ATOM   5353  C  CB  . ASP B 1 325 ? 70.857  25.499  56.374 1.00 34.54 ? 978  ASP B CB  1 
ATOM   5354  C  CG  . ASP B 1 325 ? 69.783  26.127  57.235 1.00 36.47 ? 978  ASP B CG  1 
ATOM   5355  O  OD1 . ASP B 1 325 ? 69.599  27.353  57.188 1.00 36.75 ? 978  ASP B OD1 1 
ATOM   5356  O  OD2 . ASP B 1 325 ? 69.116  25.374  57.973 1.00 40.31 ? 978  ASP B OD2 1 
ATOM   5357  N  N   . ARG B 1 326 ? 72.342  28.684  55.477 1.00 36.98 ? 979  ARG B N   1 
ATOM   5358  C  CA  . ARG B 1 326 ? 73.318  29.650  56.012 1.00 38.56 ? 979  ARG B CA  1 
ATOM   5359  C  C   . ARG B 1 326 ? 73.196  29.842  57.533 1.00 39.83 ? 979  ARG B C   1 
ATOM   5360  O  O   . ARG B 1 326 ? 74.103  30.388  58.175 1.00 40.22 ? 979  ARG B O   1 
ATOM   5361  C  CB  . ARG B 1 326 ? 73.168  31.014  55.342 1.00 39.90 ? 979  ARG B CB  1 
ATOM   5362  C  CG  . ARG B 1 326 ? 71.850  31.679  55.657 1.00 40.01 ? 979  ARG B CG  1 
ATOM   5363  C  CD  . ARG B 1 326 ? 71.815  33.114  55.231 1.00 43.57 ? 979  ARG B CD  1 
ATOM   5364  N  NE  . ARG B 1 326 ? 71.534  33.311  53.814 1.00 47.03 ? 979  ARG B NE  1 
ATOM   5365  C  CZ  . ARG B 1 326 ? 72.462  33.339  52.864 1.00 46.94 ? 979  ARG B CZ  1 
ATOM   5366  N  NH1 . ARG B 1 326 ? 73.729  33.180  53.183 1.00 47.08 ? 979  ARG B NH1 1 
ATOM   5367  N  NH2 . ARG B 1 326 ? 72.124  33.549  51.598 1.00 46.35 ? 979  ARG B NH2 1 
ATOM   5368  N  N   . SER B 1 327 ? 72.086  29.407  58.124 1.00 39.79 ? 980  SER B N   1 
ATOM   5369  C  CA  . SER B 1 327 ? 71.958  29.569  59.558 1.00 41.56 ? 980  SER B CA  1 
ATOM   5370  C  C   . SER B 1 327 ? 72.470  28.324  60.285 1.00 42.59 ? 980  SER B C   1 
ATOM   5371  O  O   . SER B 1 327 ? 72.635  28.328  61.501 1.00 43.64 ? 980  SER B O   1 
ATOM   5372  C  CB  . SER B 1 327 ? 70.505  29.835  59.949 1.00 41.46 ? 980  SER B CB  1 
ATOM   5373  O  OG  . SER B 1 327 ? 69.769  28.623  60.004 1.00 45.68 ? 980  SER B OG  1 
ATOM   5374  N  N   . SER B 1 328 ? 72.748  27.260  59.547 1.00 42.79 ? 981  SER B N   1 
ATOM   5375  C  CA  . SER B 1 328 ? 73.211  26.027  60.181 1.00 44.35 ? 981  SER B CA  1 
ATOM   5376  C  C   . SER B 1 328 ? 74.258  25.358  59.275 1.00 43.32 ? 981  SER B C   1 
ATOM   5377  O  O   . SER B 1 328 ? 74.138  24.193  58.900 1.00 43.16 ? 981  SER B O   1 
ATOM   5378  C  CB  . SER B 1 328 ? 71.994  25.119  60.409 1.00 44.23 ? 981  SER B CB  1 
ATOM   5379  O  OG  . SER B 1 328 ? 72.371  23.885  60.967 1.00 48.10 ? 981  SER B OG  1 
ATOM   5380  N  N   . PRO B 1 329 ? 75.326  26.100  58.959 1.00 43.48 ? 982  PRO B N   1 
ATOM   5381  C  CA  . PRO B 1 329 ? 76.457  25.735  58.105 1.00 43.52 ? 982  PRO B CA  1 
ATOM   5382  C  C   . PRO B 1 329 ? 77.249  24.500  58.470 1.00 42.40 ? 982  PRO B C   1 
ATOM   5383  O  O   . PRO B 1 329 ? 77.365  24.157  59.633 1.00 43.71 ? 982  PRO B O   1 
ATOM   5384  C  CB  . PRO B 1 329 ? 77.317  26.993  58.144 1.00 43.61 ? 982  PRO B CB  1 
ATOM   5385  C  CG  . PRO B 1 329 ? 77.115  27.468  59.528 1.00 43.57 ? 982  PRO B CG  1 
ATOM   5386  C  CD  . PRO B 1 329 ? 75.639  27.331  59.711 1.00 43.41 ? 982  PRO B CD  1 
ATOM   5387  N  N   . GLN B 1 330 ? 77.801  23.842  57.462 1.00 40.85 ? 983  GLN B N   1 
ATOM   5388  C  CA  . GLN B 1 330 ? 78.626  22.666  57.688 1.00 41.29 ? 983  GLN B CA  1 
ATOM   5389  C  C   . GLN B 1 330 ? 79.715  22.674  56.625 1.00 40.91 ? 983  GLN B C   1 
ATOM   5390  O  O   . GLN B 1 330 ? 79.993  21.661  55.991 1.00 41.88 ? 983  GLN B O   1 
ATOM   5391  C  CB  . GLN B 1 330 ? 77.790  21.388  57.604 1.00 41.59 ? 983  GLN B CB  1 
ATOM   5392  C  CG  . GLN B 1 330 ? 76.810  21.215  58.768 1.00 42.67 ? 983  GLN B CG  1 
ATOM   5393  C  CD  . GLN B 1 330 ? 77.493  21.167  60.141 1.00 43.68 ? 983  GLN B CD  1 
ATOM   5394  O  OE1 . GLN B 1 330 ? 78.707  20.988  60.248 1.00 43.58 ? 983  GLN B OE1 1 
ATOM   5395  N  NE2 . GLN B 1 330 ? 76.699  21.309  61.193 1.00 42.59 ? 983  GLN B NE2 1 
ATOM   5396  N  N   . LEU B 1 331 ? 80.337  23.841  56.471 1.00 40.37 ? 984  LEU B N   1 
ATOM   5397  C  CA  . LEU B 1 331 ? 81.392  24.093  55.507 1.00 40.18 ? 984  LEU B CA  1 
ATOM   5398  C  C   . LEU B 1 331 ? 82.521  23.071  55.525 1.00 40.62 ? 984  LEU B C   1 
ATOM   5399  O  O   . LEU B 1 331 ? 82.901  22.555  54.476 1.00 41.24 ? 984  LEU B O   1 
ATOM   5400  C  CB  . LEU B 1 331 ? 81.928  25.505  55.739 1.00 42.38 ? 984  LEU B CB  1 
ATOM   5401  C  CG  . LEU B 1 331 ? 83.168  26.064  55.017 1.00 43.72 ? 984  LEU B CG  1 
ATOM   5402  C  CD1 . LEU B 1 331 ? 83.034  25.974  53.517 1.00 42.83 ? 984  LEU B CD1 1 
ATOM   5403  C  CD2 . LEU B 1 331 ? 83.349  27.515  55.459 1.00 41.71 ? 984  LEU B CD2 1 
ATOM   5404  N  N   . ALA B 1 332 ? 83.051  22.744  56.697 1.00 39.74 ? 985  ALA B N   1 
ATOM   5405  C  CA  . ALA B 1 332 ? 84.133  21.762  56.724 1.00 40.57 ? 985  ALA B CA  1 
ATOM   5406  C  C   . ALA B 1 332 ? 83.671  20.367  56.271 1.00 40.23 ? 985  ALA B C   1 
ATOM   5407  O  O   . ALA B 1 332 ? 84.333  19.735  55.446 1.00 40.10 ? 985  ALA B O   1 
ATOM   5408  C  CB  . ALA B 1 332 ? 84.770  21.694  58.133 1.00 38.96 ? 985  ALA B CB  1 
ATOM   5409  N  N   . LYS B 1 333 ? 82.547  19.884  56.811 1.00 40.03 ? 986  LYS B N   1 
ATOM   5410  C  CA  . LYS B 1 333 ? 82.024  18.556  56.437 1.00 39.08 ? 986  LYS B CA  1 
ATOM   5411  C  C   . LYS B 1 333 ? 81.798  18.488  54.931 1.00 37.27 ? 986  LYS B C   1 
ATOM   5412  O  O   . LYS B 1 333 ? 82.101  17.472  54.301 1.00 36.82 ? 986  LYS B O   1 
ATOM   5413  C  CB  . LYS B 1 333 ? 80.717  18.240  57.182 1.00 42.08 ? 986  LYS B CB  1 
ATOM   5414  C  CG  . LYS B 1 333 ? 80.238  16.794  56.964 1.00 46.77 ? 986  LYS B CG  1 
ATOM   5415  C  CD  . LYS B 1 333 ? 79.006  16.437  57.806 1.00 49.74 ? 986  LYS B CD  1 
ATOM   5416  C  CE  . LYS B 1 333 ? 78.651  14.943  57.684 1.00 53.82 ? 986  LYS B CE  1 
ATOM   5417  N  NZ  . LYS B 1 333 ? 79.716  14.036  58.231 1.00 56.92 ? 986  LYS B NZ  1 
ATOM   5418  N  N   . LEU B 1 334 ? 81.298  19.589  54.366 1.00 34.96 ? 987  LEU B N   1 
ATOM   5419  C  CA  . LEU B 1 334 ? 81.079  19.689  52.942 1.00 33.80 ? 987  LEU B CA  1 
ATOM   5420  C  C   . LEU B 1 334 ? 82.394  19.434  52.193 1.00 35.68 ? 987  LEU B C   1 
ATOM   5421  O  O   . LEU B 1 334 ? 82.515  18.473  51.428 1.00 36.94 ? 987  LEU B O   1 
ATOM   5422  C  CB  . LEU B 1 334 ? 80.534  21.073  52.556 1.00 30.22 ? 987  LEU B CB  1 
ATOM   5423  C  CG  . LEU B 1 334 ? 80.565  21.315  51.031 1.00 28.76 ? 987  LEU B CG  1 
ATOM   5424  C  CD1 . LEU B 1 334 ? 79.861  20.143  50.320 1.00 28.94 ? 987  LEU B CD1 1 
ATOM   5425  C  CD2 . LEU B 1 334 ? 79.897  22.614  50.672 1.00 24.22 ? 987  LEU B CD2 1 
ATOM   5426  N  N   . GLN B 1 335 ? 83.388  20.281  52.416 1.00 35.69 ? 988  GLN B N   1 
ATOM   5427  C  CA  . GLN B 1 335 ? 84.660  20.099  51.727 1.00 37.06 ? 988  GLN B CA  1 
ATOM   5428  C  C   . GLN B 1 335 ? 85.328  18.751  51.985 1.00 37.41 ? 988  GLN B C   1 
ATOM   5429  O  O   . GLN B 1 335 ? 85.750  18.057  51.040 1.00 39.31 ? 988  GLN B O   1 
ATOM   5430  C  CB  . GLN B 1 335 ? 85.616  21.241  52.085 1.00 37.24 ? 988  GLN B CB  1 
ATOM   5431  C  CG  . GLN B 1 335 ? 85.103  22.606  51.605 1.00 36.92 ? 988  GLN B CG  1 
ATOM   5432  C  CD  . GLN B 1 335 ? 85.002  22.680  50.088 1.00 35.92 ? 988  GLN B CD  1 
ATOM   5433  O  OE1 . GLN B 1 335 ? 85.876  22.187  49.367 1.00 38.45 ? 988  GLN B OE1 1 
ATOM   5434  N  NE2 . GLN B 1 335 ? 83.928  23.291  49.598 1.00 34.68 ? 988  GLN B NE2 1 
ATOM   5435  N  N   . GLU B 1 336 ? 85.408  18.364  53.251 1.00 36.47 ? 989  GLU B N   1 
ATOM   5436  C  CA  . GLU B 1 336 ? 86.044  17.101  53.593 1.00 37.99 ? 989  GLU B CA  1 
ATOM   5437  C  C   . GLU B 1 336 ? 85.351  15.945  52.844 1.00 38.77 ? 989  GLU B C   1 
ATOM   5438  O  O   . GLU B 1 336 ? 86.013  15.070  52.291 1.00 38.83 ? 989  GLU B O   1 
ATOM   5439  C  CB  . GLU B 1 336 ? 85.993  16.895  55.117 1.00 37.42 ? 989  GLU B CB  1 
ATOM   5440  C  CG  . GLU B 1 336 ? 86.701  15.655  55.629 1.00 39.66 ? 989  GLU B CG  1 
ATOM   5441  C  CD  . GLU B 1 336 ? 86.021  14.340  55.198 1.00 44.67 ? 989  GLU B CD  1 
ATOM   5442  O  OE1 . GLU B 1 336 ? 84.770  14.241  55.257 1.00 45.88 ? 989  GLU B OE1 1 
ATOM   5443  O  OE2 . GLU B 1 336 ? 86.746  13.389  54.811 1.00 47.20 ? 989  GLU B OE2 1 
ATOM   5444  N  N   . SER B 1 337 ? 84.023  15.952  52.816 1.00 39.74 ? 990  SER B N   1 
ATOM   5445  C  CA  . SER B 1 337 ? 83.270  14.897  52.124 1.00 41.15 ? 990  SER B CA  1 
ATOM   5446  C  C   . SER B 1 337 ? 83.489  14.919  50.609 1.00 39.38 ? 990  SER B C   1 
ATOM   5447  O  O   . SER B 1 337 ? 83.897  13.932  50.001 1.00 40.28 ? 990  SER B O   1 
ATOM   5448  C  CB  . SER B 1 337 ? 81.784  15.059  52.420 1.00 42.63 ? 990  SER B CB  1 
ATOM   5449  O  OG  . SER B 1 337 ? 81.077  13.992  51.848 1.00 47.66 ? 990  SER B OG  1 
ATOM   5450  N  N   . PHE B 1 338 ? 83.240  16.071  50.007 1.00 38.49 ? 991  PHE B N   1 
ATOM   5451  C  CA  . PHE B 1 338 ? 83.392  16.246  48.570 1.00 36.93 ? 991  PHE B CA  1 
ATOM   5452  C  C   . PHE B 1 338 ? 84.805  15.888  48.060 1.00 37.28 ? 991  PHE B C   1 
ATOM   5453  O  O   . PHE B 1 338 ? 84.947  15.369  46.955 1.00 36.44 ? 991  PHE B O   1 
ATOM   5454  C  CB  . PHE B 1 338 ? 83.021  17.689  48.203 1.00 34.83 ? 991  PHE B CB  1 
ATOM   5455  C  CG  . PHE B 1 338 ? 82.909  17.931  46.731 1.00 34.27 ? 991  PHE B CG  1 
ATOM   5456  C  CD1 . PHE B 1 338 ? 81.817  17.456  46.012 1.00 35.10 ? 991  PHE B CD1 1 
ATOM   5457  C  CD2 . PHE B 1 338 ? 83.907  18.615  46.054 1.00 32.90 ? 991  PHE B CD2 1 
ATOM   5458  C  CE1 . PHE B 1 338 ? 81.733  17.655  44.647 1.00 34.33 ? 991  PHE B CE1 1 
ATOM   5459  C  CE2 . PHE B 1 338 ? 83.834  18.818  44.698 1.00 30.95 ? 991  PHE B CE2 1 
ATOM   5460  C  CZ  . PHE B 1 338 ? 82.752  18.344  43.994 1.00 34.67 ? 991  PHE B CZ  1 
ATOM   5461  N  N   . ILE B 1 339 ? 85.841  16.165  48.853 1.00 37.62 ? 992  ILE B N   1 
ATOM   5462  C  CA  . ILE B 1 339 ? 87.215  15.830  48.461 1.00 38.94 ? 992  ILE B CA  1 
ATOM   5463  C  C   . ILE B 1 339 ? 87.439  14.319  48.608 1.00 39.66 ? 992  ILE B C   1 
ATOM   5464  O  O   . ILE B 1 339 ? 88.117  13.688  47.797 1.00 38.69 ? 992  ILE B O   1 
ATOM   5465  C  CB  . ILE B 1 339 ? 88.295  16.557  49.361 1.00 37.83 ? 992  ILE B CB  1 
ATOM   5466  C  CG1 . ILE B 1 339 ? 88.314  18.055  49.106 1.00 37.52 ? 992  ILE B CG1 1 
ATOM   5467  C  CG2 . ILE B 1 339 ? 89.685  16.048  49.049 1.00 36.80 ? 992  ILE B CG2 1 
ATOM   5468  C  CD1 . ILE B 1 339 ? 89.346  18.807  49.971 1.00 36.20 ? 992  ILE B CD1 1 
ATOM   5469  N  N   . THR B 1 340 ? 86.850  13.750  49.649 1.00 42.43 ? 993  THR B N   1 
ATOM   5470  C  CA  . THR B 1 340 ? 87.018  12.336  49.947 1.00 43.91 ? 993  THR B CA  1 
ATOM   5471  C  C   . THR B 1 340 ? 86.250  11.432  49.017 1.00 44.46 ? 993  THR B C   1 
ATOM   5472  O  O   . THR B 1 340 ? 86.750  10.386  48.593 1.00 44.27 ? 993  THR B O   1 
ATOM   5473  C  CB  . THR B 1 340 ? 86.568  12.022  51.400 1.00 44.32 ? 993  THR B CB  1 
ATOM   5474  O  OG1 . THR B 1 340 ? 87.337  12.808  52.319 1.00 45.25 ? 993  THR B OG1 1 
ATOM   5475  C  CG2 . THR B 1 340 ? 86.766  10.543  51.723 1.00 43.67 ? 993  THR B CG2 1 
ATOM   5476  N  N   . HIS B 1 341 ? 85.035  11.842  48.687 1.00 44.69 ? 994  HIS B N   1 
ATOM   5477  C  CA  . HIS B 1 341 ? 84.182  11.010  47.835 1.00 45.96 ? 994  HIS B CA  1 
ATOM   5478  C  C   . HIS B 1 341 ? 84.144  11.345  46.343 1.00 43.92 ? 994  HIS B C   1 
ATOM   5479  O  O   . HIS B 1 341 ? 83.819  10.479  45.531 1.00 44.38 ? 994  HIS B O   1 
ATOM   5480  C  CB  . HIS B 1 341 ? 82.744  11.022  48.370 1.00 47.32 ? 994  HIS B CB  1 
ATOM   5481  C  CG  . HIS B 1 341 ? 82.614  10.579  49.798 1.00 49.12 ? 994  HIS B CG  1 
ATOM   5482  N  ND1 . HIS B 1 341 ? 83.029  9.339   50.237 1.00 50.87 ? 994  HIS B ND1 1 
ATOM   5483  C  CD2 . HIS B 1 341 ? 82.086  11.202  50.881 1.00 50.54 ? 994  HIS B CD2 1 
ATOM   5484  C  CE1 . HIS B 1 341 ? 82.764  9.218   51.527 1.00 51.28 ? 994  HIS B CE1 1 
ATOM   5485  N  NE2 . HIS B 1 341 ? 82.191  10.334  51.942 1.00 51.62 ? 994  HIS B NE2 1 
ATOM   5486  N  N   . ILE B 1 342 ? 84.468  12.583  45.982 1.00 42.13 ? 995  ILE B N   1 
ATOM   5487  C  CA  . ILE B 1 342 ? 84.408  12.985  44.581 1.00 40.83 ? 995  ILE B CA  1 
ATOM   5488  C  C   . ILE B 1 342 ? 85.736  13.387  43.964 1.00 40.07 ? 995  ILE B C   1 
ATOM   5489  O  O   . ILE B 1 342 ? 86.230  12.676  43.111 1.00 40.66 ? 995  ILE B O   1 
ATOM   5490  C  CB  . ILE B 1 342 ? 83.377  14.129  44.364 1.00 40.28 ? 995  ILE B CB  1 
ATOM   5491  C  CG1 . ILE B 1 342 ? 82.040  13.754  44.988 1.00 40.89 ? 995  ILE B CG1 1 
ATOM   5492  C  CG2 . ILE B 1 342 ? 83.168  14.377  42.886 1.00 38.68 ? 995  ILE B CG2 1 
ATOM   5493  C  CD1 . ILE B 1 342 ? 82.037  13.830  46.489 1.00 45.60 ? 995  ILE B CD1 1 
ATOM   5494  N  N   . VAL B 1 343 ? 86.317  14.506  44.385 1.00 39.48 ? 996  VAL B N   1 
ATOM   5495  C  CA  . VAL B 1 343 ? 87.579  14.946  43.803 1.00 40.48 ? 996  VAL B CA  1 
ATOM   5496  C  C   . VAL B 1 343 ? 88.690  13.901  43.952 1.00 41.29 ? 996  VAL B C   1 
ATOM   5497  O  O   . VAL B 1 343 ? 89.304  13.466  42.969 1.00 40.31 ? 996  VAL B O   1 
ATOM   5498  C  CB  . VAL B 1 343 ? 88.098  16.277  44.444 1.00 39.92 ? 996  VAL B CB  1 
ATOM   5499  C  CG1 . VAL B 1 343 ? 89.159  16.854  43.578 1.00 39.93 ? 996  VAL B CG1 1 
ATOM   5500  C  CG2 . VAL B 1 343 ? 86.985  17.301  44.597 1.00 37.88 ? 996  VAL B CG2 1 
ATOM   5501  N  N   . GLY B 1 344 ? 88.946  13.498  45.194 1.00 43.53 ? 997  GLY B N   1 
ATOM   5502  C  CA  . GLY B 1 344 ? 89.996  12.516  45.474 1.00 43.32 ? 997  GLY B CA  1 
ATOM   5503  C  C   . GLY B 1 344 ? 90.001  11.298  44.575 1.00 43.03 ? 997  GLY B C   1 
ATOM   5504  O  O   . GLY B 1 344 ? 90.940  11.083  43.824 1.00 44.41 ? 997  GLY B O   1 
ATOM   5505  N  N   . PRO B 1 345 ? 88.969  10.462  44.644 1.00 42.83 ? 998  PRO B N   1 
ATOM   5506  C  CA  . PRO B 1 345 ? 88.951  9.282   43.779 1.00 43.20 ? 998  PRO B CA  1 
ATOM   5507  C  C   . PRO B 1 345 ? 89.069  9.571   42.278 1.00 43.78 ? 998  PRO B C   1 
ATOM   5508  O  O   . PRO B 1 345 ? 89.530  8.725   41.512 1.00 44.28 ? 998  PRO B O   1 
ATOM   5509  C  CB  . PRO B 1 345 ? 87.635  8.592   44.146 1.00 42.42 ? 998  PRO B CB  1 
ATOM   5510  C  CG  . PRO B 1 345 ? 86.852  9.643   44.953 1.00 43.53 ? 998  PRO B CG  1 
ATOM   5511  C  CD  . PRO B 1 345 ? 87.907  10.405  45.662 1.00 42.28 ? 998  PRO B CD  1 
ATOM   5512  N  N   . LEU B 1 346 ? 88.644  10.756  41.846 1.00 43.02 ? 999  LEU B N   1 
ATOM   5513  C  CA  . LEU B 1 346 ? 88.741  11.104  40.434 1.00 42.38 ? 999  LEU B CA  1 
ATOM   5514  C  C   . LEU B 1 346 ? 90.209  11.346  40.092 1.00 42.88 ? 999  LEU B C   1 
ATOM   5515  O  O   . LEU B 1 346 ? 90.654  10.980  39.020 1.00 41.87 ? 999  LEU B O   1 
ATOM   5516  C  CB  . LEU B 1 346 ? 87.888  12.347  40.131 1.00 40.36 ? 999  LEU B CB  1 
ATOM   5517  C  CG  . LEU B 1 346 ? 88.053  13.028  38.766 1.00 40.63 ? 999  LEU B CG  1 
ATOM   5518  C  CD1 . LEU B 1 346 ? 88.090  11.978  37.667 1.00 39.85 ? 999  LEU B CD1 1 
ATOM   5519  C  CD2 . LEU B 1 346 ? 86.911  14.026  38.514 1.00 39.78 ? 999  LEU B CD2 1 
ATOM   5520  N  N   . CYS B 1 347 ? 90.965  11.962  40.998 1.00 44.76 ? 1000 CYS B N   1 
ATOM   5521  C  CA  . CYS B 1 347 ? 92.386  12.186  40.742 1.00 48.27 ? 1000 CYS B CA  1 
ATOM   5522  C  C   . CYS B 1 347 ? 93.195  10.884  40.867 1.00 48.44 ? 1000 CYS B C   1 
ATOM   5523  O  O   . CYS B 1 347 ? 93.955  10.528  39.966 1.00 48.43 ? 1000 CYS B O   1 
ATOM   5524  C  CB  . CYS B 1 347 ? 92.980  13.192  41.730 1.00 48.87 ? 1000 CYS B CB  1 
ATOM   5525  S  SG  . CYS B 1 347 ? 92.232  14.818  41.736 1.00 50.55 ? 1000 CYS B SG  1 
ATOM   5526  N  N   . ASN B 1 348 ? 93.063  10.198  42.001 1.00 49.90 ? 1001 ASN B N   1 
ATOM   5527  C  CA  . ASN B 1 348 ? 93.797  8.947   42.212 1.00 50.85 ? 1001 ASN B CA  1 
ATOM   5528  C  C   . ASN B 1 348 ? 93.582  8.075   40.991 1.00 51.54 ? 1001 ASN B C   1 
ATOM   5529  O  O   . ASN B 1 348 ? 94.505  7.403   40.518 1.00 52.40 ? 1001 ASN B O   1 
ATOM   5530  C  CB  . ASN B 1 348 ? 93.286  8.186   43.441 1.00 49.15 ? 1001 ASN B CB  1 
ATOM   5531  C  CG  . ASN B 1 348 ? 93.313  9.015   44.706 1.00 50.80 ? 1001 ASN B CG  1 
ATOM   5532  O  OD1 . ASN B 1 348 ? 94.197  9.858   44.894 1.00 50.71 ? 1001 ASN B OD1 1 
ATOM   5533  N  ND2 . ASN B 1 348 ? 92.343  8.769   45.599 1.00 50.25 ? 1001 ASN B ND2 1 
ATOM   5534  N  N   . SER B 1 349 ? 92.349  8.087   40.484 1.00 51.47 ? 1002 SER B N   1 
ATOM   5535  C  CA  . SER B 1 349 ? 92.001  7.302   39.307 1.00 51.71 ? 1002 SER B CA  1 
ATOM   5536  C  C   . SER B 1 349 ? 92.746  7.786   38.057 1.00 51.49 ? 1002 SER B C   1 
ATOM   5537  O  O   . SER B 1 349 ? 93.287  6.980   37.295 1.00 51.85 ? 1002 SER B O   1 
ATOM   5538  C  CB  . SER B 1 349 ? 90.500  7.368   39.081 1.00 52.62 ? 1002 SER B CB  1 
ATOM   5539  O  OG  . SER B 1 349 ? 90.152  6.654   37.915 1.00 56.63 ? 1002 SER B OG  1 
ATOM   5540  N  N   . TYR B 1 350 ? 92.783  9.106   37.870 1.00 50.62 ? 1003 TYR B N   1 
ATOM   5541  C  CA  . TYR B 1 350 ? 93.469  9.755   36.741 1.00 49.32 ? 1003 TYR B CA  1 
ATOM   5542  C  C   . TYR B 1 350 ? 94.982  9.590   36.861 1.00 49.38 ? 1003 TYR B C   1 
ATOM   5543  O  O   . TYR B 1 350 ? 95.714  9.574   35.868 1.00 48.36 ? 1003 TYR B O   1 
ATOM   5544  C  CB  . TYR B 1 350 ? 93.158  11.257  36.738 1.00 47.24 ? 1003 TYR B CB  1 
ATOM   5545  C  CG  . TYR B 1 350 ? 93.433  11.995  35.443 1.00 45.83 ? 1003 TYR B CG  1 
ATOM   5546  C  CD1 . TYR B 1 350 ? 92.523  11.958  34.392 1.00 47.00 ? 1003 TYR B CD1 1 
ATOM   5547  C  CD2 . TYR B 1 350 ? 94.577  12.774  35.284 1.00 46.38 ? 1003 TYR B CD2 1 
ATOM   5548  C  CE1 . TYR B 1 350 ? 92.733  12.686  33.215 1.00 46.14 ? 1003 TYR B CE1 1 
ATOM   5549  C  CE2 . TYR B 1 350 ? 94.797  13.509  34.112 1.00 45.62 ? 1003 TYR B CE2 1 
ATOM   5550  C  CZ  . TYR B 1 350 ? 93.870  13.468  33.086 1.00 45.46 ? 1003 TYR B CZ  1 
ATOM   5551  O  OH  . TYR B 1 350 ? 94.035  14.257  31.971 1.00 42.57 ? 1003 TYR B OH  1 
ATOM   5552  N  N   . ASP B 1 351 ? 95.463  9.507   38.086 1.00 51.39 ? 1004 ASP B N   1 
ATOM   5553  C  CA  . ASP B 1 351 ? 96.891  9.362   38.266 1.00 53.60 ? 1004 ASP B CA  1 
ATOM   5554  C  C   . ASP B 1 351 ? 97.335  7.948   37.927 1.00 53.50 ? 1004 ASP B C   1 
ATOM   5555  O  O   . ASP B 1 351 ? 98.259  7.764   37.131 1.00 52.72 ? 1004 ASP B O   1 
ATOM   5556  C  CB  . ASP B 1 351 ? 97.302  9.695   39.684 1.00 55.21 ? 1004 ASP B CB  1 
ATOM   5557  C  CG  . ASP B 1 351 ? 98.743  10.156  39.755 1.00 56.82 ? 1004 ASP B CG  1 
ATOM   5558  O  OD1 . ASP B 1 351 ? 99.235  10.413  40.876 1.00 57.81 ? 1004 ASP B OD1 1 
ATOM   5559  O  OD2 . ASP B 1 351 ? 99.370  10.270  38.671 1.00 57.23 ? 1004 ASP B OD2 1 
ATOM   5560  N  N   . ALA B 1 352 ? 96.662  6.959   38.513 1.00 53.51 ? 1005 ALA B N   1 
ATOM   5561  C  CA  . ALA B 1 352 ? 96.991  5.555   38.250 1.00 53.21 ? 1005 ALA B CA  1 
ATOM   5562  C  C   . ALA B 1 352 ? 97.022  5.344   36.753 1.00 52.59 ? 1005 ALA B C   1 
ATOM   5563  O  O   . ALA B 1 352 ? 97.790  4.528   36.265 1.00 54.17 ? 1005 ALA B O   1 
ATOM   5564  C  CB  . ALA B 1 352 ? 95.970  4.613   38.897 1.00 52.45 ? 1005 ALA B CB  1 
ATOM   5565  N  N   . ALA B 1 353 ? 96.190  6.066   36.020 1.00 51.40 ? 1006 ALA B N   1 
ATOM   5566  C  CA  . ALA B 1 353 ? 96.211  5.956   34.568 1.00 52.10 ? 1006 ALA B CA  1 
ATOM   5567  C  C   . ALA B 1 353 ? 97.563  6.463   34.024 1.00 52.78 ? 1006 ALA B C   1 
ATOM   5568  O  O   . ALA B 1 353 ? 98.003  6.042   32.953 1.00 51.75 ? 1006 ALA B O   1 
ATOM   5569  C  CB  . ALA B 1 353 ? 95.078  6.773   33.966 1.00 51.15 ? 1006 ALA B CB  1 
ATOM   5570  N  N   . GLY B 1 354 ? 98.199  7.380   34.765 1.00 53.77 ? 1007 GLY B N   1 
ATOM   5571  C  CA  . GLY B 1 354 ? 99.488  7.940   34.364 1.00 54.36 ? 1007 GLY B CA  1 
ATOM   5572  C  C   . GLY B 1 354 ? 99.420  9.141   33.436 1.00 54.64 ? 1007 GLY B C   1 
ATOM   5573  O  O   . GLY B 1 354 ? 100.420 9.547   32.827 1.00 54.91 ? 1007 GLY B O   1 
ATOM   5574  N  N   . LEU B 1 355 ? 98.232  9.729   33.358 1.00 55.03 ? 1008 LEU B N   1 
ATOM   5575  C  CA  . LEU B 1 355 ? 97.977  10.873  32.492 1.00 53.39 ? 1008 LEU B CA  1 
ATOM   5576  C  C   . LEU B 1 355 ? 98.229  12.232  33.117 1.00 53.04 ? 1008 LEU B C   1 
ATOM   5577  O  O   . LEU B 1 355 ? 98.113  13.249  32.440 1.00 52.07 ? 1008 LEU B O   1 
ATOM   5578  C  CB  . LEU B 1 355 ? 96.547  10.792  31.998 1.00 52.64 ? 1008 LEU B CB  1 
ATOM   5579  C  CG  . LEU B 1 355 ? 96.252  9.399   31.451 1.00 53.83 ? 1008 LEU B CG  1 
ATOM   5580  C  CD1 . LEU B 1 355 ? 94.755  9.239   31.204 1.00 54.85 ? 1008 LEU B CD1 1 
ATOM   5581  C  CD2 . LEU B 1 355 ? 97.046  9.181   30.178 1.00 53.75 ? 1008 LEU B CD2 1 
ATOM   5582  N  N   . LEU B 1 356 ? 98.571  12.268  34.399 1.00 53.87 ? 1009 LEU B N   1 
ATOM   5583  C  CA  . LEU B 1 356 ? 98.828  13.562  35.044 1.00 56.06 ? 1009 LEU B CA  1 
ATOM   5584  C  C   . LEU B 1 356 ? 100.173 14.175  34.668 1.00 56.96 ? 1009 LEU B C   1 
ATOM   5585  O  O   . LEU B 1 356 ? 101.195 13.493  34.642 1.00 57.42 ? 1009 LEU B O   1 
ATOM   5586  C  CB  . LEU B 1 356 ? 98.745  13.432  36.571 1.00 57.01 ? 1009 LEU B CB  1 
ATOM   5587  C  CG  . LEU B 1 356 ? 97.299  13.392  37.079 1.00 59.19 ? 1009 LEU B CG  1 
ATOM   5588  C  CD1 . LEU B 1 356 ? 97.210  12.941  38.535 1.00 58.44 ? 1009 LEU B CD1 1 
ATOM   5589  C  CD2 . LEU B 1 356 ? 96.712  14.769  36.878 1.00 58.92 ? 1009 LEU B CD2 1 
ATOM   5590  N  N   . PRO B 1 357 ? 100.188 15.471  34.343 1.00 57.84 ? 1010 PRO B N   1 
ATOM   5591  C  CA  . PRO B 1 357 ? 101.477 16.058  33.993 1.00 58.37 ? 1010 PRO B CA  1 
ATOM   5592  C  C   . PRO B 1 357 ? 102.227 16.217  35.301 1.00 59.69 ? 1010 PRO B C   1 
ATOM   5593  O  O   . PRO B 1 357 ? 101.734 16.865  36.231 1.00 60.23 ? 1010 PRO B O   1 
ATOM   5594  C  CB  . PRO B 1 357 ? 101.087 17.397  33.372 1.00 57.61 ? 1010 PRO B CB  1 
ATOM   5595  C  CG  . PRO B 1 357 ? 99.890  17.778  34.134 1.00 56.89 ? 1010 PRO B CG  1 
ATOM   5596  C  CD  . PRO B 1 357 ? 99.113  16.476  34.249 1.00 58.35 ? 1010 PRO B CD  1 
ATOM   5597  N  N   . GLY B 1 358 ? 103.398 15.596  35.386 1.00 61.07 ? 1011 GLY B N   1 
ATOM   5598  C  CA  . GLY B 1 358 ? 104.209 15.704  36.586 1.00 61.49 ? 1011 GLY B CA  1 
ATOM   5599  C  C   . GLY B 1 358 ? 105.686 15.636  36.228 1.00 62.70 ? 1011 GLY B C   1 
ATOM   5600  O  O   . GLY B 1 358 ? 106.058 15.812  35.055 1.00 62.14 ? 1011 GLY B O   1 
ATOM   5601  N  N   . GLN B 1 359 ? 106.528 15.374  37.229 1.00 62.57 ? 1012 GLN B N   1 
ATOM   5602  C  CA  . GLN B 1 359 ? 107.967 15.260  36.998 1.00 62.49 ? 1012 GLN B CA  1 
ATOM   5603  C  C   . GLN B 1 359 ? 108.648 14.239  37.915 1.00 61.44 ? 1012 GLN B C   1 
ATOM   5604  O  O   . GLN B 1 359 ? 108.261 14.066  39.082 1.00 60.70 ? 1012 GLN B O   1 
ATOM   5605  C  CB  . GLN B 1 359 ? 108.646 16.622  37.172 1.00 63.86 ? 1012 GLN B CB  1 
ATOM   5606  C  CG  . GLN B 1 359 ? 109.019 16.969  38.602 1.00 65.65 ? 1012 GLN B CG  1 
ATOM   5607  C  CD  . GLN B 1 359 ? 109.640 18.352  38.708 1.00 68.47 ? 1012 GLN B CD  1 
ATOM   5608  O  OE1 . GLN B 1 359 ? 110.644 18.657  38.049 1.00 69.14 ? 1012 GLN B OE1 1 
ATOM   5609  N  NE2 . GLN B 1 359 ? 109.043 19.206  39.542 1.00 69.88 ? 1012 GLN B NE2 1 
ATOM   5610  N  N   . TRP B 1 360 ? 109.658 13.557  37.377 1.00 60.60 ? 1013 TRP B N   1 
ATOM   5611  C  CA  . TRP B 1 360 ? 110.416 12.589  38.164 1.00 58.90 ? 1013 TRP B CA  1 
ATOM   5612  C  C   . TRP B 1 360 ? 111.310 13.443  39.039 1.00 59.82 ? 1013 TRP B C   1 
ATOM   5613  O  O   . TRP B 1 360 ? 111.767 14.505  38.606 1.00 58.34 ? 1013 TRP B O   1 
ATOM   5614  C  CB  . TRP B 1 360 ? 111.315 11.740  37.283 1.00 56.05 ? 1013 TRP B CB  1 
ATOM   5615  C  CG  . TRP B 1 360 ? 110.737 11.330  35.988 1.00 51.79 ? 1013 TRP B CG  1 
ATOM   5616  C  CD1 . TRP B 1 360 ? 110.868 11.973  34.796 1.00 50.54 ? 1013 TRP B CD1 1 
ATOM   5617  C  CD2 . TRP B 1 360 ? 110.037 10.110  35.717 1.00 50.79 ? 1013 TRP B CD2 1 
ATOM   5618  N  NE1 . TRP B 1 360 ? 110.308 11.219  33.786 1.00 51.07 ? 1013 TRP B NE1 1 
ATOM   5619  C  CE2 . TRP B 1 360 ? 109.789 10.071  34.329 1.00 50.44 ? 1013 TRP B CE2 1 
ATOM   5620  C  CE3 . TRP B 1 360 ? 109.597 9.041   36.517 1.00 51.88 ? 1013 TRP B CE3 1 
ATOM   5621  C  CZ2 . TRP B 1 360 ? 109.127 9.006   33.718 1.00 50.89 ? 1013 TRP B CZ2 1 
ATOM   5622  C  CZ3 . TRP B 1 360 ? 108.933 7.975   35.907 1.00 51.50 ? 1013 TRP B CZ3 1 
ATOM   5623  C  CH2 . TRP B 1 360 ? 108.705 7.970   34.517 1.00 51.10 ? 1013 TRP B CH2 1 
ATOM   5624  N  N   . LEU B 1 361 ? 111.578 12.980  40.258 1.00 62.32 ? 1014 LEU B N   1 
ATOM   5625  C  CA  . LEU B 1 361 ? 112.433 13.741  41.178 1.00 64.54 ? 1014 LEU B CA  1 
ATOM   5626  C  C   . LEU B 1 361 ? 113.944 13.458  41.019 1.00 65.84 ? 1014 LEU B C   1 
ATOM   5627  O  O   . LEU B 1 361 ? 114.726 14.364  40.688 1.00 66.47 ? 1014 LEU B O   1 
ATOM   5628  C  CB  . LEU B 1 361 ? 112.039 13.457  42.623 1.00 62.94 ? 1014 LEU B CB  1 
ATOM   5629  C  CG  . LEU B 1 361 ? 110.572 13.294  42.936 1.00 62.55 ? 1014 LEU B CG  1 
ATOM   5630  C  CD1 . LEU B 1 361 ? 110.062 11.966  42.353 1.00 61.88 ? 1014 LEU B CD1 1 
ATOM   5631  C  CD2 . LEU B 1 361 ? 110.413 13.313  44.459 1.00 62.10 ? 1014 LEU B CD2 1 
ATOM   5632  N  N   . GLU B 1 362 ? 114.330 12.208  41.289 1.00 67.47 ? 1015 GLU B N   1 
ATOM   5633  C  CA  . GLU B 1 362 ? 115.721 11.733  41.209 1.00 68.83 ? 1015 GLU B CA  1 
ATOM   5634  C  C   . GLU B 1 362 ? 115.988 10.496  42.079 1.00 69.49 ? 1015 GLU B C   1 
ATOM   5635  O  O   . GLU B 1 362 ? 115.226 10.267  43.051 1.00 69.33 ? 1015 GLU B O   1 
ATOM   5636  C  CB  . GLU B 1 362 ? 116.724 12.835  41.603 1.00 68.97 ? 1015 GLU B CB  1 
ATOM   5637  C  CG  . GLU B 1 362 ? 117.302 13.570  40.407 1.00 69.81 ? 1015 GLU B CG  1 
ATOM   5638  C  CD  . GLU B 1 362 ? 117.741 12.613  39.300 1.00 70.91 ? 1015 GLU B CD  1 
ATOM   5639  O  OE1 . GLU B 1 362 ? 116.890 11.839  38.790 1.00 71.38 ? 1015 GLU B OE1 1 
ATOM   5640  O  OE2 . GLU B 1 362 ? 118.942 12.634  38.935 1.00 72.10 ? 1015 GLU B OE2 1 
ATOM   5641  N  N   . SER B 1 400 ? 114.017 11.275  34.018 1.00 62.18 ? 1053 SER B N   1 
ATOM   5642  C  CA  . SER B 1 400 ? 114.504 10.364  35.100 1.00 63.05 ? 1053 SER B CA  1 
ATOM   5643  C  C   . SER B 1 400 ? 113.636 9.104   35.182 1.00 64.20 ? 1053 SER B C   1 
ATOM   5644  O  O   . SER B 1 400 ? 113.078 8.642   34.161 1.00 63.90 ? 1053 SER B O   1 
ATOM   5645  C  CB  . SER B 1 400 ? 114.513 11.104  36.472 1.00 62.48 ? 1053 SER B CB  1 
ATOM   5646  N  N   . ARG B 1 401 ? 113.547 8.545   36.394 1.00 65.41 ? 1054 ARG B N   1 
ATOM   5647  C  CA  . ARG B 1 401 ? 112.750 7.340   36.648 1.00 66.73 ? 1054 ARG B CA  1 
ATOM   5648  C  C   . ARG B 1 401 ? 112.508 7.066   38.145 1.00 67.64 ? 1054 ARG B C   1 
ATOM   5649  O  O   . ARG B 1 401 ? 112.730 7.932   39.009 1.00 67.77 ? 1054 ARG B O   1 
ATOM   5650  C  CB  . ARG B 1 401 ? 113.414 6.114   35.976 1.00 65.79 ? 1054 ARG B CB  1 
ATOM   5651  N  N   . ARG B 1 402 ? 112.044 5.855   38.434 1.00 68.58 ? 1055 ARG B N   1 
ATOM   5652  C  CA  . ARG B 1 402 ? 111.737 5.430   39.794 1.00 70.04 ? 1055 ARG B CA  1 
ATOM   5653  C  C   . ARG B 1 402 ? 110.469 6.117   40.350 1.00 69.99 ? 1055 ARG B C   1 
ATOM   5654  O  O   . ARG B 1 402 ? 109.411 5.480   40.421 1.00 70.40 ? 1055 ARG B O   1 
ATOM   5655  C  CB  . ARG B 1 402 ? 112.936 5.674   40.747 1.00 71.93 ? 1055 ARG B CB  1 
ATOM   5656  C  CG  . ARG B 1 402 ? 114.270 4.998   40.323 1.00 74.30 ? 1055 ARG B CG  1 
ATOM   5657  C  CD  . ARG B 1 402 ? 114.121 3.464   40.115 1.00 76.35 ? 1055 ARG B CD  1 
ATOM   5658  N  NE  . ARG B 1 402 ? 115.326 2.836   39.536 1.00 78.57 ? 1055 ARG B NE  1 
ATOM   5659  C  CZ  . ARG B 1 402 ? 116.533 2.777   40.123 1.00 79.47 ? 1055 ARG B CZ  1 
ATOM   5660  N  NH1 . ARG B 1 402 ? 116.727 3.308   41.332 1.00 79.56 ? 1055 ARG B NH1 1 
ATOM   5661  N  NH2 . ARG B 1 402 ? 117.560 2.200   39.489 1.00 78.82 ? 1055 ARG B NH2 1 
ATOM   5662  N  N   . ARG B 1 403 ? 110.553 7.398   40.726 1.00 68.30 ? 1056 ARG B N   1 
ATOM   5663  C  CA  . ARG B 1 403 ? 109.383 8.087   41.292 1.00 67.40 ? 1056 ARG B CA  1 
ATOM   5664  C  C   . ARG B 1 403 ? 108.996 9.403   40.626 1.00 66.52 ? 1056 ARG B C   1 
ATOM   5665  O  O   . ARG B 1 403 ? 109.831 10.064  40.008 1.00 66.37 ? 1056 ARG B O   1 
ATOM   5666  C  CB  . ARG B 1 403 ? 109.580 8.337   42.794 1.00 68.08 ? 1056 ARG B CB  1 
ATOM   5667  C  CG  . ARG B 1 403 ? 109.554 7.085   43.684 1.00 69.31 ? 1056 ARG B CG  1 
ATOM   5668  C  CD  . ARG B 1 403 ? 109.814 7.502   45.123 1.00 71.06 ? 1056 ARG B CD  1 
ATOM   5669  N  NE  . ARG B 1 403 ? 110.975 8.400   45.163 1.00 72.33 ? 1056 ARG B NE  1 
ATOM   5670  C  CZ  . ARG B 1 403 ? 111.196 9.337   46.085 1.00 73.28 ? 1056 ARG B CZ  1 
ATOM   5671  N  NH1 . ARG B 1 403 ? 110.327 9.531   47.088 1.00 72.87 ? 1056 ARG B NH1 1 
ATOM   5672  N  NH2 . ARG B 1 403 ? 112.297 10.091  45.986 1.00 72.67 ? 1056 ARG B NH2 1 
ATOM   5673  N  N   . ILE B 1 404 ? 107.729 9.788   40.808 1.00 65.42 ? 1057 ILE B N   1 
ATOM   5674  C  CA  . ILE B 1 404 ? 107.159 11.013  40.216 1.00 63.58 ? 1057 ILE B CA  1 
ATOM   5675  C  C   . ILE B 1 404 ? 106.463 11.968  41.207 1.00 63.69 ? 1057 ILE B C   1 
ATOM   5676  O  O   . ILE B 1 404 ? 105.597 11.549  41.987 1.00 63.00 ? 1057 ILE B O   1 
ATOM   5677  C  CB  . ILE B 1 404 ? 106.099 10.654  39.145 1.00 63.32 ? 1057 ILE B CB  1 
ATOM   5678  C  CG1 . ILE B 1 404 ? 106.676 9.656   38.144 1.00 62.74 ? 1057 ILE B CG1 1 
ATOM   5679  C  CG2 . ILE B 1 404 ? 105.608 11.911  38.449 1.00 63.70 ? 1057 ILE B CG2 1 
ATOM   5680  C  CD1 . ILE B 1 404 ? 105.672 9.209   37.091 1.00 61.14 ? 1057 ILE B CD1 1 
ATOM   5681  N  N   . PHE B 1 405 ? 106.837 13.247  41.167 1.00 62.29 ? 1058 PHE B N   1 
ATOM   5682  C  CA  . PHE B 1 405 ? 106.204 14.254  42.025 1.00 60.78 ? 1058 PHE B CA  1 
ATOM   5683  C  C   . PHE B 1 405 ? 105.109 14.986  41.228 1.00 61.08 ? 1058 PHE B C   1 
ATOM   5684  O  O   . PHE B 1 405 ? 105.395 15.656  40.220 1.00 60.67 ? 1058 PHE B O   1 
ATOM   5685  C  CB  . PHE B 1 405 ? 107.221 15.287  42.511 1.00 61.12 ? 1058 PHE B CB  1 
ATOM   5686  C  CG  . PHE B 1 405 ? 106.594 16.461  43.238 1.00 60.91 ? 1058 PHE B CG  1 
ATOM   5687  C  CD1 . PHE B 1 405 ? 105.946 16.274  44.468 1.00 60.67 ? 1058 PHE B CD1 1 
ATOM   5688  C  CD2 . PHE B 1 405 ? 106.639 17.747  42.688 1.00 60.09 ? 1058 PHE B CD2 1 
ATOM   5689  C  CE1 . PHE B 1 405 ? 105.350 17.355  45.148 1.00 60.26 ? 1058 PHE B CE1 1 
ATOM   5690  C  CE2 . PHE B 1 405 ? 106.046 18.839  43.355 1.00 59.75 ? 1058 PHE B CE2 1 
ATOM   5691  C  CZ  . PHE B 1 405 ? 105.401 18.643  44.586 1.00 60.37 ? 1058 PHE B CZ  1 
ATOM   5692  N  N   . CYS B 1 406 ? 103.860 14.854  41.676 1.00 60.60 ? 1059 CYS B N   1 
ATOM   5693  C  CA  . CYS B 1 406 ? 102.728 15.497  41.007 1.00 59.29 ? 1059 CYS B CA  1 
ATOM   5694  C  C   . CYS B 1 406 ? 102.193 16.612  41.882 1.00 57.54 ? 1059 CYS B C   1 
ATOM   5695  O  O   . CYS B 1 406 ? 101.706 16.378  42.988 1.00 55.98 ? 1059 CYS B O   1 
ATOM   5696  C  CB  . CYS B 1 406 ? 101.615 14.484  40.726 1.00 61.13 ? 1059 CYS B CB  1 
ATOM   5697  S  SG  . CYS B 1 406 ? 100.251 15.195  39.776 1.00 66.50 ? 1059 CYS B SG  1 
ATOM   5698  N  N   . GLN B 1 407 ? 102.268 17.827  41.371 1.00 55.83 ? 1060 GLN B N   1 
ATOM   5699  C  CA  . GLN B 1 407 ? 101.832 18.983  42.133 1.00 54.92 ? 1060 GLN B CA  1 
ATOM   5700  C  C   . GLN B 1 407 ? 100.374 18.955  42.617 1.00 54.41 ? 1060 GLN B C   1 
ATOM   5701  O  O   . GLN B 1 407 ? 100.105 19.218  43.788 1.00 54.18 ? 1060 GLN B O   1 
ATOM   5702  C  CB  . GLN B 1 407 ? 102.083 20.236  41.302 1.00 54.75 ? 1060 GLN B CB  1 
ATOM   5703  C  CG  . GLN B 1 407 ? 102.131 21.531  42.076 1.00 55.36 ? 1060 GLN B CG  1 
ATOM   5704  C  CD  . GLN B 1 407 ? 102.058 22.735  41.144 1.00 55.94 ? 1060 GLN B CD  1 
ATOM   5705  O  OE1 . GLN B 1 407 ? 102.652 22.731  40.058 1.00 57.03 ? 1060 GLN B OE1 1 
ATOM   5706  N  NE2 . GLN B 1 407 ? 101.334 23.770  41.563 1.00 56.00 ? 1060 GLN B NE2 1 
ATOM   5707  N  N   . LEU B 1 408 ? 99.433  18.622  41.736 1.00 53.64 ? 1061 LEU B N   1 
ATOM   5708  C  CA  . LEU B 1 408 ? 98.028  18.631  42.130 1.00 53.38 ? 1061 LEU B CA  1 
ATOM   5709  C  C   . LEU B 1 408 ? 97.661  17.671  43.266 1.00 52.70 ? 1061 LEU B C   1 
ATOM   5710  O  O   . LEU B 1 408 ? 96.768  17.964  44.070 1.00 52.01 ? 1061 LEU B O   1 
ATOM   5711  C  CB  . LEU B 1 408 ? 97.139  18.393  40.903 1.00 54.50 ? 1061 LEU B CB  1 
ATOM   5712  C  CG  . LEU B 1 408 ? 96.923  16.997  40.328 1.00 54.90 ? 1061 LEU B CG  1 
ATOM   5713  C  CD1 . LEU B 1 408 ? 95.771  16.281  41.022 1.00 53.98 ? 1061 LEU B CD1 1 
ATOM   5714  C  CD2 . LEU B 1 408 ? 96.613  17.142  38.860 1.00 55.78 ? 1061 LEU B CD2 1 
ATOM   5715  N  N   . MET B 1 409 ? 98.344  16.531  43.341 1.00 52.52 ? 1062 MET B N   1 
ATOM   5716  C  CA  . MET B 1 409 ? 98.077  15.562  44.406 1.00 53.18 ? 1062 MET B CA  1 
ATOM   5717  C  C   . MET B 1 409 ? 98.511  16.123  45.766 1.00 52.67 ? 1062 MET B C   1 
ATOM   5718  O  O   . MET B 1 409 ? 97.880  15.852  46.785 1.00 53.24 ? 1062 MET B O   1 
ATOM   5719  C  CB  . MET B 1 409 ? 98.813  14.258  44.135 1.00 53.42 ? 1062 MET B CB  1 
ATOM   5720  C  CG  . MET B 1 409 ? 98.417  13.600  42.844 1.00 54.45 ? 1062 MET B CG  1 
ATOM   5721  S  SD  . MET B 1 409 ? 96.665  13.161  42.786 1.00 58.13 ? 1062 MET B SD  1 
ATOM   5722  C  CE  . MET B 1 409 ? 96.635  11.644  43.763 1.00 57.40 ? 1062 MET B CE  1 
ATOM   5723  N  N   . HIS B 1 410 ? 99.590  16.901  45.760 1.00 52.43 ? 1063 HIS B N   1 
ATOM   5724  C  CA  . HIS B 1 410 ? 100.129 17.542  46.952 1.00 52.50 ? 1063 HIS B CA  1 
ATOM   5725  C  C   . HIS B 1 410 ? 99.095  18.533  47.494 1.00 49.74 ? 1063 HIS B C   1 
ATOM   5726  O  O   . HIS B 1 410 ? 98.714  18.499  48.668 1.00 49.71 ? 1063 HIS B O   1 
ATOM   5727  C  CB  . HIS B 1 410 ? 101.447 18.270  46.585 1.00 55.11 ? 1063 HIS B CB  1 
ATOM   5728  C  CG  . HIS B 1 410 ? 102.021 19.110  47.691 1.00 59.47 ? 1063 HIS B CG  1 
ATOM   5729  N  ND1 . HIS B 1 410 ? 102.036 20.494  47.654 1.00 61.36 ? 1063 HIS B ND1 1 
ATOM   5730  C  CD2 . HIS B 1 410 ? 102.569 18.765  48.884 1.00 61.06 ? 1063 HIS B CD2 1 
ATOM   5731  C  CE1 . HIS B 1 410 ? 102.561 20.962  48.776 1.00 61.72 ? 1063 HIS B CE1 1 
ATOM   5732  N  NE2 . HIS B 1 410 ? 102.892 19.934  49.540 1.00 62.22 ? 1063 HIS B NE2 1 
ATOM   5733  N  N   . HIS B 1 411 ? 98.639  19.418  46.627 1.00 48.46 ? 1064 HIS B N   1 
ATOM   5734  C  CA  . HIS B 1 411 ? 97.644  20.420  47.008 1.00 46.82 ? 1064 HIS B CA  1 
ATOM   5735  C  C   . HIS B 1 411 ? 96.403  19.760  47.601 1.00 45.83 ? 1064 HIS B C   1 
ATOM   5736  O  O   . HIS B 1 411 ? 95.863  20.170  48.631 1.00 45.09 ? 1064 HIS B O   1 
ATOM   5737  C  CB  . HIS B 1 411 ? 97.271  21.203  45.769 1.00 46.53 ? 1064 HIS B CB  1 
ATOM   5738  C  CG  . HIS B 1 411 ? 98.376  22.073  45.267 1.00 45.46 ? 1064 HIS B CG  1 
ATOM   5739  N  ND1 . HIS B 1 411 ? 99.002  23.003  46.064 1.00 44.47 ? 1064 HIS B ND1 1 
ATOM   5740  C  CD2 . HIS B 1 411 ? 98.941  22.182  44.042 1.00 45.52 ? 1064 HIS B CD2 1 
ATOM   5741  C  CE1 . HIS B 1 411 ? 99.904  23.653  45.354 1.00 45.61 ? 1064 HIS B CE1 1 
ATOM   5742  N  NE2 . HIS B 1 411 ? 99.887  23.175  44.121 1.00 46.77 ? 1064 HIS B NE2 1 
ATOM   5743  N  N   . LEU B 1 412 ? 95.969  18.721  46.917 1.00 44.09 ? 1065 LEU B N   1 
ATOM   5744  C  CA  . LEU B 1 412 ? 94.821  17.961  47.316 1.00 44.55 ? 1065 LEU B CA  1 
ATOM   5745  C  C   . LEU B 1 412 ? 94.982  17.412  48.733 1.00 45.74 ? 1065 LEU B C   1 
ATOM   5746  O  O   . LEU B 1 412 ? 94.076  17.529  49.564 1.00 44.45 ? 1065 LEU B O   1 
ATOM   5747  C  CB  . LEU B 1 412 ? 94.642  16.829  46.325 1.00 42.97 ? 1065 LEU B CB  1 
ATOM   5748  C  CG  . LEU B 1 412 ? 93.290  16.150  46.232 1.00 43.87 ? 1065 LEU B CG  1 
ATOM   5749  C  CD1 . LEU B 1 412 ? 92.135  17.165  46.101 1.00 42.61 ? 1065 LEU B CD1 1 
ATOM   5750  C  CD2 . LEU B 1 412 ? 93.352  15.246  45.027 1.00 42.88 ? 1065 LEU B CD2 1 
ATOM   5751  N  N   . THR B 1 413 ? 96.134  16.799  49.005 1.00 46.96 ? 1066 THR B N   1 
ATOM   5752  C  CA  . THR B 1 413 ? 96.391  16.229  50.322 1.00 47.71 ? 1066 THR B CA  1 
ATOM   5753  C  C   . THR B 1 413 ? 96.417  17.347  51.345 1.00 48.16 ? 1066 THR B C   1 
ATOM   5754  O  O   . THR B 1 413 ? 95.778  17.261  52.388 1.00 48.77 ? 1066 THR B O   1 
ATOM   5755  C  CB  . THR B 1 413 ? 97.734  15.472  50.361 1.00 48.51 ? 1066 THR B CB  1 
ATOM   5756  O  OG1 . THR B 1 413 ? 97.697  14.407  49.413 1.00 49.85 ? 1066 THR B OG1 1 
ATOM   5757  C  CG2 . THR B 1 413 ? 97.977  14.883  51.731 1.00 47.75 ? 1066 THR B CG2 1 
ATOM   5758  N  N   . GLU B 1 414 ? 97.148  18.407  51.042 1.00 48.10 ? 1067 GLU B N   1 
ATOM   5759  C  CA  . GLU B 1 414 ? 97.216  19.524  51.964 1.00 48.74 ? 1067 GLU B CA  1 
ATOM   5760  C  C   . GLU B 1 414 ? 95.864  20.182  52.222 1.00 48.79 ? 1067 GLU B C   1 
ATOM   5761  O  O   . GLU B 1 414 ? 95.532  20.455  53.369 1.00 49.43 ? 1067 GLU B O   1 
ATOM   5762  C  CB  . GLU B 1 414 ? 98.194  20.582  51.448 1.00 51.22 ? 1067 GLU B CB  1 
ATOM   5763  C  CG  . GLU B 1 414 ? 99.660  20.167  51.483 1.00 55.15 ? 1067 GLU B CG  1 
ATOM   5764  C  CD  . GLU B 1 414 ? 100.118 19.794  52.886 1.00 58.61 ? 1067 GLU B CD  1 
ATOM   5765  O  OE1 . GLU B 1 414 ? 100.099 20.678  53.788 1.00 59.55 ? 1067 GLU B OE1 1 
ATOM   5766  O  OE2 . GLU B 1 414 ? 100.493 18.609  53.088 1.00 59.83 ? 1067 GLU B OE2 1 
ATOM   5767  N  N   . ASN B 1 415 ? 95.087  20.457  51.173 1.00 48.07 ? 1068 ASN B N   1 
ATOM   5768  C  CA  . ASN B 1 415 ? 93.791  21.112  51.362 1.00 46.98 ? 1068 ASN B CA  1 
ATOM   5769  C  C   . ASN B 1 415 ? 92.833  20.223  52.161 1.00 47.09 ? 1068 ASN B C   1 
ATOM   5770  O  O   . ASN B 1 415 ? 91.934  20.692  52.867 1.00 45.19 ? 1068 ASN B O   1 
ATOM   5771  C  CB  . ASN B 1 415 ? 93.188  21.483  50.007 1.00 45.83 ? 1068 ASN B CB  1 
ATOM   5772  C  CG  . ASN B 1 415 ? 93.887  22.671  49.372 1.00 45.84 ? 1068 ASN B CG  1 
ATOM   5773  O  OD1 . ASN B 1 415 ? 94.166  23.652  50.039 1.00 47.94 ? 1068 ASN B OD1 1 
ATOM   5774  N  ND2 . ASN B 1 415 ? 94.154  22.594  48.082 1.00 44.65 ? 1068 ASN B ND2 1 
ATOM   5775  N  N   . HIS B 1 416 ? 93.047  18.921  52.076 1.00 48.24 ? 1069 HIS B N   1 
ATOM   5776  C  CA  . HIS B 1 416 ? 92.200  18.011  52.814 1.00 48.99 ? 1069 HIS B CA  1 
ATOM   5777  C  C   . HIS B 1 416 ? 92.413  18.221  54.313 1.00 48.16 ? 1069 HIS B C   1 
ATOM   5778  O  O   . HIS B 1 416 ? 91.454  18.273  55.088 1.00 47.94 ? 1069 HIS B O   1 
ATOM   5779  C  CB  . HIS B 1 416 ? 92.522  16.571  52.432 1.00 50.42 ? 1069 HIS B CB  1 
ATOM   5780  C  CG  . HIS B 1 416 ? 91.516  15.592  52.928 1.00 51.77 ? 1069 HIS B CG  1 
ATOM   5781  N  ND1 . HIS B 1 416 ? 90.590  15.001  52.101 1.00 53.57 ? 1069 HIS B ND1 1 
ATOM   5782  C  CD2 . HIS B 1 416 ? 91.236  15.158  54.180 1.00 55.05 ? 1069 HIS B CD2 1 
ATOM   5783  C  CE1 . HIS B 1 416 ? 89.774  14.248  52.821 1.00 54.77 ? 1069 HIS B CE1 1 
ATOM   5784  N  NE2 . HIS B 1 416 ? 90.144  14.326  54.088 1.00 56.15 ? 1069 HIS B NE2 1 
ATOM   5785  N  N   . LYS B 1 417 ? 93.676  18.362  54.716 1.00 48.03 ? 1070 LYS B N   1 
ATOM   5786  C  CA  . LYS B 1 417 ? 94.026  18.549  56.133 1.00 46.28 ? 1070 LYS B CA  1 
ATOM   5787  C  C   . LYS B 1 417 ? 93.346  19.764  56.727 1.00 43.57 ? 1070 LYS B C   1 
ATOM   5788  O  O   . LYS B 1 417 ? 93.206  19.853  57.938 1.00 44.74 ? 1070 LYS B O   1 
ATOM   5789  C  CB  . LYS B 1 417 ? 95.546  18.679  56.332 1.00 47.54 ? 1070 LYS B CB  1 
ATOM   5790  C  CG  . LYS B 1 417 ? 96.380  17.595  55.650 1.00 50.32 ? 1070 LYS B CG  1 
ATOM   5791  C  CD  . LYS B 1 417 ? 97.604  17.200  56.493 1.00 51.72 ? 1070 LYS B CD  1 
ATOM   5792  C  CE  . LYS B 1 417 ? 98.522  16.211  55.764 1.00 53.75 ? 1070 LYS B CE  1 
ATOM   5793  N  NZ  . LYS B 1 417 ? 99.353  16.862  54.711 1.00 55.39 ? 1070 LYS B NZ  1 
ATOM   5794  N  N   . ILE B 1 418 ? 92.919  20.695  55.884 1.00 40.65 ? 1071 ILE B N   1 
ATOM   5795  C  CA  . ILE B 1 418 ? 92.235  21.888  56.372 1.00 38.57 ? 1071 ILE B CA  1 
ATOM   5796  C  C   . ILE B 1 418 ? 90.875  21.563  56.988 1.00 39.18 ? 1071 ILE B C   1 
ATOM   5797  O  O   . ILE B 1 418 ? 90.463  22.177  57.975 1.00 38.89 ? 1071 ILE B O   1 
ATOM   5798  C  CB  . ILE B 1 418 ? 91.987  22.900  55.224 1.00 37.97 ? 1071 ILE B CB  1 
ATOM   5799  C  CG1 . ILE B 1 418 ? 93.316  23.390  54.657 1.00 36.03 ? 1071 ILE B CG1 1 
ATOM   5800  C  CG2 . ILE B 1 418 ? 91.143  24.070  55.720 1.00 37.83 ? 1071 ILE B CG2 1 
ATOM   5801  C  CD1 . ILE B 1 418 ? 93.174  24.449  53.621 1.00 36.38 ? 1071 ILE B CD1 1 
ATOM   5802  N  N   . TRP B 1 419 ? 90.187  20.574  56.418 1.00 39.71 ? 1072 TRP B N   1 
ATOM   5803  C  CA  . TRP B 1 419 ? 88.831  20.237  56.849 1.00 40.81 ? 1072 TRP B CA  1 
ATOM   5804  C  C   . TRP B 1 419 ? 88.592  18.931  57.587 1.00 43.62 ? 1072 TRP B C   1 
ATOM   5805  O  O   . TRP B 1 419 ? 87.542  18.740  58.193 1.00 44.01 ? 1072 TRP B O   1 
ATOM   5806  C  CB  . TRP B 1 419 ? 87.915  20.273  55.623 1.00 37.16 ? 1072 TRP B CB  1 
ATOM   5807  C  CG  . TRP B 1 419 ? 88.288  21.323  54.624 1.00 32.58 ? 1072 TRP B CG  1 
ATOM   5808  C  CD1 . TRP B 1 419 ? 89.049  21.164  53.489 1.00 31.66 ? 1072 TRP B CD1 1 
ATOM   5809  C  CD2 . TRP B 1 419 ? 87.898  22.702  54.640 1.00 29.76 ? 1072 TRP B CD2 1 
ATOM   5810  N  NE1 . TRP B 1 419 ? 89.151  22.359  52.813 1.00 28.23 ? 1072 TRP B NE1 1 
ATOM   5811  C  CE2 . TRP B 1 419 ? 88.450  23.315  53.509 1.00 28.62 ? 1072 TRP B CE2 1 
ATOM   5812  C  CE3 . TRP B 1 419 ? 87.136  23.470  55.530 1.00 28.73 ? 1072 TRP B CE3 1 
ATOM   5813  C  CZ2 . TRP B 1 419 ? 88.248  24.654  53.215 1.00 28.11 ? 1072 TRP B CZ2 1 
ATOM   5814  C  CZ3 . TRP B 1 419 ? 86.939  24.812  55.235 1.00 27.81 ? 1072 TRP B CZ3 1 
ATOM   5815  C  CH2 . TRP B 1 419 ? 87.499  25.390  54.095 1.00 26.11 ? 1072 TRP B CH2 1 
ATOM   5816  N  N   . LYS B 1 420 ? 89.553  18.027  57.514 1.00 49.01 ? 1073 LYS B N   1 
ATOM   5817  C  CA  . LYS B 1 420 ? 89.448  16.719  58.158 1.00 53.48 ? 1073 LYS B CA  1 
ATOM   5818  C  C   . LYS B 1 420 ? 89.831  16.867  59.629 1.00 55.76 ? 1073 LYS B C   1 
ATOM   5819  O  O   . LYS B 1 420 ? 88.955  16.707  60.520 1.00 55.44 ? 1073 LYS B O   1 
ATOM   5820  C  CB  . LYS B 1 420 ? 90.403  15.748  57.450 1.00 55.60 ? 1073 LYS B CB  1 
ATOM   5821  C  CG  . LYS B 1 420 ? 90.117  14.264  57.652 1.00 60.58 ? 1073 LYS B CG  1 
ATOM   5822  C  CD  . LYS B 1 420 ? 91.075  13.394  56.796 1.00 64.34 ? 1073 LYS B CD  1 
ATOM   5823  C  CE  . LYS B 1 420 ? 90.805  11.905  56.989 1.00 65.90 ? 1073 LYS B CE  1 
ATOM   5824  N  NZ  . LYS B 1 420 ? 91.695  11.066  56.136 1.00 68.02 ? 1073 LYS B NZ  1 
ATOM   5825  O  OXT . LYS B 1 420 ? 91.031  17.167  59.855 1.00 58.04 ? 1073 LYS B OXT 1 
ATOM   5826  N  N   . LEU C 1 6   ? 38.045  22.789  4.313  1.00 73.80 ? 659  LEU C N   1 
ATOM   5827  C  CA  . LEU C 1 6   ? 39.259  22.411  3.527  1.00 74.90 ? 659  LEU C CA  1 
ATOM   5828  C  C   . LEU C 1 6   ? 40.409  23.408  3.760  1.00 75.50 ? 659  LEU C C   1 
ATOM   5829  O  O   . LEU C 1 6   ? 40.467  24.074  4.799  1.00 76.10 ? 659  LEU C O   1 
ATOM   5830  C  CB  . LEU C 1 6   ? 38.910  22.342  2.041  1.00 74.32 ? 659  LEU C CB  1 
ATOM   5831  N  N   . ASP C 1 7   ? 41.326  23.503  2.801  1.00 75.65 ? 660  ASP C N   1 
ATOM   5832  C  CA  . ASP C 1 7   ? 42.471  24.419  2.910  1.00 75.89 ? 660  ASP C CA  1 
ATOM   5833  C  C   . ASP C 1 7   ? 43.378  24.190  1.705  1.00 76.42 ? 660  ASP C C   1 
ATOM   5834  O  O   . ASP C 1 7   ? 44.522  24.668  1.669  1.00 75.66 ? 660  ASP C O   1 
ATOM   5835  C  CB  . ASP C 1 7   ? 43.244  24.160  4.208  1.00 74.55 ? 660  ASP C CB  1 
ATOM   5836  N  N   . LEU C 1 8   ? 42.848  23.439  0.731  1.00 77.12 ? 661  LEU C N   1 
ATOM   5837  C  CA  . LEU C 1 8   ? 43.555  23.110  -0.517 1.00 77.74 ? 661  LEU C CA  1 
ATOM   5838  C  C   . LEU C 1 8   ? 43.929  24.396  -1.268 1.00 77.99 ? 661  LEU C C   1 
ATOM   5839  O  O   . LEU C 1 8   ? 43.161  25.376  -1.254 1.00 78.86 ? 661  LEU C O   1 
ATOM   5840  C  CB  . LEU C 1 8   ? 42.669  22.209  -1.411 1.00 76.91 ? 661  LEU C CB  1 
ATOM   5841  N  N   . ILE C 1 9   ? 45.099  24.382  -1.919 1.00 77.74 ? 662  ILE C N   1 
ATOM   5842  C  CA  . ILE C 1 9   ? 45.615  25.538  -2.672 1.00 77.02 ? 662  ILE C CA  1 
ATOM   5843  C  C   . ILE C 1 9   ? 45.692  26.828  -1.809 1.00 76.99 ? 662  ILE C C   1 
ATOM   5844  O  O   . ILE C 1 9   ? 45.821  27.936  -2.342 1.00 76.89 ? 662  ILE C O   1 
ATOM   5845  C  CB  . ILE C 1 9   ? 44.743  25.784  -3.926 1.00 75.95 ? 662  ILE C CB  1 
ATOM   5846  N  N   . LEU C 1 10  ? 45.621  26.679  -0.483 1.00 76.48 ? 663  LEU C N   1 
ATOM   5847  C  CA  . LEU C 1 10  ? 45.666  27.835  0.421  1.00 75.72 ? 663  LEU C CA  1 
ATOM   5848  C  C   . LEU C 1 10  ? 46.990  28.598  0.270  1.00 75.88 ? 663  LEU C C   1 
ATOM   5849  O  O   . LEU C 1 10  ? 47.143  29.717  0.783  1.00 76.89 ? 663  LEU C O   1 
ATOM   5850  C  CB  . LEU C 1 10  ? 45.447  27.379  1.879  1.00 74.04 ? 663  LEU C CB  1 
ATOM   5851  C  CG  . LEU C 1 10  ? 45.062  28.378  2.992  1.00 72.98 ? 663  LEU C CG  1 
ATOM   5852  C  CD1 . LEU C 1 10  ? 44.325  29.584  2.420  1.00 71.76 ? 663  LEU C CD1 1 
ATOM   5853  C  CD2 . LEU C 1 10  ? 44.193  27.656  4.047  1.00 70.91 ? 663  LEU C CD2 1 
ATOM   5854  N  N   . VAL C 1 11  ? 47.944  27.999  -0.445 1.00 75.47 ? 664  VAL C N   1 
ATOM   5855  C  CA  . VAL C 1 11  ? 49.242  28.649  -0.684 1.00 74.98 ? 664  VAL C CA  1 
ATOM   5856  C  C   . VAL C 1 11  ? 48.938  29.885  -1.523 1.00 74.22 ? 664  VAL C C   1 
ATOM   5857  O  O   . VAL C 1 11  ? 49.401  30.999  -1.228 1.00 73.10 ? 664  VAL C O   1 
ATOM   5858  C  CB  . VAL C 1 11  ? 50.235  27.706  -1.485 1.00 75.33 ? 664  VAL C CB  1 
ATOM   5859  C  CG1 . VAL C 1 11  ? 51.506  28.487  -1.906 1.00 74.38 ? 664  VAL C CG1 1 
ATOM   5860  C  CG2 . VAL C 1 11  ? 50.609  26.479  -0.627 1.00 74.95 ? 664  VAL C CG2 1 
ATOM   5861  N  N   . GLU C 1 12  ? 48.140  29.642  -2.567 1.00 74.31 ? 665  GLU C N   1 
ATOM   5862  C  CA  . GLU C 1 12  ? 47.680  30.644  -3.544 1.00 73.44 ? 665  GLU C CA  1 
ATOM   5863  C  C   . GLU C 1 12  ? 46.702  31.621  -2.886 1.00 72.78 ? 665  GLU C C   1 
ATOM   5864  O  O   . GLU C 1 12  ? 46.877  32.852  -2.972 1.00 73.00 ? 665  GLU C O   1 
ATOM   5865  C  CB  . GLU C 1 12  ? 46.972  29.939  -4.709 1.00 73.50 ? 665  GLU C CB  1 
ATOM   5866  C  CG  . GLU C 1 12  ? 47.880  29.158  -5.665 1.00 74.28 ? 665  GLU C CG  1 
ATOM   5867  C  CD  . GLU C 1 12  ? 47.117  28.058  -6.430 1.00 75.61 ? 665  GLU C CD  1 
ATOM   5868  O  OE1 . GLU C 1 12  ? 47.630  27.613  -7.485 1.00 75.92 ? 665  GLU C OE1 1 
ATOM   5869  O  OE2 . GLU C 1 12  ? 46.021  27.626  -5.973 1.00 74.97 ? 665  GLU C OE2 1 
ATOM   5870  N  N   . GLU C 1 13  ? 45.675  31.054  -2.243 1.00 71.12 ? 666  GLU C N   1 
ATOM   5871  C  CA  . GLU C 1 13  ? 44.650  31.830  -1.552 1.00 69.46 ? 666  GLU C CA  1 
ATOM   5872  C  C   . GLU C 1 13  ? 45.311  32.885  -0.669 1.00 67.66 ? 666  GLU C C   1 
ATOM   5873  O  O   . GLU C 1 13  ? 45.109  34.091  -0.859 1.00 68.59 ? 666  GLU C O   1 
ATOM   5874  C  CB  . GLU C 1 13  ? 43.777  30.907  -0.690 1.00 71.15 ? 666  GLU C CB  1 
ATOM   5875  C  CG  . GLU C 1 13  ? 43.122  29.754  -1.459 1.00 72.99 ? 666  GLU C CG  1 
ATOM   5876  C  CD  . GLU C 1 13  ? 42.181  28.919  -0.586 1.00 74.60 ? 666  GLU C CD  1 
ATOM   5877  O  OE1 . GLU C 1 13  ? 42.660  28.146  0.300  1.00 74.61 ? 666  GLU C OE1 1 
ATOM   5878  O  OE2 . GLU C 1 13  ? 40.948  29.050  -0.795 1.00 74.28 ? 666  GLU C OE2 1 
ATOM   5879  N  N   . TYR C 1 14  ? 46.121  32.413  0.270  1.00 64.05 ? 667  TYR C N   1 
ATOM   5880  C  CA  . TYR C 1 14  ? 46.829  33.255  1.219  1.00 61.34 ? 667  TYR C CA  1 
ATOM   5881  C  C   . TYR C 1 14  ? 47.537  34.470  0.585  1.00 60.77 ? 667  TYR C C   1 
ATOM   5882  O  O   . TYR C 1 14  ? 47.497  35.582  1.129  1.00 59.20 ? 667  TYR C O   1 
ATOM   5883  C  CB  . TYR C 1 14  ? 47.841  32.385  2.002  1.00 59.00 ? 667  TYR C CB  1 
ATOM   5884  C  CG  . TYR C 1 14  ? 48.672  33.150  3.009  1.00 55.39 ? 667  TYR C CG  1 
ATOM   5885  C  CD1 . TYR C 1 14  ? 48.250  33.299  4.333  1.00 53.62 ? 667  TYR C CD1 1 
ATOM   5886  C  CD2 . TYR C 1 14  ? 49.842  33.800  2.614  1.00 53.58 ? 667  TYR C CD2 1 
ATOM   5887  C  CE1 . TYR C 1 14  ? 48.977  34.094  5.234  1.00 52.17 ? 667  TYR C CE1 1 
ATOM   5888  C  CE2 . TYR C 1 14  ? 50.564  34.591  3.504  1.00 53.29 ? 667  TYR C CE2 1 
ATOM   5889  C  CZ  . TYR C 1 14  ? 50.124  34.738  4.810  1.00 52.00 ? 667  TYR C CZ  1 
ATOM   5890  O  OH  . TYR C 1 14  ? 50.820  35.566  5.653  1.00 51.76 ? 667  TYR C OH  1 
ATOM   5891  N  N   . ASP C 1 15  ? 48.195  34.265  -0.554 1.00 60.32 ? 668  ASP C N   1 
ATOM   5892  C  CA  . ASP C 1 15  ? 48.902  35.367  -1.219 1.00 60.75 ? 668  ASP C CA  1 
ATOM   5893  C  C   . ASP C 1 15  ? 47.938  36.435  -1.754 1.00 59.72 ? 668  ASP C C   1 
ATOM   5894  O  O   . ASP C 1 15  ? 48.108  37.632  -1.496 1.00 59.01 ? 668  ASP C O   1 
ATOM   5895  C  CB  . ASP C 1 15  ? 49.766  34.830  -2.368 1.00 61.68 ? 668  ASP C CB  1 
ATOM   5896  C  CG  . ASP C 1 15  ? 50.961  34.027  -1.874 1.00 63.65 ? 668  ASP C CG  1 
ATOM   5897  O  OD1 . ASP C 1 15  ? 50.912  33.519  -0.728 1.00 65.03 ? 668  ASP C OD1 1 
ATOM   5898  O  OD2 . ASP C 1 15  ? 51.948  33.887  -2.632 1.00 63.76 ? 668  ASP C OD2 1 
ATOM   5899  N  N   . SER C 1 16  ? 46.930  36.005  -2.504 1.00 59.60 ? 669  SER C N   1 
ATOM   5900  C  CA  . SER C 1 16  ? 45.965  36.951  -3.065 1.00 59.27 ? 669  SER C CA  1 
ATOM   5901  C  C   . SER C 1 16  ? 45.126  37.601  -1.951 1.00 58.10 ? 669  SER C C   1 
ATOM   5902  O  O   . SER C 1 16  ? 44.862  38.800  -2.000 1.00 58.78 ? 669  SER C O   1 
ATOM   5903  C  CB  . SER C 1 16  ? 45.058  36.242  -4.081 1.00 59.12 ? 669  SER C CB  1 
ATOM   5904  O  OG  . SER C 1 16  ? 43.709  36.260  -3.646 1.00 61.80 ? 669  SER C OG  1 
ATOM   5905  N  N   . LEU C 1 17  ? 44.740  36.812  -0.945 1.00 55.36 ? 670  LEU C N   1 
ATOM   5906  C  CA  . LEU C 1 17  ? 43.937  37.303  0.175  1.00 53.42 ? 670  LEU C CA  1 
ATOM   5907  C  C   . LEU C 1 17  ? 44.673  38.369  0.989  1.00 52.62 ? 670  LEU C C   1 
ATOM   5908  O  O   . LEU C 1 17  ? 44.159  39.482  1.208  1.00 51.23 ? 670  LEU C O   1 
ATOM   5909  C  CB  . LEU C 1 17  ? 43.532  36.127  1.080  1.00 51.89 ? 670  LEU C CB  1 
ATOM   5910  C  CG  . LEU C 1 17  ? 42.380  36.200  2.101  1.00 53.85 ? 670  LEU C CG  1 
ATOM   5911  C  CD1 . LEU C 1 17  ? 41.930  34.803  2.492  1.00 52.46 ? 670  LEU C CD1 1 
ATOM   5912  C  CD2 . LEU C 1 17  ? 42.811  36.937  3.353  1.00 54.59 ? 670  LEU C CD2 1 
ATOM   5913  N  N   . ILE C 1 18  ? 45.883  38.038  1.422  1.00 52.46 ? 671  ILE C N   1 
ATOM   5914  C  CA  . ILE C 1 18  ? 46.655  38.961  2.234  1.00 53.89 ? 671  ILE C CA  1 
ATOM   5915  C  C   . ILE C 1 18  ? 46.905  40.232  1.437  1.00 54.03 ? 671  ILE C C   1 
ATOM   5916  O  O   . ILE C 1 18  ? 46.971  41.329  2.000  1.00 54.11 ? 671  ILE C O   1 
ATOM   5917  C  CB  . ILE C 1 18  ? 48.004  38.302  2.738  1.00 53.74 ? 671  ILE C CB  1 
ATOM   5918  C  CG1 . ILE C 1 18  ? 48.527  39.049  3.971  1.00 53.00 ? 671  ILE C CG1 1 
ATOM   5919  C  CG2 . ILE C 1 18  ? 49.037  38.275  1.637  1.00 53.48 ? 671  ILE C CG2 1 
ATOM   5920  C  CD1 . ILE C 1 18  ? 47.678  38.830  5.222  1.00 50.33 ? 671  ILE C CD1 1 
ATOM   5921  N  N   . GLU C 1 19  ? 47.006  40.099  0.119  1.00 55.23 ? 672  GLU C N   1 
ATOM   5922  C  CA  . GLU C 1 19  ? 47.227  41.282  -0.702 1.00 55.99 ? 672  GLU C CA  1 
ATOM   5923  C  C   . GLU C 1 19  ? 45.994  42.202  -0.661 1.00 54.98 ? 672  GLU C C   1 
ATOM   5924  O  O   . GLU C 1 19  ? 46.114  43.416  -0.463 1.00 55.23 ? 672  GLU C O   1 
ATOM   5925  C  CB  . GLU C 1 19  ? 47.554  40.882  -2.138 1.00 58.16 ? 672  GLU C CB  1 
ATOM   5926  C  CG  . GLU C 1 19  ? 48.368  41.951  -2.880 1.00 62.47 ? 672  GLU C CG  1 
ATOM   5927  C  CD  . GLU C 1 19  ? 47.533  42.767  -3.872 1.00 65.79 ? 672  GLU C CD  1 
ATOM   5928  O  OE1 . GLU C 1 19  ? 48.001  43.859  -4.302 1.00 66.00 ? 672  GLU C OE1 1 
ATOM   5929  O  OE2 . GLU C 1 19  ? 46.410  42.315  -4.234 1.00 68.21 ? 672  GLU C OE2 1 
ATOM   5930  N  N   . LYS C 1 20  ? 44.816  41.625  -0.849 1.00 53.32 ? 673  LYS C N   1 
ATOM   5931  C  CA  . LYS C 1 20  ? 43.600  42.408  -0.808 1.00 52.94 ? 673  LYS C CA  1 
ATOM   5932  C  C   . LYS C 1 20  ? 43.430  43.069  0.558  1.00 52.38 ? 673  LYS C C   1 
ATOM   5933  O  O   . LYS C 1 20  ? 43.047  44.243  0.636  1.00 50.86 ? 673  LYS C O   1 
ATOM   5934  C  CB  . LYS C 1 20  ? 42.392  41.519  -1.104 1.00 54.67 ? 673  LYS C CB  1 
ATOM   5935  C  CG  . LYS C 1 20  ? 42.375  40.970  -2.524 1.00 55.39 ? 673  LYS C CG  1 
ATOM   5936  C  CD  . LYS C 1 20  ? 41.434  39.792  -2.637 1.00 56.98 ? 673  LYS C CD  1 
ATOM   5937  C  CE  . LYS C 1 20  ? 41.624  39.047  -3.953 1.00 57.97 ? 673  LYS C CE  1 
ATOM   5938  N  NZ  . LYS C 1 20  ? 40.901  37.722  -3.912 1.00 59.38 ? 673  LYS C NZ  1 
ATOM   5939  N  N   . MET C 1 21  ? 43.734  42.326  1.628  1.00 51.67 ? 674  MET C N   1 
ATOM   5940  C  CA  . MET C 1 21  ? 43.588  42.852  2.988  1.00 50.97 ? 674  MET C CA  1 
ATOM   5941  C  C   . MET C 1 21  ? 44.643  43.875  3.358  1.00 51.25 ? 674  MET C C   1 
ATOM   5942  O  O   . MET C 1 21  ? 44.465  44.647  4.298  1.00 49.47 ? 674  MET C O   1 
ATOM   5943  C  CB  . MET C 1 21  ? 43.620  41.726  4.018  1.00 51.43 ? 674  MET C CB  1 
ATOM   5944  C  CG  . MET C 1 21  ? 42.614  40.622  3.761  1.00 51.46 ? 674  MET C CG  1 
ATOM   5945  S  SD  . MET C 1 21  ? 42.675  39.450  5.109  1.00 49.28 ? 674  MET C SD  1 
ATOM   5946  C  CE  . MET C 1 21  ? 41.637  40.264  6.144  1.00 51.33 ? 674  MET C CE  1 
ATOM   5947  N  N   . SER C 1 22  ? 45.747  43.887  2.622  1.00 51.57 ? 675  SER C N   1 
ATOM   5948  C  CA  . SER C 1 22  ? 46.787  44.841  2.934  1.00 53.01 ? 675  SER C CA  1 
ATOM   5949  C  C   . SER C 1 22  ? 46.290  46.272  2.745  1.00 53.94 ? 675  SER C C   1 
ATOM   5950  O  O   . SER C 1 22  ? 46.971  47.226  3.105  1.00 55.05 ? 675  SER C O   1 
ATOM   5951  C  CB  . SER C 1 22  ? 48.033  44.577  2.088  1.00 52.82 ? 675  SER C CB  1 
ATOM   5952  O  OG  . SER C 1 22  ? 48.573  43.314  2.414  1.00 51.96 ? 675  SER C OG  1 
ATOM   5953  N  N   . ASN C 1 23  ? 45.092  46.424  2.197  1.00 54.79 ? 676  ASN C N   1 
ATOM   5954  C  CA  . ASN C 1 23  ? 44.531  47.755  1.987  1.00 54.38 ? 676  ASN C CA  1 
ATOM   5955  C  C   . ASN C 1 23  ? 43.514  48.102  3.094  1.00 52.87 ? 676  ASN C C   1 
ATOM   5956  O  O   . ASN C 1 23  ? 42.724  47.253  3.504  1.00 51.61 ? 676  ASN C O   1 
ATOM   5957  C  CB  . ASN C 1 23  ? 43.896  47.807  0.591  1.00 58.38 ? 676  ASN C CB  1 
ATOM   5958  C  CG  . ASN C 1 23  ? 43.274  49.163  0.271  1.00 62.56 ? 676  ASN C CG  1 
ATOM   5959  O  OD1 . ASN C 1 23  ? 43.751  50.224  0.721  1.00 65.27 ? 676  ASN C OD1 1 
ATOM   5960  N  ND2 . ASN C 1 23  ? 42.211  49.138  -0.533 1.00 64.58 ? 676  ASN C ND2 1 
ATOM   5961  N  N   . TRP C 1 24  ? 43.572  49.331  3.609  1.00 50.61 ? 677  TRP C N   1 
ATOM   5962  C  CA  . TRP C 1 24  ? 42.626  49.765  4.649  1.00 49.60 ? 677  TRP C CA  1 
ATOM   5963  C  C   . TRP C 1 24  ? 41.195  49.539  4.167  1.00 48.46 ? 677  TRP C C   1 
ATOM   5964  O  O   . TRP C 1 24  ? 40.337  49.100  4.931  1.00 48.49 ? 677  TRP C O   1 
ATOM   5965  C  CB  . TRP C 1 24  ? 42.834  51.246  4.979  1.00 50.22 ? 677  TRP C CB  1 
ATOM   5966  C  CG  . TRP C 1 24  ? 41.731  51.891  5.799  1.00 51.24 ? 677  TRP C CG  1 
ATOM   5967  C  CD1 . TRP C 1 24  ? 40.990  52.988  5.449  1.00 51.66 ? 677  TRP C CD1 1 
ATOM   5968  C  CD2 . TRP C 1 24  ? 41.277  51.512  7.108  1.00 51.17 ? 677  TRP C CD2 1 
ATOM   5969  N  NE1 . TRP C 1 24  ? 40.107  53.312  6.452  1.00 51.06 ? 677  TRP C NE1 1 
ATOM   5970  C  CE2 . TRP C 1 24  ? 40.264  52.425  7.483  1.00 50.72 ? 677  TRP C CE2 1 
ATOM   5971  C  CE3 . TRP C 1 24  ? 41.633  50.495  8.002  1.00 51.99 ? 677  TRP C CE3 1 
ATOM   5972  C  CZ2 . TRP C 1 24  ? 39.600  52.350  8.709  1.00 51.15 ? 677  TRP C CZ2 1 
ATOM   5973  C  CZ3 . TRP C 1 24  ? 40.969  50.417  9.229  1.00 51.76 ? 677  TRP C CZ3 1 
ATOM   5974  C  CH2 . TRP C 1 24  ? 39.964  51.343  9.567  1.00 51.65 ? 677  TRP C CH2 1 
ATOM   5975  N  N   . ASN C 1 25  ? 40.952  49.848  2.896  1.00 46.47 ? 678  ASN C N   1 
ATOM   5976  C  CA  . ASN C 1 25  ? 39.650  49.649  2.293  1.00 45.56 ? 678  ASN C CA  1 
ATOM   5977  C  C   . ASN C 1 25  ? 39.658  48.284  1.637  1.00 45.12 ? 678  ASN C C   1 
ATOM   5978  O  O   . ASN C 1 25  ? 39.568  48.163  0.423  1.00 45.47 ? 678  ASN C O   1 
ATOM   5979  C  CB  . ASN C 1 25  ? 39.357  50.748  1.247  1.00 44.80 ? 678  ASN C CB  1 
ATOM   5980  C  CG  . ASN C 1 25  ? 39.144  52.099  1.883  1.00 44.19 ? 678  ASN C CG  1 
ATOM   5981  O  OD1 . ASN C 1 25  ? 38.257  52.260  2.713  1.00 47.41 ? 678  ASN C OD1 1 
ATOM   5982  N  ND2 . ASN C 1 25  ? 39.964  53.071  1.523  1.00 42.18 ? 678  ASN C ND2 1 
ATOM   5983  N  N   . PHE C 1 26  ? 39.773  47.250  2.451  1.00 45.37 ? 679  PHE C N   1 
ATOM   5984  C  CA  . PHE C 1 26  ? 39.800  45.889  1.939  1.00 45.16 ? 679  PHE C CA  1 
ATOM   5985  C  C   . PHE C 1 26  ? 38.423  45.547  1.364  1.00 45.69 ? 679  PHE C C   1 
ATOM   5986  O  O   . PHE C 1 26  ? 37.437  45.540  2.089  1.00 47.26 ? 679  PHE C O   1 
ATOM   5987  C  CB  . PHE C 1 26  ? 40.199  44.932  3.091  1.00 44.69 ? 679  PHE C CB  1 
ATOM   5988  C  CG  . PHE C 1 26  ? 39.752  43.502  2.901  1.00 43.31 ? 679  PHE C CG  1 
ATOM   5989  C  CD1 . PHE C 1 26  ? 40.120  42.783  1.767  1.00 43.81 ? 679  PHE C CD1 1 
ATOM   5990  C  CD2 . PHE C 1 26  ? 38.933  42.889  3.846  1.00 42.28 ? 679  PHE C CD2 1 
ATOM   5991  C  CE1 . PHE C 1 26  ? 39.673  41.480  1.571  1.00 42.88 ? 679  PHE C CE1 1 
ATOM   5992  C  CE2 . PHE C 1 26  ? 38.482  41.585  3.659  1.00 42.67 ? 679  PHE C CE2 1 
ATOM   5993  C  CZ  . PHE C 1 26  ? 38.853  40.883  2.515  1.00 42.73 ? 679  PHE C CZ  1 
ATOM   5994  N  N   . PRO C 1 27  ? 38.337  45.262  0.054  1.00 45.52 ? 680  PRO C N   1 
ATOM   5995  C  CA  . PRO C 1 27  ? 37.049  44.926  -0.567 1.00 44.40 ? 680  PRO C CA  1 
ATOM   5996  C  C   . PRO C 1 27  ? 36.413  43.675  -0.037 1.00 43.30 ? 680  PRO C C   1 
ATOM   5997  O  O   . PRO C 1 27  ? 36.201  42.716  -0.765 1.00 44.54 ? 680  PRO C O   1 
ATOM   5998  C  CB  . PRO C 1 27  ? 37.380  44.815  -2.055 1.00 45.27 ? 680  PRO C CB  1 
ATOM   5999  C  CG  . PRO C 1 27  ? 38.824  44.397  -2.065 1.00 47.98 ? 680  PRO C CG  1 
ATOM   6000  C  CD  . PRO C 1 27  ? 39.422  45.241  -0.943 1.00 47.42 ? 680  PRO C CD  1 
ATOM   6001  N  N   . ILE C 1 28  ? 36.064  43.712  1.233  1.00 42.87 ? 681  ILE C N   1 
ATOM   6002  C  CA  . ILE C 1 28  ? 35.458  42.571  1.888  1.00 43.83 ? 681  ILE C CA  1 
ATOM   6003  C  C   . ILE C 1 28  ? 34.220  41.965  1.204  1.00 43.47 ? 681  ILE C C   1 
ATOM   6004  O  O   . ILE C 1 28  ? 34.014  40.746  1.269  1.00 44.11 ? 681  ILE C O   1 
ATOM   6005  C  CB  . ILE C 1 28  ? 35.158  42.924  3.394  1.00 43.38 ? 681  ILE C CB  1 
ATOM   6006  C  CG1 . ILE C 1 28  ? 34.839  41.656  4.169  1.00 42.75 ? 681  ILE C CG1 1 
ATOM   6007  C  CG2 . ILE C 1 28  ? 34.014  43.957  3.497  1.00 44.17 ? 681  ILE C CG2 1 
ATOM   6008  C  CD1 . ILE C 1 28  ? 34.552  41.902  5.643  1.00 43.01 ? 681  ILE C CD1 1 
ATOM   6009  N  N   . PHE C 1 29  ? 33.404  42.776  0.536  1.00 42.76 ? 682  PHE C N   1 
ATOM   6010  C  CA  . PHE C 1 29  ? 32.206  42.217  -0.107 1.00 42.13 ? 682  PHE C CA  1 
ATOM   6011  C  C   . PHE C 1 29  ? 32.513  41.434  -1.372 1.00 42.79 ? 682  PHE C C   1 
ATOM   6012  O  O   . PHE C 1 29  ? 31.772  40.518  -1.761 1.00 39.72 ? 682  PHE C O   1 
ATOM   6013  C  CB  . PHE C 1 29  ? 31.176  43.317  -0.369 1.00 41.45 ? 682  PHE C CB  1 
ATOM   6014  C  CG  . PHE C 1 29  ? 30.685  43.965  0.890  1.00 37.58 ? 682  PHE C CG  1 
ATOM   6015  C  CD1 . PHE C 1 29  ? 31.184  45.189  1.297  1.00 37.08 ? 682  PHE C CD1 1 
ATOM   6016  C  CD2 . PHE C 1 29  ? 29.810  43.293  1.722  1.00 37.03 ? 682  PHE C CD2 1 
ATOM   6017  C  CE1 . PHE C 1 29  ? 30.829  45.738  2.522  1.00 36.41 ? 682  PHE C CE1 1 
ATOM   6018  C  CE2 . PHE C 1 29  ? 29.445  43.829  2.953  1.00 36.69 ? 682  PHE C CE2 1 
ATOM   6019  C  CZ  . PHE C 1 29  ? 29.960  45.055  3.348  1.00 36.86 ? 682  PHE C CZ  1 
ATOM   6020  N  N   . GLU C 1 30  ? 33.630  41.784  -1.997 1.00 45.44 ? 683  GLU C N   1 
ATOM   6021  C  CA  . GLU C 1 30  ? 34.051  41.076  -3.188 1.00 49.44 ? 683  GLU C CA  1 
ATOM   6022  C  C   . GLU C 1 30  ? 34.425  39.687  -2.718 1.00 50.39 ? 683  GLU C C   1 
ATOM   6023  O  O   . GLU C 1 30  ? 33.975  38.684  -3.279 1.00 52.14 ? 683  GLU C O   1 
ATOM   6024  C  CB  . GLU C 1 30  ? 35.247  41.764  -3.845 1.00 51.19 ? 683  GLU C CB  1 
ATOM   6025  C  CG  . GLU C 1 30  ? 34.941  43.173  -4.344 1.00 55.01 ? 683  GLU C CG  1 
ATOM   6026  C  CD  . GLU C 1 30  ? 35.946  43.654  -5.384 1.00 58.98 ? 683  GLU C CD  1 
ATOM   6027  O  OE1 . GLU C 1 30  ? 35.545  43.850  -6.559 1.00 61.27 ? 683  GLU C OE1 1 
ATOM   6028  O  OE2 . GLU C 1 30  ? 37.142  43.832  -5.040 1.00 60.30 ? 683  GLU C OE2 1 
ATOM   6029  N  N   . LEU C 1 31  ? 35.235  39.629  -1.670 1.00 50.72 ? 684  LEU C N   1 
ATOM   6030  C  CA  . LEU C 1 31  ? 35.646  38.350  -1.087 1.00 50.87 ? 684  LEU C CA  1 
ATOM   6031  C  C   . LEU C 1 31  ? 34.425  37.451  -0.841 1.00 51.67 ? 684  LEU C C   1 
ATOM   6032  O  O   . LEU C 1 31  ? 34.435  36.246  -1.128 1.00 49.74 ? 684  LEU C O   1 
ATOM   6033  C  CB  . LEU C 1 31  ? 36.354  38.607  0.246  1.00 50.53 ? 684  LEU C CB  1 
ATOM   6034  C  CG  . LEU C 1 31  ? 36.726  37.358  1.049  1.00 50.76 ? 684  LEU C CG  1 
ATOM   6035  C  CD1 . LEU C 1 31  ? 37.734  36.516  0.267  1.00 49.28 ? 684  LEU C CD1 1 
ATOM   6036  C  CD2 . LEU C 1 31  ? 37.303  37.777  2.380  1.00 50.23 ? 684  LEU C CD2 1 
ATOM   6037  N  N   . VAL C 1 32  ? 33.377  38.068  -0.294 1.00 53.30 ? 685  VAL C N   1 
ATOM   6038  C  CA  . VAL C 1 32  ? 32.143  37.369  0.014  1.00 53.75 ? 685  VAL C CA  1 
ATOM   6039  C  C   . VAL C 1 32  ? 31.517  36.784  -1.223 1.00 55.45 ? 685  VAL C C   1 
ATOM   6040  O  O   . VAL C 1 32  ? 31.151  35.607  -1.250 1.00 55.39 ? 685  VAL C O   1 
ATOM   6041  C  CB  . VAL C 1 32  ? 31.129  38.301  0.670  1.00 53.39 ? 685  VAL C CB  1 
ATOM   6042  C  CG1 . VAL C 1 32  ? 29.814  37.572  0.884  1.00 52.38 ? 685  VAL C CG1 1 
ATOM   6043  C  CG2 . VAL C 1 32  ? 31.671  38.786  1.996  1.00 53.89 ? 685  VAL C CG2 1 
ATOM   6044  N  N   . GLU C 1 33  ? 31.397  37.604  -2.259 1.00 57.58 ? 686  GLU C N   1 
ATOM   6045  C  CA  . GLU C 1 33  ? 30.786  37.125  -3.488 1.00 59.41 ? 686  GLU C CA  1 
ATOM   6046  C  C   . GLU C 1 33  ? 31.655  36.117  -4.213 1.00 58.51 ? 686  GLU C C   1 
ATOM   6047  O  O   . GLU C 1 33  ? 31.145  35.231  -4.882 1.00 59.06 ? 686  GLU C O   1 
ATOM   6048  C  CB  . GLU C 1 33  ? 30.448  38.290  -4.416 1.00 62.38 ? 686  GLU C CB  1 
ATOM   6049  C  CG  . GLU C 1 33  ? 29.940  37.829  -5.764 1.00 66.43 ? 686  GLU C CG  1 
ATOM   6050  C  CD  . GLU C 1 33  ? 29.512  38.981  -6.638 1.00 69.36 ? 686  GLU C CD  1 
ATOM   6051  O  OE1 . GLU C 1 33  ? 28.384  39.493  -6.420 1.00 70.62 ? 686  GLU C OE1 1 
ATOM   6052  O  OE2 . GLU C 1 33  ? 30.311  39.390  -7.527 1.00 70.07 ? 686  GLU C OE2 1 
ATOM   6053  N  N   . LYS C 1 34  ? 32.965  36.236  -4.078 1.00 58.52 ? 687  LYS C N   1 
ATOM   6054  C  CA  . LYS C 1 34  ? 33.849  35.286  -4.736 1.00 59.12 ? 687  LYS C CA  1 
ATOM   6055  C  C   . LYS C 1 34  ? 33.847  33.916  -4.051 1.00 59.56 ? 687  LYS C C   1 
ATOM   6056  O  O   . LYS C 1 34  ? 34.256  32.927  -4.650 1.00 60.43 ? 687  LYS C O   1 
ATOM   6057  C  CB  . LYS C 1 34  ? 35.277  35.827  -4.773 1.00 58.91 ? 687  LYS C CB  1 
ATOM   6058  C  CG  . LYS C 1 34  ? 36.265  34.878  -5.444 1.00 60.86 ? 687  LYS C CG  1 
ATOM   6059  C  CD  . LYS C 1 34  ? 37.659  35.466  -5.411 1.00 62.90 ? 687  LYS C CD  1 
ATOM   6060  C  CE  . LYS C 1 34  ? 38.722  34.538  -5.977 1.00 63.96 ? 687  LYS C CE  1 
ATOM   6061  N  NZ  . LYS C 1 34  ? 40.066  35.210  -5.848 1.00 65.46 ? 687  LYS C NZ  1 
ATOM   6062  N  N   . MET C 1 35  ? 33.399  33.852  -2.800 1.00 60.11 ? 688  MET C N   1 
ATOM   6063  C  CA  . MET C 1 35  ? 33.376  32.582  -2.078 1.00 60.75 ? 688  MET C CA  1 
ATOM   6064  C  C   . MET C 1 35  ? 32.123  31.774  -2.397 1.00 61.10 ? 688  MET C C   1 
ATOM   6065  O  O   . MET C 1 35  ? 32.077  30.557  -2.194 1.00 61.58 ? 688  MET C O   1 
ATOM   6066  C  CB  . MET C 1 35  ? 33.481  32.824  -0.564 1.00 61.19 ? 688  MET C CB  1 
ATOM   6067  C  CG  . MET C 1 35  ? 34.874  33.314  -0.107 1.00 61.27 ? 688  MET C CG  1 
ATOM   6068  S  SD  . MET C 1 35  ? 35.087  33.415  1.698  1.00 60.85 ? 688  MET C SD  1 
ATOM   6069  C  CE  . MET C 1 35  ? 35.370  31.612  2.111  1.00 59.36 ? 688  MET C CE  1 
ATOM   6070  N  N   . GLY C 1 36  ? 31.104  32.461  -2.895 1.00 61.27 ? 689  GLY C N   1 
ATOM   6071  C  CA  . GLY C 1 36  ? 29.866  31.795  -3.244 1.00 61.14 ? 689  GLY C CA  1 
ATOM   6072  C  C   . GLY C 1 36  ? 29.157  31.098  -2.101 1.00 61.26 ? 689  GLY C C   1 
ATOM   6073  O  O   . GLY C 1 36  ? 28.813  31.719  -1.095 1.00 60.70 ? 689  GLY C O   1 
ATOM   6074  N  N   . GLU C 1 37  ? 28.930  29.799  -2.267 1.00 62.19 ? 690  GLU C N   1 
ATOM   6075  C  CA  . GLU C 1 37  ? 28.247  28.994  -1.251 1.00 63.54 ? 690  GLU C CA  1 
ATOM   6076  C  C   . GLU C 1 37  ? 29.119  28.746  -0.020 1.00 62.45 ? 690  GLU C C   1 
ATOM   6077  O  O   . GLU C 1 37  ? 28.636  28.273  1.007  1.00 62.73 ? 690  GLU C O   1 
ATOM   6078  C  CB  . GLU C 1 37  ? 27.827  27.655  -1.854 1.00 65.75 ? 690  GLU C CB  1 
ATOM   6079  C  CG  . GLU C 1 37  ? 27.345  27.801  -3.283 1.00 69.96 ? 690  GLU C CG  1 
ATOM   6080  C  CD  . GLU C 1 37  ? 26.764  26.532  -3.837 1.00 71.90 ? 690  GLU C CD  1 
ATOM   6081  O  OE1 . GLU C 1 37  ? 25.588  26.233  -3.509 1.00 73.57 ? 690  GLU C OE1 1 
ATOM   6082  O  OE2 . GLU C 1 37  ? 27.483  25.830  -4.596 1.00 72.96 ? 690  GLU C OE2 1 
ATOM   6083  N  N   . LYS C 1 38  ? 30.399  29.081  -0.122 1.00 60.61 ? 691  LYS C N   1 
ATOM   6084  C  CA  . LYS C 1 38  ? 31.314  28.885  0.986  1.00 58.95 ? 691  LYS C CA  1 
ATOM   6085  C  C   . LYS C 1 38  ? 31.587  30.172  1.748  1.00 57.89 ? 691  LYS C C   1 
ATOM   6086  O  O   . LYS C 1 38  ? 32.528  30.249  2.530  1.00 58.16 ? 691  LYS C O   1 
ATOM   6087  C  CB  . LYS C 1 38  ? 32.610  28.310  0.452  1.00 59.21 ? 691  LYS C CB  1 
ATOM   6088  C  CG  . LYS C 1 38  ? 32.361  27.056  -0.328 1.00 59.66 ? 691  LYS C CG  1 
ATOM   6089  C  CD  . LYS C 1 38  ? 33.648  26.434  -0.801 1.00 62.27 ? 691  LYS C CD  1 
ATOM   6090  C  CE  . LYS C 1 38  ? 33.382  25.031  -1.295 1.00 62.48 ? 691  LYS C CE  1 
ATOM   6091  N  NZ  . LYS C 1 38  ? 32.544  24.319  -0.277 1.00 64.24 ? 691  LYS C NZ  1 
ATOM   6092  N  N   . SER C 1 39  ? 30.758  31.180  1.515  1.00 56.19 ? 692  SER C N   1 
ATOM   6093  C  CA  . SER C 1 39  ? 30.904  32.466  2.178  1.00 54.53 ? 692  SER C CA  1 
ATOM   6094  C  C   . SER C 1 39  ? 30.680  32.359  3.697  1.00 53.86 ? 692  SER C C   1 
ATOM   6095  O  O   . SER C 1 39  ? 31.053  33.263  4.453  1.00 53.00 ? 692  SER C O   1 
ATOM   6096  C  CB  . SER C 1 39  ? 29.917  33.465  1.572  1.00 54.05 ? 692  SER C CB  1 
ATOM   6097  O  OG  . SER C 1 39  ? 28.611  32.932  1.604  1.00 54.44 ? 692  SER C OG  1 
ATOM   6098  N  N   . GLY C 1 40  ? 30.068  31.259  4.131  1.00 52.89 ? 693  GLY C N   1 
ATOM   6099  C  CA  . GLY C 1 40  ? 29.816  31.045  5.547  1.00 51.68 ? 693  GLY C CA  1 
ATOM   6100  C  C   . GLY C 1 40  ? 31.084  30.769  6.343  1.00 52.21 ? 693  GLY C C   1 
ATOM   6101  O  O   . GLY C 1 40  ? 31.079  30.832  7.580  1.00 52.17 ? 693  GLY C O   1 
ATOM   6102  N  N   . ARG C 1 41  ? 32.170  30.467  5.636  1.00 51.28 ? 694  ARG C N   1 
ATOM   6103  C  CA  . ARG C 1 41  ? 33.453  30.194  6.275  1.00 51.70 ? 694  ARG C CA  1 
ATOM   6104  C  C   . ARG C 1 41  ? 34.426  31.346  6.027  1.00 50.48 ? 694  ARG C C   1 
ATOM   6105  O  O   . ARG C 1 41  ? 35.622  31.136  5.844  1.00 51.32 ? 694  ARG C O   1 
ATOM   6106  C  CB  . ARG C 1 41  ? 34.032  28.884  5.731  1.00 52.54 ? 694  ARG C CB  1 
ATOM   6107  C  CG  . ARG C 1 41  ? 33.126  27.688  6.009  1.00 55.98 ? 694  ARG C CG  1 
ATOM   6108  C  CD  . ARG C 1 41  ? 33.923  26.399  6.178  1.00 60.25 ? 694  ARG C CD  1 
ATOM   6109  N  NE  . ARG C 1 41  ? 34.660  26.018  4.973  1.00 63.45 ? 694  ARG C NE  1 
ATOM   6110  C  CZ  . ARG C 1 41  ? 35.368  24.894  4.832  1.00 64.61 ? 694  ARG C CZ  1 
ATOM   6111  N  NH1 . ARG C 1 41  ? 35.453  24.014  5.828  1.00 65.33 ? 694  ARG C NH1 1 
ATOM   6112  N  NH2 . ARG C 1 41  ? 35.982  24.641  3.683  1.00 65.32 ? 694  ARG C NH2 1 
ATOM   6113  N  N   . ILE C 1 42  ? 33.910  32.568  6.054  1.00 48.34 ? 695  ILE C N   1 
ATOM   6114  C  CA  . ILE C 1 42  ? 34.738  33.719  5.760  1.00 47.06 ? 695  ILE C CA  1 
ATOM   6115  C  C   . ILE C 1 42  ? 35.552  34.227  6.932  1.00 46.16 ? 695  ILE C C   1 
ATOM   6116  O  O   . ILE C 1 42  ? 36.645  34.767  6.768  1.00 46.32 ? 695  ILE C O   1 
ATOM   6117  C  CB  . ILE C 1 42  ? 33.878  34.899  5.193  1.00 46.47 ? 695  ILE C CB  1 
ATOM   6118  C  CG1 . ILE C 1 42  ? 34.805  36.030  4.736  1.00 45.02 ? 695  ILE C CG1 1 
ATOM   6119  C  CG2 . ILE C 1 42  ? 32.900  35.395  6.248  1.00 45.50 ? 695  ILE C CG2 1 
ATOM   6120  C  CD1 . ILE C 1 42  ? 34.116  37.264  4.248  1.00 45.30 ? 695  ILE C CD1 1 
ATOM   6121  N  N   . LEU C 1 43  ? 35.012  34.065  8.123  1.00 45.20 ? 696  LEU C N   1 
ATOM   6122  C  CA  . LEU C 1 43  ? 35.700  34.530  9.305  1.00 44.65 ? 696  LEU C CA  1 
ATOM   6123  C  C   . LEU C 1 43  ? 36.854  33.564  9.675  1.00 44.38 ? 696  LEU C C   1 
ATOM   6124  O  O   . LEU C 1 43  ? 37.942  33.989  10.080 1.00 41.97 ? 696  LEU C O   1 
ATOM   6125  C  CB  . LEU C 1 43  ? 34.679  34.658  10.440 1.00 43.59 ? 696  LEU C CB  1 
ATOM   6126  C  CG  . LEU C 1 43  ? 35.200  35.098  11.799 1.00 43.80 ? 696  LEU C CG  1 
ATOM   6127  C  CD1 . LEU C 1 43  ? 35.704  36.534  11.749 1.00 45.66 ? 696  LEU C CD1 1 
ATOM   6128  C  CD2 . LEU C 1 43  ? 34.080  34.956  12.805 1.00 44.61 ? 696  LEU C CD2 1 
ATOM   6129  N  N   . SER C 1 44  ? 36.616  32.270  9.493  1.00 44.37 ? 697  SER C N   1 
ATOM   6130  C  CA  . SER C 1 44  ? 37.614  31.282  9.814  1.00 45.87 ? 697  SER C CA  1 
ATOM   6131  C  C   . SER C 1 44  ? 38.823  31.316  8.869  1.00 47.83 ? 697  SER C C   1 
ATOM   6132  O  O   . SER C 1 44  ? 39.970  31.122  9.304  1.00 47.61 ? 697  SER C O   1 
ATOM   6133  C  CB  . SER C 1 44  ? 36.972  29.884  9.856  1.00 45.60 ? 697  SER C CB  1 
ATOM   6134  O  OG  . SER C 1 44  ? 36.358  29.530  8.632  1.00 43.89 ? 697  SER C OG  1 
ATOM   6135  N  N   . GLN C 1 45  ? 38.578  31.584  7.590  1.00 48.40 ? 698  GLN C N   1 
ATOM   6136  C  CA  . GLN C 1 45  ? 39.658  31.640  6.611  1.00 48.85 ? 698  GLN C CA  1 
ATOM   6137  C  C   . GLN C 1 45  ? 40.499  32.886  6.819  1.00 47.61 ? 698  GLN C C   1 
ATOM   6138  O  O   . GLN C 1 45  ? 41.722  32.868  6.654  1.00 48.34 ? 698  GLN C O   1 
ATOM   6139  C  CB  . GLN C 1 45  ? 39.088  31.647  5.191  1.00 51.69 ? 698  GLN C CB  1 
ATOM   6140  C  CG  . GLN C 1 45  ? 38.433  30.336  4.781  1.00 55.18 ? 698  GLN C CG  1 
ATOM   6141  C  CD  . GLN C 1 45  ? 39.392  29.142  4.867  1.00 59.08 ? 698  GLN C CD  1 
ATOM   6142  O  OE1 . GLN C 1 45  ? 40.588  29.255  4.530  1.00 60.47 ? 698  GLN C OE1 1 
ATOM   6143  N  NE2 . GLN C 1 45  ? 38.868  27.985  5.305  1.00 58.82 ? 698  GLN C NE2 1 
ATOM   6144  N  N   . VAL C 1 46  ? 39.844  33.974  7.182  1.00 45.13 ? 699  VAL C N   1 
ATOM   6145  C  CA  . VAL C 1 46  ? 40.565  35.218  7.408  1.00 44.03 ? 699  VAL C CA  1 
ATOM   6146  C  C   . VAL C 1 46  ? 41.433  35.125  8.674  1.00 43.53 ? 699  VAL C C   1 
ATOM   6147  O  O   . VAL C 1 46  ? 42.563  35.597  8.680  1.00 42.51 ? 699  VAL C O   1 
ATOM   6148  C  CB  . VAL C 1 46  ? 39.582  36.422  7.506  1.00 42.15 ? 699  VAL C CB  1 
ATOM   6149  C  CG1 . VAL C 1 46  ? 40.339  37.680  7.843  1.00 39.20 ? 699  VAL C CG1 1 
ATOM   6150  C  CG2 . VAL C 1 46  ? 38.856  36.603  6.181  1.00 41.17 ? 699  VAL C CG2 1 
ATOM   6151  N  N   . MET C 1 47  ? 40.880  34.529  9.731  1.00 43.81 ? 700  MET C N   1 
ATOM   6152  C  CA  . MET C 1 47  ? 41.584  34.320  10.998 1.00 43.87 ? 700  MET C CA  1 
ATOM   6153  C  C   . MET C 1 47  ? 42.861  33.528  10.751 1.00 44.53 ? 700  MET C C   1 
ATOM   6154  O  O   . MET C 1 47  ? 43.934  33.904  11.196 1.00 44.97 ? 700  MET C O   1 
ATOM   6155  C  CB  . MET C 1 47  ? 40.708  33.525  11.966 1.00 43.31 ? 700  MET C CB  1 
ATOM   6156  C  CG  . MET C 1 47  ? 39.748  34.349  12.787 1.00 40.36 ? 700  MET C CG  1 
ATOM   6157  S  SD  . MET C 1 47  ? 40.488  34.917  14.304 1.00 45.57 ? 700  MET C SD  1 
ATOM   6158  C  CE  . MET C 1 47  ? 41.282  36.354  13.804 1.00 41.54 ? 700  MET C CE  1 
ATOM   6159  N  N   . TYR C 1 48  ? 42.733  32.419  10.044 1.00 44.78 ? 701  TYR C N   1 
ATOM   6160  C  CA  . TYR C 1 48  ? 43.879  31.594  9.734  1.00 45.25 ? 701  TYR C CA  1 
ATOM   6161  C  C   . TYR C 1 48  ? 44.899  32.379  8.918  1.00 46.05 ? 701  TYR C C   1 
ATOM   6162  O  O   . TYR C 1 48  ? 46.110  32.184  9.045  1.00 46.04 ? 701  TYR C O   1 
ATOM   6163  C  CB  . TYR C 1 48  ? 43.443  30.375  8.939  1.00 44.92 ? 701  TYR C CB  1 
ATOM   6164  C  CG  . TYR C 1 48  ? 44.610  29.601  8.410  1.00 48.01 ? 701  TYR C CG  1 
ATOM   6165  C  CD1 . TYR C 1 48  ? 45.340  28.752  9.243  1.00 49.98 ? 701  TYR C CD1 1 
ATOM   6166  C  CD2 . TYR C 1 48  ? 45.007  29.720  7.080  1.00 49.46 ? 701  TYR C CD2 1 
ATOM   6167  C  CE1 . TYR C 1 48  ? 46.432  28.033  8.765  1.00 50.46 ? 701  TYR C CE1 1 
ATOM   6168  C  CE2 . TYR C 1 48  ? 46.102  29.007  6.589  1.00 50.33 ? 701  TYR C CE2 1 
ATOM   6169  C  CZ  . TYR C 1 48  ? 46.805  28.164  7.433  1.00 50.83 ? 701  TYR C CZ  1 
ATOM   6170  O  OH  . TYR C 1 48  ? 47.871  27.430  6.955  1.00 53.15 ? 701  TYR C OH  1 
ATOM   6171  N  N   . THR C 1 49  ? 44.402  33.268  8.067  1.00 45.96 ? 702  THR C N   1 
ATOM   6172  C  CA  . THR C 1 49  ? 45.278  34.053  7.222  1.00 44.63 ? 702  THR C CA  1 
ATOM   6173  C  C   . THR C 1 49  ? 46.007  35.124  8.020  1.00 45.50 ? 702  THR C C   1 
ATOM   6174  O  O   . THR C 1 49  ? 47.231  35.256  7.952  1.00 46.95 ? 702  THR C O   1 
ATOM   6175  C  CB  . THR C 1 49  ? 44.482  34.694  6.088  1.00 43.71 ? 702  THR C CB  1 
ATOM   6176  O  OG1 . THR C 1 49  ? 43.891  33.655  5.303  1.00 42.59 ? 702  THR C OG1 1 
ATOM   6177  C  CG2 . THR C 1 49  ? 45.383  35.541  5.196  1.00 41.73 ? 702  THR C CG2 1 
ATOM   6178  N  N   . LEU C 1 50  ? 45.271  35.893  8.797  1.00 45.24 ? 703  LEU C N   1 
ATOM   6179  C  CA  . LEU C 1 50  ? 45.927  36.926  9.560  1.00 44.75 ? 703  LEU C CA  1 
ATOM   6180  C  C   . LEU C 1 50  ? 46.775  36.293  10.640 1.00 44.53 ? 703  LEU C C   1 
ATOM   6181  O  O   . LEU C 1 50  ? 47.722  36.921  11.143 1.00 44.65 ? 703  LEU C O   1 
ATOM   6182  C  CB  . LEU C 1 50  ? 44.900  37.879  10.166 1.00 43.91 ? 703  LEU C CB  1 
ATOM   6183  C  CG  . LEU C 1 50  ? 44.065  38.727  9.189  1.00 44.03 ? 703  LEU C CG  1 
ATOM   6184  C  CD1 . LEU C 1 50  ? 43.069  39.561  10.002 1.00 43.89 ? 703  LEU C CD1 1 
ATOM   6185  C  CD2 . LEU C 1 50  ? 44.961  39.642  8.366  1.00 42.97 ? 703  LEU C CD2 1 
ATOM   6186  N  N   . PHE C 1 51  ? 46.463  35.050  11.000 1.00 44.10 ? 704  PHE C N   1 
ATOM   6187  C  CA  . PHE C 1 51  ? 47.260  34.384  12.038 1.00 44.27 ? 704  PHE C CA  1 
ATOM   6188  C  C   . PHE C 1 51  ? 48.591  33.927  11.457 1.00 44.58 ? 704  PHE C C   1 
ATOM   6189  O  O   . PHE C 1 51  ? 49.574  33.892  12.172 1.00 45.40 ? 704  PHE C O   1 
ATOM   6190  C  CB  . PHE C 1 51  ? 46.486  33.234  12.703 1.00 42.22 ? 704  PHE C CB  1 
ATOM   6191  C  CG  . PHE C 1 51  ? 45.870  33.611  14.035 1.00 42.91 ? 704  PHE C CG  1 
ATOM   6192  C  CD1 . PHE C 1 51  ? 45.050  34.734  14.153 1.00 42.01 ? 704  PHE C CD1 1 
ATOM   6193  C  CD2 . PHE C 1 51  ? 46.108  32.844  15.177 1.00 43.47 ? 704  PHE C CD2 1 
ATOM   6194  C  CE1 . PHE C 1 51  ? 44.477  35.087  15.388 1.00 44.38 ? 704  PHE C CE1 1 
ATOM   6195  C  CE2 . PHE C 1 51  ? 45.537  33.191  16.416 1.00 43.62 ? 704  PHE C CE2 1 
ATOM   6196  C  CZ  . PHE C 1 51  ? 44.718  34.314  16.524 1.00 43.97 ? 704  PHE C CZ  1 
ATOM   6197  N  N   . GLN C 1 52  ? 48.623  33.628  10.159 1.00 45.27 ? 705  GLN C N   1 
ATOM   6198  C  CA  . GLN C 1 52  ? 49.858  33.241  9.465  1.00 45.89 ? 705  GLN C CA  1 
ATOM   6199  C  C   . GLN C 1 52  ? 50.751  34.483  9.296  1.00 45.63 ? 705  GLN C C   1 
ATOM   6200  O  O   . GLN C 1 52  ? 51.960  34.465  9.579  1.00 45.41 ? 705  GLN C O   1 
ATOM   6201  C  CB  . GLN C 1 52  ? 49.550  32.688  8.062  1.00 47.31 ? 705  GLN C CB  1 
ATOM   6202  C  CG  . GLN C 1 52  ? 49.593  31.172  7.901  1.00 52.77 ? 705  GLN C CG  1 
ATOM   6203  C  CD  . GLN C 1 52  ? 51.007  30.575  8.084  1.00 57.11 ? 705  GLN C CD  1 
ATOM   6204  O  OE1 . GLN C 1 52  ? 51.156  29.355  8.274  1.00 58.01 ? 705  GLN C OE1 1 
ATOM   6205  N  NE2 . GLN C 1 52  ? 52.042  31.430  8.024  1.00 55.10 ? 705  GLN C NE2 1 
ATOM   6206  N  N   . ASP C 1 53  ? 50.129  35.559  8.819  1.00 44.64 ? 706  ASP C N   1 
ATOM   6207  C  CA  . ASP C 1 53  ? 50.801  36.830  8.565  1.00 42.95 ? 706  ASP C CA  1 
ATOM   6208  C  C   . ASP C 1 53  ? 51.535  37.391  9.764  1.00 43.28 ? 706  ASP C C   1 
ATOM   6209  O  O   . ASP C 1 53  ? 52.613  37.969  9.621  1.00 43.49 ? 706  ASP C O   1 
ATOM   6210  C  CB  . ASP C 1 53  ? 49.784  37.871  8.065  1.00 41.61 ? 706  ASP C CB  1 
ATOM   6211  C  CG  . ASP C 1 53  ? 50.365  39.269  8.014  1.00 40.78 ? 706  ASP C CG  1 
ATOM   6212  O  OD1 . ASP C 1 53  ? 50.222  40.035  8.992  1.00 39.27 ? 706  ASP C OD1 1 
ATOM   6213  O  OD2 . ASP C 1 53  ? 50.995  39.599  6.993  1.00 43.43 ? 706  ASP C OD2 1 
ATOM   6214  N  N   . THR C 1 54  ? 50.933  37.241  10.943 1.00 43.67 ? 707  THR C N   1 
ATOM   6215  C  CA  . THR C 1 54  ? 51.517  37.738  12.186 1.00 43.39 ? 707  THR C CA  1 
ATOM   6216  C  C   . THR C 1 54  ? 52.504  36.769  12.818 1.00 42.70 ? 707  THR C C   1 
ATOM   6217  O  O   . THR C 1 54  ? 53.366  37.166  13.593 1.00 42.06 ? 707  THR C O   1 
ATOM   6218  C  CB  . THR C 1 54  ? 50.420  38.013  13.220 1.00 44.79 ? 707  THR C CB  1 
ATOM   6219  O  OG1 . THR C 1 54  ? 49.527  36.894  13.260 1.00 43.95 ? 707  THR C OG1 1 
ATOM   6220  C  CG2 . THR C 1 54  ? 49.665  39.268  12.867 1.00 43.21 ? 707  THR C CG2 1 
ATOM   6221  N  N   . GLY C 1 55  ? 52.361  35.496  12.502 1.00 42.97 ? 708  GLY C N   1 
ATOM   6222  C  CA  . GLY C 1 55  ? 53.260  34.516  13.071 1.00 45.31 ? 708  GLY C CA  1 
ATOM   6223  C  C   . GLY C 1 55  ? 52.757  33.974  14.393 1.00 46.40 ? 708  GLY C C   1 
ATOM   6224  O  O   . GLY C 1 55  ? 53.487  33.277  15.107 1.00 47.20 ? 708  GLY C O   1 
ATOM   6225  N  N   . LEU C 1 56  ? 51.509  34.289  14.730 1.00 46.14 ? 709  LEU C N   1 
ATOM   6226  C  CA  . LEU C 1 56  ? 50.937  33.808  15.981 1.00 45.35 ? 709  LEU C CA  1 
ATOM   6227  C  C   . LEU C 1 56  ? 50.839  32.286  15.984 1.00 45.57 ? 709  LEU C C   1 
ATOM   6228  O  O   . LEU C 1 56  ? 50.916  31.657  17.036 1.00 45.67 ? 709  LEU C O   1 
ATOM   6229  C  CB  . LEU C 1 56  ? 49.555  34.419  16.214 1.00 43.37 ? 709  LEU C CB  1 
ATOM   6230  C  CG  . LEU C 1 56  ? 49.639  35.901  16.545 1.00 44.20 ? 709  LEU C CG  1 
ATOM   6231  C  CD1 . LEU C 1 56  ? 48.280  36.594  16.358 1.00 42.50 ? 709  LEU C CD1 1 
ATOM   6232  C  CD2 . LEU C 1 56  ? 50.147  36.039  17.965 1.00 43.02 ? 709  LEU C CD2 1 
ATOM   6233  N  N   . LEU C 1 57  ? 50.657  31.693  14.812 1.00 44.73 ? 710  LEU C N   1 
ATOM   6234  C  CA  . LEU C 1 57  ? 50.562  30.243  14.734 1.00 45.55 ? 710  LEU C CA  1 
ATOM   6235  C  C   . LEU C 1 57  ? 51.855  29.595  15.215 1.00 46.61 ? 710  LEU C C   1 
ATOM   6236  O  O   . LEU C 1 57  ? 51.829  28.535  15.833 1.00 46.99 ? 710  LEU C O   1 
ATOM   6237  C  CB  . LEU C 1 57  ? 50.280  29.816  13.303 1.00 44.68 ? 710  LEU C CB  1 
ATOM   6238  C  CG  . LEU C 1 57  ? 48.959  30.302  12.721 1.00 44.69 ? 710  LEU C CG  1 
ATOM   6239  C  CD1 . LEU C 1 57  ? 48.874  29.809  11.288 1.00 44.17 ? 710  LEU C CD1 1 
ATOM   6240  C  CD2 . LEU C 1 57  ? 47.773  29.780  13.551 1.00 43.60 ? 710  LEU C CD2 1 
ATOM   6241  N  N   . GLU C 1 58  ? 52.984  30.237  14.920 1.00 48.25 ? 711  GLU C N   1 
ATOM   6242  C  CA  . GLU C 1 58  ? 54.291  29.740  15.329 1.00 49.34 ? 711  GLU C CA  1 
ATOM   6243  C  C   . GLU C 1 58  ? 54.608  30.025  16.787 1.00 48.47 ? 711  GLU C C   1 
ATOM   6244  O  O   . GLU C 1 58  ? 54.985  29.126  17.526 1.00 48.04 ? 711  GLU C O   1 
ATOM   6245  C  CB  . GLU C 1 58  ? 55.391  30.348  14.467 1.00 52.83 ? 711  GLU C CB  1 
ATOM   6246  C  CG  . GLU C 1 58  ? 56.051  29.316  13.583 1.00 58.99 ? 711  GLU C CG  1 
ATOM   6247  C  CD  . GLU C 1 58  ? 55.986  27.947  14.232 1.00 63.42 ? 711  GLU C CD  1 
ATOM   6248  O  OE1 . GLU C 1 58  ? 56.595  27.787  15.325 1.00 63.97 ? 711  GLU C OE1 1 
ATOM   6249  O  OE2 . GLU C 1 58  ? 55.299  27.052  13.666 1.00 64.52 ? 711  GLU C OE2 1 
ATOM   6250  N  N   . ILE C 1 59  ? 54.455  31.287  17.173 1.00 47.45 ? 712  ILE C N   1 
ATOM   6251  C  CA  . ILE C 1 59  ? 54.717  31.762  18.530 1.00 46.49 ? 712  ILE C CA  1 
ATOM   6252  C  C   . ILE C 1 59  ? 54.011  30.933  19.584 1.00 47.88 ? 712  ILE C C   1 
ATOM   6253  O  O   . ILE C 1 59  ? 54.570  30.669  20.653 1.00 48.78 ? 712  ILE C O   1 
ATOM   6254  C  CB  . ILE C 1 59  ? 54.275  33.221  18.702 1.00 45.78 ? 712  ILE C CB  1 
ATOM   6255  C  CG1 . ILE C 1 59  ? 55.102  34.130  17.780 1.00 45.69 ? 712  ILE C CG1 1 
ATOM   6256  C  CG2 . ILE C 1 59  ? 54.409  33.638  20.142 1.00 43.39 ? 712  ILE C CG2 1 
ATOM   6257  C  CD1 . ILE C 1 59  ? 54.539  35.558  17.610 1.00 44.80 ? 712  ILE C CD1 1 
ATOM   6258  N  N   . PHE C 1 60  ? 52.786  30.510  19.298 1.00 47.34 ? 713  PHE C N   1 
ATOM   6259  C  CA  . PHE C 1 60  ? 52.053  29.715  20.273 1.00 46.55 ? 713  PHE C CA  1 
ATOM   6260  C  C   . PHE C 1 60  ? 51.831  28.311  19.803 1.00 46.71 ? 713  PHE C C   1 
ATOM   6261  O  O   . PHE C 1 60  ? 50.991  27.595  20.335 1.00 47.32 ? 713  PHE C O   1 
ATOM   6262  C  CB  . PHE C 1 60  ? 50.725  30.387  20.631 1.00 47.33 ? 713  PHE C CB  1 
ATOM   6263  C  CG  . PHE C 1 60  ? 50.899  31.744  21.239 1.00 46.86 ? 713  PHE C CG  1 
ATOM   6264  C  CD1 . PHE C 1 60  ? 50.712  32.893  20.477 1.00 47.09 ? 713  PHE C CD1 1 
ATOM   6265  C  CD2 . PHE C 1 60  ? 51.358  31.875  22.550 1.00 46.72 ? 713  PHE C CD2 1 
ATOM   6266  C  CE1 . PHE C 1 60  ? 50.992  34.170  21.005 1.00 47.11 ? 713  PHE C CE1 1 
ATOM   6267  C  CE2 . PHE C 1 60  ? 51.642  33.139  23.098 1.00 46.15 ? 713  PHE C CE2 1 
ATOM   6268  C  CZ  . PHE C 1 60  ? 51.459  34.288  22.324 1.00 47.91 ? 713  PHE C CZ  1 
ATOM   6269  N  N   . LYS C 1 61  ? 52.591  27.923  18.791 1.00 47.87 ? 714  LYS C N   1 
ATOM   6270  C  CA  . LYS C 1 61  ? 52.523  26.570  18.277 1.00 48.93 ? 714  LYS C CA  1 
ATOM   6271  C  C   . LYS C 1 61  ? 51.089  26.076  18.176 1.00 48.10 ? 714  LYS C C   1 
ATOM   6272  O  O   . LYS C 1 61  ? 50.772  24.959  18.598 1.00 47.06 ? 714  LYS C O   1 
ATOM   6273  C  CB  . LYS C 1 61  ? 53.331  25.649  19.205 1.00 52.43 ? 714  LYS C CB  1 
ATOM   6274  C  CG  . LYS C 1 61  ? 54.850  25.805  19.083 1.00 56.17 ? 714  LYS C CG  1 
ATOM   6275  C  CD  . LYS C 1 61  ? 55.296  25.555  17.611 1.00 60.32 ? 714  LYS C CD  1 
ATOM   6276  C  CE  . LYS C 1 61  ? 56.815  25.698  17.420 1.00 61.60 ? 714  LYS C CE  1 
ATOM   6277  N  NZ  . LYS C 1 61  ? 57.237  25.545  15.978 1.00 61.74 ? 714  LYS C NZ  1 
ATOM   6278  N  N   . ILE C 1 62  ? 50.223  26.909  17.605 1.00 46.18 ? 715  ILE C N   1 
ATOM   6279  C  CA  . ILE C 1 62  ? 48.814  26.566  17.460 1.00 44.29 ? 715  ILE C CA  1 
ATOM   6280  C  C   . ILE C 1 62  ? 48.546  25.404  16.493 1.00 43.46 ? 715  ILE C C   1 
ATOM   6281  O  O   . ILE C 1 62  ? 49.061  25.385  15.381 1.00 43.33 ? 715  ILE C O   1 
ATOM   6282  C  CB  . ILE C 1 62  ? 48.021  27.808  16.972 1.00 44.76 ? 715  ILE C CB  1 
ATOM   6283  C  CG1 . ILE C 1 62  ? 48.184  28.947  17.975 1.00 43.19 ? 715  ILE C CG1 1 
ATOM   6284  C  CG2 . ILE C 1 62  ? 46.553  27.449  16.731 1.00 43.46 ? 715  ILE C CG2 1 
ATOM   6285  C  CD1 . ILE C 1 62  ? 47.468  30.204  17.559 1.00 43.30 ? 715  ILE C CD1 1 
ATOM   6286  N  N   . PRO C 1 63  ? 47.759  24.399  16.917 1.00 43.52 ? 716  PRO C N   1 
ATOM   6287  C  CA  . PRO C 1 63  ? 47.483  23.297  15.977 1.00 43.96 ? 716  PRO C CA  1 
ATOM   6288  C  C   . PRO C 1 63  ? 46.360  23.760  15.040 1.00 44.81 ? 716  PRO C C   1 
ATOM   6289  O  O   . PRO C 1 63  ? 45.268  24.127  15.484 1.00 44.80 ? 716  PRO C O   1 
ATOM   6290  C  CB  . PRO C 1 63  ? 47.047  22.149  16.887 1.00 41.79 ? 716  PRO C CB  1 
ATOM   6291  C  CG  . PRO C 1 63  ? 46.339  22.867  18.008 1.00 41.69 ? 716  PRO C CG  1 
ATOM   6292  C  CD  . PRO C 1 63  ? 47.266  24.071  18.270 1.00 42.67 ? 716  PRO C CD  1 
ATOM   6293  N  N   . THR C 1 64  ? 46.655  23.749  13.750 1.00 45.73 ? 717  THR C N   1 
ATOM   6294  C  CA  . THR C 1 64  ? 45.735  24.188  12.711 1.00 46.46 ? 717  THR C CA  1 
ATOM   6295  C  C   . THR C 1 64  ? 44.342  23.580  12.748 1.00 46.70 ? 717  THR C C   1 
ATOM   6296  O  O   . THR C 1 64  ? 43.350  24.283  12.617 1.00 46.28 ? 717  THR C O   1 
ATOM   6297  C  CB  . THR C 1 64  ? 46.338  23.915  11.322 1.00 47.87 ? 717  THR C CB  1 
ATOM   6298  O  OG1 . THR C 1 64  ? 47.604  24.584  11.225 1.00 49.85 ? 717  THR C OG1 1 
ATOM   6299  C  CG2 . THR C 1 64  ? 45.404  24.416  10.215 1.00 46.50 ? 717  THR C CG2 1 
ATOM   6300  N  N   . GLN C 1 65  ? 44.274  22.270  12.928 1.00 46.55 ? 718  GLN C N   1 
ATOM   6301  C  CA  . GLN C 1 65  ? 43.003  21.575  12.942 1.00 45.67 ? 718  GLN C CA  1 
ATOM   6302  C  C   . GLN C 1 65  ? 42.012  22.093  13.987 1.00 45.54 ? 718  GLN C C   1 
ATOM   6303  O  O   . GLN C 1 65  ? 40.873  22.421  13.656 1.00 45.48 ? 718  GLN C O   1 
ATOM   6304  C  CB  . GLN C 1 65  ? 43.258  20.088  13.150 1.00 46.44 ? 718  GLN C CB  1 
ATOM   6305  C  CG  . GLN C 1 65  ? 42.007  19.252  13.244 1.00 49.96 ? 718  GLN C CG  1 
ATOM   6306  C  CD  . GLN C 1 65  ? 41.281  19.178  11.930 1.00 51.77 ? 718  GLN C CD  1 
ATOM   6307  O  OE1 . GLN C 1 65  ? 41.811  18.651  10.957 1.00 52.95 ? 718  GLN C OE1 1 
ATOM   6308  N  NE2 . GLN C 1 65  ? 40.065  19.718  11.884 1.00 53.54 ? 718  GLN C NE2 1 
ATOM   6309  N  N   . GLN C 1 66  ? 42.451  22.174  15.242 1.00 44.86 ? 719  GLN C N   1 
ATOM   6310  C  CA  . GLN C 1 66  ? 41.593  22.624  16.339 1.00 43.86 ? 719  GLN C CA  1 
ATOM   6311  C  C   . GLN C 1 66  ? 41.255  24.097  16.233 1.00 43.92 ? 719  GLN C C   1 
ATOM   6312  O  O   . GLN C 1 66  ? 40.171  24.521  16.609 1.00 44.61 ? 719  GLN C O   1 
ATOM   6313  C  CB  . GLN C 1 66  ? 42.258  22.356  17.702 1.00 44.19 ? 719  GLN C CB  1 
ATOM   6314  C  CG  . GLN C 1 66  ? 42.325  20.890  18.105 1.00 43.61 ? 719  GLN C CG  1 
ATOM   6315  C  CD  . GLN C 1 66  ? 43.414  20.093  17.395 1.00 43.22 ? 719  GLN C CD  1 
ATOM   6316  O  OE1 . GLN C 1 66  ? 43.401  18.869  17.416 1.00 47.33 ? 719  GLN C OE1 1 
ATOM   6317  N  NE2 . GLN C 1 66  ? 44.359  20.779  16.779 1.00 42.68 ? 719  GLN C NE2 1 
ATOM   6318  N  N   . PHE C 1 67  ? 42.202  24.877  15.736 1.00 43.40 ? 720  PHE C N   1 
ATOM   6319  C  CA  . PHE C 1 67  ? 42.011  26.310  15.546 1.00 42.87 ? 720  PHE C CA  1 
ATOM   6320  C  C   . PHE C 1 67  ? 40.833  26.509  14.580 1.00 42.96 ? 720  PHE C C   1 
ATOM   6321  O  O   . PHE C 1 67  ? 39.877  27.226  14.864 1.00 43.42 ? 720  PHE C O   1 
ATOM   6322  C  CB  . PHE C 1 67  ? 43.291  26.871  14.950 1.00 40.15 ? 720  PHE C CB  1 
ATOM   6323  C  CG  . PHE C 1 67  ? 43.240  28.324  14.624 1.00 39.79 ? 720  PHE C CG  1 
ATOM   6324  C  CD1 . PHE C 1 67  ? 43.559  29.275  15.582 1.00 39.57 ? 720  PHE C CD1 1 
ATOM   6325  C  CD2 . PHE C 1 67  ? 42.973  28.747  13.318 1.00 40.42 ? 720  PHE C CD2 1 
ATOM   6326  C  CE1 . PHE C 1 67  ? 43.612  30.632  15.245 1.00 39.59 ? 720  PHE C CE1 1 
ATOM   6327  C  CE2 . PHE C 1 67  ? 43.022  30.092  12.973 1.00 39.32 ? 720  PHE C CE2 1 
ATOM   6328  C  CZ  . PHE C 1 67  ? 43.349  31.036  13.933 1.00 39.69 ? 720  PHE C CZ  1 
ATOM   6329  N  N   . MET C 1 68  ? 40.909  25.834  13.440 1.00 44.63 ? 721  MET C N   1 
ATOM   6330  C  CA  . MET C 1 68  ? 39.873  25.931  12.430 1.00 45.19 ? 721  MET C CA  1 
ATOM   6331  C  C   . MET C 1 68  ? 38.583  25.333  12.917 1.00 44.61 ? 721  MET C C   1 
ATOM   6332  O  O   . MET C 1 68  ? 37.520  25.854  12.622 1.00 45.09 ? 721  MET C O   1 
ATOM   6333  C  CB  . MET C 1 68  ? 40.310  25.261  11.119 1.00 46.36 ? 721  MET C CB  1 
ATOM   6334  C  CG  . MET C 1 68  ? 41.515  25.931  10.413 1.00 46.41 ? 721  MET C CG  1 
ATOM   6335  S  SD  . MET C 1 68  ? 41.323  27.713  10.075 1.00 53.25 ? 721  MET C SD  1 
ATOM   6336  C  CE  . MET C 1 68  ? 39.814  27.718  9.008  1.00 49.58 ? 721  MET C CE  1 
ATOM   6337  N  N   . ASN C 1 69  ? 38.648  24.247  13.667 1.00 44.45 ? 722  ASN C N   1 
ATOM   6338  C  CA  . ASN C 1 69  ? 37.402  23.673  14.166 1.00 44.85 ? 722  ASN C CA  1 
ATOM   6339  C  C   . ASN C 1 69  ? 36.642  24.688  15.023 1.00 44.28 ? 722  ASN C C   1 
ATOM   6340  O  O   . ASN C 1 69  ? 35.428  24.811  14.913 1.00 42.54 ? 722  ASN C O   1 
ATOM   6341  C  CB  . ASN C 1 69  ? 37.644  22.431  15.031 1.00 46.34 ? 722  ASN C CB  1 
ATOM   6342  C  CG  . ASN C 1 69  ? 38.274  21.281  14.269 1.00 47.92 ? 722  ASN C CG  1 
ATOM   6343  O  OD1 . ASN C 1 69  ? 37.770  20.844  13.237 1.00 49.38 ? 722  ASN C OD1 1 
ATOM   6344  N  ND2 . ASN C 1 69  ? 39.376  20.770  14.794 1.00 50.32 ? 722  ASN C ND2 1 
ATOM   6345  N  N   . TYR C 1 70  ? 37.357  25.410  15.880 1.00 44.56 ? 723  TYR C N   1 
ATOM   6346  C  CA  . TYR C 1 70  ? 36.692  26.359  16.769 1.00 44.90 ? 723  TYR C CA  1 
ATOM   6347  C  C   . TYR C 1 70  ? 36.092  27.510  16.021 1.00 45.75 ? 723  TYR C C   1 
ATOM   6348  O  O   . TYR C 1 70  ? 34.903  27.796  16.137 1.00 45.49 ? 723  TYR C O   1 
ATOM   6349  C  CB  . TYR C 1 70  ? 37.649  26.931  17.812 1.00 43.75 ? 723  TYR C CB  1 
ATOM   6350  C  CG  . TYR C 1 70  ? 36.953  27.911  18.730 1.00 42.58 ? 723  TYR C CG  1 
ATOM   6351  C  CD1 . TYR C 1 70  ? 35.915  27.485  19.568 1.00 42.96 ? 723  TYR C CD1 1 
ATOM   6352  C  CD2 . TYR C 1 70  ? 37.263  29.269  18.710 1.00 41.67 ? 723  TYR C CD2 1 
ATOM   6353  C  CE1 . TYR C 1 70  ? 35.192  28.392  20.361 1.00 42.75 ? 723  TYR C CE1 1 
ATOM   6354  C  CE2 . TYR C 1 70  ? 36.545  30.190  19.502 1.00 42.50 ? 723  TYR C CE2 1 
ATOM   6355  C  CZ  . TYR C 1 70  ? 35.508  29.737  20.323 1.00 42.84 ? 723  TYR C CZ  1 
ATOM   6356  O  OH  . TYR C 1 70  ? 34.777  30.622  21.088 1.00 43.01 ? 723  TYR C OH  1 
ATOM   6357  N  N   . PHE C 1 71  ? 36.939  28.181  15.261 1.00 45.66 ? 724  PHE C N   1 
ATOM   6358  C  CA  . PHE C 1 71  ? 36.493  29.317  14.509 1.00 44.88 ? 724  PHE C CA  1 
ATOM   6359  C  C   . PHE C 1 71  ? 35.444  29.014  13.429 1.00 45.83 ? 724  PHE C C   1 
ATOM   6360  O  O   . PHE C 1 71  ? 34.714  29.907  13.007 1.00 46.18 ? 724  PHE C O   1 
ATOM   6361  C  CB  . PHE C 1 71  ? 37.717  30.055  14.011 1.00 43.43 ? 724  PHE C CB  1 
ATOM   6362  C  CG  . PHE C 1 71  ? 38.460  30.737  15.128 1.00 42.80 ? 724  PHE C CG  1 
ATOM   6363  C  CD1 . PHE C 1 71  ? 37.893  31.827  15.796 1.00 42.06 ? 724  PHE C CD1 1 
ATOM   6364  C  CD2 . PHE C 1 71  ? 39.680  30.247  15.578 1.00 41.81 ? 724  PHE C CD2 1 
ATOM   6365  C  CE1 . PHE C 1 71  ? 38.534  32.411  16.901 1.00 41.64 ? 724  PHE C CE1 1 
ATOM   6366  C  CE2 . PHE C 1 71  ? 40.321  30.822  16.672 1.00 40.25 ? 724  PHE C CE2 1 
ATOM   6367  C  CZ  . PHE C 1 71  ? 39.749  31.904  17.337 1.00 40.79 ? 724  PHE C CZ  1 
ATOM   6368  N  N   . ARG C 1 72  ? 35.338  27.762  13.006 1.00 45.03 ? 725  ARG C N   1 
ATOM   6369  C  CA  . ARG C 1 72  ? 34.298  27.414  12.054 1.00 45.42 ? 725  ARG C CA  1 
ATOM   6370  C  C   . ARG C 1 72  ? 33.010  27.352  12.866 1.00 45.93 ? 725  ARG C C   1 
ATOM   6371  O  O   . ARG C 1 72  ? 31.955  27.845  12.420 1.00 47.49 ? 725  ARG C O   1 
ATOM   6372  C  CB  . ARG C 1 72  ? 34.571  26.070  11.373 1.00 45.40 ? 725  ARG C CB  1 
ATOM   6373  C  CG  . ARG C 1 72  ? 35.482  26.208  10.142 1.00 48.64 ? 725  ARG C CG  1 
ATOM   6374  C  CD  . ARG C 1 72  ? 36.078  24.882  9.648  1.00 51.69 ? 725  ARG C CD  1 
ATOM   6375  N  NE  . ARG C 1 72  ? 37.007  25.083  8.527  1.00 56.08 ? 725  ARG C NE  1 
ATOM   6376  C  CZ  . ARG C 1 72  ? 37.880  24.179  8.063  1.00 58.32 ? 725  ARG C CZ  1 
ATOM   6377  N  NH1 . ARG C 1 72  ? 37.985  22.968  8.600  1.00 58.33 ? 725  ARG C NH1 1 
ATOM   6378  N  NH2 . ARG C 1 72  ? 38.677  24.494  7.053  1.00 60.20 ? 725  ARG C NH2 1 
ATOM   6379  N  N   . ALA C 1 73  ? 33.108  26.793  14.075 1.00 43.78 ? 726  ALA C N   1 
ATOM   6380  C  CA  . ALA C 1 73  ? 31.965  26.662  14.983 1.00 41.92 ? 726  ALA C CA  1 
ATOM   6381  C  C   . ALA C 1 73  ? 31.524  28.028  15.458 1.00 41.09 ? 726  ALA C C   1 
ATOM   6382  O  O   . ALA C 1 73  ? 30.349  28.270  15.685 1.00 41.70 ? 726  ALA C O   1 
ATOM   6383  C  CB  . ALA C 1 73  ? 32.346  25.821  16.181 1.00 40.98 ? 726  ALA C CB  1 
ATOM   6384  N  N   . LEU C 1 74  ? 32.489  28.914  15.635 1.00 41.23 ? 727  LEU C N   1 
ATOM   6385  C  CA  . LEU C 1 74  ? 32.201  30.256  16.076 1.00 40.75 ? 727  LEU C CA  1 
ATOM   6386  C  C   . LEU C 1 74  ? 31.383  30.962  14.986 1.00 42.10 ? 727  LEU C C   1 
ATOM   6387  O  O   . LEU C 1 74  ? 30.351  31.542  15.284 1.00 42.49 ? 727  LEU C O   1 
ATOM   6388  C  CB  . LEU C 1 74  ? 33.503  31.006  16.342 1.00 38.90 ? 727  LEU C CB  1 
ATOM   6389  C  CG  . LEU C 1 74  ? 33.376  32.379  16.996 1.00 36.45 ? 727  LEU C CG  1 
ATOM   6390  C  CD1 . LEU C 1 74  ? 32.698  32.250  18.332 1.00 35.14 ? 727  LEU C CD1 1 
ATOM   6391  C  CD2 . LEU C 1 74  ? 34.746  32.979  17.162 1.00 36.80 ? 727  LEU C CD2 1 
ATOM   6392  N  N   . GLU C 1 75  ? 31.848  30.900  13.736 1.00 43.25 ? 728  GLU C N   1 
ATOM   6393  C  CA  . GLU C 1 75  ? 31.160  31.524  12.600 1.00 45.71 ? 728  GLU C CA  1 
ATOM   6394  C  C   . GLU C 1 75  ? 29.696  31.134  12.589 1.00 46.73 ? 728  GLU C C   1 
ATOM   6395  O  O   . GLU C 1 75  ? 28.807  31.993  12.574 1.00 46.79 ? 728  GLU C O   1 
ATOM   6396  C  CB  . GLU C 1 75  ? 31.730  31.051  11.266 1.00 45.60 ? 728  GLU C CB  1 
ATOM   6397  C  CG  . GLU C 1 75  ? 33.127  31.434  10.988 1.00 46.61 ? 728  GLU C CG  1 
ATOM   6398  C  CD  . GLU C 1 75  ? 33.619  30.805  9.715  1.00 47.06 ? 728  GLU C CD  1 
ATOM   6399  O  OE1 . GLU C 1 75  ? 33.433  29.581  9.528  1.00 46.34 ? 728  GLU C OE1 1 
ATOM   6400  O  OE2 . GLU C 1 75  ? 34.199  31.543  8.899  1.00 49.84 ? 728  GLU C OE2 1 
ATOM   6401  N  N   . ASN C 1 76  ? 29.472  29.823  12.576 1.00 46.58 ? 729  ASN C N   1 
ATOM   6402  C  CA  . ASN C 1 76  ? 28.138  29.258  12.553 1.00 48.17 ? 729  ASN C CA  1 
ATOM   6403  C  C   . ASN C 1 76  ? 27.253  29.784  13.653 1.00 47.96 ? 729  ASN C C   1 
ATOM   6404  O  O   . ASN C 1 76  ? 26.059  29.516  13.665 1.00 48.72 ? 729  ASN C O   1 
ATOM   6405  C  CB  . ASN C 1 76  ? 28.195  27.745  12.687 1.00 50.08 ? 729  ASN C CB  1 
ATOM   6406  C  CG  . ASN C 1 76  ? 29.080  27.113  11.664 1.00 52.12 ? 729  ASN C CG  1 
ATOM   6407  O  OD1 . ASN C 1 76  ? 29.555  27.783  10.745 1.00 54.42 ? 729  ASN C OD1 1 
ATOM   6408  N  ND2 . ASN C 1 76  ? 29.312  25.807  11.804 1.00 53.98 ? 729  ASN C ND2 1 
ATOM   6409  N  N   . GLY C 1 77  ? 27.836  30.505  14.593 1.00 47.18 ? 730  GLY C N   1 
ATOM   6410  C  CA  . GLY C 1 77  ? 27.044  31.032  15.686 1.00 46.50 ? 730  GLY C CA  1 
ATOM   6411  C  C   . GLY C 1 77  ? 26.538  32.427  15.409 1.00 46.80 ? 730  GLY C C   1 
ATOM   6412  O  O   . GLY C 1 77  ? 25.729  32.948  16.165 1.00 46.39 ? 730  GLY C O   1 
ATOM   6413  N  N   . TYR C 1 78  ? 27.043  33.053  14.351 1.00 47.60 ? 731  TYR C N   1 
ATOM   6414  C  CA  . TYR C 1 78  ? 26.567  34.379  13.986 1.00 47.58 ? 731  TYR C CA  1 
ATOM   6415  C  C   . TYR C 1 78  ? 25.330  34.206  13.140 1.00 49.54 ? 731  TYR C C   1 
ATOM   6416  O  O   . TYR C 1 78  ? 25.333  33.459  12.161 1.00 49.43 ? 731  TYR C O   1 
ATOM   6417  C  CB  . TYR C 1 78  ? 27.603  35.137  13.184 1.00 45.40 ? 731  TYR C CB  1 
ATOM   6418  C  CG  . TYR C 1 78  ? 28.615  35.848  14.042 1.00 43.01 ? 731  TYR C CG  1 
ATOM   6419  C  CD1 . TYR C 1 78  ? 29.682  35.162  14.622 1.00 40.84 ? 731  TYR C CD1 1 
ATOM   6420  C  CD2 . TYR C 1 78  ? 28.509  37.211  14.267 1.00 40.46 ? 731  TYR C CD2 1 
ATOM   6421  C  CE1 . TYR C 1 78  ? 30.624  35.824  15.406 1.00 40.64 ? 731  TYR C CE1 1 
ATOM   6422  C  CE2 . TYR C 1 78  ? 29.445  37.882  15.047 1.00 43.45 ? 731  TYR C CE2 1 
ATOM   6423  C  CZ  . TYR C 1 78  ? 30.512  37.177  15.622 1.00 41.49 ? 731  TYR C CZ  1 
ATOM   6424  O  OH  . TYR C 1 78  ? 31.429  37.857  16.406 1.00 40.89 ? 731  TYR C OH  1 
ATOM   6425  N  N   . ARG C 1 79  ? 24.275  34.917  13.510 1.00 51.57 ? 732  ARG C N   1 
ATOM   6426  C  CA  . ARG C 1 79  ? 23.012  34.820  12.791 1.00 53.52 ? 732  ARG C CA  1 
ATOM   6427  C  C   . ARG C 1 79  ? 22.983  35.545  11.432 1.00 54.11 ? 732  ARG C C   1 
ATOM   6428  O  O   . ARG C 1 79  ? 23.839  36.383  11.125 1.00 53.25 ? 732  ARG C O   1 
ATOM   6429  C  CB  . ARG C 1 79  ? 21.886  35.335  13.690 1.00 54.35 ? 732  ARG C CB  1 
ATOM   6430  C  CG  . ARG C 1 79  ? 21.755  34.584  15.011 1.00 55.34 ? 732  ARG C CG  1 
ATOM   6431  C  CD  . ARG C 1 79  ? 20.566  35.102  15.806 1.00 56.97 ? 732  ARG C CD  1 
ATOM   6432  N  NE  . ARG C 1 79  ? 20.487  34.503  17.125 1.00 58.79 ? 732  ARG C NE  1 
ATOM   6433  C  CZ  . ARG C 1 79  ? 19.719  34.968  18.101 1.00 59.67 ? 732  ARG C CZ  1 
ATOM   6434  N  NH1 . ARG C 1 79  ? 18.964  36.036  17.887 1.00 60.68 ? 732  ARG C NH1 1 
ATOM   6435  N  NH2 . ARG C 1 79  ? 19.722  34.379  19.294 1.00 60.75 ? 732  ARG C NH2 1 
ATOM   6436  N  N   . ASP C 1 80  ? 21.997  35.192  10.614 1.00 54.45 ? 733  ASP C N   1 
ATOM   6437  C  CA  . ASP C 1 80  ? 21.843  35.802  9.306  1.00 54.88 ? 733  ASP C CA  1 
ATOM   6438  C  C   . ASP C 1 80  ? 20.989  37.069  9.440  1.00 53.65 ? 733  ASP C C   1 
ATOM   6439  O  O   . ASP C 1 80  ? 19.842  37.096  9.020  1.00 52.76 ? 733  ASP C O   1 
ATOM   6440  C  CB  . ASP C 1 80  ? 21.179  34.814  8.344  1.00 57.84 ? 733  ASP C CB  1 
ATOM   6441  C  CG  . ASP C 1 80  ? 21.157  35.321  6.887  1.00 61.27 ? 733  ASP C CG  1 
ATOM   6442  O  OD1 . ASP C 1 80  ? 21.656  36.445  6.625  1.00 62.37 ? 733  ASP C OD1 1 
ATOM   6443  O  OD2 . ASP C 1 80  ? 20.644  34.588  6.000  1.00 62.85 ? 733  ASP C OD2 1 
ATOM   6444  N  N   . ILE C 1 81  ? 21.552  38.091  10.080 1.00 52.92 ? 734  ILE C N   1 
ATOM   6445  C  CA  . ILE C 1 81  ? 20.882  39.369  10.254 1.00 53.60 ? 734  ILE C CA  1 
ATOM   6446  C  C   . ILE C 1 81  ? 21.646  40.369  9.397  1.00 53.39 ? 734  ILE C C   1 
ATOM   6447  O  O   . ILE C 1 81  ? 22.797  40.128  9.054  1.00 53.11 ? 734  ILE C O   1 
ATOM   6448  C  CB  . ILE C 1 81  ? 20.839  39.847  11.745 1.00 53.08 ? 734  ILE C CB  1 
ATOM   6449  C  CG1 . ILE C 1 81  ? 22.247  39.908  12.337 1.00 51.70 ? 734  ILE C CG1 1 
ATOM   6450  C  CG2 . ILE C 1 81  ? 19.888  38.947  12.543 1.00 51.39 ? 734  ILE C CG2 1 
ATOM   6451  C  CD1 . ILE C 1 81  ? 22.273  40.358  13.782 1.00 51.11 ? 734  ILE C CD1 1 
ATOM   6452  N  N   . PRO C 1 82  ? 21.010  41.501  9.034  1.00 54.39 ? 735  PRO C N   1 
ATOM   6453  C  CA  . PRO C 1 82  ? 21.642  42.525  8.191  1.00 53.40 ? 735  PRO C CA  1 
ATOM   6454  C  C   . PRO C 1 82  ? 22.958  43.182  8.621  1.00 52.89 ? 735  PRO C C   1 
ATOM   6455  O  O   . PRO C 1 82  ? 23.811  43.459  7.763  1.00 53.16 ? 735  PRO C O   1 
ATOM   6456  C  CB  . PRO C 1 82  ? 20.506  43.541  7.961  1.00 52.62 ? 735  PRO C CB  1 
ATOM   6457  C  CG  . PRO C 1 82  ? 19.652  43.397  9.155  1.00 54.32 ? 735  PRO C CG  1 
ATOM   6458  C  CD  . PRO C 1 82  ? 19.628  41.890  9.375  1.00 54.58 ? 735  PRO C CD  1 
ATOM   6459  N  N   . TYR C 1 83  ? 23.144  43.432  9.916  1.00 50.85 ? 736  TYR C N   1 
ATOM   6460  C  CA  . TYR C 1 83  ? 24.384  44.070  10.352 1.00 48.39 ? 736  TYR C CA  1 
ATOM   6461  C  C   . TYR C 1 83  ? 25.366  43.215  11.187 1.00 47.58 ? 736  TYR C C   1 
ATOM   6462  O  O   . TYR C 1 83  ? 26.459  42.912  10.728 1.00 46.35 ? 736  TYR C O   1 
ATOM   6463  C  CB  . TYR C 1 83  ? 24.074  45.353  11.119 1.00 47.22 ? 736  TYR C CB  1 
ATOM   6464  C  CG  . TYR C 1 83  ? 25.312  46.186  11.410 1.00 47.97 ? 736  TYR C CG  1 
ATOM   6465  C  CD1 . TYR C 1 83  ? 25.826  47.083  10.461 1.00 45.24 ? 736  TYR C CD1 1 
ATOM   6466  C  CD2 . TYR C 1 83  ? 25.967  46.078  12.640 1.00 46.87 ? 736  TYR C CD2 1 
ATOM   6467  C  CE1 . TYR C 1 83  ? 26.961  47.866  10.738 1.00 47.28 ? 736  TYR C CE1 1 
ATOM   6468  C  CE2 . TYR C 1 83  ? 27.103  46.848  12.935 1.00 47.25 ? 736  TYR C CE2 1 
ATOM   6469  C  CZ  . TYR C 1 83  ? 27.600  47.743  11.990 1.00 48.47 ? 736  TYR C CZ  1 
ATOM   6470  O  OH  . TYR C 1 83  ? 28.705  48.522  12.313 1.00 46.51 ? 736  TYR C OH  1 
ATOM   6471  N  N   . HIS C 1 84  ? 24.967  42.832  12.398 1.00 46.10 ? 737  HIS C N   1 
ATOM   6472  C  CA  . HIS C 1 84  ? 25.839  42.068  13.288 1.00 44.99 ? 737  HIS C CA  1 
ATOM   6473  C  C   . HIS C 1 84  ? 26.007  40.561  12.992 1.00 44.96 ? 737  HIS C C   1 
ATOM   6474  O  O   . HIS C 1 84  ? 25.599  39.715  13.787 1.00 44.77 ? 737  HIS C O   1 
ATOM   6475  C  CB  . HIS C 1 84  ? 25.365  42.264  14.727 1.00 44.08 ? 737  HIS C CB  1 
ATOM   6476  C  CG  . HIS C 1 84  ? 25.338  43.694  15.178 1.00 42.02 ? 737  HIS C CG  1 
ATOM   6477  N  ND1 . HIS C 1 84  ? 24.175  44.431  15.253 1.00 43.72 ? 737  HIS C ND1 1 
ATOM   6478  C  CD2 . HIS C 1 84  ? 26.323  44.507  15.627 1.00 41.83 ? 737  HIS C CD2 1 
ATOM   6479  C  CE1 . HIS C 1 84  ? 24.443  45.634  15.732 1.00 41.74 ? 737  HIS C CE1 1 
ATOM   6480  N  NE2 . HIS C 1 84  ? 25.740  45.705  15.967 1.00 43.64 ? 737  HIS C NE2 1 
ATOM   6481  N  N   . ASN C 1 85  ? 26.663  40.253  11.874 1.00 44.75 ? 738  ASN C N   1 
ATOM   6482  C  CA  . ASN C 1 85  ? 26.896  38.881  11.395 1.00 46.38 ? 738  ASN C CA  1 
ATOM   6483  C  C   . ASN C 1 85  ? 28.399  38.558  11.196 1.00 45.07 ? 738  ASN C C   1 
ATOM   6484  O  O   . ASN C 1 85  ? 29.255  39.376  11.519 1.00 45.16 ? 738  ASN C O   1 
ATOM   6485  C  CB  . ASN C 1 85  ? 26.189  38.718  10.044 1.00 47.36 ? 738  ASN C CB  1 
ATOM   6486  C  CG  . ASN C 1 85  ? 26.563  39.837  9.081  1.00 48.65 ? 738  ASN C CG  1 
ATOM   6487  O  OD1 . ASN C 1 85  ? 27.745  40.134  8.884  1.00 48.64 ? 738  ASN C OD1 1 
ATOM   6488  N  ND2 . ASN C 1 85  ? 25.562  40.471  8.488  1.00 50.34 ? 738  ASN C ND2 1 
ATOM   6489  N  N   . ARG C 1 86  ? 28.684  37.382  10.625 1.00 45.07 ? 739  ARG C N   1 
ATOM   6490  C  CA  . ARG C 1 86  ? 30.053  36.903  10.353 1.00 45.33 ? 739  ARG C CA  1 
ATOM   6491  C  C   . ARG C 1 86  ? 30.909  37.942  9.652  1.00 44.23 ? 739  ARG C C   1 
ATOM   6492  O  O   . ARG C 1 86  ? 32.076  38.129  9.994  1.00 44.06 ? 739  ARG C O   1 
ATOM   6493  C  CB  . ARG C 1 86  ? 30.053  35.681  9.425  1.00 46.20 ? 739  ARG C CB  1 
ATOM   6494  C  CG  . ARG C 1 86  ? 29.216  34.509  9.850  1.00 49.49 ? 739  ARG C CG  1 
ATOM   6495  C  CD  . ARG C 1 86  ? 28.758  33.768  8.612  1.00 51.09 ? 739  ARG C CD  1 
ATOM   6496  N  NE  . ARG C 1 86  ? 28.846  32.315  8.726  1.00 53.38 ? 739  ARG C NE  1 
ATOM   6497  C  CZ  . ARG C 1 86  ? 28.017  31.554  9.432  1.00 54.35 ? 739  ARG C CZ  1 
ATOM   6498  N  NH1 . ARG C 1 86  ? 27.013  32.103  10.109 1.00 52.98 ? 739  ARG C NH1 1 
ATOM   6499  N  NH2 . ARG C 1 86  ? 28.192  30.230  9.447  1.00 55.72 ? 739  ARG C NH2 1 
ATOM   6500  N  N   . ILE C 1 87  ? 30.326  38.580  8.639  1.00 43.19 ? 740  ILE C N   1 
ATOM   6501  C  CA  . ILE C 1 87  ? 31.029  39.578  7.848  1.00 42.13 ? 740  ILE C CA  1 
ATOM   6502  C  C   . ILE C 1 87  ? 31.468  40.735  8.708  1.00 41.09 ? 740  ILE C C   1 
ATOM   6503  O  O   . ILE C 1 87  ? 32.615  41.141  8.620  1.00 42.44 ? 740  ILE C O   1 
ATOM   6504  C  CB  . ILE C 1 87  ? 30.157  40.099  6.654  1.00 42.60 ? 740  ILE C CB  1 
ATOM   6505  C  CG1 . ILE C 1 87  ? 29.654  38.921  5.823  1.00 40.48 ? 740  ILE C CG1 1 
ATOM   6506  C  CG2 . ILE C 1 87  ? 30.996  41.007  5.753  1.00 41.81 ? 740  ILE C CG2 1 
ATOM   6507  C  CD1 . ILE C 1 87  ? 28.535  39.270  4.900  1.00 37.31 ? 740  ILE C CD1 1 
ATOM   6508  N  N   . HIS C 1 88  ? 30.580  41.265  9.540  1.00 39.57 ? 741  HIS C N   1 
ATOM   6509  C  CA  . HIS C 1 88  ? 30.956  42.371  10.419 1.00 39.70 ? 741  HIS C CA  1 
ATOM   6510  C  C   . HIS C 1 88  ? 32.127  41.948  11.333 1.00 39.73 ? 741  HIS C C   1 
ATOM   6511  O  O   . HIS C 1 88  ? 33.097  42.705  11.512 1.00 39.96 ? 741  HIS C O   1 
ATOM   6512  C  CB  . HIS C 1 88  ? 29.751  42.805  11.285 1.00 38.57 ? 741  HIS C CB  1 
ATOM   6513  C  CG  . HIS C 1 88  ? 30.073  43.871  12.292 1.00 37.40 ? 741  HIS C CG  1 
ATOM   6514  N  ND1 . HIS C 1 88  ? 30.668  45.069  11.951 1.00 38.08 ? 741  HIS C ND1 1 
ATOM   6515  C  CD2 . HIS C 1 88  ? 29.867  43.928  13.631 1.00 38.46 ? 741  HIS C CD2 1 
ATOM   6516  C  CE1 . HIS C 1 88  ? 30.814  45.815  13.034 1.00 36.40 ? 741  HIS C CE1 1 
ATOM   6517  N  NE2 . HIS C 1 88  ? 30.336  45.146  14.066 1.00 37.18 ? 741  HIS C NE2 1 
ATOM   6518  N  N   . ALA C 1 89  ? 32.005  40.750  11.916 1.00 38.76 ? 742  ALA C N   1 
ATOM   6519  C  CA  . ALA C 1 89  ? 33.020  40.177  12.806 1.00 39.12 ? 742  ALA C CA  1 
ATOM   6520  C  C   . ALA C 1 89  ? 34.360  40.221  12.082 1.00 38.41 ? 742  ALA C C   1 
ATOM   6521  O  O   . ALA C 1 89  ? 35.351  40.770  12.573 1.00 37.50 ? 742  ALA C O   1 
ATOM   6522  C  CB  . ALA C 1 89  ? 32.660  38.724  13.150 1.00 37.24 ? 742  ALA C CB  1 
ATOM   6523  N  N   . THR C 1 90  ? 34.368  39.636  10.896 1.00 37.65 ? 743  THR C N   1 
ATOM   6524  C  CA  . THR C 1 90  ? 35.560  39.604  10.066 1.00 38.94 ? 743  THR C CA  1 
ATOM   6525  C  C   . THR C 1 90  ? 36.134  41.012  9.866  1.00 39.43 ? 743  THR C C   1 
ATOM   6526  O  O   . THR C 1 90  ? 37.341  41.249  9.986  1.00 41.36 ? 743  THR C O   1 
ATOM   6527  C  CB  . THR C 1 90  ? 35.220  39.043  8.688  1.00 38.19 ? 743  THR C CB  1 
ATOM   6528  O  OG1 . THR C 1 90  ? 34.518  37.809  8.828  1.00 38.36 ? 743  THR C OG1 1 
ATOM   6529  C  CG2 . THR C 1 90  ? 36.463  38.823  7.892  1.00 37.73 ? 743  THR C CG2 1 
ATOM   6530  N  N   . ASP C 1 91  ? 35.239  41.942  9.556  1.00 39.59 ? 744  ASP C N   1 
ATOM   6531  C  CA  . ASP C 1 91  ? 35.605  43.312  9.291  1.00 38.89 ? 744  ASP C CA  1 
ATOM   6532  C  C   . ASP C 1 91  ? 36.260  43.983  10.474 1.00 38.93 ? 744  ASP C C   1 
ATOM   6533  O  O   . ASP C 1 91  ? 37.228  44.730  10.312 1.00 39.13 ? 744  ASP C O   1 
ATOM   6534  C  CB  . ASP C 1 91  ? 34.372  44.109  8.848  1.00 38.83 ? 744  ASP C CB  1 
ATOM   6535  C  CG  . ASP C 1 91  ? 34.733  45.490  8.374  1.00 36.64 ? 744  ASP C CG  1 
ATOM   6536  O  OD1 . ASP C 1 91  ? 35.430  45.555  7.344  1.00 37.81 ? 744  ASP C OD1 1 
ATOM   6537  O  OD2 . ASP C 1 91  ? 34.354  46.476  9.045  1.00 33.24 ? 744  ASP C OD2 1 
ATOM   6538  N  N   . VAL C 1 92  ? 35.734  43.733  11.668 1.00 40.37 ? 745  VAL C N   1 
ATOM   6539  C  CA  . VAL C 1 92  ? 36.315  44.314  12.884 1.00 40.38 ? 745  VAL C CA  1 
ATOM   6540  C  C   . VAL C 1 92  ? 37.694  43.699  13.103 1.00 39.70 ? 745  VAL C C   1 
ATOM   6541  O  O   . VAL C 1 92  ? 38.643  44.382  13.520 1.00 36.93 ? 745  VAL C O   1 
ATOM   6542  C  CB  . VAL C 1 92  ? 35.438  44.040  14.137 1.00 40.79 ? 745  VAL C CB  1 
ATOM   6543  C  CG1 . VAL C 1 92  ? 36.170  44.499  15.394 1.00 37.86 ? 745  VAL C CG1 1 
ATOM   6544  C  CG2 . VAL C 1 92  ? 34.106  44.791  14.004 1.00 41.17 ? 745  VAL C CG2 1 
ATOM   6545  N  N   . LEU C 1 93  ? 37.769  42.409  12.789 1.00 39.62 ? 746  LEU C N   1 
ATOM   6546  C  CA  . LEU C 1 93  ? 38.988  41.627  12.916 1.00 41.92 ? 746  LEU C CA  1 
ATOM   6547  C  C   . LEU C 1 93  ? 40.092  42.211  12.035 1.00 43.16 ? 746  LEU C C   1 
ATOM   6548  O  O   . LEU C 1 93  ? 41.240  42.346  12.458 1.00 43.27 ? 746  LEU C O   1 
ATOM   6549  C  CB  . LEU C 1 93  ? 38.711  40.183  12.505 1.00 40.67 ? 746  LEU C CB  1 
ATOM   6550  C  CG  . LEU C 1 93  ? 39.952  39.377  12.129 1.00 40.59 ? 746  LEU C CG  1 
ATOM   6551  C  CD1 . LEU C 1 93  ? 40.888  39.356  13.323 1.00 39.91 ? 746  LEU C CD1 1 
ATOM   6552  C  CD2 . LEU C 1 93  ? 39.555  37.979  11.692 1.00 39.80 ? 746  LEU C CD2 1 
ATOM   6553  N  N   . HIS C 1 94  ? 39.730  42.565  10.808 1.00 43.60 ? 747  HIS C N   1 
ATOM   6554  C  CA  . HIS C 1 94  ? 40.692  43.121  9.886  1.00 44.41 ? 747  HIS C CA  1 
ATOM   6555  C  C   . HIS C 1 94  ? 41.112  44.522  10.278 1.00 44.17 ? 747  HIS C C   1 
ATOM   6556  O  O   . HIS C 1 94  ? 42.217  44.956  9.949  1.00 45.82 ? 747  HIS C O   1 
ATOM   6557  C  CB  . HIS C 1 94  ? 40.123  43.112  8.459  1.00 46.67 ? 747  HIS C CB  1 
ATOM   6558  C  CG  . HIS C 1 94  ? 40.872  43.992  7.505  1.00 49.27 ? 747  HIS C CG  1 
ATOM   6559  N  ND1 . HIS C 1 94  ? 40.719  45.362  7.484  1.00 50.07 ? 747  HIS C ND1 1 
ATOM   6560  C  CD2 . HIS C 1 94  ? 41.822  43.708  6.582  1.00 49.72 ? 747  HIS C CD2 1 
ATOM   6561  C  CE1 . HIS C 1 94  ? 41.541  45.884  6.590  1.00 50.39 ? 747  HIS C CE1 1 
ATOM   6562  N  NE2 . HIS C 1 94  ? 42.222  44.901  6.030  1.00 51.54 ? 747  HIS C NE2 1 
ATOM   6563  N  N   . ALA C 1 95  ? 40.246  45.236  10.984 1.00 44.06 ? 748  ALA C N   1 
ATOM   6564  C  CA  . ALA C 1 95  ? 40.589  46.596  11.390 1.00 44.25 ? 748  ALA C CA  1 
ATOM   6565  C  C   . ALA C 1 95  ? 41.611  46.592  12.517 1.00 43.44 ? 748  ALA C C   1 
ATOM   6566  O  O   . ALA C 1 95  ? 42.663  47.197  12.399 1.00 43.98 ? 748  ALA C O   1 
ATOM   6567  C  CB  . ALA C 1 95  ? 39.338  47.355  11.816 1.00 42.72 ? 748  ALA C CB  1 
ATOM   6568  N  N   . VAL C 1 96  ? 41.299  45.914  13.616 1.00 44.00 ? 749  VAL C N   1 
ATOM   6569  C  CA  . VAL C 1 96  ? 42.234  45.847  14.734 1.00 42.74 ? 749  VAL C CA  1 
ATOM   6570  C  C   . VAL C 1 96  ? 43.595  45.364  14.229 1.00 42.98 ? 749  VAL C C   1 
ATOM   6571  O  O   . VAL C 1 96  ? 44.622  45.907  14.601 1.00 40.28 ? 749  VAL C O   1 
ATOM   6572  C  CB  . VAL C 1 96  ? 41.718  44.913  15.861 1.00 40.92 ? 749  VAL C CB  1 
ATOM   6573  C  CG1 . VAL C 1 96  ? 40.487  45.522  16.491 1.00 39.80 ? 749  VAL C CG1 1 
ATOM   6574  C  CG2 . VAL C 1 96  ? 41.428  43.526  15.328 1.00 37.65 ? 749  VAL C CG2 1 
ATOM   6575  N  N   . TRP C 1 97  ? 43.588  44.356  13.363 1.00 43.68 ? 750  TRP C N   1 
ATOM   6576  C  CA  . TRP C 1 97  ? 44.829  43.842  12.811 1.00 45.86 ? 750  TRP C CA  1 
ATOM   6577  C  C   . TRP C 1 97  ? 45.599  44.920  12.081 1.00 46.91 ? 750  TRP C C   1 
ATOM   6578  O  O   . TRP C 1 97  ? 46.789  45.129  12.322 1.00 48.05 ? 750  TRP C O   1 
ATOM   6579  C  CB  . TRP C 1 97  ? 44.544  42.738  11.809 1.00 46.45 ? 750  TRP C CB  1 
ATOM   6580  C  CG  . TRP C 1 97  ? 45.746  42.315  10.972 1.00 48.72 ? 750  TRP C CG  1 
ATOM   6581  C  CD1 . TRP C 1 97  ? 46.759  41.460  11.345 1.00 48.44 ? 750  TRP C CD1 1 
ATOM   6582  C  CD2 . TRP C 1 97  ? 45.974  42.611  9.586  1.00 48.88 ? 750  TRP C CD2 1 
ATOM   6583  N  NE1 . TRP C 1 97  ? 47.580  41.199  10.271 1.00 48.06 ? 750  TRP C NE1 1 
ATOM   6584  C  CE2 . TRP C 1 97  ? 47.124  41.891  9.185  1.00 47.89 ? 750  TRP C CE2 1 
ATOM   6585  C  CE3 . TRP C 1 97  ? 45.314  43.412  8.646  1.00 49.70 ? 750  TRP C CE3 1 
ATOM   6586  C  CZ2 . TRP C 1 97  ? 47.620  41.941  7.885  1.00 49.05 ? 750  TRP C CZ2 1 
ATOM   6587  C  CZ3 . TRP C 1 97  ? 45.805  43.465  7.348  1.00 48.40 ? 750  TRP C CZ3 1 
ATOM   6588  C  CH2 . TRP C 1 97  ? 46.949  42.734  6.978  1.00 50.16 ? 750  TRP C CH2 1 
ATOM   6589  N  N   . TYR C 1 98  ? 44.909  45.580  11.154 1.00 47.71 ? 751  TYR C N   1 
ATOM   6590  C  CA  . TYR C 1 98  ? 45.510  46.617  10.343 1.00 45.73 ? 751  TYR C CA  1 
ATOM   6591  C  C   . TYR C 1 98  ? 46.005  47.763  11.205 1.00 44.66 ? 751  TYR C C   1 
ATOM   6592  O  O   . TYR C 1 98  ? 47.070  48.323  10.946 1.00 44.67 ? 751  TYR C O   1 
ATOM   6593  C  CB  . TYR C 1 98  ? 44.495  47.125  9.299  1.00 46.47 ? 751  TYR C CB  1 
ATOM   6594  C  CG  . TYR C 1 98  ? 45.079  48.140  8.320  1.00 44.85 ? 751  TYR C CG  1 
ATOM   6595  C  CD1 . TYR C 1 98  ? 45.353  47.795  7.001  1.00 45.54 ? 751  TYR C CD1 1 
ATOM   6596  C  CD2 . TYR C 1 98  ? 45.427  49.426  8.748  1.00 45.68 ? 751  TYR C CD2 1 
ATOM   6597  C  CE1 . TYR C 1 98  ? 45.972  48.704  6.128  1.00 45.07 ? 751  TYR C CE1 1 
ATOM   6598  C  CE2 . TYR C 1 98  ? 46.042  50.339  7.888  1.00 46.50 ? 751  TYR C CE2 1 
ATOM   6599  C  CZ  . TYR C 1 98  ? 46.312  49.969  6.586  1.00 44.64 ? 751  TYR C CZ  1 
ATOM   6600  O  OH  . TYR C 1 98  ? 46.943  50.867  5.766  1.00 45.87 ? 751  TYR C OH  1 
ATOM   6601  N  N   . LEU C 1 99  ? 45.246  48.099  12.241 1.00 44.91 ? 752  LEU C N   1 
ATOM   6602  C  CA  . LEU C 1 99  ? 45.604  49.208  13.135 1.00 45.67 ? 752  LEU C CA  1 
ATOM   6603  C  C   . LEU C 1 99  ? 46.805  48.970  14.015 1.00 46.08 ? 752  LEU C C   1 
ATOM   6604  O  O   . LEU C 1 99  ? 47.511  49.920  14.404 1.00 46.47 ? 752  LEU C O   1 
ATOM   6605  C  CB  . LEU C 1 99  ? 44.432  49.566  14.041 1.00 45.87 ? 752  LEU C CB  1 
ATOM   6606  C  CG  . LEU C 1 99  ? 43.269  50.339  13.431 1.00 46.16 ? 752  LEU C CG  1 
ATOM   6607  C  CD1 . LEU C 1 99  ? 42.162  50.446  14.476 1.00 45.67 ? 752  LEU C CD1 1 
ATOM   6608  C  CD2 . LEU C 1 99  ? 43.753  51.719  12.948 1.00 45.21 ? 752  LEU C CD2 1 
ATOM   6609  N  N   . THR C 1 100 ? 47.022  47.700  14.337 1.00 45.62 ? 753  THR C N   1 
ATOM   6610  C  CA  . THR C 1 100 ? 48.124  47.312  15.195 1.00 45.78 ? 753  THR C CA  1 
ATOM   6611  C  C   . THR C 1 100 ? 49.387  46.842  14.478 1.00 47.14 ? 753  THR C C   1 
ATOM   6612  O  O   . THR C 1 100 ? 50.392  46.556  15.129 1.00 46.85 ? 753  THR C O   1 
ATOM   6613  C  CB  . THR C 1 100 ? 47.669  46.219  16.179 1.00 44.60 ? 753  THR C CB  1 
ATOM   6614  O  OG1 . THR C 1 100 ? 47.072  45.136  15.457 1.00 43.28 ? 753  THR C OG1 1 
ATOM   6615  C  CG2 . THR C 1 100 ? 46.660  46.788  17.165 1.00 45.31 ? 753  THR C CG2 1 
ATOM   6616  N  N   . THR C 1 101 ? 49.358  46.776  13.147 1.00 48.16 ? 754  THR C N   1 
ATOM   6617  C  CA  . THR C 1 101 ? 50.540  46.324  12.416 1.00 48.35 ? 754  THR C CA  1 
ATOM   6618  C  C   . THR C 1 101 ? 51.136  47.276  11.364 1.00 49.66 ? 754  THR C C   1 
ATOM   6619  O  O   . THR C 1 101 ? 52.323  47.179  11.068 1.00 50.03 ? 754  THR C O   1 
ATOM   6620  C  CB  . THR C 1 101 ? 50.271  44.984  11.731 1.00 47.83 ? 754  THR C CB  1 
ATOM   6621  O  OG1 . THR C 1 101 ? 49.302  45.170  10.699 1.00 47.37 ? 754  THR C OG1 1 
ATOM   6622  C  CG2 . THR C 1 101 ? 49.766  43.959  12.737 1.00 46.12 ? 754  THR C CG2 1 
ATOM   6623  N  N   . ARG C 1 102 ? 50.337  48.194  10.807 1.00 50.23 ? 755  ARG C N   1 
ATOM   6624  C  CA  . ARG C 1 102 ? 50.839  49.111  9.769  1.00 48.81 ? 755  ARG C CA  1 
ATOM   6625  C  C   . ARG C 1 102 ? 51.610  50.299  10.339 1.00 47.71 ? 755  ARG C C   1 
ATOM   6626  O  O   . ARG C 1 102 ? 51.401  50.695  11.486 1.00 48.60 ? 755  ARG C O   1 
ATOM   6627  C  CB  . ARG C 1 102 ? 49.708  49.656  8.890  1.00 47.67 ? 755  ARG C CB  1 
ATOM   6628  C  CG  . ARG C 1 102 ? 48.692  48.655  8.400  1.00 47.41 ? 755  ARG C CG  1 
ATOM   6629  C  CD  . ARG C 1 102 ? 49.152  47.715  7.342  1.00 45.33 ? 755  ARG C CD  1 
ATOM   6630  N  NE  . ARG C 1 102 ? 49.347  46.420  7.955  1.00 47.86 ? 755  ARG C NE  1 
ATOM   6631  C  CZ  . ARG C 1 102 ? 49.588  45.288  7.301  1.00 47.62 ? 755  ARG C CZ  1 
ATOM   6632  N  NH1 . ARG C 1 102 ? 49.652  45.264  5.971  1.00 46.77 ? 755  ARG C NH1 1 
ATOM   6633  N  NH2 . ARG C 1 102 ? 49.826  44.182  8.001  1.00 45.95 ? 755  ARG C NH2 1 
ATOM   6634  N  N   . PRO C 1 103 ? 52.500  50.896  9.526  1.00 46.38 ? 756  PRO C N   1 
ATOM   6635  C  CA  . PRO C 1 103 ? 53.322  52.041  9.930  1.00 47.30 ? 756  PRO C CA  1 
ATOM   6636  C  C   . PRO C 1 103 ? 52.576  53.247  10.528 1.00 49.38 ? 756  PRO C C   1 
ATOM   6637  O  O   . PRO C 1 103 ? 51.545  53.693  10.005 1.00 49.04 ? 756  PRO C O   1 
ATOM   6638  C  CB  . PRO C 1 103 ? 54.065  52.388  8.642  1.00 46.54 ? 756  PRO C CB  1 
ATOM   6639  C  CG  . PRO C 1 103 ? 54.229  51.065  7.986  1.00 44.51 ? 756  PRO C CG  1 
ATOM   6640  C  CD  . PRO C 1 103 ? 52.895  50.412  8.190  1.00 43.89 ? 756  PRO C CD  1 
ATOM   6641  N  N   . VAL C 1 104 ? 53.114  53.775  11.626 1.00 50.07 ? 757  VAL C N   1 
ATOM   6642  C  CA  . VAL C 1 104 ? 52.528  54.926  12.294 1.00 51.01 ? 757  VAL C CA  1 
ATOM   6643  C  C   . VAL C 1 104 ? 53.570  56.017  12.406 1.00 53.27 ? 757  VAL C C   1 
ATOM   6644  O  O   . VAL C 1 104 ? 54.620  55.823  13.005 1.00 54.15 ? 757  VAL C O   1 
ATOM   6645  C  CB  . VAL C 1 104 ? 52.039  54.601  13.723 1.00 51.18 ? 757  VAL C CB  1 
ATOM   6646  C  CG1 . VAL C 1 104 ? 51.544  55.893  14.403 1.00 50.03 ? 757  VAL C CG1 1 
ATOM   6647  C  CG2 . VAL C 1 104 ? 50.931  53.557  13.684 1.00 49.92 ? 757  VAL C CG2 1 
ATOM   6648  N  N   . PRO C 1 105 ? 53.279  57.195  11.842 1.00 55.04 ? 758  PRO C N   1 
ATOM   6649  C  CA  . PRO C 1 105 ? 54.157  58.367  11.841 1.00 55.27 ? 758  PRO C CA  1 
ATOM   6650  C  C   . PRO C 1 105 ? 54.645  58.817  13.211 1.00 55.31 ? 758  PRO C C   1 
ATOM   6651  O  O   . PRO C 1 105 ? 53.860  59.311  14.035 1.00 55.88 ? 758  PRO C O   1 
ATOM   6652  C  CB  . PRO C 1 105 ? 53.299  59.435  11.177 1.00 55.41 ? 758  PRO C CB  1 
ATOM   6653  C  CG  . PRO C 1 105 ? 52.452  58.629  10.242 1.00 55.63 ? 758  PRO C CG  1 
ATOM   6654  C  CD  . PRO C 1 105 ? 52.034  57.492  11.117 1.00 54.54 ? 758  PRO C CD  1 
ATOM   6655  N  N   . GLY C 1 106 ? 55.944  58.637  13.443 1.00 55.25 ? 759  GLY C N   1 
ATOM   6656  C  CA  . GLY C 1 106 ? 56.579  59.059  14.688 1.00 55.09 ? 759  GLY C CA  1 
ATOM   6657  C  C   . GLY C 1 106 ? 56.316  58.242  15.936 1.00 55.50 ? 759  GLY C C   1 
ATOM   6658  O  O   . GLY C 1 106 ? 56.542  58.717  17.044 1.00 54.84 ? 759  GLY C O   1 
ATOM   6659  N  N   . LEU C 1 107 ? 55.860  57.006  15.770 1.00 56.53 ? 760  LEU C N   1 
ATOM   6660  C  CA  . LEU C 1 107 ? 55.565  56.168  16.924 1.00 58.14 ? 760  LEU C CA  1 
ATOM   6661  C  C   . LEU C 1 107 ? 56.818  55.540  17.564 1.00 59.91 ? 760  LEU C C   1 
ATOM   6662  O  O   . LEU C 1 107 ? 57.435  54.631  16.999 1.00 60.15 ? 760  LEU C O   1 
ATOM   6663  C  CB  . LEU C 1 107 ? 54.583  55.067  16.524 1.00 55.40 ? 760  LEU C CB  1 
ATOM   6664  C  CG  . LEU C 1 107 ? 54.164  54.164  17.681 1.00 53.64 ? 760  LEU C CG  1 
ATOM   6665  C  CD1 . LEU C 1 107 ? 53.481  54.962  18.790 1.00 51.12 ? 760  LEU C CD1 1 
ATOM   6666  C  CD2 . LEU C 1 107 ? 53.246  53.109  17.136 1.00 55.26 ? 760  LEU C CD2 1 
ATOM   6667  N  N   . GLN C 1 108 ? 57.179  56.022  18.748 1.00 61.50 ? 761  GLN C N   1 
ATOM   6668  C  CA  . GLN C 1 108 ? 58.342  55.492  19.444 1.00 64.01 ? 761  GLN C CA  1 
ATOM   6669  C  C   . GLN C 1 108 ? 58.183  53.996  19.720 1.00 64.79 ? 761  GLN C C   1 
ATOM   6670  O  O   . GLN C 1 108 ? 57.297  53.574  20.465 1.00 65.21 ? 761  GLN C O   1 
ATOM   6671  C  CB  . GLN C 1 108 ? 58.562  56.244  20.766 1.00 63.68 ? 761  GLN C CB  1 
ATOM   6672  N  N   . GLN C 1 109 ? 59.037  53.195  19.104 1.00 66.26 ? 762  GLN C N   1 
ATOM   6673  C  CA  . GLN C 1 109 ? 59.001  51.753  19.312 1.00 68.15 ? 762  GLN C CA  1 
ATOM   6674  C  C   . GLN C 1 109 ? 59.674  51.498  20.663 1.00 69.56 ? 762  GLN C C   1 
ATOM   6675  O  O   . GLN C 1 109 ? 60.405  52.356  21.145 1.00 70.56 ? 762  GLN C O   1 
ATOM   6676  C  CB  . GLN C 1 109 ? 59.812  51.073  18.215 1.00 68.12 ? 762  GLN C CB  1 
ATOM   6677  C  CG  . GLN C 1 109 ? 59.300  51.296  16.805 1.00 67.82 ? 762  GLN C CG  1 
ATOM   6678  C  CD  . GLN C 1 109 ? 58.282  50.248  16.399 1.00 67.92 ? 762  GLN C CD  1 
ATOM   6679  O  OE1 . GLN C 1 109 ? 57.099  50.349  16.740 1.00 68.81 ? 762  GLN C OE1 1 
ATOM   6680  N  NE2 . GLN C 1 109 ? 58.740  49.223  15.678 1.00 67.35 ? 762  GLN C NE2 1 
ATOM   6681  N  N   . ILE C 1 110 ? 59.429  50.352  21.292 1.00 70.59 ? 763  ILE C N   1 
ATOM   6682  C  CA  . ILE C 1 110 ? 60.115  50.069  22.560 1.00 71.61 ? 763  ILE C CA  1 
ATOM   6683  C  C   . ILE C 1 110 ? 61.061  48.875  22.395 1.00 73.10 ? 763  ILE C C   1 
ATOM   6684  O  O   . ILE C 1 110 ? 62.257  48.971  22.728 1.00 73.37 ? 763  ILE C O   1 
ATOM   6685  C  CB  . ILE C 1 110 ? 59.144  49.766  23.757 1.00 70.67 ? 763  ILE C CB  1 
ATOM   6686  C  CG1 . ILE C 1 110 ? 58.395  48.445  23.535 1.00 70.08 ? 763  ILE C CG1 1 
ATOM   6687  C  CG2 . ILE C 1 110 ? 58.201  50.948  23.971 1.00 70.69 ? 763  ILE C CG2 1 
ATOM   6688  C  CD1 . ILE C 1 110 ? 57.540  48.006  24.743 1.00 69.11 ? 763  ILE C CD1 1 
ATOM   6689  N  N   . HIS C 1 111 ? 60.532  47.764  21.864 1.00 73.66 ? 764  HIS C N   1 
ATOM   6690  C  CA  . HIS C 1 111 ? 61.329  46.552  21.658 1.00 73.97 ? 764  HIS C CA  1 
ATOM   6691  C  C   . HIS C 1 111 ? 60.704  45.480  20.744 1.00 74.29 ? 764  HIS C C   1 
ATOM   6692  O  O   . HIS C 1 111 ? 59.803  44.717  21.157 1.00 73.27 ? 764  HIS C O   1 
ATOM   6693  C  CB  . HIS C 1 111 ? 61.680  45.933  23.014 1.00 74.06 ? 764  HIS C CB  1 
ATOM   6694  N  N   . ASN C 1 112 ? 61.226  45.417  19.515 1.00 74.57 ? 765  ASN C N   1 
ATOM   6695  C  CA  . ASN C 1 112 ? 60.779  44.460  18.494 1.00 74.93 ? 765  ASN C CA  1 
ATOM   6696  C  C   . ASN C 1 112 ? 61.531  43.114  18.599 1.00 75.10 ? 765  ASN C C   1 
ATOM   6697  O  O   . ASN C 1 112 ? 62.434  42.828  17.785 1.00 75.40 ? 765  ASN C O   1 
ATOM   6698  C  CB  . ASN C 1 112 ? 60.979  45.073  17.088 1.00 74.20 ? 765  ASN C CB  1 
ATOM   6699  N  N   . GLY C 1 113 ? 61.160  42.303  19.598 1.00 74.46 ? 766  GLY C N   1 
ATOM   6700  C  CA  . GLY C 1 113 ? 61.785  40.986  19.821 1.00 73.60 ? 766  GLY C CA  1 
ATOM   6701  C  C   . GLY C 1 113 ? 61.347  39.932  18.779 1.00 73.56 ? 766  GLY C C   1 
ATOM   6702  O  O   . GLY C 1 113 ? 61.228  40.228  17.574 1.00 73.37 ? 766  GLY C O   1 
ATOM   6703  N  N   . CYS C 1 114 ? 61.113  38.706  19.249 1.00 73.57 ? 767  CYS C N   1 
ATOM   6704  C  CA  . CYS C 1 114 ? 60.706  37.602  18.378 1.00 73.34 ? 767  CYS C CA  1 
ATOM   6705  C  C   . CYS C 1 114 ? 59.234  37.295  18.585 1.00 72.88 ? 767  CYS C C   1 
ATOM   6706  O  O   . CYS C 1 114 ? 58.586  36.847  17.606 1.00 73.07 ? 767  CYS C O   1 
ATOM   6707  C  CB  . CYS C 1 114 ? 61.561  36.339  18.662 1.00 73.72 ? 767  CYS C CB  1 
ATOM   6708  N  N   . ASP C 1 121 ? 68.483  36.077  23.215 1.00 68.66 ? 774  ASP C N   1 
ATOM   6709  C  CA  . ASP C 1 121 ? 69.718  36.911  23.419 1.00 69.36 ? 774  ASP C CA  1 
ATOM   6710  C  C   . ASP C 1 121 ? 69.852  38.041  22.379 1.00 69.55 ? 774  ASP C C   1 
ATOM   6711  O  O   . ASP C 1 121 ? 69.205  38.019  21.328 1.00 70.21 ? 774  ASP C O   1 
ATOM   6712  C  CB  . ASP C 1 121 ? 70.979  35.998  23.376 1.00 67.93 ? 774  ASP C CB  1 
ATOM   6713  N  N   . SER C 1 122 ? 70.698  39.025  22.673 1.00 69.85 ? 775  SER C N   1 
ATOM   6714  C  CA  . SER C 1 122 ? 70.923  40.156  21.764 1.00 69.55 ? 775  SER C CA  1 
ATOM   6715  C  C   . SER C 1 122 ? 72.392  40.242  21.321 1.00 69.65 ? 775  SER C C   1 
ATOM   6716  O  O   . SER C 1 122 ? 72.721  39.923  20.178 1.00 69.37 ? 775  SER C O   1 
ATOM   6717  C  CB  . SER C 1 122 ? 70.475  41.465  22.441 1.00 69.31 ? 775  SER C CB  1 
ATOM   6718  O  OG  . SER C 1 122 ? 70.743  41.450  23.842 1.00 67.96 ? 775  SER C OG  1 
ATOM   6719  N  N   . ASP C 1 123 ? 73.271  40.689  22.216 1.00 70.86 ? 776  ASP C N   1 
ATOM   6720  C  CA  . ASP C 1 123 ? 74.716  40.777  21.908 1.00 71.11 ? 776  ASP C CA  1 
ATOM   6721  C  C   . ASP C 1 123 ? 75.429  39.884  22.933 1.00 70.98 ? 776  ASP C C   1 
ATOM   6722  O  O   . ASP C 1 123 ? 76.551  40.154  23.388 1.00 70.26 ? 776  ASP C O   1 
ATOM   6723  C  CB  . ASP C 1 123 ? 75.201  42.231  22.002 1.00 71.18 ? 776  ASP C CB  1 
ATOM   6724  C  CG  . ASP C 1 123 ? 74.551  43.127  20.943 1.00 72.71 ? 776  ASP C CG  1 
ATOM   6725  O  OD1 . ASP C 1 123 ? 74.807  44.359  20.947 1.00 72.68 ? 776  ASP C OD1 1 
ATOM   6726  O  OD2 . ASP C 1 123 ? 73.784  42.590  20.100 1.00 72.40 ? 776  ASP C OD2 1 
ATOM   6727  N  N   . GLY C 1 124 ? 74.738  38.799  23.268 1.00 70.46 ? 777  GLY C N   1 
ATOM   6728  C  CA  . GLY C 1 124 ? 75.240  37.849  24.232 1.00 70.64 ? 777  GLY C CA  1 
ATOM   6729  C  C   . GLY C 1 124 ? 74.363  37.945  25.463 1.00 70.74 ? 777  GLY C C   1 
ATOM   6730  O  O   . GLY C 1 124 ? 74.235  36.984  26.236 1.00 70.38 ? 777  GLY C O   1 
ATOM   6731  N  N   . ARG C 1 125 ? 73.743  39.112  25.639 1.00 70.17 ? 778  ARG C N   1 
ATOM   6732  C  CA  . ARG C 1 125 ? 72.877  39.341  26.786 1.00 69.75 ? 778  ARG C CA  1 
ATOM   6733  C  C   . ARG C 1 125 ? 71.593  38.549  26.624 1.00 69.92 ? 778  ARG C C   1 
ATOM   6734  O  O   . ARG C 1 125 ? 70.772  38.857  25.750 1.00 70.19 ? 778  ARG C O   1 
ATOM   6735  C  CB  . ARG C 1 125 ? 72.563  40.823  26.920 1.00 69.96 ? 778  ARG C CB  1 
ATOM   6736  N  N   . ILE C 1 126 ? 71.437  37.520  27.459 1.00 70.10 ? 779  ILE C N   1 
ATOM   6737  C  CA  . ILE C 1 126 ? 70.250  36.664  27.440 1.00 70.21 ? 779  ILE C CA  1 
ATOM   6738  C  C   . ILE C 1 126 ? 69.205  37.247  28.412 1.00 71.35 ? 779  ILE C C   1 
ATOM   6739  O  O   . ILE C 1 126 ? 69.408  37.292  29.637 1.00 71.98 ? 779  ILE C O   1 
ATOM   6740  C  CB  . ILE C 1 126 ? 70.613  35.181  27.821 1.00 69.36 ? 779  ILE C CB  1 
ATOM   6741  C  CG1 . ILE C 1 126 ? 69.350  34.383  28.149 1.00 68.83 ? 779  ILE C CG1 1 
ATOM   6742  C  CG2 . ILE C 1 126 ? 71.579  35.155  28.999 1.00 69.88 ? 779  ILE C CG2 1 
ATOM   6743  C  CD1 . ILE C 1 126 ? 68.463  34.065  26.957 1.00 68.53 ? 779  ILE C CD1 1 
ATOM   6744  N  N   . ASN C 1 127 ? 68.109  37.741  27.839 1.00 71.26 ? 780  ASN C N   1 
ATOM   6745  C  CA  . ASN C 1 127 ? 67.015  38.329  28.610 1.00 71.18 ? 780  ASN C CA  1 
ATOM   6746  C  C   . ASN C 1 127 ? 65.983  37.236  28.789 1.00 70.88 ? 780  ASN C C   1 
ATOM   6747  O  O   . ASN C 1 127 ? 65.254  36.877  27.856 1.00 70.50 ? 780  ASN C O   1 
ATOM   6748  C  CB  . ASN C 1 127 ? 66.395  39.505  27.846 1.00 72.29 ? 780  ASN C CB  1 
ATOM   6749  C  CG  . ASN C 1 127 ? 66.564  39.365  26.337 1.00 73.03 ? 780  ASN C CG  1 
ATOM   6750  O  OD1 . ASN C 1 127 ? 66.750  38.242  25.820 1.00 74.63 ? 780  ASN C OD1 1 
ATOM   6751  N  ND2 . ASN C 1 127 ? 66.492  40.491  25.619 1.00 71.78 ? 780  ASN C ND2 1 
ATOM   6752  N  N   . HIS C 1 128 ? 65.952  36.682  29.989 1.00 70.89 ? 781  HIS C N   1 
ATOM   6753  C  CA  . HIS C 1 128 ? 65.022  35.621  30.301 1.00 71.11 ? 781  HIS C CA  1 
ATOM   6754  C  C   . HIS C 1 128 ? 63.632  36.235  30.384 1.00 70.82 ? 781  HIS C C   1 
ATOM   6755  O  O   . HIS C 1 128 ? 63.491  37.466  30.435 1.00 70.67 ? 781  HIS C O   1 
ATOM   6756  C  CB  . HIS C 1 128 ? 65.424  34.967  31.628 1.00 71.70 ? 781  HIS C CB  1 
ATOM   6757  C  CG  . HIS C 1 128 ? 66.884  34.636  31.706 1.00 71.85 ? 781  HIS C CG  1 
ATOM   6758  N  ND1 . HIS C 1 128 ? 67.848  35.592  31.956 1.00 70.92 ? 781  HIS C ND1 1 
ATOM   6759  C  CD2 . HIS C 1 128 ? 67.546  33.469  31.512 1.00 71.52 ? 781  HIS C CD2 1 
ATOM   6760  C  CE1 . HIS C 1 128 ? 69.043  35.027  31.911 1.00 70.67 ? 781  HIS C CE1 1 
ATOM   6761  N  NE2 . HIS C 1 128 ? 68.887  33.741  31.643 1.00 71.64 ? 781  HIS C NE2 1 
ATOM   6762  N  N   . GLY C 1 129 ? 62.610  35.382  30.384 1.00 70.14 ? 782  GLY C N   1 
ATOM   6763  C  CA  . GLY C 1 129 ? 61.250  35.886  30.437 1.00 69.67 ? 782  GLY C CA  1 
ATOM   6764  C  C   . GLY C 1 129 ? 61.042  36.882  29.307 1.00 69.08 ? 782  GLY C C   1 
ATOM   6765  O  O   . GLY C 1 129 ? 60.391  37.920  29.488 1.00 69.91 ? 782  GLY C O   1 
ATOM   6766  N  N   . ARG C 1 130 ? 61.600  36.569  28.136 1.00 67.84 ? 783  ARG C N   1 
ATOM   6767  C  CA  . ARG C 1 130 ? 61.473  37.445  26.972 1.00 66.80 ? 783  ARG C CA  1 
ATOM   6768  C  C   . ARG C 1 130 ? 60.063  37.363  26.388 1.00 65.61 ? 783  ARG C C   1 
ATOM   6769  O  O   . ARG C 1 130 ? 59.664  36.338  25.811 1.00 66.92 ? 783  ARG C O   1 
ATOM   6770  C  CB  . ARG C 1 130 ? 62.510  37.075  25.902 1.00 66.14 ? 783  ARG C CB  1 
ATOM   6771  N  N   . ILE C 1 131 ? 59.307  38.446  26.548 1.00 63.73 ? 784  ILE C N   1 
ATOM   6772  C  CA  . ILE C 1 131 ? 57.936  38.506  26.036 1.00 61.23 ? 784  ILE C CA  1 
ATOM   6773  C  C   . ILE C 1 131 ? 57.941  38.449  24.509 1.00 58.87 ? 784  ILE C C   1 
ATOM   6774  O  O   . ILE C 1 131 ? 58.692  39.179  23.856 1.00 58.27 ? 784  ILE C O   1 
ATOM   6775  C  CB  . ILE C 1 131 ? 57.257  39.814  26.454 1.00 61.30 ? 784  ILE C CB  1 
ATOM   6776  C  CG1 . ILE C 1 131 ? 57.369  40.003  27.975 1.00 60.86 ? 784  ILE C CG1 1 
ATOM   6777  C  CG2 . ILE C 1 131 ? 55.812  39.801  25.993 1.00 60.99 ? 784  ILE C CG2 1 
ATOM   6778  C  CD1 . ILE C 1 131 ? 56.901  41.378  28.454 1.00 59.98 ? 784  ILE C CD1 1 
ATOM   6779  N  N   . ALA C 1 132 ? 57.106  37.588  23.935 1.00 56.50 ? 785  ALA C N   1 
ATOM   6780  C  CA  . ALA C 1 132 ? 57.041  37.488  22.483 1.00 55.07 ? 785  ALA C CA  1 
ATOM   6781  C  C   . ALA C 1 132 ? 56.297  38.703  21.904 1.00 54.56 ? 785  ALA C C   1 
ATOM   6782  O  O   . ALA C 1 132 ? 55.463  39.322  22.584 1.00 53.21 ? 785  ALA C O   1 
ATOM   6783  C  CB  . ALA C 1 132 ? 56.350  36.204  22.080 1.00 54.05 ? 785  ALA C CB  1 
ATOM   6784  N  N   . TYR C 1 133 ? 56.646  39.038  20.660 1.00 53.88 ? 786  TYR C N   1 
ATOM   6785  C  CA  . TYR C 1 133 ? 56.064  40.145  19.891 1.00 53.62 ? 786  TYR C CA  1 
ATOM   6786  C  C   . TYR C 1 133 ? 55.861  39.655  18.463 1.00 53.93 ? 786  TYR C C   1 
ATOM   6787  O  O   . TYR C 1 133 ? 56.702  38.902  17.946 1.00 53.76 ? 786  TYR C O   1 
ATOM   6788  C  CB  . TYR C 1 133 ? 56.997  41.352  19.859 1.00 52.96 ? 786  TYR C CB  1 
ATOM   6789  C  CG  . TYR C 1 133 ? 57.029  42.086  21.158 1.00 52.62 ? 786  TYR C CG  1 
ATOM   6790  C  CD1 . TYR C 1 133 ? 57.867  41.672  22.195 1.00 53.28 ? 786  TYR C CD1 1 
ATOM   6791  C  CD2 . TYR C 1 133 ? 56.166  43.149  21.389 1.00 52.00 ? 786  TYR C CD2 1 
ATOM   6792  C  CE1 . TYR C 1 133 ? 57.835  42.303  23.441 1.00 53.89 ? 786  TYR C CE1 1 
ATOM   6793  C  CE2 . TYR C 1 133 ? 56.121  43.788  22.620 1.00 51.71 ? 786  TYR C CE2 1 
ATOM   6794  C  CZ  . TYR C 1 133 ? 56.950  43.364  23.644 1.00 53.93 ? 786  TYR C CZ  1 
ATOM   6795  O  OH  . TYR C 1 133 ? 56.877  43.972  24.879 1.00 53.95 ? 786  TYR C OH  1 
ATOM   6796  N  N   . ILE C 1 134 ? 54.767  40.074  17.818 1.00 52.74 ? 787  ILE C N   1 
ATOM   6797  C  CA  . ILE C 1 134 ? 54.489  39.625  16.455 1.00 51.69 ? 787  ILE C CA  1 
ATOM   6798  C  C   . ILE C 1 134 ? 54.995  40.612  15.415 1.00 50.68 ? 787  ILE C C   1 
ATOM   6799  O  O   . ILE C 1 134 ? 55.501  41.684  15.752 1.00 48.34 ? 787  ILE C O   1 
ATOM   6800  C  CB  . ILE C 1 134 ? 52.969  39.434  16.209 1.00 52.82 ? 787  ILE C CB  1 
ATOM   6801  C  CG1 . ILE C 1 134 ? 52.252  40.775  16.398 1.00 53.91 ? 787  ILE C CG1 1 
ATOM   6802  C  CG2 . ILE C 1 134 ? 52.392  38.395  17.152 1.00 52.42 ? 787  ILE C CG2 1 
ATOM   6803  C  CD1 . ILE C 1 134 ? 50.833  40.792  15.852 1.00 56.05 ? 787  ILE C CD1 1 
ATOM   6804  N  N   . SER C 1 135 ? 54.848  40.236  14.146 1.00 51.09 ? 788  SER C N   1 
ATOM   6805  C  CA  . SER C 1 135 ? 55.248  41.087  13.026 1.00 51.14 ? 788  SER C CA  1 
ATOM   6806  C  C   . SER C 1 135 ? 54.519  40.722  11.739 1.00 51.39 ? 788  SER C C   1 
ATOM   6807  O  O   . SER C 1 135 ? 54.617  39.596  11.243 1.00 51.55 ? 788  SER C O   1 
ATOM   6808  C  CB  . SER C 1 135 ? 56.750  41.001  12.779 1.00 52.21 ? 788  SER C CB  1 
ATOM   6809  O  OG  . SER C 1 135 ? 57.102  41.756  11.637 1.00 55.29 ? 788  SER C OG  1 
ATOM   6810  N  N   . SER C 1 136 ? 53.787  41.680  11.189 1.00 51.50 ? 789  SER C N   1 
ATOM   6811  C  CA  . SER C 1 136 ? 53.076  41.415  9.946  1.00 51.63 ? 789  SER C CA  1 
ATOM   6812  C  C   . SER C 1 136 ? 54.103  41.195  8.841  1.00 50.76 ? 789  SER C C   1 
ATOM   6813  O  O   . SER C 1 136 ? 55.028  41.984  8.692  1.00 50.31 ? 789  SER C O   1 
ATOM   6814  C  CB  . SER C 1 136 ? 52.185  42.599  9.573  1.00 50.66 ? 789  SER C CB  1 
ATOM   6815  O  OG  . SER C 1 136 ? 51.474  42.311  8.383  1.00 50.05 ? 789  SER C OG  1 
ATOM   6816  N  N   . LYS C 1 137 ? 53.936  40.122  8.081  1.00 50.30 ? 790  LYS C N   1 
ATOM   6817  C  CA  . LYS C 1 137 ? 54.837  39.820  6.980  1.00 51.31 ? 790  LYS C CA  1 
ATOM   6818  C  C   . LYS C 1 137 ? 54.461  40.595  5.722  1.00 52.60 ? 790  LYS C C   1 
ATOM   6819  O  O   . LYS C 1 137 ? 55.255  40.704  4.782  1.00 52.59 ? 790  LYS C O   1 
ATOM   6820  C  CB  . LYS C 1 137 ? 54.789  38.333  6.641  1.00 50.27 ? 790  LYS C CB  1 
ATOM   6821  C  CG  . LYS C 1 137 ? 55.200  37.456  7.775  1.00 50.57 ? 790  LYS C CG  1 
ATOM   6822  C  CD  . LYS C 1 137 ? 54.932  36.010  7.473  1.00 50.49 ? 790  LYS C CD  1 
ATOM   6823  C  CE  . LYS C 1 137 ? 55.059  35.224  8.749  1.00 51.18 ? 790  LYS C CE  1 
ATOM   6824  N  NZ  . LYS C 1 137 ? 54.566  33.838  8.557  1.00 53.92 ? 790  LYS C NZ  1 
ATOM   6825  N  N   . SER C 1 138 ? 53.242  41.122  5.701  1.00 52.88 ? 791  SER C N   1 
ATOM   6826  C  CA  . SER C 1 138 ? 52.741  41.858  4.546  1.00 51.65 ? 791  SER C CA  1 
ATOM   6827  C  C   . SER C 1 138 ? 53.086  43.342  4.578  1.00 52.21 ? 791  SER C C   1 
ATOM   6828  O  O   . SER C 1 138 ? 52.598  44.118  3.750  1.00 51.35 ? 791  SER C O   1 
ATOM   6829  C  CB  . SER C 1 138 ? 51.231  41.666  4.458  1.00 51.32 ? 791  SER C CB  1 
ATOM   6830  O  OG  . SER C 1 138 ? 50.619  42.014  5.687  1.00 50.57 ? 791  SER C OG  1 
ATOM   6831  N  N   . CYS C 1 139 ? 53.909  43.753  5.537  1.00 52.95 ? 792  CYS C N   1 
ATOM   6832  C  CA  . CYS C 1 139 ? 54.293  45.157  5.595  1.00 55.65 ? 792  CYS C CA  1 
ATOM   6833  C  C   . CYS C 1 139 ? 55.384  45.404  6.615  1.00 56.12 ? 792  CYS C C   1 
ATOM   6834  O  O   . CYS C 1 139 ? 55.631  44.576  7.481  1.00 57.03 ? 792  CYS C O   1 
ATOM   6835  C  CB  . CYS C 1 139 ? 53.081  46.041  5.919  1.00 57.25 ? 792  CYS C CB  1 
ATOM   6836  S  SG  . CYS C 1 139 ? 52.872  46.433  7.682  1.00 62.52 ? 792  CYS C SG  1 
ATOM   6837  N  N   . SER C 1 140 ? 56.031  46.559  6.514  1.00 57.86 ? 793  SER C N   1 
ATOM   6838  C  CA  . SER C 1 140 ? 57.109  46.925  7.429  1.00 59.36 ? 793  SER C CA  1 
ATOM   6839  C  C   . SER C 1 140 ? 57.226  48.449  7.549  1.00 59.88 ? 793  SER C C   1 
ATOM   6840  O  O   . SER C 1 140 ? 56.746  49.172  6.678  1.00 60.00 ? 793  SER C O   1 
ATOM   6841  C  CB  . SER C 1 140 ? 58.424  46.344  6.908  1.00 59.93 ? 793  SER C CB  1 
ATOM   6842  O  OG  . SER C 1 140 ? 58.545  46.604  5.518  1.00 61.33 ? 793  SER C OG  1 
ATOM   6843  N  N   . ASN C 1 141 ? 57.846  48.932  8.628  1.00 60.67 ? 794  ASN C N   1 
ATOM   6844  C  CA  . ASN C 1 141 ? 58.033  50.373  8.825  1.00 62.10 ? 794  ASN C CA  1 
ATOM   6845  C  C   . ASN C 1 141 ? 59.095  50.888  7.840  1.00 63.28 ? 794  ASN C C   1 
ATOM   6846  O  O   . ASN C 1 141 ? 60.256  50.485  7.896  1.00 64.19 ? 794  ASN C O   1 
ATOM   6847  C  CB  . ASN C 1 141 ? 58.473  50.676  10.257 1.00 61.72 ? 794  ASN C CB  1 
ATOM   6848  C  CG  . ASN C 1 141 ? 57.408  50.302  11.297 1.00 62.80 ? 794  ASN C CG  1 
ATOM   6849  O  OD1 . ASN C 1 141 ? 56.215  50.586  11.124 1.00 63.07 ? 794  ASN C OD1 1 
ATOM   6850  N  ND2 . ASN C 1 141 ? 57.843  49.677  12.392 1.00 61.95 ? 794  ASN C ND2 1 
ATOM   6851  N  N   . PRO C 1 142 ? 58.702  51.786  6.918  1.00 64.38 ? 795  PRO C N   1 
ATOM   6852  C  CA  . PRO C 1 142 ? 59.586  52.375  5.899  1.00 64.31 ? 795  PRO C CA  1 
ATOM   6853  C  C   . PRO C 1 142 ? 60.961  52.761  6.442  1.00 64.58 ? 795  PRO C C   1 
ATOM   6854  O  O   . PRO C 1 142 ? 61.972  52.691  5.731  1.00 64.68 ? 795  PRO C O   1 
ATOM   6855  C  CB  . PRO C 1 142 ? 58.804  53.608  5.436  1.00 64.25 ? 795  PRO C CB  1 
ATOM   6856  C  CG  . PRO C 1 142 ? 57.390  53.144  5.536  1.00 64.10 ? 795  PRO C CG  1 
ATOM   6857  C  CD  . PRO C 1 142 ? 57.381  52.448  6.895  1.00 64.88 ? 795  PRO C CD  1 
ATOM   6858  N  N   . ASP C 1 143 ? 60.989  53.180  7.703  1.00 64.78 ? 796  ASP C N   1 
ATOM   6859  C  CA  . ASP C 1 143 ? 62.238  53.587  8.314  1.00 65.49 ? 796  ASP C CA  1 
ATOM   6860  C  C   . ASP C 1 143 ? 62.059  53.992  9.761  1.00 65.22 ? 796  ASP C C   1 
ATOM   6861  O  O   . ASP C 1 143 ? 60.975  53.862  10.328 1.00 65.65 ? 796  ASP C O   1 
ATOM   6862  C  CB  . ASP C 1 143 ? 62.847  54.753  7.533  1.00 65.68 ? 796  ASP C CB  1 
ATOM   6863  C  CG  . ASP C 1 143 ? 61.835  55.819  7.220  1.00 67.01 ? 796  ASP C CG  1 
ATOM   6864  O  OD1 . ASP C 1 143 ? 61.310  56.447  8.176  1.00 67.19 ? 796  ASP C OD1 1 
ATOM   6865  O  OD2 . ASP C 1 143 ? 61.554  56.018  6.009  1.00 68.00 ? 796  ASP C OD2 1 
ATOM   6866  N  N   . GLU C 1 144 ? 63.146  54.498  10.330 1.00 65.04 ? 797  GLU C N   1 
ATOM   6867  C  CA  . GLU C 1 144 ? 63.211  54.940  11.712 1.00 64.15 ? 797  GLU C CA  1 
ATOM   6868  C  C   . GLU C 1 144 ? 62.076  55.854  12.139 1.00 63.29 ? 797  GLU C C   1 
ATOM   6869  O  O   . GLU C 1 144 ? 61.675  55.813  13.298 1.00 64.42 ? 797  GLU C O   1 
ATOM   6870  C  CB  . GLU C 1 144 ? 64.561  55.639  11.962 1.00 64.36 ? 797  GLU C CB  1 
ATOM   6871  N  N   . SER C 1 145 ? 61.558  56.682  11.234 1.00 61.86 ? 798  SER C N   1 
ATOM   6872  C  CA  . SER C 1 145 ? 60.478  57.592  11.624 1.00 61.50 ? 798  SER C CA  1 
ATOM   6873  C  C   . SER C 1 145 ? 59.078  56.979  11.544 1.00 61.29 ? 798  SER C C   1 
ATOM   6874  O  O   . SER C 1 145 ? 58.073  57.691  11.521 1.00 61.01 ? 798  SER C O   1 
ATOM   6875  C  CB  . SER C 1 145 ? 60.542  58.891  10.806 1.00 59.86 ? 798  SER C CB  1 
ATOM   6876  O  OG  . SER C 1 145 ? 60.702  58.628  9.427  1.00 58.92 ? 798  SER C OG  1 
ATOM   6877  N  N   . TYR C 1 146 ? 59.035  55.652  11.516 1.00 61.79 ? 799  TYR C N   1 
ATOM   6878  C  CA  . TYR C 1 146 ? 57.791  54.885  11.473 1.00 62.62 ? 799  TYR C CA  1 
ATOM   6879  C  C   . TYR C 1 146 ? 57.808  53.756  12.508 1.00 63.13 ? 799  TYR C C   1 
ATOM   6880  O  O   . TYR C 1 146 ? 58.813  53.052  12.660 1.00 63.36 ? 799  TYR C O   1 
ATOM   6881  C  CB  . TYR C 1 146 ? 57.574  54.268  10.089 1.00 62.65 ? 799  TYR C CB  1 
ATOM   6882  C  CG  . TYR C 1 146 ? 57.031  55.241  9.080  1.00 63.76 ? 799  TYR C CG  1 
ATOM   6883  C  CD1 . TYR C 1 146 ? 57.858  55.822  8.116  1.00 63.20 ? 799  TYR C CD1 1 
ATOM   6884  C  CD2 . TYR C 1 146 ? 55.693  55.630  9.127  1.00 64.42 ? 799  TYR C CD2 1 
ATOM   6885  C  CE1 . TYR C 1 146 ? 57.364  56.772  7.229  1.00 63.89 ? 799  TYR C CE1 1 
ATOM   6886  C  CE2 . TYR C 1 146 ? 55.184  56.579  8.248  1.00 64.33 ? 799  TYR C CE2 1 
ATOM   6887  C  CZ  . TYR C 1 146 ? 56.022  57.151  7.304  1.00 64.33 ? 799  TYR C CZ  1 
ATOM   6888  O  OH  . TYR C 1 146 ? 55.524  58.124  6.467  1.00 63.93 ? 799  TYR C OH  1 
ATOM   6889  N  N   . GLY C 1 147 ? 56.690  53.586  13.211 1.00 62.68 ? 800  GLY C N   1 
ATOM   6890  C  CA  . GLY C 1 147 ? 56.584  52.525  14.196 1.00 61.77 ? 800  GLY C CA  1 
ATOM   6891  C  C   . GLY C 1 147 ? 55.272  51.782  14.033 1.00 60.96 ? 800  GLY C C   1 
ATOM   6892  O  O   . GLY C 1 147 ? 54.471  52.120  13.162 1.00 62.81 ? 800  GLY C O   1 
ATOM   6893  N  N   . CYS C 1 148 ? 55.048  50.761  14.852 1.00 59.30 ? 801  CYS C N   1 
ATOM   6894  C  CA  . CYS C 1 148 ? 53.803  50.012  14.801 1.00 57.04 ? 801  CYS C CA  1 
ATOM   6895  C  C   . CYS C 1 148 ? 53.483  49.469  16.172 1.00 55.93 ? 801  CYS C C   1 
ATOM   6896  O  O   . CYS C 1 148 ? 54.377  49.189  16.975 1.00 54.36 ? 801  CYS C O   1 
ATOM   6897  C  CB  . CYS C 1 148 ? 53.885  48.881  13.791 1.00 58.07 ? 801  CYS C CB  1 
ATOM   6898  S  SG  . CYS C 1 148 ? 55.338  47.860  13.983 1.00 60.54 ? 801  CYS C SG  1 
ATOM   6899  N  N   . LEU C 1 149 ? 52.192  49.320  16.439 1.00 54.56 ? 802  LEU C N   1 
ATOM   6900  C  CA  . LEU C 1 149 ? 51.755  48.835  17.731 1.00 52.51 ? 802  LEU C CA  1 
ATOM   6901  C  C   . LEU C 1 149 ? 52.240  47.427  18.059 1.00 50.39 ? 802  LEU C C   1 
ATOM   6902  O  O   . LEU C 1 149 ? 52.410  47.097  19.221 1.00 50.10 ? 802  LEU C O   1 
ATOM   6903  C  CB  . LEU C 1 149 ? 50.225  48.926  17.823 1.00 52.35 ? 802  LEU C CB  1 
ATOM   6904  C  CG  . LEU C 1 149 ? 49.641  50.350  17.760 1.00 52.13 ? 802  LEU C CG  1 
ATOM   6905  C  CD1 . LEU C 1 149 ? 48.175  50.340  18.159 1.00 52.82 ? 802  LEU C CD1 1 
ATOM   6906  C  CD2 . LEU C 1 149 ? 50.381  51.239  18.713 1.00 53.23 ? 802  LEU C CD2 1 
ATOM   6907  N  N   . SER C 1 150 ? 52.480  46.603  17.047 1.00 49.33 ? 803  SER C N   1 
ATOM   6908  C  CA  . SER C 1 150 ? 52.936  45.239  17.301 1.00 49.19 ? 803  SER C CA  1 
ATOM   6909  C  C   . SER C 1 150 ? 54.287  45.171  18.009 1.00 49.25 ? 803  SER C C   1 
ATOM   6910  O  O   . SER C 1 150 ? 54.655  44.138  18.552 1.00 48.57 ? 803  SER C O   1 
ATOM   6911  C  CB  . SER C 1 150 ? 52.979  44.419  15.997 1.00 47.74 ? 803  SER C CB  1 
ATOM   6912  O  OG  . SER C 1 150 ? 53.632  45.106  14.937 1.00 48.73 ? 803  SER C OG  1 
ATOM   6913  N  N   . SER C 1 151 ? 55.008  46.288  18.016 1.00 49.87 ? 804  SER C N   1 
ATOM   6914  C  CA  . SER C 1 151 ? 56.317  46.360  18.646 1.00 50.39 ? 804  SER C CA  1 
ATOM   6915  C  C   . SER C 1 151 ? 56.242  46.868  20.067 1.00 50.09 ? 804  SER C C   1 
ATOM   6916  O  O   . SER C 1 151 ? 57.229  46.821  20.796 1.00 50.55 ? 804  SER C O   1 
ATOM   6917  C  CB  . SER C 1 151 ? 57.241  47.282  17.853 1.00 51.64 ? 804  SER C CB  1 
ATOM   6918  O  OG  . SER C 1 151 ? 57.452  46.793  16.537 1.00 55.72 ? 804  SER C OG  1 
ATOM   6919  N  N   . ASN C 1 152 ? 55.076  47.360  20.460 1.00 49.01 ? 805  ASN C N   1 
ATOM   6920  C  CA  . ASN C 1 152 ? 54.891  47.896  21.798 1.00 47.85 ? 805  ASN C CA  1 
ATOM   6921  C  C   . ASN C 1 152 ? 53.910  47.072  22.631 1.00 46.42 ? 805  ASN C C   1 
ATOM   6922  O  O   . ASN C 1 152 ? 53.825  47.252  23.849 1.00 45.57 ? 805  ASN C O   1 
ATOM   6923  C  CB  . ASN C 1 152 ? 54.372  49.336  21.708 1.00 51.28 ? 805  ASN C CB  1 
ATOM   6924  C  CG  . ASN C 1 152 ? 55.369  50.292  21.076 1.00 55.00 ? 805  ASN C CG  1 
ATOM   6925  O  OD1 . ASN C 1 152 ? 55.081  51.478  20.913 1.00 59.78 ? 805  ASN C OD1 1 
ATOM   6926  N  ND2 . ASN C 1 152 ? 56.541  49.792  20.722 1.00 55.89 ? 805  ASN C ND2 1 
ATOM   6927  N  N   . ILE C 1 153 ? 53.169  46.181  21.982 1.00 43.77 ? 806  ILE C N   1 
ATOM   6928  C  CA  . ILE C 1 153 ? 52.172  45.392  22.679 1.00 43.03 ? 806  ILE C CA  1 
ATOM   6929  C  C   . ILE C 1 153 ? 52.467  43.939  22.404 1.00 43.50 ? 806  ILE C C   1 
ATOM   6930  O  O   . ILE C 1 153 ? 52.452  43.488  21.252 1.00 41.69 ? 806  ILE C O   1 
ATOM   6931  C  CB  . ILE C 1 153 ? 50.727  45.765  22.200 1.00 44.06 ? 806  ILE C CB  1 
ATOM   6932  C  CG1 . ILE C 1 153 ? 50.500  47.264  22.395 1.00 45.11 ? 806  ILE C CG1 1 
ATOM   6933  C  CG2 . ILE C 1 153 ? 49.660  45.001  22.994 1.00 41.05 ? 806  ILE C CG2 1 
ATOM   6934  C  CD1 . ILE C 1 153 ? 49.154  47.789  21.857 1.00 46.42 ? 806  ILE C CD1 1 
ATOM   6935  N  N   . PRO C 1 154 ? 52.750  43.177  23.472 1.00 43.90 ? 807  PRO C N   1 
ATOM   6936  C  CA  . PRO C 1 154 ? 53.069  41.757  23.354 1.00 44.58 ? 807  PRO C CA  1 
ATOM   6937  C  C   . PRO C 1 154 ? 52.074  40.931  22.570 1.00 44.95 ? 807  PRO C C   1 
ATOM   6938  O  O   . PRO C 1 154 ? 50.870  41.188  22.604 1.00 45.66 ? 807  PRO C O   1 
ATOM   6939  C  CB  . PRO C 1 154 ? 53.217  41.309  24.811 1.00 44.14 ? 807  PRO C CB  1 
ATOM   6940  C  CG  . PRO C 1 154 ? 52.480  42.331  25.591 1.00 44.59 ? 807  PRO C CG  1 
ATOM   6941  C  CD  . PRO C 1 154 ? 52.792  43.606  24.881 1.00 44.26 ? 807  PRO C CD  1 
ATOM   6942  N  N   . ALA C 1 155 ? 52.607  39.936  21.868 1.00 43.88 ? 808  ALA C N   1 
ATOM   6943  C  CA  . ALA C 1 155 ? 51.819  39.032  21.045 1.00 44.10 ? 808  ALA C CA  1 
ATOM   6944  C  C   . ALA C 1 155 ? 50.587  38.468  21.749 1.00 44.09 ? 808  ALA C C   1 
ATOM   6945  O  O   . ALA C 1 155 ? 49.531  38.348  21.146 1.00 45.02 ? 808  ALA C O   1 
ATOM   6946  C  CB  . ALA C 1 155 ? 52.692  37.894  20.553 1.00 42.21 ? 808  ALA C CB  1 
ATOM   6947  N  N   . LEU C 1 156 ? 50.716  38.121  23.020 1.00 43.80 ? 809  LEU C N   1 
ATOM   6948  C  CA  . LEU C 1 156 ? 49.595  37.553  23.756 1.00 43.59 ? 809  LEU C CA  1 
ATOM   6949  C  C   . LEU C 1 156 ? 48.390  38.492  23.831 1.00 43.92 ? 809  LEU C C   1 
ATOM   6950  O  O   . LEU C 1 156 ? 47.244  38.069  23.712 1.00 44.82 ? 809  LEU C O   1 
ATOM   6951  C  CB  . LEU C 1 156 ? 50.020  37.200  25.177 1.00 41.72 ? 809  LEU C CB  1 
ATOM   6952  C  CG  . LEU C 1 156 ? 48.951  36.489  26.020 1.00 43.81 ? 809  LEU C CG  1 
ATOM   6953  C  CD1 . LEU C 1 156 ? 48.729  35.096  25.461 1.00 41.62 ? 809  LEU C CD1 1 
ATOM   6954  C  CD2 . LEU C 1 156 ? 49.371  36.420  27.491 1.00 44.00 ? 809  LEU C CD2 1 
ATOM   6955  N  N   . GLU C 1 157 ? 48.670  39.761  24.070 1.00 44.30 ? 810  GLU C N   1 
ATOM   6956  C  CA  . GLU C 1 157 ? 47.651  40.784  24.200 1.00 44.96 ? 810  GLU C CA  1 
ATOM   6957  C  C   . GLU C 1 157 ? 47.028  41.120  22.856 1.00 45.47 ? 810  GLU C C   1 
ATOM   6958  O  O   . GLU C 1 157 ? 45.842  41.390  22.785 1.00 46.45 ? 810  GLU C O   1 
ATOM   6959  C  CB  . GLU C 1 157 ? 48.275  42.019  24.845 1.00 44.11 ? 810  GLU C CB  1 
ATOM   6960  C  CG  . GLU C 1 157 ? 48.701  41.730  26.262 1.00 45.10 ? 810  GLU C CG  1 
ATOM   6961  C  CD  . GLU C 1 157 ? 49.583  42.802  26.848 1.00 45.80 ? 810  GLU C CD  1 
ATOM   6962  O  OE1 . GLU C 1 157 ? 49.721  43.867  26.230 1.00 47.12 ? 810  GLU C OE1 1 
ATOM   6963  O  OE2 . GLU C 1 157 ? 50.127  42.576  27.942 1.00 47.88 ? 810  GLU C OE2 1 
ATOM   6964  N  N   . LEU C 1 158 ? 47.836  41.100  21.799 1.00 44.52 ? 811  LEU C N   1 
ATOM   6965  C  CA  . LEU C 1 158 ? 47.333  41.367  20.470 1.00 44.74 ? 811  LEU C CA  1 
ATOM   6966  C  C   . LEU C 1 158 ? 46.503  40.188  19.975 1.00 45.78 ? 811  LEU C C   1 
ATOM   6967  O  O   . LEU C 1 158 ? 45.481  40.374  19.311 1.00 47.65 ? 811  LEU C O   1 
ATOM   6968  C  CB  . LEU C 1 158 ? 48.477  41.645  19.504 1.00 43.73 ? 811  LEU C CB  1 
ATOM   6969  C  CG  . LEU C 1 158 ? 49.048  43.053  19.669 1.00 44.66 ? 811  LEU C CG  1 
ATOM   6970  C  CD1 . LEU C 1 158 ? 49.947  43.395  18.481 1.00 41.16 ? 811  LEU C CD1 1 
ATOM   6971  C  CD2 . LEU C 1 158 ? 47.881  44.060  19.767 1.00 43.41 ? 811  LEU C CD2 1 
ATOM   6972  N  N   . MET C 1 159 ? 46.934  38.977  20.306 1.00 44.36 ? 812  MET C N   1 
ATOM   6973  C  CA  . MET C 1 159 ? 46.204  37.788  19.917 1.00 43.18 ? 812  MET C CA  1 
ATOM   6974  C  C   . MET C 1 159 ? 44.847  37.789  20.628 1.00 42.86 ? 812  MET C C   1 
ATOM   6975  O  O   . MET C 1 159 ? 43.842  37.333  20.066 1.00 41.74 ? 812  MET C O   1 
ATOM   6976  C  CB  . MET C 1 159 ? 46.984  36.523  20.286 1.00 43.66 ? 812  MET C CB  1 
ATOM   6977  C  CG  . MET C 1 159 ? 46.217  35.251  19.946 1.00 44.29 ? 812  MET C CG  1 
ATOM   6978  S  SD  . MET C 1 159 ? 47.203  33.741  19.961 1.00 45.08 ? 812  MET C SD  1 
ATOM   6979  C  CE  . MET C 1 159 ? 47.366  33.455  21.799 1.00 44.63 ? 812  MET C CE  1 
ATOM   6980  N  N   . ALA C 1 160 ? 44.819  38.319  21.851 1.00 41.18 ? 813  ALA C N   1 
ATOM   6981  C  CA  . ALA C 1 160 ? 43.578  38.395  22.619 1.00 41.48 ? 813  ALA C CA  1 
ATOM   6982  C  C   . ALA C 1 160 ? 42.600  39.394  21.946 1.00 41.97 ? 813  ALA C C   1 
ATOM   6983  O  O   . ALA C 1 160 ? 41.389  39.181  21.930 1.00 41.24 ? 813  ALA C O   1 
ATOM   6984  C  CB  . ALA C 1 160 ? 43.874  38.825  24.043 1.00 37.29 ? 813  ALA C CB  1 
ATOM   6985  N  N   . LEU C 1 161 ? 43.160  40.464  21.385 1.00 41.92 ? 814  LEU C N   1 
ATOM   6986  C  CA  . LEU C 1 161 ? 42.399  41.512  20.694 1.00 42.16 ? 814  LEU C CA  1 
ATOM   6987  C  C   . LEU C 1 161 ? 41.726  40.952  19.432 1.00 40.41 ? 814  LEU C C   1 
ATOM   6988  O  O   . LEU C 1 161 ? 40.554  41.157  19.215 1.00 41.06 ? 814  LEU C O   1 
ATOM   6989  C  CB  . LEU C 1 161 ? 43.343  42.669  20.305 1.00 41.01 ? 814  LEU C CB  1 
ATOM   6990  C  CG  . LEU C 1 161 ? 42.753  43.959  19.739 1.00 38.40 ? 814  LEU C CG  1 
ATOM   6991  C  CD1 . LEU C 1 161 ? 41.936  44.627  20.820 1.00 40.48 ? 814  LEU C CD1 1 
ATOM   6992  C  CD2 . LEU C 1 161 ? 43.857  44.900  19.290 1.00 37.88 ? 814  LEU C CD2 1 
ATOM   6993  N  N   . TYR C 1 162 ? 42.496  40.252  18.608 1.00 39.78 ? 815  TYR C N   1 
ATOM   6994  C  CA  . TYR C 1 162 ? 41.986  39.650  17.391 1.00 38.88 ? 815  TYR C CA  1 
ATOM   6995  C  C   . TYR C 1 162 ? 40.869  38.676  17.728 1.00 39.29 ? 815  TYR C C   1 
ATOM   6996  O  O   . TYR C 1 162 ? 39.737  38.839  17.280 1.00 40.00 ? 815  TYR C O   1 
ATOM   6997  C  CB  . TYR C 1 162 ? 43.118  38.924  16.663 1.00 37.26 ? 815  TYR C CB  1 
ATOM   6998  C  CG  . TYR C 1 162 ? 44.244  39.854  16.285 1.00 36.09 ? 815  TYR C CG  1 
ATOM   6999  C  CD1 . TYR C 1 162 ? 45.478  39.357  15.866 1.00 36.47 ? 815  TYR C CD1 1 
ATOM   7000  C  CD2 . TYR C 1 162 ? 44.081  41.240  16.358 1.00 35.68 ? 815  TYR C CD2 1 
ATOM   7001  C  CE1 . TYR C 1 162 ? 46.527  40.220  15.533 1.00 36.49 ? 815  TYR C CE1 1 
ATOM   7002  C  CE2 . TYR C 1 162 ? 45.118  42.114  16.027 1.00 37.09 ? 815  TYR C CE2 1 
ATOM   7003  C  CZ  . TYR C 1 162 ? 46.343  41.592  15.612 1.00 38.80 ? 815  TYR C CZ  1 
ATOM   7004  O  OH  . TYR C 1 162 ? 47.371  42.441  15.262 1.00 39.81 ? 815  TYR C OH  1 
ATOM   7005  N  N   . VAL C 1 163 ? 41.195  37.670  18.531 1.00 38.88 ? 816  VAL C N   1 
ATOM   7006  C  CA  . VAL C 1 163 ? 40.225  36.669  18.959 1.00 38.14 ? 816  VAL C CA  1 
ATOM   7007  C  C   . VAL C 1 163 ? 38.920  37.301  19.500 1.00 37.99 ? 816  VAL C C   1 
ATOM   7008  O  O   . VAL C 1 163 ? 37.829  36.773  19.279 1.00 35.89 ? 816  VAL C O   1 
ATOM   7009  C  CB  . VAL C 1 163 ? 40.849  35.759  20.042 1.00 36.89 ? 816  VAL C CB  1 
ATOM   7010  C  CG1 . VAL C 1 163 ? 39.816  34.804  20.592 1.00 38.60 ? 816  VAL C CG1 1 
ATOM   7011  C  CG2 . VAL C 1 163 ? 41.965  34.964  19.446 1.00 37.11 ? 816  VAL C CG2 1 
ATOM   7012  N  N   . ALA C 1 164 ? 39.045  38.430  20.198 1.00 37.07 ? 817  ALA C N   1 
ATOM   7013  C  CA  . ALA C 1 164 ? 37.877  39.113  20.754 1.00 37.73 ? 817  ALA C CA  1 
ATOM   7014  C  C   . ALA C 1 164 ? 37.053  39.645  19.579 1.00 38.62 ? 817  ALA C C   1 
ATOM   7015  O  O   . ALA C 1 164 ? 35.836  39.478  19.540 1.00 37.45 ? 817  ALA C O   1 
ATOM   7016  C  CB  . ALA C 1 164 ? 38.315  40.267  21.700 1.00 34.58 ? 817  ALA C CB  1 
ATOM   7017  N  N   . ALA C 1 165 ? 37.738  40.254  18.609 1.00 39.00 ? 818  ALA C N   1 
ATOM   7018  C  CA  . ALA C 1 165 ? 37.063  40.775  17.435 1.00 38.93 ? 818  ALA C CA  1 
ATOM   7019  C  C   . ALA C 1 165 ? 36.271  39.620  16.842 1.00 40.22 ? 818  ALA C C   1 
ATOM   7020  O  O   . ALA C 1 165 ? 35.089  39.738  16.551 1.00 41.40 ? 818  ALA C O   1 
ATOM   7021  C  CB  . ALA C 1 165 ? 38.061  41.296  16.442 1.00 34.44 ? 818  ALA C CB  1 
ATOM   7022  N  N   . ALA C 1 166 ? 36.918  38.477  16.708 1.00 41.97 ? 819  ALA C N   1 
ATOM   7023  C  CA  . ALA C 1 166 ? 36.246  37.329  16.145 1.00 42.77 ? 819  ALA C CA  1 
ATOM   7024  C  C   . ALA C 1 166 ? 34.979  36.912  16.909 1.00 43.82 ? 819  ALA C C   1 
ATOM   7025  O  O   . ALA C 1 166 ? 34.020  36.450  16.290 1.00 44.41 ? 819  ALA C O   1 
ATOM   7026  C  CB  . ALA C 1 166 ? 37.220  36.165  16.058 1.00 42.30 ? 819  ALA C CB  1 
ATOM   7027  N  N   . MET C 1 167 ? 34.939  37.078  18.234 1.00 43.18 ? 820  MET C N   1 
ATOM   7028  C  CA  . MET C 1 167 ? 33.752  36.638  18.969 1.00 42.84 ? 820  MET C CA  1 
ATOM   7029  C  C   . MET C 1 167 ? 32.865  37.703  19.574 1.00 41.47 ? 820  MET C C   1 
ATOM   7030  O  O   . MET C 1 167 ? 31.860  37.374  20.181 1.00 40.32 ? 820  MET C O   1 
ATOM   7031  C  CB  . MET C 1 167 ? 34.126  35.633  20.097 1.00 45.67 ? 820  MET C CB  1 
ATOM   7032  C  CG  . MET C 1 167 ? 35.566  35.674  20.619 1.00 47.27 ? 820  MET C CG  1 
ATOM   7033  S  SD  . MET C 1 167 ? 35.929  34.759  22.223 1.00 48.50 ? 820  MET C SD  1 
ATOM   7034  C  CE  . MET C 1 167 ? 36.382  33.171  21.702 1.00 46.89 ? 820  MET C CE  1 
ATOM   7035  N  N   . HIS C 1 168 ? 33.199  38.969  19.376 1.00 40.64 ? 821  HIS C N   1 
ATOM   7036  C  CA  . HIS C 1 168 ? 32.445  40.036  20.002 1.00 40.46 ? 821  HIS C CA  1 
ATOM   7037  C  C   . HIS C 1 168 ? 30.934  40.230  19.735 1.00 40.14 ? 821  HIS C C   1 
ATOM   7038  O  O   . HIS C 1 168 ? 30.283  40.915  20.507 1.00 40.80 ? 821  HIS C O   1 
ATOM   7039  C  CB  . HIS C 1 168 ? 33.188  41.357  19.814 1.00 41.14 ? 821  HIS C CB  1 
ATOM   7040  C  CG  . HIS C 1 168 ? 32.961  41.996  18.482 1.00 44.08 ? 821  HIS C CG  1 
ATOM   7041  N  ND1 . HIS C 1 168 ? 33.371  41.417  17.303 1.00 42.90 ? 821  HIS C ND1 1 
ATOM   7042  C  CD2 . HIS C 1 168 ? 32.370  43.167  18.145 1.00 42.23 ? 821  HIS C CD2 1 
ATOM   7043  C  CE1 . HIS C 1 168 ? 33.044  42.205  16.295 1.00 44.35 ? 821  HIS C CE1 1 
ATOM   7044  N  NE2 . HIS C 1 168 ? 32.435  43.273  16.778 1.00 44.23 ? 821  HIS C NE2 1 
ATOM   7045  N  N   . ASP C 1 169 ? 30.361  39.681  18.669 1.00 39.81 ? 822  ASP C N   1 
ATOM   7046  C  CA  . ASP C 1 169 ? 28.905  39.815  18.488 1.00 39.84 ? 822  ASP C CA  1 
ATOM   7047  C  C   . ASP C 1 169 ? 28.281  38.434  18.277 1.00 41.15 ? 822  ASP C C   1 
ATOM   7048  O  O   . ASP C 1 169 ? 27.146  38.313  17.809 1.00 41.40 ? 822  ASP C O   1 
ATOM   7049  C  CB  . ASP C 1 169 ? 28.534  40.757  17.316 1.00 37.32 ? 822  ASP C CB  1 
ATOM   7050  C  CG  . ASP C 1 169 ? 28.721  42.248  17.668 1.00 36.83 ? 822  ASP C CG  1 
ATOM   7051  O  OD1 . ASP C 1 169 ? 28.266  42.688  18.751 1.00 37.19 ? 822  ASP C OD1 1 
ATOM   7052  O  OD2 . ASP C 1 169 ? 29.313  42.996  16.855 1.00 36.51 ? 822  ASP C OD2 1 
ATOM   7053  N  N   . TYR C 1 170 ? 29.041  37.397  18.617 1.00 40.37 ? 823  TYR C N   1 
ATOM   7054  C  CA  . TYR C 1 170 ? 28.585  36.019  18.500 1.00 42.04 ? 823  TYR C CA  1 
ATOM   7055  C  C   . TYR C 1 170 ? 27.135  35.894  18.964 1.00 43.06 ? 823  TYR C C   1 
ATOM   7056  O  O   . TYR C 1 170 ? 26.770  36.388  20.036 1.00 42.83 ? 823  TYR C O   1 
ATOM   7057  C  CB  . TYR C 1 170 ? 29.445  35.104  19.379 1.00 41.59 ? 823  TYR C CB  1 
ATOM   7058  C  CG  . TYR C 1 170 ? 29.068  33.641  19.283 1.00 39.24 ? 823  TYR C CG  1 
ATOM   7059  C  CD1 . TYR C 1 170 ? 29.419  32.896  18.163 1.00 40.23 ? 823  TYR C CD1 1 
ATOM   7060  C  CD2 . TYR C 1 170 ? 28.370  33.004  20.307 1.00 39.11 ? 823  TYR C CD2 1 
ATOM   7061  C  CE1 . TYR C 1 170 ? 29.092  31.546  18.055 1.00 41.09 ? 823  TYR C CE1 1 
ATOM   7062  C  CE2 . TYR C 1 170 ? 28.029  31.641  20.210 1.00 40.87 ? 823  TYR C CE2 1 
ATOM   7063  C  CZ  . TYR C 1 170 ? 28.396  30.923  19.080 1.00 41.65 ? 823  TYR C CZ  1 
ATOM   7064  O  OH  . TYR C 1 170 ? 28.064  29.598  18.942 1.00 44.10 ? 823  TYR C OH  1 
ATOM   7065  N  N   . ASP C 1 171 ? 26.319  35.214  18.169 1.00 44.39 ? 824  ASP C N   1 
ATOM   7066  C  CA  . ASP C 1 171 ? 24.908  35.027  18.488 1.00 45.60 ? 824  ASP C CA  1 
ATOM   7067  C  C   . ASP C 1 171 ? 24.148  36.331  18.822 1.00 45.49 ? 824  ASP C C   1 
ATOM   7068  O  O   . ASP C 1 171 ? 23.439  36.413  19.823 1.00 46.12 ? 824  ASP C O   1 
ATOM   7069  C  CB  . ASP C 1 171 ? 24.775  34.020  19.633 1.00 44.66 ? 824  ASP C CB  1 
ATOM   7070  C  CG  . ASP C 1 171 ? 23.336  33.606  19.873 1.00 46.36 ? 824  ASP C CG  1 
ATOM   7071  O  OD1 . ASP C 1 171 ? 22.667  33.202  18.891 1.00 46.58 ? 824  ASP C OD1 1 
ATOM   7072  O  OD2 . ASP C 1 171 ? 22.874  33.683  21.037 1.00 45.33 ? 824  ASP C OD2 1 
ATOM   7073  N  N   . HIS C 1 172 ? 24.302  37.353  17.988 1.00 46.48 ? 825  HIS C N   1 
ATOM   7074  C  CA  . HIS C 1 172 ? 23.612  38.636  18.213 1.00 47.76 ? 825  HIS C CA  1 
ATOM   7075  C  C   . HIS C 1 172 ? 22.162  38.466  17.730 1.00 48.30 ? 825  HIS C C   1 
ATOM   7076  O  O   . HIS C 1 172 ? 21.915  37.834  16.709 1.00 48.05 ? 825  HIS C O   1 
ATOM   7077  C  CB  . HIS C 1 172 ? 24.328  39.759  17.428 1.00 46.27 ? 825  HIS C CB  1 
ATOM   7078  C  CG  . HIS C 1 172 ? 23.998  41.155  17.883 1.00 46.26 ? 825  HIS C CG  1 
ATOM   7079  N  ND1 . HIS C 1 172 ? 22.772  41.751  17.660 1.00 46.00 ? 825  HIS C ND1 1 
ATOM   7080  C  CD2 . HIS C 1 172 ? 24.757  42.091  18.505 1.00 47.14 ? 825  HIS C CD2 1 
ATOM   7081  C  CE1 . HIS C 1 172 ? 22.792  42.990  18.124 1.00 46.61 ? 825  HIS C CE1 1 
ATOM   7082  N  NE2 . HIS C 1 172 ? 23.984  43.223  18.642 1.00 47.51 ? 825  HIS C NE2 1 
ATOM   7083  N  N   . PRO C 1 173 ? 21.181  38.988  18.480 1.00 49.10 ? 826  PRO C N   1 
ATOM   7084  C  CA  . PRO C 1 173 ? 19.773  38.860  18.074 1.00 50.77 ? 826  PRO C CA  1 
ATOM   7085  C  C   . PRO C 1 173 ? 19.314  39.943  17.068 1.00 52.02 ? 826  PRO C C   1 
ATOM   7086  O  O   . PRO C 1 173 ? 18.290  39.791  16.396 1.00 52.70 ? 826  PRO C O   1 
ATOM   7087  C  CB  . PRO C 1 173 ? 19.029  38.953  19.402 1.00 48.97 ? 826  PRO C CB  1 
ATOM   7088  C  CG  . PRO C 1 173 ? 19.819  39.972  20.119 1.00 49.86 ? 826  PRO C CG  1 
ATOM   7089  C  CD  . PRO C 1 173 ? 21.276  39.564  19.831 1.00 50.19 ? 826  PRO C CD  1 
ATOM   7090  N  N   . GLY C 1 174 ? 20.086  41.021  16.966 1.00 52.75 ? 827  GLY C N   1 
ATOM   7091  C  CA  . GLY C 1 174 ? 19.746  42.099  16.064 1.00 52.61 ? 827  GLY C CA  1 
ATOM   7092  C  C   . GLY C 1 174 ? 18.930  43.144  16.799 1.00 53.39 ? 827  GLY C C   1 
ATOM   7093  O  O   . GLY C 1 174 ? 18.288  44.018  16.188 1.00 54.94 ? 827  GLY C O   1 
ATOM   7094  N  N   . ARG C 1 175 ? 18.932  43.060  18.123 1.00 52.03 ? 828  ARG C N   1 
ATOM   7095  C  CA  . ARG C 1 175 ? 18.184  44.015  18.925 1.00 50.92 ? 828  ARG C CA  1 
ATOM   7096  C  C   . ARG C 1 175 ? 19.157  44.738  19.842 1.00 50.05 ? 828  ARG C C   1 
ATOM   7097  O  O   . ARG C 1 175 ? 20.287  44.282  19.993 1.00 51.24 ? 828  ARG C O   1 
ATOM   7098  C  CB  . ARG C 1 175 ? 17.117  43.281  19.735 1.00 51.08 ? 828  ARG C CB  1 
ATOM   7099  C  CG  . ARG C 1 175 ? 15.763  43.939  19.628 1.00 53.49 ? 828  ARG C CG  1 
ATOM   7100  C  CD  . ARG C 1 175 ? 14.794  43.231  18.660 1.00 53.19 ? 828  ARG C CD  1 
ATOM   7101  N  NE  . ARG C 1 175 ? 15.313  43.101  17.312 1.00 51.11 ? 828  ARG C NE  1 
ATOM   7102  C  CZ  . ARG C 1 175 ? 14.699  42.424  16.353 1.00 50.73 ? 828  ARG C CZ  1 
ATOM   7103  N  NH1 . ARG C 1 175 ? 13.545  41.832  16.599 1.00 47.98 ? 828  ARG C NH1 1 
ATOM   7104  N  NH2 . ARG C 1 175 ? 15.264  42.300  15.162 1.00 51.23 ? 828  ARG C NH2 1 
ATOM   7105  N  N   . THR C 1 176 ? 18.763  45.867  20.427 1.00 48.27 ? 829  THR C N   1 
ATOM   7106  C  CA  . THR C 1 176 ? 19.686  46.542  21.327 1.00 49.44 ? 829  THR C CA  1 
ATOM   7107  C  C   . THR C 1 176 ? 19.471  46.128  22.776 1.00 49.18 ? 829  THR C C   1 
ATOM   7108  O  O   . THR C 1 176 ? 18.504  45.424  23.109 1.00 49.83 ? 829  THR C O   1 
ATOM   7109  C  CB  . THR C 1 176 ? 19.578  48.056  21.290 1.00 48.69 ? 829  THR C CB  1 
ATOM   7110  O  OG1 . THR C 1 176 ? 18.354  48.461  21.897 1.00 50.20 ? 829  THR C OG1 1 
ATOM   7111  C  CG2 . THR C 1 176 ? 19.643  48.543  19.885 1.00 50.02 ? 829  THR C CG2 1 
ATOM   7112  N  N   . ASN C 1 177 ? 20.381  46.568  23.640 1.00 47.75 ? 830  ASN C N   1 
ATOM   7113  C  CA  . ASN C 1 177 ? 20.275  46.246  25.052 1.00 46.81 ? 830  ASN C CA  1 
ATOM   7114  C  C   . ASN C 1 177 ? 18.976  46.850  25.610 1.00 47.89 ? 830  ASN C C   1 
ATOM   7115  O  O   . ASN C 1 177 ? 18.221  46.174  26.325 1.00 48.49 ? 830  ASN C O   1 
ATOM   7116  C  CB  . ASN C 1 177 ? 21.478  46.794  25.821 1.00 44.01 ? 830  ASN C CB  1 
ATOM   7117  C  CG  . ASN C 1 177 ? 22.730  45.933  25.661 1.00 43.35 ? 830  ASN C CG  1 
ATOM   7118  O  OD1 . ASN C 1 177 ? 22.652  44.699  25.488 1.00 39.32 ? 830  ASN C OD1 1 
ATOM   7119  N  ND2 . ASN C 1 177 ? 23.901  46.584  25.741 1.00 38.69 ? 830  ASN C ND2 1 
ATOM   7120  N  N   . ALA C 1 178 ? 18.713  48.113  25.264 1.00 46.98 ? 831  ALA C N   1 
ATOM   7121  C  CA  . ALA C 1 178 ? 17.510  48.798  25.735 1.00 45.91 ? 831  ALA C CA  1 
ATOM   7122  C  C   . ALA C 1 178 ? 16.295  47.977  25.396 1.00 46.02 ? 831  ALA C C   1 
ATOM   7123  O  O   . ALA C 1 178 ? 15.381  47.824  26.206 1.00 45.82 ? 831  ALA C O   1 
ATOM   7124  C  CB  . ALA C 1 178 ? 17.400  50.159  25.101 1.00 45.36 ? 831  ALA C CB  1 
ATOM   7125  N  N   . PHE C 1 179 ? 16.290  47.421  24.198 1.00 46.67 ? 832  PHE C N   1 
ATOM   7126  C  CA  . PHE C 1 179 ? 15.158  46.631  23.812 1.00 48.05 ? 832  PHE C CA  1 
ATOM   7127  C  C   . PHE C 1 179 ? 15.034  45.548  24.849 1.00 48.97 ? 832  PHE C C   1 
ATOM   7128  O  O   . PHE C 1 179 ? 14.165  45.618  25.710 1.00 50.26 ? 832  PHE C O   1 
ATOM   7129  C  CB  . PHE C 1 179 ? 15.363  46.016  22.448 1.00 47.83 ? 832  PHE C CB  1 
ATOM   7130  C  CG  . PHE C 1 179 ? 14.192  45.231  21.973 1.00 49.27 ? 832  PHE C CG  1 
ATOM   7131  C  CD1 . PHE C 1 179 ? 13.094  45.868  21.405 1.00 50.99 ? 832  PHE C CD1 1 
ATOM   7132  C  CD2 . PHE C 1 179 ? 14.181  43.849  22.077 1.00 51.09 ? 832  PHE C CD2 1 
ATOM   7133  C  CE1 . PHE C 1 179 ? 12.004  45.129  20.925 1.00 51.44 ? 832  PHE C CE1 1 
ATOM   7134  C  CE2 . PHE C 1 179 ? 13.094  43.095  21.601 1.00 52.24 ? 832  PHE C CE2 1 
ATOM   7135  C  CZ  . PHE C 1 179 ? 12.004  43.743  21.027 1.00 51.53 ? 832  PHE C CZ  1 
ATOM   7136  N  N   . LEU C 1 180 ? 15.936  44.565  24.784 1.00 50.32 ? 833  LEU C N   1 
ATOM   7137  C  CA  . LEU C 1 180 ? 15.960  43.437  25.714 1.00 48.01 ? 833  LEU C CA  1 
ATOM   7138  C  C   . LEU C 1 180 ? 15.591  43.830  27.149 1.00 48.68 ? 833  LEU C C   1 
ATOM   7139  O  O   . LEU C 1 180 ? 14.802  43.132  27.792 1.00 49.13 ? 833  LEU C O   1 
ATOM   7140  C  CB  . LEU C 1 180 ? 17.333  42.780  25.661 1.00 47.42 ? 833  LEU C CB  1 
ATOM   7141  C  CG  . LEU C 1 180 ? 17.684  42.174  24.290 1.00 46.74 ? 833  LEU C CG  1 
ATOM   7142  C  CD1 . LEU C 1 180 ? 19.180  41.830  24.256 1.00 43.92 ? 833  LEU C CD1 1 
ATOM   7143  C  CD2 . LEU C 1 180 ? 16.831  40.948  24.015 1.00 43.60 ? 833  LEU C CD2 1 
ATOM   7144  N  N   . VAL C 1 181 ? 16.137  44.946  27.631 1.00 48.19 ? 834  VAL C N   1 
ATOM   7145  C  CA  . VAL C 1 181 ? 15.852  45.456  28.977 1.00 49.76 ? 834  VAL C CA  1 
ATOM   7146  C  C   . VAL C 1 181 ? 14.370  45.854  29.127 1.00 52.72 ? 834  VAL C C   1 
ATOM   7147  O  O   . VAL C 1 181 ? 13.760  45.683  30.196 1.00 53.29 ? 834  VAL C O   1 
ATOM   7148  C  CB  . VAL C 1 181 ? 16.709  46.727  29.293 1.00 48.99 ? 834  VAL C CB  1 
ATOM   7149  C  CG1 . VAL C 1 181 ? 16.225  47.417  30.558 1.00 48.46 ? 834  VAL C CG1 1 
ATOM   7150  C  CG2 . VAL C 1 181 ? 18.135  46.348  29.455 1.00 49.98 ? 834  VAL C CG2 1 
ATOM   7151  N  N   . ALA C 1 182 ? 13.805  46.407  28.055 1.00 53.47 ? 835  ALA C N   1 
ATOM   7152  C  CA  . ALA C 1 182 ? 12.418  46.846  28.060 1.00 55.18 ? 835  ALA C CA  1 
ATOM   7153  C  C   . ALA C 1 182 ? 11.425  45.705  27.905 1.00 55.63 ? 835  ALA C C   1 
ATOM   7154  O  O   . ALA C 1 182 ? 10.373  45.715  28.537 1.00 56.65 ? 835  ALA C O   1 
ATOM   7155  C  CB  . ALA C 1 182 ? 12.192  47.872  26.953 1.00 55.83 ? 835  ALA C CB  1 
ATOM   7156  N  N   . THR C 1 183 ? 11.733  44.732  27.061 1.00 56.00 ? 836  THR C N   1 
ATOM   7157  C  CA  . THR C 1 183 ? 10.812  43.622  26.887 1.00 57.71 ? 836  THR C CA  1 
ATOM   7158  C  C   . THR C 1 183 ? 11.076  42.566  27.967 1.00 58.25 ? 836  THR C C   1 
ATOM   7159  O  O   . THR C 1 183 ? 10.589  41.426  27.882 1.00 57.70 ? 836  THR C O   1 
ATOM   7160  C  CB  . THR C 1 183 ? 10.984  42.985  25.491 1.00 58.04 ? 836  THR C CB  1 
ATOM   7161  O  OG1 . THR C 1 183 ? 12.281  42.371  25.380 1.00 56.83 ? 836  THR C OG1 1 
ATOM   7162  C  CG2 . THR C 1 183 ? 10.835  44.058  24.412 1.00 59.31 ? 836  THR C CG2 1 
ATOM   7163  N  N   . ASN C 1 184 ? 11.846  42.964  28.986 1.00 58.85 ? 837  ASN C N   1 
ATOM   7164  C  CA  . ASN C 1 184 ? 12.242  42.067  30.080 1.00 59.04 ? 837  ASN C CA  1 
ATOM   7165  C  C   . ASN C 1 184 ? 12.642  40.709  29.506 1.00 57.28 ? 837  ASN C C   1 
ATOM   7166  O  O   . ASN C 1 184 ? 12.175  39.664  29.950 1.00 57.31 ? 837  ASN C O   1 
ATOM   7167  C  CB  . ASN C 1 184 ? 11.108  41.891  31.110 1.00 60.94 ? 837  ASN C CB  1 
ATOM   7168  C  CG  . ASN C 1 184 ? 10.739  43.208  31.814 1.00 62.55 ? 837  ASN C CG  1 
ATOM   7169  O  OD1 . ASN C 1 184 ? 11.609  43.961  32.274 1.00 63.03 ? 837  ASN C OD1 1 
ATOM   7170  N  ND2 . ASN C 1 184 ? 9.446   43.482  31.899 1.00 62.21 ? 837  ASN C ND2 1 
ATOM   7171  N  N   . ALA C 1 185 ? 13.484  40.736  28.483 1.00 54.95 ? 838  ALA C N   1 
ATOM   7172  C  CA  . ALA C 1 185 ? 13.947  39.500  27.886 1.00 54.39 ? 838  ALA C CA  1 
ATOM   7173  C  C   . ALA C 1 185 ? 14.724  38.737  28.969 1.00 53.91 ? 838  ALA C C   1 
ATOM   7174  O  O   . ALA C 1 185 ? 15.446  39.339  29.775 1.00 52.36 ? 838  ALA C O   1 
ATOM   7175  C  CB  . ALA C 1 185 ? 14.844  39.803  26.706 1.00 54.11 ? 838  ALA C CB  1 
ATOM   7176  N  N   . PRO C 1 186 ? 14.583  37.404  28.999 1.00 53.20 ? 839  PRO C N   1 
ATOM   7177  C  CA  . PRO C 1 186 ? 15.285  36.602  30.002 1.00 52.61 ? 839  PRO C CA  1 
ATOM   7178  C  C   . PRO C 1 186 ? 16.756  36.960  30.131 1.00 53.07 ? 839  PRO C C   1 
ATOM   7179  O  O   . PRO C 1 186 ? 17.256  37.175  31.243 1.00 53.70 ? 839  PRO C O   1 
ATOM   7180  C  CB  . PRO C 1 186 ? 15.065  35.169  29.525 1.00 52.46 ? 839  PRO C CB  1 
ATOM   7181  C  CG  . PRO C 1 186 ? 14.749  35.313  28.050 1.00 53.58 ? 839  PRO C CG  1 
ATOM   7182  C  CD  . PRO C 1 186 ? 13.900  36.548  28.016 1.00 53.17 ? 839  PRO C CD  1 
ATOM   7183  N  N   . GLN C 1 187 ? 17.451  37.031  29.001 1.00 51.92 ? 840  GLN C N   1 
ATOM   7184  C  CA  . GLN C 1 187 ? 18.854  37.360  29.032 1.00 50.94 ? 840  GLN C CA  1 
ATOM   7185  C  C   . GLN C 1 187 ? 19.188  38.645  29.755 1.00 50.50 ? 840  GLN C C   1 
ATOM   7186  O  O   . GLN C 1 187 ? 20.319  38.815  30.204 1.00 50.05 ? 840  GLN C O   1 
ATOM   7187  C  CB  . GLN C 1 187 ? 19.429  37.400  27.629 1.00 52.47 ? 840  GLN C CB  1 
ATOM   7188  C  CG  . GLN C 1 187 ? 19.771  36.038  27.120 1.00 55.70 ? 840  GLN C CG  1 
ATOM   7189  C  CD  . GLN C 1 187 ? 20.539  36.107  25.831 1.00 59.89 ? 840  GLN C CD  1 
ATOM   7190  O  OE1 . GLN C 1 187 ? 21.578  36.779  25.749 1.00 61.56 ? 840  GLN C OE1 1 
ATOM   7191  N  NE2 . GLN C 1 187 ? 20.041  35.415  24.802 1.00 60.76 ? 840  GLN C NE2 1 
ATOM   7192  N  N   . ALA C 1 188 ? 18.239  39.567  29.878 1.00 50.22 ? 841  ALA C N   1 
ATOM   7193  C  CA  . ALA C 1 188 ? 18.547  40.817  30.605 1.00 50.02 ? 841  ALA C CA  1 
ATOM   7194  C  C   . ALA C 1 188 ? 18.354  40.626  32.130 1.00 48.75 ? 841  ALA C C   1 
ATOM   7195  O  O   . ALA C 1 188 ? 18.989  41.311  32.955 1.00 47.08 ? 841  ALA C O   1 
ATOM   7196  C  CB  . ALA C 1 188 ? 17.668  41.974  30.085 1.00 49.10 ? 841  ALA C CB  1 
ATOM   7197  N  N   . VAL C 1 189 ? 17.465  39.697  32.485 1.00 47.95 ? 842  VAL C N   1 
ATOM   7198  C  CA  . VAL C 1 189 ? 17.207  39.383  33.884 1.00 49.84 ? 842  VAL C CA  1 
ATOM   7199  C  C   . VAL C 1 189 ? 18.490  38.714  34.366 1.00 49.25 ? 842  VAL C C   1 
ATOM   7200  O  O   . VAL C 1 189 ? 19.037  39.061  35.412 1.00 48.39 ? 842  VAL C O   1 
ATOM   7201  C  CB  . VAL C 1 189 ? 16.039  38.374  34.049 1.00 51.46 ? 842  VAL C CB  1 
ATOM   7202  C  CG1 . VAL C 1 189 ? 15.734  38.173  35.541 1.00 50.28 ? 842  VAL C CG1 1 
ATOM   7203  C  CG2 . VAL C 1 189 ? 14.808  38.873  33.301 1.00 51.30 ? 842  VAL C CG2 1 
ATOM   7204  N  N   . LEU C 1 190 ? 18.955  37.764  33.555 1.00 48.86 ? 843  LEU C N   1 
ATOM   7205  C  CA  . LEU C 1 190 ? 20.177  37.024  33.821 1.00 48.48 ? 843  LEU C CA  1 
ATOM   7206  C  C   . LEU C 1 190 ? 21.358  37.928  34.128 1.00 47.95 ? 843  LEU C C   1 
ATOM   7207  O  O   . LEU C 1 190 ? 22.077  37.723  35.127 1.00 49.17 ? 843  LEU C O   1 
ATOM   7208  C  CB  . LEU C 1 190 ? 20.534  36.164  32.632 1.00 48.47 ? 843  LEU C CB  1 
ATOM   7209  C  CG  . LEU C 1 190 ? 21.730  35.256  32.865 1.00 49.71 ? 843  LEU C CG  1 
ATOM   7210  C  CD1 . LEU C 1 190 ? 21.421  34.284  34.008 1.00 50.53 ? 843  LEU C CD1 1 
ATOM   7211  C  CD2 . LEU C 1 190 ? 22.023  34.492  31.578 1.00 49.76 ? 843  LEU C CD2 1 
ATOM   7212  N  N   . TYR C 1 191 ? 21.551  38.934  33.285 1.00 44.23 ? 844  TYR C N   1 
ATOM   7213  C  CA  . TYR C 1 191 ? 22.659  39.849  33.447 1.00 42.53 ? 844  TYR C CA  1 
ATOM   7214  C  C   . TYR C 1 191 ? 22.318  41.119  34.171 1.00 43.00 ? 844  TYR C C   1 
ATOM   7215  O  O   . TYR C 1 191 ? 23.054  42.117  34.115 1.00 41.30 ? 844  TYR C O   1 
ATOM   7216  C  CB  . TYR C 1 191 ? 23.282  40.136  32.089 1.00 41.60 ? 844  TYR C CB  1 
ATOM   7217  C  CG  . TYR C 1 191 ? 23.999  38.917  31.538 1.00 42.05 ? 844  TYR C CG  1 
ATOM   7218  C  CD1 . TYR C 1 191 ? 23.509  38.234  30.423 1.00 41.97 ? 844  TYR C CD1 1 
ATOM   7219  C  CD2 . TYR C 1 191 ? 25.161  38.432  32.146 1.00 41.26 ? 844  TYR C CD2 1 
ATOM   7220  C  CE1 . TYR C 1 191 ? 24.156  37.102  29.924 1.00 42.27 ? 844  TYR C CE1 1 
ATOM   7221  C  CE2 . TYR C 1 191 ? 25.820  37.293  31.658 1.00 41.24 ? 844  TYR C CE2 1 
ATOM   7222  C  CZ  . TYR C 1 191 ? 25.322  36.635  30.549 1.00 42.43 ? 844  TYR C CZ  1 
ATOM   7223  O  OH  . TYR C 1 191 ? 25.973  35.530  30.040 1.00 41.29 ? 844  TYR C OH  1 
ATOM   7224  N  N   . ASN C 1 192 ? 21.187  41.075  34.861 1.00 44.57 ? 845  ASN C N   1 
ATOM   7225  C  CA  . ASN C 1 192 ? 20.747  42.222  35.648 1.00 45.85 ? 845  ASN C CA  1 
ATOM   7226  C  C   . ASN C 1 192 ? 20.815  43.561  34.906 1.00 44.63 ? 845  ASN C C   1 
ATOM   7227  O  O   . ASN C 1 192 ? 21.229  44.576  35.487 1.00 44.82 ? 845  ASN C O   1 
ATOM   7228  C  CB  . ASN C 1 192 ? 21.598  42.280  36.922 1.00 46.62 ? 845  ASN C CB  1 
ATOM   7229  C  CG  . ASN C 1 192 ? 21.595  40.963  37.673 1.00 46.55 ? 845  ASN C CG  1 
ATOM   7230  O  OD1 . ASN C 1 192 ? 20.556  40.511  38.138 1.00 47.69 ? 845  ASN C OD1 1 
ATOM   7231  N  ND2 . ASN C 1 192 ? 22.766  40.332  37.784 1.00 49.28 ? 845  ASN C ND2 1 
ATOM   7232  N  N   . ASP C 1 193 ? 20.401  43.553  33.639 1.00 44.25 ? 846  ASP C N   1 
ATOM   7233  C  CA  . ASP C 1 193 ? 20.398  44.752  32.782 1.00 45.96 ? 846  ASP C CA  1 
ATOM   7234  C  C   . ASP C 1 193 ? 21.778  45.356  32.533 1.00 46.77 ? 846  ASP C C   1 
ATOM   7235  O  O   . ASP C 1 193 ? 21.875  46.521  32.138 1.00 46.43 ? 846  ASP C O   1 
ATOM   7236  C  CB  . ASP C 1 193 ? 19.527  45.887  33.355 1.00 44.43 ? 846  ASP C CB  1 
ATOM   7237  C  CG  . ASP C 1 193 ? 18.126  45.439  33.751 1.00 45.90 ? 846  ASP C CG  1 
ATOM   7238  O  OD1 . ASP C 1 193 ? 17.533  44.548  33.081 1.00 43.19 ? 846  ASP C OD1 1 
ATOM   7239  O  OD2 . ASP C 1 193 ? 17.608  46.016  34.745 1.00 46.47 ? 846  ASP C OD2 1 
ATOM   7240  N  N   . ARG C 1 194 ? 22.838  44.593  32.789 1.00 47.20 ? 847  ARG C N   1 
ATOM   7241  C  CA  . ARG C 1 194 ? 24.201  45.090  32.575 1.00 46.41 ? 847  ARG C CA  1 
ATOM   7242  C  C   . ARG C 1 194 ? 24.807  44.466  31.316 1.00 44.83 ? 847  ARG C C   1 
ATOM   7243  O  O   . ARG C 1 194 ? 24.855  43.245  31.203 1.00 43.65 ? 847  ARG C O   1 
ATOM   7244  C  CB  . ARG C 1 194 ? 25.073  44.763  33.787 1.00 48.54 ? 847  ARG C CB  1 
ATOM   7245  C  CG  . ARG C 1 194 ? 24.921  45.716  34.945 1.00 50.27 ? 847  ARG C CG  1 
ATOM   7246  C  CD  . ARG C 1 194 ? 24.702  44.953  36.236 1.00 54.35 ? 847  ARG C CD  1 
ATOM   7247  N  NE  . ARG C 1 194 ? 25.091  45.723  37.415 1.00 57.11 ? 847  ARG C NE  1 
ATOM   7248  C  CZ  . ARG C 1 194 ? 26.342  45.852  37.853 1.00 58.72 ? 847  ARG C CZ  1 
ATOM   7249  N  NH1 . ARG C 1 194 ? 27.341  45.252  37.212 1.00 59.15 ? 847  ARG C NH1 1 
ATOM   7250  N  NH2 . ARG C 1 194 ? 26.595  46.597  38.928 1.00 59.06 ? 847  ARG C NH2 1 
ATOM   7251  N  N   . SER C 1 195 ? 25.269  45.318  30.393 1.00 43.57 ? 848  SER C N   1 
ATOM   7252  C  CA  . SER C 1 195 ? 25.853  44.907  29.114 1.00 42.35 ? 848  SER C CA  1 
ATOM   7253  C  C   . SER C 1 195 ? 25.290  43.573  28.709 1.00 42.97 ? 848  SER C C   1 
ATOM   7254  O  O   . SER C 1 195 ? 26.019  42.671  28.303 1.00 44.47 ? 848  SER C O   1 
ATOM   7255  C  CB  . SER C 1 195 ? 27.378  44.814  29.205 1.00 41.92 ? 848  SER C CB  1 
ATOM   7256  O  OG  . SER C 1 195 ? 27.956  46.088  29.488 1.00 40.95 ? 848  SER C OG  1 
ATOM   7257  N  N   . VAL C 1 196 ? 23.978  43.448  28.824 1.00 42.48 ? 849  VAL C N   1 
ATOM   7258  C  CA  . VAL C 1 196 ? 23.320  42.205  28.500 1.00 42.57 ? 849  VAL C CA  1 
ATOM   7259  C  C   . VAL C 1 196 ? 23.914  41.524  27.294 1.00 42.91 ? 849  VAL C C   1 
ATOM   7260  O  O   . VAL C 1 196 ? 24.282  40.368  27.360 1.00 45.57 ? 849  VAL C O   1 
ATOM   7261  C  CB  . VAL C 1 196 ? 21.814  42.419  28.241 1.00 43.05 ? 849  VAL C CB  1 
ATOM   7262  C  CG1 . VAL C 1 196 ? 21.131  41.075  27.941 1.00 40.64 ? 849  VAL C CG1 1 
ATOM   7263  C  CG2 . VAL C 1 196 ? 21.180  43.117  29.441 1.00 44.24 ? 849  VAL C CG2 1 
ATOM   7264  N  N   . LEU C 1 197 ? 24.017  42.230  26.179 1.00 44.17 ? 850  LEU C N   1 
ATOM   7265  C  CA  . LEU C 1 197 ? 24.525  41.613  24.952 1.00 43.56 ? 850  LEU C CA  1 
ATOM   7266  C  C   . LEU C 1 197 ? 25.996  41.200  24.969 1.00 42.29 ? 850  LEU C C   1 
ATOM   7267  O  O   . LEU C 1 197 ? 26.361  40.084  24.610 1.00 39.23 ? 850  LEU C O   1 
ATOM   7268  C  CB  . LEU C 1 197 ? 24.291  42.568  23.787 1.00 45.30 ? 850  LEU C CB  1 
ATOM   7269  C  CG  . LEU C 1 197 ? 22.894  42.530  23.170 1.00 46.36 ? 850  LEU C CG  1 
ATOM   7270  C  CD1 . LEU C 1 197 ? 22.836  43.520  21.998 1.00 45.49 ? 850  LEU C CD1 1 
ATOM   7271  C  CD2 . LEU C 1 197 ? 22.578  41.111  22.710 1.00 46.18 ? 850  LEU C CD2 1 
ATOM   7272  N  N   . GLU C 1 198 ? 26.829  42.145  25.364 1.00 42.87 ? 851  GLU C N   1 
ATOM   7273  C  CA  . GLU C 1 198 ? 28.238  41.909  25.407 1.00 44.22 ? 851  GLU C CA  1 
ATOM   7274  C  C   . GLU C 1 198 ? 28.550  40.714  26.332 1.00 44.85 ? 851  GLU C C   1 
ATOM   7275  O  O   . GLU C 1 198 ? 29.341  39.831  25.970 1.00 44.78 ? 851  GLU C O   1 
ATOM   7276  C  CB  . GLU C 1 198 ? 28.935  43.190  25.838 1.00 43.71 ? 851  GLU C CB  1 
ATOM   7277  C  CG  . GLU C 1 198 ? 28.867  44.336  24.802 1.00 45.14 ? 851  GLU C CG  1 
ATOM   7278  C  CD  . GLU C 1 198 ? 27.494  45.069  24.683 1.00 46.40 ? 851  GLU C CD  1 
ATOM   7279  O  OE1 . GLU C 1 198 ? 26.922  45.474  25.725 1.00 43.42 ? 851  GLU C OE1 1 
ATOM   7280  O  OE2 . GLU C 1 198 ? 27.014  45.261  23.532 1.00 44.70 ? 851  GLU C OE2 1 
ATOM   7281  N  N   . ASN C 1 199 ? 27.916  40.662  27.502 1.00 44.44 ? 852  ASN C N   1 
ATOM   7282  C  CA  . ASN C 1 199 ? 28.127  39.544  28.418 1.00 44.42 ? 852  ASN C CA  1 
ATOM   7283  C  C   . ASN C 1 199 ? 27.791  38.227  27.731 1.00 43.80 ? 852  ASN C C   1 
ATOM   7284  O  O   . ASN C 1 199 ? 28.512  37.237  27.898 1.00 44.71 ? 852  ASN C O   1 
ATOM   7285  C  CB  . ASN C 1 199 ? 27.297  39.705  29.708 1.00 45.71 ? 852  ASN C CB  1 
ATOM   7286  C  CG  . ASN C 1 199 ? 27.950  40.649  30.697 1.00 46.28 ? 852  ASN C CG  1 
ATOM   7287  O  OD1 . ASN C 1 199 ? 29.141  40.544  30.956 1.00 50.03 ? 852  ASN C OD1 1 
ATOM   7288  N  ND2 . ASN C 1 199 ? 27.183  41.574  31.249 1.00 46.75 ? 852  ASN C ND2 1 
ATOM   7289  N  N   . HIS C 1 200 ? 26.712  38.210  26.954 1.00 42.49 ? 853  HIS C N   1 
ATOM   7290  C  CA  . HIS C 1 200 ? 26.323  36.997  26.214 1.00 41.61 ? 853  HIS C CA  1 
ATOM   7291  C  C   . HIS C 1 200 ? 27.337  36.599  25.128 1.00 41.74 ? 853  HIS C C   1 
ATOM   7292  O  O   . HIS C 1 200 ? 27.569  35.407  24.871 1.00 41.61 ? 853  HIS C O   1 
ATOM   7293  C  CB  . HIS C 1 200 ? 24.974  37.195  25.526 1.00 39.96 ? 853  HIS C CB  1 
ATOM   7294  C  CG  . HIS C 1 200 ? 24.496  35.987  24.780 1.00 39.04 ? 853  HIS C CG  1 
ATOM   7295  N  ND1 . HIS C 1 200 ? 24.175  34.803  25.406 1.00 37.35 ? 853  HIS C ND1 1 
ATOM   7296  C  CD2 . HIS C 1 200 ? 24.286  35.782  23.459 1.00 39.38 ? 853  HIS C CD2 1 
ATOM   7297  C  CE1 . HIS C 1 200 ? 23.787  33.922  24.507 1.00 38.27 ? 853  HIS C CE1 1 
ATOM   7298  N  NE2 . HIS C 1 200 ? 23.845  34.490  23.315 1.00 39.03 ? 853  HIS C NE2 1 
ATOM   7299  N  N   . HIS C 1 201 ? 27.924  37.584  24.461 1.00 39.65 ? 854  HIS C N   1 
ATOM   7300  C  CA  . HIS C 1 201 ? 28.867  37.227  23.413 1.00 41.18 ? 854  HIS C CA  1 
ATOM   7301  C  C   . HIS C 1 201 ? 30.080  36.475  24.001 1.00 40.57 ? 854  HIS C C   1 
ATOM   7302  O  O   . HIS C 1 201 ? 30.421  35.391  23.536 1.00 38.32 ? 854  HIS C O   1 
ATOM   7303  C  CB  . HIS C 1 201 ? 29.298  38.482  22.630 1.00 39.71 ? 854  HIS C CB  1 
ATOM   7304  C  CG  . HIS C 1 201 ? 28.155  39.217  21.997 1.00 39.59 ? 854  HIS C CG  1 
ATOM   7305  N  ND1 . HIS C 1 201 ? 27.133  38.571  21.331 1.00 39.61 ? 854  HIS C ND1 1 
ATOM   7306  C  CD2 . HIS C 1 201 ? 27.882  40.541  21.914 1.00 38.42 ? 854  HIS C CD2 1 
ATOM   7307  C  CE1 . HIS C 1 201 ? 26.282  39.466  20.862 1.00 39.26 ? 854  HIS C CE1 1 
ATOM   7308  N  NE2 . HIS C 1 201 ? 26.713  40.669  21.201 1.00 39.37 ? 854  HIS C NE2 1 
ATOM   7309  N  N   . ALA C 1 202 ? 30.707  37.063  25.025 1.00 40.98 ? 855  ALA C N   1 
ATOM   7310  C  CA  . ALA C 1 202 ? 31.854  36.457  25.704 1.00 40.15 ? 855  ALA C CA  1 
ATOM   7311  C  C   . ALA C 1 202 ? 31.479  35.114  26.323 1.00 40.44 ? 855  ALA C C   1 
ATOM   7312  O  O   . ALA C 1 202 ? 32.080  34.089  26.015 1.00 40.30 ? 855  ALA C O   1 
ATOM   7313  C  CB  . ALA C 1 202 ? 32.361  37.376  26.776 1.00 38.70 ? 855  ALA C CB  1 
ATOM   7314  N  N   . ALA C 1 203 ? 30.473  35.128  27.190 1.00 39.80 ? 856  ALA C N   1 
ATOM   7315  C  CA  . ALA C 1 203 ? 30.025  33.924  27.852 1.00 39.34 ? 856  ALA C CA  1 
ATOM   7316  C  C   . ALA C 1 203 ? 29.799  32.804  26.860 1.00 40.30 ? 856  ALA C C   1 
ATOM   7317  O  O   . ALA C 1 203 ? 30.338  31.706  27.034 1.00 42.32 ? 856  ALA C O   1 
ATOM   7318  C  CB  . ALA C 1 203 ? 28.751  34.191  28.648 1.00 39.36 ? 856  ALA C CB  1 
ATOM   7319  N  N   . SER C 1 204 ? 29.023  33.057  25.813 1.00 40.62 ? 857  SER C N   1 
ATOM   7320  C  CA  . SER C 1 204 ? 28.731  32.022  24.808 1.00 40.66 ? 857  SER C CA  1 
ATOM   7321  C  C   . SER C 1 204 ? 29.925  31.538  23.980 1.00 41.07 ? 857  SER C C   1 
ATOM   7322  O  O   . SER C 1 204 ? 30.007  30.362  23.625 1.00 42.68 ? 857  SER C O   1 
ATOM   7323  C  CB  . SER C 1 204 ? 27.665  32.514  23.819 1.00 41.33 ? 857  SER C CB  1 
ATOM   7324  O  OG  . SER C 1 204 ? 26.519  32.990  24.469 1.00 43.84 ? 857  SER C OG  1 
ATOM   7325  N  N   . ALA C 1 205 ? 30.810  32.455  23.619 1.00 40.33 ? 858  ALA C N   1 
ATOM   7326  C  CA  . ALA C 1 205 ? 31.974  32.111  22.816 1.00 41.47 ? 858  ALA C CA  1 
ATOM   7327  C  C   . ALA C 1 205 ? 32.922  31.190  23.614 1.00 42.94 ? 858  ALA C C   1 
ATOM   7328  O  O   . ALA C 1 205 ? 33.429  30.177  23.105 1.00 42.71 ? 858  ALA C O   1 
ATOM   7329  C  CB  . ALA C 1 205 ? 32.692  33.380  22.403 1.00 41.25 ? 858  ALA C CB  1 
ATOM   7330  N  N   . TRP C 1 206 ? 33.147  31.556  24.873 1.00 42.81 ? 859  TRP C N   1 
ATOM   7331  C  CA  . TRP C 1 206 ? 33.998  30.786  25.743 1.00 42.91 ? 859  TRP C CA  1 
ATOM   7332  C  C   . TRP C 1 206 ? 33.339  29.469  26.083 1.00 43.68 ? 859  TRP C C   1 
ATOM   7333  O  O   . TRP C 1 206 ? 33.990  28.418  26.060 1.00 42.20 ? 859  TRP C O   1 
ATOM   7334  C  CB  . TRP C 1 206 ? 34.353  31.595  26.992 1.00 42.18 ? 859  TRP C CB  1 
ATOM   7335  C  CG  . TRP C 1 206 ? 35.515  32.516  26.720 1.00 42.11 ? 859  TRP C CG  1 
ATOM   7336  C  CD1 . TRP C 1 206 ? 35.501  33.885  26.688 1.00 40.50 ? 859  TRP C CD1 1 
ATOM   7337  C  CD2 . TRP C 1 206 ? 36.850  32.118  26.353 1.00 41.58 ? 859  TRP C CD2 1 
ATOM   7338  N  NE1 . TRP C 1 206 ? 36.735  34.358  26.317 1.00 41.05 ? 859  TRP C NE1 1 
ATOM   7339  C  CE2 . TRP C 1 206 ? 37.584  33.298  26.111 1.00 41.20 ? 859  TRP C CE2 1 
ATOM   7340  C  CE3 . TRP C 1 206 ? 37.495  30.872  26.211 1.00 39.98 ? 859  TRP C CE3 1 
ATOM   7341  C  CZ2 . TRP C 1 206 ? 38.931  33.273  25.723 1.00 41.21 ? 859  TRP C CZ2 1 
ATOM   7342  C  CZ3 . TRP C 1 206 ? 38.828  30.849  25.825 1.00 39.11 ? 859  TRP C CZ3 1 
ATOM   7343  C  CH2 . TRP C 1 206 ? 39.531  32.039  25.589 1.00 39.28 ? 859  TRP C CH2 1 
ATOM   7344  N  N   . ASN C 1 207 ? 32.038  29.501  26.358 1.00 44.56 ? 860  ASN C N   1 
ATOM   7345  C  CA  . ASN C 1 207 ? 31.335  28.252  26.649 1.00 45.12 ? 860  ASN C CA  1 
ATOM   7346  C  C   . ASN C 1 207 ? 31.533  27.285  25.482 1.00 45.72 ? 860  ASN C C   1 
ATOM   7347  O  O   . ASN C 1 207 ? 31.658  26.075  25.680 1.00 47.06 ? 860  ASN C O   1 
ATOM   7348  C  CB  . ASN C 1 207 ? 29.848  28.497  26.830 1.00 46.66 ? 860  ASN C CB  1 
ATOM   7349  C  CG  . ASN C 1 207 ? 29.034  27.216  26.709 1.00 49.54 ? 860  ASN C CG  1 
ATOM   7350  O  OD1 . ASN C 1 207 ? 28.898  26.453  27.676 1.00 48.40 ? 860  ASN C OD1 1 
ATOM   7351  N  ND2 . ASN C 1 207 ? 28.503  26.962  25.501 1.00 50.44 ? 860  ASN C ND2 1 
ATOM   7352  N  N   . LEU C 1 208 ? 31.558  27.831  24.267 1.00 44.16 ? 861  LEU C N   1 
ATOM   7353  C  CA  . LEU C 1 208 ? 31.746  27.030  23.066 1.00 43.24 ? 861  LEU C CA  1 
ATOM   7354  C  C   . LEU C 1 208 ? 33.138  26.411  23.089 1.00 43.16 ? 861  LEU C C   1 
ATOM   7355  O  O   . LEU C 1 208 ? 33.294  25.214  22.913 1.00 41.86 ? 861  LEU C O   1 
ATOM   7356  C  CB  . LEU C 1 208 ? 31.617  27.902  21.810 1.00 41.93 ? 861  LEU C CB  1 
ATOM   7357  C  CG  . LEU C 1 208 ? 31.733  27.141  20.473 1.00 43.06 ? 861  LEU C CG  1 
ATOM   7358  C  CD1 . LEU C 1 208 ? 30.582  26.129  20.349 1.00 39.23 ? 861  LEU C CD1 1 
ATOM   7359  C  CD2 . LEU C 1 208 ? 31.719  28.120  19.301 1.00 42.30 ? 861  LEU C CD2 1 
ATOM   7360  N  N   . TYR C 1 209 ? 34.133  27.264  23.301 1.00 42.82 ? 862  TYR C N   1 
ATOM   7361  C  CA  . TYR C 1 209 ? 35.520  26.873  23.346 1.00 42.21 ? 862  TYR C CA  1 
ATOM   7362  C  C   . TYR C 1 209 ? 35.705  25.709  24.329 1.00 41.95 ? 862  TYR C C   1 
ATOM   7363  O  O   . TYR C 1 209 ? 36.203  24.654  23.990 1.00 41.47 ? 862  TYR C O   1 
ATOM   7364  C  CB  . TYR C 1 209 ? 36.354  28.080  23.776 1.00 43.98 ? 862  TYR C CB  1 
ATOM   7365  C  CG  . TYR C 1 209 ? 37.842  27.808  23.781 1.00 45.49 ? 862  TYR C CG  1 
ATOM   7366  C  CD1 . TYR C 1 209 ? 38.600  27.943  22.620 1.00 44.28 ? 862  TYR C CD1 1 
ATOM   7367  C  CD2 . TYR C 1 209 ? 38.473  27.320  24.928 1.00 45.78 ? 862  TYR C CD2 1 
ATOM   7368  C  CE1 . TYR C 1 209 ? 39.962  27.590  22.600 1.00 47.33 ? 862  TYR C CE1 1 
ATOM   7369  C  CE2 . TYR C 1 209 ? 39.825  26.960  24.923 1.00 45.16 ? 862  TYR C CE2 1 
ATOM   7370  C  CZ  . TYR C 1 209 ? 40.572  27.093  23.766 1.00 46.10 ? 862  TYR C CZ  1 
ATOM   7371  O  OH  . TYR C 1 209 ? 41.914  26.751  23.766 1.00 43.55 ? 862  TYR C OH  1 
ATOM   7372  N  N   . LEU C 1 210 ? 35.272  25.899  25.551 1.00 41.67 ? 863  LEU C N   1 
ATOM   7373  C  CA  . LEU C 1 210 ? 35.408  24.861  26.544 1.00 42.39 ? 863  LEU C CA  1 
ATOM   7374  C  C   . LEU C 1 210 ? 34.535  23.643  26.290 1.00 43.84 ? 863  LEU C C   1 
ATOM   7375  O  O   . LEU C 1 210 ? 34.803  22.574  26.814 1.00 46.35 ? 863  LEU C O   1 
ATOM   7376  C  CB  . LEU C 1 210 ? 35.062  25.426  27.916 1.00 38.89 ? 863  LEU C CB  1 
ATOM   7377  C  CG  . LEU C 1 210 ? 35.812  26.713  28.252 1.00 39.62 ? 863  LEU C CG  1 
ATOM   7378  C  CD1 . LEU C 1 210 ? 35.257  27.331  29.509 1.00 38.88 ? 863  LEU C CD1 1 
ATOM   7379  C  CD2 . LEU C 1 210 ? 37.284  26.412  28.397 1.00 39.36 ? 863  LEU C CD2 1 
ATOM   7380  N  N   . SER C 1 211 ? 33.498  23.775  25.486 1.00 44.89 ? 864  SER C N   1 
ATOM   7381  C  CA  . SER C 1 211 ? 32.604  22.636  25.300 1.00 45.39 ? 864  SER C CA  1 
ATOM   7382  C  C   . SER C 1 211 ? 33.218  21.386  24.705 1.00 45.70 ? 864  SER C C   1 
ATOM   7383  O  O   . SER C 1 211 ? 32.822  20.297  25.078 1.00 44.95 ? 864  SER C O   1 
ATOM   7384  C  CB  . SER C 1 211 ? 31.376  23.030  24.459 1.00 44.95 ? 864  SER C CB  1 
ATOM   7385  O  OG  . SER C 1 211 ? 31.671  23.016  23.065 1.00 46.22 ? 864  SER C OG  1 
ATOM   7386  N  N   . ARG C 1 212 ? 34.158  21.516  23.773 1.00 46.37 ? 865  ARG C N   1 
ATOM   7387  C  CA  . ARG C 1 212 ? 34.737  20.319  23.168 1.00 47.25 ? 865  ARG C CA  1 
ATOM   7388  C  C   . ARG C 1 212 ? 36.252  20.350  23.074 1.00 48.02 ? 865  ARG C C   1 
ATOM   7389  O  O   . ARG C 1 212 ? 36.854  21.406  22.913 1.00 47.10 ? 865  ARG C O   1 
ATOM   7390  C  CB  . ARG C 1 212 ? 34.132  20.085  21.775 1.00 49.72 ? 865  ARG C CB  1 
ATOM   7391  C  CG  . ARG C 1 212 ? 32.624  19.777  21.800 1.00 53.13 ? 865  ARG C CG  1 
ATOM   7392  C  CD  . ARG C 1 212 ? 32.007  19.782  20.409 1.00 55.81 ? 865  ARG C CD  1 
ATOM   7393  N  NE  . ARG C 1 212 ? 32.290  18.547  19.668 1.00 60.82 ? 865  ARG C NE  1 
ATOM   7394  C  CZ  . ARG C 1 212 ? 31.865  17.329  20.019 1.00 61.45 ? 865  ARG C CZ  1 
ATOM   7395  N  NH1 . ARG C 1 212 ? 31.129  17.154  21.115 1.00 62.28 ? 865  ARG C NH1 1 
ATOM   7396  N  NH2 . ARG C 1 212 ? 32.168  16.283  19.260 1.00 61.03 ? 865  ARG C NH2 1 
ATOM   7397  N  N   . PRO C 1 213 ? 36.891  19.185  23.196 1.00 48.57 ? 866  PRO C N   1 
ATOM   7398  C  CA  . PRO C 1 213 ? 38.356  19.145  23.110 1.00 48.53 ? 866  PRO C CA  1 
ATOM   7399  C  C   . PRO C 1 213 ? 38.930  19.391  21.708 1.00 49.87 ? 866  PRO C C   1 
ATOM   7400  O  O   . PRO C 1 213 ? 40.113  19.644  21.564 1.00 49.85 ? 866  PRO C O   1 
ATOM   7401  C  CB  . PRO C 1 213 ? 38.706  17.757  23.679 1.00 48.23 ? 866  PRO C CB  1 
ATOM   7402  C  CG  . PRO C 1 213 ? 37.476  16.930  23.370 1.00 49.17 ? 866  PRO C CG  1 
ATOM   7403  C  CD  . PRO C 1 213 ? 36.346  17.907  23.693 1.00 48.19 ? 866  PRO C CD  1 
ATOM   7404  N  N   . GLU C 1 214 ? 38.099  19.328  20.674 1.00 51.80 ? 867  GLU C N   1 
ATOM   7405  C  CA  . GLU C 1 214 ? 38.584  19.578  19.314 1.00 52.83 ? 867  GLU C CA  1 
ATOM   7406  C  C   . GLU C 1 214 ? 38.746  21.064  19.014 1.00 52.02 ? 867  GLU C C   1 
ATOM   7407  O  O   . GLU C 1 214 ? 39.243  21.441  17.953 1.00 51.97 ? 867  GLU C O   1 
ATOM   7408  C  CB  . GLU C 1 214 ? 37.644  18.965  18.270 1.00 54.61 ? 867  GLU C CB  1 
ATOM   7409  C  CG  . GLU C 1 214 ? 36.220  18.841  18.729 1.00 59.05 ? 867  GLU C CG  1 
ATOM   7410  C  CD  . GLU C 1 214 ? 35.997  17.555  19.510 1.00 61.87 ? 867  GLU C CD  1 
ATOM   7411  O  OE1 . GLU C 1 214 ? 35.953  16.484  18.860 1.00 63.69 ? 867  GLU C OE1 1 
ATOM   7412  O  OE2 . GLU C 1 214 ? 35.875  17.610  20.758 1.00 62.67 ? 867  GLU C OE2 1 
ATOM   7413  N  N   . TYR C 1 215 ? 38.320  21.899  19.950 1.00 51.01 ? 868  TYR C N   1 
ATOM   7414  C  CA  . TYR C 1 215 ? 38.422  23.352  19.806 1.00 50.61 ? 868  TYR C CA  1 
ATOM   7415  C  C   . TYR C 1 215 ? 39.638  23.876  20.549 1.00 49.88 ? 868  TYR C C   1 
ATOM   7416  O  O   . TYR C 1 215 ? 39.941  25.064  20.494 1.00 49.77 ? 868  TYR C O   1 
ATOM   7417  C  CB  . TYR C 1 215 ? 37.195  24.024  20.410 1.00 50.08 ? 868  TYR C CB  1 
ATOM   7418  C  CG  . TYR C 1 215 ? 35.904  23.627  19.769 1.00 51.11 ? 868  TYR C CG  1 
ATOM   7419  C  CD1 . TYR C 1 215 ? 34.688  23.877  20.407 1.00 51.64 ? 868  TYR C CD1 1 
ATOM   7420  C  CD2 . TYR C 1 215 ? 35.887  23.037  18.506 1.00 51.03 ? 868  TYR C CD2 1 
ATOM   7421  C  CE1 . TYR C 1 215 ? 33.485  23.553  19.804 1.00 52.30 ? 868  TYR C CE1 1 
ATOM   7422  C  CE2 . TYR C 1 215 ? 34.692  22.713  17.891 1.00 52.45 ? 868  TYR C CE2 1 
ATOM   7423  C  CZ  . TYR C 1 215 ? 33.495  22.974  18.539 1.00 53.02 ? 868  TYR C CZ  1 
ATOM   7424  O  OH  . TYR C 1 215 ? 32.305  22.686  17.916 1.00 53.95 ? 868  TYR C OH  1 
ATOM   7425  N  N   . ASN C 1 216 ? 40.332  22.983  21.245 1.00 49.51 ? 869  ASN C N   1 
ATOM   7426  C  CA  . ASN C 1 216 ? 41.473  23.377  22.051 1.00 49.05 ? 869  ASN C CA  1 
ATOM   7427  C  C   . ASN C 1 216 ? 42.734  23.694  21.270 1.00 48.68 ? 869  ASN C C   1 
ATOM   7428  O  O   . ASN C 1 216 ? 43.502  22.795  20.919 1.00 50.23 ? 869  ASN C O   1 
ATOM   7429  C  CB  . ASN C 1 216 ? 41.758  22.294  23.064 1.00 49.20 ? 869  ASN C CB  1 
ATOM   7430  C  CG  . ASN C 1 216 ? 42.741  22.735  24.134 1.00 50.41 ? 869  ASN C CG  1 
ATOM   7431  O  OD1 . ASN C 1 216 ? 43.251  21.895  24.876 1.00 51.05 ? 869  ASN C OD1 1 
ATOM   7432  N  ND2 . ASN C 1 216 ? 43.009  24.042  24.227 1.00 48.47 ? 869  ASN C ND2 1 
ATOM   7433  N  N   . PHE C 1 217 ? 42.949  24.981  21.013 1.00 45.73 ? 870  PHE C N   1 
ATOM   7434  C  CA  . PHE C 1 217 ? 44.118  25.406  20.258 1.00 44.41 ? 870  PHE C CA  1 
ATOM   7435  C  C   . PHE C 1 217 ? 45.010  26.300  21.087 1.00 42.99 ? 870  PHE C C   1 
ATOM   7436  O  O   . PHE C 1 217 ? 46.028  26.775  20.607 1.00 43.57 ? 870  PHE C O   1 
ATOM   7437  C  CB  . PHE C 1 217 ? 43.700  26.127  18.957 1.00 41.81 ? 870  PHE C CB  1 
ATOM   7438  C  CG  . PHE C 1 217 ? 43.008  27.448  19.177 1.00 41.42 ? 870  PHE C CG  1 
ATOM   7439  C  CD1 . PHE C 1 217 ? 43.740  28.627  19.314 1.00 40.29 ? 870  PHE C CD1 1 
ATOM   7440  C  CD2 . PHE C 1 217 ? 41.623  27.509  19.280 1.00 41.11 ? 870  PHE C CD2 1 
ATOM   7441  C  CE1 . PHE C 1 217 ? 43.104  29.848  19.556 1.00 40.86 ? 870  PHE C CE1 1 
ATOM   7442  C  CE2 . PHE C 1 217 ? 40.978  28.729  19.523 1.00 42.22 ? 870  PHE C CE2 1 
ATOM   7443  C  CZ  . PHE C 1 217 ? 41.725  29.901  19.662 1.00 40.68 ? 870  PHE C CZ  1 
ATOM   7444  N  N   . LEU C 1 218 ? 44.631  26.531  22.336 1.00 42.52 ? 871  LEU C N   1 
ATOM   7445  C  CA  . LEU C 1 218 ? 45.441  27.381  23.215 1.00 41.79 ? 871  LEU C CA  1 
ATOM   7446  C  C   . LEU C 1 218 ? 46.220  26.537  24.239 1.00 41.68 ? 871  LEU C C   1 
ATOM   7447  O  O   . LEU C 1 218 ? 46.691  27.066  25.253 1.00 42.12 ? 871  LEU C O   1 
ATOM   7448  C  CB  . LEU C 1 218 ? 44.541  28.407  23.931 1.00 38.79 ? 871  LEU C CB  1 
ATOM   7449  C  CG  . LEU C 1 218 ? 43.823  29.447  23.038 1.00 36.89 ? 871  LEU C CG  1 
ATOM   7450  C  CD1 . LEU C 1 218 ? 42.872  30.283  23.871 1.00 36.42 ? 871  LEU C CD1 1 
ATOM   7451  C  CD2 . LEU C 1 218 ? 44.832  30.333  22.340 1.00 35.87 ? 871  LEU C CD2 1 
ATOM   7452  N  N   . LEU C 1 219 ? 46.357  25.234  23.951 1.00 40.75 ? 872  LEU C N   1 
ATOM   7453  C  CA  . LEU C 1 219 ? 47.060  24.283  24.834 1.00 40.42 ? 872  LEU C CA  1 
ATOM   7454  C  C   . LEU C 1 219 ? 48.484  24.676  25.263 1.00 39.13 ? 872  LEU C C   1 
ATOM   7455  O  O   . LEU C 1 219 ? 48.867  24.378  26.381 1.00 39.61 ? 872  LEU C O   1 
ATOM   7456  C  CB  . LEU C 1 219 ? 47.108  22.882  24.197 1.00 39.24 ? 872  LEU C CB  1 
ATOM   7457  C  CG  . LEU C 1 219 ? 48.067  22.677  23.030 1.00 40.06 ? 872  LEU C CG  1 
ATOM   7458  C  CD1 . LEU C 1 219 ? 48.196  21.203  22.720 1.00 40.83 ? 872  LEU C CD1 1 
ATOM   7459  C  CD2 . LEU C 1 219 ? 47.575  23.455  21.816 1.00 40.30 ? 872  LEU C CD2 1 
ATOM   7460  N  N   . HIS C 1 220 ? 49.248  25.333  24.391 1.00 39.25 ? 873  HIS C N   1 
ATOM   7461  C  CA  . HIS C 1 220 ? 50.618  25.733  24.698 1.00 40.89 ? 873  HIS C CA  1 
ATOM   7462  C  C   . HIS C 1 220 ? 50.800  26.995  25.535 1.00 41.64 ? 873  HIS C C   1 
ATOM   7463  O  O   . HIS C 1 220 ? 51.907  27.525  25.635 1.00 42.21 ? 873  HIS C O   1 
ATOM   7464  C  CB  . HIS C 1 220 ? 51.453  25.854  23.416 1.00 43.09 ? 873  HIS C CB  1 
ATOM   7465  C  CG  . HIS C 1 220 ? 51.632  24.553  22.694 1.00 48.29 ? 873  HIS C CG  1 
ATOM   7466  N  ND1 . HIS C 1 220 ? 50.863  24.191  21.608 1.00 49.96 ? 873  HIS C ND1 1 
ATOM   7467  C  CD2 . HIS C 1 220 ? 52.451  23.498  22.941 1.00 49.75 ? 873  HIS C CD2 1 
ATOM   7468  C  CE1 . HIS C 1 220 ? 51.196  22.973  21.218 1.00 50.12 ? 873  HIS C CE1 1 
ATOM   7469  N  NE2 . HIS C 1 220 ? 52.156  22.529  22.010 1.00 50.57 ? 873  HIS C NE2 1 
ATOM   7470  N  N   . LEU C 1 221 ? 49.715  27.488  26.111 1.00 41.09 ? 874  LEU C N   1 
ATOM   7471  C  CA  . LEU C 1 221 ? 49.769  28.639  26.993 1.00 39.70 ? 874  LEU C CA  1 
ATOM   7472  C  C   . LEU C 1 221 ? 49.795  27.959  28.337 1.00 40.61 ? 874  LEU C C   1 
ATOM   7473  O  O   . LEU C 1 221 ? 49.068  26.982  28.532 1.00 41.88 ? 874  LEU C O   1 
ATOM   7474  C  CB  . LEU C 1 221 ? 48.490  29.473  26.908 1.00 39.12 ? 874  LEU C CB  1 
ATOM   7475  C  CG  . LEU C 1 221 ? 48.139  30.318  25.678 1.00 39.77 ? 874  LEU C CG  1 
ATOM   7476  C  CD1 . LEU C 1 221 ? 46.954  31.206  26.017 1.00 38.46 ? 874  LEU C CD1 1 
ATOM   7477  C  CD2 . LEU C 1 221 ? 49.303  31.188  25.288 1.00 40.41 ? 874  LEU C CD2 1 
ATOM   7478  N  N   . ASP C 1 222 ? 50.620  28.404  29.276 1.00 40.10 ? 875  ASP C N   1 
ATOM   7479  C  CA  . ASP C 1 222 ? 50.557  27.715  30.565 1.00 39.80 ? 875  ASP C CA  1 
ATOM   7480  C  C   . ASP C 1 222 ? 49.298  28.249  31.260 1.00 39.25 ? 875  ASP C C   1 
ATOM   7481  O  O   . ASP C 1 222 ? 48.674  29.212  30.784 1.00 37.68 ? 875  ASP C O   1 
ATOM   7482  C  CB  . ASP C 1 222 ? 51.839  27.920  31.387 1.00 41.35 ? 875  ASP C CB  1 
ATOM   7483  C  CG  . ASP C 1 222 ? 52.138  29.372  31.680 1.00 43.53 ? 875  ASP C CG  1 
ATOM   7484  O  OD1 . ASP C 1 222 ? 53.317  29.742  31.578 1.00 44.69 ? 875  ASP C OD1 1 
ATOM   7485  O  OD2 . ASP C 1 222 ? 51.210  30.139  32.026 1.00 46.32 ? 875  ASP C OD2 1 
ATOM   7486  N  N   . HIS C 1 223 ? 48.912  27.614  32.354 1.00 38.61 ? 876  HIS C N   1 
ATOM   7487  C  CA  . HIS C 1 223 ? 47.691  27.989  33.066 1.00 39.04 ? 876  HIS C CA  1 
ATOM   7488  C  C   . HIS C 1 223 ? 47.516  29.493  33.359 1.00 38.90 ? 876  HIS C C   1 
ATOM   7489  O  O   . HIS C 1 223 ? 46.414  30.025  33.225 1.00 37.72 ? 876  HIS C O   1 
ATOM   7490  C  CB  . HIS C 1 223 ? 47.585  27.158  34.351 1.00 38.35 ? 876  HIS C CB  1 
ATOM   7491  C  CG  . HIS C 1 223 ? 46.205  27.107  34.937 1.00 40.48 ? 876  HIS C CG  1 
ATOM   7492  N  ND1 . HIS C 1 223 ? 45.061  27.223  34.175 1.00 41.91 ? 876  HIS C ND1 1 
ATOM   7493  C  CD2 . HIS C 1 223 ? 45.786  26.878  36.205 1.00 41.28 ? 876  HIS C CD2 1 
ATOM   7494  C  CE1 . HIS C 1 223 ? 44.001  27.064  34.944 1.00 40.93 ? 876  HIS C CE1 1 
ATOM   7495  N  NE2 . HIS C 1 223 ? 44.412  26.853  36.179 1.00 42.76 ? 876  HIS C NE2 1 
ATOM   7496  N  N   . VAL C 1 224 ? 48.606  30.166  33.739 1.00 38.72 ? 877  VAL C N   1 
ATOM   7497  C  CA  . VAL C 1 224 ? 48.590  31.598  34.048 1.00 37.71 ? 877  VAL C CA  1 
ATOM   7498  C  C   . VAL C 1 224 ? 48.266  32.407  32.782 1.00 38.10 ? 877  VAL C C   1 
ATOM   7499  O  O   . VAL C 1 224 ? 47.372  33.253  32.776 1.00 36.63 ? 877  VAL C O   1 
ATOM   7500  C  CB  . VAL C 1 224 ? 49.962  32.045  34.656 1.00 36.13 ? 877  VAL C CB  1 
ATOM   7501  C  CG1 . VAL C 1 224 ? 50.143  33.527  34.548 1.00 35.45 ? 877  VAL C CG1 1 
ATOM   7502  C  CG2 . VAL C 1 224 ? 50.020  31.665  36.113 1.00 33.50 ? 877  VAL C CG2 1 
ATOM   7503  N  N   . GLU C 1 225 ? 49.005  32.116  31.721 1.00 39.27 ? 878  GLU C N   1 
ATOM   7504  C  CA  . GLU C 1 225 ? 48.829  32.740  30.422 1.00 40.84 ? 878  GLU C CA  1 
ATOM   7505  C  C   . GLU C 1 225 ? 47.404  32.571  29.910 1.00 40.39 ? 878  GLU C C   1 
ATOM   7506  O  O   . GLU C 1 225 ? 46.827  33.501  29.370 1.00 41.43 ? 878  GLU C O   1 
ATOM   7507  C  CB  . GLU C 1 225 ? 49.755  32.093  29.407 1.00 42.24 ? 878  GLU C CB  1 
ATOM   7508  C  CG  . GLU C 1 225 ? 51.131  32.656  29.327 1.00 44.20 ? 878  GLU C CG  1 
ATOM   7509  C  CD  . GLU C 1 225 ? 52.033  31.789  28.461 1.00 46.18 ? 878  GLU C CD  1 
ATOM   7510  O  OE1 . GLU C 1 225 ? 53.032  32.318  27.943 1.00 47.00 ? 878  GLU C OE1 1 
ATOM   7511  O  OE2 . GLU C 1 225 ? 51.741  30.579  28.309 1.00 47.62 ? 878  GLU C OE2 1 
ATOM   7512  N  N   . PHE C 1 226 ? 46.860  31.369  30.050 1.00 40.29 ? 879  PHE C N   1 
ATOM   7513  C  CA  . PHE C 1 226 ? 45.515  31.096  29.598 1.00 39.91 ? 879  PHE C CA  1 
ATOM   7514  C  C   . PHE C 1 226 ? 44.540  31.950  30.394 1.00 40.32 ? 879  PHE C C   1 
ATOM   7515  O  O   . PHE C 1 226 ? 43.614  32.557  29.843 1.00 38.11 ? 879  PHE C O   1 
ATOM   7516  C  CB  . PHE C 1 226 ? 45.176  29.627  29.798 1.00 41.53 ? 879  PHE C CB  1 
ATOM   7517  C  CG  . PHE C 1 226 ? 43.819  29.254  29.306 1.00 44.47 ? 879  PHE C CG  1 
ATOM   7518  C  CD1 . PHE C 1 226 ? 43.630  28.837  27.990 1.00 45.98 ? 879  PHE C CD1 1 
ATOM   7519  C  CD2 . PHE C 1 226 ? 42.720  29.350  30.145 1.00 45.90 ? 879  PHE C CD2 1 
ATOM   7520  C  CE1 . PHE C 1 226 ? 42.361  28.513  27.512 1.00 46.65 ? 879  PHE C CE1 1 
ATOM   7521  C  CE2 . PHE C 1 226 ? 41.443  29.030  29.681 1.00 48.48 ? 879  PHE C CE2 1 
ATOM   7522  C  CZ  . PHE C 1 226 ? 41.265  28.609  28.354 1.00 47.75 ? 879  PHE C CZ  1 
ATOM   7523  N  N   . LYS C 1 227 ? 44.733  32.008  31.702 1.00 40.33 ? 880  LYS C N   1 
ATOM   7524  C  CA  . LYS C 1 227 ? 43.822  32.827  32.478 1.00 40.21 ? 880  LYS C CA  1 
ATOM   7525  C  C   . LYS C 1 227 ? 43.979  34.303  32.095 1.00 39.79 ? 880  LYS C C   1 
ATOM   7526  O  O   . LYS C 1 227 ? 42.988  35.018  32.067 1.00 39.29 ? 880  LYS C O   1 
ATOM   7527  C  CB  . LYS C 1 227 ? 44.022  32.609  33.979 1.00 37.79 ? 880  LYS C CB  1 
ATOM   7528  C  CG  . LYS C 1 227 ? 43.443  31.273  34.459 1.00 39.54 ? 880  LYS C CG  1 
ATOM   7529  C  CD  . LYS C 1 227 ? 43.679  31.014  35.964 1.00 40.09 ? 880  LYS C CD  1 
ATOM   7530  C  CE  . LYS C 1 227 ? 45.143  30.755  36.292 1.00 41.41 ? 880  LYS C CE  1 
ATOM   7531  N  NZ  . LYS C 1 227 ? 45.389  30.440  37.726 1.00 39.62 ? 880  LYS C NZ  1 
ATOM   7532  N  N   . ARG C 1 228 ? 45.194  34.743  31.768 1.00 38.88 ? 881  ARG C N   1 
ATOM   7533  C  CA  . ARG C 1 228 ? 45.392  36.134  31.410 1.00 40.93 ? 881  ARG C CA  1 
ATOM   7534  C  C   . ARG C 1 228 ? 44.758  36.449  30.064 1.00 41.10 ? 881  ARG C C   1 
ATOM   7535  O  O   . ARG C 1 228 ? 44.185  37.525  29.846 1.00 40.57 ? 881  ARG C O   1 
ATOM   7536  C  CB  . ARG C 1 228 ? 46.871  36.498  31.353 1.00 40.88 ? 881  ARG C CB  1 
ATOM   7537  C  CG  . ARG C 1 228 ? 47.088  37.912  30.825 1.00 44.03 ? 881  ARG C CG  1 
ATOM   7538  C  CD  . ARG C 1 228 ? 48.419  38.488  31.266 1.00 46.08 ? 881  ARG C CD  1 
ATOM   7539  N  NE  . ARG C 1 228 ? 48.748  39.760  30.609 1.00 46.93 ? 881  ARG C NE  1 
ATOM   7540  C  CZ  . ARG C 1 228 ? 48.110  40.915  30.790 1.00 46.28 ? 881  ARG C CZ  1 
ATOM   7541  N  NH1 . ARG C 1 228 ? 47.071  41.007  31.624 1.00 45.10 ? 881  ARG C NH1 1 
ATOM   7542  N  NH2 . ARG C 1 228 ? 48.528  41.982  30.123 1.00 45.49 ? 881  ARG C NH2 1 
ATOM   7543  N  N   . PHE C 1 229 ? 44.873  35.484  29.169 1.00 41.07 ? 882  PHE C N   1 
ATOM   7544  C  CA  . PHE C 1 229 ? 44.325  35.573  27.829 1.00 41.03 ? 882  PHE C CA  1 
ATOM   7545  C  C   . PHE C 1 229 ? 42.790  35.689  27.870 1.00 40.46 ? 882  PHE C C   1 
ATOM   7546  O  O   . PHE C 1 229 ? 42.190  36.562  27.243 1.00 39.70 ? 882  PHE C O   1 
ATOM   7547  C  CB  . PHE C 1 229 ? 44.715  34.317  27.060 1.00 39.75 ? 882  PHE C CB  1 
ATOM   7548  C  CG  . PHE C 1 229 ? 44.346  34.363  25.632 1.00 39.39 ? 882  PHE C CG  1 
ATOM   7549  C  CD1 . PHE C 1 229 ? 45.090  35.130  24.734 1.00 39.96 ? 882  PHE C CD1 1 
ATOM   7550  C  CD2 . PHE C 1 229 ? 43.231  33.690  25.181 1.00 39.85 ? 882  PHE C CD2 1 
ATOM   7551  C  CE1 . PHE C 1 229 ? 44.718  35.222  23.406 1.00 39.91 ? 882  PHE C CE1 1 
ATOM   7552  C  CE2 . PHE C 1 229 ? 42.838  33.776  23.846 1.00 40.08 ? 882  PHE C CE2 1 
ATOM   7553  C  CZ  . PHE C 1 229 ? 43.581  34.541  22.961 1.00 39.71 ? 882  PHE C CZ  1 
ATOM   7554  N  N   . ARG C 1 230 ? 42.175  34.785  28.614 1.00 39.46 ? 883  ARG C N   1 
ATOM   7555  C  CA  . ARG C 1 230 ? 40.741  34.771  28.726 1.00 40.32 ? 883  ARG C CA  1 
ATOM   7556  C  C   . ARG C 1 230 ? 40.293  36.098  29.314 1.00 40.55 ? 883  ARG C C   1 
ATOM   7557  O  O   . ARG C 1 230 ? 39.285  36.657  28.888 1.00 42.26 ? 883  ARG C O   1 
ATOM   7558  C  CB  . ARG C 1 230 ? 40.307  33.607  29.601 1.00 39.74 ? 883  ARG C CB  1 
ATOM   7559  C  CG  . ARG C 1 230 ? 38.860  33.599  29.976 1.00 41.77 ? 883  ARG C CG  1 
ATOM   7560  C  CD  . ARG C 1 230 ? 38.654  32.618  31.113 1.00 44.85 ? 883  ARG C CD  1 
ATOM   7561  N  NE  . ARG C 1 230 ? 37.434  32.857  31.886 1.00 46.07 ? 883  ARG C NE  1 
ATOM   7562  C  CZ  . ARG C 1 230 ? 36.207  32.566  31.466 1.00 46.61 ? 883  ARG C CZ  1 
ATOM   7563  N  NH1 . ARG C 1 230 ? 36.026  32.021  30.274 1.00 46.23 ? 883  ARG C NH1 1 
ATOM   7564  N  NH2 . ARG C 1 230 ? 35.161  32.822  32.241 1.00 47.92 ? 883  ARG C NH2 1 
ATOM   7565  N  N   . PHE C 1 231 ? 41.047  36.609  30.282 1.00 38.74 ? 884  PHE C N   1 
ATOM   7566  C  CA  . PHE C 1 231 ? 40.719  37.880  30.910 1.00 36.74 ? 884  PHE C CA  1 
ATOM   7567  C  C   . PHE C 1 231 ? 40.775  39.024  29.902 1.00 38.64 ? 884  PHE C C   1 
ATOM   7568  O  O   . PHE C 1 231 ? 39.900  39.885  29.880 1.00 39.20 ? 884  PHE C O   1 
ATOM   7569  C  CB  . PHE C 1 231 ? 41.696  38.197  32.037 1.00 34.02 ? 884  PHE C CB  1 
ATOM   7570  C  CG  . PHE C 1 231 ? 41.594  39.618  32.556 1.00 30.04 ? 884  PHE C CG  1 
ATOM   7571  C  CD1 . PHE C 1 231 ? 40.525  40.009  33.347 1.00 32.05 ? 884  PHE C CD1 1 
ATOM   7572  C  CD2 . PHE C 1 231 ? 42.555  40.558  32.234 1.00 30.51 ? 884  PHE C CD2 1 
ATOM   7573  C  CE1 . PHE C 1 231 ? 40.413  41.330  33.813 1.00 31.21 ? 884  PHE C CE1 1 
ATOM   7574  C  CE2 . PHE C 1 231 ? 42.462  41.880  32.691 1.00 31.45 ? 884  PHE C CE2 1 
ATOM   7575  C  CZ  . PHE C 1 231 ? 41.385  42.258  33.481 1.00 30.76 ? 884  PHE C CZ  1 
ATOM   7576  N  N   . LEU C 1 232 ? 41.835  39.031  29.099 1.00 38.54 ? 885  LEU C N   1 
ATOM   7577  C  CA  . LEU C 1 232 ? 42.050  40.058  28.104 1.00 38.81 ? 885  LEU C CA  1 
ATOM   7578  C  C   . LEU C 1 232 ? 40.967  40.037  27.042 1.00 39.14 ? 885  LEU C C   1 
ATOM   7579  O  O   . LEU C 1 232 ? 40.512  41.092  26.587 1.00 40.22 ? 885  LEU C O   1 
ATOM   7580  C  CB  . LEU C 1 232 ? 43.425  39.884  27.456 1.00 40.39 ? 885  LEU C CB  1 
ATOM   7581  C  CG  . LEU C 1 232 ? 44.604  40.246  28.362 1.00 40.22 ? 885  LEU C CG  1 
ATOM   7582  C  CD1 . LEU C 1 232 ? 45.904  40.172  27.574 1.00 38.84 ? 885  LEU C CD1 1 
ATOM   7583  C  CD2 . LEU C 1 232 ? 44.397  41.649  28.926 1.00 38.75 ? 885  LEU C CD2 1 
ATOM   7584  N  N   . VAL C 1 233 ? 40.547  38.841  26.651 1.00 37.43 ? 886  VAL C N   1 
ATOM   7585  C  CA  . VAL C 1 233 ? 39.513  38.719  25.654 1.00 36.88 ? 886  VAL C CA  1 
ATOM   7586  C  C   . VAL C 1 233 ? 38.178  39.217  26.181 1.00 39.20 ? 886  VAL C C   1 
ATOM   7587  O  O   . VAL C 1 233 ? 37.417  39.838  25.437 1.00 40.27 ? 886  VAL C O   1 
ATOM   7588  C  CB  . VAL C 1 233 ? 39.363  37.276  25.152 1.00 37.03 ? 886  VAL C CB  1 
ATOM   7589  C  CG1 . VAL C 1 233 ? 38.155  37.180  24.237 1.00 35.85 ? 886  VAL C CG1 1 
ATOM   7590  C  CG2 . VAL C 1 233 ? 40.634  36.862  24.380 1.00 33.62 ? 886  VAL C CG2 1 
ATOM   7591  N  N   . ILE C 1 234 ? 37.891  38.982  27.459 1.00 38.66 ? 887  ILE C N   1 
ATOM   7592  C  CA  . ILE C 1 234 ? 36.634  39.432  28.025 1.00 39.10 ? 887  ILE C CA  1 
ATOM   7593  C  C   . ILE C 1 234 ? 36.585  40.950  28.155 1.00 40.95 ? 887  ILE C C   1 
ATOM   7594  O  O   . ILE C 1 234 ? 35.565  41.580  27.864 1.00 40.94 ? 887  ILE C O   1 
ATOM   7595  C  CB  . ILE C 1 234 ? 36.383  38.816  29.405 1.00 38.97 ? 887  ILE C CB  1 
ATOM   7596  C  CG1 . ILE C 1 234 ? 36.070  37.323  29.254 1.00 39.15 ? 887  ILE C CG1 1 
ATOM   7597  C  CG2 . ILE C 1 234 ? 35.217  39.508  30.074 1.00 37.22 ? 887  ILE C CG2 1 
ATOM   7598  C  CD1 . ILE C 1 234 ? 36.013  36.545  30.579 1.00 36.06 ? 887  ILE C CD1 1 
ATOM   7599  N  N   . GLU C 1 235 ? 37.691  41.545  28.582 1.00 41.96 ? 888  GLU C N   1 
ATOM   7600  C  CA  . GLU C 1 235 ? 37.734  42.988  28.750 1.00 41.91 ? 888  GLU C CA  1 
ATOM   7601  C  C   . GLU C 1 235 ? 37.548  43.740  27.443 1.00 41.74 ? 888  GLU C C   1 
ATOM   7602  O  O   . GLU C 1 235 ? 37.008  44.842  27.434 1.00 42.61 ? 888  GLU C O   1 
ATOM   7603  C  CB  . GLU C 1 235 ? 39.046  43.408  29.400 1.00 42.11 ? 888  GLU C CB  1 
ATOM   7604  C  CG  . GLU C 1 235 ? 39.186  42.922  30.825 1.00 45.39 ? 888  GLU C CG  1 
ATOM   7605  C  CD  . GLU C 1 235 ? 38.247  43.628  31.788 1.00 46.17 ? 888  GLU C CD  1 
ATOM   7606  O  OE1 . GLU C 1 235 ? 37.348  42.978  32.384 1.00 46.61 ? 888  GLU C OE1 1 
ATOM   7607  O  OE2 . GLU C 1 235 ? 38.429  44.848  31.958 1.00 48.05 ? 888  GLU C OE2 1 
ATOM   7608  N  N   . ALA C 1 236 ? 37.990  43.152  26.337 1.00 41.09 ? 889  ALA C N   1 
ATOM   7609  C  CA  . ALA C 1 236 ? 37.862  43.816  25.053 1.00 40.88 ? 889  ALA C CA  1 
ATOM   7610  C  C   . ALA C 1 236 ? 36.436  43.677  24.509 1.00 41.08 ? 889  ALA C C   1 
ATOM   7611  O  O   . ALA C 1 236 ? 35.834  44.647  24.072 1.00 40.56 ? 889  ALA C O   1 
ATOM   7612  C  CB  . ALA C 1 236 ? 38.867  43.246  24.075 1.00 40.45 ? 889  ALA C CB  1 
ATOM   7613  N  N   . ILE C 1 237 ? 35.905  42.463  24.534 1.00 40.34 ? 890  ILE C N   1 
ATOM   7614  C  CA  . ILE C 1 237 ? 34.555  42.241  24.075 1.00 40.39 ? 890  ILE C CA  1 
ATOM   7615  C  C   . ILE C 1 237 ? 33.554  43.143  24.829 1.00 43.01 ? 890  ILE C C   1 
ATOM   7616  O  O   . ILE C 1 237 ? 32.600  43.654  24.236 1.00 42.77 ? 890  ILE C O   1 
ATOM   7617  C  CB  . ILE C 1 237 ? 34.142  40.781  24.286 1.00 38.09 ? 890  ILE C CB  1 
ATOM   7618  C  CG1 . ILE C 1 237 ? 34.947  39.885  23.352 1.00 34.92 ? 890  ILE C CG1 1 
ATOM   7619  C  CG2 . ILE C 1 237 ? 32.635  40.635  24.091 1.00 36.21 ? 890  ILE C CG2 1 
ATOM   7620  C  CD1 . ILE C 1 237 ? 34.620  38.410  23.485 1.00 32.46 ? 890  ILE C CD1 1 
ATOM   7621  N  N   . LEU C 1 238 ? 33.775  43.332  26.128 1.00 42.72 ? 891  LEU C N   1 
ATOM   7622  C  CA  . LEU C 1 238 ? 32.871  44.139  26.920 1.00 44.41 ? 891  LEU C CA  1 
ATOM   7623  C  C   . LEU C 1 238 ? 33.029  45.609  26.659 1.00 44.78 ? 891  LEU C C   1 
ATOM   7624  O  O   . LEU C 1 238 ? 32.108  46.394  26.917 1.00 45.16 ? 891  LEU C O   1 
ATOM   7625  C  CB  . LEU C 1 238 ? 33.058  43.875  28.421 1.00 46.03 ? 891  LEU C CB  1 
ATOM   7626  C  CG  . LEU C 1 238 ? 32.432  42.602  28.993 1.00 47.85 ? 891  LEU C CG  1 
ATOM   7627  C  CD1 . LEU C 1 238 ? 32.692  42.590  30.479 1.00 50.64 ? 891  LEU C CD1 1 
ATOM   7628  C  CD2 . LEU C 1 238 ? 30.950  42.548  28.730 1.00 48.66 ? 891  LEU C CD2 1 
ATOM   7629  N  N   . ALA C 1 239 ? 34.206  45.986  26.177 1.00 43.59 ? 892  ALA C N   1 
ATOM   7630  C  CA  . ALA C 1 239 ? 34.493  47.369  25.862 1.00 43.38 ? 892  ALA C CA  1 
ATOM   7631  C  C   . ALA C 1 239 ? 33.680  47.837  24.638 1.00 44.26 ? 892  ALA C C   1 
ATOM   7632  O  O   . ALA C 1 239 ? 33.572  49.050  24.392 1.00 43.58 ? 892  ALA C O   1 
ATOM   7633  C  CB  . ALA C 1 239 ? 35.969  47.528  25.589 1.00 42.92 ? 892  ALA C CB  1 
ATOM   7634  N  N   . THR C 1 240 ? 33.126  46.883  23.873 1.00 43.25 ? 893  THR C N   1 
ATOM   7635  C  CA  . THR C 1 240 ? 32.331  47.231  22.702 1.00 43.05 ? 893  THR C CA  1 
ATOM   7636  C  C   . THR C 1 240 ? 30.898  47.662  23.033 1.00 45.60 ? 893  THR C C   1 
ATOM   7637  O  O   . THR C 1 240 ? 30.120  47.986  22.128 1.00 44.78 ? 893  THR C O   1 
ATOM   7638  C  CB  . THR C 1 240 ? 32.213  46.100  21.696 1.00 41.44 ? 893  THR C CB  1 
ATOM   7639  O  OG1 . THR C 1 240 ? 31.507  45.012  22.287 1.00 39.80 ? 893  THR C OG1 1 
ATOM   7640  C  CG2 . THR C 1 240 ? 33.580  45.674  21.203 1.00 39.82 ? 893  THR C CG2 1 
ATOM   7641  N  N   . ASP C 1 241 ? 30.523  47.645  24.309 1.00 46.92 ? 894  ASP C N   1 
ATOM   7642  C  CA  . ASP C 1 241 ? 29.184  48.093  24.657 1.00 48.60 ? 894  ASP C CA  1 
ATOM   7643  C  C   . ASP C 1 241 ? 29.194  49.616  24.606 1.00 48.92 ? 894  ASP C C   1 
ATOM   7644  O  O   . ASP C 1 241 ? 29.866  50.281  25.418 1.00 47.75 ? 894  ASP C O   1 
ATOM   7645  C  CB  . ASP C 1 241 ? 28.780  47.633  26.042 1.00 48.83 ? 894  ASP C CB  1 
ATOM   7646  C  CG  . ASP C 1 241 ? 27.469  48.237  26.479 1.00 51.22 ? 894  ASP C CG  1 
ATOM   7647  O  OD1 . ASP C 1 241 ? 26.740  48.780  25.601 1.00 53.18 ? 894  ASP C OD1 1 
ATOM   7648  O  OD2 . ASP C 1 241 ? 27.166  48.168  27.690 1.00 49.30 ? 894  ASP C OD2 1 
ATOM   7649  N  N   . LEU C 1 242 ? 28.431  50.171  23.661 1.00 49.34 ? 895  LEU C N   1 
ATOM   7650  C  CA  . LEU C 1 242 ? 28.400  51.625  23.466 1.00 49.97 ? 895  LEU C CA  1 
ATOM   7651  C  C   . LEU C 1 242 ? 27.960  52.460  24.661 1.00 49.95 ? 895  LEU C C   1 
ATOM   7652  O  O   . LEU C 1 242 ? 28.188  53.662  24.696 1.00 50.04 ? 895  LEU C O   1 
ATOM   7653  C  CB  . LEU C 1 242 ? 27.579  51.958  22.219 1.00 50.73 ? 895  LEU C CB  1 
ATOM   7654  C  CG  . LEU C 1 242 ? 28.249  51.497  20.913 1.00 50.50 ? 895  LEU C CG  1 
ATOM   7655  C  CD1 . LEU C 1 242 ? 27.363  51.813  19.695 1.00 48.70 ? 895  LEU C CD1 1 
ATOM   7656  C  CD2 . LEU C 1 242 ? 29.614  52.185  20.801 1.00 48.75 ? 895  LEU C CD2 1 
ATOM   7657  N  N   . LYS C 1 243 ? 27.349  51.822  25.648 1.00 50.57 ? 896  LYS C N   1 
ATOM   7658  C  CA  . LYS C 1 243 ? 26.939  52.535  26.855 1.00 51.84 ? 896  LYS C CA  1 
ATOM   7659  C  C   . LYS C 1 243 ? 28.153  53.085  27.627 1.00 52.46 ? 896  LYS C C   1 
ATOM   7660  O  O   . LYS C 1 243 ? 28.053  54.090  28.357 1.00 51.39 ? 896  LYS C O   1 
ATOM   7661  C  CB  . LYS C 1 243 ? 26.136  51.607  27.766 1.00 52.20 ? 896  LYS C CB  1 
ATOM   7662  C  CG  . LYS C 1 243 ? 25.954  52.125  29.188 1.00 55.92 ? 896  LYS C CG  1 
ATOM   7663  C  CD  . LYS C 1 243 ? 24.911  53.243  29.310 1.00 58.83 ? 896  LYS C CD  1 
ATOM   7664  C  CE  . LYS C 1 243 ? 23.479  52.703  29.132 1.00 61.21 ? 896  LYS C CE  1 
ATOM   7665  N  NZ  . LYS C 1 243 ? 23.106  51.678  30.179 1.00 60.56 ? 896  LYS C NZ  1 
ATOM   7666  N  N   . LYS C 1 244 ? 29.308  52.435  27.472 1.00 52.47 ? 897  LYS C N   1 
ATOM   7667  C  CA  . LYS C 1 244 ? 30.489  52.884  28.184 1.00 51.61 ? 897  LYS C CA  1 
ATOM   7668  C  C   . LYS C 1 244 ? 31.397  53.711  27.309 1.00 51.21 ? 897  LYS C C   1 
ATOM   7669  O  O   . LYS C 1 244 ? 32.486  54.094  27.724 1.00 51.32 ? 897  LYS C O   1 
ATOM   7670  C  CB  . LYS C 1 244 ? 31.228  51.678  28.757 1.00 54.24 ? 897  LYS C CB  1 
ATOM   7671  C  CG  . LYS C 1 244 ? 30.344  50.847  29.680 1.00 56.09 ? 897  LYS C CG  1 
ATOM   7672  C  CD  . LYS C 1 244 ? 31.121  49.784  30.411 1.00 57.83 ? 897  LYS C CD  1 
ATOM   7673  C  CE  . LYS C 1 244 ? 30.210  49.037  31.381 1.00 60.34 ? 897  LYS C CE  1 
ATOM   7674  N  NZ  . LYS C 1 244 ? 30.850  47.757  31.857 1.00 61.41 ? 897  LYS C NZ  1 
ATOM   7675  N  N   . HIS C 1 245 ? 30.921  54.021  26.110 1.00 50.55 ? 898  HIS C N   1 
ATOM   7676  C  CA  . HIS C 1 245 ? 31.696  54.793  25.151 1.00 48.93 ? 898  HIS C CA  1 
ATOM   7677  C  C   . HIS C 1 245 ? 32.431  56.005  25.723 1.00 49.23 ? 898  HIS C C   1 
ATOM   7678  O  O   . HIS C 1 245 ? 33.636  56.191  25.505 1.00 48.75 ? 898  HIS C O   1 
ATOM   7679  C  CB  . HIS C 1 245 ? 30.798  55.275  24.004 1.00 47.47 ? 898  HIS C CB  1 
ATOM   7680  C  CG  . HIS C 1 245 ? 31.528  56.101  22.993 1.00 46.08 ? 898  HIS C CG  1 
ATOM   7681  N  ND1 . HIS C 1 245 ? 32.329  55.542  22.021 1.00 45.63 ? 898  HIS C ND1 1 
ATOM   7682  C  CD2 . HIS C 1 245 ? 31.698  57.441  22.894 1.00 46.26 ? 898  HIS C CD2 1 
ATOM   7683  C  CE1 . HIS C 1 245 ? 32.968  56.500  21.373 1.00 45.27 ? 898  HIS C CE1 1 
ATOM   7684  N  NE2 . HIS C 1 245 ? 32.603  57.663  21.881 1.00 46.14 ? 898  HIS C NE2 1 
ATOM   7685  N  N   . PHE C 1 246 ? 31.707  56.838  26.453 1.00 49.96 ? 899  PHE C N   1 
ATOM   7686  C  CA  . PHE C 1 246 ? 32.302  58.066  26.979 1.00 49.56 ? 899  PHE C CA  1 
ATOM   7687  C  C   . PHE C 1 246 ? 33.275  57.814  28.118 1.00 48.97 ? 899  PHE C C   1 
ATOM   7688  O  O   . PHE C 1 246 ? 34.287  58.512  28.247 1.00 49.06 ? 899  PHE C O   1 
ATOM   7689  C  CB  . PHE C 1 246 ? 31.194  59.065  27.380 1.00 49.22 ? 899  PHE C CB  1 
ATOM   7690  C  CG  . PHE C 1 246 ? 30.208  59.364  26.258 1.00 49.10 ? 899  PHE C CG  1 
ATOM   7691  C  CD1 . PHE C 1 246 ? 29.010  58.645  26.152 1.00 47.96 ? 899  PHE C CD1 1 
ATOM   7692  C  CD2 . PHE C 1 246 ? 30.509  60.312  25.275 1.00 49.20 ? 899  PHE C CD2 1 
ATOM   7693  C  CE1 . PHE C 1 246 ? 28.126  58.859  25.082 1.00 49.07 ? 899  PHE C CE1 1 
ATOM   7694  C  CE2 . PHE C 1 246 ? 29.632  60.535  24.197 1.00 49.35 ? 899  PHE C CE2 1 
ATOM   7695  C  CZ  . PHE C 1 246 ? 28.434  59.801  24.105 1.00 48.83 ? 899  PHE C CZ  1 
ATOM   7696  N  N   . ASP C 1 247 ? 32.981  56.811  28.934 1.00 49.10 ? 900  ASP C N   1 
ATOM   7697  C  CA  . ASP C 1 247 ? 33.879  56.451  30.032 1.00 47.98 ? 900  ASP C CA  1 
ATOM   7698  C  C   . ASP C 1 247 ? 35.254  56.103  29.439 1.00 47.68 ? 900  ASP C C   1 
ATOM   7699  O  O   . ASP C 1 247 ? 36.279  56.705  29.784 1.00 47.84 ? 900  ASP C O   1 
ATOM   7700  C  CB  . ASP C 1 247 ? 33.323  55.251  30.780 1.00 47.85 ? 900  ASP C CB  1 
ATOM   7701  C  CG  . ASP C 1 247 ? 32.072  55.576  31.541 1.00 48.45 ? 900  ASP C CG  1 
ATOM   7702  O  OD1 . ASP C 1 247 ? 32.010  56.681  32.122 1.00 47.96 ? 900  ASP C OD1 1 
ATOM   7703  O  OD2 . ASP C 1 247 ? 31.156  54.728  31.587 1.00 48.63 ? 900  ASP C OD2 1 
ATOM   7704  N  N   . PHE C 1 248 ? 35.280  55.142  28.526 1.00 47.53 ? 901  PHE C N   1 
ATOM   7705  C  CA  . PHE C 1 248 ? 36.542  54.755  27.912 1.00 48.05 ? 901  PHE C CA  1 
ATOM   7706  C  C   . PHE C 1 248 ? 37.277  55.930  27.261 1.00 48.57 ? 901  PHE C C   1 
ATOM   7707  O  O   . PHE C 1 248 ? 38.490  56.083  27.437 1.00 48.45 ? 901  PHE C O   1 
ATOM   7708  C  CB  . PHE C 1 248 ? 36.307  53.644  26.895 1.00 47.36 ? 901  PHE C CB  1 
ATOM   7709  C  CG  . PHE C 1 248 ? 36.114  52.271  27.519 1.00 48.85 ? 901  PHE C CG  1 
ATOM   7710  C  CD1 . PHE C 1 248 ? 34.878  51.634  27.460 1.00 47.66 ? 901  PHE C CD1 1 
ATOM   7711  C  CD2 . PHE C 1 248 ? 37.187  51.607  28.155 1.00 50.14 ? 901  PHE C CD2 1 
ATOM   7712  C  CE1 . PHE C 1 248 ? 34.686  50.361  28.014 1.00 49.30 ? 901  PHE C CE1 1 
ATOM   7713  C  CE2 . PHE C 1 248 ? 37.010  50.325  28.720 1.00 50.66 ? 901  PHE C CE2 1 
ATOM   7714  C  CZ  . PHE C 1 248 ? 35.750  49.699  28.648 1.00 50.05 ? 901  PHE C CZ  1 
ATOM   7715  N  N   . LEU C 1 249 ? 36.544  56.770  26.531 1.00 49.20 ? 902  LEU C N   1 
ATOM   7716  C  CA  . LEU C 1 249 ? 37.152  57.907  25.846 1.00 49.47 ? 902  LEU C CA  1 
ATOM   7717  C  C   . LEU C 1 249 ? 37.759  58.856  26.847 1.00 49.48 ? 902  LEU C C   1 
ATOM   7718  O  O   . LEU C 1 249 ? 38.913  59.257  26.714 1.00 49.66 ? 902  LEU C O   1 
ATOM   7719  C  CB  . LEU C 1 249 ? 36.118  58.652  24.985 1.00 49.75 ? 902  LEU C CB  1 
ATOM   7720  C  CG  . LEU C 1 249 ? 36.615  59.832  24.127 1.00 49.96 ? 902  LEU C CG  1 
ATOM   7721  C  CD1 . LEU C 1 249 ? 37.680  59.360  23.145 1.00 47.64 ? 902  LEU C CD1 1 
ATOM   7722  C  CD2 . LEU C 1 249 ? 35.447  60.468  23.371 1.00 49.44 ? 902  LEU C CD2 1 
ATOM   7723  N  N   . ALA C 1 250 ? 36.975  59.221  27.850 1.00 49.83 ? 903  ALA C N   1 
ATOM   7724  C  CA  . ALA C 1 250 ? 37.462  60.125  28.872 1.00 50.22 ? 903  ALA C CA  1 
ATOM   7725  C  C   . ALA C 1 250 ? 38.778  59.586  29.420 1.00 51.59 ? 903  ALA C C   1 
ATOM   7726  O  O   . ALA C 1 250 ? 39.813  60.262  29.383 1.00 51.79 ? 903  ALA C O   1 
ATOM   7727  C  CB  . ALA C 1 250 ? 36.438  60.238  29.984 1.00 48.14 ? 903  ALA C CB  1 
ATOM   7728  N  N   . GLU C 1 251 ? 38.744  58.357  29.917 1.00 52.39 ? 904  GLU C N   1 
ATOM   7729  C  CA  . GLU C 1 251 ? 39.950  57.782  30.476 1.00 54.29 ? 904  GLU C CA  1 
ATOM   7730  C  C   . GLU C 1 251 ? 41.103  57.779  29.474 1.00 53.40 ? 904  GLU C C   1 
ATOM   7731  O  O   . GLU C 1 251 ? 42.240  58.126  29.812 1.00 53.75 ? 904  GLU C O   1 
ATOM   7732  C  CB  . GLU C 1 251 ? 39.694  56.362  30.971 1.00 56.45 ? 904  GLU C CB  1 
ATOM   7733  C  CG  . GLU C 1 251 ? 40.846  55.843  31.810 1.00 62.05 ? 904  GLU C CG  1 
ATOM   7734  C  CD  . GLU C 1 251 ? 40.533  54.510  32.442 1.00 65.26 ? 904  GLU C CD  1 
ATOM   7735  O  OE1 . GLU C 1 251 ? 39.408  54.377  32.986 1.00 66.54 ? 904  GLU C OE1 1 
ATOM   7736  O  OE2 . GLU C 1 251 ? 41.408  53.603  32.404 1.00 67.33 ? 904  GLU C OE2 1 
ATOM   7737  N  N   . PHE C 1 252 ? 40.810  57.401  28.240 1.00 51.14 ? 905  PHE C N   1 
ATOM   7738  C  CA  . PHE C 1 252 ? 41.844  57.361  27.233 1.00 50.66 ? 905  PHE C CA  1 
ATOM   7739  C  C   . PHE C 1 252 ? 42.509  58.718  27.112 1.00 51.45 ? 905  PHE C C   1 
ATOM   7740  O  O   . PHE C 1 252 ? 43.720  58.852  27.269 1.00 52.17 ? 905  PHE C O   1 
ATOM   7741  C  CB  . PHE C 1 252 ? 41.251  56.978  25.901 1.00 49.48 ? 905  PHE C CB  1 
ATOM   7742  C  CG  . PHE C 1 252 ? 42.265  56.862  24.805 1.00 49.57 ? 905  PHE C CG  1 
ATOM   7743  C  CD1 . PHE C 1 252 ? 43.134  55.770  24.753 1.00 47.31 ? 905  PHE C CD1 1 
ATOM   7744  C  CD2 . PHE C 1 252 ? 42.348  57.842  23.813 1.00 46.63 ? 905  PHE C CD2 1 
ATOM   7745  C  CE1 . PHE C 1 252 ? 44.060  55.666  23.734 1.00 46.70 ? 905  PHE C CE1 1 
ATOM   7746  C  CE2 . PHE C 1 252 ? 43.272  57.739  22.800 1.00 46.47 ? 905  PHE C CE2 1 
ATOM   7747  C  CZ  . PHE C 1 252 ? 44.131  56.653  22.750 1.00 46.80 ? 905  PHE C CZ  1 
ATOM   7748  N  N   . ASN C 1 253 ? 41.702  59.723  26.828 1.00 52.35 ? 906  ASN C N   1 
ATOM   7749  C  CA  . ASN C 1 253 ? 42.195  61.073  26.685 1.00 53.64 ? 906  ASN C CA  1 
ATOM   7750  C  C   . ASN C 1 253 ? 43.043  61.507  27.860 1.00 55.31 ? 906  ASN C C   1 
ATOM   7751  O  O   . ASN C 1 253 ? 44.047  62.195  27.669 1.00 56.36 ? 906  ASN C O   1 
ATOM   7752  C  CB  . ASN C 1 253 ? 41.024  62.040  26.510 1.00 53.38 ? 906  ASN C CB  1 
ATOM   7753  C  CG  . ASN C 1 253 ? 40.521  62.067  25.096 1.00 52.45 ? 906  ASN C CG  1 
ATOM   7754  O  OD1 . ASN C 1 253 ? 41.282  62.372  24.162 1.00 51.26 ? 906  ASN C OD1 1 
ATOM   7755  N  ND2 . ASN C 1 253 ? 39.240  61.737  24.914 1.00 52.25 ? 906  ASN C ND2 1 
ATOM   7756  N  N   . ALA C 1 254 ? 42.647  61.118  29.070 1.00 55.92 ? 907  ALA C N   1 
ATOM   7757  C  CA  . ALA C 1 254 ? 43.423  61.481  30.252 1.00 57.85 ? 907  ALA C CA  1 
ATOM   7758  C  C   . ALA C 1 254 ? 44.844  60.906  30.120 1.00 59.81 ? 907  ALA C C   1 
ATOM   7759  O  O   . ALA C 1 254 ? 45.829  61.662  30.053 1.00 61.58 ? 907  ALA C O   1 
ATOM   7760  C  CB  . ALA C 1 254 ? 42.751  60.954  31.512 1.00 56.82 ? 907  ALA C CB  1 
ATOM   7761  N  N   . LYS C 1 255 ? 44.946  59.579  30.049 1.00 60.12 ? 908  LYS C N   1 
ATOM   7762  C  CA  . LYS C 1 255 ? 46.240  58.917  29.909 1.00 61.10 ? 908  LYS C CA  1 
ATOM   7763  C  C   . LYS C 1 255 ? 47.145  59.466  28.805 1.00 61.77 ? 908  LYS C C   1 
ATOM   7764  O  O   . LYS C 1 255 ? 48.365  59.513  28.977 1.00 61.82 ? 908  LYS C O   1 
ATOM   7765  C  CB  . LYS C 1 255 ? 46.051  57.410  29.662 1.00 62.49 ? 908  LYS C CB  1 
ATOM   7766  C  CG  . LYS C 1 255 ? 46.068  56.538  30.919 1.00 63.41 ? 908  LYS C CG  1 
ATOM   7767  C  CD  . LYS C 1 255 ? 47.451  56.560  31.556 1.00 63.80 ? 908  LYS C CD  1 
ATOM   7768  C  CE  . LYS C 1 255 ? 47.478  55.824  32.888 1.00 63.68 ? 908  LYS C CE  1 
ATOM   7769  N  NZ  . LYS C 1 255 ? 48.788  56.076  33.554 1.00 64.49 ? 908  LYS C NZ  1 
ATOM   7770  N  N   . ALA C 1 256 ? 46.574  59.894  27.681 1.00 62.09 ? 909  ALA C N   1 
ATOM   7771  C  CA  . ALA C 1 256 ? 47.422  60.357  26.581 1.00 61.91 ? 909  ALA C CA  1 
ATOM   7772  C  C   . ALA C 1 256 ? 47.059  61.621  25.822 1.00 62.08 ? 909  ALA C C   1 
ATOM   7773  O  O   . ALA C 1 256 ? 47.533  61.797  24.710 1.00 62.08 ? 909  ALA C O   1 
ATOM   7774  C  CB  . ALA C 1 256 ? 47.582  59.233  25.581 1.00 60.80 ? 909  ALA C CB  1 
ATOM   7775  N  N   . ASN C 1 257 ? 46.248  62.506  26.386 1.00 62.55 ? 910  ASN C N   1 
ATOM   7776  C  CA  . ASN C 1 257 ? 45.893  63.711  25.640 1.00 63.44 ? 910  ASN C CA  1 
ATOM   7777  C  C   . ASN C 1 257 ? 45.668  64.984  26.441 1.00 64.88 ? 910  ASN C C   1 
ATOM   7778  O  O   . ASN C 1 257 ? 46.056  66.075  26.010 1.00 65.22 ? 910  ASN C O   1 
ATOM   7779  C  CB  . ASN C 1 257 ? 44.660  63.451  24.771 1.00 62.41 ? 910  ASN C CB  1 
ATOM   7780  C  CG  . ASN C 1 257 ? 45.007  62.768  23.457 1.00 61.59 ? 910  ASN C CG  1 
ATOM   7781  O  OD1 . ASN C 1 257 ? 46.000  63.115  22.810 1.00 61.65 ? 910  ASN C OD1 1 
ATOM   7782  N  ND2 . ASN C 1 257 ? 44.182  61.813  23.046 1.00 59.48 ? 910  ASN C ND2 1 
ATOM   7783  N  N   . ASP C 1 258 ? 45.024  64.853  27.594 1.00 66.32 ? 911  ASP C N   1 
ATOM   7784  C  CA  . ASP C 1 258 ? 44.744  66.002  28.442 1.00 67.64 ? 911  ASP C CA  1 
ATOM   7785  C  C   . ASP C 1 258 ? 46.021  66.711  28.888 1.00 69.74 ? 911  ASP C C   1 
ATOM   7786  O  O   . ASP C 1 258 ? 47.123  66.110  28.919 1.00 70.15 ? 911  ASP C O   1 
ATOM   7787  C  CB  . ASP C 1 258 ? 43.930  65.555  29.652 1.00 67.28 ? 911  ASP C CB  1 
ATOM   7788  C  CG  . ASP C 1 258 ? 42.556  65.026  29.257 1.00 68.05 ? 911  ASP C CG  1 
ATOM   7789  O  OD1 . ASP C 1 258 ? 42.318  64.840  28.032 1.00 67.43 ? 911  ASP C OD1 1 
ATOM   7790  O  OD2 . ASP C 1 258 ? 41.715  64.791  30.164 1.00 66.87 ? 911  ASP C OD2 1 
ATOM   7791  N  N   . VAL C 1 259 ? 45.859  67.996  29.217 1.00 71.59 ? 912  VAL C N   1 
ATOM   7792  C  CA  . VAL C 1 259 ? 46.958  68.860  29.684 1.00 73.05 ? 912  VAL C CA  1 
ATOM   7793  C  C   . VAL C 1 259 ? 48.047  68.048  30.394 1.00 74.51 ? 912  VAL C C   1 
ATOM   7794  O  O   . VAL C 1 259 ? 49.227  68.103  30.027 1.00 74.69 ? 912  VAL C O   1 
ATOM   7795  C  CB  . VAL C 1 259 ? 46.439  69.953  30.688 1.00 72.95 ? 912  VAL C CB  1 
ATOM   7796  C  CG1 . VAL C 1 259 ? 45.427  70.877  29.992 1.00 72.43 ? 912  VAL C CG1 1 
ATOM   7797  C  CG2 . VAL C 1 259 ? 45.806  69.292  31.929 1.00 72.07 ? 912  VAL C CG2 1 
ATOM   7798  N  N   . ASN C 1 260 ? 47.614  67.287  31.396 1.00 75.44 ? 913  ASN C N   1 
ATOM   7799  C  CA  . ASN C 1 260 ? 48.487  66.447  32.204 1.00 76.65 ? 913  ASN C CA  1 
ATOM   7800  C  C   . ASN C 1 260 ? 49.124  65.374  31.318 1.00 77.20 ? 913  ASN C C   1 
ATOM   7801  O  O   . ASN C 1 260 ? 48.522  64.319  31.031 1.00 77.02 ? 913  ASN C O   1 
ATOM   7802  C  CB  . ASN C 1 260 ? 47.650  65.840  33.331 1.00 77.29 ? 913  ASN C CB  1 
ATOM   7803  C  CG  . ASN C 1 260 ? 46.642  66.853  33.909 1.00 78.34 ? 913  ASN C CG  1 
ATOM   7804  O  OD1 . ASN C 1 260 ? 46.984  68.029  34.157 1.00 78.33 ? 913  ASN C OD1 1 
ATOM   7805  N  ND2 . ASN C 1 260 ? 45.403  66.403  34.130 1.00 77.54 ? 913  ASN C ND2 1 
ATOM   7806  N  N   . SER C 1 261 ? 50.349  65.664  30.874 1.00 77.15 ? 914  SER C N   1 
ATOM   7807  C  CA  . SER C 1 261 ? 51.063  64.752  29.987 1.00 76.61 ? 914  SER C CA  1 
ATOM   7808  C  C   . SER C 1 261 ? 51.644  63.533  30.689 1.00 76.22 ? 914  SER C C   1 
ATOM   7809  O  O   . SER C 1 261 ? 52.839  63.467  31.017 1.00 76.27 ? 914  SER C O   1 
ATOM   7810  C  CB  . SER C 1 261 ? 52.179  65.477  29.232 1.00 77.25 ? 914  SER C CB  1 
ATOM   7811  O  OG  . SER C 1 261 ? 52.684  64.621  28.205 1.00 77.30 ? 914  SER C OG  1 
ATOM   7812  N  N   . ASN C 1 262 ? 50.788  62.551  30.915 1.00 75.09 ? 915  ASN C N   1 
ATOM   7813  C  CA  . ASN C 1 262 ? 51.259  61.344  31.547 1.00 73.79 ? 915  ASN C CA  1 
ATOM   7814  C  C   . ASN C 1 262 ? 51.620  60.316  30.455 1.00 72.40 ? 915  ASN C C   1 
ATOM   7815  O  O   . ASN C 1 262 ? 52.161  59.242  30.759 1.00 72.89 ? 915  ASN C O   1 
ATOM   7816  C  CB  . ASN C 1 262 ? 50.184  60.811  32.497 1.00 74.21 ? 915  ASN C CB  1 
ATOM   7817  C  CG  . ASN C 1 262 ? 50.745  59.840  33.519 1.00 74.46 ? 915  ASN C CG  1 
ATOM   7818  O  OD1 . ASN C 1 262 ? 51.072  58.687  33.191 1.00 75.28 ? 915  ASN C OD1 1 
ATOM   7819  N  ND2 . ASN C 1 262 ? 50.872  60.302  34.766 1.00 73.75 ? 915  ASN C ND2 1 
ATOM   7820  N  N   . GLY C 1 263 ? 51.329  60.672  29.195 1.00 69.88 ? 916  GLY C N   1 
ATOM   7821  C  CA  . GLY C 1 263 ? 51.593  59.815  28.046 1.00 66.07 ? 916  GLY C CA  1 
ATOM   7822  C  C   . GLY C 1 263 ? 51.214  58.351  28.233 1.00 63.36 ? 916  GLY C C   1 
ATOM   7823  O  O   . GLY C 1 263 ? 50.824  57.924  29.319 1.00 63.82 ? 916  GLY C O   1 
ATOM   7824  N  N   . ILE C 1 264 ? 51.299  57.566  27.167 1.00 61.39 ? 917  ILE C N   1 
ATOM   7825  C  CA  . ILE C 1 264 ? 50.998  56.147  27.284 1.00 60.07 ? 917  ILE C CA  1 
ATOM   7826  C  C   . ILE C 1 264 ? 52.293  55.480  27.735 1.00 58.68 ? 917  ILE C C   1 
ATOM   7827  O  O   . ILE C 1 264 ? 53.357  55.744  27.171 1.00 58.25 ? 917  ILE C O   1 
ATOM   7828  C  CB  . ILE C 1 264 ? 50.602  55.512  25.917 1.00 59.39 ? 917  ILE C CB  1 
ATOM   7829  C  CG1 . ILE C 1 264 ? 49.336  56.178  25.361 1.00 59.14 ? 917  ILE C CG1 1 
ATOM   7830  C  CG2 . ILE C 1 264 ? 50.369  54.008  26.078 1.00 56.68 ? 917  ILE C CG2 1 
ATOM   7831  C  CD1 . ILE C 1 264 ? 48.100  55.965  26.213 1.00 59.49 ? 917  ILE C CD1 1 
ATOM   7832  N  N   . GLU C 1 265 ? 52.214  54.649  28.768 1.00 58.26 ? 918  GLU C N   1 
ATOM   7833  C  CA  . GLU C 1 265 ? 53.388  53.901  29.244 1.00 57.59 ? 918  GLU C CA  1 
ATOM   7834  C  C   . GLU C 1 265 ? 53.244  52.459  28.726 1.00 54.98 ? 918  GLU C C   1 
ATOM   7835  O  O   . GLU C 1 265 ? 52.574  51.647  29.360 1.00 54.00 ? 918  GLU C O   1 
ATOM   7836  C  CB  . GLU C 1 265 ? 53.427  53.862  30.777 1.00 59.60 ? 918  GLU C CB  1 
ATOM   7837  C  CG  . GLU C 1 265 ? 54.204  54.971  31.473 1.00 63.55 ? 918  GLU C CG  1 
ATOM   7838  C  CD  . GLU C 1 265 ? 53.796  55.118  32.951 1.00 66.74 ? 918  GLU C CD  1 
ATOM   7839  O  OE1 . GLU C 1 265 ? 53.981  54.162  33.756 1.00 66.20 ? 918  GLU C OE1 1 
ATOM   7840  O  OE2 . GLU C 1 265 ? 53.271  56.205  33.302 1.00 69.34 ? 918  GLU C OE2 1 
ATOM   7841  N  N   . TRP C 1 266 ? 53.870  52.143  27.595 1.00 53.38 ? 919  TRP C N   1 
ATOM   7842  C  CA  . TRP C 1 266 ? 53.781  50.800  27.017 1.00 53.51 ? 919  TRP C CA  1 
ATOM   7843  C  C   . TRP C 1 266 ? 54.239  49.684  27.935 1.00 53.93 ? 919  TRP C C   1 
ATOM   7844  O  O   . TRP C 1 266 ? 53.947  48.508  27.706 1.00 53.99 ? 919  TRP C O   1 
ATOM   7845  C  CB  . TRP C 1 266 ? 54.568  50.736  25.719 1.00 53.45 ? 919  TRP C CB  1 
ATOM   7846  C  CG  . TRP C 1 266 ? 54.050  51.711  24.718 1.00 54.96 ? 919  TRP C CG  1 
ATOM   7847  C  CD1 . TRP C 1 266 ? 54.622  52.890  24.355 1.00 55.42 ? 919  TRP C CD1 1 
ATOM   7848  C  CD2 . TRP C 1 266 ? 52.784  51.653  24.042 1.00 54.79 ? 919  TRP C CD2 1 
ATOM   7849  N  NE1 . TRP C 1 266 ? 53.791  53.573  23.500 1.00 55.45 ? 919  TRP C NE1 1 
ATOM   7850  C  CE2 . TRP C 1 266 ? 52.657  52.831  23.290 1.00 54.97 ? 919  TRP C CE2 1 
ATOM   7851  C  CE3 . TRP C 1 266 ? 51.744  50.709  23.999 1.00 54.39 ? 919  TRP C CE3 1 
ATOM   7852  C  CZ2 . TRP C 1 266 ? 51.531  53.105  22.510 1.00 54.95 ? 919  TRP C CZ2 1 
ATOM   7853  C  CZ3 . TRP C 1 266 ? 50.625  50.983  23.223 1.00 53.60 ? 919  TRP C CZ3 1 
ATOM   7854  C  CH2 . TRP C 1 266 ? 50.533  52.167  22.488 1.00 53.88 ? 919  TRP C CH2 1 
ATOM   7855  N  N   . SER C 1 267 ? 54.963  50.049  28.978 1.00 53.31 ? 920  SER C N   1 
ATOM   7856  C  CA  . SER C 1 267 ? 55.439  49.064  29.920 1.00 54.10 ? 920  SER C CA  1 
ATOM   7857  C  C   . SER C 1 267 ? 54.335  48.761  30.908 1.00 53.54 ? 920  SER C C   1 
ATOM   7858  O  O   . SER C 1 267 ? 54.385  47.758  31.618 1.00 53.93 ? 920  SER C O   1 
ATOM   7859  C  CB  . SER C 1 267 ? 56.663  49.604  30.648 1.00 55.28 ? 920  SER C CB  1 
ATOM   7860  O  OG  . SER C 1 267 ? 56.423  50.930  31.094 1.00 58.72 ? 920  SER C OG  1 
ATOM   7861  N  N   . ASN C 1 268 ? 53.336  49.639  30.952 1.00 52.52 ? 921  ASN C N   1 
ATOM   7862  C  CA  . ASN C 1 268 ? 52.208  49.478  31.864 1.00 51.50 ? 921  ASN C CA  1 
ATOM   7863  C  C   . ASN C 1 268 ? 51.122  48.587  31.252 1.00 51.66 ? 921  ASN C C   1 
ATOM   7864  O  O   . ASN C 1 268 ? 50.590  48.875  30.191 1.00 51.77 ? 921  ASN C O   1 
ATOM   7865  C  CB  . ASN C 1 268 ? 51.636  50.853  32.198 1.00 51.77 ? 921  ASN C CB  1 
ATOM   7866  C  CG  . ASN C 1 268 ? 50.669  50.818  33.356 1.00 51.67 ? 921  ASN C CG  1 
ATOM   7867  O  OD1 . ASN C 1 268 ? 49.723  50.034  33.365 1.00 52.66 ? 921  ASN C OD1 1 
ATOM   7868  N  ND2 . ASN C 1 268 ? 50.899  51.671  34.344 1.00 52.44 ? 921  ASN C ND2 1 
ATOM   7869  N  N   . GLU C 1 269 ? 50.795  47.500  31.928 1.00 52.13 ? 922  GLU C N   1 
ATOM   7870  C  CA  . GLU C 1 269 ? 49.791  46.568  31.437 1.00 52.90 ? 922  GLU C CA  1 
ATOM   7871  C  C   . GLU C 1 269 ? 48.388  47.150  31.318 1.00 51.57 ? 922  GLU C C   1 
ATOM   7872  O  O   . GLU C 1 269 ? 47.585  46.705  30.505 1.00 50.25 ? 922  GLU C O   1 
ATOM   7873  C  CB  . GLU C 1 269 ? 49.717  45.372  32.361 1.00 54.50 ? 922  GLU C CB  1 
ATOM   7874  C  CG  . GLU C 1 269 ? 50.521  44.206  31.934 1.00 58.07 ? 922  GLU C CG  1 
ATOM   7875  C  CD  . GLU C 1 269 ? 50.464  43.117  32.986 1.00 61.77 ? 922  GLU C CD  1 
ATOM   7876  O  OE1 . GLU C 1 269 ? 49.505  43.167  33.820 1.00 60.66 ? 922  GLU C OE1 1 
ATOM   7877  O  OE2 . GLU C 1 269 ? 51.359  42.217  32.970 1.00 62.90 ? 922  GLU C OE2 1 
ATOM   7878  N  N   . ASN C 1 270 ? 48.084  48.113  32.164 1.00 50.55 ? 923  ASN C N   1 
ATOM   7879  C  CA  . ASN C 1 270 ? 46.772  48.723  32.135 1.00 51.44 ? 923  ASN C CA  1 
ATOM   7880  C  C   . ASN C 1 270 ? 46.674  49.678  30.956 1.00 51.09 ? 923  ASN C C   1 
ATOM   7881  O  O   . ASN C 1 270 ? 45.682  49.686  30.251 1.00 51.81 ? 923  ASN C O   1 
ATOM   7882  C  CB  . ASN C 1 270 ? 46.510  49.420  33.457 1.00 52.15 ? 923  ASN C CB  1 
ATOM   7883  C  CG  . ASN C 1 270 ? 46.216  48.427  34.569 1.00 54.32 ? 923  ASN C CG  1 
ATOM   7884  O  OD1 . ASN C 1 270 ? 46.168  48.779  35.747 1.00 55.09 ? 923  ASN C OD1 1 
ATOM   7885  N  ND2 . ASN C 1 270 ? 46.007  47.169  34.189 1.00 55.97 ? 923  ASN C ND2 1 
ATOM   7886  N  N   . ASP C 1 271 ? 47.721  50.454  30.731 1.00 49.88 ? 924  ASP C N   1 
ATOM   7887  C  CA  . ASP C 1 271 ? 47.749  51.363  29.618 1.00 49.68 ? 924  ASP C CA  1 
ATOM   7888  C  C   . ASP C 1 271 ? 47.611  50.575  28.317 1.00 49.93 ? 924  ASP C C   1 
ATOM   7889  O  O   . ASP C 1 271 ? 46.961  51.027  27.374 1.00 50.19 ? 924  ASP C O   1 
ATOM   7890  C  CB  . ASP C 1 271 ? 49.062  52.144  29.605 1.00 49.58 ? 924  ASP C CB  1 
ATOM   7891  C  CG  . ASP C 1 271 ? 49.122  53.176  30.689 1.00 49.58 ? 924  ASP C CG  1 
ATOM   7892  O  OD1 . ASP C 1 271 ? 48.528  52.943  31.767 1.00 50.26 ? 924  ASP C OD1 1 
ATOM   7893  O  OD2 . ASP C 1 271 ? 49.768  54.221  30.471 1.00 50.73 ? 924  ASP C OD2 1 
ATOM   7894  N  N   . ARG C 1 272 ? 48.219  49.400  28.252 1.00 48.46 ? 925  ARG C N   1 
ATOM   7895  C  CA  . ARG C 1 272 ? 48.123  48.614  27.030 1.00 48.11 ? 925  ARG C CA  1 
ATOM   7896  C  C   . ARG C 1 272 ? 46.706  48.055  26.818 1.00 47.34 ? 925  ARG C C   1 
ATOM   7897  O  O   . ARG C 1 272 ? 46.201  48.084  25.701 1.00 47.43 ? 925  ARG C O   1 
ATOM   7898  C  CB  . ARG C 1 272 ? 49.165  47.475  27.021 1.00 47.51 ? 925  ARG C CB  1 
ATOM   7899  C  CG  . ARG C 1 272 ? 50.596  47.953  27.171 1.00 46.70 ? 925  ARG C CG  1 
ATOM   7900  C  CD  . ARG C 1 272 ? 51.613  47.000  26.540 1.00 48.74 ? 925  ARG C CD  1 
ATOM   7901  N  NE  . ARG C 1 272 ? 51.652  45.677  27.171 1.00 49.80 ? 925  ARG C NE  1 
ATOM   7902  C  CZ  . ARG C 1 272 ? 52.218  45.406  28.345 1.00 50.67 ? 925  ARG C CZ  1 
ATOM   7903  N  NH1 . ARG C 1 272 ? 52.817  46.363  29.044 1.00 51.58 ? 925  ARG C NH1 1 
ATOM   7904  N  NH2 . ARG C 1 272 ? 52.160  44.178  28.832 1.00 49.49 ? 925  ARG C NH2 1 
ATOM   7905  N  N   . LEU C 1 273 ? 46.059  47.561  27.871 1.00 45.92 ? 926  LEU C N   1 
ATOM   7906  C  CA  . LEU C 1 273 ? 44.703  47.019  27.711 1.00 45.30 ? 926  LEU C CA  1 
ATOM   7907  C  C   . LEU C 1 273 ? 43.756  48.103  27.185 1.00 45.50 ? 926  LEU C C   1 
ATOM   7908  O  O   . LEU C 1 273 ? 42.995  47.877  26.256 1.00 45.51 ? 926  LEU C O   1 
ATOM   7909  C  CB  . LEU C 1 273 ? 44.167  46.516  29.041 1.00 43.40 ? 926  LEU C CB  1 
ATOM   7910  C  CG  . LEU C 1 273 ? 42.738  46.000  28.952 1.00 42.38 ? 926  LEU C CG  1 
ATOM   7911  C  CD1 . LEU C 1 273 ? 42.654  44.874  27.957 1.00 41.15 ? 926  LEU C CD1 1 
ATOM   7912  C  CD2 . LEU C 1 273 ? 42.286  45.543  30.313 1.00 41.85 ? 926  LEU C CD2 1 
ATOM   7913  N  N   . LEU C 1 274 ? 43.814  49.269  27.816 1.00 44.29 ? 927  LEU C N   1 
ATOM   7914  C  CA  . LEU C 1 274 ? 43.013  50.390  27.439 1.00 45.25 ? 927  LEU C CA  1 
ATOM   7915  C  C   . LEU C 1 274 ? 43.163  50.630  25.937 1.00 45.14 ? 927  LEU C C   1 
ATOM   7916  O  O   . LEU C 1 274 ? 42.172  50.663  25.207 1.00 46.14 ? 927  LEU C O   1 
ATOM   7917  C  CB  . LEU C 1 274 ? 43.459  51.640  28.209 1.00 45.21 ? 927  LEU C CB  1 
ATOM   7918  C  CG  . LEU C 1 274 ? 42.569  52.880  27.962 1.00 46.71 ? 927  LEU C CG  1 
ATOM   7919  C  CD1 . LEU C 1 274 ? 41.178  52.627  28.538 1.00 45.66 ? 927  LEU C CD1 1 
ATOM   7920  C  CD2 . LEU C 1 274 ? 43.172  54.116  28.591 1.00 46.49 ? 927  LEU C CD2 1 
ATOM   7921  N  N   . VAL C 1 275 ? 44.404  50.785  25.481 1.00 44.27 ? 928  VAL C N   1 
ATOM   7922  C  CA  . VAL C 1 275 ? 44.692  51.020  24.074 1.00 42.66 ? 928  VAL C CA  1 
ATOM   7923  C  C   . VAL C 1 275 ? 44.010  49.990  23.214 1.00 43.23 ? 928  VAL C C   1 
ATOM   7924  O  O   . VAL C 1 275 ? 43.407  50.335  22.187 1.00 45.43 ? 928  VAL C O   1 
ATOM   7925  C  CB  . VAL C 1 275 ? 46.207  50.986  23.781 1.00 42.69 ? 928  VAL C CB  1 
ATOM   7926  C  CG1 . VAL C 1 275 ? 46.460  50.887  22.274 1.00 41.41 ? 928  VAL C CG1 1 
ATOM   7927  C  CG2 . VAL C 1 275 ? 46.851  52.247  24.321 1.00 41.70 ? 928  VAL C CG2 1 
ATOM   7928  N  N   . CYS C 1 276 ? 44.104  48.727  23.616 1.00 42.40 ? 929  CYS C N   1 
ATOM   7929  C  CA  . CYS C 1 276 ? 43.465  47.649  22.869 1.00 41.96 ? 929  CYS C CA  1 
ATOM   7930  C  C   . CYS C 1 276 ? 41.942  47.836  22.881 1.00 40.00 ? 929  CYS C C   1 
ATOM   7931  O  O   . CYS C 1 276 ? 41.282  47.605  21.879 1.00 39.29 ? 929  CYS C O   1 
ATOM   7932  C  CB  . CYS C 1 276 ? 43.842  46.283  23.462 1.00 42.60 ? 929  CYS C CB  1 
ATOM   7933  S  SG  . CYS C 1 276 ? 45.610  45.783  23.255 1.00 49.22 ? 929  CYS C SG  1 
ATOM   7934  N  N   . GLN C 1 277 ? 41.388  48.262  24.009 1.00 38.71 ? 930  GLN C N   1 
ATOM   7935  C  CA  . GLN C 1 277 ? 39.947  48.486  24.091 1.00 39.18 ? 930  GLN C CA  1 
ATOM   7936  C  C   . GLN C 1 277 ? 39.480  49.649  23.179 1.00 39.61 ? 930  GLN C C   1 
ATOM   7937  O  O   . GLN C 1 277 ? 38.497  49.527  22.438 1.00 38.50 ? 930  GLN C O   1 
ATOM   7938  C  CB  . GLN C 1 277 ? 39.558  48.740  25.538 1.00 38.29 ? 930  GLN C CB  1 
ATOM   7939  C  CG  . GLN C 1 277 ? 39.816  47.532  26.434 1.00 38.49 ? 930  GLN C CG  1 
ATOM   7940  C  CD  . GLN C 1 277 ? 39.529  47.819  27.887 1.00 38.26 ? 930  GLN C CD  1 
ATOM   7941  O  OE1 . GLN C 1 277 ? 40.109  48.744  28.487 1.00 37.43 ? 930  GLN C OE1 1 
ATOM   7942  N  NE2 . GLN C 1 277 ? 38.632  47.023  28.474 1.00 38.24 ? 930  GLN C NE2 1 
ATOM   7943  N  N   . VAL C 1 278 ? 40.190  50.764  23.239 1.00 39.45 ? 931  VAL C N   1 
ATOM   7944  C  CA  . VAL C 1 278 ? 39.884  51.903  22.393 1.00 41.22 ? 931  VAL C CA  1 
ATOM   7945  C  C   . VAL C 1 278 ? 40.057  51.494  20.926 1.00 42.80 ? 931  VAL C C   1 
ATOM   7946  O  O   . VAL C 1 278 ? 39.318  51.954  20.046 1.00 42.50 ? 931  VAL C O   1 
ATOM   7947  C  CB  . VAL C 1 278 ? 40.826  53.056  22.660 1.00 40.96 ? 931  VAL C CB  1 
ATOM   7948  C  CG1 . VAL C 1 278 ? 40.447  54.230  21.794 1.00 42.01 ? 931  VAL C CG1 1 
ATOM   7949  C  CG2 . VAL C 1 278 ? 40.769  53.425  24.110 1.00 40.28 ? 931  VAL C CG2 1 
ATOM   7950  N  N   . CYS C 1 279 ? 41.041  50.630  20.673 1.00 43.28 ? 932  CYS C N   1 
ATOM   7951  C  CA  . CYS C 1 279 ? 41.303  50.135  19.325 1.00 42.95 ? 932  CYS C CA  1 
ATOM   7952  C  C   . CYS C 1 279 ? 40.173  49.215  18.861 1.00 42.39 ? 932  CYS C C   1 
ATOM   7953  O  O   . CYS C 1 279 ? 39.713  49.314  17.724 1.00 42.83 ? 932  CYS C O   1 
ATOM   7954  C  CB  . CYS C 1 279 ? 42.632  49.380  19.282 1.00 43.28 ? 932  CYS C CB  1 
ATOM   7955  S  SG  . CYS C 1 279 ? 43.023  48.609  17.684 1.00 45.57 ? 932  CYS C SG  1 
ATOM   7956  N  N   . ILE C 1 280 ? 39.706  48.317  19.721 1.00 40.65 ? 933  ILE C N   1 
ATOM   7957  C  CA  . ILE C 1 280 ? 38.616  47.463  19.265 1.00 39.21 ? 933  ILE C CA  1 
ATOM   7958  C  C   . ILE C 1 280 ? 37.302  48.260  19.165 1.00 39.36 ? 933  ILE C C   1 
ATOM   7959  O  O   . ILE C 1 280 ? 36.394  47.866  18.465 1.00 39.27 ? 933  ILE C O   1 
ATOM   7960  C  CB  . ILE C 1 280 ? 38.405  46.212  20.168 1.00 36.54 ? 933  ILE C CB  1 
ATOM   7961  C  CG1 . ILE C 1 280 ? 37.526  45.213  19.414 1.00 34.48 ? 933  ILE C CG1 1 
ATOM   7962  C  CG2 . ILE C 1 280 ? 37.799  46.582  21.505 1.00 33.30 ? 933  ILE C CG2 1 
ATOM   7963  C  CD1 . ILE C 1 280 ? 37.113  44.030  20.253 1.00 36.74 ? 933  ILE C CD1 1 
ATOM   7964  N  N   . LYS C 1 281 ? 37.204  49.372  19.880 1.00 40.67 ? 934  LYS C N   1 
ATOM   7965  C  CA  . LYS C 1 281 ? 36.005  50.187  19.816 1.00 42.67 ? 934  LYS C CA  1 
ATOM   7966  C  C   . LYS C 1 281 ? 35.953  50.855  18.431 1.00 43.30 ? 934  LYS C C   1 
ATOM   7967  O  O   . LYS C 1 281 ? 34.979  50.727  17.698 1.00 43.39 ? 934  LYS C O   1 
ATOM   7968  C  CB  . LYS C 1 281 ? 36.024  51.252  20.928 1.00 43.58 ? 934  LYS C CB  1 
ATOM   7969  C  CG  . LYS C 1 281 ? 35.519  50.746  22.294 1.00 43.54 ? 934  LYS C CG  1 
ATOM   7970  C  CD  . LYS C 1 281 ? 35.429  51.856  23.325 1.00 45.00 ? 934  LYS C CD  1 
ATOM   7971  C  CE  . LYS C 1 281 ? 34.643  53.079  22.810 1.00 45.30 ? 934  LYS C CE  1 
ATOM   7972  N  NZ  . LYS C 1 281 ? 33.245  52.730  22.438 1.00 45.89 ? 934  LYS C NZ  1 
ATOM   7973  N  N   . LEU C 1 282 ? 37.026  51.555  18.086 1.00 44.05 ? 935  LEU C N   1 
ATOM   7974  C  CA  . LEU C 1 282 ? 37.143  52.216  16.798 1.00 43.83 ? 935  LEU C CA  1 
ATOM   7975  C  C   . LEU C 1 282 ? 36.907  51.220  15.663 1.00 43.58 ? 935  LEU C C   1 
ATOM   7976  O  O   . LEU C 1 282 ? 36.206  51.515  14.701 1.00 45.08 ? 935  LEU C O   1 
ATOM   7977  C  CB  . LEU C 1 282 ? 38.530  52.850  16.679 1.00 43.60 ? 935  LEU C CB  1 
ATOM   7978  C  CG  . LEU C 1 282 ? 38.931  53.555  15.385 1.00 44.82 ? 935  LEU C CG  1 
ATOM   7979  C  CD1 . LEU C 1 282 ? 40.143  54.432  15.644 1.00 45.07 ? 935  LEU C CD1 1 
ATOM   7980  C  CD2 . LEU C 1 282 ? 39.226  52.527  14.294 1.00 44.38 ? 935  LEU C CD2 1 
ATOM   7981  N  N   . ALA C 1 283 ? 37.483  50.036  15.784 1.00 42.18 ? 936  ALA C N   1 
ATOM   7982  C  CA  . ALA C 1 283 ? 37.323  49.006  14.774 1.00 40.59 ? 936  ALA C CA  1 
ATOM   7983  C  C   . ALA C 1 283 ? 35.882  48.541  14.673 1.00 39.78 ? 936  ALA C C   1 
ATOM   7984  O  O   . ALA C 1 283 ? 35.443  48.154  13.600 1.00 41.53 ? 936  ALA C O   1 
ATOM   7985  C  CB  . ALA C 1 283 ? 38.227  47.804  15.101 1.00 39.64 ? 936  ALA C CB  1 
ATOM   7986  N  N   . ASP C 1 284 ? 35.145  48.555  15.779 1.00 37.55 ? 937  ASP C N   1 
ATOM   7987  C  CA  . ASP C 1 284 ? 33.749  48.092  15.747 1.00 36.87 ? 937  ASP C CA  1 
ATOM   7988  C  C   . ASP C 1 284 ? 32.785  49.048  14.998 1.00 36.73 ? 937  ASP C C   1 
ATOM   7989  O  O   . ASP C 1 284 ? 31.753  48.616  14.502 1.00 34.78 ? 937  ASP C O   1 
ATOM   7990  C  CB  . ASP C 1 284 ? 33.220  47.865  17.180 1.00 35.46 ? 937  ASP C CB  1 
ATOM   7991  C  CG  . ASP C 1 284 ? 32.021  46.926  17.215 1.00 33.87 ? 937  ASP C CG  1 
ATOM   7992  O  OD1 . ASP C 1 284 ? 31.857  46.141  16.258 1.00 33.75 ? 937  ASP C OD1 1 
ATOM   7993  O  OD2 . ASP C 1 284 ? 31.252  46.947  18.198 1.00 34.36 ? 937  ASP C OD2 1 
ATOM   7994  N  N   . ILE C 1 285 ? 33.126  50.330  14.939 1.00 36.09 ? 938  ILE C N   1 
ATOM   7995  C  CA  . ILE C 1 285 ? 32.297  51.315  14.256 1.00 38.48 ? 938  ILE C CA  1 
ATOM   7996  C  C   . ILE C 1 285 ? 33.091  52.021  13.143 1.00 39.88 ? 938  ILE C C   1 
ATOM   7997  O  O   . ILE C 1 285 ? 32.900  53.197  12.898 1.00 40.94 ? 938  ILE C O   1 
ATOM   7998  C  CB  . ILE C 1 285 ? 31.766  52.385  15.262 1.00 37.14 ? 938  ILE C CB  1 
ATOM   7999  C  CG1 . ILE C 1 285 ? 32.929  53.126  15.924 1.00 34.81 ? 938  ILE C CG1 1 
ATOM   8000  C  CG2 . ILE C 1 285 ? 30.893  51.728  16.327 1.00 35.63 ? 938  ILE C CG2 1 
ATOM   8001  C  CD1 . ILE C 1 285 ? 32.503  54.023  17.062 1.00 33.65 ? 938  ILE C CD1 1 
ATOM   8002  N  N   . ASN C 1 286 ? 33.977  51.289  12.472 1.00 42.60 ? 939  ASN C N   1 
ATOM   8003  C  CA  . ASN C 1 286 ? 34.831  51.848  11.418 1.00 44.21 ? 939  ASN C CA  1 
ATOM   8004  C  C   . ASN C 1 286 ? 34.155  52.268  10.096 1.00 45.37 ? 939  ASN C C   1 
ATOM   8005  O  O   . ASN C 1 286 ? 34.727  53.063  9.345  1.00 44.44 ? 939  ASN C O   1 
ATOM   8006  C  CB  . ASN C 1 286 ? 35.954  50.864  11.069 1.00 44.07 ? 939  ASN C CB  1 
ATOM   8007  C  CG  . ASN C 1 286 ? 35.460  49.696  10.242 1.00 44.94 ? 939  ASN C CG  1 
ATOM   8008  O  OD1 . ASN C 1 286 ? 35.371  48.570  10.727 1.00 44.98 ? 939  ASN C OD1 1 
ATOM   8009  N  ND2 . ASN C 1 286 ? 35.113  49.964  8.987  1.00 46.68 ? 939  ASN C ND2 1 
ATOM   8010  N  N   . GLY C 1 287 ? 32.975  51.720  9.805  1.00 44.84 ? 940  GLY C N   1 
ATOM   8011  C  CA  . GLY C 1 287 ? 32.271  52.048  8.570  1.00 44.53 ? 940  GLY C CA  1 
ATOM   8012  C  C   . GLY C 1 287 ? 32.464  53.446  7.988  1.00 43.84 ? 940  GLY C C   1 
ATOM   8013  O  O   . GLY C 1 287 ? 32.923  53.579  6.860  1.00 42.25 ? 940  GLY C O   1 
ATOM   8014  N  N   . PRO C 1 288 ? 32.109  54.509  8.731  1.00 44.99 ? 941  PRO C N   1 
ATOM   8015  C  CA  . PRO C 1 288 ? 32.263  55.879  8.241  1.00 45.29 ? 941  PRO C CA  1 
ATOM   8016  C  C   . PRO C 1 288 ? 33.689  56.386  8.025  1.00 45.64 ? 941  PRO C C   1 
ATOM   8017  O  O   . PRO C 1 288 ? 33.890  57.524  7.580  1.00 46.15 ? 941  PRO C O   1 
ATOM   8018  C  CB  . PRO C 1 288 ? 31.479  56.707  9.273  1.00 44.88 ? 941  PRO C CB  1 
ATOM   8019  C  CG  . PRO C 1 288 ? 31.493  55.886  10.470 1.00 45.40 ? 941  PRO C CG  1 
ATOM   8020  C  CD  . PRO C 1 288 ? 31.302  54.499  9.963  1.00 44.87 ? 941  PRO C CD  1 
ATOM   8021  N  N   . ALA C 1 289 ? 34.678  55.547  8.317  1.00 45.80 ? 942  ALA C N   1 
ATOM   8022  C  CA  . ALA C 1 289 ? 36.087  55.925  8.158  1.00 44.82 ? 942  ALA C CA  1 
ATOM   8023  C  C   . ALA C 1 289 ? 36.697  55.176  7.005  1.00 44.08 ? 942  ALA C C   1 
ATOM   8024  O  O   . ALA C 1 289 ? 37.896  55.247  6.766  1.00 43.46 ? 942  ALA C O   1 
ATOM   8025  C  CB  . ALA C 1 289 ? 36.855  55.630  9.425  1.00 45.65 ? 942  ALA C CB  1 
ATOM   8026  N  N   . LYS C 1 290 ? 35.835  54.442  6.313  1.00 44.00 ? 943  LYS C N   1 
ATOM   8027  C  CA  . LYS C 1 290 ? 36.198  53.673  5.138  1.00 45.46 ? 943  LYS C CA  1 
ATOM   8028  C  C   . LYS C 1 290 ? 35.743  54.455  3.882  1.00 45.31 ? 943  LYS C C   1 
ATOM   8029  O  O   . LYS C 1 290 ? 34.955  55.403  3.964  1.00 45.58 ? 943  LYS C O   1 
ATOM   8030  C  CB  . LYS C 1 290 ? 35.497  52.301  5.167  1.00 45.61 ? 943  LYS C CB  1 
ATOM   8031  C  CG  . LYS C 1 290 ? 35.921  51.354  6.293  1.00 45.62 ? 943  LYS C CG  1 
ATOM   8032  C  CD  . LYS C 1 290 ? 37.359  50.832  6.098  1.00 47.44 ? 943  LYS C CD  1 
ATOM   8033  C  CE  . LYS C 1 290 ? 37.704  49.692  7.059  1.00 47.10 ? 943  LYS C CE  1 
ATOM   8034  N  NZ  . LYS C 1 290 ? 36.869  48.466  6.841  1.00 48.07 ? 943  LYS C NZ  1 
ATOM   8035  N  N   . VAL C 1 291 ? 36.250  54.057  2.726  1.00 44.55 ? 944  VAL C N   1 
ATOM   8036  C  CA  . VAL C 1 291 ? 35.876  54.692  1.483  1.00 43.49 ? 944  VAL C CA  1 
ATOM   8037  C  C   . VAL C 1 291 ? 34.343  54.579  1.327  1.00 43.26 ? 944  VAL C C   1 
ATOM   8038  O  O   . VAL C 1 291 ? 33.750  53.582  1.735  1.00 42.54 ? 944  VAL C O   1 
ATOM   8039  C  CB  . VAL C 1 291 ? 36.573  53.993  0.288  1.00 42.48 ? 944  VAL C CB  1 
ATOM   8040  C  CG1 . VAL C 1 291 ? 35.960  52.640  0.071  1.00 39.39 ? 944  VAL C CG1 1 
ATOM   8041  C  CG2 . VAL C 1 291 ? 36.439  54.838  -0.977 1.00 42.36 ? 944  VAL C CG2 1 
ATOM   8042  N  N   . ARG C 1 292 ? 33.733  55.617  0.739  1.00 43.20 ? 945  ARG C N   1 
ATOM   8043  C  CA  . ARG C 1 292 ? 32.283  55.738  0.491  1.00 42.12 ? 945  ARG C CA  1 
ATOM   8044  C  C   . ARG C 1 292 ? 31.470  54.471  0.216  1.00 42.16 ? 945  ARG C C   1 
ATOM   8045  O  O   . ARG C 1 292 ? 30.471  54.165  0.856  1.00 42.25 ? 945  ARG C O   1 
ATOM   8046  C  CB  . ARG C 1 292 ? 32.053  56.693  -0.689 1.00 42.42 ? 945  ARG C CB  1 
ATOM   8047  C  CG  . ARG C 1 292 ? 30.593  56.792  -1.186 1.00 40.56 ? 945  ARG C CG  1 
ATOM   8048  C  CD  . ARG C 1 292 ? 30.512  57.377  -2.591 1.00 38.78 ? 945  ARG C CD  1 
ATOM   8049  N  NE  . ARG C 1 292 ? 29.132  57.560  -3.034 1.00 38.06 ? 945  ARG C NE  1 
ATOM   8050  C  CZ  . ARG C 1 292 ? 28.383  58.637  -2.777 1.00 37.12 ? 945  ARG C CZ  1 
ATOM   8051  N  NH1 . ARG C 1 292 ? 28.852  59.660  -2.086 1.00 34.43 ? 945  ARG C NH1 1 
ATOM   8052  N  NH2 . ARG C 1 292 ? 27.141  58.684  -3.208 1.00 37.44 ? 945  ARG C NH2 1 
ATOM   8053  N  N   . ASP C 1 293 ? 31.900  53.748  -0.780 1.00 43.77 ? 946  ASP C N   1 
ATOM   8054  C  CA  . ASP C 1 293 ? 31.218  52.554  -1.224 1.00 44.97 ? 946  ASP C CA  1 
ATOM   8055  C  C   . ASP C 1 293 ? 31.118  51.479  -0.148 1.00 45.51 ? 946  ASP C C   1 
ATOM   8056  O  O   . ASP C 1 293 ? 30.179  50.664  -0.144 1.00 46.38 ? 946  ASP C O   1 
ATOM   8057  C  CB  . ASP C 1 293 ? 31.975  52.096  -2.463 1.00 47.46 ? 946  ASP C CB  1 
ATOM   8058  C  CG  . ASP C 1 293 ? 32.354  53.301  -3.370 1.00 52.44 ? 946  ASP C CG  1 
ATOM   8059  O  OD1 . ASP C 1 293 ? 31.430  53.869  -4.020 1.00 54.45 ? 946  ASP C OD1 1 
ATOM   8060  O  OD2 . ASP C 1 293 ? 33.551  53.712  -3.408 1.00 51.95 ? 946  ASP C OD2 1 
ATOM   8061  N  N   . LEU C 1 294 ? 32.087  51.493  0.769  1.00 43.97 ? 947  LEU C N   1 
ATOM   8062  C  CA  . LEU C 1 294 ? 32.149  50.539  1.863  1.00 41.89 ? 947  LEU C CA  1 
ATOM   8063  C  C   . LEU C 1 294 ? 31.280  51.093  2.967  1.00 40.07 ? 947  LEU C C   1 
ATOM   8064  O  O   . LEU C 1 294 ? 30.453  50.387  3.517  1.00 39.37 ? 947  LEU C O   1 
ATOM   8065  C  CB  . LEU C 1 294 ? 33.597  50.403  2.334  1.00 42.58 ? 947  LEU C CB  1 
ATOM   8066  C  CG  . LEU C 1 294 ? 34.390  49.097  2.482  1.00 41.51 ? 947  LEU C CG  1 
ATOM   8067  C  CD1 . LEU C 1 294 ? 33.947  48.011  1.522  1.00 40.51 ? 947  LEU C CD1 1 
ATOM   8068  C  CD2 . LEU C 1 294 ? 35.855  49.450  2.267  1.00 39.75 ? 947  LEU C CD2 1 
ATOM   8069  N  N   . HIS C 1 295 ? 31.450  52.375  3.263  1.00 39.36 ? 948  HIS C N   1 
ATOM   8070  C  CA  . HIS C 1 295 ? 30.657  53.039  4.295  1.00 40.05 ? 948  HIS C CA  1 
ATOM   8071  C  C   . HIS C 1 295 ? 29.128  52.932  4.045  1.00 40.48 ? 948  HIS C C   1 
ATOM   8072  O  O   . HIS C 1 295 ? 28.347  52.682  4.971  1.00 40.75 ? 948  HIS C O   1 
ATOM   8073  C  CB  . HIS C 1 295 ? 31.103  54.508  4.395  1.00 38.51 ? 948  HIS C CB  1 
ATOM   8074  C  CG  . HIS C 1 295 ? 30.041  55.451  4.886  1.00 40.55 ? 948  HIS C CG  1 
ATOM   8075  N  ND1 . HIS C 1 295 ? 29.401  55.299  6.103  1.00 40.76 ? 948  HIS C ND1 1 
ATOM   8076  C  CD2 . HIS C 1 295 ? 29.537  56.586  4.335  1.00 39.77 ? 948  HIS C CD2 1 
ATOM   8077  C  CE1 . HIS C 1 295 ? 28.553  56.301  6.278  1.00 40.82 ? 948  HIS C CE1 1 
ATOM   8078  N  NE2 . HIS C 1 295 ? 28.618  57.096  5.221  1.00 39.69 ? 948  HIS C NE2 1 
ATOM   8079  N  N   . LEU C 1 296 ? 28.702  53.106  2.799  1.00 39.98 ? 949  LEU C N   1 
ATOM   8080  C  CA  . LEU C 1 296 ? 27.283  53.025  2.479  1.00 40.17 ? 949  LEU C CA  1 
ATOM   8081  C  C   . LEU C 1 296 ? 26.732  51.603  2.573  1.00 40.65 ? 949  LEU C C   1 
ATOM   8082  O  O   . LEU C 1 296 ? 25.556  51.390  2.861  1.00 38.70 ? 949  LEU C O   1 
ATOM   8083  C  CB  . LEU C 1 296 ? 27.034  53.582  1.080  1.00 39.63 ? 949  LEU C CB  1 
ATOM   8084  C  CG  . LEU C 1 296 ? 27.301  55.077  0.897  1.00 37.89 ? 949  LEU C CG  1 
ATOM   8085  C  CD1 . LEU C 1 296 ? 27.125  55.447  -0.587 1.00 36.14 ? 949  LEU C CD1 1 
ATOM   8086  C  CD2 . LEU C 1 296 ? 26.359  55.861  1.800  1.00 34.12 ? 949  LEU C CD2 1 
ATOM   8087  N  N   . LYS C 1 297 ? 27.579  50.622  2.317  1.00 41.72 ? 950  LYS C N   1 
ATOM   8088  C  CA  . LYS C 1 297 ? 27.136  49.247  2.415  1.00 43.15 ? 950  LYS C CA  1 
ATOM   8089  C  C   . LYS C 1 297 ? 26.835  48.915  3.898  1.00 44.37 ? 950  LYS C C   1 
ATOM   8090  O  O   . LYS C 1 297 ? 25.827  48.257  4.205  1.00 44.48 ? 950  LYS C O   1 
ATOM   8091  C  CB  . LYS C 1 297 ? 28.222  48.334  1.866  1.00 45.90 ? 950  LYS C CB  1 
ATOM   8092  C  CG  . LYS C 1 297 ? 27.726  47.001  1.353  1.00 49.03 ? 950  LYS C CG  1 
ATOM   8093  C  CD  . LYS C 1 297 ? 27.279  47.075  -0.096 1.00 49.83 ? 950  LYS C CD  1 
ATOM   8094  C  CE  . LYS C 1 297 ? 26.710  45.728  -0.550 1.00 52.15 ? 950  LYS C CE  1 
ATOM   8095  N  NZ  . LYS C 1 297 ? 25.581  45.308  0.338  1.00 52.62 ? 950  LYS C NZ  1 
ATOM   8096  N  N   . TRP C 1 298 ? 27.678  49.393  4.820  1.00 43.20 ? 951  TRP C N   1 
ATOM   8097  C  CA  . TRP C 1 298 ? 27.457  49.119  6.249  1.00 42.61 ? 951  TRP C CA  1 
ATOM   8098  C  C   . TRP C 1 298 ? 26.358  50.017  6.824  1.00 41.95 ? 951  TRP C C   1 
ATOM   8099  O  O   . TRP C 1 298 ? 25.660  49.640  7.769  1.00 40.33 ? 951  TRP C O   1 
ATOM   8100  C  CB  . TRP C 1 298 ? 28.751  49.285  7.083  1.00 43.89 ? 951  TRP C CB  1 
ATOM   8101  C  CG  . TRP C 1 298 ? 29.846  48.273  6.804  1.00 44.46 ? 951  TRP C CG  1 
ATOM   8102  C  CD1 . TRP C 1 298 ? 31.045  48.516  6.193  1.00 44.72 ? 951  TRP C CD1 1 
ATOM   8103  C  CD2 . TRP C 1 298 ? 29.813  46.863  7.060  1.00 44.22 ? 951  TRP C CD2 1 
ATOM   8104  N  NE1 . TRP C 1 298 ? 31.747  47.350  6.039  1.00 45.17 ? 951  TRP C NE1 1 
ATOM   8105  C  CE2 . TRP C 1 298 ? 31.016  46.318  6.556  1.00 45.01 ? 951  TRP C CE2 1 
ATOM   8106  C  CE3 . TRP C 1 298 ? 28.879  46.004  7.649  1.00 44.76 ? 951  TRP C CE3 1 
ATOM   8107  C  CZ2 . TRP C 1 298 ? 31.313  44.952  6.627  1.00 45.27 ? 951  TRP C CZ2 1 
ATOM   8108  C  CZ3 . TRP C 1 298 ? 29.174  44.637  7.715  1.00 44.14 ? 951  TRP C CZ3 1 
ATOM   8109  C  CH2 . TRP C 1 298 ? 30.379  44.129  7.202  1.00 43.82 ? 951  TRP C CH2 1 
ATOM   8110  N  N   . THR C 1 299 ? 26.207  51.216  6.273  1.00 41.79 ? 952  THR C N   1 
ATOM   8111  C  CA  . THR C 1 299 ? 25.145  52.094  6.749  1.00 40.55 ? 952  THR C CA  1 
ATOM   8112  C  C   . THR C 1 299 ? 23.843  51.399  6.458  1.00 40.21 ? 952  THR C C   1 
ATOM   8113  O  O   . THR C 1 299 ? 22.921  51.410  7.266  1.00 40.68 ? 952  THR C O   1 
ATOM   8114  C  CB  . THR C 1 299 ? 25.116  53.415  6.025  1.00 41.14 ? 952  THR C CB  1 
ATOM   8115  O  OG1 . THR C 1 299 ? 26.192  54.224  6.499  1.00 41.86 ? 952  THR C OG1 1 
ATOM   8116  C  CG2 . THR C 1 299 ? 23.798  54.136  6.278  1.00 41.43 ? 952  THR C CG2 1 
ATOM   8117  N  N   . GLU C 1 300 ? 23.796  50.758  5.300  1.00 39.60 ? 953  GLU C N   1 
ATOM   8118  C  CA  . GLU C 1 300 ? 22.603  50.052  4.886  1.00 40.14 ? 953  GLU C CA  1 
ATOM   8119  C  C   . GLU C 1 300 ? 22.302  48.908  5.833  1.00 39.77 ? 953  GLU C C   1 
ATOM   8120  O  O   . GLU C 1 300 ? 21.152  48.662  6.142  1.00 40.20 ? 953  GLU C O   1 
ATOM   8121  C  CB  . GLU C 1 300 ? 22.766  49.517  3.450  1.00 38.96 ? 953  GLU C CB  1 
ATOM   8122  C  CG  . GLU C 1 300 ? 21.587  48.658  2.986  1.00 40.68 ? 953  GLU C CG  1 
ATOM   8123  C  CD  . GLU C 1 300 ? 21.708  48.145  1.559  1.00 41.75 ? 953  GLU C CD  1 
ATOM   8124  O  OE1 . GLU C 1 300 ? 20.769  47.457  1.111  1.00 45.27 ? 953  GLU C OE1 1 
ATOM   8125  O  OE2 . GLU C 1 300 ? 22.721  48.419  0.877  1.00 43.02 ? 953  GLU C OE2 1 
ATOM   8126  N  N   . GLY C 1 301 ? 23.345  48.200  6.275  1.00 42.04 ? 954  GLY C N   1 
ATOM   8127  C  CA  . GLY C 1 301 ? 23.164  47.063  7.171  1.00 39.13 ? 954  GLY C CA  1 
ATOM   8128  C  C   . GLY C 1 301 ? 22.537  47.458  8.484  1.00 38.10 ? 954  GLY C C   1 
ATOM   8129  O  O   . GLY C 1 301 ? 21.567  46.844  8.925  1.00 37.95 ? 954  GLY C O   1 
ATOM   8130  N  N   . ILE C 1 302 ? 23.071  48.503  9.099  1.00 38.30 ? 955  ILE C N   1 
ATOM   8131  C  CA  . ILE C 1 302 ? 22.555  48.959  10.380 1.00 40.30 ? 955  ILE C CA  1 
ATOM   8132  C  C   . ILE C 1 302 ? 21.143  49.596  10.370 1.00 42.83 ? 955  ILE C C   1 
ATOM   8133  O  O   . ILE C 1 302 ? 20.389  49.476  11.347 1.00 42.20 ? 955  ILE C O   1 
ATOM   8134  C  CB  . ILE C 1 302 ? 23.562  49.922  11.041 1.00 40.50 ? 955  ILE C CB  1 
ATOM   8135  C  CG1 . ILE C 1 302 ? 23.162  50.149  12.495 1.00 40.46 ? 955  ILE C CG1 1 
ATOM   8136  C  CG2 . ILE C 1 302 ? 23.672  51.210  10.268 1.00 40.64 ? 955  ILE C CG2 1 
ATOM   8137  C  CD1 . ILE C 1 302 ? 23.081  48.852  13.294 1.00 39.56 ? 955  ILE C CD1 1 
ATOM   8138  N  N   . VAL C 1 303 ? 20.770  50.275  9.283  1.00 43.45 ? 956  VAL C N   1 
ATOM   8139  C  CA  . VAL C 1 303 ? 19.444  50.876  9.236  1.00 43.13 ? 956  VAL C CA  1 
ATOM   8140  C  C   . VAL C 1 303 ? 18.447  49.749  8.998  1.00 44.05 ? 956  VAL C C   1 
ATOM   8141  O  O   . VAL C 1 303 ? 17.336  49.763  9.529  1.00 44.25 ? 956  VAL C O   1 
ATOM   8142  C  CB  . VAL C 1 303 ? 19.308  51.935  8.106  1.00 43.29 ? 956  VAL C CB  1 
ATOM   8143  C  CG1 . VAL C 1 303 ? 20.395  52.981  8.220  1.00 40.62 ? 956  VAL C CG1 1 
ATOM   8144  C  CG2 . VAL C 1 303 ? 19.357  51.268  6.767  1.00 41.78 ? 956  VAL C CG2 1 
ATOM   8145  N  N   . ASN C 1 304 ? 18.832  48.759  8.210  1.00 43.89 ? 957  ASN C N   1 
ATOM   8146  C  CA  . ASN C 1 304 ? 17.912  47.671  7.989  1.00 45.80 ? 957  ASN C CA  1 
ATOM   8147  C  C   . ASN C 1 304 ? 17.635  46.968  9.313  1.00 47.30 ? 957  ASN C C   1 
ATOM   8148  O  O   . ASN C 1 304 ? 16.475  46.814  9.703  1.00 48.73 ? 957  ASN C O   1 
ATOM   8149  C  CB  . ASN C 1 304 ? 18.461  46.688  6.955  1.00 46.92 ? 957  ASN C CB  1 
ATOM   8150  C  CG  . ASN C 1 304 ? 18.270  47.183  5.526  1.00 50.82 ? 957  ASN C CG  1 
ATOM   8151  O  OD1 . ASN C 1 304 ? 17.322  47.930  5.237  1.00 50.90 ? 957  ASN C OD1 1 
ATOM   8152  N  ND2 . ASN C 1 304 ? 19.159  46.760  4.618  1.00 51.28 ? 957  ASN C ND2 1 
ATOM   8153  N  N   . GLU C 1 305 ? 18.693  46.562  10.019 1.00 47.73 ? 958  GLU C N   1 
ATOM   8154  C  CA  . GLU C 1 305 ? 18.544  45.881  11.307 1.00 46.63 ? 958  GLU C CA  1 
ATOM   8155  C  C   . GLU C 1 305 ? 17.722  46.757  12.267 1.00 45.69 ? 958  GLU C C   1 
ATOM   8156  O  O   . GLU C 1 305 ? 16.858  46.267  12.985 1.00 44.15 ? 958  GLU C O   1 
ATOM   8157  C  CB  . GLU C 1 305 ? 19.932  45.557  11.901 1.00 46.99 ? 958  GLU C CB  1 
ATOM   8158  C  CG  . GLU C 1 305 ? 19.921  44.542  13.059 1.00 47.30 ? 958  GLU C CG  1 
ATOM   8159  C  CD  . GLU C 1 305 ? 21.329  44.054  13.483 1.00 48.05 ? 958  GLU C CD  1 
ATOM   8160  O  OE1 . GLU C 1 305 ? 21.990  43.362  12.681 1.00 46.39 ? 958  GLU C OE1 1 
ATOM   8161  O  OE2 . GLU C 1 305 ? 21.767  44.371  14.616 1.00 48.44 ? 958  GLU C OE2 1 
ATOM   8162  N  N   . PHE C 1 306 ? 17.993  48.052  12.283 1.00 46.32 ? 959  PHE C N   1 
ATOM   8163  C  CA  . PHE C 1 306 ? 17.228  48.963  13.127 1.00 48.20 ? 959  PHE C CA  1 
ATOM   8164  C  C   . PHE C 1 306 ? 15.710  48.908  12.859 1.00 49.90 ? 959  PHE C C   1 
ATOM   8165  O  O   . PHE C 1 306 ? 14.899  48.985  13.803 1.00 51.35 ? 959  PHE C O   1 
ATOM   8166  C  CB  . PHE C 1 306 ? 17.701  50.408  12.928 1.00 47.46 ? 959  PHE C CB  1 
ATOM   8167  C  CG  . PHE C 1 306 ? 18.849  50.812  13.816 1.00 47.71 ? 959  PHE C CG  1 
ATOM   8168  C  CD1 . PHE C 1 306 ? 19.228  52.151  13.912 1.00 48.59 ? 959  PHE C CD1 1 
ATOM   8169  C  CD2 . PHE C 1 306 ? 19.541  49.869  14.568 1.00 47.62 ? 959  PHE C CD2 1 
ATOM   8170  C  CE1 . PHE C 1 306 ? 20.279  52.549  14.746 1.00 48.25 ? 959  PHE C CE1 1 
ATOM   8171  C  CE2 . PHE C 1 306 ? 20.582  50.249  15.396 1.00 46.60 ? 959  PHE C CE2 1 
ATOM   8172  C  CZ  . PHE C 1 306 ? 20.951  51.594  15.486 1.00 48.76 ? 959  PHE C CZ  1 
ATOM   8173  N  N   . TYR C 1 307 ? 15.320  48.797  11.586 1.00 49.73 ? 960  TYR C N   1 
ATOM   8174  C  CA  . TYR C 1 307 ? 13.896  48.751  11.223 1.00 50.15 ? 960  TYR C CA  1 
ATOM   8175  C  C   . TYR C 1 307 ? 13.250  47.463  11.678 1.00 50.43 ? 960  TYR C C   1 
ATOM   8176  O  O   . TYR C 1 307 ? 12.082  47.459  12.063 1.00 50.99 ? 960  TYR C O   1 
ATOM   8177  C  CB  . TYR C 1 307 ? 13.689  48.894  9.701  1.00 49.62 ? 960  TYR C CB  1 
ATOM   8178  C  CG  . TYR C 1 307 ? 13.955  50.275  9.156  1.00 48.21 ? 960  TYR C CG  1 
ATOM   8179  C  CD1 . TYR C 1 307 ? 14.150  50.478  7.789  1.00 49.93 ? 960  TYR C CD1 1 
ATOM   8180  C  CD2 . TYR C 1 307 ? 14.080  51.366  10.005 1.00 46.76 ? 960  TYR C CD2 1 
ATOM   8181  C  CE1 . TYR C 1 307 ? 14.480  51.742  7.280  1.00 48.75 ? 960  TYR C CE1 1 
ATOM   8182  C  CE2 . TYR C 1 307 ? 14.409  52.626  9.513  1.00 48.88 ? 960  TYR C CE2 1 
ATOM   8183  C  CZ  . TYR C 1 307 ? 14.616  52.806  8.146  1.00 49.46 ? 960  TYR C CZ  1 
ATOM   8184  O  OH  . TYR C 1 307 ? 15.022  54.034  7.677  1.00 50.12 ? 960  TYR C OH  1 
ATOM   8185  N  N   . GLU C 1 308 ? 13.996  46.366  11.610 1.00 50.29 ? 961  GLU C N   1 
ATOM   8186  C  CA  . GLU C 1 308 ? 13.469  45.086  12.050 1.00 50.50 ? 961  GLU C CA  1 
ATOM   8187  C  C   . GLU C 1 308 ? 13.092  45.219  13.539 1.00 50.97 ? 961  GLU C C   1 
ATOM   8188  O  O   . GLU C 1 308 ? 12.091  44.656  13.981 1.00 52.03 ? 961  GLU C O   1 
ATOM   8189  C  CB  . GLU C 1 308 ? 14.508  43.978  11.812 1.00 51.64 ? 961  GLU C CB  1 
ATOM   8190  C  CG  . GLU C 1 308 ? 14.281  43.162  10.514 1.00 53.60 ? 961  GLU C CG  1 
ATOM   8191  C  CD  . GLU C 1 308 ? 15.495  42.306  10.099 1.00 55.94 ? 961  GLU C CD  1 
ATOM   8192  O  OE1 . GLU C 1 308 ? 15.326  41.247  9.430  1.00 55.67 ? 961  GLU C OE1 1 
ATOM   8193  O  OE2 . GLU C 1 308 ? 16.634  42.709  10.428 1.00 57.59 ? 961  GLU C OE2 1 
ATOM   8194  N  N   . GLN C 1 309 ? 13.863  45.999  14.299 1.00 50.39 ? 962  GLN C N   1 
ATOM   8195  C  CA  . GLN C 1 309 ? 13.566  46.215  15.717 1.00 50.04 ? 962  GLN C CA  1 
ATOM   8196  C  C   . GLN C 1 309 ? 12.328  47.097  15.891 1.00 51.05 ? 962  GLN C C   1 
ATOM   8197  O  O   . GLN C 1 309 ? 11.486  46.837  16.758 1.00 51.58 ? 962  GLN C O   1 
ATOM   8198  C  CB  . GLN C 1 309 ? 14.739  46.887  16.443 1.00 48.41 ? 962  GLN C CB  1 
ATOM   8199  C  CG  . GLN C 1 309 ? 14.385  47.331  17.876 1.00 48.07 ? 962  GLN C CG  1 
ATOM   8200  C  CD  . GLN C 1 309 ? 15.605  47.583  18.726 1.00 47.76 ? 962  GLN C CD  1 
ATOM   8201  O  OE1 . GLN C 1 309 ? 16.586  46.851  18.627 1.00 48.35 ? 962  GLN C OE1 1 
ATOM   8202  N  NE2 . GLN C 1 309 ? 15.552  48.605  19.585 1.00 47.23 ? 962  GLN C NE2 1 
ATOM   8203  N  N   . GLY C 1 310 ? 12.256  48.160  15.082 1.00 51.10 ? 963  GLY C N   1 
ATOM   8204  C  CA  . GLY C 1 310 ? 11.134  49.073  15.124 1.00 49.77 ? 963  GLY C CA  1 
ATOM   8205  C  C   . GLY C 1 310 ? 9.856   48.304  14.839 1.00 49.40 ? 963  GLY C C   1 
ATOM   8206  O  O   . GLY C 1 310 ? 8.838   48.539  15.466 1.00 47.89 ? 963  GLY C O   1 
ATOM   8207  N  N   . ASP C 1 311 ? 9.903   47.367  13.901 1.00 49.89 ? 964  ASP C N   1 
ATOM   8208  C  CA  . ASP C 1 311 ? 8.706   46.605  13.593 1.00 50.82 ? 964  ASP C CA  1 
ATOM   8209  C  C   . ASP C 1 311 ? 8.258   45.883  14.848 1.00 51.69 ? 964  ASP C C   1 
ATOM   8210  O  O   . ASP C 1 311 ? 7.180   46.171  15.402 1.00 51.39 ? 964  ASP C O   1 
ATOM   8211  C  CB  . ASP C 1 311 ? 8.967   45.601  12.472 1.00 51.69 ? 964  ASP C CB  1 
ATOM   8212  C  CG  . ASP C 1 311 ? 9.212   46.276  11.114 1.00 54.79 ? 964  ASP C CG  1 
ATOM   8213  O  OD1 . ASP C 1 311 ? 8.850   47.480  10.929 1.00 54.64 ? 964  ASP C OD1 1 
ATOM   8214  O  OD2 . ASP C 1 311 ? 9.757   45.586  10.212 1.00 55.19 ? 964  ASP C OD2 1 
ATOM   8215  N  N   . GLU C 1 312 ? 9.095   44.961  15.317 1.00 51.57 ? 965  GLU C N   1 
ATOM   8216  C  CA  . GLU C 1 312 ? 8.782   44.212  16.526 1.00 51.46 ? 965  GLU C CA  1 
ATOM   8217  C  C   . GLU C 1 312 ? 8.361   45.147  17.666 1.00 50.81 ? 965  GLU C C   1 
ATOM   8218  O  O   . GLU C 1 312 ? 7.412   44.850  18.384 1.00 49.63 ? 965  GLU C O   1 
ATOM   8219  C  CB  . GLU C 1 312 ? 9.981   43.333  16.934 1.00 52.20 ? 965  GLU C CB  1 
ATOM   8220  C  CG  . GLU C 1 312 ? 9.955   42.869  18.400 1.00 54.97 ? 965  GLU C CG  1 
ATOM   8221  C  CD  . GLU C 1 312 ? 10.535  41.465  18.618 1.00 57.41 ? 965  GLU C CD  1 
ATOM   8222  O  OE1 . GLU C 1 312 ? 11.282  40.950  17.748 1.00 58.72 ? 965  GLU C OE1 1 
ATOM   8223  O  OE2 . GLU C 1 312 ? 10.244  40.876  19.681 1.00 58.88 ? 965  GLU C OE2 1 
ATOM   8224  N  N   . GLU C 1 313 ? 9.046   46.278  17.824 1.00 50.99 ? 966  GLU C N   1 
ATOM   8225  C  CA  . GLU C 1 313 ? 8.677   47.234  18.886 1.00 52.70 ? 966  GLU C CA  1 
ATOM   8226  C  C   . GLU C 1 313 ? 7.199   47.687  18.752 1.00 54.46 ? 966  GLU C C   1 
ATOM   8227  O  O   . GLU C 1 313 ? 6.506   47.913  19.752 1.00 55.99 ? 966  GLU C O   1 
ATOM   8228  C  CB  . GLU C 1 313 ? 9.580   48.492  18.860 1.00 51.64 ? 966  GLU C CB  1 
ATOM   8229  C  CG  . GLU C 1 313 ? 11.077  48.287  19.190 1.00 51.02 ? 966  GLU C CG  1 
ATOM   8230  C  CD  . GLU C 1 313 ? 11.825  49.607  19.487 1.00 50.72 ? 966  GLU C CD  1 
ATOM   8231  O  OE1 . GLU C 1 313 ? 11.885  50.489  18.605 1.00 51.68 ? 966  GLU C OE1 1 
ATOM   8232  O  OE2 . GLU C 1 313 ? 12.351  49.765  20.609 1.00 49.64 ? 966  GLU C OE2 1 
ATOM   8233  N  N   . ALA C 1 314 ? 6.718   47.823  17.519 1.00 54.72 ? 967  ALA C N   1 
ATOM   8234  C  CA  . ALA C 1 314 ? 5.347   48.256  17.290 1.00 55.32 ? 967  ALA C CA  1 
ATOM   8235  C  C   . ALA C 1 314 ? 4.341   47.115  17.460 1.00 55.40 ? 967  ALA C C   1 
ATOM   8236  O  O   . ALA C 1 314 ? 3.234   47.310  17.993 1.00 55.41 ? 967  ALA C O   1 
ATOM   8237  C  CB  . ALA C 1 314 ? 5.223   48.863  15.905 1.00 55.08 ? 967  ALA C CB  1 
ATOM   8238  N  N   . ASN C 1 315 ? 4.719   45.927  17.003 1.00 55.23 ? 968  ASN C N   1 
ATOM   8239  C  CA  . ASN C 1 315 ? 3.850   44.768  17.141 1.00 55.75 ? 968  ASN C CA  1 
ATOM   8240  C  C   . ASN C 1 315 ? 3.689   44.431  18.620 1.00 55.50 ? 968  ASN C C   1 
ATOM   8241  O  O   . ASN C 1 315 ? 2.868   43.598  18.988 1.00 55.26 ? 968  ASN C O   1 
ATOM   8242  C  CB  . ASN C 1 315 ? 4.438   43.567  16.402 1.00 57.14 ? 968  ASN C CB  1 
ATOM   8243  C  CG  . ASN C 1 315 ? 4.563   43.810  14.911 1.00 59.15 ? 968  ASN C CG  1 
ATOM   8244  O  OD1 . ASN C 1 315 ? 3.566   44.095  14.228 1.00 61.43 ? 968  ASN C OD1 1 
ATOM   8245  N  ND2 . ASN C 1 315 ? 5.786   43.708  14.388 1.00 60.44 ? 968  ASN C ND2 1 
ATOM   8246  N  N   . LEU C 1 316 ? 4.476   45.084  19.467 1.00 55.07 ? 969  LEU C N   1 
ATOM   8247  C  CA  . LEU C 1 316 ? 4.394   44.823  20.898 1.00 56.21 ? 969  LEU C CA  1 
ATOM   8248  C  C   . LEU C 1 316 ? 3.706   45.952  21.620 1.00 56.28 ? 969  LEU C C   1 
ATOM   8249  O  O   . LEU C 1 316 ? 3.680   45.981  22.849 1.00 56.11 ? 969  LEU C O   1 
ATOM   8250  C  CB  . LEU C 1 316 ? 5.790   44.612  21.498 1.00 54.62 ? 969  LEU C CB  1 
ATOM   8251  C  CG  . LEU C 1 316 ? 6.451   43.318  21.028 1.00 54.37 ? 969  LEU C CG  1 
ATOM   8252  C  CD1 . LEU C 1 316 ? 7.854   43.223  21.576 1.00 54.42 ? 969  LEU C CD1 1 
ATOM   8253  C  CD2 . LEU C 1 316 ? 5.601   42.131  21.460 1.00 54.11 ? 969  LEU C CD2 1 
ATOM   8254  N  N   . GLY C 1 317 ? 3.147   46.884  20.857 1.00 56.77 ? 970  GLY C N   1 
ATOM   8255  C  CA  . GLY C 1 317 ? 2.465   48.000  21.480 1.00 57.06 ? 970  GLY C CA  1 
ATOM   8256  C  C   . GLY C 1 317 ? 3.475   48.911  22.138 1.00 57.75 ? 970  GLY C C   1 
ATOM   8257  O  O   . GLY C 1 317 ? 3.144   49.698  23.025 1.00 57.82 ? 970  GLY C O   1 
ATOM   8258  N  N   . LEU C 1 318 ? 4.721   48.818  21.697 1.00 58.10 ? 971  LEU C N   1 
ATOM   8259  C  CA  . LEU C 1 318 ? 5.756   49.645  22.287 1.00 59.05 ? 971  LEU C CA  1 
ATOM   8260  C  C   . LEU C 1 318 ? 6.072   50.833  21.399 1.00 58.16 ? 971  LEU C C   1 
ATOM   8261  O  O   . LEU C 1 318 ? 5.817   50.794  20.199 1.00 57.91 ? 971  LEU C O   1 
ATOM   8262  C  CB  . LEU C 1 318 ? 7.018   48.796  22.523 1.00 60.62 ? 971  LEU C CB  1 
ATOM   8263  C  CG  . LEU C 1 318 ? 6.853   47.727  23.624 1.00 62.91 ? 971  LEU C CG  1 
ATOM   8264  C  CD1 . LEU C 1 318 ? 7.804   46.535  23.397 1.00 62.71 ? 971  LEU C CD1 1 
ATOM   8265  C  CD2 . LEU C 1 318 ? 7.083   48.386  24.993 1.00 62.15 ? 971  LEU C CD2 1 
ATOM   8266  N  N   . PRO C 1 319 ? 6.611   51.919  21.987 1.00 57.91 ? 972  PRO C N   1 
ATOM   8267  C  CA  . PRO C 1 319 ? 6.961   53.113  21.207 1.00 58.65 ? 972  PRO C CA  1 
ATOM   8268  C  C   . PRO C 1 319 ? 8.187   52.807  20.323 1.00 57.46 ? 972  PRO C C   1 
ATOM   8269  O  O   . PRO C 1 319 ? 9.186   52.278  20.819 1.00 57.49 ? 972  PRO C O   1 
ATOM   8270  C  CB  . PRO C 1 319 ? 7.286   54.161  22.288 1.00 58.68 ? 972  PRO C CB  1 
ATOM   8271  C  CG  . PRO C 1 319 ? 6.537   53.680  23.493 1.00 58.22 ? 972  PRO C CG  1 
ATOM   8272  C  CD  . PRO C 1 319 ? 6.758   52.189  23.429 1.00 58.30 ? 972  PRO C CD  1 
ATOM   8273  N  N   . ILE C 1 320 ? 8.108   53.113  19.028 1.00 55.92 ? 973  ILE C N   1 
ATOM   8274  C  CA  . ILE C 1 320 ? 9.235   52.852  18.147 1.00 54.73 ? 973  ILE C CA  1 
ATOM   8275  C  C   . ILE C 1 320 ? 10.390  53.762  18.574 1.00 54.05 ? 973  ILE C C   1 
ATOM   8276  O  O   . ILE C 1 320 ? 10.208  54.971  18.801 1.00 55.12 ? 973  ILE C O   1 
ATOM   8277  C  CB  . ILE C 1 320 ? 8.873   53.089  16.638 1.00 54.85 ? 973  ILE C CB  1 
ATOM   8278  C  CG1 . ILE C 1 320 ? 8.092   51.897  16.058 1.00 54.72 ? 973  ILE C CG1 1 
ATOM   8279  C  CG2 . ILE C 1 320 ? 10.137  53.177  15.801 1.00 53.76 ? 973  ILE C CG2 1 
ATOM   8280  C  CD1 . ILE C 1 320 ? 6.710   51.727  16.579 1.00 56.11 ? 973  ILE C CD1 1 
ATOM   8281  N  N   . SER C 1 321 ? 11.572  53.169  18.721 1.00 51.59 ? 974  SER C N   1 
ATOM   8282  C  CA  . SER C 1 321 ? 12.764  53.911  19.135 1.00 49.05 ? 974  SER C CA  1 
ATOM   8283  C  C   . SER C 1 321 ? 13.239  54.839  18.017 1.00 46.78 ? 974  SER C C   1 
ATOM   8284  O  O   . SER C 1 321 ? 13.004  54.599  16.844 1.00 46.40 ? 974  SER C O   1 
ATOM   8285  C  CB  . SER C 1 321 ? 13.935  52.934  19.468 1.00 48.67 ? 974  SER C CB  1 
ATOM   8286  O  OG  . SER C 1 321 ? 13.604  51.940  20.429 1.00 46.59 ? 974  SER C OG  1 
ATOM   8287  N  N   . PRO C 1 322 ? 13.924  55.912  18.378 1.00 45.73 ? 975  PRO C N   1 
ATOM   8288  C  CA  . PRO C 1 322 ? 14.441  56.848  17.386 1.00 46.13 ? 975  PRO C CA  1 
ATOM   8289  C  C   . PRO C 1 322 ? 15.212  56.100  16.293 1.00 47.06 ? 975  PRO C C   1 
ATOM   8290  O  O   . PRO C 1 322 ? 15.932  55.142  16.579 1.00 49.68 ? 975  PRO C O   1 
ATOM   8291  C  CB  . PRO C 1 322 ? 15.362  57.723  18.215 1.00 46.48 ? 975  PRO C CB  1 
ATOM   8292  C  CG  . PRO C 1 322 ? 14.631  57.804  19.515 1.00 45.67 ? 975  PRO C CG  1 
ATOM   8293  C  CD  . PRO C 1 322 ? 14.165  56.394  19.745 1.00 44.60 ? 975  PRO C CD  1 
ATOM   8294  N  N   . PHE C 1 323 ? 15.042  56.537  15.051 1.00 46.18 ? 976  PHE C N   1 
ATOM   8295  C  CA  . PHE C 1 323 ? 15.707  55.958  13.882 1.00 45.20 ? 976  PHE C CA  1 
ATOM   8296  C  C   . PHE C 1 323 ? 15.274  54.553  13.513 1.00 44.92 ? 976  PHE C C   1 
ATOM   8297  O  O   . PHE C 1 323 ? 15.779  53.970  12.554 1.00 44.91 ? 976  PHE C O   1 
ATOM   8298  C  CB  . PHE C 1 323 ? 17.235  56.027  14.045 1.00 43.63 ? 976  PHE C CB  1 
ATOM   8299  C  CG  . PHE C 1 323 ? 17.740  57.409  14.344 1.00 41.42 ? 976  PHE C CG  1 
ATOM   8300  C  CD1 . PHE C 1 323 ? 18.135  57.761  15.629 1.00 43.12 ? 976  PHE C CD1 1 
ATOM   8301  C  CD2 . PHE C 1 323 ? 17.736  58.384  13.368 1.00 40.29 ? 976  PHE C CD2 1 
ATOM   8302  C  CE1 . PHE C 1 323 ? 18.515  59.082  15.936 1.00 40.74 ? 976  PHE C CE1 1 
ATOM   8303  C  CE2 . PHE C 1 323 ? 18.107  59.703  13.658 1.00 42.23 ? 976  PHE C CE2 1 
ATOM   8304  C  CZ  . PHE C 1 323 ? 18.496  60.053  14.947 1.00 39.91 ? 976  PHE C CZ  1 
ATOM   8305  N  N   . MET C 1 324 ? 14.294  54.020  14.225 1.00 45.99 ? 977  MET C N   1 
ATOM   8306  C  CA  . MET C 1 324 ? 13.861  52.664  13.918 1.00 47.39 ? 977  MET C CA  1 
ATOM   8307  C  C   . MET C 1 324 ? 12.489  52.485  13.237 1.00 47.11 ? 977  MET C C   1 
ATOM   8308  O  O   . MET C 1 324 ? 11.996  51.361  13.087 1.00 45.09 ? 977  MET C O   1 
ATOM   8309  C  CB  . MET C 1 324 ? 13.970  51.835  15.198 1.00 49.37 ? 977  MET C CB  1 
ATOM   8310  C  CG  . MET C 1 324 ? 15.311  52.053  15.860 1.00 49.67 ? 977  MET C CG  1 
ATOM   8311  S  SD  . MET C 1 324 ? 15.901  50.666  16.827 1.00 52.41 ? 977  MET C SD  1 
ATOM   8312  C  CE  . MET C 1 324 ? 17.111  51.533  17.869 1.00 50.76 ? 977  MET C CE  1 
ATOM   8313  N  N   . ASP C 1 325 ? 11.896  53.595  12.788 1.00 48.66 ? 978  ASP C N   1 
ATOM   8314  C  CA  . ASP C 1 325 ? 10.598  53.562  12.100 1.00 48.83 ? 978  ASP C CA  1 
ATOM   8315  C  C   . ASP C 1 325 ? 10.810  53.591  10.590 1.00 47.81 ? 978  ASP C C   1 
ATOM   8316  O  O   . ASP C 1 325 ? 11.276  54.593  10.063 1.00 49.44 ? 978  ASP C O   1 
ATOM   8317  C  CB  . ASP C 1 325 ? 9.762   54.783  12.496 1.00 49.45 ? 978  ASP C CB  1 
ATOM   8318  C  CG  . ASP C 1 325 ? 8.268   54.573  12.283 1.00 49.09 ? 978  ASP C CG  1 
ATOM   8319  O  OD1 . ASP C 1 325 ? 7.881   53.649  11.529 1.00 50.15 ? 978  ASP C OD1 1 
ATOM   8320  O  OD2 . ASP C 1 325 ? 7.488   55.346  12.871 1.00 49.62 ? 978  ASP C OD2 1 
ATOM   8321  N  N   . ARG C 1 326 ? 10.472  52.523  9.877  1.00 47.76 ? 979  ARG C N   1 
ATOM   8322  C  CA  . ARG C 1 326 ? 10.663  52.573  8.434  1.00 48.90 ? 979  ARG C CA  1 
ATOM   8323  C  C   . ARG C 1 326 ? 9.659   53.532  7.753  1.00 48.58 ? 979  ARG C C   1 
ATOM   8324  O  O   . ARG C 1 326 ? 9.849   53.932  6.601  1.00 48.43 ? 979  ARG C O   1 
ATOM   8325  C  CB  . ARG C 1 326 ? 10.562  51.179  7.822  1.00 49.04 ? 979  ARG C CB  1 
ATOM   8326  C  CG  . ARG C 1 326 ? 9.183   50.621  7.737  1.00 51.73 ? 979  ARG C CG  1 
ATOM   8327  C  CD  . ARG C 1 326 ? 9.234   49.202  7.167  1.00 54.05 ? 979  ARG C CD  1 
ATOM   8328  N  NE  . ARG C 1 326 ? 10.001  48.294  8.029  1.00 56.78 ? 979  ARG C NE  1 
ATOM   8329  C  CZ  . ARG C 1 326 ? 11.193  47.783  7.730  1.00 57.26 ? 979  ARG C CZ  1 
ATOM   8330  N  NH1 . ARG C 1 326 ? 11.782  48.068  6.583  1.00 58.00 ? 979  ARG C NH1 1 
ATOM   8331  N  NH2 . ARG C 1 326 ? 11.811  46.996  8.598  1.00 59.54 ? 979  ARG C NH2 1 
ATOM   8332  N  N   . SER C 1 327 ? 8.610   53.921  8.472  1.00 47.77 ? 980  SER C N   1 
ATOM   8333  C  CA  . SER C 1 327 ? 7.625   54.816  7.895  1.00 49.31 ? 980  SER C CA  1 
ATOM   8334  C  C   . SER C 1 327 ? 7.985   56.305  8.117  1.00 49.40 ? 980  SER C C   1 
ATOM   8335  O  O   . SER C 1 327 ? 7.473   57.185  7.425  1.00 49.50 ? 980  SER C O   1 
ATOM   8336  C  CB  . SER C 1 327 ? 6.229   54.490  8.443  1.00 47.65 ? 980  SER C CB  1 
ATOM   8337  O  OG  . SER C 1 327 ? 6.046   54.993  9.754  1.00 48.14 ? 980  SER C OG  1 
ATOM   8338  N  N   . SER C 1 328 ? 8.869   56.580  9.072  1.00 50.47 ? 981  SER C N   1 
ATOM   8339  C  CA  . SER C 1 328 ? 9.322   57.945  9.348  1.00 51.30 ? 981  SER C CA  1 
ATOM   8340  C  C   . SER C 1 328 ? 10.859  57.910  9.429  1.00 52.13 ? 981  SER C C   1 
ATOM   8341  O  O   . SER C 1 328 ? 11.461  58.314  10.438 1.00 51.30 ? 981  SER C O   1 
ATOM   8342  C  CB  . SER C 1 328 ? 8.756   58.452  10.678 1.00 51.98 ? 981  SER C CB  1 
ATOM   8343  O  OG  . SER C 1 328 ? 7.404   58.074  10.849 1.00 55.45 ? 981  SER C OG  1 
ATOM   8344  N  N   . PRO C 1 329 ? 11.512  57.442  8.354  1.00 52.15 ? 982  PRO C N   1 
ATOM   8345  C  CA  . PRO C 1 329 ? 12.976  57.351  8.323  1.00 51.72 ? 982  PRO C CA  1 
ATOM   8346  C  C   . PRO C 1 329 ? 13.708  58.679  8.524  1.00 51.87 ? 982  PRO C C   1 
ATOM   8347  O  O   . PRO C 1 329 ? 13.198  59.740  8.157  1.00 53.08 ? 982  PRO C O   1 
ATOM   8348  C  CB  . PRO C 1 329 ? 13.243  56.742  6.949  1.00 52.17 ? 982  PRO C CB  1 
ATOM   8349  C  CG  . PRO C 1 329 ? 12.130  57.374  6.102  1.00 52.23 ? 982  PRO C CG  1 
ATOM   8350  C  CD  . PRO C 1 329 ? 10.933  57.224  7.009  1.00 50.91 ? 982  PRO C CD  1 
ATOM   8351  N  N   . GLN C 1 330 ? 14.894  58.612  9.127  1.00 50.92 ? 983  GLN C N   1 
ATOM   8352  C  CA  . GLN C 1 330 ? 15.733  59.789  9.334  1.00 50.43 ? 983  GLN C CA  1 
ATOM   8353  C  C   . GLN C 1 330 ? 17.189  59.343  9.163  1.00 50.34 ? 983  GLN C C   1 
ATOM   8354  O  O   . GLN C 1 330 ? 18.045  59.596  10.005 1.00 50.42 ? 983  GLN C O   1 
ATOM   8355  C  CB  . GLN C 1 330 ? 15.540  60.388  10.726 1.00 50.70 ? 983  GLN C CB  1 
ATOM   8356  C  CG  . GLN C 1 330 ? 14.300  61.262  10.926 1.00 52.79 ? 983  GLN C CG  1 
ATOM   8357  C  CD  . GLN C 1 330 ? 14.181  62.429  9.953  1.00 54.89 ? 983  GLN C CD  1 
ATOM   8358  O  OE1 . GLN C 1 330 ? 15.160  63.119  9.634  1.00 55.48 ? 983  GLN C OE1 1 
ATOM   8359  N  NE2 . GLN C 1 330 ? 12.960  62.670  9.494  1.00 54.81 ? 983  GLN C NE2 1 
ATOM   8360  N  N   . LEU C 1 331 ? 17.457  58.673  8.057  1.00 49.66 ? 984  LEU C N   1 
ATOM   8361  C  CA  . LEU C 1 331 ? 18.785  58.172  7.759  1.00 49.74 ? 984  LEU C CA  1 
ATOM   8362  C  C   . LEU C 1 331 ? 19.944  59.184  7.912  1.00 49.86 ? 984  LEU C C   1 
ATOM   8363  O  O   . LEU C 1 331 ? 20.870  58.981  8.690  1.00 50.10 ? 984  LEU C O   1 
ATOM   8364  C  CB  . LEU C 1 331 ? 18.768  57.581  6.346  1.00 49.02 ? 984  LEU C CB  1 
ATOM   8365  C  CG  . LEU C 1 331 ? 20.084  57.089  5.730  1.00 49.63 ? 984  LEU C CG  1 
ATOM   8366  C  CD1 . LEU C 1 331 ? 20.905  56.291  6.735  1.00 50.33 ? 984  LEU C CD1 1 
ATOM   8367  C  CD2 . LEU C 1 331 ? 19.747  56.248  4.533  1.00 49.44 ? 984  LEU C CD2 1 
ATOM   8368  N  N   . ALA C 1 332 ? 19.900  60.278  7.183  1.00 48.92 ? 985  ALA C N   1 
ATOM   8369  C  CA  . ALA C 1 332 ? 20.978  61.237  7.276  1.00 49.34 ? 985  ALA C CA  1 
ATOM   8370  C  C   . ALA C 1 332 ? 21.241  61.733  8.685  1.00 49.36 ? 985  ALA C C   1 
ATOM   8371  O  O   . ALA C 1 332 ? 22.400  61.914  9.068  1.00 51.49 ? 985  ALA C O   1 
ATOM   8372  C  CB  . ALA C 1 332 ? 20.712  62.432  6.324  1.00 48.63 ? 985  ALA C CB  1 
ATOM   8373  N  N   . LYS C 1 333 ? 20.179  61.959  9.454  1.00 49.42 ? 986  LYS C N   1 
ATOM   8374  C  CA  . LYS C 1 333 ? 20.307  62.456  10.822 1.00 48.69 ? 986  LYS C CA  1 
ATOM   8375  C  C   . LYS C 1 333 ? 20.989  61.422  11.742 1.00 48.48 ? 986  LYS C C   1 
ATOM   8376  O  O   . LYS C 1 333 ? 21.716  61.787  12.669 1.00 46.77 ? 986  LYS C O   1 
ATOM   8377  C  CB  . LYS C 1 333 ? 18.921  62.854  11.341 1.00 49.15 ? 986  LYS C CB  1 
ATOM   8378  C  CG  . LYS C 1 333 ? 18.880  63.506  12.726 1.00 50.91 ? 986  LYS C CG  1 
ATOM   8379  C  CD  . LYS C 1 333 ? 17.518  64.187  12.957 1.00 53.41 ? 986  LYS C CD  1 
ATOM   8380  C  CE  . LYS C 1 333 ? 17.333  64.664  14.387 1.00 54.29 ? 986  LYS C CE  1 
ATOM   8381  N  NZ  . LYS C 1 333 ? 16.051  65.446  14.548 1.00 55.06 ? 986  LYS C NZ  1 
ATOM   8382  N  N   . LEU C 1 334 ? 20.754  60.139  11.475 1.00 47.47 ? 987  LEU C N   1 
ATOM   8383  C  CA  . LEU C 1 334 ? 21.383  59.068  12.245 1.00 47.83 ? 987  LEU C CA  1 
ATOM   8384  C  C   . LEU C 1 334 ? 22.906  59.161  12.057 1.00 47.38 ? 987  LEU C C   1 
ATOM   8385  O  O   . LEU C 1 334 ? 23.666  59.384  12.997 1.00 47.20 ? 987  LEU C O   1 
ATOM   8386  C  CB  . LEU C 1 334 ? 20.885  57.700  11.751 1.00 45.60 ? 987  LEU C CB  1 
ATOM   8387  C  CG  . LEU C 1 334 ? 21.520  56.401  12.261 1.00 43.30 ? 987  LEU C CG  1 
ATOM   8388  C  CD1 . LEU C 1 334 ? 21.218  56.217  13.721 1.00 44.10 ? 987  LEU C CD1 1 
ATOM   8389  C  CD2 . LEU C 1 334 ? 20.959  55.208  11.495 1.00 42.34 ? 987  LEU C CD2 1 
ATOM   8390  N  N   . GLN C 1 335 ? 23.350  58.999  10.824 1.00 47.90 ? 988  GLN C N   1 
ATOM   8391  C  CA  . GLN C 1 335 ? 24.777  59.059  10.529 1.00 48.65 ? 988  GLN C CA  1 
ATOM   8392  C  C   . GLN C 1 335 ? 25.459  60.364  10.979 1.00 49.03 ? 988  GLN C C   1 
ATOM   8393  O  O   . GLN C 1 335 ? 26.455  60.351  11.703 1.00 49.44 ? 988  GLN C O   1 
ATOM   8394  C  CB  . GLN C 1 335 ? 24.971  58.863  9.033  1.00 46.81 ? 988  GLN C CB  1 
ATOM   8395  C  CG  . GLN C 1 335 ? 24.447  57.549  8.517  1.00 46.35 ? 988  GLN C CG  1 
ATOM   8396  C  CD  . GLN C 1 335 ? 25.119  56.362  9.193  1.00 47.36 ? 988  GLN C CD  1 
ATOM   8397  O  OE1 . GLN C 1 335 ? 26.080  55.802  8.683  1.00 47.82 ? 988  GLN C OE1 1 
ATOM   8398  N  NE2 . GLN C 1 335 ? 24.607  55.974  10.340 1.00 47.97 ? 988  GLN C NE2 1 
ATOM   8399  N  N   . GLU C 1 336 ? 24.920  61.492  10.539 1.00 49.40 ? 989  GLU C N   1 
ATOM   8400  C  CA  . GLU C 1 336 ? 25.489  62.790  10.884 1.00 49.18 ? 989  GLU C CA  1 
ATOM   8401  C  C   . GLU C 1 336 ? 25.665  62.909  12.398 1.00 48.98 ? 989  GLU C C   1 
ATOM   8402  O  O   . GLU C 1 336 ? 26.658  63.456  12.904 1.00 47.80 ? 989  GLU C O   1 
ATOM   8403  C  CB  . GLU C 1 336 ? 24.555  63.899  10.386 1.00 48.83 ? 989  GLU C CB  1 
ATOM   8404  C  CG  . GLU C 1 336 ? 25.158  65.295  10.350 1.00 49.55 ? 989  GLU C CG  1 
ATOM   8405  C  CD  . GLU C 1 336 ? 25.564  65.817  11.716 1.00 51.42 ? 989  GLU C CD  1 
ATOM   8406  O  OE1 . GLU C 1 336 ? 24.811  65.615  12.705 1.00 52.47 ? 989  GLU C OE1 1 
ATOM   8407  O  OE2 . GLU C 1 336 ? 26.634  66.457  11.801 1.00 54.19 ? 989  GLU C OE2 1 
ATOM   8408  N  N   . SER C 1 337 ? 24.680  62.393  13.115 1.00 48.94 ? 990  SER C N   1 
ATOM   8409  C  CA  . SER C 1 337 ? 24.679  62.451  14.562 1.00 49.97 ? 990  SER C CA  1 
ATOM   8410  C  C   . SER C 1 337 ? 25.677  61.471  15.160 1.00 49.56 ? 990  SER C C   1 
ATOM   8411  O  O   . SER C 1 337 ? 26.472  61.813  16.036 1.00 49.91 ? 990  SER C O   1 
ATOM   8412  C  CB  . SER C 1 337 ? 23.283  62.140  15.078 1.00 49.43 ? 990  SER C CB  1 
ATOM   8413  O  OG  . SER C 1 337 ? 23.231  62.362  16.463 1.00 52.49 ? 990  SER C OG  1 
ATOM   8414  N  N   . PHE C 1 338 ? 25.640  60.246  14.669 1.00 49.34 ? 991  PHE C N   1 
ATOM   8415  C  CA  . PHE C 1 338 ? 26.535  59.237  15.174 1.00 49.91 ? 991  PHE C CA  1 
ATOM   8416  C  C   . PHE C 1 338 ? 27.984  59.667  14.953 1.00 49.30 ? 991  PHE C C   1 
ATOM   8417  O  O   . PHE C 1 338 ? 28.803  59.610  15.868 1.00 49.68 ? 991  PHE C O   1 
ATOM   8418  C  CB  . PHE C 1 338 ? 26.246  57.912  14.482 1.00 51.46 ? 991  PHE C CB  1 
ATOM   8419  C  CG  . PHE C 1 338 ? 26.879  56.745  15.157 1.00 54.43 ? 991  PHE C CG  1 
ATOM   8420  C  CD1 . PHE C 1 338 ? 26.499  56.388  16.447 1.00 55.52 ? 991  PHE C CD1 1 
ATOM   8421  C  CD2 . PHE C 1 338 ? 27.872  56.011  14.518 1.00 53.83 ? 991  PHE C CD2 1 
ATOM   8422  C  CE1 . PHE C 1 338 ? 27.099  55.309  17.092 1.00 56.37 ? 991  PHE C CE1 1 
ATOM   8423  C  CE2 . PHE C 1 338 ? 28.472  54.938  15.149 1.00 56.05 ? 991  PHE C CE2 1 
ATOM   8424  C  CZ  . PHE C 1 338 ? 28.088  54.585  16.442 1.00 56.34 ? 991  PHE C CZ  1 
ATOM   8425  N  N   . ILE C 1 339 ? 28.295  60.116  13.744 1.00 47.49 ? 992  ILE C N   1 
ATOM   8426  C  CA  . ILE C 1 339 ? 29.640  60.563  13.425 1.00 47.07 ? 992  ILE C CA  1 
ATOM   8427  C  C   . ILE C 1 339 ? 30.102  61.709  14.334 1.00 48.03 ? 992  ILE C C   1 
ATOM   8428  O  O   . ILE C 1 339 ? 31.153  61.645  14.974 1.00 50.62 ? 992  ILE C O   1 
ATOM   8429  C  CB  . ILE C 1 339 ? 29.710  61.002  11.942 1.00 45.53 ? 992  ILE C CB  1 
ATOM   8430  C  CG1 . ILE C 1 339 ? 29.611  59.776  11.047 1.00 43.82 ? 992  ILE C CG1 1 
ATOM   8431  C  CG2 . ILE C 1 339 ? 30.992  61.752  11.655 1.00 45.52 ? 992  ILE C CG2 1 
ATOM   8432  C  CD1 . ILE C 1 339 ? 29.371  60.104  9.585  1.00 41.78 ? 992  ILE C CD1 1 
ATOM   8433  N  N   . THR C 1 340 ? 29.305  62.755  14.401 1.00 47.89 ? 993  THR C N   1 
ATOM   8434  C  CA  . THR C 1 340 ? 29.627  63.918  15.208 1.00 48.13 ? 993  THR C CA  1 
ATOM   8435  C  C   . THR C 1 340 ? 29.774  63.649  16.703 1.00 48.92 ? 993  THR C C   1 
ATOM   8436  O  O   . THR C 1 340 ? 30.622  64.254  17.362 1.00 48.29 ? 993  THR C O   1 
ATOM   8437  C  CB  . THR C 1 340 ? 28.523  65.020  15.024 1.00 47.46 ? 993  THR C CB  1 
ATOM   8438  O  OG1 . THR C 1 340 ? 28.650  65.610  13.725 1.00 46.55 ? 993  THR C OG1 1 
ATOM   8439  C  CG2 . THR C 1 340 ? 28.637  66.096  16.096 1.00 45.71 ? 993  THR C CG2 1 
ATOM   8440  N  N   . HIS C 1 341 ? 28.924  62.768  17.230 1.00 50.32 ? 994  HIS C N   1 
ATOM   8441  C  CA  . HIS C 1 341 ? 28.896  62.463  18.659 1.00 51.91 ? 994  HIS C CA  1 
ATOM   8442  C  C   . HIS C 1 341 ? 29.619  61.186  19.095 1.00 52.31 ? 994  HIS C C   1 
ATOM   8443  O  O   . HIS C 1 341 ? 29.899  61.027  20.280 1.00 53.49 ? 994  HIS C O   1 
ATOM   8444  C  CB  . HIS C 1 341 ? 27.432  62.367  19.152 1.00 53.60 ? 994  HIS C CB  1 
ATOM   8445  C  CG  . HIS C 1 341 ? 26.646  63.636  18.998 1.00 56.45 ? 994  HIS C CG  1 
ATOM   8446  N  ND1 . HIS C 1 341 ? 26.890  64.766  19.752 1.00 58.30 ? 994  HIS C ND1 1 
ATOM   8447  C  CD2 . HIS C 1 341 ? 25.660  63.974  18.131 1.00 57.56 ? 994  HIS C CD2 1 
ATOM   8448  C  CE1 . HIS C 1 341 ? 26.097  65.746  19.354 1.00 58.56 ? 994  HIS C CE1 1 
ATOM   8449  N  NE2 . HIS C 1 341 ? 25.341  65.291  18.371 1.00 59.16 ? 994  HIS C NE2 1 
ATOM   8450  N  N   . ILE C 1 342 ? 29.901  60.273  18.173 1.00 50.77 ? 995  ILE C N   1 
ATOM   8451  C  CA  . ILE C 1 342 ? 30.554  59.024  18.553 1.00 50.60 ? 995  ILE C CA  1 
ATOM   8452  C  C   . ILE C 1 342 ? 31.855  58.750  17.792 1.00 50.80 ? 995  ILE C C   1 
ATOM   8453  O  O   . ILE C 1 342 ? 32.939  59.027  18.299 1.00 50.09 ? 995  ILE C O   1 
ATOM   8454  C  CB  . ILE C 1 342 ? 29.581  57.821  18.370 1.00 49.54 ? 995  ILE C CB  1 
ATOM   8455  C  CG1 . ILE C 1 342 ? 28.274  58.101  19.108 1.00 49.20 ? 995  ILE C CG1 1 
ATOM   8456  C  CG2 . ILE C 1 342 ? 30.206  56.542  18.900 1.00 50.52 ? 995  ILE C CG2 1 
ATOM   8457  C  CD1 . ILE C 1 342 ? 28.458  58.724  20.494 1.00 48.06 ? 995  ILE C CD1 1 
ATOM   8458  N  N   . VAL C 1 343 ? 31.736  58.220  16.575 1.00 50.53 ? 996  VAL C N   1 
ATOM   8459  C  CA  . VAL C 1 343 ? 32.893  57.889  15.742 1.00 49.88 ? 996  VAL C CA  1 
ATOM   8460  C  C   . VAL C 1 343 ? 33.983  58.971  15.676 1.00 50.11 ? 996  VAL C C   1 
ATOM   8461  O  O   . VAL C 1 343 ? 35.160  58.707  15.940 1.00 49.55 ? 996  VAL C O   1 
ATOM   8462  C  CB  . VAL C 1 343 ? 32.467  57.590  14.303 1.00 48.93 ? 996  VAL C CB  1 
ATOM   8463  C  CG1 . VAL C 1 343 ? 33.593  56.914  13.574 1.00 50.61 ? 996  VAL C CG1 1 
ATOM   8464  C  CG2 . VAL C 1 343 ? 31.248  56.716  14.287 1.00 49.50 ? 996  VAL C CG2 1 
ATOM   8465  N  N   . GLY C 1 344 ? 33.580  60.182  15.315 1.00 49.42 ? 997  GLY C N   1 
ATOM   8466  C  CA  . GLY C 1 344 ? 34.523  61.270  15.177 1.00 49.35 ? 997  GLY C CA  1 
ATOM   8467  C  C   . GLY C 1 344 ? 35.315  61.635  16.414 1.00 50.14 ? 997  GLY C C   1 
ATOM   8468  O  O   . GLY C 1 344 ? 36.547  61.582  16.394 1.00 49.81 ? 997  GLY C O   1 
ATOM   8469  N  N   . PRO C 1 345 ? 34.644  62.028  17.508 1.00 50.74 ? 998  PRO C N   1 
ATOM   8470  C  CA  . PRO C 1 345 ? 35.412  62.382  18.702 1.00 52.03 ? 998  PRO C CA  1 
ATOM   8471  C  C   . PRO C 1 345 ? 36.343  61.244  19.119 1.00 51.61 ? 998  PRO C C   1 
ATOM   8472  O  O   . PRO C 1 345 ? 37.419  61.482  19.667 1.00 51.22 ? 998  PRO C O   1 
ATOM   8473  C  CB  . PRO C 1 345 ? 34.331  62.731  19.739 1.00 50.86 ? 998  PRO C CB  1 
ATOM   8474  C  CG  . PRO C 1 345 ? 33.072  62.126  19.203 1.00 51.50 ? 998  PRO C CG  1 
ATOM   8475  C  CD  . PRO C 1 345 ? 33.200  62.224  17.716 1.00 51.52 ? 998  PRO C CD  1 
ATOM   8476  N  N   . LEU C 1 346 ? 35.934  60.013  18.817 1.00 52.23 ? 999  LEU C N   1 
ATOM   8477  C  CA  . LEU C 1 346 ? 36.743  58.835  19.128 1.00 53.42 ? 999  LEU C CA  1 
ATOM   8478  C  C   . LEU C 1 346 ? 38.030  58.846  18.301 1.00 54.51 ? 999  LEU C C   1 
ATOM   8479  O  O   . LEU C 1 346 ? 39.111  58.618  18.833 1.00 54.83 ? 999  LEU C O   1 
ATOM   8480  C  CB  . LEU C 1 346 ? 35.973  57.545  18.836 1.00 52.17 ? 999  LEU C CB  1 
ATOM   8481  C  CG  . LEU C 1 346 ? 36.758  56.251  19.088 1.00 52.42 ? 999  LEU C CG  1 
ATOM   8482  C  CD1 . LEU C 1 346 ? 37.132  56.185  20.550 1.00 53.28 ? 999  LEU C CD1 1 
ATOM   8483  C  CD2 . LEU C 1 346 ? 35.934  55.034  18.733 1.00 51.19 ? 999  LEU C CD2 1 
ATOM   8484  N  N   . CYS C 1 347 ? 37.910  59.116  17.002 1.00 55.73 ? 1000 CYS C N   1 
ATOM   8485  C  CA  . CYS C 1 347 ? 39.074  59.150  16.132 1.00 56.33 ? 1000 CYS C CA  1 
ATOM   8486  C  C   . CYS C 1 347 ? 39.990  60.319  16.438 1.00 56.47 ? 1000 CYS C C   1 
ATOM   8487  O  O   . CYS C 1 347 ? 41.201  60.146  16.556 1.00 56.99 ? 1000 CYS C O   1 
ATOM   8488  C  CB  . CYS C 1 347 ? 38.646  59.218  14.676 1.00 57.05 ? 1000 CYS C CB  1 
ATOM   8489  S  SG  . CYS C 1 347 ? 37.821  57.731  14.139 1.00 59.14 ? 1000 CYS C SG  1 
ATOM   8490  N  N   . ASN C 1 348 ? 39.422  61.508  16.576 1.00 55.70 ? 1001 ASN C N   1 
ATOM   8491  C  CA  . ASN C 1 348 ? 40.235  62.679  16.860 1.00 56.06 ? 1001 ASN C CA  1 
ATOM   8492  C  C   . ASN C 1 348 ? 41.128  62.445  18.069 1.00 55.44 ? 1001 ASN C C   1 
ATOM   8493  O  O   . ASN C 1 348 ? 42.251  62.942  18.141 1.00 55.27 ? 1001 ASN C O   1 
ATOM   8494  C  CB  . ASN C 1 348 ? 39.339  63.898  17.099 1.00 55.70 ? 1001 ASN C CB  1 
ATOM   8495  C  CG  . ASN C 1 348 ? 38.339  64.094  15.988 1.00 55.59 ? 1001 ASN C CG  1 
ATOM   8496  O  OD1 . ASN C 1 348 ? 38.672  63.935  14.823 1.00 56.38 ? 1001 ASN C OD1 1 
ATOM   8497  N  ND2 . ASN C 1 348 ? 37.102  64.431  16.341 1.00 56.70 ? 1001 ASN C ND2 1 
ATOM   8498  N  N   . SER C 1 349 ? 40.614  61.671  19.010 1.00 55.54 ? 1002 SER C N   1 
ATOM   8499  C  CA  . SER C 1 349 ? 41.322  61.348  20.236 1.00 55.12 ? 1002 SER C CA  1 
ATOM   8500  C  C   . SER C 1 349 ? 42.448  60.342  19.940 1.00 55.12 ? 1002 SER C C   1 
ATOM   8501  O  O   . SER C 1 349 ? 43.596  60.532  20.342 1.00 55.52 ? 1002 SER C O   1 
ATOM   8502  C  CB  . SER C 1 349 ? 40.313  60.776  21.236 1.00 56.29 ? 1002 SER C CB  1 
ATOM   8503  O  OG  . SER C 1 349 ? 40.873  60.626  22.525 1.00 59.32 ? 1002 SER C OG  1 
ATOM   8504  N  N   . TYR C 1 350 ? 42.118  59.288  19.206 1.00 54.04 ? 1003 TYR C N   1 
ATOM   8505  C  CA  . TYR C 1 350 ? 43.096  58.270  18.853 1.00 54.07 ? 1003 TYR C CA  1 
ATOM   8506  C  C   . TYR C 1 350 ? 44.224  58.863  18.008 1.00 55.35 ? 1003 TYR C C   1 
ATOM   8507  O  O   . TYR C 1 350 ? 45.391  58.486  18.151 1.00 55.10 ? 1003 TYR C O   1 
ATOM   8508  C  CB  . TYR C 1 350 ? 42.416  57.183  18.049 1.00 51.50 ? 1003 TYR C CB  1 
ATOM   8509  C  CG  . TYR C 1 350 ? 43.134  55.870  18.042 1.00 49.69 ? 1003 TYR C CG  1 
ATOM   8510  C  CD1 . TYR C 1 350 ? 43.051  55.015  19.134 1.00 51.06 ? 1003 TYR C CD1 1 
ATOM   8511  C  CD2 . TYR C 1 350 ? 43.832  55.437  16.920 1.00 49.33 ? 1003 TYR C CD2 1 
ATOM   8512  C  CE1 . TYR C 1 350 ? 43.636  53.745  19.110 1.00 49.88 ? 1003 TYR C CE1 1 
ATOM   8513  C  CE2 . TYR C 1 350 ? 44.417  54.177  16.875 1.00 49.38 ? 1003 TYR C CE2 1 
ATOM   8514  C  CZ  . TYR C 1 350 ? 44.313  53.328  17.976 1.00 51.07 ? 1003 TYR C CZ  1 
ATOM   8515  O  OH  . TYR C 1 350 ? 44.855  52.050  17.940 1.00 51.63 ? 1003 TYR C OH  1 
ATOM   8516  N  N   . ASP C 1 351 ? 43.841  59.771  17.112 1.00 56.05 ? 1004 ASP C N   1 
ATOM   8517  C  CA  . ASP C 1 351 ? 44.740  60.446  16.192 1.00 56.77 ? 1004 ASP C CA  1 
ATOM   8518  C  C   . ASP C 1 351 ? 45.582  61.463  16.935 1.00 57.44 ? 1004 ASP C C   1 
ATOM   8519  O  O   . ASP C 1 351 ? 46.753  61.682  16.611 1.00 58.92 ? 1004 ASP C O   1 
ATOM   8520  C  CB  . ASP C 1 351 ? 43.927  61.167  15.102 1.00 58.15 ? 1004 ASP C CB  1 
ATOM   8521  C  CG  . ASP C 1 351 ? 44.807  61.752  13.988 1.00 58.37 ? 1004 ASP C CG  1 
ATOM   8522  O  OD1 . ASP C 1 351 ? 44.480  62.851  13.481 1.00 59.39 ? 1004 ASP C OD1 1 
ATOM   8523  O  OD2 . ASP C 1 351 ? 45.809  61.109  13.600 1.00 58.42 ? 1004 ASP C OD2 1 
ATOM   8524  N  N   . ALA C 1 352 ? 44.979  62.106  17.922 1.00 57.33 ? 1005 ALA C N   1 
ATOM   8525  C  CA  . ALA C 1 352 ? 45.695  63.112  18.691 1.00 57.61 ? 1005 ALA C CA  1 
ATOM   8526  C  C   . ALA C 1 352 ? 46.747  62.368  19.481 1.00 58.28 ? 1005 ALA C C   1 
ATOM   8527  O  O   . ALA C 1 352 ? 47.789  62.926  19.825 1.00 58.56 ? 1005 ALA C O   1 
ATOM   8528  C  CB  . ALA C 1 352 ? 44.740  63.836  19.632 1.00 57.20 ? 1005 ALA C CB  1 
ATOM   8529  N  N   . ALA C 1 353 ? 46.461  61.099  19.755 1.00 58.27 ? 1006 ALA C N   1 
ATOM   8530  C  CA  . ALA C 1 353 ? 47.372  60.250  20.502 1.00 58.37 ? 1006 ALA C CA  1 
ATOM   8531  C  C   . ALA C 1 353 ? 48.429  59.702  19.542 1.00 58.81 ? 1006 ALA C C   1 
ATOM   8532  O  O   . ALA C 1 353 ? 49.275  58.885  19.922 1.00 60.19 ? 1006 ALA C O   1 
ATOM   8533  C  CB  . ALA C 1 353 ? 46.599  59.107  21.158 1.00 58.22 ? 1006 ALA C CB  1 
ATOM   8534  N  N   . GLY C 1 354 ? 48.369  60.156  18.294 1.00 57.89 ? 1007 GLY C N   1 
ATOM   8535  C  CA  . GLY C 1 354 ? 49.323  59.722  17.292 1.00 56.40 ? 1007 GLY C CA  1 
ATOM   8536  C  C   . GLY C 1 354 ? 49.378  58.221  17.103 1.00 55.57 ? 1007 GLY C C   1 
ATOM   8537  O  O   . GLY C 1 354 ? 50.401  57.689  16.670 1.00 56.87 ? 1007 GLY C O   1 
ATOM   8538  N  N   . LEU C 1 355 ? 48.284  57.530  17.405 1.00 53.96 ? 1008 LEU C N   1 
ATOM   8539  C  CA  . LEU C 1 355 ? 48.252  56.078  17.263 1.00 52.87 ? 1008 LEU C CA  1 
ATOM   8540  C  C   . LEU C 1 355 ? 47.744  55.636  15.893 1.00 51.85 ? 1008 LEU C C   1 
ATOM   8541  O  O   . LEU C 1 355 ? 47.757  54.440  15.568 1.00 51.17 ? 1008 LEU C O   1 
ATOM   8542  C  CB  . LEU C 1 355 ? 47.390  55.457  18.382 1.00 53.77 ? 1008 LEU C CB  1 
ATOM   8543  C  CG  . LEU C 1 355 ? 47.811  55.763  19.836 1.00 53.68 ? 1008 LEU C CG  1 
ATOM   8544  C  CD1 . LEU C 1 355 ? 46.942  54.989  20.818 1.00 54.20 ? 1008 LEU C CD1 1 
ATOM   8545  C  CD2 . LEU C 1 355 ? 49.276  55.384  20.039 1.00 54.72 ? 1008 LEU C CD2 1 
ATOM   8546  N  N   . LEU C 1 356 ? 47.323  56.598  15.077 1.00 51.16 ? 1009 LEU C N   1 
ATOM   8547  C  CA  . LEU C 1 356 ? 46.812  56.279  13.752 1.00 51.75 ? 1009 LEU C CA  1 
ATOM   8548  C  C   . LEU C 1 356 ? 47.885  56.083  12.698 1.00 51.85 ? 1009 LEU C C   1 
ATOM   8549  O  O   . LEU C 1 356 ? 48.762  56.931  12.515 1.00 51.48 ? 1009 LEU C O   1 
ATOM   8550  C  CB  . LEU C 1 356 ? 45.832  57.360  13.254 1.00 51.13 ? 1009 LEU C CB  1 
ATOM   8551  C  CG  . LEU C 1 356 ? 44.400  57.335  13.823 1.00 52.25 ? 1009 LEU C CG  1 
ATOM   8552  C  CD1 . LEU C 1 356 ? 43.622  58.505  13.236 1.00 52.93 ? 1009 LEU C CD1 1 
ATOM   8553  C  CD2 . LEU C 1 356 ? 43.698  55.996  13.502 1.00 49.93 ? 1009 LEU C CD2 1 
ATOM   8554  N  N   . PRO C 1 357 ? 47.830  54.946  11.991 1.00 51.79 ? 1010 PRO C N   1 
ATOM   8555  C  CA  . PRO C 1 357 ? 48.817  54.683  10.949 1.00 54.16 ? 1010 PRO C CA  1 
ATOM   8556  C  C   . PRO C 1 357 ? 48.576  55.555  9.722  1.00 56.14 ? 1010 PRO C C   1 
ATOM   8557  O  O   . PRO C 1 357 ? 47.496  55.516  9.126  1.00 57.68 ? 1010 PRO C O   1 
ATOM   8558  C  CB  . PRO C 1 357 ? 48.640  53.190  10.665 1.00 52.33 ? 1010 PRO C CB  1 
ATOM   8559  C  CG  . PRO C 1 357 ? 47.254  52.913  11.083 1.00 51.09 ? 1010 PRO C CG  1 
ATOM   8560  C  CD  . PRO C 1 357 ? 47.078  53.725  12.316 1.00 51.30 ? 1010 PRO C CD  1 
ATOM   8561  N  N   . GLY C 1 358 ? 49.583  56.356  9.370  1.00 57.30 ? 1011 GLY C N   1 
ATOM   8562  C  CA  . GLY C 1 358 ? 49.495  57.230  8.221  1.00 57.22 ? 1011 GLY C CA  1 
ATOM   8563  C  C   . GLY C 1 358 ? 50.813  57.259  7.476  1.00 58.05 ? 1011 GLY C C   1 
ATOM   8564  O  O   . GLY C 1 358 ? 51.545  56.267  7.447  1.00 58.05 ? 1011 GLY C O   1 
ATOM   8565  N  N   . GLN C 1 359 ? 51.117  58.398  6.866  1.00 58.71 ? 1012 GLN C N   1 
ATOM   8566  C  CA  . GLN C 1 359 ? 52.355  58.540  6.121  1.00 60.20 ? 1012 GLN C CA  1 
ATOM   8567  C  C   . GLN C 1 359 ? 52.755  59.995  6.068  1.00 60.23 ? 1012 GLN C C   1 
ATOM   8568  O  O   . GLN C 1 359 ? 51.907  60.868  5.881  1.00 60.43 ? 1012 GLN C O   1 
ATOM   8569  C  CB  . GLN C 1 359 ? 52.206  58.002  4.698  1.00 60.16 ? 1012 GLN C CB  1 
ATOM   8570  C  CG  . GLN C 1 359 ? 51.640  58.997  3.707  1.00 63.32 ? 1012 GLN C CG  1 
ATOM   8571  C  CD  . GLN C 1 359 ? 51.748  58.501  2.258  1.00 65.54 ? 1012 GLN C CD  1 
ATOM   8572  O  OE1 . GLN C 1 359 ? 52.855  58.197  1.767  1.00 65.31 ? 1012 GLN C OE1 1 
ATOM   8573  N  NE2 . GLN C 1 359 ? 50.601  58.426  1.561  1.00 65.15 ? 1012 GLN C NE2 1 
ATOM   8574  N  N   . TRP C 1 360 ? 54.049  60.247  6.254  1.00 61.48 ? 1013 TRP C N   1 
ATOM   8575  C  CA  . TRP C 1 360 ? 54.605  61.605  6.212  1.00 63.15 ? 1013 TRP C CA  1 
ATOM   8576  C  C   . TRP C 1 360 ? 54.447  62.167  4.809  1.00 64.40 ? 1013 TRP C C   1 
ATOM   8577  O  O   . TRP C 1 360 ? 54.326  61.405  3.829  1.00 64.84 ? 1013 TRP C O   1 
ATOM   8578  C  CB  . TRP C 1 360 ? 56.100  61.593  6.547  1.00 60.56 ? 1013 TRP C CB  1 
ATOM   8579  C  CG  . TRP C 1 360 ? 56.426  61.166  7.922  1.00 57.96 ? 1013 TRP C CG  1 
ATOM   8580  C  CD1 . TRP C 1 360 ? 57.105  60.045  8.288  1.00 56.91 ? 1013 TRP C CD1 1 
ATOM   8581  C  CD2 . TRP C 1 360 ? 56.153  61.886  9.128  1.00 57.27 ? 1013 TRP C CD2 1 
ATOM   8582  N  NE1 . TRP C 1 360 ? 57.283  60.024  9.659  1.00 57.01 ? 1013 TRP C NE1 1 
ATOM   8583  C  CE2 . TRP C 1 360 ? 56.707  61.140  10.197 1.00 56.14 ? 1013 TRP C CE2 1 
ATOM   8584  C  CE3 . TRP C 1 360 ? 55.495  63.091  9.413  1.00 57.48 ? 1013 TRP C CE3 1 
ATOM   8585  C  CZ2 . TRP C 1 360 ? 56.628  61.557  11.527 1.00 56.81 ? 1013 TRP C CZ2 1 
ATOM   8586  C  CZ3 . TRP C 1 360 ? 55.414  63.515  10.749 1.00 57.22 ? 1013 TRP C CZ3 1 
ATOM   8587  C  CH2 . TRP C 1 360 ? 55.980  62.745  11.789 1.00 56.96 ? 1013 TRP C CH2 1 
ATOM   8588  N  N   . LEU C 1 361 ? 54.458  63.494  4.702  1.00 66.12 ? 1014 LEU C N   1 
ATOM   8589  C  CA  . LEU C 1 361 ? 54.340  64.118  3.385  1.00 68.31 ? 1014 LEU C CA  1 
ATOM   8590  C  C   . LEU C 1 361 ? 55.599  64.884  3.012  1.00 69.73 ? 1014 LEU C C   1 
ATOM   8591  O  O   . LEU C 1 361 ? 56.326  64.499  2.092  1.00 69.42 ? 1014 LEU C O   1 
ATOM   8592  C  CB  . LEU C 1 361 ? 53.120  65.050  3.330  1.00 67.03 ? 1014 LEU C CB  1 
ATOM   8593  C  CG  . LEU C 1 361 ? 51.767  64.327  3.347  1.00 66.38 ? 1014 LEU C CG  1 
ATOM   8594  C  CD1 . LEU C 1 361 ? 50.636  65.358  3.362  1.00 65.47 ? 1014 LEU C CD1 1 
ATOM   8595  C  CD2 . LEU C 1 361 ? 51.669  63.390  2.129  1.00 65.45 ? 1014 LEU C CD2 1 
ATOM   8596  N  N   . GLU C 1 362 ? 55.873  65.958  3.743  1.00 72.53 ? 1015 GLU C N   1 
ATOM   8597  C  CA  . GLU C 1 362 ? 57.052  66.769  3.437  1.00 75.28 ? 1015 GLU C CA  1 
ATOM   8598  C  C   . GLU C 1 362 ? 58.297  66.303  4.230  1.00 76.11 ? 1015 GLU C C   1 
ATOM   8599  O  O   . GLU C 1 362 ? 58.191  65.236  4.889  1.00 76.22 ? 1015 GLU C O   1 
ATOM   8600  C  CB  . GLU C 1 362 ? 56.743  68.255  3.704  1.00 75.66 ? 1015 GLU C CB  1 
ATOM   8601  C  CG  . GLU C 1 362 ? 57.523  69.210  2.788  1.00 77.66 ? 1015 GLU C CG  1 
ATOM   8602  C  CD  . GLU C 1 362 ? 57.170  69.051  1.303  1.00 78.96 ? 1015 GLU C CD  1 
ATOM   8603  O  OE1 . GLU C 1 362 ? 56.017  69.370  0.921  1.00 79.91 ? 1015 GLU C OE1 1 
ATOM   8604  O  OE2 . GLU C 1 362 ? 58.045  68.607  0.519  1.00 78.95 ? 1015 GLU C OE2 1 
ATOM   8605  N  N   . SER C 1 400 ? 56.086  65.555  15.684 1.00 74.85 ? 1053 SER C N   1 
ATOM   8606  C  CA  . SER C 1 400 ? 54.854  66.309  16.089 1.00 75.22 ? 1053 SER C CA  1 
ATOM   8607  C  C   . SER C 1 400 ? 54.901  67.704  15.458 1.00 75.44 ? 1053 SER C C   1 
ATOM   8608  O  O   . SER C 1 400 ? 54.210  68.639  15.895 1.00 75.18 ? 1053 SER C O   1 
ATOM   8609  C  CB  . SER C 1 400 ? 54.770  66.405  17.631 1.00 75.38 ? 1053 SER C CB  1 
ATOM   8610  N  N   . ARG C 1 401 ? 55.739  67.814  14.421 1.00 75.52 ? 1054 ARG C N   1 
ATOM   8611  C  CA  . ARG C 1 401 ? 55.954  69.052  13.649 1.00 74.93 ? 1054 ARG C CA  1 
ATOM   8612  C  C   . ARG C 1 401 ? 56.216  68.736  12.156 1.00 74.44 ? 1054 ARG C C   1 
ATOM   8613  O  O   . ARG C 1 401 ? 57.225  69.185  11.595 1.00 74.13 ? 1054 ARG C O   1 
ATOM   8614  C  CB  . ARG C 1 401 ? 57.145  69.857  14.236 1.00 74.10 ? 1054 ARG C CB  1 
ATOM   8615  N  N   . ARG C 1 402 ? 55.330  67.935  11.544 1.00 73.70 ? 1055 ARG C N   1 
ATOM   8616  C  CA  . ARG C 1 402 ? 55.413  67.581  10.105 1.00 72.86 ? 1055 ARG C CA  1 
ATOM   8617  C  C   . ARG C 1 402 ? 54.055  67.076  9.569  1.00 72.78 ? 1055 ARG C C   1 
ATOM   8618  O  O   . ARG C 1 402 ? 53.203  66.598  10.337 1.00 72.58 ? 1055 ARG C O   1 
ATOM   8619  C  CB  . ARG C 1 402 ? 56.492  66.510  9.816  1.00 71.23 ? 1055 ARG C CB  1 
ATOM   8620  C  CG  . ARG C 1 402 ? 57.071  66.623  8.387  1.00 69.56 ? 1055 ARG C CG  1 
ATOM   8621  C  CD  . ARG C 1 402 ? 57.598  65.307  7.777  1.00 68.09 ? 1055 ARG C CD  1 
ATOM   8622  N  NE  . ARG C 1 402 ? 58.540  64.555  8.616  1.00 67.07 ? 1055 ARG C NE  1 
ATOM   8623  C  CZ  . ARG C 1 402 ? 59.298  63.542  8.178  1.00 66.24 ? 1055 ARG C CZ  1 
ATOM   8624  N  NH1 . ARG C 1 402 ? 59.244  63.159  6.905  1.00 64.20 ? 1055 ARG C NH1 1 
ATOM   8625  N  NH2 . ARG C 1 402 ? 60.092  62.885  9.021  1.00 66.21 ? 1055 ARG C NH2 1 
ATOM   8626  N  N   . ARG C 1 403 ? 53.865  67.164  8.254  1.00 71.53 ? 1056 ARG C N   1 
ATOM   8627  C  CA  . ARG C 1 403 ? 52.609  66.732  7.649  1.00 70.60 ? 1056 ARG C CA  1 
ATOM   8628  C  C   . ARG C 1 403 ? 52.422  65.216  7.578  1.00 70.01 ? 1056 ARG C C   1 
ATOM   8629  O  O   . ARG C 1 403 ? 53.322  64.482  7.147  1.00 70.15 ? 1056 ARG C O   1 
ATOM   8630  C  CB  . ARG C 1 403 ? 52.458  67.337  6.236  1.00 71.36 ? 1056 ARG C CB  1 
ATOM   8631  C  CG  . ARG C 1 403 ? 51.785  68.718  6.217  1.00 72.40 ? 1056 ARG C CG  1 
ATOM   8632  C  CD  . ARG C 1 403 ? 51.549  69.240  4.793  1.00 72.82 ? 1056 ARG C CD  1 
ATOM   8633  N  NE  . ARG C 1 403 ? 52.770  69.756  4.172  1.00 73.99 ? 1056 ARG C NE  1 
ATOM   8634  C  CZ  . ARG C 1 403 ? 52.906  69.984  2.866  1.00 74.40 ? 1056 ARG C CZ  1 
ATOM   8635  N  NH1 . ARG C 1 403 ? 51.890  69.737  2.039  1.00 73.12 ? 1056 ARG C NH1 1 
ATOM   8636  N  NH2 . ARG C 1 403 ? 54.057  70.461  2.386  1.00 73.91 ? 1056 ARG C NH2 1 
ATOM   8637  N  N   . ILE C 1 404 ? 51.230  64.766  7.984  1.00 69.18 ? 1057 ILE C N   1 
ATOM   8638  C  CA  . ILE C 1 404 ? 50.857  63.347  7.963  1.00 67.50 ? 1057 ILE C CA  1 
ATOM   8639  C  C   . ILE C 1 404 ? 49.543  63.161  7.218  1.00 66.60 ? 1057 ILE C C   1 
ATOM   8640  O  O   . ILE C 1 404 ? 48.578  63.900  7.450  1.00 65.82 ? 1057 ILE C O   1 
ATOM   8641  C  CB  . ILE C 1 404 ? 50.652  62.775  9.403  1.00 68.02 ? 1057 ILE C CB  1 
ATOM   8642  C  CG1 . ILE C 1 404 ? 49.482  63.497  10.104 1.00 69.43 ? 1057 ILE C CG1 1 
ATOM   8643  C  CG2 . ILE C 1 404 ? 51.930  62.951  10.229 1.00 67.87 ? 1057 ILE C CG2 1 
ATOM   8644  C  CD1 . ILE C 1 404 ? 48.112  62.773  10.047 1.00 69.33 ? 1057 ILE C CD1 1 
ATOM   8645  N  N   . PHE C 1 405 ? 49.492  62.188  6.316  1.00 64.70 ? 1058 PHE C N   1 
ATOM   8646  C  CA  . PHE C 1 405 ? 48.240  61.943  5.627  1.00 62.52 ? 1058 PHE C CA  1 
ATOM   8647  C  C   . PHE C 1 405 ? 47.597  60.711  6.230  1.00 62.17 ? 1058 PHE C C   1 
ATOM   8648  O  O   . PHE C 1 405 ? 48.094  59.590  6.058  1.00 61.75 ? 1058 PHE C O   1 
ATOM   8649  C  CB  . PHE C 1 405 ? 48.426  61.708  4.127  1.00 61.39 ? 1058 PHE C CB  1 
ATOM   8650  C  CG  . PHE C 1 405 ? 47.144  61.324  3.426  1.00 61.18 ? 1058 PHE C CG  1 
ATOM   8651  C  CD1 . PHE C 1 405 ? 46.020  62.177  3.464  1.00 61.23 ? 1058 PHE C CD1 1 
ATOM   8652  C  CD2 . PHE C 1 405 ? 47.033  60.099  2.771  1.00 60.32 ? 1058 PHE C CD2 1 
ATOM   8653  C  CE1 . PHE C 1 405 ? 44.801  61.806  2.864  1.00 59.99 ? 1058 PHE C CE1 1 
ATOM   8654  C  CE2 . PHE C 1 405 ? 45.827  59.715  2.168  1.00 61.18 ? 1058 PHE C CE2 1 
ATOM   8655  C  CZ  . PHE C 1 405 ? 44.704  60.572  2.213  1.00 60.95 ? 1058 PHE C CZ  1 
ATOM   8656  N  N   . CYS C 1 406 ? 46.496  60.920  6.942  1.00 61.48 ? 1059 CYS C N   1 
ATOM   8657  C  CA  . CYS C 1 406 ? 45.791  59.806  7.550  1.00 60.67 ? 1059 CYS C CA  1 
ATOM   8658  C  C   . CYS C 1 406 ? 44.584  59.495  6.701  1.00 59.58 ? 1059 CYS C C   1 
ATOM   8659  O  O   . CYS C 1 406 ? 43.572  60.194  6.754  1.00 59.30 ? 1059 CYS C O   1 
ATOM   8660  C  CB  . CYS C 1 406 ? 45.356  60.147  8.974  1.00 61.55 ? 1059 CYS C CB  1 
ATOM   8661  S  SG  . CYS C 1 406 ? 44.726  58.719  9.863  1.00 62.51 ? 1059 CYS C SG  1 
ATOM   8662  N  N   . GLN C 1 407 ? 44.716  58.443  5.905  1.00 58.83 ? 1060 GLN C N   1 
ATOM   8663  C  CA  . GLN C 1 407 ? 43.661  58.003  5.011  1.00 58.21 ? 1060 GLN C CA  1 
ATOM   8664  C  C   . GLN C 1 407 ? 42.280  57.902  5.665  1.00 58.00 ? 1060 GLN C C   1 
ATOM   8665  O  O   . GLN C 1 407 ? 41.347  58.609  5.272  1.00 57.93 ? 1060 GLN C O   1 
ATOM   8666  C  CB  . GLN C 1 407 ? 44.041  56.658  4.392  1.00 57.36 ? 1060 GLN C CB  1 
ATOM   8667  C  CG  . GLN C 1 407 ? 42.847  55.858  3.956  1.00 59.73 ? 1060 GLN C CG  1 
ATOM   8668  C  CD  . GLN C 1 407 ? 43.110  55.018  2.729  1.00 59.41 ? 1060 GLN C CD  1 
ATOM   8669  O  OE1 . GLN C 1 407 ? 43.941  54.111  2.747  1.00 60.58 ? 1060 GLN C OE1 1 
ATOM   8670  N  NE2 . GLN C 1 407 ? 42.398  55.317  1.649  1.00 60.14 ? 1060 GLN C NE2 1 
ATOM   8671  N  N   . LEU C 1 408 ? 42.145  57.038  6.668  1.00 58.07 ? 1061 LEU C N   1 
ATOM   8672  C  CA  . LEU C 1 408 ? 40.848  56.866  7.308  1.00 57.87 ? 1061 LEU C CA  1 
ATOM   8673  C  C   . LEU C 1 408 ? 40.281  58.155  7.886  1.00 57.36 ? 1061 LEU C C   1 
ATOM   8674  O  O   . LEU C 1 408 ? 39.062  58.333  7.943  1.00 57.60 ? 1061 LEU C O   1 
ATOM   8675  C  CB  . LEU C 1 408 ? 40.907  55.781  8.395  1.00 57.40 ? 1061 LEU C CB  1 
ATOM   8676  C  CG  . LEU C 1 408 ? 41.393  56.034  9.821  1.00 57.27 ? 1061 LEU C CG  1 
ATOM   8677  C  CD1 . LEU C 1 408 ? 40.461  56.955  10.588 1.00 55.92 ? 1061 LEU C CD1 1 
ATOM   8678  C  CD2 . LEU C 1 408 ? 41.457  54.683  10.523 1.00 56.64 ? 1061 LEU C CD2 1 
ATOM   8679  N  N   . MET C 1 409 ? 41.156  59.052  8.321  1.00 56.66 ? 1062 MET C N   1 
ATOM   8680  C  CA  . MET C 1 409 ? 40.708  60.322  8.892  1.00 56.28 ? 1062 MET C CA  1 
ATOM   8681  C  C   . MET C 1 409 ? 40.105  61.185  7.762  1.00 55.21 ? 1062 MET C C   1 
ATOM   8682  O  O   . MET C 1 409 ? 39.244  62.029  7.999  1.00 53.89 ? 1062 MET C O   1 
ATOM   8683  C  CB  . MET C 1 409 ? 41.902  61.027  9.551  1.00 57.52 ? 1062 MET C CB  1 
ATOM   8684  C  CG  . MET C 1 409 ? 41.554  61.937  10.708 1.00 58.44 ? 1062 MET C CG  1 
ATOM   8685  S  SD  . MET C 1 409 ? 40.764  61.071  12.071 1.00 62.33 ? 1062 MET C SD  1 
ATOM   8686  C  CE  . MET C 1 409 ? 40.406  62.464  13.165 1.00 60.68 ? 1062 MET C CE  1 
ATOM   8687  N  N   . HIS C 1 410 ? 40.562  60.943  6.535  1.00 54.31 ? 1063 HIS C N   1 
ATOM   8688  C  CA  . HIS C 1 410 ? 40.091  61.647  5.345  1.00 53.91 ? 1063 HIS C CA  1 
ATOM   8689  C  C   . HIS C 1 410 ? 38.689  61.141  4.943  1.00 52.69 ? 1063 HIS C C   1 
ATOM   8690  O  O   . HIS C 1 410 ? 37.787  61.924  4.617  1.00 51.59 ? 1063 HIS C O   1 
ATOM   8691  C  CB  . HIS C 1 410 ? 41.122  61.442  4.217  1.00 56.35 ? 1063 HIS C CB  1 
ATOM   8692  C  CG  . HIS C 1 410 ? 40.588  61.654  2.833  1.00 58.99 ? 1063 HIS C CG  1 
ATOM   8693  N  ND1 . HIS C 1 410 ? 40.051  62.853  2.409  1.00 61.04 ? 1063 HIS C ND1 1 
ATOM   8694  C  CD2 . HIS C 1 410 ? 40.520  60.816  1.769  1.00 60.51 ? 1063 HIS C CD2 1 
ATOM   8695  C  CE1 . HIS C 1 410 ? 39.674  62.744  1.147  1.00 60.85 ? 1063 HIS C CE1 1 
ATOM   8696  N  NE2 . HIS C 1 410 ? 39.947  61.517  0.735  1.00 61.18 ? 1063 HIS C NE2 1 
ATOM   8697  N  N   . HIS C 1 411 ? 38.502  59.827  4.972  1.00 51.51 ? 1064 HIS C N   1 
ATOM   8698  C  CA  . HIS C 1 411 ? 37.207  59.263  4.628  1.00 49.61 ? 1064 HIS C CA  1 
ATOM   8699  C  C   . HIS C 1 411 ? 36.172  59.821  5.574  1.00 49.45 ? 1064 HIS C C   1 
ATOM   8700  O  O   . HIS C 1 411 ? 35.100  60.267  5.165  1.00 49.74 ? 1064 HIS C O   1 
ATOM   8701  C  CB  . HIS C 1 411 ? 37.267  57.751  4.728  1.00 46.99 ? 1064 HIS C CB  1 
ATOM   8702  C  CG  . HIS C 1 411 ? 38.179  57.148  3.719  1.00 45.24 ? 1064 HIS C CG  1 
ATOM   8703  N  ND1 . HIS C 1 411 ? 38.036  57.382  2.371  1.00 44.97 ? 1064 HIS C ND1 1 
ATOM   8704  C  CD2 . HIS C 1 411 ? 39.279  56.372  3.854  1.00 46.34 ? 1064 HIS C CD2 1 
ATOM   8705  C  CE1 . HIS C 1 411 ? 39.011  56.779  1.716  1.00 45.91 ? 1064 HIS C CE1 1 
ATOM   8706  N  NE2 . HIS C 1 411 ? 39.780  56.157  2.593  1.00 47.11 ? 1064 HIS C NE2 1 
ATOM   8707  N  N   . LEU C 1 412 ? 36.518  59.820  6.848  1.00 48.41 ? 1065 LEU C N   1 
ATOM   8708  C  CA  . LEU C 1 412 ? 35.625  60.331  7.858  1.00 48.44 ? 1065 LEU C CA  1 
ATOM   8709  C  C   . LEU C 1 412 ? 35.106  61.748  7.517  1.00 48.87 ? 1065 LEU C C   1 
ATOM   8710  O  O   . LEU C 1 412 ? 33.925  62.006  7.677  1.00 48.93 ? 1065 LEU C O   1 
ATOM   8711  C  CB  . LEU C 1 412 ? 36.338  60.327  9.207  1.00 45.91 ? 1065 LEU C CB  1 
ATOM   8712  C  CG  . LEU C 1 412 ? 35.512  60.332  10.494 1.00 44.74 ? 1065 LEU C CG  1 
ATOM   8713  C  CD1 . LEU C 1 412 ? 34.532  59.168  10.529 1.00 42.63 ? 1065 LEU C CD1 1 
ATOM   8714  C  CD2 . LEU C 1 412 ? 36.485  60.238  11.664 1.00 43.82 ? 1065 LEU C CD2 1 
ATOM   8715  N  N   . THR C 1 413 ? 35.978  62.651  7.059  1.00 49.41 ? 1066 THR C N   1 
ATOM   8716  C  CA  . THR C 1 413 ? 35.572  64.017  6.703  1.00 50.00 ? 1066 THR C CA  1 
ATOM   8717  C  C   . THR C 1 413 ? 34.677  64.034  5.474  1.00 49.83 ? 1066 THR C C   1 
ATOM   8718  O  O   . THR C 1 413 ? 33.725  64.804  5.408  1.00 49.67 ? 1066 THR C O   1 
ATOM   8719  C  CB  . THR C 1 413 ? 36.776  64.938  6.356  1.00 50.75 ? 1066 THR C CB  1 
ATOM   8720  O  OG1 . THR C 1 413 ? 37.757  64.867  7.390  1.00 51.82 ? 1066 THR C OG1 1 
ATOM   8721  C  CG2 . THR C 1 413 ? 36.304  66.409  6.196  1.00 49.53 ? 1066 THR C CG2 1 
ATOM   8722  N  N   . GLU C 1 414 ? 35.013  63.205  4.492  1.00 50.08 ? 1067 GLU C N   1 
ATOM   8723  C  CA  . GLU C 1 414 ? 34.232  63.137  3.264  1.00 51.63 ? 1067 GLU C CA  1 
ATOM   8724  C  C   . GLU C 1 414 ? 32.857  62.538  3.488  1.00 50.59 ? 1067 GLU C C   1 
ATOM   8725  O  O   . GLU C 1 414 ? 31.850  63.151  3.124  1.00 50.99 ? 1067 GLU C O   1 
ATOM   8726  C  CB  . GLU C 1 414 ? 34.960  62.330  2.176  1.00 52.50 ? 1067 GLU C CB  1 
ATOM   8727  C  CG  . GLU C 1 414 ? 36.263  62.949  1.691  1.00 57.41 ? 1067 GLU C CG  1 
ATOM   8728  C  CD  . GLU C 1 414 ? 36.301  64.475  1.840  1.00 60.59 ? 1067 GLU C CD  1 
ATOM   8729  O  OE1 . GLU C 1 414 ? 35.398  65.167  1.317  1.00 62.39 ? 1067 GLU C OE1 1 
ATOM   8730  O  OE2 . GLU C 1 414 ? 37.244  64.989  2.485  1.00 63.11 ? 1067 GLU C OE2 1 
ATOM   8731  N  N   . ASN C 1 415 ? 32.816  61.348  4.085  1.00 48.55 ? 1068 ASN C N   1 
ATOM   8732  C  CA  . ASN C 1 415 ? 31.553  60.652  4.347  1.00 47.02 ? 1068 ASN C CA  1 
ATOM   8733  C  C   . ASN C 1 415 ? 30.567  61.466  5.209  1.00 47.18 ? 1068 ASN C C   1 
ATOM   8734  O  O   . ASN C 1 415 ? 29.337  61.301  5.120  1.00 46.22 ? 1068 ASN C O   1 
ATOM   8735  C  CB  . ASN C 1 415 ? 31.838  59.312  5.021  1.00 46.87 ? 1068 ASN C CB  1 
ATOM   8736  C  CG  . ASN C 1 415 ? 32.527  58.333  4.096  1.00 46.43 ? 1068 ASN C CG  1 
ATOM   8737  O  OD1 . ASN C 1 415 ? 32.296  58.354  2.890  1.00 50.02 ? 1068 ASN C OD1 1 
ATOM   8738  N  ND2 . ASN C 1 415 ? 33.356  57.451  4.653  1.00 46.54 ? 1068 ASN C ND2 1 
ATOM   8739  N  N   . HIS C 1 416 ? 31.117  62.349  6.034  1.00 45.05 ? 1069 HIS C N   1 
ATOM   8740  C  CA  . HIS C 1 416 ? 30.327  63.187  6.908  1.00 44.22 ? 1069 HIS C CA  1 
ATOM   8741  C  C   . HIS C 1 416 ? 29.600  64.257  6.082  1.00 43.88 ? 1069 HIS C C   1 
ATOM   8742  O  O   . HIS C 1 416 ? 28.537  64.733  6.468  1.00 41.86 ? 1069 HIS C O   1 
ATOM   8743  C  CB  . HIS C 1 416 ? 31.261  63.839  7.930  1.00 45.72 ? 1069 HIS C CB  1 
ATOM   8744  C  CG  . HIS C 1 416 ? 30.558  64.610  9.007  1.00 49.89 ? 1069 HIS C CG  1 
ATOM   8745  N  ND1 . HIS C 1 416 ? 29.503  64.091  9.733  1.00 51.41 ? 1069 HIS C ND1 1 
ATOM   8746  C  CD2 . HIS C 1 416 ? 30.799  65.838  9.523  1.00 50.73 ? 1069 HIS C CD2 1 
ATOM   8747  C  CE1 . HIS C 1 416 ? 29.130  64.964  10.653 1.00 51.41 ? 1069 HIS C CE1 1 
ATOM   8748  N  NE2 . HIS C 1 416 ? 29.902  66.032  10.547 1.00 53.17 ? 1069 HIS C NE2 1 
ATOM   8749  N  N   . LYS C 1 417 ? 30.190  64.635  4.949  1.00 43.74 ? 1070 LYS C N   1 
ATOM   8750  C  CA  . LYS C 1 417 ? 29.611  65.654  4.089  1.00 43.50 ? 1070 LYS C CA  1 
ATOM   8751  C  C   . LYS C 1 417 ? 28.382  65.125  3.378  1.00 43.18 ? 1070 LYS C C   1 
ATOM   8752  O  O   . LYS C 1 417 ? 27.501  65.889  2.959  1.00 44.49 ? 1070 LYS C O   1 
ATOM   8753  C  CB  . LYS C 1 417 ? 30.632  66.125  3.069  1.00 43.50 ? 1070 LYS C CB  1 
ATOM   8754  C  CG  . LYS C 1 417 ? 31.760  66.904  3.683  1.00 46.68 ? 1070 LYS C CG  1 
ATOM   8755  C  CD  . LYS C 1 417 ? 32.710  67.341  2.601  1.00 49.81 ? 1070 LYS C CD  1 
ATOM   8756  C  CE  . LYS C 1 417 ? 33.974  67.970  3.165  1.00 51.82 ? 1070 LYS C CE  1 
ATOM   8757  N  NZ  . LYS C 1 417 ? 34.841  68.446  2.040  1.00 53.31 ? 1070 LYS C NZ  1 
ATOM   8758  N  N   . ILE C 1 418 ? 28.320  63.811  3.243  1.00 40.74 ? 1071 ILE C N   1 
ATOM   8759  C  CA  . ILE C 1 418 ? 27.194  63.202  2.582  1.00 39.45 ? 1071 ILE C CA  1 
ATOM   8760  C  C   . ILE C 1 418 ? 25.932  63.483  3.373  1.00 40.36 ? 1071 ILE C C   1 
ATOM   8761  O  O   . ILE C 1 418 ? 24.891  63.787  2.797  1.00 38.60 ? 1071 ILE C O   1 
ATOM   8762  C  CB  . ILE C 1 418 ? 27.372  61.675  2.458  1.00 37.57 ? 1071 ILE C CB  1 
ATOM   8763  C  CG1 . ILE C 1 418 ? 28.538  61.356  1.521  1.00 35.53 ? 1071 ILE C CG1 1 
ATOM   8764  C  CG2 . ILE C 1 418 ? 26.080  61.029  1.964  1.00 36.71 ? 1071 ILE C CG2 1 
ATOM   8765  C  CD1 . ILE C 1 418 ? 28.925  59.891  1.548  1.00 32.17 ? 1071 ILE C CD1 1 
ATOM   8766  N  N   . TRP C 1 419 ? 26.039  63.422  4.700  1.00 41.66 ? 1072 TRP C N   1 
ATOM   8767  C  CA  . TRP C 1 419 ? 24.866  63.609  5.550  1.00 42.48 ? 1072 TRP C CA  1 
ATOM   8768  C  C   . TRP C 1 419 ? 24.662  64.914  6.323  1.00 43.55 ? 1072 TRP C C   1 
ATOM   8769  O  O   . TRP C 1 419 ? 23.624  65.077  6.965  1.00 41.05 ? 1072 TRP C O   1 
ATOM   8770  C  CB  . TRP C 1 419 ? 24.773  62.449  6.546  1.00 40.20 ? 1072 TRP C CB  1 
ATOM   8771  C  CG  . TRP C 1 419 ? 25.267  61.147  6.036  1.00 39.03 ? 1072 TRP C CG  1 
ATOM   8772  C  CD1 . TRP C 1 419 ? 26.519  60.636  6.200  1.00 38.89 ? 1072 TRP C CD1 1 
ATOM   8773  C  CD2 . TRP C 1 419 ? 24.524  60.158  5.307  1.00 39.15 ? 1072 TRP C CD2 1 
ATOM   8774  N  NE1 . TRP C 1 419 ? 26.607  59.391  5.627  1.00 38.07 ? 1072 TRP C NE1 1 
ATOM   8775  C  CE2 . TRP C 1 419 ? 25.400  59.068  5.068  1.00 38.04 ? 1072 TRP C CE2 1 
ATOM   8776  C  CE3 . TRP C 1 419 ? 23.203  60.081  4.828  1.00 37.75 ? 1072 TRP C CE3 1 
ATOM   8777  C  CZ2 . TRP C 1 419 ? 25.002  57.913  4.378  1.00 36.86 ? 1072 TRP C CZ2 1 
ATOM   8778  C  CZ3 . TRP C 1 419 ? 22.809  58.929  4.141  1.00 36.48 ? 1072 TRP C CZ3 1 
ATOM   8779  C  CH2 . TRP C 1 419 ? 23.713  57.860  3.924  1.00 36.19 ? 1072 TRP C CH2 1 
ATOM   8780  N  N   . LYS C 1 420 ? 25.626  65.833  6.271  1.00 46.85 ? 1073 LYS C N   1 
ATOM   8781  C  CA  . LYS C 1 420 ? 25.504  67.088  7.009  1.00 50.33 ? 1073 LYS C CA  1 
ATOM   8782  C  C   . LYS C 1 420 ? 25.100  68.295  6.160  1.00 52.83 ? 1073 LYS C C   1 
ATOM   8783  O  O   . LYS C 1 420 ? 24.025  68.890  6.416  1.00 53.67 ? 1073 LYS C O   1 
ATOM   8784  C  CB  . LYS C 1 420 ? 26.815  67.408  7.737  1.00 52.41 ? 1073 LYS C CB  1 
ATOM   8785  C  CG  . LYS C 1 420 ? 26.810  68.775  8.439  1.00 54.63 ? 1073 LYS C CG  1 
ATOM   8786  C  CD  . LYS C 1 420 ? 27.941  68.959  9.445  1.00 57.66 ? 1073 LYS C CD  1 
ATOM   8787  C  CE  . LYS C 1 420 ? 27.851  70.346  10.129 1.00 58.32 ? 1073 LYS C CE  1 
ATOM   8788  N  NZ  . LYS C 1 420 ? 28.928  70.594  11.143 1.00 58.73 ? 1073 LYS C NZ  1 
ATOM   8789  O  OXT . LYS C 1 420 ? 25.882  68.647  5.255  1.00 55.63 ? 1073 LYS C OXT 1 
ATOM   8790  N  N   . LEU D 1 6   ? -7.622  31.140  68.624 1.00 76.91 ? 659  LEU D N   1 
ATOM   8791  C  CA  . LEU D 1 6   ? -7.854  32.621  68.549 1.00 78.05 ? 659  LEU D CA  1 
ATOM   8792  C  C   . LEU D 1 6   ? -6.675  33.322  67.876 1.00 78.25 ? 659  LEU D C   1 
ATOM   8793  O  O   . LEU D 1 6   ? -5.525  32.868  67.984 1.00 78.95 ? 659  LEU D O   1 
ATOM   8794  C  CB  . LEU D 1 6   ? -8.077  33.215  69.965 1.00 77.11 ? 659  LEU D CB  1 
ATOM   8795  N  N   . ASP D 1 7   ? -6.973  34.426  67.185 1.00 78.27 ? 660  ASP D N   1 
ATOM   8796  C  CA  . ASP D 1 7   ? -5.961  35.227  66.486 1.00 77.86 ? 660  ASP D CA  1 
ATOM   8797  C  C   . ASP D 1 7   ? -5.416  36.326  67.417 1.00 77.94 ? 660  ASP D C   1 
ATOM   8798  O  O   . ASP D 1 7   ? -4.763  37.281  66.968 1.00 77.95 ? 660  ASP D O   1 
ATOM   8799  C  CB  . ASP D 1 7   ? -6.574  35.858  65.211 1.00 77.66 ? 660  ASP D CB  1 
ATOM   8800  N  N   . LEU D 1 8   ? -5.702  36.175  68.713 1.00 77.61 ? 661  LEU D N   1 
ATOM   8801  C  CA  . LEU D 1 8   ? -5.254  37.120  69.737 1.00 77.58 ? 661  LEU D CA  1 
ATOM   8802  C  C   . LEU D 1 8   ? -3.878  36.684  70.230 1.00 77.67 ? 661  LEU D C   1 
ATOM   8803  O  O   . LEU D 1 8   ? -3.146  37.472  70.858 1.00 77.84 ? 661  LEU D O   1 
ATOM   8804  C  CB  . LEU D 1 8   ? -6.249  37.154  70.900 1.00 76.78 ? 661  LEU D CB  1 
ATOM   8805  N  N   . ILE D 1 9   ? -3.533  35.425  69.932 1.00 77.09 ? 662  ILE D N   1 
ATOM   8806  C  CA  . ILE D 1 9   ? -2.242  34.847  70.316 1.00 76.50 ? 662  ILE D CA  1 
ATOM   8807  C  C   . ILE D 1 9   ? -1.178  35.263  69.305 1.00 76.79 ? 662  ILE D C   1 
ATOM   8808  O  O   . ILE D 1 9   ? -0.030  35.531  69.674 1.00 77.74 ? 662  ILE D O   1 
ATOM   8809  C  CB  . ILE D 1 9   ? -2.330  33.316  70.386 1.00 75.57 ? 662  ILE D CB  1 
ATOM   8810  N  N   . LEU D 1 10  ? -1.557  35.315  68.028 1.00 76.33 ? 663  LEU D N   1 
ATOM   8811  C  CA  . LEU D 1 10  ? -0.615  35.721  66.989 1.00 75.51 ? 663  LEU D CA  1 
ATOM   8812  C  C   . LEU D 1 10  ? -0.091  37.119  67.342 1.00 75.29 ? 663  LEU D C   1 
ATOM   8813  O  O   . LEU D 1 10  ? 1.075   37.446  67.075 1.00 75.60 ? 663  LEU D O   1 
ATOM   8814  C  CB  . LEU D 1 10  ? -1.294  35.728  65.614 1.00 74.92 ? 663  LEU D CB  1 
ATOM   8815  C  CG  . LEU D 1 10  ? -0.364  36.114  64.445 1.00 75.64 ? 663  LEU D CG  1 
ATOM   8816  C  CD1 . LEU D 1 10  ? -0.809  35.427  63.145 1.00 73.83 ? 663  LEU D CD1 1 
ATOM   8817  C  CD2 . LEU D 1 10  ? -0.344  37.652  64.292 1.00 74.98 ? 663  LEU D CD2 1 
ATOM   8818  N  N   . VAL D 1 11  ? -0.960  37.928  67.952 1.00 74.51 ? 664  VAL D N   1 
ATOM   8819  C  CA  . VAL D 1 11  ? -0.613  39.287  68.384 1.00 73.99 ? 664  VAL D CA  1 
ATOM   8820  C  C   . VAL D 1 11  ? 0.641   39.230  69.263 1.00 73.60 ? 664  VAL D C   1 
ATOM   8821  O  O   . VAL D 1 11  ? 1.655   39.893  68.999 1.00 73.27 ? 664  VAL D O   1 
ATOM   8822  C  CB  . VAL D 1 11  ? -1.749  39.902  69.233 1.00 73.44 ? 664  VAL D CB  1 
ATOM   8823  C  CG1 . VAL D 1 11  ? -1.502  41.411  69.425 1.00 72.63 ? 664  VAL D CG1 1 
ATOM   8824  C  CG2 . VAL D 1 11  ? -3.103  39.609  68.585 1.00 72.77 ? 664  VAL D CG2 1 
ATOM   8825  N  N   . GLU D 1 12  ? 0.538   38.435  70.324 1.00 73.85 ? 665  GLU D N   1 
ATOM   8826  C  CA  . GLU D 1 12  ? 1.636   38.235  71.266 1.00 74.21 ? 665  GLU D CA  1 
ATOM   8827  C  C   . GLU D 1 12  ? 2.894   37.843  70.514 1.00 73.46 ? 665  GLU D C   1 
ATOM   8828  O  O   . GLU D 1 12  ? 4.001   38.294  70.855 1.00 73.37 ? 665  GLU D O   1 
ATOM   8829  C  CB  . GLU D 1 12  ? 1.269   37.134  72.264 1.00 74.72 ? 665  GLU D CB  1 
ATOM   8830  C  CG  . GLU D 1 12  ? 0.083   37.505  73.151 1.00 76.26 ? 665  GLU D CG  1 
ATOM   8831  C  CD  . GLU D 1 12  ? -0.324  36.375  74.086 1.00 76.99 ? 665  GLU D CD  1 
ATOM   8832  O  OE1 . GLU D 1 12  ? -1.055  36.649  75.073 1.00 77.60 ? 665  GLU D OE1 1 
ATOM   8833  O  OE2 . GLU D 1 12  ? 0.079   35.212  73.827 1.00 77.45 ? 665  GLU D OE2 1 
ATOM   8834  N  N   . GLU D 1 13  ? 2.721   36.996  69.498 1.00 72.32 ? 666  GLU D N   1 
ATOM   8835  C  CA  . GLU D 1 13  ? 3.854   36.572  68.688 1.00 71.54 ? 666  GLU D CA  1 
ATOM   8836  C  C   . GLU D 1 13  ? 4.536   37.790  68.098 1.00 71.01 ? 666  GLU D C   1 
ATOM   8837  O  O   . GLU D 1 13  ? 5.708   38.032  68.398 1.00 72.26 ? 666  GLU D O   1 
ATOM   8838  C  CB  . GLU D 1 13  ? 3.413   35.649  67.569 1.00 71.14 ? 666  GLU D CB  1 
ATOM   8839  C  CG  . GLU D 1 13  ? 3.330   34.221  67.993 1.00 72.40 ? 666  GLU D CG  1 
ATOM   8840  C  CD  . GLU D 1 13  ? 2.794   33.361  66.883 1.00 73.52 ? 666  GLU D CD  1 
ATOM   8841  O  OE1 . GLU D 1 13  ? 1.575   33.485  66.618 1.00 73.77 ? 666  GLU D OE1 1 
ATOM   8842  O  OE2 . GLU D 1 13  ? 3.583   32.589  66.269 1.00 73.35 ? 666  GLU D OE2 1 
ATOM   8843  N  N   . TYR D 1 14  ? 3.800   38.562  67.290 1.00 68.75 ? 667  TYR D N   1 
ATOM   8844  C  CA  . TYR D 1 14  ? 4.337   39.763  66.650 1.00 66.91 ? 667  TYR D CA  1 
ATOM   8845  C  C   . TYR D 1 14  ? 5.034   40.707  67.640 1.00 67.36 ? 667  TYR D C   1 
ATOM   8846  O  O   . TYR D 1 14  ? 6.133   41.213  67.363 1.00 67.39 ? 667  TYR D O   1 
ATOM   8847  C  CB  . TYR D 1 14  ? 3.213   40.522  65.903 1.00 64.69 ? 667  TYR D CB  1 
ATOM   8848  C  CG  . TYR D 1 14  ? 3.632   41.858  65.284 1.00 62.04 ? 667  TYR D CG  1 
ATOM   8849  C  CD1 . TYR D 1 14  ? 4.011   41.956  63.942 1.00 61.04 ? 667  TYR D CD1 1 
ATOM   8850  C  CD2 . TYR D 1 14  ? 3.705   43.010  66.066 1.00 61.11 ? 667  TYR D CD2 1 
ATOM   8851  C  CE1 . TYR D 1 14  ? 4.463   43.184  63.400 1.00 59.68 ? 667  TYR D CE1 1 
ATOM   8852  C  CE2 . TYR D 1 14  ? 4.157   44.231  65.544 1.00 59.61 ? 667  TYR D CE2 1 
ATOM   8853  C  CZ  . TYR D 1 14  ? 4.542   44.320  64.213 1.00 59.37 ? 667  TYR D CZ  1 
ATOM   8854  O  OH  . TYR D 1 14  ? 5.058   45.529  63.748 1.00 56.84 ? 667  TYR D OH  1 
ATOM   8855  N  N   . ASP D 1 15  ? 4.411   40.949  68.793 1.00 67.51 ? 668  ASP D N   1 
ATOM   8856  C  CA  . ASP D 1 15  ? 4.993   41.866  69.795 1.00 67.61 ? 668  ASP D CA  1 
ATOM   8857  C  C   . ASP D 1 15  ? 6.253   41.356  70.474 1.00 66.49 ? 668  ASP D C   1 
ATOM   8858  O  O   . ASP D 1 15  ? 7.163   42.131  70.762 1.00 66.19 ? 668  ASP D O   1 
ATOM   8859  C  CB  . ASP D 1 15  ? 3.957   42.201  70.866 1.00 68.72 ? 668  ASP D CB  1 
ATOM   8860  C  CG  . ASP D 1 15  ? 2.711   42.808  70.279 1.00 70.77 ? 668  ASP D CG  1 
ATOM   8861  O  OD1 . ASP D 1 15  ? 2.826   43.884  69.636 1.00 71.11 ? 668  ASP D OD1 1 
ATOM   8862  O  OD2 . ASP D 1 15  ? 1.626   42.204  70.456 1.00 71.19 ? 668  ASP D OD2 1 
ATOM   8863  N  N   . SER D 1 16  ? 6.285   40.061  70.767 1.00 65.97 ? 669  SER D N   1 
ATOM   8864  C  CA  . SER D 1 16  ? 7.450   39.449  71.409 1.00 64.74 ? 669  SER D CA  1 
ATOM   8865  C  C   . SER D 1 16  ? 8.610   39.553  70.422 1.00 63.86 ? 669  SER D C   1 
ATOM   8866  O  O   . SER D 1 16  ? 9.660   40.154  70.704 1.00 62.84 ? 669  SER D O   1 
ATOM   8867  C  CB  . SER D 1 16  ? 7.158   37.976  71.716 1.00 64.78 ? 669  SER D CB  1 
ATOM   8868  O  OG  . SER D 1 16  ? 8.344   37.272  72.025 1.00 65.64 ? 669  SER D OG  1 
ATOM   8869  N  N   . LEU D 1 17  ? 8.385   38.967  69.247 1.00 62.47 ? 670  LEU D N   1 
ATOM   8870  C  CA  . LEU D 1 17  ? 9.366   38.962  68.165 1.00 60.92 ? 670  LEU D CA  1 
ATOM   8871  C  C   . LEU D 1 17  ? 9.917   40.362  67.947 1.00 59.98 ? 670  LEU D C   1 
ATOM   8872  O  O   . LEU D 1 17  ? 11.131  40.564  67.876 1.00 60.39 ? 670  LEU D O   1 
ATOM   8873  C  CB  . LEU D 1 17  ? 8.711   38.464  66.878 1.00 60.11 ? 670  LEU D CB  1 
ATOM   8874  C  CG  . LEU D 1 17  ? 9.689   37.797  65.921 1.00 60.49 ? 670  LEU D CG  1 
ATOM   8875  C  CD1 . LEU D 1 17  ? 8.977   37.489  64.607 1.00 59.04 ? 670  LEU D CD1 1 
ATOM   8876  C  CD2 . LEU D 1 17  ? 10.904  38.705  65.711 1.00 59.61 ? 670  LEU D CD2 1 
ATOM   8877  N  N   . ILE D 1 18  ? 9.008   41.323  67.834 1.00 58.99 ? 671  ILE D N   1 
ATOM   8878  C  CA  . ILE D 1 18  ? 9.376   42.712  67.629 1.00 58.28 ? 671  ILE D CA  1 
ATOM   8879  C  C   . ILE D 1 18  ? 10.205  43.219  68.796 1.00 58.46 ? 671  ILE D C   1 
ATOM   8880  O  O   . ILE D 1 18  ? 11.175  43.954  68.613 1.00 57.51 ? 671  ILE D O   1 
ATOM   8881  C  CB  . ILE D 1 18  ? 8.106   43.586  67.471 1.00 57.97 ? 671  ILE D CB  1 
ATOM   8882  C  CG1 . ILE D 1 18  ? 7.655   43.569  66.006 1.00 57.19 ? 671  ILE D CG1 1 
ATOM   8883  C  CG2 . ILE D 1 18  ? 8.374   45.026  67.952 1.00 57.39 ? 671  ILE D CG2 1 
ATOM   8884  C  CD1 . ILE D 1 18  ? 8.576   44.366  65.058 1.00 55.75 ? 671  ILE D CD1 1 
ATOM   8885  N  N   . GLU D 1 19  ? 9.808   42.818  69.997 1.00 59.47 ? 672  GLU D N   1 
ATOM   8886  C  CA  . GLU D 1 19  ? 10.497  43.225  71.215 1.00 60.47 ? 672  GLU D CA  1 
ATOM   8887  C  C   . GLU D 1 19  ? 11.909  42.643  71.193 1.00 60.28 ? 672  GLU D C   1 
ATOM   8888  O  O   . GLU D 1 19  ? 12.893  43.303  71.567 1.00 58.99 ? 672  GLU D O   1 
ATOM   8889  C  CB  . GLU D 1 19  ? 9.712   42.723  72.432 1.00 61.47 ? 672  GLU D CB  1 
ATOM   8890  C  CG  . GLU D 1 19  ? 10.382  43.008  73.775 1.00 65.61 ? 672  GLU D CG  1 
ATOM   8891  C  CD  . GLU D 1 19  ? 10.310  41.806  74.713 1.00 67.58 ? 672  GLU D CD  1 
ATOM   8892  O  OE1 . GLU D 1 19  ? 10.816  40.725  74.312 1.00 67.76 ? 672  GLU D OE1 1 
ATOM   8893  O  OE2 . GLU D 1 19  ? 9.742   41.930  75.835 1.00 68.90 ? 672  GLU D OE2 1 
ATOM   8894  N  N   . LYS D 1 20  ? 12.000  41.404  70.724 1.00 60.13 ? 673  LYS D N   1 
ATOM   8895  C  CA  . LYS D 1 20  ? 13.285  40.731  70.636 1.00 60.82 ? 673  LYS D CA  1 
ATOM   8896  C  C   . LYS D 1 20  ? 14.219  41.430  69.656 1.00 61.44 ? 673  LYS D C   1 
ATOM   8897  O  O   . LYS D 1 20  ? 15.348  41.819  70.012 1.00 61.48 ? 673  LYS D O   1 
ATOM   8898  C  CB  . LYS D 1 20  ? 13.090  39.282  70.194 1.00 60.74 ? 673  LYS D CB  1 
ATOM   8899  C  CG  . LYS D 1 20  ? 12.563  38.369  71.275 1.00 61.77 ? 673  LYS D CG  1 
ATOM   8900  C  CD  . LYS D 1 20  ? 12.230  36.989  70.701 1.00 64.08 ? 673  LYS D CD  1 
ATOM   8901  C  CE  . LYS D 1 20  ? 11.855  36.002  71.811 1.00 64.92 ? 673  LYS D CE  1 
ATOM   8902  N  NZ  . LYS D 1 20  ? 11.622  34.634  71.250 1.00 66.68 ? 673  LYS D NZ  1 
ATOM   8903  N  N   . MET D 1 21  ? 13.729  41.593  68.427 1.00 60.79 ? 674  MET D N   1 
ATOM   8904  C  CA  . MET D 1 21  ? 14.513  42.200  67.371 1.00 60.88 ? 674  MET D CA  1 
ATOM   8905  C  C   . MET D 1 21  ? 14.831  43.649  67.588 1.00 61.45 ? 674  MET D C   1 
ATOM   8906  O  O   . MET D 1 21  ? 15.656  44.204  66.865 1.00 62.11 ? 674  MET D O   1 
ATOM   8907  C  CB  . MET D 1 21  ? 13.806  42.070  66.033 1.00 61.14 ? 674  MET D CB  1 
ATOM   8908  C  CG  . MET D 1 21  ? 13.563  40.660  65.569 1.00 61.74 ? 674  MET D CG  1 
ATOM   8909  S  SD  . MET D 1 21  ? 12.667  40.679  64.006 1.00 63.55 ? 674  MET D SD  1 
ATOM   8910  C  CE  . MET D 1 21  ? 13.831  41.461  62.962 1.00 62.78 ? 674  MET D CE  1 
ATOM   8911  N  N   . SER D 1 22  ? 14.193  44.277  68.568 1.00 62.08 ? 675  SER D N   1 
ATOM   8912  C  CA  . SER D 1 22  ? 14.434  45.701  68.810 1.00 62.97 ? 675  SER D CA  1 
ATOM   8913  C  C   . SER D 1 22  ? 15.800  45.942  69.440 1.00 63.56 ? 675  SER D C   1 
ATOM   8914  O  O   . SER D 1 22  ? 16.228  47.088  69.669 1.00 64.93 ? 675  SER D O   1 
ATOM   8915  C  CB  . SER D 1 22  ? 13.318  46.283  69.682 1.00 62.07 ? 675  SER D CB  1 
ATOM   8916  O  OG  . SER D 1 22  ? 12.072  46.124  69.032 1.00 59.52 ? 675  SER D OG  1 
ATOM   8917  N  N   . ASN D 1 23  ? 16.496  44.852  69.721 1.00 63.51 ? 676  ASN D N   1 
ATOM   8918  C  CA  . ASN D 1 23  ? 17.822  44.985  70.281 1.00 63.27 ? 676  ASN D CA  1 
ATOM   8919  C  C   . ASN D 1 23  ? 18.851  44.703  69.179 1.00 60.74 ? 676  ASN D C   1 
ATOM   8920  O  O   . ASN D 1 23  ? 18.629  43.845  68.320 1.00 60.02 ? 676  ASN D O   1 
ATOM   8921  C  CB  . ASN D 1 23  ? 18.014  44.021  71.453 1.00 64.71 ? 676  ASN D CB  1 
ATOM   8922  C  CG  . ASN D 1 23  ? 19.068  44.518  72.413 1.00 67.69 ? 676  ASN D CG  1 
ATOM   8923  O  OD1 . ASN D 1 23  ? 18.877  45.545  73.086 1.00 68.03 ? 676  ASN D OD1 1 
ATOM   8924  N  ND2 . ASN D 1 23  ? 20.206  43.820  72.465 1.00 68.91 ? 676  ASN D ND2 1 
ATOM   8925  N  N   . TRP D 1 24  ? 19.954  45.449  69.185 1.00 58.72 ? 677  TRP D N   1 
ATOM   8926  C  CA  . TRP D 1 24  ? 21.008  45.251  68.195 1.00 57.04 ? 677  TRP D CA  1 
ATOM   8927  C  C   . TRP D 1 24  ? 21.425  43.783  68.194 1.00 55.11 ? 677  TRP D C   1 
ATOM   8928  O  O   . TRP D 1 24  ? 21.535  43.155  67.145 1.00 53.78 ? 677  TRP D O   1 
ATOM   8929  C  CB  . TRP D 1 24  ? 22.216  46.108  68.538 1.00 58.30 ? 677  TRP D CB  1 
ATOM   8930  C  CG  . TRP D 1 24  ? 23.435  45.762  67.746 1.00 60.51 ? 677  TRP D CG  1 
ATOM   8931  C  CD1 . TRP D 1 24  ? 24.701  45.554  68.235 1.00 62.15 ? 677  TRP D CD1 1 
ATOM   8932  C  CD2 . TRP D 1 24  ? 23.534  45.652  66.324 1.00 61.22 ? 677  TRP D CD2 1 
ATOM   8933  N  NE1 . TRP D 1 24  ? 25.579  45.330  67.204 1.00 61.61 ? 677  TRP D NE1 1 
ATOM   8934  C  CE2 . TRP D 1 24  ? 24.890  45.386  66.018 1.00 62.26 ? 677  TRP D CE2 1 
ATOM   8935  C  CE3 . TRP D 1 24  ? 22.614  45.756  65.274 1.00 60.78 ? 677  TRP D CE3 1 
ATOM   8936  C  CZ2 . TRP D 1 24  ? 25.344  45.227  64.700 1.00 62.28 ? 677  TRP D CZ2 1 
ATOM   8937  C  CZ3 . TRP D 1 24  ? 23.066  45.598  63.970 1.00 60.74 ? 677  TRP D CZ3 1 
ATOM   8938  C  CH2 . TRP D 1 24  ? 24.419  45.337  63.695 1.00 60.87 ? 677  TRP D CH2 1 
ATOM   8939  N  N   . ASN D 1 25  ? 21.640  43.252  69.394 1.00 53.33 ? 678  ASN D N   1 
ATOM   8940  C  CA  . ASN D 1 25  ? 22.032  41.865  69.568 1.00 52.37 ? 678  ASN D CA  1 
ATOM   8941  C  C   . ASN D 1 25  ? 20.839  40.933  69.599 1.00 52.00 ? 678  ASN D C   1 
ATOM   8942  O  O   . ASN D 1 25  ? 20.648  40.168  70.544 1.00 52.03 ? 678  ASN D O   1 
ATOM   8943  C  CB  . ASN D 1 25  ? 22.874  41.715  70.839 1.00 49.07 ? 678  ASN D CB  1 
ATOM   8944  C  CG  . ASN D 1 25  ? 24.283  42.242  70.650 1.00 49.01 ? 678  ASN D CG  1 
ATOM   8945  O  OD1 . ASN D 1 25  ? 24.892  42.011  69.604 1.00 51.21 ? 678  ASN D OD1 1 
ATOM   8946  N  ND2 . ASN D 1 25  ? 24.814  42.942  71.647 1.00 46.90 ? 678  ASN D ND2 1 
ATOM   8947  N  N   . PHE D 1 26  ? 20.037  40.993  68.548 1.00 52.13 ? 679  PHE D N   1 
ATOM   8948  C  CA  . PHE D 1 26  ? 18.853  40.146  68.453 1.00 52.81 ? 679  PHE D CA  1 
ATOM   8949  C  C   . PHE D 1 26  ? 19.199  38.652  68.600 1.00 53.32 ? 679  PHE D C   1 
ATOM   8950  O  O   . PHE D 1 26  ? 19.952  38.100  67.804 1.00 54.55 ? 679  PHE D O   1 
ATOM   8951  C  CB  . PHE D 1 26  ? 18.133  40.418  67.106 1.00 50.14 ? 679  PHE D CB  1 
ATOM   8952  C  CG  . PHE D 1 26  ? 17.084  39.381  66.737 1.00 49.16 ? 679  PHE D CG  1 
ATOM   8953  C  CD1 . PHE D 1 26  ? 16.106  38.987  67.655 1.00 49.67 ? 679  PHE D CD1 1 
ATOM   8954  C  CD2 . PHE D 1 26  ? 17.090  38.773  65.478 1.00 48.96 ? 679  PHE D CD2 1 
ATOM   8955  C  CE1 . PHE D 1 26  ? 15.149  37.989  67.326 1.00 48.54 ? 679  PHE D CE1 1 
ATOM   8956  C  CE2 . PHE D 1 26  ? 16.140  37.776  65.136 1.00 48.43 ? 679  PHE D CE2 1 
ATOM   8957  C  CZ  . PHE D 1 26  ? 15.171  37.388  66.069 1.00 48.24 ? 679  PHE D CZ  1 
ATOM   8958  N  N   . PRO D 1 27  ? 18.664  37.981  69.635 1.00 54.42 ? 680  PRO D N   1 
ATOM   8959  C  CA  . PRO D 1 27  ? 18.932  36.547  69.846 1.00 53.34 ? 680  PRO D CA  1 
ATOM   8960  C  C   . PRO D 1 27  ? 18.306  35.690  68.752 1.00 52.71 ? 680  PRO D C   1 
ATOM   8961  O  O   . PRO D 1 27  ? 17.386  34.894  68.995 1.00 52.48 ? 680  PRO D O   1 
ATOM   8962  C  CB  . PRO D 1 27  ? 18.315  36.275  71.210 1.00 53.76 ? 680  PRO D CB  1 
ATOM   8963  C  CG  . PRO D 1 27  ? 17.164  37.284  71.260 1.00 54.84 ? 680  PRO D CG  1 
ATOM   8964  C  CD  . PRO D 1 27  ? 17.844  38.530  70.730 1.00 54.23 ? 680  PRO D CD  1 
ATOM   8965  N  N   . ILE D 1 28  ? 18.837  35.848  67.544 1.00 51.92 ? 681  ILE D N   1 
ATOM   8966  C  CA  . ILE D 1 28  ? 18.360  35.126  66.368 1.00 51.11 ? 681  ILE D CA  1 
ATOM   8967  C  C   . ILE D 1 28  ? 18.398  33.594  66.464 1.00 49.94 ? 681  ILE D C   1 
ATOM   8968  O  O   . ILE D 1 28  ? 17.526  32.917  65.907 1.00 50.82 ? 681  ILE D O   1 
ATOM   8969  C  CB  . ILE D 1 28  ? 19.136  35.595  65.098 1.00 50.90 ? 681  ILE D CB  1 
ATOM   8970  C  CG1 . ILE D 1 28  ? 18.475  35.024  63.845 1.00 51.16 ? 681  ILE D CG1 1 
ATOM   8971  C  CG2 . ILE D 1 28  ? 20.609  35.172  65.194 1.00 53.36 ? 681  ILE D CG2 1 
ATOM   8972  C  CD1 . ILE D 1 28  ? 18.951  35.658  62.547 1.00 49.71 ? 681  ILE D CD1 1 
ATOM   8973  N  N   . PHE D 1 29  ? 19.385  33.026  67.152 1.00 49.03 ? 682  PHE D N   1 
ATOM   8974  C  CA  . PHE D 1 29  ? 19.435  31.557  67.246 1.00 47.25 ? 682  PHE D CA  1 
ATOM   8975  C  C   . PHE D 1 29  ? 18.386  31.053  68.218 1.00 47.82 ? 682  PHE D C   1 
ATOM   8976  O  O   . PHE D 1 29  ? 17.837  29.956  68.055 1.00 45.30 ? 682  PHE D O   1 
ATOM   8977  C  CB  . PHE D 1 29  ? 20.841  31.087  67.617 1.00 43.64 ? 682  PHE D CB  1 
ATOM   8978  C  CG  . PHE D 1 29  ? 21.862  31.388  66.554 1.00 38.59 ? 682  PHE D CG  1 
ATOM   8979  C  CD1 . PHE D 1 29  ? 22.746  32.439  66.702 1.00 37.68 ? 682  PHE D CD1 1 
ATOM   8980  C  CD2 . PHE D 1 29  ? 21.875  30.660  65.366 1.00 38.32 ? 682  PHE D CD2 1 
ATOM   8981  C  CE1 . PHE D 1 29  ? 23.647  32.784  65.675 1.00 37.07 ? 682  PHE D CE1 1 
ATOM   8982  C  CE2 . PHE D 1 29  ? 22.758  30.986  64.336 1.00 37.40 ? 682  PHE D CE2 1 
ATOM   8983  C  CZ  . PHE D 1 29  ? 23.645  32.056  64.497 1.00 37.36 ? 682  PHE D CZ  1 
ATOM   8984  N  N   . GLU D 1 30  ? 18.076  31.870  69.219 1.00 50.90 ? 683  GLU D N   1 
ATOM   8985  C  CA  . GLU D 1 30  ? 17.017  31.484  70.156 1.00 54.28 ? 683  GLU D CA  1 
ATOM   8986  C  C   . GLU D 1 30  ? 15.720  31.419  69.336 1.00 55.31 ? 683  GLU D C   1 
ATOM   8987  O  O   . GLU D 1 30  ? 14.939  30.470  69.471 1.00 55.70 ? 683  GLU D O   1 
ATOM   8988  C  CB  . GLU D 1 30  ? 16.903  32.498  71.307 1.00 55.55 ? 683  GLU D CB  1 
ATOM   8989  C  CG  . GLU D 1 30  ? 17.805  32.151  72.512 1.00 58.82 ? 683  GLU D CG  1 
ATOM   8990  C  CD  . GLU D 1 30  ? 17.826  33.212  73.620 1.00 60.97 ? 683  GLU D CD  1 
ATOM   8991  O  OE1 . GLU D 1 30  ? 16.739  33.698  74.024 1.00 63.08 ? 683  GLU D OE1 1 
ATOM   8992  O  OE2 . GLU D 1 30  ? 18.933  33.553  74.106 1.00 60.71 ? 683  GLU D OE2 1 
ATOM   8993  N  N   . LEU D 1 31  ? 15.509  32.412  68.468 1.00 55.34 ? 684  LEU D N   1 
ATOM   8994  C  CA  . LEU D 1 31  ? 14.327  32.426  67.611 1.00 55.39 ? 684  LEU D CA  1 
ATOM   8995  C  C   . LEU D 1 31  ? 14.268  31.158  66.743 1.00 55.73 ? 684  LEU D C   1 
ATOM   8996  O  O   . LEU D 1 31  ? 13.211  30.527  66.640 1.00 55.98 ? 684  LEU D O   1 
ATOM   8997  C  CB  . LEU D 1 31  ? 14.332  33.671  66.718 1.00 54.74 ? 684  LEU D CB  1 
ATOM   8998  C  CG  . LEU D 1 31  ? 13.215  33.838  65.672 1.00 54.83 ? 684  LEU D CG  1 
ATOM   8999  C  CD1 . LEU D 1 31  ? 11.863  34.020  66.326 1.00 53.42 ? 684  LEU D CD1 1 
ATOM   9000  C  CD2 . LEU D 1 31  ? 13.515  35.061  64.860 1.00 54.69 ? 684  LEU D CD2 1 
ATOM   9001  N  N   . VAL D 1 32  ? 15.386  30.778  66.117 1.00 56.16 ? 685  VAL D N   1 
ATOM   9002  C  CA  . VAL D 1 32  ? 15.409  29.563  65.279 1.00 57.00 ? 685  VAL D CA  1 
ATOM   9003  C  C   . VAL D 1 32  ? 15.083  28.335  66.131 1.00 59.36 ? 685  VAL D C   1 
ATOM   9004  O  O   . VAL D 1 32  ? 14.452  27.365  65.673 1.00 60.17 ? 685  VAL D O   1 
ATOM   9005  C  CB  . VAL D 1 32  ? 16.794  29.332  64.627 1.00 55.52 ? 685  VAL D CB  1 
ATOM   9006  C  CG1 . VAL D 1 32  ? 16.822  27.967  63.920 1.00 52.07 ? 685  VAL D CG1 1 
ATOM   9007  C  CG2 . VAL D 1 32  ? 17.091  30.452  63.645 1.00 54.24 ? 685  VAL D CG2 1 
ATOM   9008  N  N   . GLU D 1 33  ? 15.560  28.386  67.368 1.00 61.46 ? 686  GLU D N   1 
ATOM   9009  C  CA  . GLU D 1 33  ? 15.341  27.337  68.349 1.00 63.75 ? 686  GLU D CA  1 
ATOM   9010  C  C   . GLU D 1 33  ? 13.851  27.298  68.691 1.00 64.41 ? 686  GLU D C   1 
ATOM   9011  O  O   . GLU D 1 33  ? 13.234  26.222  68.736 1.00 63.72 ? 686  GLU D O   1 
ATOM   9012  C  CB  . GLU D 1 33  ? 16.172  27.658  69.598 1.00 66.18 ? 686  GLU D CB  1 
ATOM   9013  C  CG  . GLU D 1 33  ? 15.984  26.745  70.797 1.00 69.17 ? 686  GLU D CG  1 
ATOM   9014  C  CD  . GLU D 1 33  ? 16.361  25.311  70.494 1.00 71.71 ? 686  GLU D CD  1 
ATOM   9015  O  OE1 . GLU D 1 33  ? 17.435  25.103  69.871 1.00 73.03 ? 686  GLU D OE1 1 
ATOM   9016  O  OE2 . GLU D 1 33  ? 15.591  24.393  70.885 1.00 72.10 ? 686  GLU D OE2 1 
ATOM   9017  N  N   . LYS D 1 34  ? 13.277  28.483  68.916 1.00 64.90 ? 687  LYS D N   1 
ATOM   9018  C  CA  . LYS D 1 34  ? 11.857  28.607  69.261 1.00 65.11 ? 687  LYS D CA  1 
ATOM   9019  C  C   . LYS D 1 34  ? 10.942  28.110  68.137 1.00 65.41 ? 687  LYS D C   1 
ATOM   9020  O  O   . LYS D 1 34  ? 10.091  27.241  68.354 1.00 66.27 ? 687  LYS D O   1 
ATOM   9021  C  CB  . LYS D 1 34  ? 11.517  30.073  69.612 1.00 63.82 ? 687  LYS D CB  1 
ATOM   9022  N  N   . MET D 1 35  ? 11.131  28.633  66.929 1.00 65.24 ? 688  MET D N   1 
ATOM   9023  C  CA  . MET D 1 35  ? 10.278  28.247  65.812 1.00 64.85 ? 688  MET D CA  1 
ATOM   9024  C  C   . MET D 1 35  ? 10.253  26.751  65.526 1.00 65.33 ? 688  MET D C   1 
ATOM   9025  O  O   . MET D 1 35  ? 9.424   26.274  64.750 1.00 65.47 ? 688  MET D O   1 
ATOM   9026  C  CB  . MET D 1 35  ? 10.691  29.012  64.560 1.00 64.59 ? 688  MET D CB  1 
ATOM   9027  C  CG  . MET D 1 35  ? 10.597  30.535  64.716 1.00 62.85 ? 688  MET D CG  1 
ATOM   9028  S  SD  . MET D 1 35  ? 11.008  31.382  63.153 1.00 63.15 ? 688  MET D SD  1 
ATOM   9029  C  CE  . MET D 1 35  ? 10.175  30.227  61.952 1.00 60.04 ? 688  MET D CE  1 
ATOM   9030  N  N   . GLY D 1 36  ? 11.169  26.014  66.140 1.00 65.86 ? 689  GLY D N   1 
ATOM   9031  C  CA  . GLY D 1 36  ? 11.219  24.576  65.941 1.00 66.82 ? 689  GLY D CA  1 
ATOM   9032  C  C   . GLY D 1 36  ? 11.241  24.107  64.496 1.00 68.19 ? 689  GLY D C   1 
ATOM   9033  O  O   . GLY D 1 36  ? 12.104  24.521  63.713 1.00 69.91 ? 689  GLY D O   1 
ATOM   9034  N  N   . GLU D 1 37  ? 10.297  23.230  64.147 1.00 68.69 ? 690  GLU D N   1 
ATOM   9035  C  CA  . GLU D 1 37  ? 10.187  22.682  62.791 1.00 68.77 ? 690  GLU D CA  1 
ATOM   9036  C  C   . GLU D 1 37  ? 9.714   23.714  61.778 1.00 67.25 ? 690  GLU D C   1 
ATOM   9037  O  O   . GLU D 1 37  ? 9.778   23.489  60.571 1.00 67.19 ? 690  GLU D O   1 
ATOM   9038  C  CB  . GLU D 1 37  ? 9.217   21.502  62.760 1.00 70.77 ? 690  GLU D CB  1 
ATOM   9039  C  CG  . GLU D 1 37  ? 9.734   20.223  63.375 1.00 74.50 ? 690  GLU D CG  1 
ATOM   9040  C  CD  . GLU D 1 37  ? 8.729   19.076  63.233 1.00 77.26 ? 690  GLU D CD  1 
ATOM   9041  O  OE1 . GLU D 1 37  ? 8.623   18.492  62.119 1.00 77.92 ? 690  GLU D OE1 1 
ATOM   9042  O  OE2 . GLU D 1 37  ? 8.028   18.775  64.234 1.00 78.45 ? 690  GLU D OE2 1 
ATOM   9043  N  N   . LYS D 1 38  ? 9.210   24.832  62.270 1.00 65.49 ? 691  LYS D N   1 
ATOM   9044  C  CA  . LYS D 1 38  ? 8.759   25.890  61.388 1.00 63.43 ? 691  LYS D CA  1 
ATOM   9045  C  C   . LYS D 1 38  ? 9.906   26.880  61.162 1.00 61.81 ? 691  LYS D C   1 
ATOM   9046  O  O   . LYS D 1 38  ? 9.707   27.945  60.565 1.00 60.81 ? 691  LYS D O   1 
ATOM   9047  C  CB  . LYS D 1 38  ? 7.575   26.627  62.009 1.00 64.67 ? 691  LYS D CB  1 
ATOM   9048  C  CG  . LYS D 1 38  ? 6.207   26.004  61.748 1.00 65.20 ? 691  LYS D CG  1 
ATOM   9049  C  CD  . LYS D 1 38  ? 5.125   27.101  61.834 1.00 66.49 ? 691  LYS D CD  1 
ATOM   9050  C  CE  . LYS D 1 38  ? 5.349   28.213  60.754 1.00 66.54 ? 691  LYS D CE  1 
ATOM   9051  N  NZ  . LYS D 1 38  ? 4.490   29.439  60.920 1.00 65.23 ? 691  LYS D NZ  1 
ATOM   9052  N  N   . SER D 1 39  ? 11.101  26.530  61.646 1.00 59.48 ? 692  SER D N   1 
ATOM   9053  C  CA  . SER D 1 39  ? 12.271  27.407  61.500 1.00 57.07 ? 692  SER D CA  1 
ATOM   9054  C  C   . SER D 1 39  ? 12.662  27.574  60.026 1.00 55.84 ? 692  SER D C   1 
ATOM   9055  O  O   . SER D 1 39  ? 13.382  28.515  59.675 1.00 55.84 ? 692  SER D O   1 
ATOM   9056  C  CB  . SER D 1 39  ? 13.465  26.869  62.299 1.00 55.87 ? 692  SER D CB  1 
ATOM   9057  O  OG  . SER D 1 39  ? 13.872  25.623  61.798 1.00 53.65 ? 692  SER D OG  1 
ATOM   9058  N  N   . GLY D 1 40  ? 12.201  26.666  59.174 1.00 53.79 ? 693  GLY D N   1 
ATOM   9059  C  CA  . GLY D 1 40  ? 12.490  26.799  57.763 1.00 55.04 ? 693  GLY D CA  1 
ATOM   9060  C  C   . GLY D 1 40  ? 11.922  28.100  57.181 1.00 56.23 ? 693  GLY D C   1 
ATOM   9061  O  O   . GLY D 1 40  ? 12.384  28.591  56.143 1.00 55.90 ? 693  GLY D O   1 
ATOM   9062  N  N   . ARG D 1 41  ? 10.925  28.675  57.854 1.00 56.46 ? 694  ARG D N   1 
ATOM   9063  C  CA  . ARG D 1 41  ? 10.303  29.909  57.386 1.00 55.99 ? 694  ARG D CA  1 
ATOM   9064  C  C   . ARG D 1 41  ? 10.674  31.110  58.223 1.00 54.80 ? 694  ARG D C   1 
ATOM   9065  O  O   . ARG D 1 41  ? 9.857   31.998  58.428 1.00 55.63 ? 694  ARG D O   1 
ATOM   9066  C  CB  . ARG D 1 41  ? 8.784   29.760  57.375 1.00 57.77 ? 694  ARG D CB  1 
ATOM   9067  C  CG  . ARG D 1 41  ? 8.250   28.919  56.209 1.00 62.70 ? 694  ARG D CG  1 
ATOM   9068  C  CD  . ARG D 1 41  ? 6.974   29.572  55.632 1.00 66.16 ? 694  ARG D CD  1 
ATOM   9069  N  NE  . ARG D 1 41  ? 5.927   29.682  56.646 1.00 69.38 ? 694  ARG D NE  1 
ATOM   9070  C  CZ  . ARG D 1 41  ? 5.127   28.678  57.009 1.00 71.76 ? 694  ARG D CZ  1 
ATOM   9071  N  NH1 . ARG D 1 41  ? 5.245   27.486  56.426 1.00 71.83 ? 694  ARG D NH1 1 
ATOM   9072  N  NH2 . ARG D 1 41  ? 4.234   28.849  57.984 1.00 72.10 ? 694  ARG D NH2 1 
ATOM   9073  N  N   . ILE D 1 42  ? 11.907  31.152  58.705 1.00 53.54 ? 695  ILE D N   1 
ATOM   9074  C  CA  . ILE D 1 42  ? 12.331  32.273  59.533 1.00 52.51 ? 695  ILE D CA  1 
ATOM   9075  C  C   . ILE D 1 42  ? 12.422  33.601  58.785 1.00 51.75 ? 695  ILE D C   1 
ATOM   9076  O  O   . ILE D 1 42  ? 11.967  34.616  59.291 1.00 51.32 ? 695  ILE D O   1 
ATOM   9077  C  CB  . ILE D 1 42  ? 13.687  32.004  60.213 1.00 51.91 ? 695  ILE D CB  1 
ATOM   9078  C  CG1 . ILE D 1 42  ? 14.108  33.241  61.024 1.00 53.77 ? 695  ILE D CG1 1 
ATOM   9079  C  CG2 . ILE D 1 42  ? 14.734  31.676  59.166 1.00 52.03 ? 695  ILE D CG2 1 
ATOM   9080  C  CD1 . ILE D 1 42  ? 15.392  33.072  61.857 1.00 53.45 ? 695  ILE D CD1 1 
ATOM   9081  N  N   . LEU D 1 43  ? 13.019  33.587  57.594 1.00 51.71 ? 696  LEU D N   1 
ATOM   9082  C  CA  . LEU D 1 43  ? 13.181  34.786  56.762 1.00 50.59 ? 696  LEU D CA  1 
ATOM   9083  C  C   . LEU D 1 43  ? 11.829  35.416  56.362 1.00 51.32 ? 696  LEU D C   1 
ATOM   9084  O  O   . LEU D 1 43  ? 11.639  36.640  56.477 1.00 50.07 ? 696  LEU D O   1 
ATOM   9085  C  CB  . LEU D 1 43  ? 13.978  34.426  55.493 1.00 49.10 ? 696  LEU D CB  1 
ATOM   9086  C  CG  . LEU D 1 43  ? 14.297  35.570  54.513 1.00 46.63 ? 696  LEU D CG  1 
ATOM   9087  C  CD1 . LEU D 1 43  ? 15.124  36.678  55.190 1.00 46.22 ? 696  LEU D CD1 1 
ATOM   9088  C  CD2 . LEU D 1 43  ? 15.048  34.996  53.338 1.00 46.75 ? 696  LEU D CD2 1 
ATOM   9089  N  N   . SER D 1 44  ? 10.910  34.565  55.893 1.00 51.27 ? 697  SER D N   1 
ATOM   9090  C  CA  . SER D 1 44  ? 9.587   35.002  55.481 1.00 52.75 ? 697  SER D CA  1 
ATOM   9091  C  C   . SER D 1 44  ? 8.840   35.645  56.661 1.00 53.30 ? 697  SER D C   1 
ATOM   9092  O  O   . SER D 1 44  ? 8.361   36.797  56.569 1.00 52.06 ? 697  SER D O   1 
ATOM   9093  C  CB  . SER D 1 44  ? 8.788   33.822  54.888 1.00 52.00 ? 697  SER D CB  1 
ATOM   9094  O  OG  . SER D 1 44  ? 8.501   32.819  55.840 1.00 53.51 ? 697  SER D OG  1 
ATOM   9095  N  N   . GLN D 1 45  ? 8.766   34.913  57.770 1.00 53.53 ? 698  GLN D N   1 
ATOM   9096  C  CA  . GLN D 1 45  ? 8.099   35.424  58.950 1.00 54.98 ? 698  GLN D CA  1 
ATOM   9097  C  C   . GLN D 1 45  ? 8.718   36.751  59.388 1.00 54.68 ? 698  GLN D C   1 
ATOM   9098  O  O   . GLN D 1 45  ? 7.990   37.688  59.721 1.00 56.16 ? 698  GLN D O   1 
ATOM   9099  C  CB  . GLN D 1 45  ? 8.171   34.398  60.084 1.00 57.14 ? 698  GLN D CB  1 
ATOM   9100  C  CG  . GLN D 1 45  ? 7.454   33.079  59.777 1.00 60.24 ? 698  GLN D CG  1 
ATOM   9101  C  CD  . GLN D 1 45  ? 5.932   33.204  59.849 1.00 62.65 ? 698  GLN D CD  1 
ATOM   9102  O  OE1 . GLN D 1 45  ? 5.340   34.126  59.272 1.00 64.14 ? 698  GLN D OE1 1 
ATOM   9103  N  NE2 . GLN D 1 45  ? 5.293   32.268  60.554 1.00 62.71 ? 698  GLN D NE2 1 
ATOM   9104  N  N   . VAL D 1 46  ? 10.046  36.852  59.387 1.00 53.47 ? 699  VAL D N   1 
ATOM   9105  C  CA  . VAL D 1 46  ? 10.704  38.107  59.786 1.00 53.11 ? 699  VAL D CA  1 
ATOM   9106  C  C   . VAL D 1 46  ? 10.474  39.240  58.779 1.00 53.99 ? 699  VAL D C   1 
ATOM   9107  O  O   . VAL D 1 46  ? 10.417  40.414  59.173 1.00 54.20 ? 699  VAL D O   1 
ATOM   9108  C  CB  . VAL D 1 46  ? 12.240  37.934  59.989 1.00 50.64 ? 699  VAL D CB  1 
ATOM   9109  C  CG1 . VAL D 1 46  ? 12.906  39.280  60.256 1.00 48.42 ? 699  VAL D CG1 1 
ATOM   9110  C  CG2 . VAL D 1 46  ? 12.502  37.028  61.177 1.00 50.87 ? 699  VAL D CG2 1 
ATOM   9111  N  N   . MET D 1 47  ? 10.363  38.908  57.488 1.00 54.31 ? 700  MET D N   1 
ATOM   9112  C  CA  . MET D 1 47  ? 10.136  39.945  56.468 1.00 55.40 ? 700  MET D CA  1 
ATOM   9113  C  C   . MET D 1 47  ? 8.779   40.595  56.743 1.00 56.15 ? 700  MET D C   1 
ATOM   9114  O  O   . MET D 1 47  ? 8.676   41.813  56.881 1.00 54.99 ? 700  MET D O   1 
ATOM   9115  C  CB  . MET D 1 47  ? 10.157  39.340  55.053 1.00 54.21 ? 700  MET D CB  1 
ATOM   9116  C  CG  . MET D 1 47  ? 11.543  39.234  54.423 1.00 52.38 ? 700  MET D CG  1 
ATOM   9117  S  SD  . MET D 1 47  ? 12.069  40.694  53.455 1.00 53.33 ? 700  MET D SD  1 
ATOM   9118  C  CE  . MET D 1 47  ? 12.732  41.702  54.624 1.00 47.88 ? 700  MET D CE  1 
ATOM   9119  N  N   . TYR D 1 48  ? 7.743   39.763  56.826 1.00 57.70 ? 701  TYR D N   1 
ATOM   9120  C  CA  . TYR D 1 48  ? 6.408   40.253  57.122 1.00 58.23 ? 701  TYR D CA  1 
ATOM   9121  C  C   . TYR D 1 48  ? 6.483   41.147  58.370 1.00 57.70 ? 701  TYR D C   1 
ATOM   9122  O  O   . TYR D 1 48  ? 6.103   42.316  58.331 1.00 58.26 ? 701  TYR D O   1 
ATOM   9123  C  CB  . TYR D 1 48  ? 5.447   39.092  57.388 1.00 59.48 ? 701  TYR D CB  1 
ATOM   9124  C  CG  . TYR D 1 48  ? 4.108   39.580  57.904 1.00 63.88 ? 701  TYR D CG  1 
ATOM   9125  C  CD1 . TYR D 1 48  ? 3.063   39.903  57.023 1.00 65.50 ? 701  TYR D CD1 1 
ATOM   9126  C  CD2 . TYR D 1 48  ? 3.910   39.823  59.271 1.00 65.38 ? 701  TYR D CD2 1 
ATOM   9127  C  CE1 . TYR D 1 48  ? 1.849   40.464  57.493 1.00 65.78 ? 701  TYR D CE1 1 
ATOM   9128  C  CE2 . TYR D 1 48  ? 2.700   40.389  59.756 1.00 66.16 ? 701  TYR D CE2 1 
ATOM   9129  C  CZ  . TYR D 1 48  ? 1.678   40.709  58.860 1.00 66.55 ? 701  TYR D CZ  1 
ATOM   9130  O  OH  . TYR D 1 48  ? 0.511   41.300  59.328 1.00 67.03 ? 701  TYR D OH  1 
ATOM   9131  N  N   . THR D 1 49  ? 6.980   40.604  59.472 1.00 56.51 ? 702  THR D N   1 
ATOM   9132  C  CA  . THR D 1 49  ? 7.065   41.389  60.691 1.00 56.29 ? 702  THR D CA  1 
ATOM   9133  C  C   . THR D 1 49  ? 7.647   42.768  60.431 1.00 56.77 ? 702  THR D C   1 
ATOM   9134  O  O   . THR D 1 49  ? 6.989   43.761  60.716 1.00 56.80 ? 702  THR D O   1 
ATOM   9135  C  CB  . THR D 1 49  ? 7.893   40.660  61.795 1.00 55.48 ? 702  THR D CB  1 
ATOM   9136  O  OG1 . THR D 1 49  ? 7.142   39.542  62.283 1.00 55.14 ? 702  THR D OG1 1 
ATOM   9137  C  CG2 . THR D 1 49  ? 8.192   41.583  62.964 1.00 52.29 ? 702  THR D CG2 1 
ATOM   9138  N  N   . LEU D 1 50  ? 8.853   42.847  59.870 1.00 58.19 ? 703  LEU D N   1 
ATOM   9139  C  CA  . LEU D 1 50  ? 9.483   44.157  59.613 1.00 59.53 ? 703  LEU D CA  1 
ATOM   9140  C  C   . LEU D 1 50  ? 8.768   45.060  58.590 1.00 59.54 ? 703  LEU D C   1 
ATOM   9141  O  O   . LEU D 1 50  ? 8.960   46.278  58.581 1.00 59.18 ? 703  LEU D O   1 
ATOM   9142  C  CB  . LEU D 1 50  ? 10.940  43.969  59.179 1.00 59.07 ? 703  LEU D CB  1 
ATOM   9143  C  CG  . LEU D 1 50  ? 11.882  43.163  60.072 1.00 58.37 ? 703  LEU D CG  1 
ATOM   9144  C  CD1 . LEU D 1 50  ? 13.251  43.178  59.424 1.00 58.65 ? 703  LEU D CD1 1 
ATOM   9145  C  CD2 . LEU D 1 50  ? 11.965  43.765  61.463 1.00 58.13 ? 703  LEU D CD2 1 
ATOM   9146  N  N   . PHE D 1 51  ? 7.963   44.464  57.723 1.00 60.20 ? 704  PHE D N   1 
ATOM   9147  C  CA  . PHE D 1 51  ? 7.237   45.242  56.734 1.00 61.74 ? 704  PHE D CA  1 
ATOM   9148  C  C   . PHE D 1 51  ? 5.978   45.858  57.365 1.00 62.96 ? 704  PHE D C   1 
ATOM   9149  O  O   . PHE D 1 51  ? 5.527   46.952  56.980 1.00 63.23 ? 704  PHE D O   1 
ATOM   9150  C  CB  . PHE D 1 51  ? 6.927   44.348  55.535 1.00 60.60 ? 704  PHE D CB  1 
ATOM   9151  C  CG  . PHE D 1 51  ? 8.010   44.380  54.493 1.00 62.18 ? 704  PHE D CG  1 
ATOM   9152  C  CD1 . PHE D 1 51  ? 9.355   44.355  54.876 1.00 62.02 ? 704  PHE D CD1 1 
ATOM   9153  C  CD2 . PHE D 1 51  ? 7.705   44.536  53.140 1.00 62.89 ? 704  PHE D CD2 1 
ATOM   9154  C  CE1 . PHE D 1 51  ? 10.375  44.489  53.933 1.00 61.82 ? 704  PHE D CE1 1 
ATOM   9155  C  CE2 . PHE D 1 51  ? 8.720   44.671  52.183 1.00 61.81 ? 704  PHE D CE2 1 
ATOM   9156  C  CZ  . PHE D 1 51  ? 10.058  44.651  52.584 1.00 62.29 ? 704  PHE D CZ  1 
ATOM   9157  N  N   . GLN D 1 52  ? 5.453   45.140  58.360 1.00 63.27 ? 705  GLN D N   1 
ATOM   9158  C  CA  . GLN D 1 52  ? 4.288   45.528  59.150 1.00 63.30 ? 705  GLN D CA  1 
ATOM   9159  C  C   . GLN D 1 52  ? 4.713   46.568  60.203 1.00 62.28 ? 705  GLN D C   1 
ATOM   9160  O  O   . GLN D 1 52  ? 3.909   47.369  60.650 1.00 62.94 ? 705  GLN D O   1 
ATOM   9161  C  CB  . GLN D 1 52  ? 3.727   44.293  59.854 1.00 64.64 ? 705  GLN D CB  1 
ATOM   9162  C  CG  . GLN D 1 52  ? 2.356   43.881  59.389 1.00 68.02 ? 705  GLN D CG  1 
ATOM   9163  C  CD  . GLN D 1 52  ? 1.270   44.714  60.049 1.00 71.18 ? 705  GLN D CD  1 
ATOM   9164  O  OE1 . GLN D 1 52  ? 0.376   45.260  59.373 1.00 71.79 ? 705  GLN D OE1 1 
ATOM   9165  N  NE2 . GLN D 1 52  ? 1.337   44.818  61.386 1.00 71.13 ? 705  GLN D NE2 1 
ATOM   9166  N  N   . ASP D 1 53  ? 5.986   46.548  60.578 1.00 60.98 ? 706  ASP D N   1 
ATOM   9167  C  CA  . ASP D 1 53  ? 6.544   47.449  61.585 1.00 60.82 ? 706  ASP D CA  1 
ATOM   9168  C  C   . ASP D 1 53  ? 6.814   48.834  61.032 1.00 59.77 ? 706  ASP D C   1 
ATOM   9169  O  O   . ASP D 1 53  ? 6.583   49.860  61.688 1.00 59.96 ? 706  ASP D O   1 
ATOM   9170  C  CB  . ASP D 1 53  ? 7.863   46.863  62.129 1.00 59.49 ? 706  ASP D CB  1 
ATOM   9171  C  CG  . ASP D 1 53  ? 8.687   47.887  62.908 1.00 59.68 ? 706  ASP D CG  1 
ATOM   9172  O  OD1 . ASP D 1 53  ? 9.322   48.775  62.289 1.00 59.07 ? 706  ASP D OD1 1 
ATOM   9173  O  OD2 . ASP D 1 53  ? 8.696   47.812  64.156 1.00 61.83 ? 706  ASP D OD2 1 
ATOM   9174  N  N   . THR D 1 54  ? 7.354   48.823  59.824 1.00 59.93 ? 707  THR D N   1 
ATOM   9175  C  CA  . THR D 1 54  ? 7.726   50.012  59.067 1.00 59.92 ? 707  THR D CA  1 
ATOM   9176  C  C   . THR D 1 54  ? 6.506   50.505  58.293 1.00 59.97 ? 707  THR D C   1 
ATOM   9177  O  O   . THR D 1 54  ? 6.450   51.659  57.860 1.00 60.07 ? 707  THR D O   1 
ATOM   9178  C  CB  . THR D 1 54  ? 8.864   49.653  58.077 1.00 58.33 ? 707  THR D CB  1 
ATOM   9179  O  OG1 . THR D 1 54  ? 8.555   48.400  57.446 1.00 57.47 ? 707  THR D OG1 1 
ATOM   9180  C  CG2 . THR D 1 54  ? 10.191  49.530  58.810 1.00 56.35 ? 707  THR D CG2 1 
ATOM   9181  N  N   . GLY D 1 55  ? 5.536   49.602  58.132 1.00 61.02 ? 708  GLY D N   1 
ATOM   9182  C  CA  . GLY D 1 55  ? 4.300   49.918  57.438 1.00 61.28 ? 708  GLY D CA  1 
ATOM   9183  C  C   . GLY D 1 55  ? 4.391   49.760  55.938 1.00 61.99 ? 708  GLY D C   1 
ATOM   9184  O  O   . GLY D 1 55  ? 3.410   50.000  55.239 1.00 62.97 ? 708  GLY D O   1 
ATOM   9185  N  N   . LEU D 1 56  ? 5.556   49.352  55.440 1.00 61.09 ? 709  LEU D N   1 
ATOM   9186  C  CA  . LEU D 1 56  ? 5.756   49.173  54.006 1.00 60.41 ? 709  LEU D CA  1 
ATOM   9187  C  C   . LEU D 1 56  ? 4.626   48.436  53.314 1.00 59.65 ? 709  LEU D C   1 
ATOM   9188  O  O   . LEU D 1 56  ? 4.447   48.569  52.108 1.00 59.32 ? 709  LEU D O   1 
ATOM   9189  C  CB  . LEU D 1 56  ? 7.065   48.426  53.738 1.00 59.63 ? 709  LEU D CB  1 
ATOM   9190  C  CG  . LEU D 1 56  ? 8.344   49.239  53.953 1.00 59.33 ? 709  LEU D CG  1 
ATOM   9191  C  CD1 . LEU D 1 56  ? 9.569   48.337  53.735 1.00 58.66 ? 709  LEU D CD1 1 
ATOM   9192  C  CD2 . LEU D 1 56  ? 8.358   50.420  52.991 1.00 59.27 ? 709  LEU D CD2 1 
ATOM   9193  N  N   . LEU D 1 57  ? 3.866   47.640  54.049 1.00 60.35 ? 710  LEU D N   1 
ATOM   9194  C  CA  . LEU D 1 57  ? 2.776   46.922  53.392 1.00 62.57 ? 710  LEU D CA  1 
ATOM   9195  C  C   . LEU D 1 57  ? 1.665   47.891  53.013 1.00 63.55 ? 710  LEU D C   1 
ATOM   9196  O  O   . LEU D 1 57  ? 0.990   47.697  51.994 1.00 64.09 ? 710  LEU D O   1 
ATOM   9197  C  CB  . LEU D 1 57  ? 2.209   45.825  54.299 1.00 62.35 ? 710  LEU D CB  1 
ATOM   9198  C  CG  . LEU D 1 57  ? 3.107   44.607  54.530 1.00 62.66 ? 710  LEU D CG  1 
ATOM   9199  C  CD1 . LEU D 1 57  ? 2.390   43.654  55.484 1.00 62.75 ? 710  LEU D CD1 1 
ATOM   9200  C  CD2 . LEU D 1 57  ? 3.442   43.910  53.200 1.00 62.01 ? 710  LEU D CD2 1 
ATOM   9201  N  N   . GLU D 1 58  ? 1.489   48.922  53.848 1.00 63.97 ? 711  GLU D N   1 
ATOM   9202  C  CA  . GLU D 1 58  ? 0.479   49.951  53.632 1.00 64.18 ? 711  GLU D CA  1 
ATOM   9203  C  C   . GLU D 1 58  ? 0.965   50.884  52.534 1.00 62.71 ? 711  GLU D C   1 
ATOM   9204  O  O   . GLU D 1 58  ? 0.320   51.017  51.491 1.00 64.04 ? 711  GLU D O   1 
ATOM   9205  C  CB  . GLU D 1 58  ? 0.235   50.767  54.910 1.00 65.92 ? 711  GLU D CB  1 
ATOM   9206  C  CG  . GLU D 1 58  ? -0.360  49.987  56.080 1.00 70.17 ? 711  GLU D CG  1 
ATOM   9207  C  CD  . GLU D 1 58  ? -1.891  50.005  56.113 1.00 72.63 ? 711  GLU D CD  1 
ATOM   9208  O  OE1 . GLU D 1 58  ? -2.445  50.479  57.142 1.00 73.83 ? 711  GLU D OE1 1 
ATOM   9209  O  OE2 . GLU D 1 58  ? -2.545  49.550  55.130 1.00 73.70 ? 711  GLU D OE2 1 
ATOM   9210  N  N   . ILE D 1 59  ? 2.112   51.513  52.754 1.00 60.36 ? 712  ILE D N   1 
ATOM   9211  C  CA  . ILE D 1 59  ? 2.645   52.446  51.774 1.00 58.89 ? 712  ILE D CA  1 
ATOM   9212  C  C   . ILE D 1 59  ? 2.611   51.960  50.322 1.00 58.14 ? 712  ILE D C   1 
ATOM   9213  O  O   . ILE D 1 59  ? 2.437   52.755  49.399 1.00 59.24 ? 712  ILE D O   1 
ATOM   9214  C  CB  . ILE D 1 59  ? 4.080   52.844  52.104 1.00 57.89 ? 712  ILE D CB  1 
ATOM   9215  C  CG1 . ILE D 1 59  ? 4.178   53.236  53.587 1.00 57.91 ? 712  ILE D CG1 1 
ATOM   9216  C  CG2 . ILE D 1 59  ? 4.516   53.963  51.160 1.00 57.41 ? 712  ILE D CG2 1 
ATOM   9217  C  CD1 . ILE D 1 59  ? 5.361   54.160  53.941 1.00 56.12 ? 712  ILE D CD1 1 
ATOM   9218  N  N   . PHE D 1 60  ? 2.761   50.666  50.098 1.00 56.62 ? 713  PHE D N   1 
ATOM   9219  C  CA  . PHE D 1 60  ? 2.748   50.182  48.727 1.00 55.57 ? 713  PHE D CA  1 
ATOM   9220  C  C   . PHE D 1 60  ? 1.607   49.199  48.517 1.00 55.78 ? 713  PHE D C   1 
ATOM   9221  O  O   . PHE D 1 60  ? 1.571   48.437  47.537 1.00 52.96 ? 713  PHE D O   1 
ATOM   9222  C  CB  . PHE D 1 60  ? 4.123   49.581  48.361 1.00 55.10 ? 713  PHE D CB  1 
ATOM   9223  C  CG  . PHE D 1 60  ? 5.258   50.583  48.450 1.00 53.35 ? 713  PHE D CG  1 
ATOM   9224  C  CD1 . PHE D 1 60  ? 5.971   50.749  49.632 1.00 52.70 ? 713  PHE D CD1 1 
ATOM   9225  C  CD2 . PHE D 1 60  ? 5.541   51.434  47.384 1.00 53.44 ? 713  PHE D CD2 1 
ATOM   9226  C  CE1 . PHE D 1 60  ? 6.962   51.766  49.763 1.00 52.50 ? 713  PHE D CE1 1 
ATOM   9227  C  CE2 . PHE D 1 60  ? 6.527   52.459  47.496 1.00 51.65 ? 713  PHE D CE2 1 
ATOM   9228  C  CZ  . PHE D 1 60  ? 7.231   52.621  48.690 1.00 52.14 ? 713  PHE D CZ  1 
ATOM   9229  N  N   . LYS D 1 61  ? 0.659   49.249  49.453 1.00 56.92 ? 714  LYS D N   1 
ATOM   9230  C  CA  . LYS D 1 61  ? -0.532  48.414  49.387 1.00 59.06 ? 714  LYS D CA  1 
ATOM   9231  C  C   . LYS D 1 61  ? -0.137  47.043  48.877 1.00 59.12 ? 714  LYS D C   1 
ATOM   9232  O  O   . LYS D 1 61  ? -0.527  46.629  47.779 1.00 60.10 ? 714  LYS D O   1 
ATOM   9233  C  CB  . LYS D 1 61  ? -1.559  49.065  48.444 1.00 60.38 ? 714  LYS D CB  1 
ATOM   9234  C  CG  . LYS D 1 61  ? -1.919  50.510  48.841 1.00 62.51 ? 714  LYS D CG  1 
ATOM   9235  C  CD  . LYS D 1 61  ? -3.076  50.610  49.887 1.00 63.61 ? 714  LYS D CD  1 
ATOM   9236  C  CE  . LYS D 1 61  ? -2.769  49.905  51.211 1.00 64.54 ? 714  LYS D CE  1 
ATOM   9237  N  NZ  . LYS D 1 61  ? -3.930  49.944  52.168 1.00 63.82 ? 714  LYS D NZ  1 
ATOM   9238  N  N   . ILE D 1 62  ? 0.647   46.342  49.683 1.00 58.27 ? 715  ILE D N   1 
ATOM   9239  C  CA  . ILE D 1 62  ? 1.126   45.034  49.300 1.00 57.15 ? 715  ILE D CA  1 
ATOM   9240  C  C   . ILE D 1 62  ? 0.192   43.955  49.787 1.00 56.43 ? 715  ILE D C   1 
ATOM   9241  O  O   . ILE D 1 62  ? -0.158  43.896  50.965 1.00 56.68 ? 715  ILE D O   1 
ATOM   9242  C  CB  . ILE D 1 62  ? 2.545   44.787  49.874 1.00 59.06 ? 715  ILE D CB  1 
ATOM   9243  C  CG1 . ILE D 1 62  ? 3.530   45.811  49.271 1.00 59.16 ? 715  ILE D CG1 1 
ATOM   9244  C  CG2 . ILE D 1 62  ? 2.991   43.338  49.591 1.00 58.06 ? 715  ILE D CG2 1 
ATOM   9245  C  CD1 . ILE D 1 62  ? 4.867   45.901  50.026 1.00 59.06 ? 715  ILE D CD1 1 
ATOM   9246  N  N   . PRO D 1 63  ? -0.240  43.085  48.881 1.00 55.03 ? 716  PRO D N   1 
ATOM   9247  C  CA  . PRO D 1 63  ? -1.143  42.015  49.304 1.00 55.58 ? 716  PRO D CA  1 
ATOM   9248  C  C   . PRO D 1 63  ? -0.403  40.916  50.056 1.00 57.09 ? 716  PRO D C   1 
ATOM   9249  O  O   . PRO D 1 63  ? 0.580   40.362  49.559 1.00 58.09 ? 716  PRO D O   1 
ATOM   9250  C  CB  . PRO D 1 63  ? -1.724  41.513  47.989 1.00 54.37 ? 716  PRO D CB  1 
ATOM   9251  C  CG  . PRO D 1 63  ? -0.579  41.757  47.015 1.00 53.38 ? 716  PRO D CG  1 
ATOM   9252  C  CD  . PRO D 1 63  ? -0.092  43.121  47.417 1.00 53.54 ? 716  PRO D CD  1 
ATOM   9253  N  N   . THR D 1 64  ? -0.885  40.606  51.254 1.00 57.88 ? 717  THR D N   1 
ATOM   9254  C  CA  . THR D 1 64  ? -0.297  39.573  52.075 1.00 58.56 ? 717  THR D CA  1 
ATOM   9255  C  C   . THR D 1 64  ? -0.045  38.276  51.328 1.00 60.01 ? 717  THR D C   1 
ATOM   9256  O  O   . THR D 1 64  ? 1.104   37.826  51.251 1.00 61.05 ? 717  THR D O   1 
ATOM   9257  C  CB  . THR D 1 64  ? -1.170  39.278  53.305 1.00 58.48 ? 717  THR D CB  1 
ATOM   9258  O  OG1 . THR D 1 64  ? -1.105  40.401  54.195 1.00 58.06 ? 717  THR D OG1 1 
ATOM   9259  C  CG2 . THR D 1 64  ? -0.690  37.999  54.031 1.00 57.28 ? 717  THR D CG2 1 
ATOM   9260  N  N   . GLN D 1 65  ? -1.085  37.673  50.766 1.00 59.86 ? 718  GLN D N   1 
ATOM   9261  C  CA  . GLN D 1 65  ? -0.892  36.411  50.058 1.00 61.78 ? 718  GLN D CA  1 
ATOM   9262  C  C   . GLN D 1 65  ? 0.359   36.361  49.132 1.00 62.80 ? 718  GLN D C   1 
ATOM   9263  O  O   . GLN D 1 65  ? 1.237   35.517  49.321 1.00 62.38 ? 718  GLN D O   1 
ATOM   9264  C  CB  . GLN D 1 65  ? -2.151  36.063  49.261 1.00 62.06 ? 718  GLN D CB  1 
ATOM   9265  C  CG  . GLN D 1 65  ? -2.219  34.605  48.800 1.00 64.11 ? 718  GLN D CG  1 
ATOM   9266  C  CD  . GLN D 1 65  ? -2.267  33.607  49.954 1.00 65.97 ? 718  GLN D CD  1 
ATOM   9267  O  OE1 . GLN D 1 65  ? -2.954  33.827  50.960 1.00 66.23 ? 718  GLN D OE1 1 
ATOM   9268  N  NE2 . GLN D 1 65  ? -1.550  32.489  49.805 1.00 66.83 ? 718  GLN D NE2 1 
ATOM   9269  N  N   . GLN D 1 66  ? 0.454   37.257  48.145 1.00 63.77 ? 719  GLN D N   1 
ATOM   9270  C  CA  . GLN D 1 66  ? 1.606   37.253  47.218 1.00 64.24 ? 719  GLN D CA  1 
ATOM   9271  C  C   . GLN D 1 66  ? 2.956   37.383  47.931 1.00 62.97 ? 719  GLN D C   1 
ATOM   9272  O  O   . GLN D 1 66  ? 3.880   36.606  47.684 1.00 62.42 ? 719  GLN D O   1 
ATOM   9273  C  CB  . GLN D 1 66  ? 1.478   38.375  46.177 1.00 65.20 ? 719  GLN D CB  1 
ATOM   9274  C  CG  . GLN D 1 66  ? 0.368   38.161  45.140 1.00 67.07 ? 719  GLN D CG  1 
ATOM   9275  C  CD  . GLN D 1 66  ? -1.038  38.437  45.684 1.00 68.60 ? 719  GLN D CD  1 
ATOM   9276  O  OE1 . GLN D 1 66  ? -2.040  38.009  45.092 1.00 69.44 ? 719  GLN D OE1 1 
ATOM   9277  N  NE2 . GLN D 1 66  ? -1.117  39.152  46.808 1.00 67.75 ? 719  GLN D NE2 1 
ATOM   9278  N  N   . PHE D 1 67  ? 3.055   38.382  48.800 1.00 61.45 ? 720  PHE D N   1 
ATOM   9279  C  CA  . PHE D 1 67  ? 4.253   38.633  49.583 1.00 60.59 ? 720  PHE D CA  1 
ATOM   9280  C  C   . PHE D 1 67  ? 4.725   37.329  50.233 1.00 61.21 ? 720  PHE D C   1 
ATOM   9281  O  O   . PHE D 1 67  ? 5.769   36.776  49.873 1.00 61.82 ? 720  PHE D O   1 
ATOM   9282  C  CB  . PHE D 1 67  ? 3.913   39.637  50.661 1.00 58.80 ? 720  PHE D CB  1 
ATOM   9283  C  CG  . PHE D 1 67  ? 5.084   40.090  51.473 1.00 58.09 ? 720  PHE D CG  1 
ATOM   9284  C  CD1 . PHE D 1 67  ? 5.731   41.290  51.164 1.00 56.84 ? 720  PHE D CD1 1 
ATOM   9285  C  CD2 . PHE D 1 67  ? 5.472   39.389  52.613 1.00 56.38 ? 720  PHE D CD2 1 
ATOM   9286  C  CE1 . PHE D 1 67  ? 6.735   41.794  51.978 1.00 55.16 ? 720  PHE D CE1 1 
ATOM   9287  C  CE2 . PHE D 1 67  ? 6.481   39.888  53.436 1.00 56.02 ? 720  PHE D CE2 1 
ATOM   9288  C  CZ  . PHE D 1 67  ? 7.107   41.101  53.116 1.00 55.75 ? 720  PHE D CZ  1 
ATOM   9289  N  N   . MET D 1 68  ? 3.946   36.836  51.187 1.00 61.14 ? 721  MET D N   1 
ATOM   9290  C  CA  . MET D 1 68  ? 4.301   35.604  51.859 1.00 62.06 ? 721  MET D CA  1 
ATOM   9291  C  C   . MET D 1 68  ? 4.641   34.469  50.881 1.00 62.29 ? 721  MET D C   1 
ATOM   9292  O  O   . MET D 1 68  ? 5.579   33.705  51.126 1.00 63.60 ? 721  MET D O   1 
ATOM   9293  C  CB  . MET D 1 68  ? 3.183   35.178  52.816 1.00 62.83 ? 721  MET D CB  1 
ATOM   9294  C  CG  . MET D 1 68  ? 2.971   36.150  53.987 1.00 63.30 ? 721  MET D CG  1 
ATOM   9295  S  SD  . MET D 1 68  ? 4.447   36.451  55.000 1.00 64.97 ? 721  MET D SD  1 
ATOM   9296  C  CE  . MET D 1 68  ? 4.704   34.779  55.731 1.00 63.35 ? 721  MET D CE  1 
ATOM   9297  N  N   . ASN D 1 69  ? 3.905   34.364  49.777 1.00 60.95 ? 722  ASN D N   1 
ATOM   9298  C  CA  . ASN D 1 69  ? 4.149   33.321  48.783 1.00 60.34 ? 722  ASN D CA  1 
ATOM   9299  C  C   . ASN D 1 69  ? 5.543   33.346  48.126 1.00 60.86 ? 722  ASN D C   1 
ATOM   9300  O  O   . ASN D 1 69  ? 6.175   32.293  47.919 1.00 59.64 ? 722  ASN D O   1 
ATOM   9301  C  CB  . ASN D 1 69  ? 3.093   33.412  47.683 1.00 61.01 ? 722  ASN D CB  1 
ATOM   9302  C  CG  . ASN D 1 69  ? 1.850   32.611  47.995 1.00 61.55 ? 722  ASN D CG  1 
ATOM   9303  O  OD1 . ASN D 1 69  ? 1.657   31.516  47.459 1.00 62.52 ? 722  ASN D OD1 1 
ATOM   9304  N  ND2 . ASN D 1 69  ? 1.002   33.141  48.866 1.00 60.42 ? 722  ASN D ND2 1 
ATOM   9305  N  N   . TYR D 1 70  ? 6.005   34.545  47.767 1.00 60.43 ? 723  TYR D N   1 
ATOM   9306  C  CA  . TYR D 1 70  ? 7.301   34.695  47.111 1.00 59.80 ? 723  TYR D CA  1 
ATOM   9307  C  C   . TYR D 1 70  ? 8.429   34.367  48.064 1.00 59.67 ? 723  TYR D C   1 
ATOM   9308  O  O   . TYR D 1 70  ? 9.286   33.527  47.774 1.00 60.20 ? 723  TYR D O   1 
ATOM   9309  C  CB  . TYR D 1 70  ? 7.504   36.126  46.604 1.00 59.04 ? 723  TYR D CB  1 
ATOM   9310  C  CG  . TYR D 1 70  ? 8.898   36.377  46.052 1.00 57.72 ? 723  TYR D CG  1 
ATOM   9311  C  CD1 . TYR D 1 70  ? 9.432   35.560  45.051 1.00 57.80 ? 723  TYR D CD1 1 
ATOM   9312  C  CD2 . TYR D 1 70  ? 9.692   37.426  46.539 1.00 57.53 ? 723  TYR D CD2 1 
ATOM   9313  C  CE1 . TYR D 1 70  ? 10.730  35.777  44.544 1.00 56.89 ? 723  TYR D CE1 1 
ATOM   9314  C  CE2 . TYR D 1 70  ? 10.995  37.655  46.040 1.00 56.27 ? 723  TYR D CE2 1 
ATOM   9315  C  CZ  . TYR D 1 70  ? 11.502  36.825  45.043 1.00 56.54 ? 723  TYR D CZ  1 
ATOM   9316  O  OH  . TYR D 1 70  ? 12.767  37.039  44.531 1.00 55.60 ? 723  TYR D OH  1 
ATOM   9317  N  N   . PHE D 1 71  ? 8.410   35.039  49.203 1.00 58.10 ? 724  PHE D N   1 
ATOM   9318  C  CA  . PHE D 1 71  ? 9.438   34.846  50.191 1.00 57.81 ? 724  PHE D CA  1 
ATOM   9319  C  C   . PHE D 1 71  ? 9.505   33.430  50.777 1.00 58.52 ? 724  PHE D C   1 
ATOM   9320  O  O   . PHE D 1 71  ? 10.542  33.010  51.287 1.00 58.57 ? 724  PHE D O   1 
ATOM   9321  C  CB  . PHE D 1 71  ? 9.294   35.912  51.270 1.00 54.63 ? 724  PHE D CB  1 
ATOM   9322  C  CG  . PHE D 1 71  ? 9.637   37.289  50.786 1.00 53.03 ? 724  PHE D CG  1 
ATOM   9323  C  CD1 . PHE D 1 71  ? 10.964  37.646  50.542 1.00 52.57 ? 724  PHE D CD1 1 
ATOM   9324  C  CD2 . PHE D 1 71  ? 8.637   38.233  50.559 1.00 52.16 ? 724  PHE D CD2 1 
ATOM   9325  C  CE1 . PHE D 1 71  ? 11.295  38.932  50.081 1.00 52.35 ? 724  PHE D CE1 1 
ATOM   9326  C  CE2 . PHE D 1 71  ? 8.955   39.516  50.098 1.00 52.30 ? 724  PHE D CE2 1 
ATOM   9327  C  CZ  . PHE D 1 71  ? 10.284  39.872  49.857 1.00 52.45 ? 724  PHE D CZ  1 
ATOM   9328  N  N   . ARG D 1 72  ? 8.423   32.674  50.689 1.00 58.25 ? 725  ARG D N   1 
ATOM   9329  C  CA  . ARG D 1 72  ? 8.486   31.327  51.203 1.00 58.15 ? 725  ARG D CA  1 
ATOM   9330  C  C   . ARG D 1 72  ? 9.268   30.481  50.231 1.00 57.76 ? 725  ARG D C   1 
ATOM   9331  O  O   . ARG D 1 72  ? 9.969   29.564  50.651 1.00 58.52 ? 725  ARG D O   1 
ATOM   9332  C  CB  . ARG D 1 72  ? 7.100   30.733  51.401 1.00 59.07 ? 725  ARG D CB  1 
ATOM   9333  C  CG  . ARG D 1 72  ? 6.402   31.253  52.630 1.00 61.35 ? 725  ARG D CG  1 
ATOM   9334  C  CD  . ARG D 1 72  ? 5.022   30.646  52.730 1.00 64.36 ? 725  ARG D CD  1 
ATOM   9335  N  NE  . ARG D 1 72  ? 4.291   31.142  53.896 1.00 68.42 ? 725  ARG D NE  1 
ATOM   9336  C  CZ  . ARG D 1 72  ? 3.123   31.788  53.838 1.00 69.05 ? 725  ARG D CZ  1 
ATOM   9337  N  NH1 . ARG D 1 72  ? 2.546   32.019  52.661 1.00 68.61 ? 725  ARG D NH1 1 
ATOM   9338  N  NH2 . ARG D 1 72  ? 2.541   32.212  54.958 1.00 68.82 ? 725  ARG D NH2 1 
ATOM   9339  N  N   . ALA D 1 73  ? 9.148   30.780  48.937 1.00 56.82 ? 726  ALA D N   1 
ATOM   9340  C  CA  . ALA D 1 73  ? 9.876   30.034  47.902 1.00 55.58 ? 726  ALA D CA  1 
ATOM   9341  C  C   . ALA D 1 73  ? 11.296  30.598  47.771 1.00 54.24 ? 726  ALA D C   1 
ATOM   9342  O  O   . ALA D 1 73  ? 12.187  29.965  47.194 1.00 53.26 ? 726  ALA D O   1 
ATOM   9343  C  CB  . ALA D 1 73  ? 9.140   30.123  46.563 1.00 55.15 ? 726  ALA D CB  1 
ATOM   9344  N  N   . LEU D 1 74  ? 11.496  31.797  48.307 1.00 52.96 ? 727  LEU D N   1 
ATOM   9345  C  CA  . LEU D 1 74  ? 12.814  32.406  48.284 1.00 52.62 ? 727  LEU D CA  1 
ATOM   9346  C  C   . LEU D 1 74  ? 13.633  31.659  49.351 1.00 54.19 ? 727  LEU D C   1 
ATOM   9347  O  O   . LEU D 1 74  ? 14.735  31.193  49.069 1.00 55.48 ? 727  LEU D O   1 
ATOM   9348  C  CB  . LEU D 1 74  ? 12.734  33.888  48.631 1.00 49.29 ? 727  LEU D CB  1 
ATOM   9349  C  CG  . LEU D 1 74  ? 14.043  34.638  48.398 1.00 49.33 ? 727  LEU D CG  1 
ATOM   9350  C  CD1 . LEU D 1 74  ? 14.368  34.629  46.900 1.00 47.99 ? 727  LEU D CD1 1 
ATOM   9351  C  CD2 . LEU D 1 74  ? 13.956  36.063  48.906 1.00 47.94 ? 727  LEU D CD2 1 
ATOM   9352  N  N   . GLU D 1 75  ? 13.068  31.528  50.557 1.00 54.48 ? 728  GLU D N   1 
ATOM   9353  C  CA  . GLU D 1 75  ? 13.717  30.832  51.663 1.00 55.00 ? 728  GLU D CA  1 
ATOM   9354  C  C   . GLU D 1 75  ? 14.162  29.450  51.248 1.00 54.77 ? 728  GLU D C   1 
ATOM   9355  O  O   . GLU D 1 75  ? 15.276  29.039  51.545 1.00 55.20 ? 728  GLU D O   1 
ATOM   9356  C  CB  . GLU D 1 75  ? 12.774  30.641  52.854 1.00 55.90 ? 728  GLU D CB  1 
ATOM   9357  C  CG  . GLU D 1 75  ? 12.281  31.895  53.476 1.00 57.40 ? 728  GLU D CG  1 
ATOM   9358  C  CD  . GLU D 1 75  ? 11.368  31.634  54.654 1.00 58.05 ? 728  GLU D CD  1 
ATOM   9359  O  OE1 . GLU D 1 75  ? 10.437  30.794  54.548 1.00 57.62 ? 728  GLU D OE1 1 
ATOM   9360  O  OE2 . GLU D 1 75  ? 11.592  32.296  55.690 1.00 59.38 ? 728  GLU D OE2 1 
ATOM   9361  N  N   . ASN D 1 76  ? 13.275  28.729  50.574 1.00 54.29 ? 729  ASN D N   1 
ATOM   9362  C  CA  . ASN D 1 76  ? 13.577  27.372  50.147 1.00 54.96 ? 729  ASN D CA  1 
ATOM   9363  C  C   . ASN D 1 76  ? 14.638  27.361  49.061 1.00 54.83 ? 729  ASN D C   1 
ATOM   9364  O  O   . ASN D 1 76  ? 15.077  26.300  48.613 1.00 54.12 ? 729  ASN D O   1 
ATOM   9365  C  CB  . ASN D 1 76  ? 12.302  26.697  49.672 1.00 55.83 ? 729  ASN D CB  1 
ATOM   9366  C  CG  . ASN D 1 76  ? 11.111  27.052  50.547 1.00 58.58 ? 729  ASN D CG  1 
ATOM   9367  O  OD1 . ASN D 1 76  ? 11.194  27.022  51.785 1.00 58.94 ? 729  ASN D OD1 1 
ATOM   9368  N  ND2 . ASN D 1 76  ? 9.992   27.396  49.910 1.00 59.04 ? 729  ASN D ND2 1 
ATOM   9369  N  N   . GLY D 1 77  ? 15.056  28.556  48.653 1.00 54.47 ? 730  GLY D N   1 
ATOM   9370  C  CA  . GLY D 1 77  ? 16.090  28.671  47.645 1.00 54.28 ? 730  GLY D CA  1 
ATOM   9371  C  C   . GLY D 1 77  ? 17.456  28.723  48.307 1.00 53.84 ? 730  GLY D C   1 
ATOM   9372  O  O   . GLY D 1 77  ? 18.488  28.546  47.656 1.00 54.18 ? 730  GLY D O   1 
ATOM   9373  N  N   . TYR D 1 78  ? 17.459  28.998  49.606 1.00 53.81 ? 731  TYR D N   1 
ATOM   9374  C  CA  . TYR D 1 78  ? 18.693  29.035  50.365 1.00 53.87 ? 731  TYR D CA  1 
ATOM   9375  C  C   . TYR D 1 78  ? 19.111  27.613  50.748 1.00 55.11 ? 731  TYR D C   1 
ATOM   9376  O  O   . TYR D 1 78  ? 18.333  26.868  51.363 1.00 56.08 ? 731  TYR D O   1 
ATOM   9377  C  CB  . TYR D 1 78  ? 18.526  29.878  51.613 1.00 51.79 ? 731  TYR D CB  1 
ATOM   9378  C  CG  . TYR D 1 78  ? 18.780  31.340  51.366 1.00 51.38 ? 731  TYR D CG  1 
ATOM   9379  C  CD1 . TYR D 1 78  ? 17.758  32.191  50.920 1.00 49.71 ? 731  TYR D CD1 1 
ATOM   9380  C  CD2 . TYR D 1 78  ? 20.046  31.880  51.581 1.00 49.56 ? 731  TYR D CD2 1 
ATOM   9381  C  CE1 . TYR D 1 78  ? 18.005  33.545  50.699 1.00 49.16 ? 731  TYR D CE1 1 
ATOM   9382  C  CE2 . TYR D 1 78  ? 20.302  33.226  51.369 1.00 49.33 ? 731  TYR D CE2 1 
ATOM   9383  C  CZ  . TYR D 1 78  ? 19.285  34.055  50.929 1.00 50.51 ? 731  TYR D CZ  1 
ATOM   9384  O  OH  . TYR D 1 78  ? 19.561  35.389  50.737 1.00 50.74 ? 731  TYR D OH  1 
ATOM   9385  N  N   . ARG D 1 79  ? 20.338  27.243  50.376 1.00 55.02 ? 732  ARG D N   1 
ATOM   9386  C  CA  . ARG D 1 79  ? 20.867  25.910  50.651 1.00 55.91 ? 732  ARG D CA  1 
ATOM   9387  C  C   . ARG D 1 79  ? 21.169  25.683  52.136 1.00 55.97 ? 732  ARG D C   1 
ATOM   9388  O  O   . ARG D 1 79  ? 21.507  26.616  52.876 1.00 55.76 ? 732  ARG D O   1 
ATOM   9389  C  CB  . ARG D 1 79  ? 22.136  25.648  49.803 1.00 56.08 ? 732  ARG D CB  1 
ATOM   9390  C  CG  . ARG D 1 79  ? 21.926  25.736  48.274 1.00 56.28 ? 732  ARG D CG  1 
ATOM   9391  C  CD  . ARG D 1 79  ? 23.071  25.130  47.458 1.00 57.03 ? 732  ARG D CD  1 
ATOM   9392  N  NE  . ARG D 1 79  ? 23.013  25.574  46.068 1.00 58.60 ? 732  ARG D NE  1 
ATOM   9393  C  CZ  . ARG D 1 79  ? 23.903  25.281  45.121 1.00 58.29 ? 732  ARG D CZ  1 
ATOM   9394  N  NH1 . ARG D 1 79  ? 24.957  24.518  45.391 1.00 58.40 ? 732  ARG D NH1 1 
ATOM   9395  N  NH2 . ARG D 1 79  ? 23.748  25.777  43.894 1.00 57.78 ? 732  ARG D NH2 1 
ATOM   9396  N  N   . ASP D 1 80  ? 21.016  24.438  52.578 1.00 56.33 ? 733  ASP D N   1 
ATOM   9397  C  CA  . ASP D 1 80  ? 21.303  24.128  53.968 1.00 56.82 ? 733  ASP D CA  1 
ATOM   9398  C  C   . ASP D 1 80  ? 22.809  23.923  54.126 1.00 56.21 ? 733  ASP D C   1 
ATOM   9399  O  O   . ASP D 1 80  ? 23.307  22.796  54.120 1.00 55.83 ? 733  ASP D O   1 
ATOM   9400  C  CB  . ASP D 1 80  ? 20.571  22.874  54.430 1.00 58.00 ? 733  ASP D CB  1 
ATOM   9401  C  CG  . ASP D 1 80  ? 21.106  22.365  55.758 1.00 60.68 ? 733  ASP D CG  1 
ATOM   9402  O  OD1 . ASP D 1 80  ? 20.936  23.062  56.792 1.00 60.92 ? 733  ASP D OD1 1 
ATOM   9403  O  OD2 . ASP D 1 80  ? 21.719  21.273  55.760 1.00 62.08 ? 733  ASP D OD2 1 
ATOM   9404  N  N   . ILE D 1 81  ? 23.517  25.043  54.226 1.00 54.92 ? 734  ILE D N   1 
ATOM   9405  C  CA  . ILE D 1 81  ? 24.958  25.066  54.390 1.00 52.88 ? 734  ILE D CA  1 
ATOM   9406  C  C   . ILE D 1 81  ? 25.199  25.762  55.719 1.00 52.69 ? 734  ILE D C   1 
ATOM   9407  O  O   . ILE D 1 81  ? 24.274  26.344  56.291 1.00 52.70 ? 734  ILE D O   1 
ATOM   9408  C  CB  . ILE D 1 81  ? 25.674  25.855  53.243 1.00 51.92 ? 734  ILE D CB  1 
ATOM   9409  C  CG1 . ILE D 1 81  ? 25.210  27.309  53.203 1.00 49.93 ? 734  ILE D CG1 1 
ATOM   9410  C  CG2 . ILE D 1 81  ? 25.407  25.200  51.911 1.00 50.17 ? 734  ILE D CG2 1 
ATOM   9411  C  CD1 . ILE D 1 81  ? 25.888  28.107  52.096 1.00 47.35 ? 734  ILE D CD1 1 
ATOM   9412  N  N   . PRO D 1 82  ? 26.445  25.718  56.224 1.00 52.17 ? 735  PRO D N   1 
ATOM   9413  C  CA  . PRO D 1 82  ? 26.819  26.339  57.501 1.00 50.70 ? 735  PRO D CA  1 
ATOM   9414  C  C   . PRO D 1 82  ? 26.764  27.855  57.664 1.00 49.18 ? 735  PRO D C   1 
ATOM   9415  O  O   . PRO D 1 82  ? 26.416  28.325  58.746 1.00 49.82 ? 735  PRO D O   1 
ATOM   9416  C  CB  . PRO D 1 82  ? 28.214  25.765  57.778 1.00 49.84 ? 735  PRO D CB  1 
ATOM   9417  C  CG  . PRO D 1 82  ? 28.744  25.475  56.426 1.00 51.70 ? 735  PRO D CG  1 
ATOM   9418  C  CD  . PRO D 1 82  ? 27.550  24.891  55.704 1.00 51.85 ? 735  PRO D CD  1 
ATOM   9419  N  N   . TYR D 1 83  ? 27.083  28.631  56.633 1.00 47.33 ? 736  TYR D N   1 
ATOM   9420  C  CA  . TYR D 1 83  ? 27.046  30.083  56.812 1.00 46.19 ? 736  TYR D CA  1 
ATOM   9421  C  C   . TYR D 1 83  ? 26.001  30.834  55.967 1.00 45.73 ? 736  TYR D C   1 
ATOM   9422  O  O   . TYR D 1 83  ? 25.048  31.399  56.511 1.00 45.45 ? 736  TYR D O   1 
ATOM   9423  C  CB  . TYR D 1 83  ? 28.427  30.690  56.568 1.00 45.32 ? 736  TYR D CB  1 
ATOM   9424  C  CG  . TYR D 1 83  ? 28.531  32.175  56.895 1.00 46.56 ? 736  TYR D CG  1 
ATOM   9425  C  CD1 . TYR D 1 83  ? 28.903  32.619  58.172 1.00 44.30 ? 736  TYR D CD1 1 
ATOM   9426  C  CD2 . TYR D 1 83  ? 28.269  33.141  55.919 1.00 46.55 ? 736  TYR D CD2 1 
ATOM   9427  C  CE1 . TYR D 1 83  ? 29.019  33.999  58.460 1.00 46.17 ? 736  TYR D CE1 1 
ATOM   9428  C  CE2 . TYR D 1 83  ? 28.375  34.516  56.191 1.00 45.00 ? 736  TYR D CE2 1 
ATOM   9429  C  CZ  . TYR D 1 83  ? 28.749  34.948  57.444 1.00 47.38 ? 736  TYR D CZ  1 
ATOM   9430  O  OH  . TYR D 1 83  ? 28.889  36.313  57.677 1.00 45.29 ? 736  TYR D OH  1 
ATOM   9431  N  N   . HIS D 1 84  ? 26.173  30.839  54.651 1.00 44.82 ? 737  HIS D N   1 
ATOM   9432  C  CA  . HIS D 1 84  ? 25.259  31.548  53.754 1.00 42.89 ? 737  HIS D CA  1 
ATOM   9433  C  C   . HIS D 1 84  ? 23.906  30.852  53.543 1.00 42.67 ? 737  HIS D C   1 
ATOM   9434  O  O   . HIS D 1 84  ? 23.592  30.365  52.450 1.00 41.49 ? 737  HIS D O   1 
ATOM   9435  C  CB  . HIS D 1 84  ? 25.949  31.774  52.406 1.00 41.94 ? 737  HIS D CB  1 
ATOM   9436  C  CG  . HIS D 1 84  ? 27.211  32.576  52.496 1.00 38.96 ? 737  HIS D CG  1 
ATOM   9437  N  ND1 . HIS D 1 84  ? 28.454  32.017  52.299 1.00 37.88 ? 737  HIS D ND1 1 
ATOM   9438  C  CD2 . HIS D 1 84  ? 27.424  33.893  52.723 1.00 38.24 ? 737  HIS D CD2 1 
ATOM   9439  C  CE1 . HIS D 1 84  ? 29.379  32.956  52.395 1.00 36.30 ? 737  HIS D CE1 1 
ATOM   9440  N  NE2 . HIS D 1 84  ? 28.781  34.104  52.652 1.00 37.71 ? 737  HIS D NE2 1 
ATOM   9441  N  N   . ASN D 1 85  ? 23.102  30.854  54.596 1.00 42.60 ? 738  ASN D N   1 
ATOM   9442  C  CA  . ASN D 1 85  ? 21.793  30.214  54.598 1.00 45.27 ? 738  ASN D CA  1 
ATOM   9443  C  C   . ASN D 1 85  ? 20.649  31.211  54.943 1.00 45.76 ? 738  ASN D C   1 
ATOM   9444  O  O   . ASN D 1 85  ? 20.890  32.422  55.105 1.00 44.41 ? 738  ASN D O   1 
ATOM   9445  C  CB  . ASN D 1 85  ? 21.813  29.069  55.628 1.00 45.43 ? 738  ASN D CB  1 
ATOM   9446  C  CG  . ASN D 1 85  ? 22.384  29.517  56.978 1.00 46.05 ? 738  ASN D CG  1 
ATOM   9447  O  OD1 . ASN D 1 85  ? 22.103  30.619  57.449 1.00 47.56 ? 738  ASN D OD1 1 
ATOM   9448  N  ND2 . ASN D 1 85  ? 23.178  28.664  57.597 1.00 48.01 ? 738  ASN D ND2 1 
ATOM   9449  N  N   . ARG D 1 86  ? 19.421  30.683  55.050 1.00 45.28 ? 739  ARG D N   1 
ATOM   9450  C  CA  . ARG D 1 86  ? 18.230  31.485  55.409 1.00 46.33 ? 739  ARG D CA  1 
ATOM   9451  C  C   . ARG D 1 86  ? 18.519  32.404  56.593 1.00 46.55 ? 739  ARG D C   1 
ATOM   9452  O  O   . ARG D 1 86  ? 18.176  33.599  56.562 1.00 45.69 ? 739  ARG D O   1 
ATOM   9453  C  CB  . ARG D 1 86  ? 17.062  30.603  55.865 1.00 45.94 ? 739  ARG D CB  1 
ATOM   9454  C  CG  . ARG D 1 86  ? 16.489  29.637  54.881 1.00 47.40 ? 739  ARG D CG  1 
ATOM   9455  C  CD  . ARG D 1 86  ? 16.102  28.454  55.667 1.00 48.13 ? 739  ARG D CD  1 
ATOM   9456  N  NE  . ARG D 1 86  ? 14.882  27.811  55.216 1.00 52.41 ? 739  ARG D NE  1 
ATOM   9457  C  CZ  . ARG D 1 86  ? 14.749  27.135  54.082 1.00 53.08 ? 739  ARG D CZ  1 
ATOM   9458  N  NH1 . ARG D 1 86  ? 15.775  27.016  53.250 1.00 51.73 ? 739  ARG D NH1 1 
ATOM   9459  N  NH2 . ARG D 1 86  ? 13.584  26.542  53.809 1.00 54.92 ? 739  ARG D NH2 1 
ATOM   9460  N  N   . ILE D 1 87  ? 19.128  31.820  57.637 1.00 45.46 ? 740  ILE D N   1 
ATOM   9461  C  CA  . ILE D 1 87  ? 19.436  32.549  58.865 1.00 44.98 ? 740  ILE D CA  1 
ATOM   9462  C  C   . ILE D 1 87  ? 20.377  33.707  58.641 1.00 45.08 ? 740  ILE D C   1 
ATOM   9463  O  O   . ILE D 1 87  ? 20.162  34.790  59.179 1.00 46.66 ? 740  ILE D O   1 
ATOM   9464  C  CB  . ILE D 1 87  ? 20.034  31.615  59.963 1.00 44.97 ? 740  ILE D CB  1 
ATOM   9465  C  CG1 . ILE D 1 87  ? 19.055  30.495  60.298 1.00 43.96 ? 740  ILE D CG1 1 
ATOM   9466  C  CG2 . ILE D 1 87  ? 20.351  32.406  61.216 1.00 44.16 ? 740  ILE D CG2 1 
ATOM   9467  C  CD1 . ILE D 1 87  ? 19.734  29.155  60.488 1.00 43.70 ? 740  ILE D CD1 1 
ATOM   9468  N  N   . HIS D 1 88  ? 21.439  33.492  57.869 1.00 45.22 ? 741  HIS D N   1 
ATOM   9469  C  CA  . HIS D 1 88  ? 22.364  34.587  57.582 1.00 43.40 ? 741  HIS D CA  1 
ATOM   9470  C  C   . HIS D 1 88  ? 21.636  35.738  56.848 1.00 43.32 ? 741  HIS D C   1 
ATOM   9471  O  O   . HIS D 1 88  ? 21.886  36.908  57.150 1.00 43.50 ? 741  HIS D O   1 
ATOM   9472  C  CB  . HIS D 1 88  ? 23.523  34.091  56.726 1.00 41.25 ? 741  HIS D CB  1 
ATOM   9473  C  CG  . HIS D 1 88  ? 24.397  35.182  56.207 1.00 37.83 ? 741  HIS D CG  1 
ATOM   9474  N  ND1 . HIS D 1 88  ? 25.047  36.071  57.039 1.00 39.37 ? 741  HIS D ND1 1 
ATOM   9475  C  CD2 . HIS D 1 88  ? 24.733  35.526  54.942 1.00 37.19 ? 741  HIS D CD2 1 
ATOM   9476  C  CE1 . HIS D 1 88  ? 25.752  36.918  56.306 1.00 39.36 ? 741  HIS D CE1 1 
ATOM   9477  N  NE2 . HIS D 1 88  ? 25.579  36.607  55.030 1.00 39.92 ? 741  HIS D NE2 1 
ATOM   9478  N  N   . ALA D 1 89  ? 20.773  35.414  55.875 1.00 43.03 ? 742  ALA D N   1 
ATOM   9479  C  CA  . ALA D 1 89  ? 19.989  36.449  55.140 1.00 44.45 ? 742  ALA D CA  1 
ATOM   9480  C  C   . ALA D 1 89  ? 19.198  37.244  56.175 1.00 44.58 ? 742  ALA D C   1 
ATOM   9481  O  O   . ALA D 1 89  ? 19.373  38.453  56.310 1.00 44.58 ? 742  ALA D O   1 
ATOM   9482  C  CB  . ALA D 1 89  ? 19.017  35.808  54.131 1.00 42.03 ? 742  ALA D CB  1 
ATOM   9483  N  N   . THR D 1 90  ? 18.350  36.538  56.918 1.00 45.47 ? 743  THR D N   1 
ATOM   9484  C  CA  . THR D 1 90  ? 17.561  37.148  57.965 1.00 46.02 ? 743  THR D CA  1 
ATOM   9485  C  C   . THR D 1 90  ? 18.416  38.058  58.856 1.00 46.91 ? 743  THR D C   1 
ATOM   9486  O  O   . THR D 1 90  ? 18.017  39.178  59.204 1.00 49.47 ? 743  THR D O   1 
ATOM   9487  C  CB  . THR D 1 90  ? 16.908  36.079  58.865 1.00 46.67 ? 743  THR D CB  1 
ATOM   9488  O  OG1 . THR D 1 90  ? 16.142  35.171  58.070 1.00 47.81 ? 743  THR D OG1 1 
ATOM   9489  C  CG2 . THR D 1 90  ? 15.986  36.730  59.880 1.00 47.09 ? 743  THR D CG2 1 
ATOM   9490  N  N   . ASP D 1 91  ? 19.600  37.595  59.231 1.00 45.67 ? 744  ASP D N   1 
ATOM   9491  C  CA  . ASP D 1 91  ? 20.440  38.394  60.105 1.00 44.37 ? 744  ASP D CA  1 
ATOM   9492  C  C   . ASP D 1 91  ? 20.869  39.710  59.456 1.00 43.41 ? 744  ASP D C   1 
ATOM   9493  O  O   . ASP D 1 91  ? 20.976  40.734  60.124 1.00 42.56 ? 744  ASP D O   1 
ATOM   9494  C  CB  . ASP D 1 91  ? 21.666  37.583  60.544 1.00 44.10 ? 744  ASP D CB  1 
ATOM   9495  C  CG  . ASP D 1 91  ? 22.588  38.379  61.439 1.00 45.07 ? 744  ASP D CG  1 
ATOM   9496  O  OD1 . ASP D 1 91  ? 23.649  38.846  60.971 1.00 44.95 ? 744  ASP D OD1 1 
ATOM   9497  O  OD2 . ASP D 1 91  ? 22.236  38.565  62.625 1.00 47.57 ? 744  ASP D OD2 1 
ATOM   9498  N  N   . VAL D 1 92  ? 21.129  39.670  58.152 1.00 43.79 ? 745  VAL D N   1 
ATOM   9499  C  CA  . VAL D 1 92  ? 21.540  40.854  57.402 1.00 45.31 ? 745  VAL D CA  1 
ATOM   9500  C  C   . VAL D 1 92  ? 20.312  41.780  57.270 1.00 44.91 ? 745  VAL D C   1 
ATOM   9501  O  O   . VAL D 1 92  ? 20.401  43.000  57.380 1.00 43.10 ? 745  VAL D O   1 
ATOM   9502  C  CB  . VAL D 1 92  ? 22.070  40.435  56.014 1.00 45.66 ? 745  VAL D CB  1 
ATOM   9503  C  CG1 . VAL D 1 92  ? 22.550  41.663  55.239 1.00 42.68 ? 745  VAL D CG1 1 
ATOM   9504  C  CG2 . VAL D 1 92  ? 23.224  39.408  56.200 1.00 45.39 ? 745  VAL D CG2 1 
ATOM   9505  N  N   . LEU D 1 93  ? 19.168  41.160  57.052 1.00 45.29 ? 746  LEU D N   1 
ATOM   9506  C  CA  . LEU D 1 93  ? 17.913  41.866  56.969 1.00 48.39 ? 746  LEU D CA  1 
ATOM   9507  C  C   . LEU D 1 93  ? 17.726  42.707  58.228 1.00 49.91 ? 746  LEU D C   1 
ATOM   9508  O  O   . LEU D 1 93  ? 17.556  43.936  58.176 1.00 49.57 ? 746  LEU D O   1 
ATOM   9509  C  CB  . LEU D 1 93  ? 16.772  40.857  56.862 1.00 47.75 ? 746  LEU D CB  1 
ATOM   9510  C  CG  . LEU D 1 93  ? 15.354  41.394  57.068 1.00 48.74 ? 746  LEU D CG  1 
ATOM   9511  C  CD1 . LEU D 1 93  ? 15.198  42.744  56.341 1.00 47.99 ? 746  LEU D CD1 1 
ATOM   9512  C  CD2 . LEU D 1 93  ? 14.354  40.330  56.597 1.00 46.84 ? 746  LEU D CD2 1 
ATOM   9513  N  N   . HIS D 1 94  ? 17.769  42.019  59.361 1.00 50.90 ? 747  HIS D N   1 
ATOM   9514  C  CA  . HIS D 1 94  ? 17.597  42.645  60.653 1.00 51.95 ? 747  HIS D CA  1 
ATOM   9515  C  C   . HIS D 1 94  ? 18.542  43.828  60.851 1.00 52.73 ? 747  HIS D C   1 
ATOM   9516  O  O   . HIS D 1 94  ? 18.147  44.888  61.367 1.00 52.62 ? 747  HIS D O   1 
ATOM   9517  C  CB  . HIS D 1 94  ? 17.813  41.586  61.753 1.00 53.58 ? 747  HIS D CB  1 
ATOM   9518  C  CG  . HIS D 1 94  ? 17.966  42.163  63.126 1.00 54.45 ? 747  HIS D CG  1 
ATOM   9519  N  ND1 . HIS D 1 94  ? 19.086  42.868  63.517 1.00 55.59 ? 747  HIS D ND1 1 
ATOM   9520  C  CD2 . HIS D 1 94  ? 17.112  42.203  64.174 1.00 55.03 ? 747  HIS D CD2 1 
ATOM   9521  C  CE1 . HIS D 1 94  ? 18.913  43.323  64.745 1.00 56.46 ? 747  HIS D CE1 1 
ATOM   9522  N  NE2 . HIS D 1 94  ? 17.723  42.933  65.166 1.00 57.28 ? 747  HIS D NE2 1 
ATOM   9523  N  N   . ALA D 1 95  ? 19.785  43.644  60.426 1.00 52.98 ? 748  ALA D N   1 
ATOM   9524  C  CA  . ALA D 1 95  ? 20.803  44.666  60.583 1.00 53.18 ? 748  ALA D CA  1 
ATOM   9525  C  C   . ALA D 1 95  ? 20.509  45.938  59.811 1.00 53.94 ? 748  ALA D C   1 
ATOM   9526  O  O   . ALA D 1 95  ? 20.705  47.025  60.347 1.00 54.27 ? 748  ALA D O   1 
ATOM   9527  C  CB  . ALA D 1 95  ? 22.168  44.110  60.173 1.00 53.61 ? 748  ALA D CB  1 
ATOM   9528  N  N   . VAL D 1 96  ? 20.070  45.816  58.554 1.00 54.53 ? 749  VAL D N   1 
ATOM   9529  C  CA  . VAL D 1 96  ? 19.777  47.003  57.738 1.00 55.09 ? 749  VAL D CA  1 
ATOM   9530  C  C   . VAL D 1 96  ? 18.548  47.710  58.309 1.00 54.90 ? 749  VAL D C   1 
ATOM   9531  O  O   . VAL D 1 96  ? 18.536  48.934  58.525 1.00 53.25 ? 749  VAL D O   1 
ATOM   9532  C  CB  . VAL D 1 96  ? 19.523  46.651  56.234 1.00 54.31 ? 749  VAL D CB  1 
ATOM   9533  C  CG1 . VAL D 1 96  ? 20.852  46.353  55.544 1.00 54.61 ? 749  VAL D CG1 1 
ATOM   9534  C  CG2 . VAL D 1 96  ? 18.569  45.465  56.106 1.00 52.61 ? 749  VAL D CG2 1 
ATOM   9535  N  N   . TRP D 1 97  ? 17.519  46.915  58.555 1.00 56.16 ? 750  TRP D N   1 
ATOM   9536  C  CA  . TRP D 1 97  ? 16.312  47.437  59.142 1.00 57.66 ? 750  TRP D CA  1 
ATOM   9537  C  C   . TRP D 1 97  ? 16.766  48.311  60.310 1.00 56.95 ? 750  TRP D C   1 
ATOM   9538  O  O   . TRP D 1 97  ? 16.599  49.534  60.305 1.00 58.16 ? 750  TRP D O   1 
ATOM   9539  C  CB  . TRP D 1 97  ? 15.433  46.280  59.633 1.00 59.55 ? 750  TRP D CB  1 
ATOM   9540  C  CG  . TRP D 1 97  ? 14.306  46.746  60.466 1.00 63.75 ? 750  TRP D CG  1 
ATOM   9541  C  CD1 . TRP D 1 97  ? 13.248  47.514  60.055 1.00 65.99 ? 750  TRP D CD1 1 
ATOM   9542  C  CD2 . TRP D 1 97  ? 14.191  46.640  61.894 1.00 65.24 ? 750  TRP D CD2 1 
ATOM   9543  N  NE1 . TRP D 1 97  ? 12.493  47.910  61.139 1.00 66.43 ? 750  TRP D NE1 1 
ATOM   9544  C  CE2 . TRP D 1 97  ? 13.048  47.390  62.280 1.00 66.21 ? 750  TRP D CE2 1 
ATOM   9545  C  CE3 . TRP D 1 97  ? 14.945  45.995  62.885 1.00 65.25 ? 750  TRP D CE3 1 
ATOM   9546  C  CZ2 . TRP D 1 97  ? 12.643  47.512  63.620 1.00 65.74 ? 750  TRP D CZ2 1 
ATOM   9547  C  CZ3 . TRP D 1 97  ? 14.541  46.116  64.217 1.00 65.21 ? 750  TRP D CZ3 1 
ATOM   9548  C  CH2 . TRP D 1 97  ? 13.398  46.872  64.570 1.00 65.28 ? 750  TRP D CH2 1 
ATOM   9549  N  N   . TYR D 1 98  ? 17.401  47.671  61.280 1.00 56.09 ? 751  TYR D N   1 
ATOM   9550  C  CA  . TYR D 1 98  ? 17.890  48.322  62.489 1.00 55.35 ? 751  TYR D CA  1 
ATOM   9551  C  C   . TYR D 1 98  ? 18.761  49.570  62.274 1.00 55.36 ? 751  TYR D C   1 
ATOM   9552  O  O   . TYR D 1 98  ? 18.566  50.591  62.943 1.00 56.59 ? 751  TYR D O   1 
ATOM   9553  C  CB  . TYR D 1 98  ? 18.663  47.291  63.340 1.00 53.86 ? 751  TYR D CB  1 
ATOM   9554  C  CG  . TYR D 1 98  ? 18.926  47.720  64.777 1.00 51.82 ? 751  TYR D CG  1 
ATOM   9555  C  CD1 . TYR D 1 98  ? 18.083  47.323  65.816 1.00 50.98 ? 751  TYR D CD1 1 
ATOM   9556  C  CD2 . TYR D 1 98  ? 19.996  48.552  65.086 1.00 50.54 ? 751  TYR D CD2 1 
ATOM   9557  C  CE1 . TYR D 1 98  ? 18.307  47.753  67.126 1.00 50.64 ? 751  TYR D CE1 1 
ATOM   9558  C  CE2 . TYR D 1 98  ? 20.224  48.983  66.376 1.00 50.28 ? 751  TYR D CE2 1 
ATOM   9559  C  CZ  . TYR D 1 98  ? 19.383  48.587  67.394 1.00 51.24 ? 751  TYR D CZ  1 
ATOM   9560  O  OH  . TYR D 1 98  ? 19.625  49.050  68.680 1.00 51.92 ? 751  TYR D OH  1 
ATOM   9561  N  N   . LEU D 1 99  ? 19.722  49.505  61.363 1.00 54.62 ? 752  LEU D N   1 
ATOM   9562  C  CA  . LEU D 1 99  ? 20.619  50.641  61.129 1.00 53.43 ? 752  LEU D CA  1 
ATOM   9563  C  C   . LEU D 1 99  ? 19.959  51.829  60.434 1.00 53.24 ? 752  LEU D C   1 
ATOM   9564  O  O   . LEU D 1 99  ? 20.418  52.980  60.563 1.00 52.23 ? 752  LEU D O   1 
ATOM   9565  C  CB  . LEU D 1 99  ? 21.813  50.185  60.297 1.00 53.48 ? 752  LEU D CB  1 
ATOM   9566  C  CG  . LEU D 1 99  ? 22.755  49.121  60.869 1.00 53.37 ? 752  LEU D CG  1 
ATOM   9567  C  CD1 . LEU D 1 99  ? 23.626  48.556  59.751 1.00 53.19 ? 752  LEU D CD1 1 
ATOM   9568  C  CD2 . LEU D 1 99  ? 23.604  49.751  61.950 1.00 53.03 ? 752  LEU D CD2 1 
ATOM   9569  N  N   . THR D 1 100 ? 18.898  51.551  59.685 1.00 52.90 ? 753  THR D N   1 
ATOM   9570  C  CA  . THR D 1 100 ? 18.207  52.608  58.957 1.00 53.83 ? 753  THR D CA  1 
ATOM   9571  C  C   . THR D 1 100 ? 17.017  53.199  59.716 1.00 56.29 ? 753  THR D C   1 
ATOM   9572  O  O   . THR D 1 100 ? 16.485  54.225  59.293 1.00 56.83 ? 753  THR D O   1 
ATOM   9573  C  CB  . THR D 1 100 ? 17.660  52.113  57.613 1.00 53.39 ? 753  THR D CB  1 
ATOM   9574  O  OG1 . THR D 1 100 ? 16.616  51.145  57.839 1.00 50.67 ? 753  THR D OG1 1 
ATOM   9575  C  CG2 . THR D 1 100 ? 18.787  51.514  56.759 1.00 52.20 ? 753  THR D CG2 1 
ATOM   9576  N  N   . THR D 1 101 ? 16.624  52.573  60.833 1.00 56.23 ? 754  THR D N   1 
ATOM   9577  C  CA  . THR D 1 101 ? 15.486  53.034  61.609 1.00 55.02 ? 754  THR D CA  1 
ATOM   9578  C  C   . THR D 1 101 ? 15.767  53.267  63.099 1.00 56.25 ? 754  THR D C   1 
ATOM   9579  O  O   . THR D 1 101 ? 14.861  53.098  63.914 1.00 57.28 ? 754  THR D O   1 
ATOM   9580  C  CB  . THR D 1 101 ? 14.311  52.034  61.521 1.00 55.73 ? 754  THR D CB  1 
ATOM   9581  O  OG1 . THR D 1 101 ? 14.577  50.898  62.355 1.00 56.48 ? 754  THR D OG1 1 
ATOM   9582  C  CG2 . THR D 1 101 ? 14.119  51.537  60.088 1.00 55.86 ? 754  THR D CG2 1 
ATOM   9583  N  N   . ARG D 1 102 ? 16.983  53.664  63.477 1.00 55.10 ? 755  ARG D N   1 
ATOM   9584  C  CA  . ARG D 1 102 ? 17.263  53.883  64.897 1.00 53.35 ? 755  ARG D CA  1 
ATOM   9585  C  C   . ARG D 1 102 ? 17.919  55.202  65.172 1.00 52.86 ? 755  ARG D C   1 
ATOM   9586  O  O   . ARG D 1 102 ? 18.673  55.722  64.355 1.00 52.07 ? 755  ARG D O   1 
ATOM   9587  C  CB  . ARG D 1 102 ? 18.178  52.790  65.487 1.00 55.27 ? 755  ARG D CB  1 
ATOM   9588  C  CG  . ARG D 1 102 ? 17.594  51.368  65.639 1.00 56.17 ? 755  ARG D CG  1 
ATOM   9589  C  CD  . ARG D 1 102 ? 16.430  51.279  66.582 1.00 55.29 ? 755  ARG D CD  1 
ATOM   9590  N  NE  . ARG D 1 102 ? 15.213  51.073  65.806 1.00 57.13 ? 755  ARG D NE  1 
ATOM   9591  C  CZ  . ARG D 1 102 ? 14.505  49.951  65.797 1.00 57.48 ? 755  ARG D CZ  1 
ATOM   9592  N  NH1 . ARG D 1 102 ? 14.885  48.916  66.535 1.00 57.43 ? 755  ARG D NH1 1 
ATOM   9593  N  NH2 . ARG D 1 102 ? 13.422  49.862  65.035 1.00 58.05 ? 755  ARG D NH2 1 
ATOM   9594  N  N   . PRO D 1 103 ? 17.680  55.737  66.376 1.00 52.86 ? 756  PRO D N   1 
ATOM   9595  C  CA  . PRO D 1 103 ? 18.213  57.010  66.853 1.00 53.38 ? 756  PRO D CA  1 
ATOM   9596  C  C   . PRO D 1 103 ? 19.716  57.193  66.659 1.00 54.39 ? 756  PRO D C   1 
ATOM   9597  O  O   . PRO D 1 103 ? 20.524  56.587  67.373 1.00 56.05 ? 756  PRO D O   1 
ATOM   9598  C  CB  . PRO D 1 103 ? 17.788  57.010  68.322 1.00 52.03 ? 756  PRO D CB  1 
ATOM   9599  C  CG  . PRO D 1 103 ? 16.470  56.308  68.273 1.00 50.09 ? 756  PRO D CG  1 
ATOM   9600  C  CD  . PRO D 1 103 ? 16.783  55.146  67.392 1.00 51.64 ? 756  PRO D CD  1 
ATOM   9601  N  N   . VAL D 1 104 ? 20.090  58.044  65.711 1.00 54.15 ? 757  VAL D N   1 
ATOM   9602  C  CA  . VAL D 1 104 ? 21.493  58.296  65.437 1.00 53.83 ? 757  VAL D CA  1 
ATOM   9603  C  C   . VAL D 1 104 ? 22.009  59.623  65.967 1.00 57.03 ? 757  VAL D C   1 
ATOM   9604  O  O   . VAL D 1 104 ? 21.906  60.666  65.319 1.00 58.04 ? 757  VAL D O   1 
ATOM   9605  C  CB  . VAL D 1 104 ? 21.785  58.258  63.951 1.00 52.90 ? 757  VAL D CB  1 
ATOM   9606  C  CG1 . VAL D 1 104 ? 23.288  58.537  63.714 1.00 51.36 ? 757  VAL D CG1 1 
ATOM   9607  C  CG2 . VAL D 1 104 ? 21.336  56.918  63.384 1.00 50.90 ? 757  VAL D CG2 1 
ATOM   9608  N  N   . PRO D 1 105 ? 22.617  59.597  67.148 1.00 58.86 ? 758  PRO D N   1 
ATOM   9609  C  CA  . PRO D 1 105 ? 23.153  60.816  67.754 1.00 60.91 ? 758  PRO D CA  1 
ATOM   9610  C  C   . PRO D 1 105 ? 23.706  61.873  66.785 1.00 62.17 ? 758  PRO D C   1 
ATOM   9611  O  O   . PRO D 1 105 ? 24.686  61.632  66.072 1.00 62.65 ? 758  PRO D O   1 
ATOM   9612  C  CB  . PRO D 1 105 ? 24.219  60.268  68.709 1.00 59.82 ? 758  PRO D CB  1 
ATOM   9613  C  CG  . PRO D 1 105 ? 23.532  59.042  69.231 1.00 59.66 ? 758  PRO D CG  1 
ATOM   9614  C  CD  . PRO D 1 105 ? 22.961  58.413  67.960 1.00 59.08 ? 758  PRO D CD  1 
ATOM   9615  N  N   . GLY D 1 106 ? 23.052  63.039  66.770 1.00 63.52 ? 759  GLY D N   1 
ATOM   9616  C  CA  . GLY D 1 106 ? 23.475  64.168  65.941 1.00 63.77 ? 759  GLY D CA  1 
ATOM   9617  C  C   . GLY D 1 106 ? 23.186  64.166  64.447 1.00 64.13 ? 759  GLY D C   1 
ATOM   9618  O  O   . GLY D 1 106 ? 23.770  64.965  63.706 1.00 63.38 ? 759  GLY D O   1 
ATOM   9619  N  N   . LEU D 1 107 ? 22.294  63.286  63.996 1.00 64.82 ? 760  LEU D N   1 
ATOM   9620  C  CA  . LEU D 1 107 ? 21.966  63.220  62.573 1.00 65.36 ? 760  LEU D CA  1 
ATOM   9621  C  C   . LEU D 1 107 ? 20.929  64.283  62.226 1.00 67.28 ? 760  LEU D C   1 
ATOM   9622  O  O   . LEU D 1 107 ? 20.008  64.539  63.013 1.00 68.31 ? 760  LEU D O   1 
ATOM   9623  C  CB  . LEU D 1 107 ? 21.407  61.839  62.206 1.00 62.87 ? 760  LEU D CB  1 
ATOM   9624  C  CG  . LEU D 1 107 ? 21.047  61.697  60.721 1.00 61.92 ? 760  LEU D CG  1 
ATOM   9625  C  CD1 . LEU D 1 107 ? 22.303  61.917  59.868 1.00 60.68 ? 760  LEU D CD1 1 
ATOM   9626  C  CD2 . LEU D 1 107 ? 20.434  60.328  60.446 1.00 59.36 ? 760  LEU D CD2 1 
ATOM   9627  N  N   . GLN D 1 108 ? 21.067  64.894  61.051 1.00 68.66 ? 761  GLN D N   1 
ATOM   9628  C  CA  . GLN D 1 108 ? 20.114  65.918  60.622 1.00 70.01 ? 761  GLN D CA  1 
ATOM   9629  C  C   . GLN D 1 108 ? 18.941  65.283  59.883 1.00 71.42 ? 761  GLN D C   1 
ATOM   9630  O  O   . GLN D 1 108 ? 19.103  64.265  59.200 1.00 71.95 ? 761  GLN D O   1 
ATOM   9631  C  CB  . GLN D 1 108 ? 20.808  66.947  59.726 1.00 69.18 ? 761  GLN D CB  1 
ATOM   9632  N  N   . GLN D 1 109 ? 17.764  65.892  60.035 1.00 72.52 ? 762  GLN D N   1 
ATOM   9633  C  CA  . GLN D 1 109 ? 16.524  65.430  59.391 1.00 73.67 ? 762  GLN D CA  1 
ATOM   9634  C  C   . GLN D 1 109 ? 16.159  66.217  58.109 1.00 74.18 ? 762  GLN D C   1 
ATOM   9635  O  O   . GLN D 1 109 ? 16.197  67.457  58.076 1.00 74.17 ? 762  GLN D O   1 
ATOM   9636  C  CB  . GLN D 1 109 ? 15.346  65.525  60.381 1.00 74.16 ? 762  GLN D CB  1 
ATOM   9637  C  CG  . GLN D 1 109 ? 15.393  64.505  61.509 1.00 75.66 ? 762  GLN D CG  1 
ATOM   9638  C  CD  . GLN D 1 109 ? 15.144  63.086  61.010 1.00 76.36 ? 762  GLN D CD  1 
ATOM   9639  O  OE1 . GLN D 1 109 ? 15.567  62.720  59.907 1.00 76.19 ? 762  GLN D OE1 1 
ATOM   9640  N  NE2 . GLN D 1 109 ? 14.464  62.277  61.824 1.00 76.89 ? 762  GLN D NE2 1 
ATOM   9641  N  N   . ILE D 1 110 ? 15.810  65.483  57.055 1.00 74.09 ? 763  ILE D N   1 
ATOM   9642  C  CA  . ILE D 1 110 ? 15.416  66.095  55.796 1.00 73.95 ? 763  ILE D CA  1 
ATOM   9643  C  C   . ILE D 1 110 ? 13.889  66.214  55.807 1.00 74.58 ? 763  ILE D C   1 
ATOM   9644  O  O   . ILE D 1 110 ? 13.333  67.292  55.522 1.00 75.17 ? 763  ILE D O   1 
ATOM   9645  C  CB  . ILE D 1 110 ? 15.878  65.237  54.611 1.00 72.98 ? 763  ILE D CB  1 
ATOM   9646  N  N   . HIS D 1 111 ? 13.214  65.114  56.148 1.00 73.98 ? 764  HIS D N   1 
ATOM   9647  C  CA  . HIS D 1 111 ? 11.752  65.101  56.209 1.00 74.42 ? 764  HIS D CA  1 
ATOM   9648  C  C   . HIS D 1 111 ? 11.229  66.201  57.152 1.00 74.97 ? 764  HIS D C   1 
ATOM   9649  O  O   . HIS D 1 111 ? 10.023  66.236  57.465 1.00 75.71 ? 764  HIS D O   1 
ATOM   9650  C  CB  . HIS D 1 111 ? 11.241  63.722  56.669 1.00 72.91 ? 764  HIS D CB  1 
ATOM   9651  N  N   . ASN D 1 112 ? 12.136  67.089  57.585 1.00 74.74 ? 765  ASN D N   1 
ATOM   9652  C  CA  . ASN D 1 112 ? 11.816  68.212  58.478 1.00 74.66 ? 765  ASN D CA  1 
ATOM   9653  C  C   . ASN D 1 112 ? 10.883  67.780  59.619 1.00 74.41 ? 765  ASN D C   1 
ATOM   9654  O  O   . ASN D 1 112 ? 9.725   68.221  59.707 1.00 74.75 ? 765  ASN D O   1 
ATOM   9655  C  CB  . ASN D 1 112 ? 11.182  69.379  57.669 1.00 74.24 ? 765  ASN D CB  1 
ATOM   9656  N  N   . GLY D 1 113 ? 11.400  66.899  60.477 1.00 73.97 ? 766  GLY D N   1 
ATOM   9657  C  CA  . GLY D 1 113 ? 10.665  66.375  61.635 1.00 73.17 ? 766  GLY D CA  1 
ATOM   9658  C  C   . GLY D 1 113 ? 9.533   65.403  61.271 1.00 73.07 ? 766  GLY D C   1 
ATOM   9659  O  O   . GLY D 1 113 ? 9.272   65.236  60.051 1.00 73.07 ? 766  GLY D O   1 
ATOM   9660  N  N   . ASN D 1 127 ? -2.133  64.467  40.208 1.00 79.87 ? 780  ASN D N   1 
ATOM   9661  C  CA  . ASN D 1 127 ? -1.654  64.036  41.565 1.00 79.67 ? 780  ASN D CA  1 
ATOM   9662  C  C   . ASN D 1 127 ? -0.312  64.702  41.923 1.00 79.63 ? 780  ASN D C   1 
ATOM   9663  O  O   . ASN D 1 127 ? -0.203  65.943  41.937 1.00 79.79 ? 780  ASN D O   1 
ATOM   9664  C  CB  . ASN D 1 127 ? -1.519  62.489  41.626 1.00 78.73 ? 780  ASN D CB  1 
ATOM   9665  C  CG  . ASN D 1 127 ? -2.881  61.763  41.496 1.00 78.13 ? 780  ASN D CG  1 
ATOM   9666  O  OD1 . ASN D 1 127 ? -2.969  60.532  41.678 1.00 76.53 ? 780  ASN D OD1 1 
ATOM   9667  N  ND2 . ASN D 1 127 ? -3.945  62.529  41.169 1.00 76.60 ? 780  ASN D ND2 1 
ATOM   9668  N  N   . HIS D 1 128 ? 0.693   63.870  42.218 1.00 78.73 ? 781  HIS D N   1 
ATOM   9669  C  CA  . HIS D 1 128 ? 2.052   64.314  42.586 1.00 77.50 ? 781  HIS D CA  1 
ATOM   9670  C  C   . HIS D 1 128 ? 2.247   65.050  43.911 1.00 77.03 ? 781  HIS D C   1 
ATOM   9671  O  O   . HIS D 1 128 ? 1.298   65.239  44.691 1.00 76.71 ? 781  HIS D O   1 
ATOM   9672  C  CB  . HIS D 1 128 ? 2.701   65.152  41.471 1.00 76.17 ? 781  HIS D CB  1 
ATOM   9673  C  CG  . HIS D 1 128 ? 4.021   64.599  41.021 1.00 75.63 ? 781  HIS D CG  1 
ATOM   9674  N  ND1 . HIS D 1 128 ? 5.048   64.325  41.904 1.00 74.14 ? 781  HIS D ND1 1 
ATOM   9675  C  CD2 . HIS D 1 128 ? 4.451   64.187  39.801 1.00 74.86 ? 781  HIS D CD2 1 
ATOM   9676  C  CE1 . HIS D 1 128 ? 6.050   63.763  41.248 1.00 74.58 ? 781  HIS D CE1 1 
ATOM   9677  N  NE2 . HIS D 1 128 ? 5.714   63.667  39.971 1.00 75.22 ? 781  HIS D NE2 1 
ATOM   9678  N  N   . GLY D 1 129 ? 3.502   65.461  44.140 1.00 76.15 ? 782  GLY D N   1 
ATOM   9679  C  CA  . GLY D 1 129 ? 3.877   66.136  45.370 1.00 74.04 ? 782  GLY D CA  1 
ATOM   9680  C  C   . GLY D 1 129 ? 5.159   65.556  45.968 1.00 73.26 ? 782  GLY D C   1 
ATOM   9681  O  O   . GLY D 1 129 ? 6.213   65.670  45.349 1.00 72.70 ? 782  GLY D O   1 
ATOM   9682  N  N   . ARG D 1 130 ? 5.081   64.917  47.141 1.00 72.04 ? 783  ARG D N   1 
ATOM   9683  C  CA  . ARG D 1 130 ? 6.288   64.377  47.794 1.00 71.02 ? 783  ARG D CA  1 
ATOM   9684  C  C   . ARG D 1 130 ? 6.409   62.842  47.929 1.00 69.40 ? 783  ARG D C   1 
ATOM   9685  O  O   . ARG D 1 130 ? 5.451   62.095  47.702 1.00 69.32 ? 783  ARG D O   1 
ATOM   9686  C  CB  . ARG D 1 130 ? 6.464   65.041  49.187 1.00 71.03 ? 783  ARG D CB  1 
ATOM   9687  N  N   . ILE D 1 131 ? 7.601   62.394  48.326 1.00 68.03 ? 784  ILE D N   1 
ATOM   9688  C  CA  . ILE D 1 131 ? 7.898   60.961  48.482 1.00 66.61 ? 784  ILE D CA  1 
ATOM   9689  C  C   . ILE D 1 131 ? 7.632   60.373  49.874 1.00 65.63 ? 784  ILE D C   1 
ATOM   9690  O  O   . ILE D 1 131 ? 8.018   60.952  50.899 1.00 65.73 ? 784  ILE D O   1 
ATOM   9691  C  CB  . ILE D 1 131 ? 9.361   60.657  48.106 1.00 66.80 ? 784  ILE D CB  1 
ATOM   9692  C  CG1 . ILE D 1 131 ? 10.294  61.482  48.998 1.00 68.06 ? 784  ILE D CG1 1 
ATOM   9693  C  CG2 . ILE D 1 131 ? 9.594   60.967  46.615 1.00 65.23 ? 784  ILE D CG2 1 
ATOM   9694  C  CD1 . ILE D 1 131 ? 11.781  61.213  48.784 1.00 69.60 ? 784  ILE D CD1 1 
ATOM   9695  N  N   . ALA D 1 132 ? 6.974   59.214  49.888 1.00 63.70 ? 785  ALA D N   1 
ATOM   9696  C  CA  . ALA D 1 132 ? 6.625   58.509  51.120 1.00 63.42 ? 785  ALA D CA  1 
ATOM   9697  C  C   . ALA D 1 132 ? 7.842   57.942  51.866 1.00 63.72 ? 785  ALA D C   1 
ATOM   9698  O  O   . ALA D 1 132 ? 8.627   57.175  51.299 1.00 64.78 ? 785  ALA D O   1 
ATOM   9699  C  CB  . ALA D 1 132 ? 5.636   57.365  50.807 1.00 61.38 ? 785  ALA D CB  1 
ATOM   9700  N  N   . TYR D 1 133 ? 7.997   58.340  53.126 1.00 63.44 ? 786  TYR D N   1 
ATOM   9701  C  CA  . TYR D 1 133 ? 9.064   57.831  53.976 1.00 63.57 ? 786  TYR D CA  1 
ATOM   9702  C  C   . TYR D 1 133 ? 8.465   56.794  54.947 1.00 64.16 ? 786  TYR D C   1 
ATOM   9703  O  O   . TYR D 1 133 ? 7.232   56.652  55.067 1.00 62.53 ? 786  TYR D O   1 
ATOM   9704  C  CB  . TYR D 1 133 ? 9.727   58.954  54.779 1.00 63.34 ? 786  TYR D CB  1 
ATOM   9705  C  CG  . TYR D 1 133 ? 10.553  59.900  53.943 1.00 64.46 ? 786  TYR D CG  1 
ATOM   9706  C  CD1 . TYR D 1 133 ? 9.950   60.794  53.046 1.00 65.50 ? 786  TYR D CD1 1 
ATOM   9707  C  CD2 . TYR D 1 133 ? 11.943  59.908  54.049 1.00 64.62 ? 786  TYR D CD2 1 
ATOM   9708  C  CE1 . TYR D 1 133 ? 10.729  61.690  52.268 1.00 65.62 ? 786  TYR D CE1 1 
ATOM   9709  C  CE2 . TYR D 1 133 ? 12.731  60.783  53.284 1.00 65.53 ? 786  TYR D CE2 1 
ATOM   9710  C  CZ  . TYR D 1 133 ? 12.120  61.676  52.392 1.00 66.42 ? 786  TYR D CZ  1 
ATOM   9711  O  OH  . TYR D 1 133 ? 12.910  62.529  51.634 1.00 65.67 ? 786  TYR D OH  1 
ATOM   9712  N  N   . ILE D 1 134 ? 9.351   56.067  55.634 1.00 65.01 ? 787  ILE D N   1 
ATOM   9713  C  CA  . ILE D 1 134 ? 8.953   55.036  56.591 1.00 64.02 ? 787  ILE D CA  1 
ATOM   9714  C  C   . ILE D 1 134 ? 9.308   55.496  58.001 1.00 63.25 ? 787  ILE D C   1 
ATOM   9715  O  O   . ILE D 1 134 ? 10.062  56.462  58.184 1.00 62.26 ? 787  ILE D O   1 
ATOM   9716  C  CB  . ILE D 1 134 ? 9.675   53.702  56.268 1.00 64.49 ? 787  ILE D CB  1 
ATOM   9717  C  CG1 . ILE D 1 134 ? 9.089   53.082  55.008 1.00 65.35 ? 787  ILE D CG1 1 
ATOM   9718  C  CG2 . ILE D 1 134 ? 9.483   52.711  57.380 1.00 65.80 ? 787  ILE D CG2 1 
ATOM   9719  C  CD1 . ILE D 1 134 ? 7.668   52.601  55.201 1.00 66.99 ? 787  ILE D CD1 1 
ATOM   9720  N  N   . SER D 1 135 ? 8.742   54.819  58.999 1.00 63.55 ? 788  SER D N   1 
ATOM   9721  C  CA  . SER D 1 135 ? 9.036   55.138  60.392 1.00 63.73 ? 788  SER D CA  1 
ATOM   9722  C  C   . SER D 1 135 ? 8.667   53.932  61.214 1.00 63.93 ? 788  SER D C   1 
ATOM   9723  O  O   . SER D 1 135 ? 7.495   53.544  61.266 1.00 65.13 ? 788  SER D O   1 
ATOM   9724  C  CB  . SER D 1 135 ? 8.238   56.353  60.877 1.00 62.95 ? 788  SER D CB  1 
ATOM   9725  O  OG  . SER D 1 135 ? 8.975   57.086  61.845 1.00 60.86 ? 788  SER D OG  1 
ATOM   9726  N  N   . SER D 1 136 ? 9.666   53.331  61.849 1.00 63.46 ? 789  SER D N   1 
ATOM   9727  C  CA  . SER D 1 136 ? 9.399   52.157  62.668 1.00 63.07 ? 789  SER D CA  1 
ATOM   9728  C  C   . SER D 1 136 ? 8.522   52.483  63.887 1.00 62.89 ? 789  SER D C   1 
ATOM   9729  O  O   . SER D 1 136 ? 8.660   53.527  64.553 1.00 60.81 ? 789  SER D O   1 
ATOM   9730  C  CB  . SER D 1 136 ? 10.713  51.503  63.144 1.00 62.60 ? 789  SER D CB  1 
ATOM   9731  O  OG  . SER D 1 136 ? 10.456  50.208  63.686 1.00 60.63 ? 789  SER D OG  1 
ATOM   9732  N  N   . LYS D 1 137 ? 7.629   51.548  64.168 1.00 62.97 ? 790  LYS D N   1 
ATOM   9733  C  CA  . LYS D 1 137 ? 6.729   51.655  65.294 1.00 63.64 ? 790  LYS D CA  1 
ATOM   9734  C  C   . LYS D 1 137 ? 7.403   51.214  66.600 1.00 65.35 ? 790  LYS D C   1 
ATOM   9735  O  O   . LYS D 1 137 ? 6.977   51.624  67.687 1.00 66.55 ? 790  LYS D O   1 
ATOM   9736  C  CB  . LYS D 1 137 ? 5.497   50.794  65.015 1.00 62.32 ? 790  LYS D CB  1 
ATOM   9737  C  CG  . LYS D 1 137 ? 4.777   51.218  63.726 1.00 60.49 ? 790  LYS D CG  1 
ATOM   9738  C  CD  . LYS D 1 137 ? 3.720   50.212  63.290 1.00 58.55 ? 790  LYS D CD  1 
ATOM   9739  C  CE  . LYS D 1 137 ? 3.136   50.586  61.921 1.00 56.45 ? 790  LYS D CE  1 
ATOM   9740  N  NZ  . LYS D 1 137 ? 2.283   49.472  61.397 1.00 54.23 ? 790  LYS D NZ  1 
ATOM   9741  N  N   . SER D 1 138 ? 8.463   50.404  66.498 1.00 65.91 ? 791  SER D N   1 
ATOM   9742  C  CA  . SER D 1 138 ? 9.159   49.899  67.689 1.00 65.95 ? 791  SER D CA  1 
ATOM   9743  C  C   . SER D 1 138 ? 10.157  50.868  68.323 1.00 66.75 ? 791  SER D C   1 
ATOM   9744  O  O   . SER D 1 138 ? 10.777  50.550  69.351 1.00 67.25 ? 791  SER D O   1 
ATOM   9745  C  CB  . SER D 1 138 ? 9.873   48.570  67.377 1.00 66.71 ? 791  SER D CB  1 
ATOM   9746  O  OG  . SER D 1 138 ? 10.945  48.740  66.457 1.00 66.64 ? 791  SER D OG  1 
ATOM   9747  N  N   . CYS D 1 139 ? 10.338  52.039  67.724 1.00 66.65 ? 792  CYS D N   1 
ATOM   9748  C  CA  . CYS D 1 139 ? 11.260  53.006  68.306 1.00 67.72 ? 792  CYS D CA  1 
ATOM   9749  C  C   . CYS D 1 139 ? 10.853  54.413  67.914 1.00 67.80 ? 792  CYS D C   1 
ATOM   9750  O  O   . CYS D 1 139 ? 9.881   54.591  67.184 1.00 68.00 ? 792  CYS D O   1 
ATOM   9751  C  CB  . CYS D 1 139 ? 12.698  52.736  67.849 1.00 68.65 ? 792  CYS D CB  1 
ATOM   9752  S  SG  . CYS D 1 139 ? 13.042  53.166  66.124 1.00 71.46 ? 792  CYS D SG  1 
ATOM   9753  N  N   . SER D 1 140 ? 11.589  55.407  68.405 1.00 67.56 ? 793  SER D N   1 
ATOM   9754  C  CA  . SER D 1 140 ? 11.301  56.796  68.080 1.00 68.23 ? 793  SER D CA  1 
ATOM   9755  C  C   . SER D 1 140 ? 12.492  57.638  68.473 1.00 69.06 ? 793  SER D C   1 
ATOM   9756  O  O   . SER D 1 140 ? 13.285  57.249  69.329 1.00 69.03 ? 793  SER D O   1 
ATOM   9757  C  CB  . SER D 1 140 ? 10.068  57.295  68.840 1.00 68.83 ? 793  SER D CB  1 
ATOM   9758  O  OG  . SER D 1 140 ? 10.406  57.694  70.164 1.00 69.15 ? 793  SER D OG  1 
ATOM   9759  N  N   . ASN D 1 141 ? 12.618  58.804  67.854 1.00 70.24 ? 794  ASN D N   1 
ATOM   9760  C  CA  . ASN D 1 141 ? 13.738  59.677  68.172 1.00 70.96 ? 794  ASN D CA  1 
ATOM   9761  C  C   . ASN D 1 141 ? 13.521  60.395  69.498 1.00 71.63 ? 794  ASN D C   1 
ATOM   9762  O  O   . ASN D 1 141 ? 12.497  61.050  69.717 1.00 71.85 ? 794  ASN D O   1 
ATOM   9763  C  CB  . ASN D 1 141 ? 13.955  60.707  67.065 1.00 71.38 ? 794  ASN D CB  1 
ATOM   9764  C  CG  . ASN D 1 141 ? 14.632  60.118  65.833 1.00 71.90 ? 794  ASN D CG  1 
ATOM   9765  O  OD1 . ASN D 1 141 ? 15.625  60.681  65.331 1.00 71.93 ? 794  ASN D OD1 1 
ATOM   9766  N  ND2 . ASN D 1 141 ? 14.103  58.996  65.331 1.00 70.66 ? 794  ASN D ND2 1 
ATOM   9767  N  N   . PRO D 1 142 ? 14.489  60.273  70.415 1.00 72.83 ? 795  PRO D N   1 
ATOM   9768  C  CA  . PRO D 1 142 ? 14.371  60.934  71.722 1.00 72.61 ? 795  PRO D CA  1 
ATOM   9769  C  C   . PRO D 1 142 ? 13.979  62.415  71.563 1.00 72.53 ? 795  PRO D C   1 
ATOM   9770  O  O   . PRO D 1 142 ? 13.002  62.878  72.168 1.00 72.55 ? 795  PRO D O   1 
ATOM   9771  C  CB  . PRO D 1 142 ? 15.775  60.775  72.316 1.00 72.76 ? 795  PRO D CB  1 
ATOM   9772  C  CG  . PRO D 1 142 ? 16.225  59.443  71.747 1.00 72.65 ? 795  PRO D CG  1 
ATOM   9773  C  CD  . PRO D 1 142 ? 15.764  59.531  70.302 1.00 73.00 ? 795  PRO D CD  1 
ATOM   9774  N  N   . ASP D 1 143 ? 14.725  63.141  70.729 1.00 72.03 ? 796  ASP D N   1 
ATOM   9775  C  CA  . ASP D 1 143 ? 14.456  64.556  70.535 1.00 71.51 ? 796  ASP D CA  1 
ATOM   9776  C  C   . ASP D 1 143 ? 14.950  65.180  69.233 1.00 71.54 ? 796  ASP D C   1 
ATOM   9777  O  O   . ASP D 1 143 ? 14.659  64.690  68.126 1.00 71.35 ? 796  ASP D O   1 
ATOM   9778  C  CB  . ASP D 1 143 ? 15.025  65.338  71.719 1.00 71.75 ? 796  ASP D CB  1 
ATOM   9779  C  CG  . ASP D 1 143 ? 16.320  64.748  72.247 1.00 71.19 ? 796  ASP D CG  1 
ATOM   9780  O  OD1 . ASP D 1 143 ? 17.310  64.679  71.483 1.00 71.95 ? 796  ASP D OD1 1 
ATOM   9781  O  OD2 . ASP D 1 143 ? 16.342  64.351  73.432 1.00 70.79 ? 796  ASP D OD2 1 
ATOM   9782  N  N   . GLU D 1 144 ? 15.673  66.290  69.376 1.00 70.91 ? 797  GLU D N   1 
ATOM   9783  C  CA  . GLU D 1 144 ? 16.204  67.009  68.219 1.00 70.68 ? 797  GLU D CA  1 
ATOM   9784  C  C   . GLU D 1 144 ? 17.679  66.681  68.020 1.00 70.46 ? 797  GLU D C   1 
ATOM   9785  O  O   . GLU D 1 144 ? 18.202  66.842  66.920 1.00 69.73 ? 797  GLU D O   1 
ATOM   9786  C  CB  . GLU D 1 144 ? 16.013  68.532  68.400 1.00 69.32 ? 797  GLU D CB  1 
ATOM   9787  N  N   . SER D 1 145 ? 18.348  66.229  69.081 1.00 70.54 ? 798  SER D N   1 
ATOM   9788  C  CA  . SER D 1 145 ? 19.769  65.877  68.979 1.00 70.80 ? 798  SER D CA  1 
ATOM   9789  C  C   . SER D 1 145 ? 19.960  64.495  68.324 1.00 70.86 ? 798  SER D C   1 
ATOM   9790  O  O   . SER D 1 145 ? 21.084  64.027  68.161 1.00 71.05 ? 798  SER D O   1 
ATOM   9791  C  CB  . SER D 1 145 ? 20.451  65.924  70.359 1.00 69.53 ? 798  SER D CB  1 
ATOM   9792  O  OG  . SER D 1 145 ? 19.691  65.247  71.346 1.00 67.75 ? 798  SER D OG  1 
ATOM   9793  N  N   . TYR D 1 146 ? 18.848  63.861  67.952 1.00 71.00 ? 799  TYR D N   1 
ATOM   9794  C  CA  . TYR D 1 146 ? 18.871  62.561  67.290 1.00 71.29 ? 799  TYR D CA  1 
ATOM   9795  C  C   . TYR D 1 146 ? 18.263  62.678  65.897 1.00 71.74 ? 799  TYR D C   1 
ATOM   9796  O  O   . TYR D 1 146 ? 17.736  63.729  65.518 1.00 72.05 ? 799  TYR D O   1 
ATOM   9797  C  CB  . TYR D 1 146 ? 18.074  61.512  68.070 1.00 71.01 ? 799  TYR D CB  1 
ATOM   9798  C  CG  . TYR D 1 146 ? 18.752  61.003  69.320 1.00 71.74 ? 799  TYR D CG  1 
ATOM   9799  C  CD1 . TYR D 1 146 ? 18.663  61.708  70.531 1.00 71.91 ? 799  TYR D CD1 1 
ATOM   9800  C  CD2 . TYR D 1 146 ? 19.461  59.802  69.306 1.00 71.39 ? 799  TYR D CD2 1 
ATOM   9801  C  CE1 . TYR D 1 146 ? 19.260  61.222  71.702 1.00 71.13 ? 799  TYR D CE1 1 
ATOM   9802  C  CE2 . TYR D 1 146 ? 20.064  59.308  70.472 1.00 72.75 ? 799  TYR D CE2 1 
ATOM   9803  C  CZ  . TYR D 1 146 ? 19.959  60.023  71.665 1.00 71.78 ? 799  TYR D CZ  1 
ATOM   9804  O  OH  . TYR D 1 146 ? 20.567  59.540  72.804 1.00 71.35 ? 799  TYR D OH  1 
ATOM   9805  N  N   . GLY D 1 147 ? 18.335  61.577  65.149 1.00 71.97 ? 800  GLY D N   1 
ATOM   9806  C  CA  . GLY D 1 147 ? 17.796  61.529  63.802 1.00 71.71 ? 800  GLY D CA  1 
ATOM   9807  C  C   . GLY D 1 147 ? 18.124  60.198  63.147 1.00 71.31 ? 800  GLY D C   1 
ATOM   9808  O  O   . GLY D 1 147 ? 19.296  59.827  63.058 1.00 71.71 ? 800  GLY D O   1 
ATOM   9809  N  N   . CYS D 1 148 ? 17.100  59.477  62.697 1.00 69.94 ? 801  CYS D N   1 
ATOM   9810  C  CA  . CYS D 1 148 ? 17.304  58.193  62.043 1.00 69.88 ? 801  CYS D CA  1 
ATOM   9811  C  C   . CYS D 1 148 ? 17.488  58.321  60.517 1.00 69.18 ? 801  CYS D C   1 
ATOM   9812  O  O   . CYS D 1 148 ? 17.305  59.407  59.938 1.00 69.96 ? 801  CYS D O   1 
ATOM   9813  C  CB  . CYS D 1 148 ? 16.139  57.258  62.371 1.00 70.67 ? 801  CYS D CB  1 
ATOM   9814  S  SG  . CYS D 1 148 ? 14.531  58.025  62.239 1.00 74.40 ? 801  CYS D SG  1 
ATOM   9815  N  N   . LEU D 1 149 ? 17.861  57.220  59.865 1.00 67.09 ? 802  LEU D N   1 
ATOM   9816  C  CA  . LEU D 1 149 ? 18.071  57.243  58.423 1.00 64.79 ? 802  LEU D CA  1 
ATOM   9817  C  C   . LEU D 1 149 ? 16.762  57.203  57.652 1.00 63.74 ? 802  LEU D C   1 
ATOM   9818  O  O   . LEU D 1 149 ? 16.698  57.692  56.523 1.00 63.41 ? 802  LEU D O   1 
ATOM   9819  C  CB  . LEU D 1 149 ? 18.971  56.072  57.977 1.00 64.79 ? 802  LEU D CB  1 
ATOM   9820  C  CG  . LEU D 1 149 ? 20.482  56.219  58.244 1.00 64.84 ? 802  LEU D CG  1 
ATOM   9821  C  CD1 . LEU D 1 149 ? 21.244  54.977  57.778 1.00 63.87 ? 802  LEU D CD1 1 
ATOM   9822  C  CD2 . LEU D 1 149 ? 21.000  57.449  57.511 1.00 64.66 ? 802  LEU D CD2 1 
ATOM   9823  N  N   . SER D 1 150 ? 15.722  56.638  58.264 1.00 62.45 ? 803  SER D N   1 
ATOM   9824  C  CA  . SER D 1 150 ? 14.403  56.511  57.632 1.00 61.22 ? 803  SER D CA  1 
ATOM   9825  C  C   . SER D 1 150 ? 13.741  57.864  57.288 1.00 61.21 ? 803  SER D C   1 
ATOM   9826  O  O   . SER D 1 150 ? 12.737  57.920  56.572 1.00 60.01 ? 803  SER D O   1 
ATOM   9827  C  CB  . SER D 1 150 ? 13.482  55.678  58.545 1.00 61.32 ? 803  SER D CB  1 
ATOM   9828  O  OG  . SER D 1 150 ? 13.590  56.078  59.911 1.00 60.67 ? 803  SER D OG  1 
ATOM   9829  N  N   . SER D 1 151 ? 14.329  58.946  57.792 1.00 60.71 ? 804  SER D N   1 
ATOM   9830  C  CA  . SER D 1 151 ? 13.827  60.288  57.546 1.00 60.67 ? 804  SER D CA  1 
ATOM   9831  C  C   . SER D 1 151 ? 14.658  61.037  56.497 1.00 60.52 ? 804  SER D C   1 
ATOM   9832  O  O   . SER D 1 151 ? 14.421  62.224  56.244 1.00 60.59 ? 804  SER D O   1 
ATOM   9833  C  CB  . SER D 1 151 ? 13.807  61.089  58.848 1.00 61.53 ? 804  SER D CB  1 
ATOM   9834  O  OG  . SER D 1 151 ? 12.936  60.498  59.819 1.00 62.85 ? 804  SER D OG  1 
ATOM   9835  N  N   . ASN D 1 152 ? 15.637  60.354  55.901 1.00 59.55 ? 805  ASN D N   1 
ATOM   9836  C  CA  . ASN D 1 152 ? 16.468  60.944  54.857 1.00 58.33 ? 805  ASN D CA  1 
ATOM   9837  C  C   . ASN D 1 152 ? 16.549  60.047  53.617 1.00 57.41 ? 805  ASN D C   1 
ATOM   9838  O  O   . ASN D 1 152 ? 17.291  60.344  52.676 1.00 56.62 ? 805  ASN D O   1 
ATOM   9839  C  CB  . ASN D 1 152 ? 17.877  61.234  55.375 1.00 59.09 ? 805  ASN D CB  1 
ATOM   9840  C  CG  . ASN D 1 152 ? 17.913  62.393  56.355 1.00 59.86 ? 805  ASN D CG  1 
ATOM   9841  O  OD1 . ASN D 1 152 ? 18.987  62.862  56.746 1.00 60.70 ? 805  ASN D OD1 1 
ATOM   9842  N  ND2 . ASN D 1 152 ? 16.742  62.860  56.760 1.00 60.17 ? 805  ASN D ND2 1 
ATOM   9843  N  N   . ILE D 1 153 ? 15.786  58.954  53.622 1.00 57.33 ? 806  ILE D N   1 
ATOM   9844  C  CA  . ILE D 1 153 ? 15.757  58.011  52.494 1.00 58.19 ? 806  ILE D CA  1 
ATOM   9845  C  C   . ILE D 1 153 ? 14.347  57.479  52.279 1.00 57.64 ? 806  ILE D C   1 
ATOM   9846  O  O   . ILE D 1 153 ? 13.783  56.794  53.142 1.00 57.96 ? 806  ILE D O   1 
ATOM   9847  C  CB  . ILE D 1 153 ? 16.689  56.763  52.723 1.00 59.41 ? 806  ILE D CB  1 
ATOM   9848  C  CG1 . ILE D 1 153 ? 18.149  57.200  52.852 1.00 58.41 ? 806  ILE D CG1 1 
ATOM   9849  C  CG2 . ILE D 1 153 ? 16.539  55.756  51.558 1.00 58.93 ? 806  ILE D CG2 1 
ATOM   9850  C  CD1 . ILE D 1 153 ? 19.042  56.103  53.410 1.00 58.82 ? 806  ILE D CD1 1 
ATOM   9851  N  N   . PRO D 1 154 ? 13.761  57.779  51.117 1.00 58.14 ? 807  PRO D N   1 
ATOM   9852  C  CA  . PRO D 1 154 ? 12.407  57.325  50.790 1.00 57.54 ? 807  PRO D CA  1 
ATOM   9853  C  C   . PRO D 1 154 ? 12.151  55.836  50.963 1.00 57.52 ? 807  PRO D C   1 
ATOM   9854  O  O   . PRO D 1 154 ? 13.043  55.014  50.763 1.00 58.14 ? 807  PRO D O   1 
ATOM   9855  C  CB  . PRO D 1 154 ? 12.224  57.779  49.338 1.00 57.39 ? 807  PRO D CB  1 
ATOM   9856  C  CG  . PRO D 1 154 ? 13.622  58.001  48.838 1.00 56.55 ? 807  PRO D CG  1 
ATOM   9857  C  CD  . PRO D 1 154 ? 14.312  58.599  50.027 1.00 57.55 ? 807  PRO D CD  1 
ATOM   9858  N  N   . ALA D 1 155 ? 10.913  55.516  51.326 1.00 56.74 ? 808  ALA D N   1 
ATOM   9859  C  CA  . ALA D 1 155 ? 10.456  54.144  51.542 1.00 56.26 ? 808  ALA D CA  1 
ATOM   9860  C  C   . ALA D 1 155 ? 10.872  53.193  50.448 1.00 55.68 ? 808  ALA D C   1 
ATOM   9861  O  O   . ALA D 1 155 ? 11.358  52.098  50.711 1.00 57.33 ? 808  ALA D O   1 
ATOM   9862  C  CB  . ALA D 1 155 ? 8.945   54.109  51.667 1.00 54.83 ? 808  ALA D CB  1 
ATOM   9863  N  N   . LEU D 1 156 ? 10.641  53.605  49.215 1.00 54.55 ? 809  LEU D N   1 
ATOM   9864  C  CA  . LEU D 1 156 ? 10.968  52.784  48.072 1.00 53.68 ? 809  LEU D CA  1 
ATOM   9865  C  C   . LEU D 1 156 ? 12.448  52.374  48.131 1.00 54.02 ? 809  LEU D C   1 
ATOM   9866  O  O   . LEU D 1 156 ? 12.788  51.221  47.882 1.00 53.27 ? 809  LEU D O   1 
ATOM   9867  C  CB  . LEU D 1 156 ? 10.676  53.574  46.787 1.00 50.77 ? 809  LEU D CB  1 
ATOM   9868  C  CG  . LEU D 1 156 ? 10.864  52.835  45.468 1.00 50.01 ? 809  LEU D CG  1 
ATOM   9869  C  CD1 . LEU D 1 156 ? 9.723   51.835  45.240 1.00 48.52 ? 809  LEU D CD1 1 
ATOM   9870  C  CD2 . LEU D 1 156 ? 10.945  53.851  44.345 1.00 50.80 ? 809  LEU D CD2 1 
ATOM   9871  N  N   . GLU D 1 157 ? 13.307  53.338  48.464 1.00 54.62 ? 810  GLU D N   1 
ATOM   9872  C  CA  . GLU D 1 157 ? 14.750  53.124  48.541 1.00 55.21 ? 810  GLU D CA  1 
ATOM   9873  C  C   . GLU D 1 157 ? 15.107  52.191  49.708 1.00 56.05 ? 810  GLU D C   1 
ATOM   9874  O  O   . GLU D 1 157 ? 15.801  51.187  49.507 1.00 56.22 ? 810  GLU D O   1 
ATOM   9875  C  CB  . GLU D 1 157 ? 15.486  54.479  48.652 1.00 54.65 ? 810  GLU D CB  1 
ATOM   9876  C  CG  . GLU D 1 157 ? 15.600  55.273  47.309 1.00 54.65 ? 810  GLU D CG  1 
ATOM   9877  C  CD  . GLU D 1 157 ? 16.311  56.636  47.447 1.00 55.27 ? 810  GLU D CD  1 
ATOM   9878  O  OE1 . GLU D 1 157 ? 17.235  56.753  48.262 1.00 56.98 ? 810  GLU D OE1 1 
ATOM   9879  O  OE2 . GLU D 1 157 ? 15.960  57.597  46.729 1.00 56.78 ? 810  GLU D OE2 1 
ATOM   9880  N  N   . LEU D 1 158 ? 14.631  52.506  50.915 1.00 55.71 ? 811  LEU D N   1 
ATOM   9881  C  CA  . LEU D 1 158 ? 14.900  51.641  52.055 1.00 55.41 ? 811  LEU D CA  1 
ATOM   9882  C  C   . LEU D 1 158 ? 14.226  50.305  51.800 1.00 55.40 ? 811  LEU D C   1 
ATOM   9883  O  O   . LEU D 1 158 ? 14.782  49.262  52.128 1.00 58.08 ? 811  LEU D O   1 
ATOM   9884  C  CB  . LEU D 1 158 ? 14.401  52.245  53.371 1.00 54.73 ? 811  LEU D CB  1 
ATOM   9885  C  CG  . LEU D 1 158 ? 15.135  53.534  53.777 1.00 55.09 ? 811  LEU D CG  1 
ATOM   9886  C  CD1 . LEU D 1 158 ? 14.812  53.879  55.219 1.00 54.40 ? 811  LEU D CD1 1 
ATOM   9887  C  CD2 . LEU D 1 158 ? 16.648  53.361  53.613 1.00 55.40 ? 811  LEU D CD2 1 
ATOM   9888  N  N   . MET D 1 159 ? 13.049  50.304  51.195 1.00 53.79 ? 812  MET D N   1 
ATOM   9889  C  CA  . MET D 1 159 ? 12.416  49.025  50.922 1.00 52.31 ? 812  MET D CA  1 
ATOM   9890  C  C   . MET D 1 159 ? 13.236  48.216  49.915 1.00 51.54 ? 812  MET D C   1 
ATOM   9891  O  O   . MET D 1 159 ? 13.148  46.982  49.875 1.00 51.30 ? 812  MET D O   1 
ATOM   9892  C  CB  . MET D 1 159 ? 11.001  49.189  50.376 1.00 52.22 ? 812  MET D CB  1 
ATOM   9893  C  CG  . MET D 1 159 ? 10.480  47.860  49.822 1.00 51.83 ? 812  MET D CG  1 
ATOM   9894  S  SD  . MET D 1 159 ? 8.733   47.862  49.508 1.00 53.89 ? 812  MET D SD  1 
ATOM   9895  C  CE  . MET D 1 159 ? 8.716   49.006  48.011 1.00 50.28 ? 812  MET D CE  1 
ATOM   9896  N  N   . ALA D 1 160 ? 14.023  48.891  49.084 1.00 50.76 ? 813  ALA D N   1 
ATOM   9897  C  CA  . ALA D 1 160 ? 14.823  48.139  48.120 1.00 51.79 ? 813  ALA D CA  1 
ATOM   9898  C  C   . ALA D 1 160 ? 15.857  47.352  48.966 1.00 52.09 ? 813  ALA D C   1 
ATOM   9899  O  O   . ALA D 1 160 ? 15.963  46.119  48.886 1.00 50.76 ? 813  ALA D O   1 
ATOM   9900  C  CB  . ALA D 1 160 ? 15.511  49.094  47.144 1.00 49.60 ? 813  ALA D CB  1 
ATOM   9901  N  N   . LEU D 1 161 ? 16.567  48.098  49.807 1.00 52.05 ? 814  LEU D N   1 
ATOM   9902  C  CA  . LEU D 1 161 ? 17.566  47.569  50.720 1.00 53.85 ? 814  LEU D CA  1 
ATOM   9903  C  C   . LEU D 1 161 ? 17.084  46.299  51.446 1.00 53.79 ? 814  LEU D C   1 
ATOM   9904  O  O   . LEU D 1 161 ? 17.763  45.283  51.430 1.00 56.03 ? 814  LEU D O   1 
ATOM   9905  C  CB  . LEU D 1 161 ? 17.917  48.655  51.742 1.00 53.76 ? 814  LEU D CB  1 
ATOM   9906  C  CG  . LEU D 1 161 ? 19.159  48.464  52.599 1.00 52.92 ? 814  LEU D CG  1 
ATOM   9907  C  CD1 . LEU D 1 161 ? 20.375  48.239  51.707 1.00 52.26 ? 814  LEU D CD1 1 
ATOM   9908  C  CD2 . LEU D 1 161 ? 19.354  49.690  53.465 1.00 52.17 ? 814  LEU D CD2 1 
ATOM   9909  N  N   . TYR D 1 162 ? 15.908  46.361  52.060 1.00 53.26 ? 815  TYR D N   1 
ATOM   9910  C  CA  . TYR D 1 162 ? 15.341  45.228  52.787 1.00 51.41 ? 815  TYR D CA  1 
ATOM   9911  C  C   . TYR D 1 162 ? 15.088  44.046  51.888 1.00 50.49 ? 815  TYR D C   1 
ATOM   9912  O  O   . TYR D 1 162 ? 15.262  42.890  52.279 1.00 51.40 ? 815  TYR D O   1 
ATOM   9913  C  CB  . TYR D 1 162 ? 14.029  45.635  53.472 1.00 49.72 ? 815  TYR D CB  1 
ATOM   9914  C  CG  . TYR D 1 162 ? 14.202  46.798  54.427 1.00 49.92 ? 815  TYR D CG  1 
ATOM   9915  C  CD1 . TYR D 1 162 ? 13.115  47.352  55.091 1.00 50.15 ? 815  TYR D CD1 1 
ATOM   9916  C  CD2 . TYR D 1 162 ? 15.451  47.375  54.629 1.00 49.10 ? 815  TYR D CD2 1 
ATOM   9917  C  CE1 . TYR D 1 162 ? 13.269  48.452  55.924 1.00 50.45 ? 815  TYR D CE1 1 
ATOM   9918  C  CE2 . TYR D 1 162 ? 15.614  48.466  55.451 1.00 51.10 ? 815  TYR D CE2 1 
ATOM   9919  C  CZ  . TYR D 1 162 ? 14.526  49.005  56.097 1.00 51.48 ? 815  TYR D CZ  1 
ATOM   9920  O  OH  . TYR D 1 162 ? 14.709  50.105  56.911 1.00 53.68 ? 815  TYR D OH  1 
ATOM   9921  N  N   . VAL D 1 163 ? 14.677  44.320  50.667 1.00 49.81 ? 816  VAL D N   1 
ATOM   9922  C  CA  . VAL D 1 163 ? 14.403  43.227  49.755 1.00 49.38 ? 816  VAL D CA  1 
ATOM   9923  C  C   . VAL D 1 163 ? 15.686  42.547  49.289 1.00 48.32 ? 816  VAL D C   1 
ATOM   9924  O  O   . VAL D 1 163 ? 15.708  41.334  49.119 1.00 46.66 ? 816  VAL D O   1 
ATOM   9925  C  CB  . VAL D 1 163 ? 13.620  43.731  48.540 1.00 48.74 ? 816  VAL D CB  1 
ATOM   9926  C  CG1 . VAL D 1 163 ? 13.387  42.570  47.546 1.00 48.30 ? 816  VAL D CG1 1 
ATOM   9927  C  CG2 . VAL D 1 163 ? 12.290  44.324  49.026 1.00 48.31 ? 816  VAL D CG2 1 
ATOM   9928  N  N   . ALA D 1 164 ? 16.732  43.355  49.094 1.00 47.36 ? 817  ALA D N   1 
ATOM   9929  C  CA  . ALA D 1 164 ? 18.029  42.894  48.632 1.00 48.57 ? 817  ALA D CA  1 
ATOM   9930  C  C   . ALA D 1 164 ? 18.658  41.992  49.701 1.00 49.68 ? 817  ALA D C   1 
ATOM   9931  O  O   . ALA D 1 164 ? 19.094  40.859  49.413 1.00 48.53 ? 817  ALA D O   1 
ATOM   9932  C  CB  . ALA D 1 164 ? 18.939  44.096  48.335 1.00 46.38 ? 817  ALA D CB  1 
ATOM   9933  N  N   . ALA D 1 165 ? 18.692  42.510  50.930 1.00 48.96 ? 818  ALA D N   1 
ATOM   9934  C  CA  . ALA D 1 165 ? 19.217  41.768  52.065 1.00 49.62 ? 818  ALA D CA  1 
ATOM   9935  C  C   . ALA D 1 165 ? 18.541  40.404  52.039 1.00 49.82 ? 818  ALA D C   1 
ATOM   9936  O  O   . ALA D 1 165 ? 19.185  39.347  52.144 1.00 50.06 ? 818  ALA D O   1 
ATOM   9937  C  CB  . ALA D 1 165 ? 18.885  42.493  53.364 1.00 48.18 ? 818  ALA D CB  1 
ATOM   9938  N  N   . ALA D 1 166 ? 17.235  40.429  51.842 1.00 49.05 ? 819  ALA D N   1 
ATOM   9939  C  CA  . ALA D 1 166 ? 16.485  39.200  51.811 1.00 49.53 ? 819  ALA D CA  1 
ATOM   9940  C  C   . ALA D 1 166 ? 16.816  38.300  50.619 1.00 49.63 ? 819  ALA D C   1 
ATOM   9941  O  O   . ALA D 1 166 ? 16.374  37.154  50.567 1.00 50.87 ? 819  ALA D O   1 
ATOM   9942  C  CB  . ALA D 1 166 ? 15.005  39.516  51.850 1.00 48.84 ? 819  ALA D CB  1 
ATOM   9943  N  N   . MET D 1 167 ? 17.579  38.790  49.648 1.00 49.09 ? 820  MET D N   1 
ATOM   9944  C  CA  . MET D 1 167 ? 17.900  37.918  48.518 1.00 48.60 ? 820  MET D CA  1 
ATOM   9945  C  C   . MET D 1 167 ? 19.377  37.801  48.124 1.00 47.22 ? 820  MET D C   1 
ATOM   9946  O  O   . MET D 1 167 ? 19.724  36.934  47.330 1.00 45.18 ? 820  MET D O   1 
ATOM   9947  C  CB  . MET D 1 167 ? 17.053  38.296  47.280 1.00 52.60 ? 820  MET D CB  1 
ATOM   9948  C  CG  . MET D 1 167 ? 16.757  39.785  47.050 1.00 55.70 ? 820  MET D CG  1 
ATOM   9949  S  SD  . MET D 1 167 ? 15.921  40.169  45.418 1.00 59.74 ? 820  MET D SD  1 
ATOM   9950  C  CE  . MET D 1 167 ? 14.269  39.439  45.587 1.00 59.19 ? 820  MET D CE  1 
ATOM   9951  N  N   . HIS D 1 168 ? 20.226  38.645  48.720 1.00 45.56 ? 821  HIS D N   1 
ATOM   9952  C  CA  . HIS D 1 168 ? 21.652  38.719  48.444 1.00 44.58 ? 821  HIS D CA  1 
ATOM   9953  C  C   . HIS D 1 168 ? 22.537  37.454  48.454 1.00 43.94 ? 821  HIS D C   1 
ATOM   9954  O  O   . HIS D 1 168 ? 23.662  37.496  47.943 1.00 43.42 ? 821  HIS D O   1 
ATOM   9955  C  CB  . HIS D 1 168 ? 22.279  39.798  49.336 1.00 48.27 ? 821  HIS D CB  1 
ATOM   9956  C  CG  . HIS D 1 168 ? 22.757  39.299  50.669 1.00 50.76 ? 821  HIS D CG  1 
ATOM   9957  N  ND1 . HIS D 1 168 ? 22.070  38.354  51.398 1.00 51.73 ? 821  HIS D ND1 1 
ATOM   9958  C  CD2 . HIS D 1 168 ? 23.804  39.680  51.435 1.00 49.68 ? 821  HIS D CD2 1 
ATOM   9959  C  CE1 . HIS D 1 168 ? 22.669  38.178  52.561 1.00 51.81 ? 821  HIS D CE1 1 
ATOM   9960  N  NE2 . HIS D 1 168 ? 23.724  38.972  52.607 1.00 52.34 ? 821  HIS D NE2 1 
ATOM   9961  N  N   . ASP D 1 169 ? 22.075  36.349  49.038 1.00 41.37 ? 822  ASP D N   1 
ATOM   9962  C  CA  . ASP D 1 169 ? 22.868  35.124  48.978 1.00 40.59 ? 822  ASP D CA  1 
ATOM   9963  C  C   . ASP D 1 169 ? 22.035  33.958  48.501 1.00 41.09 ? 822  ASP D C   1 
ATOM   9964  O  O   . ASP D 1 169 ? 22.407  32.797  48.684 1.00 42.38 ? 822  ASP D O   1 
ATOM   9965  C  CB  . ASP D 1 169 ? 23.567  34.802  50.322 1.00 36.66 ? 822  ASP D CB  1 
ATOM   9966  C  CG  . ASP D 1 169 ? 24.816  35.641  50.531 1.00 34.63 ? 822  ASP D CG  1 
ATOM   9967  O  OD1 . ASP D 1 169 ? 25.577  35.781  49.545 1.00 33.31 ? 822  ASP D OD1 1 
ATOM   9968  O  OD2 . ASP D 1 169 ? 25.047  36.162  51.650 1.00 32.02 ? 822  ASP D OD2 1 
ATOM   9969  N  N   . TYR D 1 170 ? 20.918  34.284  47.863 1.00 41.16 ? 823  TYR D N   1 
ATOM   9970  C  CA  . TYR D 1 170 ? 19.992  33.286  47.325 1.00 42.13 ? 823  TYR D CA  1 
ATOM   9971  C  C   . TYR D 1 170 ? 20.746  32.168  46.580 1.00 43.82 ? 823  TYR D C   1 
ATOM   9972  O  O   . TYR D 1 170 ? 21.620  32.440  45.750 1.00 44.94 ? 823  TYR D O   1 
ATOM   9973  C  CB  . TYR D 1 170 ? 18.983  33.974  46.365 1.00 40.56 ? 823  TYR D CB  1 
ATOM   9974  C  CG  . TYR D 1 170 ? 17.938  33.038  45.772 1.00 37.92 ? 823  TYR D CG  1 
ATOM   9975  C  CD1 . TYR D 1 170 ? 16.933  32.491  46.573 1.00 37.74 ? 823  TYR D CD1 1 
ATOM   9976  C  CD2 . TYR D 1 170 ? 17.994  32.637  44.439 1.00 36.56 ? 823  TYR D CD2 1 
ATOM   9977  C  CE1 . TYR D 1 170 ? 16.008  31.558  46.060 1.00 37.25 ? 823  TYR D CE1 1 
ATOM   9978  C  CE2 . TYR D 1 170 ? 17.066  31.696  43.919 1.00 36.24 ? 823  TYR D CE2 1 
ATOM   9979  C  CZ  . TYR D 1 170 ? 16.083  31.166  44.736 1.00 36.63 ? 823  TYR D CZ  1 
ATOM   9980  O  OH  . TYR D 1 170 ? 15.169  30.239  44.256 1.00 40.28 ? 823  TYR D OH  1 
ATOM   9981  N  N   . ASP D 1 171 ? 20.400  30.914  46.868 1.00 45.31 ? 824  ASP D N   1 
ATOM   9982  C  CA  . ASP D 1 171 ? 21.036  29.755  46.222 1.00 45.75 ? 824  ASP D CA  1 
ATOM   9983  C  C   . ASP D 1 171 ? 22.585  29.743  46.218 1.00 45.44 ? 824  ASP D C   1 
ATOM   9984  O  O   . ASP D 1 171 ? 23.201  29.331  45.234 1.00 46.15 ? 824  ASP D O   1 
ATOM   9985  C  CB  . ASP D 1 171 ? 20.519  29.632  44.785 1.00 47.15 ? 824  ASP D CB  1 
ATOM   9986  C  CG  . ASP D 1 171 ? 20.900  28.309  44.130 1.00 48.05 ? 824  ASP D CG  1 
ATOM   9987  O  OD1 . ASP D 1 171 ? 20.696  27.271  44.766 1.00 50.63 ? 824  ASP D OD1 1 
ATOM   9988  O  OD2 . ASP D 1 171 ? 21.379  28.295  42.972 1.00 49.44 ? 824  ASP D OD2 1 
ATOM   9989  N  N   . HIS D 1 172 ? 23.205  30.204  47.308 1.00 45.02 ? 825  HIS D N   1 
ATOM   9990  C  CA  . HIS D 1 172 ? 24.667  30.232  47.447 1.00 43.90 ? 825  HIS D CA  1 
ATOM   9991  C  C   . HIS D 1 172 ? 25.162  28.774  47.541 1.00 43.71 ? 825  HIS D C   1 
ATOM   9992  O  O   . HIS D 1 172 ? 24.615  27.971  48.285 1.00 43.18 ? 825  HIS D O   1 
ATOM   9993  C  CB  . HIS D 1 172 ? 25.032  30.998  48.708 1.00 43.94 ? 825  HIS D CB  1 
ATOM   9994  C  CG  . HIS D 1 172 ? 26.454  31.454  48.763 1.00 44.66 ? 825  HIS D CG  1 
ATOM   9995  N  ND1 . HIS D 1 172 ? 27.521  30.590  48.639 1.00 46.39 ? 825  HIS D ND1 1 
ATOM   9996  C  CD2 . HIS D 1 172 ? 26.986  32.677  48.998 1.00 45.11 ? 825  HIS D CD2 1 
ATOM   9997  C  CE1 . HIS D 1 172 ? 28.650  31.263  48.799 1.00 47.33 ? 825  HIS D CE1 1 
ATOM   9998  N  NE2 . HIS D 1 172 ? 28.352  32.533  49.019 1.00 46.53 ? 825  HIS D NE2 1 
ATOM   9999  N  N   . PRO D 1 173 ? 26.196  28.414  46.774 1.00 43.39 ? 826  PRO D N   1 
ATOM   10000 C  CA  . PRO D 1 173 ? 26.736  27.053  46.776 1.00 44.13 ? 826  PRO D CA  1 
ATOM   10001 C  C   . PRO D 1 173 ? 27.746  26.776  47.901 1.00 45.50 ? 826  PRO D C   1 
ATOM   10002 O  O   . PRO D 1 173 ? 28.212  25.646  48.072 1.00 47.68 ? 826  PRO D O   1 
ATOM   10003 C  CB  . PRO D 1 173 ? 27.371  26.962  45.408 1.00 43.79 ? 826  PRO D CB  1 
ATOM   10004 C  CG  . PRO D 1 173 ? 27.984  28.352  45.289 1.00 43.78 ? 826  PRO D CG  1 
ATOM   10005 C  CD  . PRO D 1 173 ? 26.915  29.273  45.815 1.00 41.94 ? 826  PRO D CD  1 
ATOM   10006 N  N   . GLY D 1 174 ? 28.090  27.806  48.664 1.00 44.66 ? 827  GLY D N   1 
ATOM   10007 C  CA  . GLY D 1 174 ? 29.022  27.597  49.742 1.00 44.49 ? 827  GLY D CA  1 
ATOM   10008 C  C   . GLY D 1 174 ? 30.451  27.628  49.261 1.00 45.06 ? 827  GLY D C   1 
ATOM   10009 O  O   . GLY D 1 174 ? 31.350  27.076  49.901 1.00 46.67 ? 827  GLY D O   1 
ATOM   10010 N  N   . ARG D 1 175 ? 30.667  28.271  48.124 1.00 42.97 ? 828  ARG D N   1 
ATOM   10011 C  CA  . ARG D 1 175 ? 31.996  28.380  47.564 1.00 40.61 ? 828  ARG D CA  1 
ATOM   10012 C  C   . ARG D 1 175 ? 32.268  29.834  47.256 1.00 41.01 ? 828  ARG D C   1 
ATOM   10013 O  O   . ARG D 1 175 ? 31.345  30.659  47.242 1.00 42.84 ? 828  ARG D O   1 
ATOM   10014 C  CB  . ARG D 1 175 ? 32.098  27.528  46.306 1.00 40.98 ? 828  ARG D CB  1 
ATOM   10015 C  CG  . ARG D 1 175 ? 31.876  26.036  46.554 1.00 41.81 ? 828  ARG D CG  1 
ATOM   10016 C  CD  . ARG D 1 175 ? 33.036  25.407  47.339 1.00 43.35 ? 828  ARG D CD  1 
ATOM   10017 N  NE  . ARG D 1 175 ? 32.863  23.960  47.545 1.00 43.85 ? 828  ARG D NE  1 
ATOM   10018 C  CZ  . ARG D 1 175 ? 32.128  23.407  48.513 1.00 43.55 ? 828  ARG D CZ  1 
ATOM   10019 N  NH1 . ARG D 1 175 ? 31.484  24.174  49.393 1.00 42.97 ? 828  ARG D NH1 1 
ATOM   10020 N  NH2 . ARG D 1 175 ? 32.023  22.084  48.589 1.00 41.87 ? 828  ARG D NH2 1 
ATOM   10021 N  N   . THR D 1 176 ? 33.532  30.167  47.032 1.00 40.00 ? 829  THR D N   1 
ATOM   10022 C  CA  . THR D 1 176 ? 33.891  31.548  46.734 1.00 40.98 ? 829  THR D CA  1 
ATOM   10023 C  C   . THR D 1 176 ? 33.874  31.805  45.240 1.00 40.28 ? 829  THR D C   1 
ATOM   10024 O  O   . THR D 1 176 ? 33.734  30.873  44.442 1.00 42.36 ? 829  THR D O   1 
ATOM   10025 C  CB  . THR D 1 176 ? 35.293  31.883  47.236 1.00 40.34 ? 829  THR D CB  1 
ATOM   10026 O  OG1 . THR D 1 176 ? 36.233  30.983  46.625 1.00 41.93 ? 829  THR D OG1 1 
ATOM   10027 C  CG2 . THR D 1 176 ? 35.358  31.795  48.765 1.00 40.02 ? 829  THR D CG2 1 
ATOM   10028 N  N   . ASN D 1 177 ? 34.022  33.068  44.859 1.00 39.71 ? 830  ASN D N   1 
ATOM   10029 C  CA  . ASN D 1 177 ? 34.047  33.408  43.438 1.00 38.34 ? 830  ASN D CA  1 
ATOM   10030 C  C   . ASN D 1 177 ? 35.324  32.799  42.886 1.00 38.60 ? 830  ASN D C   1 
ATOM   10031 O  O   . ASN D 1 177 ? 35.294  32.078  41.882 1.00 40.03 ? 830  ASN D O   1 
ATOM   10032 C  CB  . ASN D 1 177 ? 34.030  34.925  43.234 1.00 34.42 ? 830  ASN D CB  1 
ATOM   10033 C  CG  . ASN D 1 177 ? 32.612  35.492  43.256 1.00 32.56 ? 830  ASN D CG  1 
ATOM   10034 O  OD1 . ASN D 1 177 ? 31.685  34.853  42.777 1.00 33.93 ? 830  ASN D OD1 1 
ATOM   10035 N  ND2 . ASN D 1 177 ? 32.446  36.686  43.786 1.00 28.27 ? 830  ASN D ND2 1 
ATOM   10036 N  N   . ALA D 1 178 ? 36.438  33.067  43.571 1.00 37.45 ? 831  ALA D N   1 
ATOM   10037 C  CA  . ALA D 1 178 ? 37.753  32.532  43.183 1.00 35.66 ? 831  ALA D CA  1 
ATOM   10038 C  C   . ALA D 1 178 ? 37.666  31.041  42.896 1.00 34.05 ? 831  ALA D C   1 
ATOM   10039 O  O   . ALA D 1 178 ? 38.174  30.561  41.878 1.00 34.18 ? 831  ALA D O   1 
ATOM   10040 C  CB  . ALA D 1 178 ? 38.766  32.797  44.268 1.00 31.12 ? 831  ALA D CB  1 
ATOM   10041 N  N   . PHE D 1 179 ? 36.982  30.322  43.774 1.00 34.71 ? 832  PHE D N   1 
ATOM   10042 C  CA  . PHE D 1 179 ? 36.825  28.895  43.604 1.00 36.36 ? 832  PHE D CA  1 
ATOM   10043 C  C   . PHE D 1 179 ? 36.094  28.629  42.309 1.00 38.73 ? 832  PHE D C   1 
ATOM   10044 O  O   . PHE D 1 179 ? 36.583  27.912  41.443 1.00 40.01 ? 832  PHE D O   1 
ATOM   10045 C  CB  . PHE D 1 179 ? 36.022  28.294  44.755 1.00 35.34 ? 832  PHE D CB  1 
ATOM   10046 C  CG  . PHE D 1 179 ? 35.774  26.823  44.601 1.00 35.19 ? 832  PHE D CG  1 
ATOM   10047 C  CD1 . PHE D 1 179 ? 36.766  25.895  44.924 1.00 34.29 ? 832  PHE D CD1 1 
ATOM   10048 C  CD2 . PHE D 1 179 ? 34.559  26.358  44.111 1.00 34.54 ? 832  PHE D CD2 1 
ATOM   10049 C  CE1 . PHE D 1 179 ? 36.541  24.524  44.761 1.00 34.49 ? 832  PHE D CE1 1 
ATOM   10050 C  CE2 . PHE D 1 179 ? 34.324  24.998  43.945 1.00 33.42 ? 832  PHE D CE2 1 
ATOM   10051 C  CZ  . PHE D 1 179 ? 35.317  24.078  44.271 1.00 36.62 ? 832  PHE D CZ  1 
ATOM   10052 N  N   . LEU D 1 180 ? 34.906  29.218  42.185 1.00 40.55 ? 833  LEU D N   1 
ATOM   10053 C  CA  . LEU D 1 180 ? 34.051  29.068  41.004 1.00 39.38 ? 833  LEU D CA  1 
ATOM   10054 C  C   . LEU D 1 180 ? 34.781  29.310  39.682 1.00 38.95 ? 833  LEU D C   1 
ATOM   10055 O  O   . LEU D 1 180 ? 34.594  28.590  38.698 1.00 40.09 ? 833  LEU D O   1 
ATOM   10056 C  CB  . LEU D 1 180 ? 32.862  30.027  41.130 1.00 38.84 ? 833  LEU D CB  1 
ATOM   10057 C  CG  . LEU D 1 180 ? 31.851  29.609  42.192 1.00 36.65 ? 833  LEU D CG  1 
ATOM   10058 C  CD1 . LEU D 1 180 ? 30.796  30.680  42.365 1.00 36.88 ? 833  LEU D CD1 1 
ATOM   10059 C  CD2 . LEU D 1 180 ? 31.233  28.300  41.788 1.00 35.54 ? 833  LEU D CD2 1 
ATOM   10060 N  N   . VAL D 1 181 ? 35.607  30.338  39.670 1.00 38.20 ? 834  VAL D N   1 
ATOM   10061 C  CA  . VAL D 1 181 ? 36.359  30.671  38.490 1.00 39.38 ? 834  VAL D CA  1 
ATOM   10062 C  C   . VAL D 1 181 ? 37.433  29.602  38.253 1.00 40.97 ? 834  VAL D C   1 
ATOM   10063 O  O   . VAL D 1 181 ? 37.502  28.970  37.189 1.00 40.51 ? 834  VAL D O   1 
ATOM   10064 C  CB  . VAL D 1 181 ? 36.996  32.057  38.679 1.00 39.04 ? 834  VAL D CB  1 
ATOM   10065 C  CG1 . VAL D 1 181 ? 37.943  32.365  37.547 1.00 39.52 ? 834  VAL D CG1 1 
ATOM   10066 C  CG2 . VAL D 1 181 ? 35.900  33.113  38.758 1.00 38.18 ? 834  VAL D CG2 1 
ATOM   10067 N  N   . ALA D 1 182 ? 38.257  29.391  39.268 1.00 40.88 ? 835  ALA D N   1 
ATOM   10068 C  CA  . ALA D 1 182 ? 39.320  28.418  39.174 1.00 42.70 ? 835  ALA D CA  1 
ATOM   10069 C  C   . ALA D 1 182 ? 38.859  27.090  38.577 1.00 43.31 ? 835  ALA D C   1 
ATOM   10070 O  O   . ALA D 1 182 ? 39.582  26.489  37.790 1.00 46.45 ? 835  ALA D O   1 
ATOM   10071 C  CB  . ALA D 1 182 ? 39.934  28.201  40.546 1.00 42.47 ? 835  ALA D CB  1 
ATOM   10072 N  N   . THR D 1 183 ? 37.657  26.646  38.923 1.00 43.64 ? 836  THR D N   1 
ATOM   10073 C  CA  . THR D 1 183 ? 37.125  25.366  38.431 1.00 43.29 ? 836  THR D CA  1 
ATOM   10074 C  C   . THR D 1 183 ? 36.324  25.478  37.134 1.00 45.52 ? 836  THR D C   1 
ATOM   10075 O  O   . THR D 1 183 ? 35.693  24.501  36.704 1.00 45.35 ? 836  THR D O   1 
ATOM   10076 C  CB  . THR D 1 183 ? 36.180  24.710  39.489 1.00 42.66 ? 836  THR D CB  1 
ATOM   10077 O  OG1 . THR D 1 183 ? 35.262  25.699  39.976 1.00 40.09 ? 836  THR D OG1 1 
ATOM   10078 C  CG2 . THR D 1 183 ? 36.977  24.128  40.663 1.00 41.35 ? 836  THR D CG2 1 
ATOM   10079 N  N   . ASN D 1 184 ? 36.368  26.658  36.515 1.00 47.51 ? 837  ASN D N   1 
ATOM   10080 C  CA  . ASN D 1 184 ? 35.597  26.959  35.301 1.00 48.36 ? 837  ASN D CA  1 
ATOM   10081 C  C   . ASN D 1 184 ? 34.159  26.528  35.480 1.00 48.96 ? 837  ASN D C   1 
ATOM   10082 O  O   . ASN D 1 184 ? 33.550  26.005  34.548 1.00 49.74 ? 837  ASN D O   1 
ATOM   10083 C  CB  . ASN D 1 184 ? 36.149  26.274  34.038 1.00 50.31 ? 837  ASN D CB  1 
ATOM   10084 C  CG  . ASN D 1 184 ? 37.388  26.959  33.490 1.00 52.39 ? 837  ASN D CG  1 
ATOM   10085 O  OD1 . ASN D 1 184 ? 37.437  28.199  33.357 1.00 53.14 ? 837  ASN D OD1 1 
ATOM   10086 N  ND2 . ASN D 1 184 ? 38.400  26.155  33.150 1.00 53.26 ? 837  ASN D ND2 1 
ATOM   10087 N  N   . ALA D 1 185 ? 33.614  26.717  36.680 1.00 48.98 ? 838  ALA D N   1 
ATOM   10088 C  CA  . ALA D 1 185 ? 32.220  26.352  36.910 1.00 49.15 ? 838  ALA D CA  1 
ATOM   10089 C  C   . ALA D 1 185 ? 31.396  27.132  35.877 1.00 48.99 ? 838  ALA D C   1 
ATOM   10090 O  O   . ALA D 1 185 ? 31.761  28.258  35.500 1.00 47.98 ? 838  ALA D O   1 
ATOM   10091 C  CB  . ALA D 1 185 ? 31.796  26.737  38.330 1.00 47.35 ? 838  ALA D CB  1 
ATOM   10092 N  N   . PRO D 1 186 ? 30.296  26.535  35.388 1.00 49.15 ? 839  PRO D N   1 
ATOM   10093 C  CA  . PRO D 1 186 ? 29.415  27.167  34.399 1.00 48.79 ? 839  PRO D CA  1 
ATOM   10094 C  C   . PRO D 1 186 ? 29.022  28.608  34.735 1.00 48.91 ? 839  PRO D C   1 
ATOM   10095 O  O   . PRO D 1 186 ? 29.177  29.518  33.917 1.00 50.25 ? 839  PRO D O   1 
ATOM   10096 C  CB  . PRO D 1 186 ? 28.212  26.221  34.350 1.00 48.99 ? 839  PRO D CB  1 
ATOM   10097 C  CG  . PRO D 1 186 ? 28.361  25.342  35.583 1.00 50.78 ? 839  PRO D CG  1 
ATOM   10098 C  CD  . PRO D 1 186 ? 29.835  25.173  35.688 1.00 49.57 ? 839  PRO D CD  1 
ATOM   10099 N  N   . GLN D 1 187 ? 28.527  28.813  35.942 1.00 48.27 ? 840  GLN D N   1 
ATOM   10100 C  CA  . GLN D 1 187 ? 28.140  30.138  36.366 1.00 48.51 ? 840  GLN D CA  1 
ATOM   10101 C  C   . GLN D 1 187 ? 29.278  31.117  36.216 1.00 47.23 ? 840  GLN D C   1 
ATOM   10102 O  O   . GLN D 1 187 ? 29.060  32.324  36.065 1.00 46.64 ? 840  GLN D O   1 
ATOM   10103 C  CB  . GLN D 1 187 ? 27.702  30.119  37.822 1.00 51.00 ? 840  GLN D CB  1 
ATOM   10104 C  CG  . GLN D 1 187 ? 26.537  29.196  38.114 1.00 56.64 ? 840  GLN D CG  1 
ATOM   10105 C  CD  . GLN D 1 187 ? 26.162  29.201  39.603 1.00 61.78 ? 840  GLN D CD  1 
ATOM   10106 O  OE1 . GLN D 1 187 ? 25.998  30.272  40.221 1.00 63.30 ? 840  GLN D OE1 1 
ATOM   10107 N  NE2 . GLN D 1 187 ? 26.013  28.005  40.183 1.00 62.99 ? 840  GLN D NE2 1 
ATOM   10108 N  N   . ALA D 1 188 ? 30.505  30.617  36.265 1.00 46.04 ? 841  ALA D N   1 
ATOM   10109 C  CA  . ALA D 1 188 ? 31.645  31.514  36.154 1.00 45.55 ? 841  ALA D CA  1 
ATOM   10110 C  C   . ALA D 1 188 ? 31.866  31.863  34.685 1.00 44.38 ? 841  ALA D C   1 
ATOM   10111 O  O   . ALA D 1 188 ? 32.262  32.985  34.351 1.00 42.99 ? 841  ALA D O   1 
ATOM   10112 C  CB  . ALA D 1 188 ? 32.900  30.866  36.770 1.00 46.27 ? 841  ALA D CB  1 
ATOM   10113 N  N   . VAL D 1 189 ? 31.604  30.902  33.812 1.00 42.60 ? 842  VAL D N   1 
ATOM   10114 C  CA  . VAL D 1 189 ? 31.743  31.153  32.392 1.00 43.19 ? 842  VAL D CA  1 
ATOM   10115 C  C   . VAL D 1 189 ? 30.559  32.077  32.020 1.00 43.84 ? 842  VAL D C   1 
ATOM   10116 O  O   . VAL D 1 189 ? 30.737  33.156  31.450 1.00 42.61 ? 842  VAL D O   1 
ATOM   10117 C  CB  . VAL D 1 189 ? 31.692  29.834  31.602 1.00 42.67 ? 842  VAL D CB  1 
ATOM   10118 C  CG1 . VAL D 1 189 ? 31.870  30.108  30.117 1.00 41.44 ? 842  VAL D CG1 1 
ATOM   10119 C  CG2 . VAL D 1 189 ? 32.802  28.890  32.104 1.00 43.15 ? 842  VAL D CG2 1 
ATOM   10120 N  N   . LEU D 1 190 ? 29.362  31.656  32.403 1.00 43.03 ? 843  LEU D N   1 
ATOM   10121 C  CA  . LEU D 1 190 ? 28.164  32.425  32.143 1.00 42.75 ? 843  LEU D CA  1 
ATOM   10122 C  C   . LEU D 1 190 ? 28.361  33.911  32.448 1.00 42.75 ? 843  LEU D C   1 
ATOM   10123 O  O   . LEU D 1 190 ? 27.910  34.777  31.689 1.00 43.02 ? 843  LEU D O   1 
ATOM   10124 C  CB  . LEU D 1 190 ? 27.016  31.894  32.991 1.00 42.28 ? 843  LEU D CB  1 
ATOM   10125 C  CG  . LEU D 1 190 ? 25.654  32.487  32.632 1.00 43.34 ? 843  LEU D CG  1 
ATOM   10126 C  CD1 . LEU D 1 190 ? 25.284  31.995  31.230 1.00 42.27 ? 843  LEU D CD1 1 
ATOM   10127 C  CD2 . LEU D 1 190 ? 24.604  32.074  33.646 1.00 41.01 ? 843  LEU D CD2 1 
ATOM   10128 N  N   . TYR D 1 191 ? 29.057  34.199  33.546 1.00 41.86 ? 844  TYR D N   1 
ATOM   10129 C  CA  . TYR D 1 191 ? 29.288  35.572  33.970 1.00 41.11 ? 844  TYR D CA  1 
ATOM   10130 C  C   . TYR D 1 191 ? 30.644  36.205  33.696 1.00 40.18 ? 844  TYR D C   1 
ATOM   10131 O  O   . TYR D 1 191 ? 30.943  37.287  34.208 1.00 38.44 ? 844  TYR D O   1 
ATOM   10132 C  CB  . TYR D 1 191 ? 28.966  35.702  35.453 1.00 42.72 ? 844  TYR D CB  1 
ATOM   10133 C  CG  . TYR D 1 191 ? 27.483  35.607  35.725 1.00 46.30 ? 844  TYR D CG  1 
ATOM   10134 C  CD1 . TYR D 1 191 ? 26.921  34.439  36.246 1.00 45.75 ? 844  TYR D CD1 1 
ATOM   10135 C  CD2 . TYR D 1 191 ? 26.625  36.679  35.411 1.00 47.21 ? 844  TYR D CD2 1 
ATOM   10136 C  CE1 . TYR D 1 191 ? 25.552  34.331  36.447 1.00 47.78 ? 844  TYR D CE1 1 
ATOM   10137 C  CE2 . TYR D 1 191 ? 25.246  36.579  35.606 1.00 46.97 ? 844  TYR D CE2 1 
ATOM   10138 C  CZ  . TYR D 1 191 ? 24.719  35.409  36.122 1.00 47.78 ? 844  TYR D CZ  1 
ATOM   10139 O  OH  . TYR D 1 191 ? 23.370  35.296  36.308 1.00 47.78 ? 844  TYR D OH  1 
ATOM   10140 N  N   . ASN D 1 192 ? 31.476  35.547  32.897 1.00 40.57 ? 845  ASN D N   1 
ATOM   10141 C  CA  . ASN D 1 192 ? 32.796  36.115  32.588 1.00 41.72 ? 845  ASN D CA  1 
ATOM   10142 C  C   . ASN D 1 192 ? 33.640  36.454  33.835 1.00 40.78 ? 845  ASN D C   1 
ATOM   10143 O  O   . ASN D 1 192 ? 34.359  37.463  33.865 1.00 40.71 ? 845  ASN D O   1 
ATOM   10144 C  CB  . ASN D 1 192 ? 32.604  37.363  31.710 1.00 41.54 ? 845  ASN D CB  1 
ATOM   10145 C  CG  . ASN D 1 192 ? 31.763  37.065  30.465 1.00 42.24 ? 845  ASN D CG  1 
ATOM   10146 O  OD1 . ASN D 1 192 ? 32.158  36.265  29.626 1.00 41.90 ? 845  ASN D OD1 1 
ATOM   10147 N  ND2 . ASN D 1 192 ? 30.590  37.695  30.360 1.00 40.78 ? 845  ASN D ND2 1 
ATOM   10148 N  N   . ASP D 1 193 ? 33.524  35.598  34.852 1.00 40.22 ? 846  ASP D N   1 
ATOM   10149 C  CA  . ASP D 1 193 ? 34.251  35.715  36.126 1.00 40.26 ? 846  ASP D CA  1 
ATOM   10150 C  C   . ASP D 1 193 ? 34.055  37.017  36.899 1.00 40.26 ? 846  ASP D C   1 
ATOM   10151 O  O   . ASP D 1 193 ? 34.818  37.338  37.817 1.00 39.66 ? 846  ASP D O   1 
ATOM   10152 C  CB  . ASP D 1 193 ? 35.738  35.476  35.899 1.00 39.02 ? 846  ASP D CB  1 
ATOM   10153 C  CG  . ASP D 1 193 ? 35.993  34.270  35.045 1.00 37.79 ? 846  ASP D CG  1 
ATOM   10154 O  OD1 . ASP D 1 193 ? 35.215  33.302  35.141 1.00 38.63 ? 846  ASP D OD1 1 
ATOM   10155 O  OD2 . ASP D 1 193 ? 36.967  34.289  34.281 1.00 37.72 ? 846  ASP D OD2 1 
ATOM   10156 N  N   . ARG D 1 194 ? 33.022  37.764  36.542 1.00 41.22 ? 847  ARG D N   1 
ATOM   10157 C  CA  . ARG D 1 194 ? 32.744  39.019  37.232 1.00 43.22 ? 847  ARG D CA  1 
ATOM   10158 C  C   . ARG D 1 194 ? 31.608  38.804  38.219 1.00 42.04 ? 847  ARG D C   1 
ATOM   10159 O  O   . ARG D 1 194 ? 30.565  38.245  37.850 1.00 40.72 ? 847  ARG D O   1 
ATOM   10160 C  CB  . ARG D 1 194 ? 32.366  40.070  36.206 1.00 46.96 ? 847  ARG D CB  1 
ATOM   10161 C  CG  . ARG D 1 194 ? 33.393  40.158  35.091 1.00 50.36 ? 847  ARG D CG  1 
ATOM   10162 C  CD  . ARG D 1 194 ? 32.856  40.986  33.984 1.00 53.74 ? 847  ARG D CD  1 
ATOM   10163 N  NE  . ARG D 1 194 ? 33.806  42.008  33.577 1.00 58.19 ? 847  ARG D NE  1 
ATOM   10164 C  CZ  . ARG D 1 194 ? 33.472  43.276  33.366 1.00 59.40 ? 847  ARG D CZ  1 
ATOM   10165 N  NH1 . ARG D 1 194 ? 32.212  43.662  33.541 1.00 61.83 ? 847  ARG D NH1 1 
ATOM   10166 N  NH2 . ARG D 1 194 ? 34.380  44.146  32.943 1.00 60.92 ? 847  ARG D NH2 1 
ATOM   10167 N  N   . SER D 1 195 ? 31.827  39.225  39.467 1.00 41.10 ? 848  SER D N   1 
ATOM   10168 C  CA  . SER D 1 195 ? 30.833  39.071  40.544 1.00 42.01 ? 848  SER D CA  1 
ATOM   10169 C  C   . SER D 1 195 ? 29.904  37.895  40.279 1.00 42.18 ? 848  SER D C   1 
ATOM   10170 O  O   . SER D 1 195 ? 28.684  38.027  40.336 1.00 42.72 ? 848  SER D O   1 
ATOM   10171 C  CB  . SER D 1 195 ? 30.002  40.338  40.682 1.00 39.89 ? 848  SER D CB  1 
ATOM   10172 O  OG  . SER D 1 195 ? 30.854  41.440  40.878 1.00 40.74 ? 848  SER D OG  1 
ATOM   10173 N  N   . VAL D 1 196 ? 30.497  36.745  39.999 1.00 41.94 ? 849  VAL D N   1 
ATOM   10174 C  CA  . VAL D 1 196 ? 29.741  35.545  39.671 1.00 42.94 ? 849  VAL D CA  1 
ATOM   10175 C  C   . VAL D 1 196 ? 28.557  35.240  40.575 1.00 43.62 ? 849  VAL D C   1 
ATOM   10176 O  O   . VAL D 1 196 ? 27.420  35.196  40.122 1.00 44.79 ? 849  VAL D O   1 
ATOM   10177 C  CB  . VAL D 1 196 ? 30.678  34.323  39.647 1.00 42.84 ? 849  VAL D CB  1 
ATOM   10178 C  CG1 . VAL D 1 196 ? 29.920  33.086  39.177 1.00 41.26 ? 849  VAL D CG1 1 
ATOM   10179 C  CG2 . VAL D 1 196 ? 31.875  34.624  38.761 1.00 39.61 ? 849  VAL D CG2 1 
ATOM   10180 N  N   . LEU D 1 197 ? 28.851  35.014  41.851 1.00 44.75 ? 850  LEU D N   1 
ATOM   10181 C  CA  . LEU D 1 197 ? 27.860  34.683  42.870 1.00 44.17 ? 850  LEU D CA  1 
ATOM   10182 C  C   . LEU D 1 197 ? 26.761  35.739  43.013 1.00 44.27 ? 850  LEU D C   1 
ATOM   10183 O  O   . LEU D 1 197 ? 25.584  35.415  43.028 1.00 43.02 ? 850  LEU D O   1 
ATOM   10184 C  CB  . LEU D 1 197 ? 28.554  34.514  44.231 1.00 45.84 ? 850  LEU D CB  1 
ATOM   10185 C  CG  . LEU D 1 197 ? 29.308  33.234  44.595 1.00 47.87 ? 850  LEU D CG  1 
ATOM   10186 C  CD1 . LEU D 1 197 ? 29.991  33.404  45.962 1.00 47.25 ? 850  LEU D CD1 1 
ATOM   10187 C  CD2 . LEU D 1 197 ? 28.335  32.061  44.612 1.00 47.86 ? 850  LEU D CD2 1 
ATOM   10188 N  N   . GLU D 1 198 ? 27.178  36.989  43.167 1.00 44.76 ? 851  GLU D N   1 
ATOM   10189 C  CA  . GLU D 1 198 ? 26.269  38.086  43.338 1.00 45.05 ? 851  GLU D CA  1 
ATOM   10190 C  C   . GLU D 1 198 ? 25.329  38.210  42.128 1.00 45.92 ? 851  GLU D C   1 
ATOM   10191 O  O   . GLU D 1 198 ? 24.114  38.262  42.298 1.00 45.85 ? 851  GLU D O   1 
ATOM   10192 C  CB  . GLU D 1 198 ? 27.060  39.376  43.585 1.00 45.07 ? 851  GLU D CB  1 
ATOM   10193 C  CG  . GLU D 1 198 ? 27.834  39.430  44.932 1.00 46.74 ? 851  GLU D CG  1 
ATOM   10194 C  CD  . GLU D 1 198 ? 29.073  38.501  44.981 1.00 49.34 ? 851  GLU D CD  1 
ATOM   10195 O  OE1 . GLU D 1 198 ? 29.762  38.386  43.940 1.00 47.91 ? 851  GLU D OE1 1 
ATOM   10196 O  OE2 . GLU D 1 198 ? 29.369  37.907  46.061 1.00 49.13 ? 851  GLU D OE2 1 
ATOM   10197 N  N   . ASN D 1 199 ? 25.876  38.245  40.913 1.00 45.94 ? 852  ASN D N   1 
ATOM   10198 C  CA  . ASN D 1 199 ? 25.048  38.321  39.705 1.00 45.17 ? 852  ASN D CA  1 
ATOM   10199 C  C   . ASN D 1 199 ? 23.984  37.213  39.724 1.00 45.81 ? 852  ASN D C   1 
ATOM   10200 O  O   . ASN D 1 199 ? 22.809  37.436  39.379 1.00 45.00 ? 852  ASN D O   1 
ATOM   10201 C  CB  . ASN D 1 199 ? 25.917  38.184  38.446 1.00 44.55 ? 852  ASN D CB  1 
ATOM   10202 C  CG  . ASN D 1 199 ? 26.561  39.498  38.039 1.00 43.78 ? 852  ASN D CG  1 
ATOM   10203 O  OD1 . ASN D 1 199 ? 25.907  40.537  38.045 1.00 48.51 ? 852  ASN D OD1 1 
ATOM   10204 N  ND2 . ASN D 1 199 ? 27.826  39.464  37.673 1.00 42.41 ? 852  ASN D ND2 1 
ATOM   10205 N  N   . HIS D 1 200 ? 24.414  36.023  40.129 1.00 45.46 ? 853  HIS D N   1 
ATOM   10206 C  CA  . HIS D 1 200 ? 23.541  34.860  40.241 1.00 46.75 ? 853  HIS D CA  1 
ATOM   10207 C  C   . HIS D 1 200 ? 22.453  35.047  41.308 1.00 47.19 ? 853  HIS D C   1 
ATOM   10208 O  O   . HIS D 1 200 ? 21.288  34.715  41.094 1.00 48.41 ? 853  HIS D O   1 
ATOM   10209 C  CB  . HIS D 1 200 ? 24.350  33.625  40.615 1.00 45.42 ? 853  HIS D CB  1 
ATOM   10210 C  CG  . HIS D 1 200 ? 23.516  32.384  40.718 1.00 44.57 ? 853  HIS D CG  1 
ATOM   10211 N  ND1 . HIS D 1 200 ? 22.825  31.868  39.645 1.00 45.79 ? 853  HIS D ND1 1 
ATOM   10212 C  CD2 . HIS D 1 200 ? 23.259  31.561  41.760 1.00 44.51 ? 853  HIS D CD2 1 
ATOM   10213 C  CE1 . HIS D 1 200 ? 22.180  30.775  40.020 1.00 46.03 ? 853  HIS D CE1 1 
ATOM   10214 N  NE2 . HIS D 1 200 ? 22.427  30.568  41.303 1.00 45.17 ? 853  HIS D NE2 1 
ATOM   10215 N  N   . HIS D 1 201 ? 22.850  35.544  42.469 1.00 45.95 ? 854  HIS D N   1 
ATOM   10216 C  CA  . HIS D 1 201 ? 21.900  35.754  43.542 1.00 46.69 ? 854  HIS D CA  1 
ATOM   10217 C  C   . HIS D 1 201 ? 20.776  36.671  43.037 1.00 47.73 ? 854  HIS D C   1 
ATOM   10218 O  O   . HIS D 1 201 ? 19.611  36.281  43.015 1.00 47.87 ? 854  HIS D O   1 
ATOM   10219 C  CB  . HIS D 1 201 ? 22.596  36.373  44.776 1.00 43.58 ? 854  HIS D CB  1 
ATOM   10220 C  CG  . HIS D 1 201 ? 23.684  35.516  45.359 1.00 43.92 ? 854  HIS D CG  1 
ATOM   10221 N  ND1 . HIS D 1 201 ? 23.560  34.154  45.513 1.00 41.05 ? 854  HIS D ND1 1 
ATOM   10222 C  CD2 . HIS D 1 201 ? 24.911  35.836  45.841 1.00 43.12 ? 854  HIS D CD2 1 
ATOM   10223 C  CE1 . HIS D 1 201 ? 24.658  33.671  46.061 1.00 42.35 ? 854  HIS D CE1 1 
ATOM   10224 N  NE2 . HIS D 1 201 ? 25.494  34.668  46.270 1.00 43.01 ? 854  HIS D NE2 1 
ATOM   10225 N  N   . ALA D 1 202 ? 21.156  37.875  42.614 1.00 47.47 ? 855  ALA D N   1 
ATOM   10226 C  CA  . ALA D 1 202 ? 20.233  38.884  42.103 1.00 48.00 ? 855  ALA D CA  1 
ATOM   10227 C  C   . ALA D 1 202 ? 19.404  38.430  40.908 1.00 49.50 ? 855  ALA D C   1 
ATOM   10228 O  O   . ALA D 1 202 ? 18.185  38.637  40.875 1.00 49.38 ? 855  ALA D O   1 
ATOM   10229 C  CB  . ALA D 1 202 ? 21.002  40.144  41.733 1.00 45.50 ? 855  ALA D CB  1 
ATOM   10230 N  N   . ALA D 1 203 ? 20.060  37.805  39.934 1.00 49.56 ? 856  ALA D N   1 
ATOM   10231 C  CA  . ALA D 1 203 ? 19.373  37.366  38.737 1.00 49.69 ? 856  ALA D CA  1 
ATOM   10232 C  C   . ALA D 1 203 ? 18.517  36.139  38.946 1.00 49.90 ? 856  ALA D C   1 
ATOM   10233 O  O   . ALA D 1 203 ? 17.543  35.926  38.232 1.00 50.87 ? 856  ALA D O   1 
ATOM   10234 C  CB  . ALA D 1 203 ? 20.386  37.106  37.611 1.00 49.72 ? 856  ALA D CB  1 
ATOM   10235 N  N   . SER D 1 204 ? 18.867  35.329  39.930 1.00 50.56 ? 857  SER D N   1 
ATOM   10236 C  CA  . SER D 1 204 ? 18.130  34.084  40.179 1.00 50.72 ? 857  SER D CA  1 
ATOM   10237 C  C   . SER D 1 204 ? 16.824  34.329  40.935 1.00 50.33 ? 857  SER D C   1 
ATOM   10238 O  O   . SER D 1 204 ? 15.825  33.634  40.720 1.00 49.45 ? 857  SER D O   1 
ATOM   10239 C  CB  . SER D 1 204 ? 19.025  33.104  40.966 1.00 50.87 ? 857  SER D CB  1 
ATOM   10240 O  OG  . SER D 1 204 ? 18.716  31.765  40.644 1.00 51.46 ? 857  SER D OG  1 
ATOM   10241 N  N   . ALA D 1 205 ? 16.861  35.315  41.827 1.00 50.04 ? 858  ALA D N   1 
ATOM   10242 C  CA  . ALA D 1 205 ? 15.710  35.695  42.628 1.00 51.33 ? 858  ALA D CA  1 
ATOM   10243 C  C   . ALA D 1 205 ? 14.673  36.419  41.738 1.00 52.74 ? 858  ALA D C   1 
ATOM   10244 O  O   . ALA D 1 205 ? 13.495  36.050  41.723 1.00 53.29 ? 858  ALA D O   1 
ATOM   10245 C  CB  . ALA D 1 205 ? 16.156  36.584  43.765 1.00 50.02 ? 858  ALA D CB  1 
ATOM   10246 N  N   . TRP D 1 206 ? 15.114  37.427  40.987 1.00 52.99 ? 859  TRP D N   1 
ATOM   10247 C  CA  . TRP D 1 206 ? 14.203  38.143  40.094 1.00 54.56 ? 859  TRP D CA  1 
ATOM   10248 C  C   . TRP D 1 206 ? 13.561  37.187  39.115 1.00 54.62 ? 859  TRP D C   1 
ATOM   10249 O  O   . TRP D 1 206 ? 12.369  37.285  38.843 1.00 55.16 ? 859  TRP D O   1 
ATOM   10250 C  CB  . TRP D 1 206 ? 14.923  39.231  39.312 1.00 53.29 ? 859  TRP D CB  1 
ATOM   10251 C  CG  . TRP D 1 206 ? 15.162  40.421  40.122 1.00 52.40 ? 859  TRP D CG  1 
ATOM   10252 C  CD1 . TRP D 1 206 ? 16.360  40.957  40.452 1.00 52.27 ? 859  TRP D CD1 1 
ATOM   10253 C  CD2 . TRP D 1 206 ? 14.167  41.240  40.727 1.00 53.49 ? 859  TRP D CD2 1 
ATOM   10254 N  NE1 . TRP D 1 206 ? 16.182  42.074  41.233 1.00 53.49 ? 859  TRP D NE1 1 
ATOM   10255 C  CE2 . TRP D 1 206 ? 14.840  42.272  41.417 1.00 54.55 ? 859  TRP D CE2 1 
ATOM   10256 C  CE3 . TRP D 1 206 ? 12.767  41.207  40.754 1.00 53.80 ? 859  TRP D CE3 1 
ATOM   10257 C  CZ2 . TRP D 1 206 ? 14.162  43.268  42.132 1.00 53.94 ? 859  TRP D CZ2 1 
ATOM   10258 C  CZ3 . TRP D 1 206 ? 12.091  42.204  41.468 1.00 53.71 ? 859  TRP D CZ3 1 
ATOM   10259 C  CH2 . TRP D 1 206 ? 12.795  43.217  42.144 1.00 53.43 ? 859  TRP D CH2 1 
ATOM   10260 N  N   . ASN D 1 207 ? 14.354  36.264  38.585 1.00 54.38 ? 860  ASN D N   1 
ATOM   10261 C  CA  . ASN D 1 207 ? 13.831  35.286  37.649 1.00 53.88 ? 860  ASN D CA  1 
ATOM   10262 C  C   . ASN D 1 207 ? 12.688  34.586  38.353 1.00 53.73 ? 860  ASN D C   1 
ATOM   10263 O  O   . ASN D 1 207 ? 11.640  34.357  37.767 1.00 55.05 ? 860  ASN D O   1 
ATOM   10264 C  CB  . ASN D 1 207 ? 14.895  34.243  37.286 1.00 54.17 ? 860  ASN D CB  1 
ATOM   10265 C  CG  . ASN D 1 207 ? 14.281  32.981  36.662 1.00 56.06 ? 860  ASN D CG  1 
ATOM   10266 O  OD1 . ASN D 1 207 ? 14.379  32.758  35.448 1.00 56.35 ? 860  ASN D OD1 1 
ATOM   10267 N  ND2 . ASN D 1 207 ? 13.624  32.158  37.495 1.00 55.86 ? 860  ASN D ND2 1 
ATOM   10268 N  N   . LEU D 1 208 ? 12.915  34.247  39.621 1.00 54.24 ? 861  LEU D N   1 
ATOM   10269 C  CA  . LEU D 1 208 ? 11.937  33.550  40.437 1.00 54.51 ? 861  LEU D CA  1 
ATOM   10270 C  C   . LEU D 1 208 ? 10.729  34.454  40.688 1.00 55.15 ? 861  LEU D C   1 
ATOM   10271 O  O   . LEU D 1 208 ? 9.584   34.044  40.513 1.00 54.25 ? 861  LEU D O   1 
ATOM   10272 C  CB  . LEU D 1 208 ? 12.578  33.130  41.773 1.00 53.82 ? 861  LEU D CB  1 
ATOM   10273 C  CG  . LEU D 1 208 ? 11.677  32.459  42.829 1.00 53.37 ? 861  LEU D CG  1 
ATOM   10274 C  CD1 . LEU D 1 208 ? 11.193  31.098  42.336 1.00 51.98 ? 861  LEU D CD1 1 
ATOM   10275 C  CD2 . LEU D 1 208 ? 12.448  32.316  44.136 1.00 52.02 ? 861  LEU D CD2 1 
ATOM   10276 N  N   . TYR D 1 209 ? 11.000  35.681  41.107 1.00 55.53 ? 862  TYR D N   1 
ATOM   10277 C  CA  . TYR D 1 209 ? 9.951   36.650  41.364 1.00 56.85 ? 862  TYR D CA  1 
ATOM   10278 C  C   . TYR D 1 209 ? 9.083   36.842  40.136 1.00 57.64 ? 862  TYR D C   1 
ATOM   10279 O  O   . TYR D 1 209 ? 7.898   37.102  40.260 1.00 59.36 ? 862  TYR D O   1 
ATOM   10280 C  CB  . TYR D 1 209 ? 10.545  38.007  41.713 1.00 59.45 ? 862  TYR D CB  1 
ATOM   10281 C  CG  . TYR D 1 209 ? 9.495   39.092  41.854 1.00 62.31 ? 862  TYR D CG  1 
ATOM   10282 C  CD1 . TYR D 1 209 ? 8.883   39.336  43.085 1.00 63.01 ? 862  TYR D CD1 1 
ATOM   10283 C  CD2 . TYR D 1 209 ? 9.102   39.866  40.761 1.00 63.04 ? 862  TYR D CD2 1 
ATOM   10284 C  CE1 . TYR D 1 209 ? 7.902   40.333  43.236 1.00 64.73 ? 862  TYR D CE1 1 
ATOM   10285 C  CE2 . TYR D 1 209 ? 8.115   40.869  40.893 1.00 64.26 ? 862  TYR D CE2 1 
ATOM   10286 C  CZ  . TYR D 1 209 ? 7.517   41.104  42.139 1.00 65.13 ? 862  TYR D CZ  1 
ATOM   10287 O  OH  . TYR D 1 209 ? 6.557   42.109  42.304 1.00 63.44 ? 862  TYR D OH  1 
ATOM   10288 N  N   . LEU D 1 210 ? 9.694   36.742  38.959 1.00 57.17 ? 863  LEU D N   1 
ATOM   10289 C  CA  . LEU D 1 210 ? 9.000   36.922  37.693 1.00 56.85 ? 863  LEU D CA  1 
ATOM   10290 C  C   . LEU D 1 210 ? 8.594   35.593  37.078 1.00 57.89 ? 863  LEU D C   1 
ATOM   10291 O  O   . LEU D 1 210 ? 8.196   35.544  35.913 1.00 58.02 ? 863  LEU D O   1 
ATOM   10292 C  CB  . LEU D 1 210 ? 9.907   37.644  36.696 1.00 55.70 ? 863  LEU D CB  1 
ATOM   10293 C  CG  . LEU D 1 210 ? 10.409  39.037  37.086 1.00 56.69 ? 863  LEU D CG  1 
ATOM   10294 C  CD1 . LEU D 1 210 ? 11.779  39.302  36.451 1.00 56.68 ? 863  LEU D CD1 1 
ATOM   10295 C  CD2 . LEU D 1 210 ? 9.409   40.081  36.650 1.00 56.70 ? 863  LEU D CD2 1 
ATOM   10296 N  N   . SER D 1 211 ? 8.688   34.508  37.831 1.00 57.97 ? 864  SER D N   1 
ATOM   10297 C  CA  . SER D 1 211 ? 8.350   33.232  37.224 1.00 58.48 ? 864  SER D CA  1 
ATOM   10298 C  C   . SER D 1 211 ? 6.883   32.902  37.392 1.00 59.53 ? 864  SER D C   1 
ATOM   10299 O  O   . SER D 1 211 ? 6.341   32.054  36.678 1.00 60.51 ? 864  SER D O   1 
ATOM   10300 C  CB  . SER D 1 211 ? 9.220   32.098  37.799 1.00 57.66 ? 864  SER D CB  1 
ATOM   10301 O  OG  . SER D 1 211 ? 8.943   31.864  39.168 1.00 55.86 ? 864  SER D OG  1 
ATOM   10302 N  N   . ARG D 1 212 ? 6.233   33.567  38.335 1.00 59.57 ? 865  ARG D N   1 
ATOM   10303 C  CA  . ARG D 1 212 ? 4.832   33.296  38.553 1.00 60.15 ? 865  ARG D CA  1 
ATOM   10304 C  C   . ARG D 1 212 ? 4.070   34.545  38.928 1.00 60.64 ? 865  ARG D C   1 
ATOM   10305 O  O   . ARG D 1 212 ? 4.639   35.511  39.444 1.00 62.06 ? 865  ARG D O   1 
ATOM   10306 C  CB  . ARG D 1 212 ? 4.673   32.241  39.630 1.00 61.00 ? 865  ARG D CB  1 
ATOM   10307 C  CG  . ARG D 1 212 ? 5.479   30.994  39.347 1.00 61.23 ? 865  ARG D CG  1 
ATOM   10308 C  CD  . ARG D 1 212 ? 5.281   29.982  40.442 1.00 63.65 ? 865  ARG D CD  1 
ATOM   10309 N  NE  . ARG D 1 212 ? 3.908   29.506  40.437 1.00 65.59 ? 865  ARG D NE  1 
ATOM   10310 C  CZ  . ARG D 1 212 ? 3.320   28.967  39.373 1.00 66.94 ? 865  ARG D CZ  1 
ATOM   10311 N  NH1 . ARG D 1 212 ? 3.996   28.838  38.234 1.00 66.11 ? 865  ARG D NH1 1 
ATOM   10312 N  NH2 . ARG D 1 212 ? 2.047   28.574  39.444 1.00 67.99 ? 865  ARG D NH2 1 
ATOM   10313 N  N   . PRO D 1 213 ? 2.761   34.554  38.642 1.00 61.49 ? 866  PRO D N   1 
ATOM   10314 C  CA  . PRO D 1 213 ? 1.915   35.707  38.958 1.00 60.54 ? 866  PRO D CA  1 
ATOM   10315 C  C   . PRO D 1 213 ? 1.617   35.848  40.444 1.00 60.43 ? 866  PRO D C   1 
ATOM   10316 O  O   . PRO D 1 213 ? 1.570   36.970  40.960 1.00 61.04 ? 866  PRO D O   1 
ATOM   10317 C  CB  . PRO D 1 213 ? 0.662   35.461  38.120 1.00 61.49 ? 866  PRO D CB  1 
ATOM   10318 C  CG  . PRO D 1 213 ? 0.614   33.942  37.994 1.00 61.58 ? 866  PRO D CG  1 
ATOM   10319 C  CD  . PRO D 1 213 ? 2.059   33.585  37.773 1.00 61.28 ? 866  PRO D CD  1 
ATOM   10320 N  N   . GLU D 1 214 ? 1.430   34.722  41.137 1.00 60.79 ? 867  GLU D N   1 
ATOM   10321 C  CA  . GLU D 1 214 ? 1.139   34.743  42.577 1.00 61.27 ? 867  GLU D CA  1 
ATOM   10322 C  C   . GLU D 1 214 ? 2.286   35.230  43.462 1.00 61.71 ? 867  GLU D C   1 
ATOM   10323 O  O   . GLU D 1 214 ? 2.157   35.253  44.689 1.00 62.23 ? 867  GLU D O   1 
ATOM   10324 C  CB  . GLU D 1 214 ? 0.702   33.361  43.070 1.00 62.43 ? 867  GLU D CB  1 
ATOM   10325 C  CG  . GLU D 1 214 ? 1.610   32.216  42.647 1.00 63.76 ? 867  GLU D CG  1 
ATOM   10326 C  CD  . GLU D 1 214 ? 1.189   31.588  41.321 1.00 64.49 ? 867  GLU D CD  1 
ATOM   10327 O  OE1 . GLU D 1 214 ? 1.139   32.296  40.291 1.00 63.52 ? 867  GLU D OE1 1 
ATOM   10328 O  OE2 . GLU D 1 214 ? 0.916   30.368  41.313 1.00 66.64 ? 867  GLU D OE2 1 
ATOM   10329 N  N   . TYR D 1 215 ? 3.400   35.620  42.847 1.00 61.53 ? 868  TYR D N   1 
ATOM   10330 C  CA  . TYR D 1 215 ? 4.557   36.115  43.593 1.00 61.43 ? 868  TYR D CA  1 
ATOM   10331 C  C   . TYR D 1 215 ? 4.618   37.628  43.465 1.00 61.77 ? 868  TYR D C   1 
ATOM   10332 O  O   . TYR D 1 215 ? 5.401   38.288  44.164 1.00 61.11 ? 868  TYR D O   1 
ATOM   10333 C  CB  . TYR D 1 215 ? 5.873   35.530  43.036 1.00 61.07 ? 868  TYR D CB  1 
ATOM   10334 C  CG  . TYR D 1 215 ? 6.110   34.042  43.261 1.00 60.18 ? 868  TYR D CG  1 
ATOM   10335 C  CD1 . TYR D 1 215 ? 7.081   33.353  42.519 1.00 59.64 ? 868  TYR D CD1 1 
ATOM   10336 C  CD2 . TYR D 1 215 ? 5.382   33.324  44.220 1.00 59.54 ? 868  TYR D CD2 1 
ATOM   10337 C  CE1 . TYR D 1 215 ? 7.321   31.987  42.723 1.00 59.09 ? 868  TYR D CE1 1 
ATOM   10338 C  CE2 . TYR D 1 215 ? 5.615   31.954  44.436 1.00 59.56 ? 868  TYR D CE2 1 
ATOM   10339 C  CZ  . TYR D 1 215 ? 6.589   31.295  43.681 1.00 59.77 ? 868  TYR D CZ  1 
ATOM   10340 O  OH  . TYR D 1 215 ? 6.831   29.951  43.872 1.00 59.55 ? 868  TYR D OH  1 
ATOM   10341 N  N   . ASN D 1 216 ? 3.791   38.175  42.571 1.00 62.61 ? 869  ASN D N   1 
ATOM   10342 C  CA  . ASN D 1 216 ? 3.789   39.619  42.313 1.00 63.19 ? 869  ASN D CA  1 
ATOM   10343 C  C   . ASN D 1 216 ? 3.090   40.439  43.387 1.00 62.59 ? 869  ASN D C   1 
ATOM   10344 O  O   . ASN D 1 216 ? 1.869   40.554  43.409 1.00 63.17 ? 869  ASN D O   1 
ATOM   10345 C  CB  . ASN D 1 216 ? 3.162   39.924  40.954 1.00 63.97 ? 869  ASN D CB  1 
ATOM   10346 C  CG  . ASN D 1 216 ? 3.512   41.320  40.465 1.00 66.27 ? 869  ASN D CG  1 
ATOM   10347 O  OD1 . ASN D 1 216 ? 3.470   42.298  41.234 1.00 67.58 ? 869  ASN D OD1 1 
ATOM   10348 N  ND2 . ASN D 1 216 ? 3.861   41.428  39.187 1.00 66.78 ? 869  ASN D ND2 1 
ATOM   10349 N  N   . PHE D 1 217 ? 3.886   41.037  44.259 1.00 62.13 ? 870  PHE D N   1 
ATOM   10350 C  CA  . PHE D 1 217 ? 3.361   41.814  45.364 1.00 61.67 ? 870  PHE D CA  1 
ATOM   10351 C  C   . PHE D 1 217 ? 3.814   43.251  45.247 1.00 61.98 ? 870  PHE D C   1 
ATOM   10352 O  O   . PHE D 1 217 ? 3.747   44.024  46.211 1.00 62.43 ? 870  PHE D O   1 
ATOM   10353 C  CB  . PHE D 1 217 ? 3.846   41.201  46.690 1.00 60.67 ? 870  PHE D CB  1 
ATOM   10354 C  CG  . PHE D 1 217 ? 5.341   41.213  46.855 1.00 58.32 ? 870  PHE D CG  1 
ATOM   10355 C  CD1 . PHE D 1 217 ? 5.979   42.298  47.458 1.00 58.27 ? 870  PHE D CD1 1 
ATOM   10356 C  CD2 . PHE D 1 217 ? 6.118   40.160  46.372 1.00 57.89 ? 870  PHE D CD2 1 
ATOM   10357 C  CE1 . PHE D 1 217 ? 7.367   42.342  47.576 1.00 57.34 ? 870  PHE D CE1 1 
ATOM   10358 C  CE2 . PHE D 1 217 ? 7.495   40.191  46.483 1.00 56.34 ? 870  PHE D CE2 1 
ATOM   10359 C  CZ  . PHE D 1 217 ? 8.127   41.285  47.085 1.00 57.11 ? 870  PHE D CZ  1 
ATOM   10360 N  N   . LEU D 1 218 ? 4.289   43.601  44.057 1.00 62.25 ? 871  LEU D N   1 
ATOM   10361 C  CA  . LEU D 1 218 ? 4.743   44.966  43.780 1.00 62.22 ? 871  LEU D CA  1 
ATOM   10362 C  C   . LEU D 1 218 ? 3.895   45.592  42.676 1.00 61.83 ? 871  LEU D C   1 
ATOM   10363 O  O   . LEU D 1 218 ? 4.273   46.610  42.085 1.00 62.82 ? 871  LEU D O   1 
ATOM   10364 C  CB  . LEU D 1 218 ? 6.207   44.949  43.347 1.00 61.84 ? 871  LEU D CB  1 
ATOM   10365 C  CG  . LEU D 1 218 ? 7.214   44.609  44.446 1.00 60.80 ? 871  LEU D CG  1 
ATOM   10366 C  CD1 . LEU D 1 218 ? 8.476   44.103  43.782 1.00 60.74 ? 871  LEU D CD1 1 
ATOM   10367 C  CD2 . LEU D 1 218 ? 7.494   45.840  45.327 1.00 58.74 ? 871  LEU D CD2 1 
ATOM   10368 N  N   . LEU D 1 219 ? 2.743   44.978  42.417 1.00 61.37 ? 872  LEU D N   1 
ATOM   10369 C  CA  . LEU D 1 219 ? 1.827   45.434  41.378 1.00 60.79 ? 872  LEU D CA  1 
ATOM   10370 C  C   . LEU D 1 219 ? 1.347   46.888  41.467 1.00 59.52 ? 872  LEU D C   1 
ATOM   10371 O  O   . LEU D 1 219 ? 1.268   47.558  40.442 1.00 60.46 ? 872  LEU D O   1 
ATOM   10372 C  CB  . LEU D 1 219 ? 0.624   44.478  41.286 1.00 59.98 ? 872  LEU D CB  1 
ATOM   10373 C  CG  . LEU D 1 219 ? 0.297   43.658  42.546 1.00 60.80 ? 872  LEU D CG  1 
ATOM   10374 C  CD1 . LEU D 1 219 ? 0.108   44.584  43.752 1.00 58.82 ? 872  LEU D CD1 1 
ATOM   10375 C  CD2 . LEU D 1 219 ? -0.949  42.807  42.300 1.00 59.59 ? 872  LEU D CD2 1 
ATOM   10376 N  N   . HIS D 1 220 ? 1.044   47.384  42.660 1.00 59.04 ? 873  HIS D N   1 
ATOM   10377 C  CA  . HIS D 1 220 ? 0.564   48.762  42.804 1.00 59.73 ? 873  HIS D CA  1 
ATOM   10378 C  C   . HIS D 1 220 ? 1.693   49.785  42.702 1.00 61.18 ? 873  HIS D C   1 
ATOM   10379 O  O   . HIS D 1 220 ? 1.715   50.811  43.405 1.00 61.06 ? 873  HIS D O   1 
ATOM   10380 C  CB  . HIS D 1 220 ? -0.189  48.928  44.130 1.00 58.40 ? 873  HIS D CB  1 
ATOM   10381 C  CG  . HIS D 1 220 ? -1.289  47.929  44.319 1.00 57.84 ? 873  HIS D CG  1 
ATOM   10382 N  ND1 . HIS D 1 220 ? -1.880  47.692  45.544 1.00 58.73 ? 873  HIS D ND1 1 
ATOM   10383 C  CD2 . HIS D 1 220 ? -1.850  47.046  43.457 1.00 57.70 ? 873  HIS D CD2 1 
ATOM   10384 C  CE1 . HIS D 1 220 ? -2.746  46.698  45.430 1.00 57.60 ? 873  HIS D CE1 1 
ATOM   10385 N  NE2 . HIS D 1 220 ? -2.745  46.287  44.174 1.00 57.10 ? 873  HIS D NE2 1 
ATOM   10386 N  N   . LEU D 1 221 ? 2.635   49.484  41.810 1.00 62.52 ? 874  LEU D N   1 
ATOM   10387 C  CA  . LEU D 1 221 ? 3.774   50.351  41.542 1.00 63.11 ? 874  LEU D CA  1 
ATOM   10388 C  C   . LEU D 1 221 ? 3.782   50.696  40.042 1.00 64.33 ? 874  LEU D C   1 
ATOM   10389 O  O   . LEU D 1 221 ? 3.504   49.827  39.186 1.00 63.40 ? 874  LEU D O   1 
ATOM   10390 C  CB  . LEU D 1 221 ? 5.089   49.641  41.916 1.00 62.58 ? 874  LEU D CB  1 
ATOM   10391 C  CG  . LEU D 1 221 ? 5.830   50.084  43.191 1.00 62.47 ? 874  LEU D CG  1 
ATOM   10392 C  CD1 . LEU D 1 221 ? 5.153   49.518  44.425 1.00 61.86 ? 874  LEU D CD1 1 
ATOM   10393 C  CD2 . LEU D 1 221 ? 7.272   49.609  43.135 1.00 61.05 ? 874  LEU D CD2 1 
ATOM   10394 N  N   . ASP D 1 222 ? 4.081   51.961  39.719 1.00 65.45 ? 875  ASP D N   1 
ATOM   10395 C  CA  . ASP D 1 222 ? 4.156   52.383  38.308 1.00 66.02 ? 875  ASP D CA  1 
ATOM   10396 C  C   . ASP D 1 222 ? 5.497   51.873  37.790 1.00 65.89 ? 875  ASP D C   1 
ATOM   10397 O  O   . ASP D 1 222 ? 6.447   51.743  38.572 1.00 65.16 ? 875  ASP D O   1 
ATOM   10398 C  CB  . ASP D 1 222 ? 4.058   53.914  38.175 1.00 66.84 ? 875  ASP D CB  1 
ATOM   10399 C  CG  . ASP D 1 222 ? 4.688   54.657  39.352 1.00 69.09 ? 875  ASP D CG  1 
ATOM   10400 O  OD1 . ASP D 1 222 ? 4.223   54.462  40.506 1.00 70.01 ? 875  ASP D OD1 1 
ATOM   10401 O  OD2 . ASP D 1 222 ? 5.643   55.446  39.128 1.00 69.54 ? 875  ASP D OD2 1 
ATOM   10402 N  N   . HIS D 1 223 ? 5.577   51.554  36.500 1.00 65.41 ? 876  HIS D N   1 
ATOM   10403 C  CA  . HIS D 1 223 ? 6.827   51.033  35.956 1.00 66.10 ? 876  HIS D CA  1 
ATOM   10404 C  C   . HIS D 1 223 ? 8.039   51.860  36.357 1.00 66.37 ? 876  HIS D C   1 
ATOM   10405 O  O   . HIS D 1 223 ? 9.105   51.294  36.608 1.00 66.06 ? 876  HIS D O   1 
ATOM   10406 C  CB  . HIS D 1 223 ? 6.787   50.928  34.439 1.00 66.95 ? 876  HIS D CB  1 
ATOM   10407 C  CG  . HIS D 1 223 ? 5.694   50.052  33.924 1.00 67.29 ? 876  HIS D CG  1 
ATOM   10408 N  ND1 . HIS D 1 223 ? 5.652   49.616  32.616 1.00 68.30 ? 876  HIS D ND1 1 
ATOM   10409 C  CD2 . HIS D 1 223 ? 4.562   49.595  34.514 1.00 68.21 ? 876  HIS D CD2 1 
ATOM   10410 C  CE1 . HIS D 1 223 ? 4.535   48.934  32.418 1.00 68.80 ? 876  HIS D CE1 1 
ATOM   10411 N  NE2 . HIS D 1 223 ? 3.854   48.908  33.553 1.00 69.18 ? 876  HIS D NE2 1 
ATOM   10412 N  N   . VAL D 1 224 ? 7.885   53.187  36.424 1.00 65.64 ? 877  VAL D N   1 
ATOM   10413 C  CA  . VAL D 1 224 ? 9.004   54.053  36.826 1.00 65.06 ? 877  VAL D CA  1 
ATOM   10414 C  C   . VAL D 1 224 ? 9.461   53.716  38.255 1.00 65.10 ? 877  VAL D C   1 
ATOM   10415 O  O   . VAL D 1 224 ? 10.637  53.869  38.622 1.00 65.04 ? 877  VAL D O   1 
ATOM   10416 C  CB  . VAL D 1 224 ? 8.614   55.553  36.781 1.00 64.53 ? 877  VAL D CB  1 
ATOM   10417 C  CG1 . VAL D 1 224 ? 9.753   56.413  37.344 1.00 61.43 ? 877  VAL D CG1 1 
ATOM   10418 C  CG2 . VAL D 1 224 ? 8.288   55.957  35.351 1.00 63.70 ? 877  VAL D CG2 1 
ATOM   10419 N  N   . GLU D 1 225 ? 8.509   53.272  39.060 1.00 64.95 ? 878  GLU D N   1 
ATOM   10420 C  CA  . GLU D 1 225 ? 8.806   52.906  40.424 1.00 64.12 ? 878  GLU D CA  1 
ATOM   10421 C  C   . GLU D 1 225 ? 9.397   51.512  40.432 1.00 63.91 ? 878  GLU D C   1 
ATOM   10422 O  O   . GLU D 1 225 ? 10.494  51.309  40.942 1.00 64.33 ? 878  GLU D O   1 
ATOM   10423 C  CB  . GLU D 1 225 ? 7.538   52.928  41.267 1.00 64.35 ? 878  GLU D CB  1 
ATOM   10424 C  CG  . GLU D 1 225 ? 7.402   54.155  42.141 1.00 63.57 ? 878  GLU D CG  1 
ATOM   10425 C  CD  . GLU D 1 225 ? 6.241   54.028  43.114 1.00 64.45 ? 878  GLU D CD  1 
ATOM   10426 O  OE1 . GLU D 1 225 ? 6.214   54.795  44.112 1.00 63.51 ? 878  GLU D OE1 1 
ATOM   10427 O  OE2 . GLU D 1 225 ? 5.354   53.161  42.880 1.00 63.28 ? 878  GLU D OE2 1 
ATOM   10428 N  N   . PHE D 1 226 ? 8.682   50.557  39.849 1.00 63.43 ? 879  PHE D N   1 
ATOM   10429 C  CA  . PHE D 1 226 ? 9.161   49.186  39.821 1.00 63.40 ? 879  PHE D CA  1 
ATOM   10430 C  C   . PHE D 1 226 ? 10.531  49.042  39.163 1.00 64.13 ? 879  PHE D C   1 
ATOM   10431 O  O   . PHE D 1 226 ? 11.438  48.411  39.717 1.00 64.92 ? 879  PHE D O   1 
ATOM   10432 C  CB  . PHE D 1 226 ? 8.183   48.289  39.089 1.00 63.45 ? 879  PHE D CB  1 
ATOM   10433 C  CG  . PHE D 1 226 ? 8.621   46.865  39.042 1.00 64.15 ? 879  PHE D CG  1 
ATOM   10434 C  CD1 . PHE D 1 226 ? 8.254   45.981  40.056 1.00 64.17 ? 879  PHE D CD1 1 
ATOM   10435 C  CD2 . PHE D 1 226 ? 9.455   46.416  38.013 1.00 63.89 ? 879  PHE D CD2 1 
ATOM   10436 C  CE1 . PHE D 1 226 ? 8.707   44.663  40.058 1.00 64.78 ? 879  PHE D CE1 1 
ATOM   10437 C  CE2 . PHE D 1 226 ? 9.918   45.103  38.000 1.00 65.16 ? 879  PHE D CE2 1 
ATOM   10438 C  CZ  . PHE D 1 226 ? 9.543   44.216  39.027 1.00 65.51 ? 879  PHE D CZ  1 
ATOM   10439 N  N   . LYS D 1 227 ? 10.672  49.598  37.966 1.00 63.64 ? 880  LYS D N   1 
ATOM   10440 C  CA  . LYS D 1 227 ? 11.939  49.533  37.256 1.00 62.22 ? 880  LYS D CA  1 
ATOM   10441 C  C   . LYS D 1 227 ? 13.045  50.124  38.143 1.00 60.78 ? 880  LYS D C   1 
ATOM   10442 O  O   . LYS D 1 227 ? 14.132  49.556  38.264 1.00 60.19 ? 880  LYS D O   1 
ATOM   10443 C  CB  . LYS D 1 227 ? 11.833  50.303  35.935 1.00 62.28 ? 880  LYS D CB  1 
ATOM   10444 C  CG  . LYS D 1 227 ? 12.599  49.659  34.770 1.00 64.15 ? 880  LYS D CG  1 
ATOM   10445 C  CD  . LYS D 1 227 ? 12.260  48.157  34.581 1.00 64.33 ? 880  LYS D CD  1 
ATOM   10446 C  CE  . LYS D 1 227 ? 13.141  47.496  33.494 1.00 64.83 ? 880  LYS D CE  1 
ATOM   10447 N  NZ  . LYS D 1 227 ? 14.620  47.569  33.801 1.00 64.51 ? 880  LYS D NZ  1 
ATOM   10448 N  N   . ARG D 1 228 ? 12.765  51.251  38.780 1.00 59.03 ? 881  ARG D N   1 
ATOM   10449 C  CA  . ARG D 1 228 ? 13.761  51.876  39.641 1.00 58.95 ? 881  ARG D CA  1 
ATOM   10450 C  C   . ARG D 1 228 ? 14.042  50.974  40.860 1.00 59.38 ? 881  ARG D C   1 
ATOM   10451 O  O   . ARG D 1 228 ? 15.116  51.019  41.479 1.00 59.52 ? 881  ARG D O   1 
ATOM   10452 C  CB  . ARG D 1 228 ? 13.254  53.233  40.108 1.00 57.09 ? 881  ARG D CB  1 
ATOM   10453 C  CG  . ARG D 1 228 ? 14.179  53.940  41.039 1.00 57.19 ? 881  ARG D CG  1 
ATOM   10454 C  CD  . ARG D 1 228 ? 13.438  55.070  41.722 1.00 58.22 ? 881  ARG D CD  1 
ATOM   10455 N  NE  . ARG D 1 228 ? 14.143  55.649  42.871 1.00 58.97 ? 881  ARG D NE  1 
ATOM   10456 C  CZ  . ARG D 1 228 ? 15.433  55.985  42.884 1.00 59.19 ? 881  ARG D CZ  1 
ATOM   10457 N  NH1 . ARG D 1 228 ? 16.186  55.786  41.804 1.00 59.64 ? 881  ARG D NH1 1 
ATOM   10458 N  NH2 . ARG D 1 228 ? 15.962  56.558  43.968 1.00 57.99 ? 881  ARG D NH2 1 
ATOM   10459 N  N   . PHE D 1 229 ? 13.056  50.158  41.197 1.00 58.46 ? 882  PHE D N   1 
ATOM   10460 C  CA  . PHE D 1 229 ? 13.163  49.240  42.321 1.00 58.08 ? 882  PHE D CA  1 
ATOM   10461 C  C   . PHE D 1 229 ? 14.106  48.078  41.983 1.00 57.45 ? 882  PHE D C   1 
ATOM   10462 O  O   . PHE D 1 229 ? 15.087  47.836  42.691 1.00 57.30 ? 882  PHE D O   1 
ATOM   10463 C  CB  . PHE D 1 229 ? 11.780  48.673  42.678 1.00 56.48 ? 882  PHE D CB  1 
ATOM   10464 C  CG  . PHE D 1 229 ? 11.760  47.928  43.974 1.00 54.76 ? 882  PHE D CG  1 
ATOM   10465 C  CD1 . PHE D 1 229 ? 11.852  48.615  45.179 1.00 53.72 ? 882  PHE D CD1 1 
ATOM   10466 C  CD2 . PHE D 1 229 ? 11.686  46.541  43.995 1.00 55.11 ? 882  PHE D CD2 1 
ATOM   10467 C  CE1 . PHE D 1 229 ? 11.870  47.934  46.395 1.00 54.31 ? 882  PHE D CE1 1 
ATOM   10468 C  CE2 . PHE D 1 229 ? 11.706  45.838  45.207 1.00 54.36 ? 882  PHE D CE2 1 
ATOM   10469 C  CZ  . PHE D 1 229 ? 11.799  46.542  46.410 1.00 54.09 ? 882  PHE D CZ  1 
ATOM   10470 N  N   . ARG D 1 230 ? 13.772  47.369  40.906 1.00 55.90 ? 883  ARG D N   1 
ATOM   10471 C  CA  . ARG D 1 230 ? 14.547  46.236  40.437 1.00 55.07 ? 883  ARG D CA  1 
ATOM   10472 C  C   . ARG D 1 230 ? 16.011  46.617  40.243 1.00 54.50 ? 883  ARG D C   1 
ATOM   10473 O  O   . ARG D 1 230 ? 16.910  45.799  40.430 1.00 55.35 ? 883  ARG D O   1 
ATOM   10474 C  CB  . ARG D 1 230 ? 13.948  45.698  39.140 1.00 55.42 ? 883  ARG D CB  1 
ATOM   10475 C  CG  . ARG D 1 230 ? 14.877  44.791  38.381 1.00 56.99 ? 883  ARG D CG  1 
ATOM   10476 C  CD  . ARG D 1 230 ? 14.134  43.747  37.576 1.00 58.09 ? 883  ARG D CD  1 
ATOM   10477 N  NE  . ARG D 1 230 ? 15.081  42.859  36.903 1.00 58.73 ? 883  ARG D NE  1 
ATOM   10478 C  CZ  . ARG D 1 230 ? 15.877  43.257  35.918 1.00 60.82 ? 883  ARG D CZ  1 
ATOM   10479 N  NH1 . ARG D 1 230 ? 15.816  44.521  35.505 1.00 61.93 ? 883  ARG D NH1 1 
ATOM   10480 N  NH2 . ARG D 1 230 ? 16.742  42.409  35.363 1.00 60.24 ? 883  ARG D NH2 1 
ATOM   10481 N  N   . PHE D 1 231 ? 16.254  47.870  39.895 1.00 51.83 ? 884  PHE D N   1 
ATOM   10482 C  CA  . PHE D 1 231 ? 17.620  48.344  39.707 1.00 49.20 ? 884  PHE D CA  1 
ATOM   10483 C  C   . PHE D 1 231 ? 18.280  48.593  41.066 1.00 50.46 ? 884  PHE D C   1 
ATOM   10484 O  O   . PHE D 1 231 ? 19.453  48.272  41.287 1.00 50.65 ? 884  PHE D O   1 
ATOM   10485 C  CB  . PHE D 1 231 ? 17.591  49.632  38.900 1.00 42.48 ? 884  PHE D CB  1 
ATOM   10486 C  CG  . PHE D 1 231 ? 18.878  50.405  38.918 1.00 38.50 ? 884  PHE D CG  1 
ATOM   10487 C  CD1 . PHE D 1 231 ? 19.892  50.127  38.005 1.00 37.43 ? 884  PHE D CD1 1 
ATOM   10488 C  CD2 . PHE D 1 231 ? 19.065  51.454  39.826 1.00 37.32 ? 884  PHE D CD2 1 
ATOM   10489 C  CE1 . PHE D 1 231 ? 21.076  50.883  37.993 1.00 35.45 ? 884  PHE D CE1 1 
ATOM   10490 C  CE2 . PHE D 1 231 ? 20.247  52.221  39.824 1.00 35.44 ? 884  PHE D CE2 1 
ATOM   10491 C  CZ  . PHE D 1 231 ? 21.254  51.934  38.901 1.00 35.64 ? 884  PHE D CZ  1 
ATOM   10492 N  N   . LEU D 1 232 ? 17.518  49.198  41.965 1.00 51.11 ? 885  LEU D N   1 
ATOM   10493 C  CA  . LEU D 1 232 ? 18.013  49.500  43.286 1.00 51.63 ? 885  LEU D CA  1 
ATOM   10494 C  C   . LEU D 1 232 ? 18.391  48.225  44.012 1.00 52.31 ? 885  LEU D C   1 
ATOM   10495 O  O   . LEU D 1 232 ? 19.394  48.180  44.732 1.00 52.20 ? 885  LEU D O   1 
ATOM   10496 C  CB  . LEU D 1 232 ? 16.949  50.249  44.071 1.00 51.86 ? 885  LEU D CB  1 
ATOM   10497 C  CG  . LEU D 1 232 ? 17.178  51.760  44.061 1.00 53.04 ? 885  LEU D CG  1 
ATOM   10498 C  CD1 . LEU D 1 232 ? 17.485  52.237  42.664 1.00 53.87 ? 885  LEU D CD1 1 
ATOM   10499 C  CD2 . LEU D 1 232 ? 15.956  52.452  44.608 1.00 52.45 ? 885  LEU D CD2 1 
ATOM   10500 N  N   . VAL D 1 233 ? 17.575  47.192  43.814 1.00 51.93 ? 886  VAL D N   1 
ATOM   10501 C  CA  . VAL D 1 233 ? 17.791  45.899  44.435 1.00 51.12 ? 886  VAL D CA  1 
ATOM   10502 C  C   . VAL D 1 233 ? 19.093  45.296  43.903 1.00 51.54 ? 886  VAL D C   1 
ATOM   10503 O  O   . VAL D 1 233 ? 19.783  44.566  44.600 1.00 52.31 ? 886  VAL D O   1 
ATOM   10504 C  CB  . VAL D 1 233 ? 16.575  44.963  44.151 1.00 50.90 ? 886  VAL D CB  1 
ATOM   10505 C  CG1 . VAL D 1 233 ? 16.968  43.500  44.247 1.00 51.86 ? 886  VAL D CG1 1 
ATOM   10506 C  CG2 . VAL D 1 233 ? 15.480  45.239  45.165 1.00 51.97 ? 886  VAL D CG2 1 
ATOM   10507 N  N   . ILE D 1 234 ? 19.447  45.638  42.674 1.00 50.48 ? 887  ILE D N   1 
ATOM   10508 C  CA  . ILE D 1 234 ? 20.644  45.103  42.063 1.00 48.63 ? 887  ILE D CA  1 
ATOM   10509 C  C   . ILE D 1 234 ? 21.894  45.795  42.549 1.00 49.15 ? 887  ILE D C   1 
ATOM   10510 O  O   . ILE D 1 234 ? 22.861  45.137  42.947 1.00 49.56 ? 887  ILE D O   1 
ATOM   10511 C  CB  . ILE D 1 234 ? 20.518  45.173  40.544 1.00 49.05 ? 887  ILE D CB  1 
ATOM   10512 C  CG1 . ILE D 1 234 ? 19.584  44.045  40.085 1.00 49.32 ? 887  ILE D CG1 1 
ATOM   10513 C  CG2 . ILE D 1 234 ? 21.862  45.081  39.894 1.00 47.35 ? 887  ILE D CG2 1 
ATOM   10514 C  CD1 . ILE D 1 234 ? 19.054  44.178  38.671 1.00 50.72 ? 887  ILE D CD1 1 
ATOM   10515 N  N   . GLU D 1 235 ? 21.880  47.119  42.540 1.00 48.28 ? 888  GLU D N   1 
ATOM   10516 C  CA  . GLU D 1 235 ? 23.025  47.891  43.010 1.00 47.46 ? 888  GLU D CA  1 
ATOM   10517 C  C   . GLU D 1 235 ? 23.352  47.546  44.463 1.00 46.69 ? 888  GLU D C   1 
ATOM   10518 O  O   . GLU D 1 235 ? 24.456  47.825  44.949 1.00 44.72 ? 888  GLU D O   1 
ATOM   10519 C  CB  . GLU D 1 235 ? 22.712  49.387  42.915 1.00 50.26 ? 888  GLU D CB  1 
ATOM   10520 C  CG  . GLU D 1 235 ? 22.651  49.929  41.513 1.00 52.63 ? 888  GLU D CG  1 
ATOM   10521 C  CD  . GLU D 1 235 ? 24.034  50.075  40.922 1.00 55.74 ? 888  GLU D CD  1 
ATOM   10522 O  OE1 . GLU D 1 235 ? 24.273  49.495  39.837 1.00 57.35 ? 888  GLU D OE1 1 
ATOM   10523 O  OE2 . GLU D 1 235 ? 24.883  50.772  41.540 1.00 57.12 ? 888  GLU D OE2 1 
ATOM   10524 N  N   . ALA D 1 236 ? 22.379  46.976  45.172 1.00 45.23 ? 889  ALA D N   1 
ATOM   10525 C  CA  . ALA D 1 236 ? 22.599  46.616  46.578 1.00 45.17 ? 889  ALA D CA  1 
ATOM   10526 C  C   . ALA D 1 236 ? 23.311  45.261  46.667 1.00 44.45 ? 889  ALA D C   1 
ATOM   10527 O  O   . ALA D 1 236 ? 24.379  45.168  47.250 1.00 44.91 ? 889  ALA D O   1 
ATOM   10528 C  CB  . ALA D 1 236 ? 21.266  46.561  47.341 1.00 42.70 ? 889  ALA D CB  1 
ATOM   10529 N  N   . ILE D 1 237 ? 22.688  44.245  46.076 1.00 42.49 ? 890  ILE D N   1 
ATOM   10530 C  CA  . ILE D 1 237 ? 23.182  42.894  46.030 1.00 41.25 ? 890  ILE D CA  1 
ATOM   10531 C  C   . ILE D 1 237 ? 24.625  42.811  45.499 1.00 44.09 ? 890  ILE D C   1 
ATOM   10532 O  O   . ILE D 1 237 ? 25.521  42.287  46.175 1.00 43.14 ? 890  ILE D O   1 
ATOM   10533 C  CB  . ILE D 1 237 ? 22.234  42.028  45.167 1.00 39.14 ? 890  ILE D CB  1 
ATOM   10534 C  CG1 . ILE D 1 237 ? 20.917  41.843  45.916 1.00 37.60 ? 890  ILE D CG1 1 
ATOM   10535 C  CG2 . ILE D 1 237 ? 22.899  40.689  44.789 1.00 36.69 ? 890  ILE D CG2 1 
ATOM   10536 C  CD1 . ILE D 1 237 ? 19.938  40.901  45.237 1.00 38.30 ? 890  ILE D CD1 1 
ATOM   10537 N  N   . LEU D 1 238 ? 24.846  43.347  44.305 1.00 44.58 ? 891  LEU D N   1 
ATOM   10538 C  CA  . LEU D 1 238 ? 26.171  43.344  43.702 1.00 44.83 ? 891  LEU D CA  1 
ATOM   10539 C  C   . LEU D 1 238 ? 27.221  44.107  44.523 1.00 45.68 ? 891  LEU D C   1 
ATOM   10540 O  O   . LEU D 1 238 ? 28.430  43.989  44.283 1.00 44.32 ? 891  LEU D O   1 
ATOM   10541 C  CB  . LEU D 1 238 ? 26.094  43.931  42.288 1.00 45.19 ? 891  LEU D CB  1 
ATOM   10542 C  CG  . LEU D 1 238 ? 25.520  43.041  41.177 1.00 45.16 ? 891  LEU D CG  1 
ATOM   10543 C  CD1 . LEU D 1 238 ? 25.162  43.931  40.003 1.00 47.30 ? 891  LEU D CD1 1 
ATOM   10544 C  CD2 . LEU D 1 238 ? 26.532  41.973  40.726 1.00 45.13 ? 891  LEU D CD2 1 
ATOM   10545 N  N   . ALA D 1 239 ? 26.774  44.885  45.495 1.00 45.30 ? 892  ALA D N   1 
ATOM   10546 C  CA  . ALA D 1 239 ? 27.714  45.638  46.311 1.00 45.08 ? 892  ALA D CA  1 
ATOM   10547 C  C   . ALA D 1 239 ? 28.334  44.744  47.399 1.00 44.82 ? 892  ALA D C   1 
ATOM   10548 O  O   . ALA D 1 239 ? 29.379  45.072  47.977 1.00 42.93 ? 892  ALA D O   1 
ATOM   10549 C  CB  . ALA D 1 239 ? 26.996  46.837  46.945 1.00 44.27 ? 892  ALA D CB  1 
ATOM   10550 N  N   . THR D 1 240 ? 27.692  43.612  47.664 1.00 44.62 ? 893  THR D N   1 
ATOM   10551 C  CA  . THR D 1 240 ? 28.187  42.706  48.690 1.00 46.27 ? 893  THR D CA  1 
ATOM   10552 C  C   . THR D 1 240 ? 29.370  41.844  48.224 1.00 47.72 ? 893  THR D C   1 
ATOM   10553 O  O   . THR D 1 240 ? 29.848  40.981  48.955 1.00 47.04 ? 893  THR D O   1 
ATOM   10554 C  CB  . THR D 1 240 ? 27.085  41.775  49.180 1.00 46.55 ? 893  THR D CB  1 
ATOM   10555 O  OG1 . THR D 1 240 ? 26.631  40.960  48.091 1.00 44.31 ? 893  THR D OG1 1 
ATOM   10556 C  CG2 . THR D 1 240 ? 25.927  42.589  49.779 1.00 46.04 ? 893  THR D CG2 1 
ATOM   10557 N  N   . ASP D 1 241 ? 29.822  42.078  46.997 1.00 49.61 ? 894  ASP D N   1 
ATOM   10558 C  CA  . ASP D 1 241 ? 30.947  41.349  46.436 1.00 50.87 ? 894  ASP D CA  1 
ATOM   10559 C  C   . ASP D 1 241 ? 32.173  42.027  47.002 1.00 50.15 ? 894  ASP D C   1 
ATOM   10560 O  O   . ASP D 1 241 ? 32.495  43.157  46.615 1.00 49.51 ? 894  ASP D O   1 
ATOM   10561 C  CB  . ASP D 1 241 ? 30.951  41.456  44.912 1.00 52.70 ? 894  ASP D CB  1 
ATOM   10562 C  CG  . ASP D 1 241 ? 32.167  40.802  44.292 1.00 55.46 ? 894  ASP D CG  1 
ATOM   10563 O  OD1 . ASP D 1 241 ? 33.269  40.955  44.864 1.00 57.78 ? 894  ASP D OD1 1 
ATOM   10564 O  OD2 . ASP D 1 241 ? 32.030  40.153  43.238 1.00 55.85 ? 894  ASP D OD2 1 
ATOM   10565 N  N   . LEU D 1 242 ? 32.856  41.333  47.914 1.00 49.02 ? 895  LEU D N   1 
ATOM   10566 C  CA  . LEU D 1 242 ? 34.026  41.903  48.579 1.00 47.42 ? 895  LEU D CA  1 
ATOM   10567 C  C   . LEU D 1 242 ? 35.164  42.268  47.648 1.00 46.36 ? 895  LEU D C   1 
ATOM   10568 O  O   . LEU D 1 242 ? 36.053  43.005  48.040 1.00 43.35 ? 895  LEU D O   1 
ATOM   10569 C  CB  . LEU D 1 242 ? 34.509  40.974  49.689 1.00 48.13 ? 895  LEU D CB  1 
ATOM   10570 C  CG  . LEU D 1 242 ? 33.513  40.845  50.841 1.00 49.25 ? 895  LEU D CG  1 
ATOM   10571 C  CD1 . LEU D 1 242 ? 34.102  39.942  51.931 1.00 49.67 ? 895  LEU D CD1 1 
ATOM   10572 C  CD2 . LEU D 1 242 ? 33.179  42.233  51.384 1.00 46.61 ? 895  LEU D CD2 1 
ATOM   10573 N  N   . LYS D 1 243 ? 35.142  41.750  46.425 1.00 46.89 ? 896  LYS D N   1 
ATOM   10574 C  CA  . LYS D 1 243 ? 36.168  42.111  45.448 1.00 49.71 ? 896  LYS D CA  1 
ATOM   10575 C  C   . LYS D 1 243 ? 36.142  43.645  45.208 1.00 50.65 ? 896  LYS D C   1 
ATOM   10576 O  O   . LYS D 1 243 ? 37.162  44.265  44.885 1.00 50.42 ? 896  LYS D O   1 
ATOM   10577 C  CB  . LYS D 1 243 ? 35.915  41.361  44.122 1.00 51.71 ? 896  LYS D CB  1 
ATOM   10578 C  CG  . LYS D 1 243 ? 36.904  41.651  42.986 1.00 53.14 ? 896  LYS D CG  1 
ATOM   10579 C  CD  . LYS D 1 243 ? 37.037  40.452  42.034 1.00 56.49 ? 896  LYS D CD  1 
ATOM   10580 C  CE  . LYS D 1 243 ? 38.409  40.421  41.309 1.00 58.99 ? 896  LYS D CE  1 
ATOM   10581 N  NZ  . LYS D 1 243 ? 38.724  39.090  40.667 1.00 60.18 ? 896  LYS D NZ  1 
ATOM   10582 N  N   . LYS D 1 244 ? 34.970  44.249  45.390 1.00 51.27 ? 897  LYS D N   1 
ATOM   10583 C  CA  . LYS D 1 244 ? 34.808  45.680  45.185 1.00 51.22 ? 897  LYS D CA  1 
ATOM   10584 C  C   . LYS D 1 244 ? 34.820  46.447  46.491 1.00 51.04 ? 897  LYS D C   1 
ATOM   10585 O  O   . LYS D 1 244 ? 34.726  47.678  46.501 1.00 51.43 ? 897  LYS D O   1 
ATOM   10586 C  CB  . LYS D 1 244 ? 33.503  45.947  44.429 1.00 52.33 ? 897  LYS D CB  1 
ATOM   10587 C  CG  . LYS D 1 244 ? 33.423  45.137  43.146 1.00 53.77 ? 897  LYS D CG  1 
ATOM   10588 C  CD  . LYS D 1 244 ? 32.225  45.483  42.291 1.00 54.67 ? 897  LYS D CD  1 
ATOM   10589 C  CE  . LYS D 1 244 ? 32.280  44.702  40.980 1.00 55.85 ? 897  LYS D CE  1 
ATOM   10590 N  NZ  . LYS D 1 244 ? 33.592  44.847  40.274 1.00 55.66 ? 897  LYS D NZ  1 
ATOM   10591 N  N   . HIS D 1 245 ? 34.954  45.720  47.594 1.00 49.21 ? 898  HIS D N   1 
ATOM   10592 C  CA  . HIS D 1 245 ? 34.984  46.321  48.923 1.00 47.41 ? 898  HIS D CA  1 
ATOM   10593 C  C   . HIS D 1 245 ? 35.830  47.603  49.064 1.00 48.37 ? 898  HIS D C   1 
ATOM   10594 O  O   . HIS D 1 245 ? 35.388  48.593  49.654 1.00 47.14 ? 898  HIS D O   1 
ATOM   10595 C  CB  . HIS D 1 245 ? 35.484  45.284  49.956 1.00 45.09 ? 898  HIS D CB  1 
ATOM   10596 C  CG  . HIS D 1 245 ? 35.803  45.883  51.293 1.00 42.46 ? 898  HIS D CG  1 
ATOM   10597 N  ND1 . HIS D 1 245 ? 34.854  46.034  52.287 1.00 41.52 ? 898  HIS D ND1 1 
ATOM   10598 C  CD2 . HIS D 1 245 ? 36.922  46.505  51.741 1.00 39.50 ? 898  HIS D CD2 1 
ATOM   10599 C  CE1 . HIS D 1 245 ? 35.378  46.730  53.284 1.00 41.30 ? 898  HIS D CE1 1 
ATOM   10600 N  NE2 . HIS D 1 245 ? 36.631  47.029  52.976 1.00 40.13 ? 898  HIS D NE2 1 
ATOM   10601 N  N   . PHE D 1 246 ? 37.060  47.582  48.563 1.00 50.12 ? 899  PHE D N   1 
ATOM   10602 C  CA  . PHE D 1 246 ? 37.928  48.751  48.723 1.00 52.13 ? 899  PHE D CA  1 
ATOM   10603 C  C   . PHE D 1 246 ? 37.535  49.895  47.815 1.00 53.01 ? 899  PHE D C   1 
ATOM   10604 O  O   . PHE D 1 246 ? 37.844  51.048  48.108 1.00 53.32 ? 899  PHE D O   1 
ATOM   10605 C  CB  . PHE D 1 246 ? 39.410  48.398  48.485 1.00 51.79 ? 899  PHE D CB  1 
ATOM   10606 C  CG  . PHE D 1 246 ? 40.014  47.520  49.560 1.00 52.20 ? 899  PHE D CG  1 
ATOM   10607 C  CD1 . PHE D 1 246 ? 39.951  46.123  49.471 1.00 52.12 ? 899  PHE D CD1 1 
ATOM   10608 C  CD2 . PHE D 1 246 ? 40.622  48.091  50.677 1.00 52.40 ? 899  PHE D CD2 1 
ATOM   10609 C  CE1 . PHE D 1 246 ? 40.483  45.316  50.481 1.00 51.63 ? 899  PHE D CE1 1 
ATOM   10610 C  CE2 . PHE D 1 246 ? 41.159  47.301  51.690 1.00 51.76 ? 899  PHE D CE2 1 
ATOM   10611 C  CZ  . PHE D 1 246 ? 41.089  45.908  51.595 1.00 52.37 ? 899  PHE D CZ  1 
ATOM   10612 N  N   . ASP D 1 247 ? 36.874  49.578  46.705 1.00 53.71 ? 900  ASP D N   1 
ATOM   10613 C  CA  . ASP D 1 247 ? 36.440  50.617  45.790 1.00 54.13 ? 900  ASP D CA  1 
ATOM   10614 C  C   . ASP D 1 247 ? 35.290  51.367  46.489 1.00 53.73 ? 900  ASP D C   1 
ATOM   10615 O  O   . ASP D 1 247 ? 35.291  52.598  46.610 1.00 54.04 ? 900  ASP D O   1 
ATOM   10616 C  CB  . ASP D 1 247 ? 35.982  50.007  44.464 1.00 53.75 ? 900  ASP D CB  1 
ATOM   10617 C  CG  . ASP D 1 247 ? 37.143  49.490  43.620 1.00 55.08 ? 900  ASP D CG  1 
ATOM   10618 O  OD1 . ASP D 1 247 ? 38.206  50.160  43.571 1.00 53.79 ? 900  ASP D OD1 1 
ATOM   10619 O  OD2 . ASP D 1 247 ? 36.985  48.420  42.977 1.00 56.39 ? 900  ASP D OD2 1 
ATOM   10620 N  N   . PHE D 1 248 ? 34.324  50.623  46.991 1.00 53.62 ? 901  PHE D N   1 
ATOM   10621 C  CA  . PHE D 1 248 ? 33.226  51.264  47.675 1.00 54.74 ? 901  PHE D CA  1 
ATOM   10622 C  C   . PHE D 1 248 ? 33.660  52.152  48.836 1.00 54.54 ? 901  PHE D C   1 
ATOM   10623 O  O   . PHE D 1 248 ? 33.265  53.318  48.926 1.00 57.04 ? 901  PHE D O   1 
ATOM   10624 C  CB  . PHE D 1 248 ? 32.226  50.211  48.145 1.00 53.66 ? 901  PHE D CB  1 
ATOM   10625 C  CG  . PHE D 1 248 ? 31.313  49.720  47.048 1.00 54.75 ? 901  PHE D CG  1 
ATOM   10626 C  CD1 . PHE D 1 248 ? 31.516  48.480  46.454 1.00 54.40 ? 901  PHE D CD1 1 
ATOM   10627 C  CD2 . PHE D 1 248 ? 30.262  50.525  46.578 1.00 54.34 ? 901  PHE D CD2 1 
ATOM   10628 C  CE1 . PHE D 1 248 ? 30.682  48.041  45.400 1.00 55.11 ? 901  PHE D CE1 1 
ATOM   10629 C  CE2 . PHE D 1 248 ? 29.427  50.093  45.526 1.00 53.46 ? 901  PHE D CE2 1 
ATOM   10630 C  CZ  . PHE D 1 248 ? 29.640  48.852  44.939 1.00 54.53 ? 901  PHE D CZ  1 
ATOM   10631 N  N   . LEU D 1 249 ? 34.475  51.611  49.724 1.00 54.38 ? 902  LEU D N   1 
ATOM   10632 C  CA  . LEU D 1 249 ? 34.953  52.361  50.875 1.00 54.59 ? 902  LEU D CA  1 
ATOM   10633 C  C   . LEU D 1 249 ? 35.641  53.665  50.459 1.00 55.20 ? 902  LEU D C   1 
ATOM   10634 O  O   . LEU D 1 249 ? 35.493  54.687  51.131 1.00 55.18 ? 902  LEU D O   1 
ATOM   10635 C  CB  . LEU D 1 249 ? 35.923  51.484  51.684 1.00 53.71 ? 902  LEU D CB  1 
ATOM   10636 C  CG  . LEU D 1 249 ? 36.384  51.889  53.091 1.00 53.46 ? 902  LEU D CG  1 
ATOM   10637 C  CD1 . LEU D 1 249 ? 35.180  51.925  54.036 1.00 52.42 ? 902  LEU D CD1 1 
ATOM   10638 C  CD2 . LEU D 1 249 ? 37.440  50.888  53.608 1.00 52.00 ? 902  LEU D CD2 1 
ATOM   10639 N  N   . ALA D 1 250 ? 36.403  53.640  49.366 1.00 56.74 ? 903  ALA D N   1 
ATOM   10640 C  CA  . ALA D 1 250 ? 37.102  54.853  48.905 1.00 58.41 ? 903  ALA D CA  1 
ATOM   10641 C  C   . ALA D 1 250 ? 36.094  55.868  48.367 1.00 59.55 ? 903  ALA D C   1 
ATOM   10642 O  O   . ALA D 1 250 ? 36.305  57.086  48.434 1.00 59.24 ? 903  ALA D O   1 
ATOM   10643 C  CB  . ALA D 1 250 ? 38.113  54.498  47.825 1.00 57.76 ? 903  ALA D CB  1 
ATOM   10644 N  N   . GLU D 1 251 ? 35.003  55.338  47.821 1.00 61.00 ? 904  GLU D N   1 
ATOM   10645 C  CA  . GLU D 1 251 ? 33.902  56.138  47.292 1.00 62.93 ? 904  GLU D CA  1 
ATOM   10646 C  C   . GLU D 1 251 ? 33.253  56.817  48.473 1.00 63.48 ? 904  GLU D C   1 
ATOM   10647 O  O   . GLU D 1 251 ? 33.428  58.017  48.693 1.00 64.17 ? 904  GLU D O   1 
ATOM   10648 C  CB  . GLU D 1 251 ? 32.862  55.233  46.634 1.00 64.76 ? 904  GLU D CB  1 
ATOM   10649 C  CG  . GLU D 1 251 ? 33.216  54.813  45.230 1.00 68.13 ? 904  GLU D CG  1 
ATOM   10650 C  CD  . GLU D 1 251 ? 32.922  55.920  44.232 1.00 70.16 ? 904  GLU D CD  1 
ATOM   10651 O  OE1 . GLU D 1 251 ? 31.726  56.100  43.884 1.00 71.21 ? 904  GLU D OE1 1 
ATOM   10652 O  OE2 . GLU D 1 251 ? 33.881  56.619  43.808 1.00 71.12 ? 904  GLU D OE2 1 
ATOM   10653 N  N   . PHE D 1 252 ? 32.503  56.022  49.234 1.00 63.21 ? 905  PHE D N   1 
ATOM   10654 C  CA  . PHE D 1 252 ? 31.811  56.511  50.409 1.00 63.07 ? 905  PHE D CA  1 
ATOM   10655 C  C   . PHE D 1 252 ? 32.683  57.527  51.132 1.00 63.61 ? 905  PHE D C   1 
ATOM   10656 O  O   . PHE D 1 252 ? 32.260  58.659  51.385 1.00 64.97 ? 905  PHE D O   1 
ATOM   10657 C  CB  . PHE D 1 252 ? 31.495  55.354  51.350 1.00 62.87 ? 905  PHE D CB  1 
ATOM   10658 C  CG  . PHE D 1 252 ? 30.829  55.780  52.625 1.00 62.83 ? 905  PHE D CG  1 
ATOM   10659 C  CD1 . PHE D 1 252 ? 29.436  55.917  52.693 1.00 63.12 ? 905  PHE D CD1 1 
ATOM   10660 C  CD2 . PHE D 1 252 ? 31.590  56.066  53.758 1.00 62.22 ? 905  PHE D CD2 1 
ATOM   10661 C  CE1 . PHE D 1 252 ? 28.811  56.338  53.883 1.00 62.21 ? 905  PHE D CE1 1 
ATOM   10662 C  CE2 . PHE D 1 252 ? 30.982  56.487  54.947 1.00 62.06 ? 905  PHE D CE2 1 
ATOM   10663 C  CZ  . PHE D 1 252 ? 29.589  56.622  55.012 1.00 62.19 ? 905  PHE D CZ  1 
ATOM   10664 N  N   . ASN D 1 253 ? 33.911  57.150  51.456 1.00 63.07 ? 906  ASN D N   1 
ATOM   10665 C  CA  . ASN D 1 253 ? 34.759  58.096  52.162 1.00 62.72 ? 906  ASN D CA  1 
ATOM   10666 C  C   . ASN D 1 253 ? 34.957  59.402  51.406 1.00 62.92 ? 906  ASN D C   1 
ATOM   10667 O  O   . ASN D 1 253 ? 34.920  60.467  52.009 1.00 64.09 ? 906  ASN D O   1 
ATOM   10668 C  CB  . ASN D 1 253 ? 36.104  57.465  52.521 1.00 61.58 ? 906  ASN D CB  1 
ATOM   10669 C  CG  . ASN D 1 253 ? 35.987  56.515  53.696 1.00 61.61 ? 906  ASN D CG  1 
ATOM   10670 O  OD1 . ASN D 1 253 ? 35.273  56.798  54.662 1.00 59.36 ? 906  ASN D OD1 1 
ATOM   10671 N  ND2 . ASN D 1 253 ? 36.694  55.385  53.628 1.00 61.06 ? 906  ASN D ND2 1 
ATOM   10672 N  N   . ALA D 1 254 ? 35.170  59.339  50.097 1.00 62.37 ? 907  ALA D N   1 
ATOM   10673 C  CA  . ALA D 1 254 ? 35.335  60.565  49.330 1.00 62.66 ? 907  ALA D CA  1 
ATOM   10674 C  C   . ALA D 1 254 ? 34.135  61.513  49.598 1.00 63.36 ? 907  ALA D C   1 
ATOM   10675 O  O   . ALA D 1 254 ? 34.323  62.695  49.909 1.00 63.16 ? 907  ALA D O   1 
ATOM   10676 C  CB  . ALA D 1 254 ? 35.441  60.232  47.848 1.00 61.68 ? 907  ALA D CB  1 
ATOM   10677 N  N   . LYS D 1 255 ? 32.911  60.986  49.489 1.00 64.21 ? 908  LYS D N   1 
ATOM   10678 C  CA  . LYS D 1 255 ? 31.703  61.777  49.745 1.00 64.46 ? 908  LYS D CA  1 
ATOM   10679 C  C   . LYS D 1 255 ? 31.620  62.116  51.231 1.00 65.03 ? 908  LYS D C   1 
ATOM   10680 O  O   . LYS D 1 255 ? 32.096  63.163  51.676 1.00 64.77 ? 908  LYS D O   1 
ATOM   10681 C  CB  . LYS D 1 255 ? 30.438  60.992  49.359 1.00 64.39 ? 908  LYS D CB  1 
ATOM   10682 C  CG  . LYS D 1 255 ? 30.239  60.737  47.869 1.00 65.00 ? 908  LYS D CG  1 
ATOM   10683 C  CD  . LYS D 1 255 ? 29.630  61.945  47.152 1.00 65.25 ? 908  LYS D CD  1 
ATOM   10684 C  CE  . LYS D 1 255 ? 29.339  61.611  45.687 1.00 65.10 ? 908  LYS D CE  1 
ATOM   10685 N  NZ  . LYS D 1 255 ? 28.723  62.763  44.943 1.00 64.57 ? 908  LYS D NZ  1 
ATOM   10686 N  N   . ALA D 1 256 ? 31.007  61.200  51.981 1.00 65.87 ? 909  ALA D N   1 
ATOM   10687 C  CA  . ALA D 1 256 ? 30.798  61.325  53.424 1.00 66.57 ? 909  ALA D CA  1 
ATOM   10688 C  C   . ALA D 1 256 ? 31.834  62.155  54.184 1.00 67.18 ? 909  ALA D C   1 
ATOM   10689 O  O   . ALA D 1 256 ? 31.564  63.301  54.560 1.00 68.60 ? 909  ALA D O   1 
ATOM   10690 C  CB  . ALA D 1 256 ? 30.688  59.942  54.048 1.00 66.44 ? 909  ALA D CB  1 
ATOM   10691 N  N   . ASN D 1 257 ? 33.012  61.594  54.416 1.00 67.14 ? 910  ASN D N   1 
ATOM   10692 C  CA  . ASN D 1 257 ? 34.031  62.327  55.156 1.00 68.38 ? 910  ASN D CA  1 
ATOM   10693 C  C   . ASN D 1 257 ? 35.436  62.094  54.654 1.00 69.62 ? 910  ASN D C   1 
ATOM   10694 O  O   . ASN D 1 257 ? 36.110  61.159  55.080 1.00 70.03 ? 910  ASN D O   1 
ATOM   10695 C  CB  . ASN D 1 257 ? 33.942  61.995  56.657 1.00 68.51 ? 910  ASN D CB  1 
ATOM   10696 C  CG  . ASN D 1 257 ? 33.656  60.498  56.937 1.00 68.23 ? 910  ASN D CG  1 
ATOM   10697 O  OD1 . ASN D 1 257 ? 33.118  60.160  57.997 1.00 68.50 ? 910  ASN D OD1 1 
ATOM   10698 N  ND2 . ASN D 1 257 ? 34.023  59.614  56.006 1.00 66.28 ? 910  ASN D ND2 1 
ATOM   10699 N  N   . ASP D 1 258 ? 35.870  62.946  53.730 1.00 71.01 ? 911  ASP D N   1 
ATOM   10700 C  CA  . ASP D 1 258 ? 37.214  62.844  53.172 1.00 72.14 ? 911  ASP D CA  1 
ATOM   10701 C  C   . ASP D 1 258 ? 37.862  64.229  53.088 1.00 72.47 ? 911  ASP D C   1 
ATOM   10702 O  O   . ASP D 1 258 ? 37.613  65.101  53.934 1.00 71.60 ? 911  ASP D O   1 
ATOM   10703 C  CB  . ASP D 1 258 ? 37.154  62.189  51.782 1.00 72.66 ? 911  ASP D CB  1 
ATOM   10704 C  CG  . ASP D 1 258 ? 38.197  61.076  51.612 1.00 73.51 ? 911  ASP D CG  1 
ATOM   10705 O  OD1 . ASP D 1 258 ? 38.387  60.289  52.578 1.00 73.04 ? 911  ASP D OD1 1 
ATOM   10706 O  OD2 . ASP D 1 258 ? 38.817  60.982  50.519 1.00 72.97 ? 911  ASP D OD2 1 
ATOM   10707 N  N   . VAL D 1 259 ? 38.712  64.415  52.080 1.00 73.32 ? 912  VAL D N   1 
ATOM   10708 C  CA  . VAL D 1 259 ? 39.371  65.705  51.855 1.00 74.19 ? 912  VAL D CA  1 
ATOM   10709 C  C   . VAL D 1 259 ? 38.260  66.617  51.311 1.00 74.38 ? 912  VAL D C   1 
ATOM   10710 O  O   . VAL D 1 259 ? 37.529  66.233  50.387 1.00 74.16 ? 912  VAL D O   1 
ATOM   10711 C  CB  . VAL D 1 259 ? 40.533  65.552  50.809 1.00 74.09 ? 912  VAL D CB  1 
ATOM   10712 C  CG1 . VAL D 1 259 ? 41.040  66.937  50.346 1.00 73.76 ? 912  VAL D CG1 1 
ATOM   10713 C  CG2 . VAL D 1 259 ? 41.676  64.713  51.431 1.00 73.37 ? 912  VAL D CG2 1 
ATOM   10714 N  N   . ASN D 1 260 ? 38.099  67.800  51.897 1.00 74.69 ? 913  ASN D N   1 
ATOM   10715 C  CA  . ASN D 1 260 ? 37.045  68.706  51.436 1.00 74.91 ? 913  ASN D CA  1 
ATOM   10716 C  C   . ASN D 1 260 ? 35.659  68.083  51.695 1.00 74.81 ? 913  ASN D C   1 
ATOM   10717 O  O   . ASN D 1 260 ? 34.652  68.794  51.834 1.00 74.53 ? 913  ASN D O   1 
ATOM   10718 C  CB  . ASN D 1 260 ? 37.206  68.983  49.931 1.00 75.05 ? 913  ASN D CB  1 
ATOM   10719 C  CG  . ASN D 1 260 ? 38.646  69.315  49.546 1.00 75.13 ? 913  ASN D CG  1 
ATOM   10720 O  OD1 . ASN D 1 260 ? 39.339  70.053  50.259 1.00 75.22 ? 913  ASN D OD1 1 
ATOM   10721 N  ND2 . ASN D 1 260 ? 39.096  68.787  48.405 1.00 75.10 ? 913  ASN D ND2 1 
ATOM   10722 N  N   . SER D 1 261 ? 35.631  66.750  51.766 1.00 74.65 ? 914  SER D N   1 
ATOM   10723 C  CA  . SER D 1 261 ? 34.410  65.961  51.991 1.00 74.36 ? 914  SER D CA  1 
ATOM   10724 C  C   . SER D 1 261 ? 33.204  66.432  51.166 1.00 74.36 ? 914  SER D C   1 
ATOM   10725 O  O   . SER D 1 261 ? 32.877  65.812  50.145 1.00 74.29 ? 914  SER D O   1 
ATOM   10726 C  CB  . SER D 1 261 ? 34.030  65.951  53.486 1.00 74.28 ? 914  SER D CB  1 
ATOM   10727 O  OG  . SER D 1 261 ? 35.008  65.303  54.265 1.00 74.28 ? 914  SER D OG  1 
ATOM   10728 N  N   . ASN D 1 262 ? 32.558  67.514  51.623 1.00 73.57 ? 915  ASN D N   1 
ATOM   10729 C  CA  . ASN D 1 262 ? 31.358  68.090  50.993 1.00 73.05 ? 915  ASN D CA  1 
ATOM   10730 C  C   . ASN D 1 262 ? 30.145  67.566  51.746 1.00 72.29 ? 915  ASN D C   1 
ATOM   10731 O  O   . ASN D 1 262 ? 29.054  68.135  51.674 1.00 72.95 ? 915  ASN D O   1 
ATOM   10732 C  CB  . ASN D 1 262 ? 31.245  67.685  49.512 1.00 73.23 ? 915  ASN D CB  1 
ATOM   10733 C  CG  . ASN D 1 262 ? 32.414  68.195  48.687 1.00 73.58 ? 915  ASN D CG  1 
ATOM   10734 O  OD1 . ASN D 1 262 ? 32.532  69.404  48.459 1.00 73.50 ? 915  ASN D OD1 1 
ATOM   10735 N  ND2 . ASN D 1 262 ? 33.297  67.282  48.254 1.00 73.32 ? 915  ASN D ND2 1 
ATOM   10736 N  N   . GLY D 1 263 ? 30.359  66.468  52.469 1.00 71.12 ? 916  GLY D N   1 
ATOM   10737 C  CA  . GLY D 1 263 ? 29.296  65.851  53.236 1.00 68.81 ? 916  GLY D CA  1 
ATOM   10738 C  C   . GLY D 1 263 ? 28.395  65.021  52.349 1.00 67.92 ? 916  GLY D C   1 
ATOM   10739 O  O   . GLY D 1 263 ? 28.425  65.119  51.123 1.00 66.91 ? 916  GLY D O   1 
ATOM   10740 N  N   . ILE D 1 264 ? 27.582  64.197  52.992 1.00 67.75 ? 917  ILE D N   1 
ATOM   10741 C  CA  . ILE D 1 264 ? 26.649  63.328  52.302 1.00 67.49 ? 917  ILE D CA  1 
ATOM   10742 C  C   . ILE D 1 264 ? 25.330  64.090  52.088 1.00 68.42 ? 917  ILE D C   1 
ATOM   10743 O  O   . ILE D 1 264 ? 24.565  64.324  53.037 1.00 68.72 ? 917  ILE D O   1 
ATOM   10744 C  CB  . ILE D 1 264 ? 26.446  62.035  53.135 1.00 67.07 ? 917  ILE D CB  1 
ATOM   10745 C  CG1 . ILE D 1 264 ? 25.061  61.438  52.887 1.00 66.66 ? 917  ILE D CG1 1 
ATOM   10746 C  CG2 . ILE D 1 264 ? 26.698  62.338  54.613 1.00 67.52 ? 917  ILE D CG2 1 
ATOM   10747 C  CD1 . ILE D 1 264 ? 24.861  60.958  51.481 1.00 67.30 ? 917  ILE D CD1 1 
ATOM   10748 N  N   . GLU D 1 265 ? 25.073  64.471  50.833 1.00 68.29 ? 918  GLU D N   1 
ATOM   10749 C  CA  . GLU D 1 265 ? 23.873  65.227  50.470 1.00 67.87 ? 918  GLU D CA  1 
ATOM   10750 C  C   . GLU D 1 265 ? 22.636  64.345  50.234 1.00 67.61 ? 918  GLU D C   1 
ATOM   10751 O  O   . GLU D 1 265 ? 22.410  63.852  49.130 1.00 67.32 ? 918  GLU D O   1 
ATOM   10752 C  CB  . GLU D 1 265 ? 24.192  66.080  49.245 1.00 69.21 ? 918  GLU D CB  1 
ATOM   10753 C  CG  . GLU D 1 265 ? 25.618  66.671  49.327 1.00 71.51 ? 918  GLU D CG  1 
ATOM   10754 C  CD  . GLU D 1 265 ? 25.743  68.086  48.747 1.00 72.79 ? 918  GLU D CD  1 
ATOM   10755 O  OE1 . GLU D 1 265 ? 25.209  68.344  47.638 1.00 73.93 ? 918  GLU D OE1 1 
ATOM   10756 O  OE2 . GLU D 1 265 ? 26.397  68.938  49.398 1.00 72.97 ? 918  GLU D OE2 1 
ATOM   10757 N  N   . TRP D 1 266 ? 21.839  64.172  51.290 1.00 66.46 ? 919  TRP D N   1 
ATOM   10758 C  CA  . TRP D 1 266 ? 20.636  63.340  51.264 1.00 66.53 ? 919  TRP D CA  1 
ATOM   10759 C  C   . TRP D 1 266 ? 19.679  63.692  50.149 1.00 66.43 ? 919  TRP D C   1 
ATOM   10760 O  O   . TRP D 1 266 ? 18.762  62.921  49.816 1.00 65.61 ? 919  TRP D O   1 
ATOM   10761 C  CB  . TRP D 1 266 ? 19.924  63.413  52.623 1.00 67.97 ? 919  TRP D CB  1 
ATOM   10762 C  CG  . TRP D 1 266 ? 20.880  63.103  53.750 1.00 68.92 ? 919  TRP D CG  1 
ATOM   10763 C  CD1 . TRP D 1 266 ? 21.624  64.008  54.474 1.00 68.37 ? 919  TRP D CD1 1 
ATOM   10764 C  CD2 . TRP D 1 266 ? 21.324  61.799  54.159 1.00 68.73 ? 919  TRP D CD2 1 
ATOM   10765 N  NE1 . TRP D 1 266 ? 22.505  63.343  55.295 1.00 69.26 ? 919  TRP D NE1 1 
ATOM   10766 C  CE2 . TRP D 1 266 ? 22.344  61.988  55.125 1.00 69.72 ? 919  TRP D CE2 1 
ATOM   10767 C  CE3 . TRP D 1 266 ? 20.961  60.488  53.797 1.00 69.25 ? 919  TRP D CE3 1 
ATOM   10768 C  CZ2 . TRP D 1 266 ? 23.012  60.909  55.737 1.00 68.95 ? 919  TRP D CZ2 1 
ATOM   10769 C  CZ3 . TRP D 1 266 ? 21.627  59.411  54.405 1.00 68.76 ? 919  TRP D CZ3 1 
ATOM   10770 C  CH2 . TRP D 1 266 ? 22.638  59.634  55.364 1.00 69.17 ? 919  TRP D CH2 1 
ATOM   10771 N  N   . SER D 1 267 ? 19.889  64.877  49.585 1.00 65.77 ? 920  SER D N   1 
ATOM   10772 C  CA  . SER D 1 267 ? 19.091  65.356  48.458 1.00 64.49 ? 920  SER D CA  1 
ATOM   10773 C  C   . SER D 1 267 ? 19.628  64.667  47.180 1.00 63.74 ? 920  SER D C   1 
ATOM   10774 O  O   . SER D 1 267 ? 18.882  64.435  46.233 1.00 62.55 ? 920  SER D O   1 
ATOM   10775 C  CB  . SER D 1 267 ? 19.200  66.892  48.352 1.00 63.21 ? 920  SER D CB  1 
ATOM   10776 O  OG  . SER D 1 267 ? 20.474  67.373  48.752 1.00 61.70 ? 920  SER D OG  1 
ATOM   10777 N  N   . ASN D 1 268 ? 20.924  64.335  47.180 1.00 62.95 ? 921  ASN D N   1 
ATOM   10778 C  CA  . ASN D 1 268 ? 21.561  63.667  46.041 1.00 61.78 ? 921  ASN D CA  1 
ATOM   10779 C  C   . ASN D 1 268 ? 21.130  62.211  46.047 1.00 60.88 ? 921  ASN D C   1 
ATOM   10780 O  O   . ASN D 1 268 ? 21.158  61.566  47.086 1.00 61.21 ? 921  ASN D O   1 
ATOM   10781 C  CB  . ASN D 1 268 ? 23.087  63.770  46.143 1.00 61.10 ? 921  ASN D CB  1 
ATOM   10782 C  CG  . ASN D 1 268 ? 23.784  63.312  44.872 1.00 62.09 ? 921  ASN D CG  1 
ATOM   10783 O  OD1 . ASN D 1 268 ? 23.599  62.169  44.421 1.00 63.23 ? 921  ASN D OD1 1 
ATOM   10784 N  ND2 . ASN D 1 268 ? 24.586  64.197  44.281 1.00 60.29 ? 921  ASN D ND2 1 
ATOM   10785 N  N   . GLU D 1 269 ? 20.729  61.702  44.891 1.00 60.53 ? 922  GLU D N   1 
ATOM   10786 C  CA  . GLU D 1 269 ? 20.253  60.326  44.744 1.00 60.96 ? 922  GLU D CA  1 
ATOM   10787 C  C   . GLU D 1 269 ? 21.390  59.308  44.807 1.00 61.53 ? 922  GLU D C   1 
ATOM   10788 O  O   . GLU D 1 269 ? 21.270  58.240  45.406 1.00 61.16 ? 922  GLU D O   1 
ATOM   10789 C  CB  . GLU D 1 269 ? 19.557  60.214  43.408 1.00 61.87 ? 922  GLU D CB  1 
ATOM   10790 C  CG  . GLU D 1 269 ? 18.698  59.004  43.204 1.00 63.76 ? 922  GLU D CG  1 
ATOM   10791 C  CD  . GLU D 1 269 ? 17.810  59.189  41.972 1.00 66.16 ? 922  GLU D CD  1 
ATOM   10792 O  OE1 . GLU D 1 269 ? 18.359  59.241  40.836 1.00 66.03 ? 922  GLU D OE1 1 
ATOM   10793 O  OE2 . GLU D 1 269 ? 16.563  59.307  42.142 1.00 66.91 ? 922  GLU D OE2 1 
ATOM   10794 N  N   . ASN D 1 270 ? 22.486  59.642  44.143 1.00 62.30 ? 923  ASN D N   1 
ATOM   10795 C  CA  . ASN D 1 270 ? 23.660  58.790  44.126 1.00 62.92 ? 923  ASN D CA  1 
ATOM   10796 C  C   . ASN D 1 270 ? 24.138  58.712  45.557 1.00 63.34 ? 923  ASN D C   1 
ATOM   10797 O  O   . ASN D 1 270 ? 24.305  57.624  46.115 1.00 64.69 ? 923  ASN D O   1 
ATOM   10798 C  CB  . ASN D 1 270 ? 24.722  59.413  43.242 1.00 62.38 ? 923  ASN D CB  1 
ATOM   10799 C  CG  . ASN D 1 270 ? 24.344  59.347  41.787 1.00 63.29 ? 923  ASN D CG  1 
ATOM   10800 O  OD1 . ASN D 1 270 ? 24.905  60.056  40.957 1.00 64.03 ? 923  ASN D OD1 1 
ATOM   10801 N  ND2 . ASN D 1 270 ? 23.383  58.475  41.461 1.00 63.49 ? 923  ASN D ND2 1 
ATOM   10802 N  N   . ASP D 1 271 ? 24.358  59.878  46.151 1.00 62.06 ? 924  ASP D N   1 
ATOM   10803 C  CA  . ASP D 1 271 ? 24.758  59.931  47.540 1.00 61.65 ? 924  ASP D CA  1 
ATOM   10804 C  C   . ASP D 1 271 ? 23.915  58.933  48.354 1.00 60.72 ? 924  ASP D C   1 
ATOM   10805 O  O   . ASP D 1 271 ? 24.432  58.242  49.230 1.00 60.75 ? 924  ASP D O   1 
ATOM   10806 C  CB  . ASP D 1 271 ? 24.575  61.355  48.068 1.00 61.59 ? 924  ASP D CB  1 
ATOM   10807 C  CG  . ASP D 1 271 ? 25.786  62.244  47.783 1.00 62.38 ? 924  ASP D CG  1 
ATOM   10808 O  OD1 . ASP D 1 271 ? 26.425  62.082  46.708 1.00 61.75 ? 924  ASP D OD1 1 
ATOM   10809 O  OD2 . ASP D 1 271 ? 26.090  63.109  48.637 1.00 63.19 ? 924  ASP D OD2 1 
ATOM   10810 N  N   . ARG D 1 272 ? 22.627  58.834  48.037 1.00 60.14 ? 925  ARG D N   1 
ATOM   10811 C  CA  . ARG D 1 272 ? 21.731  57.924  48.745 1.00 59.01 ? 925  ARG D CA  1 
ATOM   10812 C  C   . ARG D 1 272 ? 22.014  56.446  48.473 1.00 57.90 ? 925  ARG D C   1 
ATOM   10813 O  O   . ARG D 1 272 ? 22.029  55.629  49.393 1.00 57.99 ? 925  ARG D O   1 
ATOM   10814 C  CB  . ARG D 1 272 ? 20.264  58.248  48.416 1.00 58.44 ? 925  ARG D CB  1 
ATOM   10815 C  CG  . ARG D 1 272 ? 19.582  59.125  49.464 1.00 58.43 ? 925  ARG D CG  1 
ATOM   10816 C  CD  . ARG D 1 272 ? 18.100  59.344  49.171 1.00 59.55 ? 925  ARG D CD  1 
ATOM   10817 N  NE  . ARG D 1 272 ? 17.856  60.703  48.706 1.00 61.77 ? 925  ARG D NE  1 
ATOM   10818 C  CZ  . ARG D 1 272 ? 17.436  61.010  47.485 1.00 62.35 ? 925  ARG D CZ  1 
ATOM   10819 N  NH1 . ARG D 1 272 ? 17.200  60.040  46.605 1.00 63.03 ? 925  ARG D NH1 1 
ATOM   10820 N  NH2 . ARG D 1 272 ? 17.296  62.286  47.132 1.00 62.96 ? 925  ARG D NH2 1 
ATOM   10821 N  N   . LEU D 1 273 ? 22.239  56.094  47.217 1.00 56.89 ? 926  LEU D N   1 
ATOM   10822 C  CA  . LEU D 1 273 ? 22.518  54.702  46.876 1.00 56.30 ? 926  LEU D CA  1 
ATOM   10823 C  C   . LEU D 1 273 ? 23.793  54.202  47.594 1.00 56.27 ? 926  LEU D C   1 
ATOM   10824 O  O   . LEU D 1 273 ? 23.833  53.088  48.106 1.00 55.63 ? 926  LEU D O   1 
ATOM   10825 C  CB  . LEU D 1 273 ? 22.699  54.575  45.366 1.00 54.16 ? 926  LEU D CB  1 
ATOM   10826 C  CG  . LEU D 1 273 ? 22.756  53.144  44.826 1.00 54.30 ? 926  LEU D CG  1 
ATOM   10827 C  CD1 . LEU D 1 273 ? 21.436  52.426  45.080 1.00 54.16 ? 926  LEU D CD1 1 
ATOM   10828 C  CD2 . LEU D 1 273 ? 23.057  53.181  43.338 1.00 53.61 ? 926  LEU D CD2 1 
ATOM   10829 N  N   . LEU D 1 274 ? 24.816  55.055  47.620 1.00 56.12 ? 927  LEU D N   1 
ATOM   10830 C  CA  . LEU D 1 274 ? 26.102  54.748  48.223 1.00 55.58 ? 927  LEU D CA  1 
ATOM   10831 C  C   . LEU D 1 274 ? 25.979  54.449  49.711 1.00 55.28 ? 927  LEU D C   1 
ATOM   10832 O  O   . LEU D 1 274 ? 26.552  53.492  50.222 1.00 55.91 ? 927  LEU D O   1 
ATOM   10833 C  CB  . LEU D 1 274 ? 27.062  55.914  48.016 1.00 54.22 ? 927  LEU D CB  1 
ATOM   10834 C  CG  . LEU D 1 274 ? 28.530  55.539  48.212 1.00 54.54 ? 927  LEU D CG  1 
ATOM   10835 C  CD1 . LEU D 1 274 ? 28.881  54.389  47.268 1.00 53.20 ? 927  LEU D CD1 1 
ATOM   10836 C  CD2 . LEU D 1 274 ? 29.419  56.750  47.950 1.00 52.82 ? 927  LEU D CD2 1 
ATOM   10837 N  N   . VAL D 1 275 ? 25.226  55.282  50.404 1.00 54.68 ? 928  VAL D N   1 
ATOM   10838 C  CA  . VAL D 1 275 ? 25.016  55.109  51.829 1.00 53.31 ? 928  VAL D CA  1 
ATOM   10839 C  C   . VAL D 1 275 ? 24.318  53.778  52.056 1.00 53.00 ? 928  VAL D C   1 
ATOM   10840 O  O   . VAL D 1 275 ? 24.579  53.093  53.043 1.00 52.65 ? 928  VAL D O   1 
ATOM   10841 C  CB  . VAL D 1 275 ? 24.151  56.272  52.408 1.00 52.71 ? 928  VAL D CB  1 
ATOM   10842 C  CG1 . VAL D 1 275 ? 23.764  55.982  53.831 1.00 53.57 ? 928  VAL D CG1 1 
ATOM   10843 C  CG2 . VAL D 1 275 ? 24.938  57.578  52.362 1.00 52.25 ? 928  VAL D CG2 1 
ATOM   10844 N  N   . CYS D 1 276 ? 23.437  53.406  51.137 1.00 52.11 ? 929  CYS D N   1 
ATOM   10845 C  CA  . CYS D 1 276 ? 22.718  52.151  51.269 1.00 52.37 ? 929  CYS D CA  1 
ATOM   10846 C  C   . CYS D 1 276 ? 23.641  50.969  51.002 1.00 51.28 ? 929  CYS D C   1 
ATOM   10847 O  O   . CYS D 1 276 ? 23.567  49.942  51.669 1.00 51.08 ? 929  CYS D O   1 
ATOM   10848 C  CB  . CYS D 1 276 ? 21.535  52.116  50.298 1.00 54.89 ? 929  CYS D CB  1 
ATOM   10849 S  SG  . CYS D 1 276 ? 20.260  53.365  50.629 1.00 61.32 ? 929  CYS D SG  1 
ATOM   10850 N  N   . GLN D 1 277 ? 24.512  51.117  50.015 1.00 49.84 ? 930  GLN D N   1 
ATOM   10851 C  CA  . GLN D 1 277 ? 25.429  50.050  49.691 1.00 49.01 ? 930  GLN D CA  1 
ATOM   10852 C  C   . GLN D 1 277 ? 26.317  49.790  50.925 1.00 48.25 ? 930  GLN D C   1 
ATOM   10853 O  O   . GLN D 1 277 ? 26.349  48.673  51.463 1.00 47.17 ? 930  GLN D O   1 
ATOM   10854 C  CB  . GLN D 1 277 ? 26.239  50.438  48.442 1.00 46.66 ? 930  GLN D CB  1 
ATOM   10855 C  CG  . GLN D 1 277 ? 25.375  50.452  47.152 1.00 45.98 ? 930  GLN D CG  1 
ATOM   10856 C  CD  . GLN D 1 277 ? 26.094  51.024  45.919 1.00 44.93 ? 930  GLN D CD  1 
ATOM   10857 O  OE1 . GLN D 1 277 ? 26.686  52.118  45.971 1.00 43.90 ? 930  GLN D OE1 1 
ATOM   10858 N  NE2 . GLN D 1 277 ? 26.031  50.295  44.808 1.00 42.99 ? 930  GLN D NE2 1 
ATOM   10859 N  N   . VAL D 1 278 ? 26.998  50.835  51.384 1.00 47.71 ? 931  VAL D N   1 
ATOM   10860 C  CA  . VAL D 1 278 ? 27.847  50.746  52.549 1.00 48.91 ? 931  VAL D CA  1 
ATOM   10861 C  C   . VAL D 1 278 ? 27.073  50.142  53.706 1.00 50.59 ? 931  VAL D C   1 
ATOM   10862 O  O   . VAL D 1 278 ? 27.610  49.348  54.492 1.00 52.91 ? 931  VAL D O   1 
ATOM   10863 C  CB  . VAL D 1 278 ? 28.326  52.111  52.966 1.00 48.32 ? 931  VAL D CB  1 
ATOM   10864 C  CG1 . VAL D 1 278 ? 29.128  52.005  54.242 1.00 48.93 ? 931  VAL D CG1 1 
ATOM   10865 C  CG2 . VAL D 1 278 ? 29.151  52.715  51.858 1.00 47.50 ? 931  VAL D CG2 1 
ATOM   10866 N  N   . CYS D 1 279 ? 25.802  50.505  53.815 1.00 50.98 ? 932  CYS D N   1 
ATOM   10867 C  CA  . CYS D 1 279 ? 24.975  49.978  54.891 1.00 49.81 ? 932  CYS D CA  1 
ATOM   10868 C  C   . CYS D 1 279 ? 24.823  48.470  54.772 1.00 48.84 ? 932  CYS D C   1 
ATOM   10869 O  O   . CYS D 1 279 ? 25.039  47.758  55.757 1.00 47.88 ? 932  CYS D O   1 
ATOM   10870 C  CB  . CYS D 1 279 ? 23.585  50.640  54.894 1.00 50.77 ? 932  CYS D CB  1 
ATOM   10871 S  SG  . CYS D 1 279 ? 22.462  50.101  56.252 1.00 52.61 ? 932  CYS D SG  1 
ATOM   10872 N  N   . ILE D 1 280 ? 24.466  47.987  53.582 1.00 46.17 ? 933  ILE D N   1 
ATOM   10873 C  CA  . ILE D 1 280 ? 24.271  46.545  53.409 1.00 45.68 ? 933  ILE D CA  1 
ATOM   10874 C  C   . ILE D 1 280 ? 25.588  45.748  53.454 1.00 46.96 ? 933  ILE D C   1 
ATOM   10875 O  O   . ILE D 1 280 ? 25.598  44.569  53.782 1.00 46.21 ? 933  ILE D O   1 
ATOM   10876 C  CB  . ILE D 1 280 ? 23.509  46.196  52.097 1.00 42.22 ? 933  ILE D CB  1 
ATOM   10877 C  CG1 . ILE D 1 280 ? 23.136  44.709  52.128 1.00 40.72 ? 933  ILE D CG1 1 
ATOM   10878 C  CG2 . ILE D 1 280 ? 24.370  46.526  50.867 1.00 41.25 ? 933  ILE D CG2 1 
ATOM   10879 C  CD1 . ILE D 1 280 ? 22.144  44.255  51.088 1.00 38.92 ? 933  ILE D CD1 1 
ATOM   10880 N  N   . LYS D 1 281 ? 26.687  46.411  53.128 1.00 48.26 ? 934  LYS D N   1 
ATOM   10881 C  CA  . LYS D 1 281 ? 27.982  45.775  53.162 1.00 49.22 ? 934  LYS D CA  1 
ATOM   10882 C  C   . LYS D 1 281 ? 28.334  45.516  54.623 1.00 51.01 ? 934  LYS D C   1 
ATOM   10883 O  O   . LYS D 1 281 ? 28.901  44.474  54.989 1.00 51.41 ? 934  LYS D O   1 
ATOM   10884 C  CB  . LYS D 1 281 ? 29.032  46.693  52.565 1.00 48.92 ? 934  LYS D CB  1 
ATOM   10885 C  CG  . LYS D 1 281 ? 29.177  46.600  51.066 1.00 49.42 ? 934  LYS D CG  1 
ATOM   10886 C  CD  . LYS D 1 281 ? 30.306  47.540  50.632 1.00 51.08 ? 934  LYS D CD  1 
ATOM   10887 C  CE  . LYS D 1 281 ? 31.662  47.105  51.180 1.00 50.86 ? 934  LYS D CE  1 
ATOM   10888 N  NZ  . LYS D 1 281 ? 31.916  45.695  50.747 1.00 52.82 ? 934  LYS D NZ  1 
ATOM   10889 N  N   . LEU D 1 282 ? 27.995  46.491  55.453 1.00 51.20 ? 935  LEU D N   1 
ATOM   10890 C  CA  . LEU D 1 282 ? 28.259  46.395  56.861 1.00 51.70 ? 935  LEU D CA  1 
ATOM   10891 C  C   . LEU D 1 282 ? 27.414  45.278  57.461 1.00 51.82 ? 935  LEU D C   1 
ATOM   10892 O  O   . LEU D 1 282 ? 27.899  44.479  58.260 1.00 53.05 ? 935  LEU D O   1 
ATOM   10893 C  CB  . LEU D 1 282 ? 27.932  47.718  57.537 1.00 53.20 ? 935  LEU D CB  1 
ATOM   10894 C  CG  . LEU D 1 282 ? 28.561  47.851  58.931 1.00 55.29 ? 935  LEU D CG  1 
ATOM   10895 C  CD1 . LEU D 1 282 ? 30.079  47.711  58.814 1.00 56.70 ? 935  LEU D CD1 1 
ATOM   10896 C  CD2 . LEU D 1 282 ? 28.212  49.202  59.530 1.00 55.51 ? 935  LEU D CD2 1 
ATOM   10897 N  N   . ALA D 1 283 ? 26.157  45.203  57.051 1.00 50.40 ? 936  ALA D N   1 
ATOM   10898 C  CA  . ALA D 1 283 ? 25.249  44.195  57.561 1.00 48.83 ? 936  ALA D CA  1 
ATOM   10899 C  C   . ALA D 1 283 ? 25.573  42.766  57.146 1.00 48.18 ? 936  ALA D C   1 
ATOM   10900 O  O   . ALA D 1 283 ? 25.198  41.821  57.837 1.00 48.11 ? 936  ALA D O   1 
ATOM   10901 C  CB  . ALA D 1 283 ? 23.829  44.539  57.145 1.00 48.75 ? 936  ALA D CB  1 
ATOM   10902 N  N   . ASP D 1 284 ? 26.253  42.605  56.016 1.00 47.24 ? 937  ASP D N   1 
ATOM   10903 C  CA  . ASP D 1 284 ? 26.600  41.277  55.519 1.00 45.70 ? 937  ASP D CA  1 
ATOM   10904 C  C   . ASP D 1 284 ? 27.796  40.707  56.284 1.00 44.92 ? 937  ASP D C   1 
ATOM   10905 O  O   . ASP D 1 284 ? 28.029  39.500  56.273 1.00 45.32 ? 937  ASP D O   1 
ATOM   10906 C  CB  . ASP D 1 284 ? 26.911  41.344  54.019 1.00 45.33 ? 937  ASP D CB  1 
ATOM   10907 C  CG  . ASP D 1 284 ? 26.877  39.976  53.350 1.00 44.98 ? 937  ASP D CG  1 
ATOM   10908 O  OD1 . ASP D 1 284 ? 26.092  39.106  53.792 1.00 43.59 ? 937  ASP D OD1 1 
ATOM   10909 O  OD2 . ASP D 1 284 ? 27.618  39.777  52.363 1.00 43.19 ? 937  ASP D OD2 1 
ATOM   10910 N  N   . ILE D 1 285 ? 28.551  41.591  56.936 1.00 44.40 ? 938  ILE D N   1 
ATOM   10911 C  CA  . ILE D 1 285 ? 29.705  41.183  57.726 1.00 42.99 ? 938  ILE D CA  1 
ATOM   10912 C  C   . ILE D 1 285 ? 29.654  41.705  59.194 1.00 44.68 ? 938  ILE D C   1 
ATOM   10913 O  O   . ILE D 1 285 ? 30.694  42.021  59.789 1.00 44.65 ? 938  ILE D O   1 
ATOM   10914 C  CB  . ILE D 1 285 ? 31.044  41.618  57.019 1.00 40.58 ? 938  ILE D CB  1 
ATOM   10915 C  CG1 . ILE D 1 285 ? 31.209  43.142  57.004 1.00 38.52 ? 938  ILE D CG1 1 
ATOM   10916 C  CG2 . ILE D 1 285 ? 31.081  41.086  55.596 1.00 36.41 ? 938  ILE D CG2 1 
ATOM   10917 C  CD1 . ILE D 1 285 ? 32.574  43.606  56.438 1.00 33.55 ? 938  ILE D CD1 1 
ATOM   10918 N  N   . ASN D 1 286 ? 28.446  41.746  59.776 1.00 45.19 ? 939  ASN D N   1 
ATOM   10919 C  CA  . ASN D 1 286 ? 28.244  42.252  61.142 1.00 46.81 ? 939  ASN D CA  1 
ATOM   10920 C  C   . ASN D 1 286 ? 28.758  41.391  62.308 1.00 48.02 ? 939  ASN D C   1 
ATOM   10921 O  O   . ASN D 1 286 ? 28.882  41.903  63.419 1.00 48.30 ? 939  ASN D O   1 
ATOM   10922 C  CB  . ASN D 1 286 ? 26.758  42.593  61.402 1.00 47.02 ? 939  ASN D CB  1 
ATOM   10923 C  CG  . ASN D 1 286 ? 25.854  41.358  61.484 1.00 47.96 ? 939  ASN D CG  1 
ATOM   10924 O  OD1 . ASN D 1 286 ? 25.116  41.051  60.554 1.00 47.31 ? 939  ASN D OD1 1 
ATOM   10925 N  ND2 . ASN D 1 286 ? 25.904  40.659  62.608 1.00 50.14 ? 939  ASN D ND2 1 
ATOM   10926 N  N   . GLY D 1 287 ? 29.052  40.112  62.059 1.00 48.08 ? 940  GLY D N   1 
ATOM   10927 C  CA  . GLY D 1 287 ? 29.550  39.235  63.104 1.00 47.32 ? 940  GLY D CA  1 
ATOM   10928 C  C   . GLY D 1 287 ? 30.511  39.860  64.117 1.00 46.65 ? 940  GLY D C   1 
ATOM   10929 O  O   . GLY D 1 287 ? 30.168  39.992  65.290 1.00 44.70 ? 940  GLY D O   1 
ATOM   10930 N  N   . PRO D 1 288 ? 31.722  40.257  63.712 1.00 46.82 ? 941  PRO D N   1 
ATOM   10931 C  CA  . PRO D 1 288 ? 32.598  40.845  64.742 1.00 47.01 ? 941  PRO D CA  1 
ATOM   10932 C  C   . PRO D 1 288 ? 32.121  42.146  65.405 1.00 47.79 ? 941  PRO D C   1 
ATOM   10933 O  O   . PRO D 1 288 ? 32.854  42.765  66.193 1.00 47.75 ? 941  PRO D O   1 
ATOM   10934 C  CB  . PRO D 1 288 ? 33.947  41.001  64.021 1.00 45.66 ? 941  PRO D CB  1 
ATOM   10935 C  CG  . PRO D 1 288 ? 33.613  40.965  62.573 1.00 47.09 ? 941  PRO D CG  1 
ATOM   10936 C  CD  . PRO D 1 288 ? 32.440  40.024  62.449 1.00 45.94 ? 941  PRO D CD  1 
ATOM   10937 N  N   . ALA D 1 289 ? 30.890  42.552  65.096 1.00 47.72 ? 942  ALA D N   1 
ATOM   10938 C  CA  . ALA D 1 289 ? 30.310  43.784  65.646 1.00 47.50 ? 942  ALA D CA  1 
ATOM   10939 C  C   . ALA D 1 289 ? 29.183  43.474  66.611 1.00 47.19 ? 942  ALA D C   1 
ATOM   10940 O  O   . ALA D 1 289 ? 28.692  44.360  67.286 1.00 49.14 ? 942  ALA D O   1 
ATOM   10941 C  CB  . ALA D 1 289 ? 29.791  44.665  64.521 1.00 46.14 ? 942  ALA D CB  1 
ATOM   10942 N  N   . LYS D 1 290 ? 28.743  42.227  66.632 1.00 46.77 ? 943  LYS D N   1 
ATOM   10943 C  CA  . LYS D 1 290 ? 27.705  41.805  67.546 1.00 47.39 ? 943  LYS D CA  1 
ATOM   10944 C  C   . LYS D 1 290 ? 28.373  41.419  68.880 1.00 47.60 ? 943  LYS D C   1 
ATOM   10945 O  O   . LYS D 1 290 ? 29.570  41.627  69.079 1.00 48.53 ? 943  LYS D O   1 
ATOM   10946 C  CB  . LYS D 1 290 ? 26.960  40.598  66.980 1.00 47.23 ? 943  LYS D CB  1 
ATOM   10947 C  CG  . LYS D 1 290 ? 26.122  40.890  65.778 1.00 47.98 ? 943  LYS D CG  1 
ATOM   10948 C  CD  . LYS D 1 290 ? 25.054  41.941  66.117 1.00 49.98 ? 943  LYS D CD  1 
ATOM   10949 C  CE  . LYS D 1 290 ? 24.158  42.200  64.930 1.00 47.51 ? 943  LYS D CE  1 
ATOM   10950 N  NZ  . LYS D 1 290 ? 23.480  40.945  64.505 1.00 50.20 ? 943  LYS D NZ  1 
ATOM   10951 N  N   . VAL D 1 291 ? 27.594  40.868  69.798 1.00 47.13 ? 944  VAL D N   1 
ATOM   10952 C  CA  . VAL D 1 291 ? 28.135  40.442  71.083 1.00 46.92 ? 944  VAL D CA  1 
ATOM   10953 C  C   . VAL D 1 291 ? 28.974  39.157  70.917 1.00 46.22 ? 944  VAL D C   1 
ATOM   10954 O  O   . VAL D 1 291 ? 28.643  38.271  70.118 1.00 45.21 ? 944  VAL D O   1 
ATOM   10955 C  CB  . VAL D 1 291 ? 26.985  40.189  72.104 1.00 45.52 ? 944  VAL D CB  1 
ATOM   10956 C  CG1 . VAL D 1 291 ? 26.064  39.127  71.586 1.00 44.57 ? 944  VAL D CG1 1 
ATOM   10957 C  CG2 . VAL D 1 291 ? 27.545  39.798  73.456 1.00 45.90 ? 944  VAL D CG2 1 
ATOM   10958 N  N   . ARG D 1 292 ? 30.060  39.077  71.678 1.00 46.47 ? 945  ARG D N   1 
ATOM   10959 C  CA  . ARG D 1 292 ? 30.953  37.923  71.646 1.00 45.92 ? 945  ARG D CA  1 
ATOM   10960 C  C   . ARG D 1 292 ? 30.217  36.618  71.274 1.00 45.83 ? 945  ARG D C   1 
ATOM   10961 O  O   . ARG D 1 292 ? 30.569  35.942  70.309 1.00 44.67 ? 945  ARG D O   1 
ATOM   10962 C  CB  . ARG D 1 292 ? 31.607  37.767  73.017 1.00 45.50 ? 945  ARG D CB  1 
ATOM   10963 C  CG  . ARG D 1 292 ? 32.432  36.507  73.161 1.00 45.54 ? 945  ARG D CG  1 
ATOM   10964 C  CD  . ARG D 1 292 ? 32.695  36.138  74.615 1.00 45.31 ? 945  ARG D CD  1 
ATOM   10965 N  NE  . ARG D 1 292 ? 33.307  34.810  74.729 1.00 42.60 ? 945  ARG D NE  1 
ATOM   10966 C  CZ  . ARG D 1 292 ? 34.613  34.579  74.691 1.00 40.80 ? 945  ARG D CZ  1 
ATOM   10967 N  NH1 . ARG D 1 292 ? 35.474  35.583  74.561 1.00 38.01 ? 945  ARG D NH1 1 
ATOM   10968 N  NH2 . ARG D 1 292 ? 35.054  33.330  74.731 1.00 42.46 ? 945  ARG D NH2 1 
ATOM   10969 N  N   . ASP D 1 293 ? 29.174  36.290  72.026 1.00 46.10 ? 946  ASP D N   1 
ATOM   10970 C  CA  . ASP D 1 293 ? 28.430  35.061  71.818 1.00 47.68 ? 946  ASP D CA  1 
ATOM   10971 C  C   . ASP D 1 293 ? 27.826  34.933  70.447 1.00 48.71 ? 946  ASP D C   1 
ATOM   10972 O  O   . ASP D 1 293 ? 27.683  33.820  69.915 1.00 49.99 ? 946  ASP D O   1 
ATOM   10973 C  CB  . ASP D 1 293 ? 27.339  34.905  72.877 1.00 50.98 ? 946  ASP D CB  1 
ATOM   10974 C  CG  . ASP D 1 293 ? 27.555  35.814  74.