data_1TEW
# 
_entry.id   1TEW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.393 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1TEW         pdb_00001tew 10.2210/pdb1tew/pdb 
WWPDB D_1000176648 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-01-26 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2024-06-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp_atom               
2 4 'Structure model' chem_comp_bond               
3 4 'Structure model' database_2                   
4 4 'Structure model' pdbx_database_status         
5 4 'Structure model' pdbx_struct_special_symmetry 
6 4 'Structure model' struct_site                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_database_status.process_site'  
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TEW 
_pdbx_database_status.recvd_initial_deposition_date   1994-11-17 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Howell, P.L.' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of hexagonal turkey egg-white lysozyme at 1.65A resolution.'               'Acta Crystallogr.,Sect.D' 51 654 
662 1995 ABCRE6 DK 0907-4449 0766 ? 15299795 10.1107/S0907444994013612 
1       'X-Ray Structure of Monoclinic Turkey Egg White Lysozyme at 1.3 Angstroms Resolution' 'Acta Crystallogr.,Sect.D' 49 497 ? 
1993 ABCRE6 DK 0907-4449 0766 ? ?        ?                         
2       'Structure Determination of Turkey Egg White Lysozyme Using Laue Diffraction Data'    'Acta Crystallogr.,Sect.B' 48 200 ? 
1992 ASBSDK DK 0108-7681 0622 ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Howell, P.L.'  1 ? 
1       'Harata, K.'    2 ? 
2       'Howell, P.L.'  3 ? 
2       'Almo, S.C.'    4 ? 
2       'Parsons, M.R.' 5 ? 
2       'Hajdu, J.'     6 ? 
2       'Petsko, G.A.'  7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TURKEY EGG WHITE LYSOZYME' 14228.105 1  3.2.1.17 ? ? ? 
2 non-polymer syn 'THIOCYANATE ION'           58.082    1  ?        ? ? ? 
3 water       nat water                       18.015    86 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCNIPC
SALLSSDITASVNCAKKIASGGNGMNAWVAWRNRCKGTDVHAWIRGCRL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCNIPC
SALLSSDITASVNCAKKIASGGNGMNAWVAWRNRCKGTDVHAWIRGCRL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'THIOCYANATE ION' SCN 
3 water             HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   VAL n 
1 3   TYR n 
1 4   GLY n 
1 5   ARG n 
1 6   CYS n 
1 7   GLU n 
1 8   LEU n 
1 9   ALA n 
1 10  ALA n 
1 11  ALA n 
1 12  MET n 
1 13  LYS n 
1 14  ARG n 
1 15  LEU n 
1 16  GLY n 
1 17  LEU n 
1 18  ASP n 
1 19  ASN n 
1 20  TYR n 
1 21  ARG n 
1 22  GLY n 
1 23  TYR n 
1 24  SER n 
1 25  LEU n 
1 26  GLY n 
1 27  ASN n 
1 28  TRP n 
1 29  VAL n 
1 30  CYS n 
1 31  ALA n 
1 32  ALA n 
1 33  LYS n 
1 34  PHE n 
1 35  GLU n 
1 36  SER n 
1 37  ASN n 
1 38  PHE n 
1 39  ASN n 
1 40  THR n 
1 41  HIS n 
1 42  ALA n 
1 43  THR n 
1 44  ASN n 
1 45  ARG n 
1 46  ASN n 
1 47  THR n 
1 48  ASP n 
1 49  GLY n 
1 50  SER n 
1 51  THR n 
1 52  ASP n 
1 53  TYR n 
1 54  GLY n 
1 55  ILE n 
1 56  LEU n 
1 57  GLN n 
1 58  ILE n 
1 59  ASN n 
1 60  SER n 
1 61  ARG n 
1 62  TRP n 
1 63  TRP n 
1 64  CYS n 
1 65  ASN n 
1 66  ASP n 
1 67  GLY n 
1 68  ARG n 
1 69  THR n 
1 70  PRO n 
1 71  GLY n 
1 72  SER n 
1 73  LYS n 
1 74  ASN n 
1 75  LEU n 
1 76  CYS n 
1 77  ASN n 
1 78  ILE n 
1 79  PRO n 
1 80  CYS n 
1 81  SER n 
1 82  ALA n 
1 83  LEU n 
1 84  LEU n 
1 85  SER n 
1 86  SER n 
1 87  ASP n 
1 88  ILE n 
1 89  THR n 
1 90  ALA n 
1 91  SER n 
1 92  VAL n 
1 93  ASN n 
1 94  CYS n 
1 95  ALA n 
1 96  LYS n 
1 97  LYS n 
1 98  ILE n 
1 99  ALA n 
1 100 SER n 
1 101 GLY n 
1 102 GLY n 
1 103 ASN n 
1 104 GLY n 
1 105 MET n 
1 106 ASN n 
1 107 ALA n 
1 108 TRP n 
1 109 VAL n 
1 110 ALA n 
1 111 TRP n 
1 112 ARG n 
1 113 ASN n 
1 114 ARG n 
1 115 CYS n 
1 116 LYS n 
1 117 GLY n 
1 118 THR n 
1 119 ASP n 
1 120 VAL n 
1 121 HIS n 
1 122 ALA n 
1 123 TRP n 
1 124 ILE n 
1 125 ARG n 
1 126 GLY n 
1 127 CYS n 
1 128 ARG n 
1 129 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               turkey 
_entity_src_gen.gene_src_genus                     Meleagris 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Meleagris gallopavo' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9103 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SCN non-polymer         . 'THIOCYANATE ION' ? 'C N S -1'       58.082  
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   CYS 6   6   6   CYS CYS A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  MET 12  12  12  MET MET A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  ASN 19  19  19  ASN ASN A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  TRP 28  28  28  TRP TRP A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  HIS 41  41  41  HIS HIS A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  TRP 62  62  62  TRP TRP A . n 
A 1 63  TRP 63  63  63  TRP TRP A . n 
A 1 64  CYS 64  64  64  CYS CYS A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 ASN 103 103 103 ASN ASN A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 MET 105 105 105 MET MET A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 TRP 108 108 108 TRP TRP A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 CYS 115 115 115 CYS CYS A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 HIS 121 121 121 HIS HIS A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 TRP 123 123 123 TRP TRP A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 LEU 129 129 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SCN 1  130 129 SCN SCN A . 
C 3 HOH 1  131 130 HOH HOH A . 
C 3 HOH 2  132 131 HOH HOH A . 
C 3 HOH 3  133 132 HOH HOH A . 
C 3 HOH 4  134 133 HOH HOH A . 
C 3 HOH 5  135 134 HOH HOH A . 
C 3 HOH 6  136 135 HOH HOH A . 
C 3 HOH 7  137 136 HOH HOH A . 
C 3 HOH 8  138 137 HOH HOH A . 
C 3 HOH 9  139 138 HOH HOH A . 
C 3 HOH 10 140 139 HOH HOH A . 
C 3 HOH 11 141 140 HOH HOH A . 
C 3 HOH 12 142 141 HOH HOH A . 
C 3 HOH 13 143 142 HOH HOH A . 
C 3 HOH 14 144 143 HOH HOH A . 
C 3 HOH 15 145 144 HOH HOH A . 
C 3 HOH 16 146 145 HOH HOH A . 
C 3 HOH 17 147 146 HOH HOH A . 
C 3 HOH 18 148 147 HOH HOH A . 
C 3 HOH 19 149 148 HOH HOH A . 
C 3 HOH 20 150 149 HOH HOH A . 
C 3 HOH 21 151 150 HOH HOH A . 
C 3 HOH 22 152 151 HOH HOH A . 
C 3 HOH 23 153 152 HOH HOH A . 
C 3 HOH 24 154 153 HOH HOH A . 
C 3 HOH 25 155 154 HOH HOH A . 
C 3 HOH 26 156 155 HOH HOH A . 
C 3 HOH 27 157 156 HOH HOH A . 
C 3 HOH 28 158 157 HOH HOH A . 
C 3 HOH 29 159 158 HOH HOH A . 
C 3 HOH 30 160 159 HOH HOH A . 
C 3 HOH 31 161 160 HOH HOH A . 
C 3 HOH 32 162 161 HOH HOH A . 
C 3 HOH 33 163 162 HOH HOH A . 
C 3 HOH 34 164 163 HOH HOH A . 
C 3 HOH 35 165 164 HOH HOH A . 
C 3 HOH 36 166 165 HOH HOH A . 
C 3 HOH 37 167 166 HOH HOH A . 
C 3 HOH 38 168 167 HOH HOH A . 
C 3 HOH 39 169 168 HOH HOH A . 
C 3 HOH 40 170 169 HOH HOH A . 
C 3 HOH 41 171 170 HOH HOH A . 
C 3 HOH 42 172 171 HOH HOH A . 
C 3 HOH 43 173 172 HOH HOH A . 
C 3 HOH 44 174 173 HOH HOH A . 
C 3 HOH 45 175 174 HOH HOH A . 
C 3 HOH 46 176 175 HOH HOH A . 
C 3 HOH 47 177 176 HOH HOH A . 
C 3 HOH 48 178 177 HOH HOH A . 
C 3 HOH 49 179 178 HOH HOH A . 
C 3 HOH 50 180 179 HOH HOH A . 
C 3 HOH 51 181 180 HOH HOH A . 
C 3 HOH 52 182 181 HOH HOH A . 
C 3 HOH 53 183 182 HOH HOH A . 
C 3 HOH 54 184 183 HOH HOH A . 
C 3 HOH 55 185 184 HOH HOH A . 
C 3 HOH 56 186 185 HOH HOH A . 
C 3 HOH 57 187 186 HOH HOH A . 
C 3 HOH 58 188 187 HOH HOH A . 
C 3 HOH 59 189 188 HOH HOH A . 
C 3 HOH 60 190 189 HOH HOH A . 
C 3 HOH 61 191 190 HOH HOH A . 
C 3 HOH 62 192 191 HOH HOH A . 
C 3 HOH 63 193 192 HOH HOH A . 
C 3 HOH 64 194 193 HOH HOH A . 
C 3 HOH 65 195 194 HOH HOH A . 
C 3 HOH 66 196 195 HOH HOH A . 
C 3 HOH 67 197 196 HOH HOH A . 
C 3 HOH 68 198 197 HOH HOH A . 
C 3 HOH 69 199 198 HOH HOH A . 
C 3 HOH 70 200 199 HOH HOH A . 
C 3 HOH 71 201 201 HOH HOH A . 
C 3 HOH 72 202 202 HOH HOH A . 
C 3 HOH 73 203 203 HOH HOH A . 
C 3 HOH 74 204 204 HOH HOH A . 
C 3 HOH 75 205 205 HOH HOH A . 
C 3 HOH 76 206 206 HOH HOH A . 
C 3 HOH 77 207 207 HOH HOH A . 
C 3 HOH 78 208 208 HOH HOH A . 
C 3 HOH 79 209 209 HOH HOH A . 
C 3 HOH 80 210 210 HOH HOH A . 
C 3 HOH 81 211 211 HOH HOH A . 
C 3 HOH 82 212 212 HOH HOH A . 
C 3 HOH 83 213 213 HOH HOH A . 
C 3 HOH 84 214 214 HOH HOH A . 
C 3 HOH 85 215 215 HOH HOH A . 
C 3 HOH 86 216 196 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 45  ? CG  ? A ARG 45  CG  
2  1 Y 1 A ARG 45  ? CD  ? A ARG 45  CD  
3  1 Y 1 A ARG 45  ? NE  ? A ARG 45  NE  
4  1 Y 1 A ARG 45  ? CZ  ? A ARG 45  CZ  
5  1 Y 1 A ARG 45  ? NH1 ? A ARG 45  NH1 
6  1 Y 1 A ARG 45  ? NH2 ? A ARG 45  NH2 
7  1 Y 1 A ARG 68  ? NE  ? A ARG 68  NE  
8  1 Y 1 A ARG 68  ? CZ  ? A ARG 68  CZ  
9  1 Y 1 A ARG 68  ? NH1 ? A ARG 68  NH1 
10 1 Y 1 A ARG 68  ? NH2 ? A ARG 68  NH2 
11 1 Y 1 A ARG 128 ? CB  ? A ARG 128 CB  
12 1 Y 1 A ARG 128 ? CG  ? A ARG 128 CG  
13 1 Y 1 A ARG 128 ? CD  ? A ARG 128 CD  
14 1 Y 1 A ARG 128 ? NE  ? A ARG 128 NE  
15 1 Y 1 A ARG 128 ? CZ  ? A ARG 128 CZ  
16 1 Y 1 A ARG 128 ? NH1 ? A ARG 128 NH1 
17 1 Y 1 A ARG 128 ? NH2 ? A ARG 128 NH2 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
PROFFT refinement       . ? 3 
X-PLOR phasing          . ? 4 
# 
_cell.entry_id           1TEW 
_cell.length_a           70.960 
_cell.length_b           70.960 
_cell.length_c           83.010 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TEW 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
# 
_exptl.entry_id          1TEW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   41.98 
_exptl_crystal.description           ? 
# 
_reflns.entry_id                     1TEW 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   15265 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1TEW 
_refine.ls_number_reflns_obs                     15112 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8. 
_refine.ls_d_res_high                            1.65 
_refine.ls_percent_reflns_obs                    97. 
_refine.ls_R_factor_obs                          0.206 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               23.29 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1TEW 
_refine_analyze.Luzzati_coordinate_error_obs    0.15 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        972 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               1061 
_refine_hist.d_res_high                       1.65 
_refine_hist.d_res_low                        8. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.016 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.428 1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.073 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             1.694 1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.596 2.0 ? ? 'X-RAY DIFFRACTION' ? 
# 
_database_PDB_matrix.entry_id          1TEW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1TEW 
_struct.title                     'STRUCTURE OF HEXAGONAL TURKEY EGG WHITE LYSOZYME AT 1.65 ANGSTROMS RESOLUTION' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TEW 
_struct_keywords.pdbx_keywords   'HYDROLASE(O-GLYCOSYL)' 
_struct_keywords.text            'HYDROLASE(O-GLYCOSYL)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LYSC_MELGA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00703 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MRSLLILVLCFLPLAALGKVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINSRW
WCNDGRTPGSKNLCNIPCSALLSSDITASVNCAKKIASGGNGMNAWVAWRNRCKGTDVHAWIRGCRL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1TEW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 129 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00703 
_struct_ref_seq.db_align_beg                  19 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  147 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       129 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 4   ? LEU A 15  ? GLY A 4   LEU A 15  1 ? 12 
HELX_P HELX_P2 2 ASN A 19  ? TYR A 23  ? ASN A 19  TYR A 23  5 ? 5  
HELX_P HELX_P3 3 SER A 24  ? ASN A 37  ? SER A 24  ASN A 37  1 ? 14 
HELX_P HELX_P4 4 CYS A 80  ? SER A 85  ? CYS A 80  SER A 85  5 ? 6  
HELX_P HELX_P5 5 ILE A 88  ? SER A 100 ? ILE A 88  SER A 100 1 ? 13 
HELX_P HELX_P6 6 ASN A 103 ? ALA A 107 ? ASN A 103 ALA A 107 5 ? 5  
HELX_P HELX_P7 7 TRP A 108 ? CYS A 115 ? TRP A 108 CYS A 115 1 ? 8  
HELX_P HELX_P8 8 ASP A 119 ? ILE A 124 ? ASP A 119 ILE A 124 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 6  A CYS 127 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 115 SG ? ? A CYS 30 A CYS 115 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf3 disulf ? ? A CYS 64 SG ? ? ? 1_555 A CYS 80  SG ? ? A CYS 64 A CYS 80  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf4 disulf ? ? A CYS 76 SG ? ? ? 1_555 A CYS 94  SG ? ? A CYS 76 A CYS 94  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 43 ? ARG A 45 ? THR A 43 ARG A 45 
A 2 THR A 51 ? TYR A 53 ? THR A 51 TYR A 53 
A 3 ILE A 58 ? ASN A 59 ? ILE A 58 ASN A 59 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASN A 44 ? O ASN A 44 N ASP A 52 ? N ASP A 52 
A 2 3 N TYR A 53 ? N TYR A 53 O ILE A 58 ? O ILE A 58 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CA  Unknown  ? ?   ?   ? 2 ?                                    
AC1 Software A SCN 130 ? 1 'BINDING SITE FOR RESIDUE SCN A 130' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CA  2 ASP A 52 ? ASP A 52 . ? 1_555 ? 
2 CA  2 GLU A 35 ? GLU A 35 . ? 1_555 ? 
3 AC1 1 ARG A 14 ? ARG A 14 . ? 1_555 ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 18  ? ? CG A ASP 18  ? ? OD1 A ASP 18  ? ? 125.16 118.30 6.86  0.90 N 
2 1 O  A ASN 39  ? ? C  A ASN 39  ? ? N   A THR 40  ? ? 132.81 122.70 10.11 1.60 Y 
3 1 CA A LEU 56  ? ? CB A LEU 56  ? ? CG  A LEU 56  ? ? 129.68 115.30 14.38 2.30 N 
4 1 CB A ASP 66  ? ? CG A ASP 66  ? ? OD1 A ASP 66  ? ? 124.53 118.30 6.23  0.90 N 
5 1 CD A ARG 114 ? ? NE A ARG 114 ? ? CZ  A ARG 114 ? ? 132.46 123.60 8.86  1.40 N 
6 1 NE A ARG 114 ? ? CZ A ARG 114 ? ? NH2 A ARG 114 ? ? 117.24 120.30 -3.06 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 48 ? ? -61.41  4.61  
2 1 ARG A 68 ? ? -147.21 18.43 
3 1 ASN A 74 ? ? 38.62   60.22 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     211 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     LEU 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      129 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    LEU 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     129 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
HOH O    O N N 158 
HOH H1   H N N 159 
HOH H2   H N N 160 
ILE N    N N N 161 
ILE CA   C N S 162 
ILE C    C N N 163 
ILE O    O N N 164 
ILE CB   C N S 165 
ILE CG1  C N N 166 
ILE CG2  C N N 167 
ILE CD1  C N N 168 
ILE OXT  O N N 169 
ILE H    H N N 170 
ILE H2   H N N 171 
ILE HA   H N N 172 
ILE HB   H N N 173 
ILE HG12 H N N 174 
ILE HG13 H N N 175 
ILE HG21 H N N 176 
ILE HG22 H N N 177 
ILE HG23 H N N 178 
ILE HD11 H N N 179 
ILE HD12 H N N 180 
ILE HD13 H N N 181 
ILE HXT  H N N 182 
LEU N    N N N 183 
LEU CA   C N S 184 
LEU C    C N N 185 
LEU O    O N N 186 
LEU CB   C N N 187 
LEU CG   C N N 188 
LEU CD1  C N N 189 
LEU CD2  C N N 190 
LEU OXT  O N N 191 
LEU H    H N N 192 
LEU H2   H N N 193 
LEU HA   H N N 194 
LEU HB2  H N N 195 
LEU HB3  H N N 196 
LEU HG   H N N 197 
LEU HD11 H N N 198 
LEU HD12 H N N 199 
LEU HD13 H N N 200 
LEU HD21 H N N 201 
LEU HD22 H N N 202 
LEU HD23 H N N 203 
LEU HXT  H N N 204 
LYS N    N N N 205 
LYS CA   C N S 206 
LYS C    C N N 207 
LYS O    O N N 208 
LYS CB   C N N 209 
LYS CG   C N N 210 
LYS CD   C N N 211 
LYS CE   C N N 212 
LYS NZ   N N N 213 
LYS OXT  O N N 214 
LYS H    H N N 215 
LYS H2   H N N 216 
LYS HA   H N N 217 
LYS HB2  H N N 218 
LYS HB3  H N N 219 
LYS HG2  H N N 220 
LYS HG3  H N N 221 
LYS HD2  H N N 222 
LYS HD3  H N N 223 
LYS HE2  H N N 224 
LYS HE3  H N N 225 
LYS HZ1  H N N 226 
LYS HZ2  H N N 227 
LYS HZ3  H N N 228 
LYS HXT  H N N 229 
MET N    N N N 230 
MET CA   C N S 231 
MET C    C N N 232 
MET O    O N N 233 
MET CB   C N N 234 
MET CG   C N N 235 
MET SD   S N N 236 
MET CE   C N N 237 
MET OXT  O N N 238 
MET H    H N N 239 
MET H2   H N N 240 
MET HA   H N N 241 
MET HB2  H N N 242 
MET HB3  H N N 243 
MET HG2  H N N 244 
MET HG3  H N N 245 
MET HE1  H N N 246 
MET HE2  H N N 247 
MET HE3  H N N 248 
MET HXT  H N N 249 
PHE N    N N N 250 
PHE CA   C N S 251 
PHE C    C N N 252 
PHE O    O N N 253 
PHE CB   C N N 254 
PHE CG   C Y N 255 
PHE CD1  C Y N 256 
PHE CD2  C Y N 257 
PHE CE1  C Y N 258 
PHE CE2  C Y N 259 
PHE CZ   C Y N 260 
PHE OXT  O N N 261 
PHE H    H N N 262 
PHE H2   H N N 263 
PHE HA   H N N 264 
PHE HB2  H N N 265 
PHE HB3  H N N 266 
PHE HD1  H N N 267 
PHE HD2  H N N 268 
PHE HE1  H N N 269 
PHE HE2  H N N 270 
PHE HZ   H N N 271 
PHE HXT  H N N 272 
PRO N    N N N 273 
PRO CA   C N S 274 
PRO C    C N N 275 
PRO O    O N N 276 
PRO CB   C N N 277 
PRO CG   C N N 278 
PRO CD   C N N 279 
PRO OXT  O N N 280 
PRO H    H N N 281 
PRO HA   H N N 282 
PRO HB2  H N N 283 
PRO HB3  H N N 284 
PRO HG2  H N N 285 
PRO HG3  H N N 286 
PRO HD2  H N N 287 
PRO HD3  H N N 288 
PRO HXT  H N N 289 
SCN S    S N N 290 
SCN C    C N N 291 
SCN N    N N N 292 
SER N    N N N 293 
SER CA   C N S 294 
SER C    C N N 295 
SER O    O N N 296 
SER CB   C N N 297 
SER OG   O N N 298 
SER OXT  O N N 299 
SER H    H N N 300 
SER H2   H N N 301 
SER HA   H N N 302 
SER HB2  H N N 303 
SER HB3  H N N 304 
SER HG   H N N 305 
SER HXT  H N N 306 
THR N    N N N 307 
THR CA   C N S 308 
THR C    C N N 309 
THR O    O N N 310 
THR CB   C N R 311 
THR OG1  O N N 312 
THR CG2  C N N 313 
THR OXT  O N N 314 
THR H    H N N 315 
THR H2   H N N 316 
THR HA   H N N 317 
THR HB   H N N 318 
THR HG1  H N N 319 
THR HG21 H N N 320 
THR HG22 H N N 321 
THR HG23 H N N 322 
THR HXT  H N N 323 
TRP N    N N N 324 
TRP CA   C N S 325 
TRP C    C N N 326 
TRP O    O N N 327 
TRP CB   C N N 328 
TRP CG   C Y N 329 
TRP CD1  C Y N 330 
TRP CD2  C Y N 331 
TRP NE1  N Y N 332 
TRP CE2  C Y N 333 
TRP CE3  C Y N 334 
TRP CZ2  C Y N 335 
TRP CZ3  C Y N 336 
TRP CH2  C Y N 337 
TRP OXT  O N N 338 
TRP H    H N N 339 
TRP H2   H N N 340 
TRP HA   H N N 341 
TRP HB2  H N N 342 
TRP HB3  H N N 343 
TRP HD1  H N N 344 
TRP HE1  H N N 345 
TRP HE3  H N N 346 
TRP HZ2  H N N 347 
TRP HZ3  H N N 348 
TRP HH2  H N N 349 
TRP HXT  H N N 350 
TYR N    N N N 351 
TYR CA   C N S 352 
TYR C    C N N 353 
TYR O    O N N 354 
TYR CB   C N N 355 
TYR CG   C Y N 356 
TYR CD1  C Y N 357 
TYR CD2  C Y N 358 
TYR CE1  C Y N 359 
TYR CE2  C Y N 360 
TYR CZ   C Y N 361 
TYR OH   O N N 362 
TYR OXT  O N N 363 
TYR H    H N N 364 
TYR H2   H N N 365 
TYR HA   H N N 366 
TYR HB2  H N N 367 
TYR HB3  H N N 368 
TYR HD1  H N N 369 
TYR HD2  H N N 370 
TYR HE1  H N N 371 
TYR HE2  H N N 372 
TYR HH   H N N 373 
TYR HXT  H N N 374 
VAL N    N N N 375 
VAL CA   C N S 376 
VAL C    C N N 377 
VAL O    O N N 378 
VAL CB   C N N 379 
VAL CG1  C N N 380 
VAL CG2  C N N 381 
VAL OXT  O N N 382 
VAL H    H N N 383 
VAL H2   H N N 384 
VAL HA   H N N 385 
VAL HB   H N N 386 
VAL HG11 H N N 387 
VAL HG12 H N N 388 
VAL HG13 H N N 389 
VAL HG21 H N N 390 
VAL HG22 H N N 391 
VAL HG23 H N N 392 
VAL HXT  H N N 393 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MET N   CA   sing N N 218 
MET N   H    sing N N 219 
MET N   H2   sing N N 220 
MET CA  C    sing N N 221 
MET CA  CB   sing N N 222 
MET CA  HA   sing N N 223 
MET C   O    doub N N 224 
MET C   OXT  sing N N 225 
MET CB  CG   sing N N 226 
MET CB  HB2  sing N N 227 
MET CB  HB3  sing N N 228 
MET CG  SD   sing N N 229 
MET CG  HG2  sing N N 230 
MET CG  HG3  sing N N 231 
MET SD  CE   sing N N 232 
MET CE  HE1  sing N N 233 
MET CE  HE2  sing N N 234 
MET CE  HE3  sing N N 235 
MET OXT HXT  sing N N 236 
PHE N   CA   sing N N 237 
PHE N   H    sing N N 238 
PHE N   H2   sing N N 239 
PHE CA  C    sing N N 240 
PHE CA  CB   sing N N 241 
PHE CA  HA   sing N N 242 
PHE C   O    doub N N 243 
PHE C   OXT  sing N N 244 
PHE CB  CG   sing N N 245 
PHE CB  HB2  sing N N 246 
PHE CB  HB3  sing N N 247 
PHE CG  CD1  doub Y N 248 
PHE CG  CD2  sing Y N 249 
PHE CD1 CE1  sing Y N 250 
PHE CD1 HD1  sing N N 251 
PHE CD2 CE2  doub Y N 252 
PHE CD2 HD2  sing N N 253 
PHE CE1 CZ   doub Y N 254 
PHE CE1 HE1  sing N N 255 
PHE CE2 CZ   sing Y N 256 
PHE CE2 HE2  sing N N 257 
PHE CZ  HZ   sing N N 258 
PHE OXT HXT  sing N N 259 
PRO N   CA   sing N N 260 
PRO N   CD   sing N N 261 
PRO N   H    sing N N 262 
PRO CA  C    sing N N 263 
PRO CA  CB   sing N N 264 
PRO CA  HA   sing N N 265 
PRO C   O    doub N N 266 
PRO C   OXT  sing N N 267 
PRO CB  CG   sing N N 268 
PRO CB  HB2  sing N N 269 
PRO CB  HB3  sing N N 270 
PRO CG  CD   sing N N 271 
PRO CG  HG2  sing N N 272 
PRO CG  HG3  sing N N 273 
PRO CD  HD2  sing N N 274 
PRO CD  HD3  sing N N 275 
PRO OXT HXT  sing N N 276 
SCN S   C    sing N N 277 
SCN C   N    trip N N 278 
SER N   CA   sing N N 279 
SER N   H    sing N N 280 
SER N   H2   sing N N 281 
SER CA  C    sing N N 282 
SER CA  CB   sing N N 283 
SER CA  HA   sing N N 284 
SER C   O    doub N N 285 
SER C   OXT  sing N N 286 
SER CB  OG   sing N N 287 
SER CB  HB2  sing N N 288 
SER CB  HB3  sing N N 289 
SER OG  HG   sing N N 290 
SER OXT HXT  sing N N 291 
THR N   CA   sing N N 292 
THR N   H    sing N N 293 
THR N   H2   sing N N 294 
THR CA  C    sing N N 295 
THR CA  CB   sing N N 296 
THR CA  HA   sing N N 297 
THR C   O    doub N N 298 
THR C   OXT  sing N N 299 
THR CB  OG1  sing N N 300 
THR CB  CG2  sing N N 301 
THR CB  HB   sing N N 302 
THR OG1 HG1  sing N N 303 
THR CG2 HG21 sing N N 304 
THR CG2 HG22 sing N N 305 
THR CG2 HG23 sing N N 306 
THR OXT HXT  sing N N 307 
TRP N   CA   sing N N 308 
TRP N   H    sing N N 309 
TRP N   H2   sing N N 310 
TRP CA  C    sing N N 311 
TRP CA  CB   sing N N 312 
TRP CA  HA   sing N N 313 
TRP C   O    doub N N 314 
TRP C   OXT  sing N N 315 
TRP CB  CG   sing N N 316 
TRP CB  HB2  sing N N 317 
TRP CB  HB3  sing N N 318 
TRP CG  CD1  doub Y N 319 
TRP CG  CD2  sing Y N 320 
TRP CD1 NE1  sing Y N 321 
TRP CD1 HD1  sing N N 322 
TRP CD2 CE2  doub Y N 323 
TRP CD2 CE3  sing Y N 324 
TRP NE1 CE2  sing Y N 325 
TRP NE1 HE1  sing N N 326 
TRP CE2 CZ2  sing Y N 327 
TRP CE3 CZ3  doub Y N 328 
TRP CE3 HE3  sing N N 329 
TRP CZ2 CH2  doub Y N 330 
TRP CZ2 HZ2  sing N N 331 
TRP CZ3 CH2  sing Y N 332 
TRP CZ3 HZ3  sing N N 333 
TRP CH2 HH2  sing N N 334 
TRP OXT HXT  sing N N 335 
TYR N   CA   sing N N 336 
TYR N   H    sing N N 337 
TYR N   H2   sing N N 338 
TYR CA  C    sing N N 339 
TYR CA  CB   sing N N 340 
TYR CA  HA   sing N N 341 
TYR C   O    doub N N 342 
TYR C   OXT  sing N N 343 
TYR CB  CG   sing N N 344 
TYR CB  HB2  sing N N 345 
TYR CB  HB3  sing N N 346 
TYR CG  CD1  doub Y N 347 
TYR CG  CD2  sing Y N 348 
TYR CD1 CE1  sing Y N 349 
TYR CD1 HD1  sing N N 350 
TYR CD2 CE2  doub Y N 351 
TYR CD2 HD2  sing N N 352 
TYR CE1 CZ   doub Y N 353 
TYR CE1 HE1  sing N N 354 
TYR CE2 CZ   sing Y N 355 
TYR CE2 HE2  sing N N 356 
TYR CZ  OH   sing N N 357 
TYR OH  HH   sing N N 358 
TYR OXT HXT  sing N N 359 
VAL N   CA   sing N N 360 
VAL N   H    sing N N 361 
VAL N   H2   sing N N 362 
VAL CA  C    sing N N 363 
VAL CA  CB   sing N N 364 
VAL CA  HA   sing N N 365 
VAL C   O    doub N N 366 
VAL C   OXT  sing N N 367 
VAL CB  CG1  sing N N 368 
VAL CB  CG2  sing N N 369 
VAL CB  HB   sing N N 370 
VAL CG1 HG11 sing N N 371 
VAL CG1 HG12 sing N N 372 
VAL CG1 HG13 sing N N 373 
VAL CG2 HG21 sing N N 374 
VAL CG2 HG22 sing N N 375 
VAL CG2 HG23 sing N N 376 
VAL OXT HXT  sing N N 377 
# 
_atom_sites.entry_id                    1TEW 
_atom_sites.fract_transf_matrix[1][1]   0.014092 
_atom_sites.fract_transf_matrix[1][2]   0.008136 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016273 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012047 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 1   ? -41.408 47.912 50.781 1.00 32.33 ? 1   LYS A N   1 
ATOM   2    C CA  . LYS A 1 1   ? -41.149 48.935 49.766 1.00 30.60 ? 1   LYS A CA  1 
ATOM   3    C C   . LYS A 1 1   ? -41.502 48.415 48.385 1.00 29.96 ? 1   LYS A C   1 
ATOM   4    O O   . LYS A 1 1   ? -41.349 47.205 48.143 1.00 29.38 ? 1   LYS A O   1 
ATOM   5    C CB  . LYS A 1 1   ? -39.651 49.201 49.861 1.00 31.93 ? 1   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 1   ? -38.965 50.155 48.896 1.00 31.99 ? 1   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 1   ? -37.468 49.808 48.876 1.00 33.14 ? 1   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 1   ? -36.557 50.949 48.551 1.00 33.27 ? 1   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 1   ? -37.079 51.693 47.372 1.00 32.43 ? 1   LYS A NZ  1 
ATOM   10   N N   . VAL A 1 2   ? -41.945 49.286 47.493 1.00 28.69 ? 2   VAL A N   1 
ATOM   11   C CA  . VAL A 1 2   ? -42.250 48.863 46.120 1.00 28.21 ? 2   VAL A CA  1 
ATOM   12   C C   . VAL A 1 2   ? -41.158 49.514 45.274 1.00 28.58 ? 2   VAL A C   1 
ATOM   13   O O   . VAL A 1 2   ? -41.073 50.774 45.160 1.00 29.64 ? 2   VAL A O   1 
ATOM   14   C CB  . VAL A 1 2   ? -43.676 49.148 45.633 1.00 28.58 ? 2   VAL A CB  1 
ATOM   15   C CG1 . VAL A 1 2   ? -43.889 48.812 44.163 1.00 29.23 ? 2   VAL A CG1 1 
ATOM   16   C CG2 . VAL A 1 2   ? -44.667 48.388 46.494 1.00 28.00 ? 2   VAL A CG2 1 
ATOM   17   N N   . TYR A 1 3   ? -40.308 48.650 44.703 1.00 25.19 ? 3   TYR A N   1 
ATOM   18   C CA  . TYR A 1 3   ? -39.239 49.215 43.868 1.00 23.88 ? 3   TYR A CA  1 
ATOM   19   C C   . TYR A 1 3   ? -39.692 49.635 42.477 1.00 23.40 ? 3   TYR A C   1 
ATOM   20   O O   . TYR A 1 3   ? -40.645 49.081 41.898 1.00 24.47 ? 3   TYR A O   1 
ATOM   21   C CB  . TYR A 1 3   ? -38.138 48.149 43.547 1.00 24.48 ? 3   TYR A CB  1 
ATOM   22   C CG  . TYR A 1 3   ? -37.137 48.010 44.671 1.00 24.18 ? 3   TYR A CG  1 
ATOM   23   C CD1 . TYR A 1 3   ? -37.515 47.363 45.855 1.00 25.10 ? 3   TYR A CD1 1 
ATOM   24   C CD2 . TYR A 1 3   ? -35.854 48.522 44.555 1.00 24.89 ? 3   TYR A CD2 1 
ATOM   25   C CE1 . TYR A 1 3   ? -36.632 47.231 46.902 1.00 26.23 ? 3   TYR A CE1 1 
ATOM   26   C CE2 . TYR A 1 3   ? -34.941 48.388 45.604 1.00 26.44 ? 3   TYR A CE2 1 
ATOM   27   C CZ  . TYR A 1 3   ? -35.340 47.740 46.768 1.00 27.10 ? 3   TYR A CZ  1 
ATOM   28   O OH  . TYR A 1 3   ? -34.507 47.594 47.855 1.00 27.43 ? 3   TYR A OH  1 
ATOM   29   N N   . GLY A 1 4   ? -38.935 50.593 41.920 1.00 24.07 ? 4   GLY A N   1 
ATOM   30   C CA  . GLY A 1 4   ? -39.250 50.938 40.496 1.00 23.75 ? 4   GLY A CA  1 
ATOM   31   C C   . GLY A 1 4   ? -38.378 49.923 39.722 1.00 23.82 ? 4   GLY A C   1 
ATOM   32   O O   . GLY A 1 4   ? -37.417 49.343 40.266 1.00 22.27 ? 4   GLY A O   1 
ATOM   33   N N   . ARG A 1 5   ? -38.735 49.695 38.480 1.00 23.04 ? 5   ARG A N   1 
ATOM   34   C CA  . ARG A 1 5   ? -37.996 48.795 37.594 1.00 23.13 ? 5   ARG A CA  1 
ATOM   35   C C   . ARG A 1 5   ? -36.523 49.114 37.509 1.00 22.97 ? 5   ARG A C   1 
ATOM   36   O O   . ARG A 1 5   ? -35.690 48.196 37.674 1.00 23.57 ? 5   ARG A O   1 
ATOM   37   C CB  . ARG A 1 5   ? -38.657 48.895 36.221 1.00 24.26 ? 5   ARG A CB  1 
ATOM   38   C CG  . ARG A 1 5   ? -38.033 48.042 35.136 1.00 25.55 ? 5   ARG A CG  1 
ATOM   39   C CD  . ARG A 1 5   ? -38.951 48.146 33.934 1.00 26.24 ? 5   ARG A CD  1 
ATOM   40   N NE  . ARG A 1 5   ? -38.872 49.458 33.305 1.00 27.57 ? 5   ARG A NE  1 
ATOM   41   C CZ  . ARG A 1 5   ? -38.061 49.842 32.371 1.00 25.30 ? 5   ARG A CZ  1 
ATOM   42   N NH1 . ARG A 1 5   ? -37.169 48.977 31.885 1.00 28.15 ? 5   ARG A NH1 1 
ATOM   43   N NH2 . ARG A 1 5   ? -38.097 51.073 31.852 1.00 28.04 ? 5   ARG A NH2 1 
ATOM   44   N N   . CYS A 1 6   ? -36.096 50.323 37.167 1.00 23.42 ? 6   CYS A N   1 
ATOM   45   C CA  . CYS A 1 6   ? -34.678 50.673 37.039 1.00 23.35 ? 6   CYS A CA  1 
ATOM   46   C C   . CYS A 1 6   ? -33.934 50.603 38.366 1.00 22.09 ? 6   CYS A C   1 
ATOM   47   O O   . CYS A 1 6   ? -32.747 50.237 38.378 1.00 22.34 ? 6   CYS A O   1 
ATOM   48   C CB  . CYS A 1 6   ? -34.437 51.988 36.274 1.00 24.87 ? 6   CYS A CB  1 
ATOM   49   S SG  . CYS A 1 6   ? -35.040 51.787 34.560 1.00 28.18 ? 6   CYS A SG  1 
ATOM   50   N N   . GLU A 1 7   ? -34.583 51.035 39.402 1.00 21.29 ? 7   GLU A N   1 
ATOM   51   C CA  . GLU A 1 7   ? -33.997 51.005 40.749 1.00 21.74 ? 7   GLU A CA  1 
ATOM   52   C C   . GLU A 1 7   ? -33.687 49.565 41.157 1.00 21.62 ? 7   GLU A C   1 
ATOM   53   O O   . GLU A 1 7   ? -32.620 49.349 41.786 1.00 20.30 ? 7   GLU A O   1 
ATOM   54   C CB  . GLU A 1 7   ? -34.953 51.574 41.775 1.00 23.61 ? 7   GLU A CB  1 
ATOM   55   C CG  . GLU A 1 7   ? -34.577 51.670 43.243 1.00 26.07 ? 7   GLU A CG  1 
ATOM   56   C CD  . GLU A 1 7   ? -35.734 52.152 44.096 1.00 28.23 ? 7   GLU A CD  1 
ATOM   57   O OE1 . GLU A 1 7   ? -36.905 52.095 43.785 1.00 29.56 ? 7   GLU A OE1 1 
ATOM   58   O OE2 . GLU A 1 7   ? -35.333 52.596 45.171 1.00 29.73 ? 7   GLU A OE2 1 
ATOM   59   N N   . LEU A 1 8   ? -34.636 48.670 40.828 1.00 19.73 ? 8   LEU A N   1 
ATOM   60   C CA  . LEU A 1 8   ? -34.391 47.243 41.221 1.00 18.61 ? 8   LEU A CA  1 
ATOM   61   C C   . LEU A 1 8   ? -33.262 46.706 40.384 1.00 17.57 ? 8   LEU A C   1 
ATOM   62   O O   . LEU A 1 8   ? -32.414 45.990 40.950 1.00 17.20 ? 8   LEU A O   1 
ATOM   63   C CB  . LEU A 1 8   ? -35.745 46.503 41.038 1.00 18.26 ? 8   LEU A CB  1 
ATOM   64   C CG  . LEU A 1 8   ? -35.568 44.967 41.336 1.00 19.26 ? 8   LEU A CG  1 
ATOM   65   C CD1 . LEU A 1 8   ? -35.266 44.695 42.800 1.00 18.13 ? 8   LEU A CD1 1 
ATOM   66   C CD2 . LEU A 1 8   ? -36.855 44.313 40.870 1.00 20.94 ? 8   LEU A CD2 1 
ATOM   67   N N   . ALA A 1 9   ? -33.287 46.971 39.090 1.00 17.34 ? 9   ALA A N   1 
ATOM   68   C CA  . ALA A 1 9   ? -32.231 46.539 38.166 1.00 17.53 ? 9   ALA A CA  1 
ATOM   69   C C   . ALA A 1 9   ? -30.849 46.990 38.689 1.00 18.43 ? 9   ALA A C   1 
ATOM   70   O O   . ALA A 1 9   ? -29.899 46.189 38.634 1.00 16.34 ? 9   ALA A O   1 
ATOM   71   C CB  . ALA A 1 9   ? -32.473 47.102 36.762 1.00 20.41 ? 9   ALA A CB  1 
ATOM   72   N N   . ALA A 1 10  ? -30.691 48.247 39.093 1.00 18.56 ? 10  ALA A N   1 
ATOM   73   C CA  . ALA A 1 10  ? -29.439 48.803 39.652 1.00 18.47 ? 10  ALA A CA  1 
ATOM   74   C C   . ALA A 1 10  ? -29.001 48.033 40.908 1.00 18.58 ? 10  ALA A C   1 
ATOM   75   O O   . ALA A 1 10  ? -27.792 47.647 41.009 1.00 17.83 ? 10  ALA A O   1 
ATOM   76   C CB  . ALA A 1 10  ? -29.650 50.300 39.990 1.00 19.57 ? 10  ALA A CB  1 
ATOM   77   N N   . ALA A 1 11  ? -29.911 47.789 41.818 1.00 19.32 ? 11  ALA A N   1 
ATOM   78   C CA  . ALA A 1 11  ? -29.713 47.033 43.049 1.00 18.88 ? 11  ALA A CA  1 
ATOM   79   C C   . ALA A 1 11  ? -29.263 45.599 42.757 1.00 19.64 ? 11  ALA A C   1 
ATOM   80   O O   . ALA A 1 11  ? -28.286 45.114 43.398 1.00 18.69 ? 11  ALA A O   1 
ATOM   81   C CB  . ALA A 1 11  ? -30.870 47.049 44.046 1.00 18.31 ? 11  ALA A CB  1 
ATOM   82   N N   . MET A 1 12  ? -29.973 44.939 41.855 1.00 18.21 ? 12  MET A N   1 
ATOM   83   C CA  . MET A 1 12  ? -29.626 43.551 41.439 1.00 19.57 ? 12  MET A CA  1 
ATOM   84   C C   . MET A 1 12  ? -28.254 43.443 40.816 1.00 17.92 ? 12  MET A C   1 
ATOM   85   O O   . MET A 1 12  ? -27.484 42.446 40.990 1.00 18.77 ? 12  MET A O   1 
ATOM   86   C CB  . MET A 1 12  ? -30.734 43.078 40.431 1.00 18.74 ? 12  MET A CB  1 
ATOM   87   C CG  . MET A 1 12  ? -31.864 42.588 41.333 1.00 17.96 ? 12  MET A CG  1 
ATOM   88   S SD  . MET A 1 12  ? -33.189 41.973 40.206 1.00 19.10 ? 12  MET A SD  1 
ATOM   89   C CE  . MET A 1 12  ? -34.121 41.016 41.323 1.00 17.29 ? 12  MET A CE  1 
ATOM   90   N N   . LYS A 1 13  ? -27.915 44.451 40.047 1.00 19.52 ? 13  LYS A N   1 
ATOM   91   C CA  . LYS A 1 13  ? -26.615 44.569 39.340 1.00 20.76 ? 13  LYS A CA  1 
ATOM   92   C C   . LYS A 1 13  ? -25.480 44.696 40.363 1.00 21.91 ? 13  LYS A C   1 
ATOM   93   O O   . LYS A 1 13  ? -24.452 43.970 40.264 1.00 20.50 ? 13  LYS A O   1 
ATOM   94   C CB  . LYS A 1 13  ? -26.671 45.728 38.343 1.00 23.07 ? 13  LYS A CB  1 
ATOM   95   C CG  . LYS A 1 13  ? -25.434 45.678 37.484 1.00 25.16 ? 13  LYS A CG  1 
ATOM   96   C CD  . LYS A 1 13  ? -25.353 46.656 36.324 1.00 28.48 ? 13  LYS A CD  1 
ATOM   97   C CE  . LYS A 1 13  ? -24.176 45.989 35.560 1.00 31.36 ? 13  LYS A CE  1 
ATOM   98   N NZ  . LYS A 1 13  ? -24.166 46.398 34.152 1.00 32.96 ? 13  LYS A NZ  1 
ATOM   99   N N   . ARG A 1 14  ? -25.588 45.544 41.339 1.00 21.89 ? 14  ARG A N   1 
ATOM   100  C CA  . ARG A 1 14  ? -24.644 45.760 42.440 1.00 21.52 ? 14  ARG A CA  1 
ATOM   101  C C   . ARG A 1 14  ? -24.482 44.455 43.209 1.00 23.72 ? 14  ARG A C   1 
ATOM   102  O O   . ARG A 1 14  ? -23.365 44.175 43.668 1.00 22.55 ? 14  ARG A O   1 
ATOM   103  C CB  . ARG A 1 14  ? -25.151 46.847 43.395 1.00 23.55 ? 14  ARG A CB  1 
ATOM   104  C CG  . ARG A 1 14  ? -24.897 48.280 42.934 1.00 23.29 ? 14  ARG A CG  1 
ATOM   105  C CD  . ARG A 1 14  ? -25.124 49.222 44.077 1.00 23.51 ? 14  ARG A CD  1 
ATOM   106  N NE  . ARG A 1 14  ? -26.383 49.124 44.776 1.00 23.99 ? 14  ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 14  ? -27.518 49.775 44.490 1.00 23.85 ? 14  ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 14  ? -27.551 50.592 43.456 1.00 27.74 ? 14  ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 14  ? -28.603 49.602 45.269 1.00 25.00 ? 14  ARG A NH2 1 
ATOM   110  N N   . LEU A 1 15  ? -25.562 43.676 43.365 1.00 21.00 ? 15  LEU A N   1 
ATOM   111  C CA  . LEU A 1 15  ? -25.463 42.403 44.138 1.00 22.22 ? 15  LEU A CA  1 
ATOM   112  C C   . LEU A 1 15  ? -24.959 41.198 43.368 1.00 23.83 ? 15  LEU A C   1 
ATOM   113  O O   . LEU A 1 15  ? -24.998 40.074 43.940 1.00 24.17 ? 15  LEU A O   1 
ATOM   114  C CB  . LEU A 1 15  ? -26.822 42.197 44.812 1.00 23.09 ? 15  LEU A CB  1 
ATOM   115  C CG  . LEU A 1 15  ? -27.038 43.114 46.025 1.00 24.17 ? 15  LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 15  ? -28.416 42.789 46.603 1.00 24.46 ? 15  LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 15  ? -25.940 42.919 47.076 1.00 26.13 ? 15  LEU A CD2 1 
ATOM   118  N N   . GLY A 1 16  ? -24.594 41.415 42.162 1.00 23.86 ? 16  GLY A N   1 
ATOM   119  C CA  . GLY A 1 16  ? -24.039 40.521 41.165 1.00 25.27 ? 16  GLY A CA  1 
ATOM   120  C C   . GLY A 1 16  ? -24.936 39.506 40.486 1.00 24.78 ? 16  GLY A C   1 
ATOM   121  O O   . GLY A 1 16  ? -24.469 38.373 40.232 1.00 23.54 ? 16  GLY A O   1 
ATOM   122  N N   . LEU A 1 17  ? -26.170 39.906 40.164 1.00 23.00 ? 17  LEU A N   1 
ATOM   123  C CA  . LEU A 1 17  ? -27.066 38.966 39.456 1.00 21.43 ? 17  LEU A CA  1 
ATOM   124  C C   . LEU A 1 17  ? -26.885 39.020 37.975 1.00 23.18 ? 17  LEU A C   1 
ATOM   125  O O   . LEU A 1 17  ? -27.244 38.003 37.317 1.00 20.96 ? 17  LEU A O   1 
ATOM   126  C CB  . LEU A 1 17  ? -28.534 39.169 39.897 1.00 19.93 ? 17  LEU A CB  1 
ATOM   127  C CG  . LEU A 1 17  ? -28.957 38.645 41.263 1.00 19.85 ? 17  LEU A CG  1 
ATOM   128  C CD1 . LEU A 1 17  ? -30.377 39.095 41.504 1.00 20.76 ? 17  LEU A CD1 1 
ATOM   129  C CD2 . LEU A 1 17  ? -28.790 37.102 41.308 1.00 19.77 ? 17  LEU A CD2 1 
ATOM   130  N N   . ASP A 1 18  ? -26.312 40.060 37.386 1.00 22.22 ? 18  ASP A N   1 
ATOM   131  C CA  . ASP A 1 18  ? -26.134 40.047 35.923 1.00 23.94 ? 18  ASP A CA  1 
ATOM   132  C C   . ASP A 1 18  ? -25.198 38.909 35.506 1.00 23.50 ? 18  ASP A C   1 
ATOM   133  O O   . ASP A 1 18  ? -23.995 38.791 35.773 1.00 23.78 ? 18  ASP A O   1 
ATOM   134  C CB  . ASP A 1 18  ? -25.686 41.425 35.470 1.00 25.01 ? 18  ASP A CB  1 
ATOM   135  C CG  . ASP A 1 18  ? -25.797 41.539 33.963 1.00 27.50 ? 18  ASP A CG  1 
ATOM   136  O OD1 . ASP A 1 18  ? -26.460 40.775 33.231 1.00 27.35 ? 18  ASP A OD1 1 
ATOM   137  O OD2 . ASP A 1 18  ? -25.188 42.506 33.481 1.00 29.31 ? 18  ASP A OD2 1 
ATOM   138  N N   . ASN A 1 19  ? -25.773 37.970 34.780 1.00 23.09 ? 19  ASN A N   1 
ATOM   139  C CA  . ASN A 1 19  ? -25.166 36.771 34.243 1.00 24.78 ? 19  ASN A CA  1 
ATOM   140  C C   . ASN A 1 19  ? -24.902 35.687 35.283 1.00 23.86 ? 19  ASN A C   1 
ATOM   141  O O   . ASN A 1 19  ? -24.219 34.747 34.856 1.00 23.22 ? 19  ASN A O   1 
ATOM   142  C CB  . ASN A 1 19  ? -23.923 37.062 33.379 1.00 28.89 ? 19  ASN A CB  1 
ATOM   143  C CG  . ASN A 1 19  ? -24.435 37.662 32.081 1.00 31.63 ? 19  ASN A CG  1 
ATOM   144  O OD1 . ASN A 1 19  ? -25.345 37.112 31.431 1.00 34.21 ? 19  ASN A OD1 1 
ATOM   145  N ND2 . ASN A 1 19  ? -23.862 38.807 31.695 1.00 34.05 ? 19  ASN A ND2 1 
ATOM   146  N N   . TYR A 1 20  ? -25.493 35.830 36.456 1.00 21.30 ? 20  TYR A N   1 
ATOM   147  C CA  . TYR A 1 20  ? -25.364 34.800 37.488 1.00 22.78 ? 20  TYR A CA  1 
ATOM   148  C C   . TYR A 1 20  ? -25.966 33.503 36.920 1.00 21.12 ? 20  TYR A C   1 
ATOM   149  O O   . TYR A 1 20  ? -27.151 33.445 36.549 1.00 20.58 ? 20  TYR A O   1 
ATOM   150  C CB  . TYR A 1 20  ? -26.094 35.207 38.791 1.00 23.29 ? 20  TYR A CB  1 
ATOM   151  C CG  . TYR A 1 20  ? -25.831 34.131 39.873 1.00 23.07 ? 20  TYR A CG  1 
ATOM   152  C CD1 . TYR A 1 20  ? -24.594 34.053 40.530 1.00 24.72 ? 20  TYR A CD1 1 
ATOM   153  C CD2 . TYR A 1 20  ? -26.816 33.192 40.128 1.00 23.79 ? 20  TYR A CD2 1 
ATOM   154  C CE1 . TYR A 1 20  ? -24.377 33.032 41.467 1.00 26.20 ? 20  TYR A CE1 1 
ATOM   155  C CE2 . TYR A 1 20  ? -26.605 32.181 41.064 1.00 24.48 ? 20  TYR A CE2 1 
ATOM   156  C CZ  . TYR A 1 20  ? -25.394 32.124 41.708 1.00 24.82 ? 20  TYR A CZ  1 
ATOM   157  O OH  . TYR A 1 20  ? -25.225 31.083 42.597 1.00 26.13 ? 20  TYR A OH  1 
ATOM   158  N N   . ARG A 1 21  ? -25.132 32.470 36.944 1.00 20.39 ? 21  ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? -25.550 31.135 36.457 1.00 20.89 ? 21  ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? -26.009 31.196 34.990 1.00 21.65 ? 21  ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? -26.842 30.403 34.517 1.00 24.10 ? 21  ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? -26.616 30.487 37.329 1.00 20.77 ? 21  ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? -26.082 29.903 38.640 1.00 22.10 ? 21  ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? -25.393 28.573 38.450 1.00 22.62 ? 21  ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? -26.447 27.590 38.258 1.00 24.19 ? 21  ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? -26.430 26.515 37.434 1.00 25.19 ? 21  ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? -25.296 26.220 36.798 1.00 27.17 ? 21  ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? -27.517 25.791 37.327 1.00 25.04 ? 21  ARG A NH2 1 
ATOM   169  N N   . GLY A 1 22  ? -25.461 32.154 34.267 1.00 21.56 ? 22  GLY A N   1 
ATOM   170  C CA  . GLY A 1 22  ? -25.746 32.404 32.852 1.00 20.79 ? 22  GLY A CA  1 
ATOM   171  C C   . GLY A 1 22  ? -27.029 33.173 32.571 1.00 21.69 ? 22  GLY A C   1 
ATOM   172  O O   . GLY A 1 22  ? -27.422 33.283 31.393 1.00 23.91 ? 22  GLY A O   1 
ATOM   173  N N   . TYR A 1 23  ? -27.696 33.724 33.565 1.00 20.67 ? 23  TYR A N   1 
ATOM   174  C CA  . TYR A 1 23  ? -28.941 34.461 33.368 1.00 19.06 ? 23  TYR A CA  1 
ATOM   175  C C   . TYR A 1 23  ? -28.694 35.972 33.397 1.00 19.22 ? 23  TYR A C   1 
ATOM   176  O O   . TYR A 1 23  ? -28.293 36.459 34.447 1.00 19.76 ? 23  TYR A O   1 
ATOM   177  C CB  . TYR A 1 23  ? -29.912 34.071 34.502 1.00 16.37 ? 23  TYR A CB  1 
ATOM   178  C CG  . TYR A 1 23  ? -30.400 32.657 34.461 1.00 17.19 ? 23  TYR A CG  1 
ATOM   179  C CD1 . TYR A 1 23  ? -31.482 32.320 33.659 1.00 17.22 ? 23  TYR A CD1 1 
ATOM   180  C CD2 . TYR A 1 23  ? -29.772 31.645 35.215 1.00 18.04 ? 23  TYR A CD2 1 
ATOM   181  C CE1 . TYR A 1 23  ? -31.956 31.009 33.572 1.00 15.12 ? 23  TYR A CE1 1 
ATOM   182  C CE2 . TYR A 1 23  ? -30.266 30.328 35.172 1.00 17.02 ? 23  TYR A CE2 1 
ATOM   183  C CZ  . TYR A 1 23  ? -31.336 30.061 34.362 1.00 15.31 ? 23  TYR A CZ  1 
ATOM   184  O OH  . TYR A 1 23  ? -31.875 28.779 34.364 1.00 13.74 ? 23  TYR A OH  1 
ATOM   185  N N   . SER A 1 24  ? -28.930 36.638 32.300 1.00 19.26 ? 24  SER A N   1 
ATOM   186  C CA  . SER A 1 24  ? -28.709 38.113 32.184 1.00 19.75 ? 24  SER A CA  1 
ATOM   187  C C   . SER A 1 24  ? -29.679 38.774 33.121 1.00 18.17 ? 24  SER A C   1 
ATOM   188  O O   . SER A 1 24  ? -30.741 38.242 33.575 1.00 17.75 ? 24  SER A O   1 
ATOM   189  C CB  . SER A 1 24  ? -28.893 38.434 30.681 1.00 19.85 ? 24  SER A CB  1 
ATOM   190  O OG  . SER A 1 24  ? -30.312 38.281 30.450 1.00 22.33 ? 24  SER A OG  1 
ATOM   191  N N   . LEU A 1 25  ? -29.309 39.999 33.518 1.00 17.00 ? 25  LEU A N   1 
ATOM   192  C CA  . LEU A 1 25  ? -30.071 40.794 34.473 1.00 15.93 ? 25  LEU A CA  1 
ATOM   193  C C   . LEU A 1 25  ? -31.561 40.883 34.274 1.00 17.02 ? 25  LEU A C   1 
ATOM   194  O O   . LEU A 1 25  ? -32.331 40.873 35.229 1.00 14.79 ? 25  LEU A O   1 
ATOM   195  C CB  . LEU A 1 25  ? -29.360 42.215 34.513 1.00 17.34 ? 25  LEU A CB  1 
ATOM   196  C CG  . LEU A 1 25  ? -29.953 43.149 35.566 1.00 18.18 ? 25  LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 25  ? -29.679 42.489 36.929 1.00 20.63 ? 25  LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 25  ? -29.238 44.525 35.526 1.00 19.72 ? 25  LEU A CD2 1 
ATOM   199  N N   . GLY A 1 26  ? -31.990 41.032 33.006 1.00 14.50 ? 26  GLY A N   1 
ATOM   200  C CA  . GLY A 1 26  ? -33.396 41.179 32.656 1.00 15.55 ? 26  GLY A CA  1 
ATOM   201  C C   . GLY A 1 26  ? -34.209 39.980 33.154 1.00 14.37 ? 26  GLY A C   1 
ATOM   202  O O   . GLY A 1 26  ? -35.386 40.146 33.424 1.00 14.96 ? 26  GLY A O   1 
ATOM   203  N N   . ASN A 1 27  ? -33.582 38.846 33.285 1.00 13.51 ? 27  ASN A N   1 
ATOM   204  C CA  . ASN A 1 27  ? -34.353 37.670 33.773 1.00 14.16 ? 27  ASN A CA  1 
ATOM   205  C C   . ASN A 1 27  ? -34.813 37.803 35.186 1.00 14.69 ? 27  ASN A C   1 
ATOM   206  O O   . ASN A 1 27  ? -35.911 37.431 35.686 1.00 17.88 ? 27  ASN A O   1 
ATOM   207  C CB  . ASN A 1 27  ? -33.493 36.372 33.608 1.00 15.32 ? 27  ASN A CB  1 
ATOM   208  C CG  . ASN A 1 27  ? -33.403 35.795 32.228 1.00 16.97 ? 27  ASN A CG  1 
ATOM   209  O OD1 . ASN A 1 27  ? -34.422 35.258 31.726 1.00 15.50 ? 27  ASN A OD1 1 
ATOM   210  N ND2 . ASN A 1 27  ? -32.215 35.954 31.733 1.00 19.00 ? 27  ASN A ND2 1 
ATOM   211  N N   . TRP A 1 28  ? -33.893 38.326 36.007 1.00 15.44 ? 28  TRP A N   1 
ATOM   212  C CA  . TRP A 1 28  ? -34.133 38.534 37.432 1.00 14.75 ? 28  TRP A CA  1 
ATOM   213  C C   . TRP A 1 28  ? -35.138 39.674 37.650 1.00 14.34 ? 28  TRP A C   1 
ATOM   214  O O   . TRP A 1 28  ? -35.987 39.504 38.559 1.00 14.92 ? 28  TRP A O   1 
ATOM   215  C CB  . TRP A 1 28  ? -32.813 38.910 38.167 1.00 14.48 ? 28  TRP A CB  1 
ATOM   216  C CG  . TRP A 1 28  ? -31.790 37.811 37.983 1.00 15.83 ? 28  TRP A CG  1 
ATOM   217  C CD1 . TRP A 1 28  ? -30.811 37.801 36.991 1.00 15.16 ? 28  TRP A CD1 1 
ATOM   218  C CD2 . TRP A 1 28  ? -31.718 36.571 38.686 1.00 15.66 ? 28  TRP A CD2 1 
ATOM   219  N NE1 . TRP A 1 28  ? -30.133 36.591 37.122 1.00 17.22 ? 28  TRP A NE1 1 
ATOM   220  C CE2 . TRP A 1 28  ? -30.665 35.862 38.143 1.00 16.74 ? 28  TRP A CE2 1 
ATOM   221  C CE3 . TRP A 1 28  ? -32.456 36.081 39.773 1.00 14.23 ? 28  TRP A CE3 1 
ATOM   222  C CZ2 . TRP A 1 28  ? -30.269 34.585 38.591 1.00 17.85 ? 28  TRP A CZ2 1 
ATOM   223  C CZ3 . TRP A 1 28  ? -32.105 34.789 40.275 1.00 17.05 ? 28  TRP A CZ3 1 
ATOM   224  C CH2 . TRP A 1 28  ? -31.056 34.121 39.641 1.00 18.95 ? 28  TRP A CH2 1 
ATOM   225  N N   . VAL A 1 29  ? -35.062 40.724 36.834 1.00 14.91 ? 29  VAL A N   1 
ATOM   226  C CA  . VAL A 1 29  ? -36.027 41.833 36.978 1.00 16.19 ? 29  VAL A CA  1 
ATOM   227  C C   . VAL A 1 29  ? -37.420 41.307 36.573 1.00 14.79 ? 29  VAL A C   1 
ATOM   228  O O   . VAL A 1 29  ? -38.393 41.593 37.260 1.00 17.01 ? 29  VAL A O   1 
ATOM   229  C CB  . VAL A 1 29  ? -35.616 43.094 36.192 1.00 16.08 ? 29  VAL A CB  1 
ATOM   230  C CG1 . VAL A 1 29  ? -36.627 44.234 36.207 1.00 16.14 ? 29  VAL A CG1 1 
ATOM   231  C CG2 . VAL A 1 29  ? -34.252 43.575 36.779 1.00 16.87 ? 29  VAL A CG2 1 
ATOM   232  N N   . CYS A 1 30  ? -37.465 40.568 35.482 1.00 16.82 ? 30  CYS A N   1 
ATOM   233  C CA  . CYS A 1 30  ? -38.751 40.003 35.000 1.00 16.71 ? 30  CYS A CA  1 
ATOM   234  C C   . CYS A 1 30  ? -39.417 39.137 36.051 1.00 15.85 ? 30  CYS A C   1 
ATOM   235  O O   . CYS A 1 30  ? -40.631 39.105 36.358 1.00 17.44 ? 30  CYS A O   1 
ATOM   236  C CB  . CYS A 1 30  ? -38.449 39.258 33.700 1.00 17.31 ? 30  CYS A CB  1 
ATOM   237  S SG  . CYS A 1 30  ? -39.957 38.666 32.869 1.00 19.26 ? 30  CYS A SG  1 
ATOM   238  N N   . ALA A 1 31  ? -38.589 38.265 36.619 1.00 14.97 ? 31  ALA A N   1 
ATOM   239  C CA  . ALA A 1 31  ? -39.008 37.316 37.671 1.00 15.94 ? 31  ALA A CA  1 
ATOM   240  C C   . ALA A 1 31  ? -39.618 38.090 38.815 1.00 15.74 ? 31  ALA A C   1 
ATOM   241  O O   . ALA A 1 31  ? -40.705 37.792 39.343 1.00 18.70 ? 31  ALA A O   1 
ATOM   242  C CB  . ALA A 1 31  ? -37.904 36.383 38.242 1.00 15.66 ? 31  ALA A CB  1 
ATOM   243  N N   . ALA A 1 32  ? -38.907 39.103 39.277 1.00 16.17 ? 32  ALA A N   1 
ATOM   244  C CA  . ALA A 1 32  ? -39.393 39.913 40.405 1.00 15.42 ? 32  ALA A CA  1 
ATOM   245  C C   . ALA A 1 32  ? -40.741 40.556 40.059 1.00 17.01 ? 32  ALA A C   1 
ATOM   246  O O   . ALA A 1 32  ? -41.631 40.560 40.895 1.00 18.70 ? 32  ALA A O   1 
ATOM   247  C CB  . ALA A 1 32  ? -38.309 40.919 40.760 1.00 17.61 ? 32  ALA A CB  1 
ATOM   248  N N   . LYS A 1 33  ? -40.818 41.039 38.792 1.00 16.63 ? 33  LYS A N   1 
ATOM   249  C CA  . LYS A 1 33  ? -42.072 41.664 38.353 1.00 17.49 ? 33  LYS A CA  1 
ATOM   250  C C   . LYS A 1 33  ? -43.261 40.691 38.503 1.00 17.58 ? 33  LYS A C   1 
ATOM   251  O O   . LYS A 1 33  ? -44.237 41.085 39.157 1.00 17.49 ? 33  LYS A O   1 
ATOM   252  C CB  . LYS A 1 33  ? -42.014 42.105 36.861 1.00 19.20 ? 33  LYS A CB  1 
ATOM   253  C CG  . LYS A 1 33  ? -43.395 42.615 36.341 1.00 20.34 ? 33  LYS A CG  1 
ATOM   254  C CD  . LYS A 1 33  ? -43.671 43.969 37.026 1.00 22.30 ? 33  LYS A CD  1 
ATOM   255  C CE  . LYS A 1 33  ? -45.033 44.494 36.511 1.00 23.46 ? 33  LYS A CE  1 
ATOM   256  N NZ  . LYS A 1 33  ? -45.355 45.674 37.363 1.00 27.96 ? 33  LYS A NZ  1 
ATOM   257  N N   . PHE A 1 34  ? -43.107 39.535 37.882 1.00 17.29 ? 34  PHE A N   1 
ATOM   258  C CA  . PHE A 1 34  ? -44.268 38.630 37.928 1.00 19.55 ? 34  PHE A CA  1 
ATOM   259  C C   . PHE A 1 34  ? -44.470 37.890 39.207 1.00 20.16 ? 34  PHE A C   1 
ATOM   260  O O   . PHE A 1 34  ? -45.607 37.412 39.466 1.00 21.07 ? 34  PHE A O   1 
ATOM   261  C CB  . PHE A 1 34  ? -44.353 37.843 36.618 1.00 19.22 ? 34  PHE A CB  1 
ATOM   262  C CG  . PHE A 1 34  ? -44.460 38.738 35.411 1.00 20.92 ? 34  PHE A CG  1 
ATOM   263  C CD1 . PHE A 1 34  ? -45.637 39.476 35.165 1.00 21.99 ? 34  PHE A CD1 1 
ATOM   264  C CD2 . PHE A 1 34  ? -43.415 38.786 34.536 1.00 19.41 ? 34  PHE A CD2 1 
ATOM   265  C CE1 . PHE A 1 34  ? -45.634 40.294 34.017 1.00 22.58 ? 34  PHE A CE1 1 
ATOM   266  C CE2 . PHE A 1 34  ? -43.395 39.548 33.395 1.00 19.63 ? 34  PHE A CE2 1 
ATOM   267  C CZ  . PHE A 1 34  ? -44.545 40.314 33.163 1.00 21.32 ? 34  PHE A CZ  1 
ATOM   268  N N   . GLU A 1 35  ? -43.409 37.731 40.016 1.00 17.85 ? 35  GLU A N   1 
ATOM   269  C CA  . GLU A 1 35  ? -43.586 37.048 41.295 1.00 19.13 ? 35  GLU A CA  1 
ATOM   270  C C   . GLU A 1 35  ? -44.233 37.947 42.314 1.00 19.36 ? 35  GLU A C   1 
ATOM   271  O O   . GLU A 1 35  ? -45.181 37.472 43.000 1.00 18.54 ? 35  GLU A O   1 
ATOM   272  C CB  . GLU A 1 35  ? -42.229 36.529 41.836 1.00 20.20 ? 35  GLU A CB  1 
ATOM   273  C CG  . GLU A 1 35  ? -41.681 35.339 40.994 1.00 20.59 ? 35  GLU A CG  1 
ATOM   274  C CD  . GLU A 1 35  ? -42.391 34.030 41.156 1.00 22.09 ? 35  GLU A CD  1 
ATOM   275  O OE1 . GLU A 1 35  ? -43.155 33.973 42.128 1.00 22.74 ? 35  GLU A OE1 1 
ATOM   276  O OE2 . GLU A 1 35  ? -42.266 33.094 40.370 1.00 20.20 ? 35  GLU A OE2 1 
ATOM   277  N N   . SER A 1 36  ? -43.814 39.183 42.512 1.00 17.06 ? 36  SER A N   1 
ATOM   278  C CA  . SER A 1 36  ? -44.341 40.052 43.534 1.00 19.50 ? 36  SER A CA  1 
ATOM   279  C C   . SER A 1 36  ? -44.712 41.496 43.171 1.00 19.37 ? 36  SER A C   1 
ATOM   280  O O   . SER A 1 36  ? -45.034 42.236 44.132 1.00 20.77 ? 36  SER A O   1 
ATOM   281  C CB  . SER A 1 36  ? -43.199 40.312 44.551 1.00 19.96 ? 36  SER A CB  1 
ATOM   282  O OG  . SER A 1 36  ? -42.084 40.922 43.899 1.00 20.72 ? 36  SER A OG  1 
ATOM   283  N N   . ASN A 1 37  ? -44.587 41.779 41.928 1.00 20.85 ? 37  ASN A N   1 
ATOM   284  C CA  . ASN A 1 37  ? -44.820 43.146 41.409 1.00 22.26 ? 37  ASN A CA  1 
ATOM   285  C C   . ASN A 1 37  ? -43.871 44.132 42.103 1.00 22.48 ? 37  ASN A C   1 
ATOM   286  O O   . ASN A 1 37  ? -44.284 45.282 42.403 1.00 21.34 ? 37  ASN A O   1 
ATOM   287  C CB  . ASN A 1 37  ? -46.306 43.607 41.499 1.00 25.69 ? 37  ASN A CB  1 
ATOM   288  C CG  . ASN A 1 37  ? -46.573 44.748 40.529 1.00 27.04 ? 37  ASN A CG  1 
ATOM   289  O OD1 . ASN A 1 37  ? -45.866 44.978 39.538 1.00 28.96 ? 37  ASN A OD1 1 
ATOM   290  N ND2 . ASN A 1 37  ? -47.515 45.644 40.801 1.00 29.03 ? 37  ASN A ND2 1 
ATOM   291  N N   . PHE A 1 38  ? -42.624 43.673 42.333 1.00 20.68 ? 38  PHE A N   1 
ATOM   292  C CA  . PHE A 1 38  ? -41.572 44.474 42.920 1.00 21.55 ? 38  PHE A CA  1 
ATOM   293  C C   . PHE A 1 38  ? -41.783 44.905 44.351 1.00 19.85 ? 38  PHE A C   1 
ATOM   294  O O   . PHE A 1 38  ? -41.082 45.826 44.795 1.00 19.23 ? 38  PHE A O   1 
ATOM   295  C CB  . PHE A 1 38  ? -41.246 45.731 42.079 1.00 20.12 ? 38  PHE A CB  1 
ATOM   296  C CG  . PHE A 1 38  ? -40.865 45.543 40.640 1.00 20.11 ? 38  PHE A CG  1 
ATOM   297  C CD1 . PHE A 1 38  ? -40.138 44.423 40.200 1.00 18.60 ? 38  PHE A CD1 1 
ATOM   298  C CD2 . PHE A 1 38  ? -41.174 46.588 39.753 1.00 20.70 ? 38  PHE A CD2 1 
ATOM   299  C CE1 . PHE A 1 38  ? -39.764 44.273 38.888 1.00 20.80 ? 38  PHE A CE1 1 
ATOM   300  C CE2 . PHE A 1 38  ? -40.804 46.445 38.398 1.00 20.47 ? 38  PHE A CE2 1 
ATOM   301  C CZ  . PHE A 1 38  ? -40.094 45.287 37.985 1.00 19.82 ? 38  PHE A CZ  1 
ATOM   302  N N   . ASN A 1 39  ? -42.662 44.257 45.068 1.00 19.58 ? 39  ASN A N   1 
ATOM   303  C CA  . ASN A 1 39  ? -43.032 44.517 46.448 1.00 21.56 ? 39  ASN A CA  1 
ATOM   304  C C   . ASN A 1 39  ? -42.252 43.595 47.421 1.00 22.37 ? 39  ASN A C   1 
ATOM   305  O O   . ASN A 1 39  ? -42.566 42.399 47.308 1.00 21.55 ? 39  ASN A O   1 
ATOM   306  C CB  . ASN A 1 39  ? -44.501 44.211 46.598 1.00 22.76 ? 39  ASN A CB  1 
ATOM   307  C CG  . ASN A 1 39  ? -45.100 44.608 47.921 1.00 26.09 ? 39  ASN A CG  1 
ATOM   308  O OD1 . ASN A 1 39  ? -44.419 45.122 48.813 1.00 24.45 ? 39  ASN A OD1 1 
ATOM   309  N ND2 . ASN A 1 39  ? -46.412 44.316 47.994 1.00 28.88 ? 39  ASN A ND2 1 
ATOM   310  N N   . THR A 1 40  ? -41.415 44.220 48.197 1.00 22.82 ? 40  THR A N   1 
ATOM   311  C CA  . THR A 1 40  ? -40.561 43.506 49.143 1.00 24.73 ? 40  THR A CA  1 
ATOM   312  C C   . THR A 1 40  ? -41.375 42.841 50.234 1.00 25.15 ? 40  THR A C   1 
ATOM   313  O O   . THR A 1 40  ? -40.933 41.886 50.918 1.00 25.88 ? 40  THR A O   1 
ATOM   314  C CB  . THR A 1 40  ? -39.461 44.487 49.745 1.00 25.87 ? 40  THR A CB  1 
ATOM   315  O OG1 . THR A 1 40  ? -40.197 45.552 50.427 1.00 27.13 ? 40  THR A OG1 1 
ATOM   316  C CG2 . THR A 1 40  ? -38.499 45.098 48.708 1.00 26.80 ? 40  THR A CG2 1 
ATOM   317  N N   . HIS A 1 41  ? -42.621 43.322 50.389 1.00 25.59 ? 41  HIS A N   1 
ATOM   318  C CA  . HIS A 1 41  ? -43.507 42.746 51.427 1.00 26.65 ? 41  HIS A CA  1 
ATOM   319  C C   . HIS A 1 41  ? -44.535 41.769 50.925 1.00 26.42 ? 41  HIS A C   1 
ATOM   320  O O   . HIS A 1 41  ? -45.341 41.303 51.776 1.00 28.34 ? 41  HIS A O   1 
ATOM   321  C CB  . HIS A 1 41  ? -44.169 43.853 52.315 1.00 28.50 ? 41  HIS A CB  1 
ATOM   322  C CG  . HIS A 1 41  ? -44.108 43.447 53.766 0.60 29.03 ? 41  HIS A CG  1 
ATOM   323  N ND1 . HIS A 1 41  ? -43.269 44.044 54.655 0.60 30.09 ? 41  HIS A ND1 1 
ATOM   324  C CD2 . HIS A 1 41  ? -44.781 42.504 54.470 0.60 29.28 ? 41  HIS A CD2 1 
ATOM   325  C CE1 . HIS A 1 41  ? -43.425 43.495 55.855 0.60 29.70 ? 41  HIS A CE1 1 
ATOM   326  N NE2 . HIS A 1 41  ? -44.351 42.571 55.771 0.60 30.80 ? 41  HIS A NE2 1 
ATOM   327  N N   . ALA A 1 42  ? -44.533 41.371 49.670 1.00 25.27 ? 42  ALA A N   1 
ATOM   328  C CA  . ALA A 1 42  ? -45.491 40.388 49.149 1.00 23.87 ? 42  ALA A CA  1 
ATOM   329  C C   . ALA A 1 42  ? -45.393 39.049 49.896 1.00 24.14 ? 42  ALA A C   1 
ATOM   330  O O   . ALA A 1 42  ? -44.301 38.550 50.166 1.00 22.56 ? 42  ALA A O   1 
ATOM   331  C CB  . ALA A 1 42  ? -45.161 40.200 47.673 1.00 21.62 ? 42  ALA A CB  1 
ATOM   332  N N   . THR A 1 43  ? -46.517 38.476 50.240 1.00 25.71 ? 43  THR A N   1 
ATOM   333  C CA  . THR A 1 43  ? -46.681 37.182 50.914 1.00 28.09 ? 43  THR A CA  1 
ATOM   334  C C   . THR A 1 43  ? -47.799 36.407 50.229 1.00 30.40 ? 43  THR A C   1 
ATOM   335  O O   . THR A 1 43  ? -48.836 37.044 49.950 1.00 31.58 ? 43  THR A O   1 
ATOM   336  C CB  . THR A 1 43  ? -46.994 37.340 52.463 1.00 27.90 ? 43  THR A CB  1 
ATOM   337  O OG1 . THR A 1 43  ? -48.213 38.033 52.597 1.00 28.38 ? 43  THR A OG1 1 
ATOM   338  C CG2 . THR A 1 43  ? -45.911 38.133 53.181 1.00 27.51 ? 43  THR A CG2 1 
ATOM   339  N N   . ASN A 1 44  ? -47.620 35.144 49.906 1.00 31.04 ? 44  ASN A N   1 
ATOM   340  C CA  . ASN A 1 44  ? -48.671 34.368 49.240 1.00 33.34 ? 44  ASN A CA  1 
ATOM   341  C C   . ASN A 1 44  ? -48.720 32.978 49.896 1.00 34.62 ? 44  ASN A C   1 
ATOM   342  O O   . ASN A 1 44  ? -47.772 32.199 49.816 1.00 33.47 ? 44  ASN A O   1 
ATOM   343  C CB  . ASN A 1 44  ? -48.534 34.330 47.731 1.00 33.76 ? 44  ASN A CB  1 
ATOM   344  C CG  . ASN A 1 44  ? -48.788 35.703 47.026 1.00 43.83 ? 44  ASN A CG  1 
ATOM   345  O OD1 . ASN A 1 44  ? -49.603 36.611 47.305 1.00 46.54 ? 44  ASN A OD1 1 
ATOM   346  N ND2 . ASN A 1 44  ? -48.030 35.973 45.936 1.00 46.70 ? 44  ASN A ND2 1 
ATOM   347  N N   . ARG A 1 45  ? -49.881 32.738 50.485 1.00 36.84 ? 45  ARG A N   1 
ATOM   348  C CA  . ARG A 1 45  ? -50.127 31.441 51.152 1.00 39.22 ? 45  ARG A CA  1 
ATOM   349  C C   . ARG A 1 45  ? -50.443 30.422 50.071 1.00 41.36 ? 45  ARG A C   1 
ATOM   350  O O   . ARG A 1 45  ? -51.214 30.665 49.113 1.00 42.58 ? 45  ARG A O   1 
ATOM   351  C CB  . ARG A 1 45  ? -51.169 31.550 52.258 1.00 39.73 ? 45  ARG A CB  1 
ATOM   352  N N   . ASN A 1 46  ? -49.778 29.287 50.180 1.00 42.49 ? 46  ASN A N   1 
ATOM   353  C CA  . ASN A 1 46  ? -49.926 28.156 49.254 1.00 44.37 ? 46  ASN A CA  1 
ATOM   354  C C   . ASN A 1 46  ? -50.946 27.228 49.938 1.00 45.56 ? 46  ASN A C   1 
ATOM   355  O O   . ASN A 1 46  ? -51.271 27.384 51.114 1.00 46.87 ? 46  ASN A O   1 
ATOM   356  C CB  . ASN A 1 46  ? -48.638 27.446 48.886 1.00 43.28 ? 46  ASN A CB  1 
ATOM   357  C CG  . ASN A 1 46  ? -47.703 28.347 48.103 1.00 43.16 ? 46  ASN A CG  1 
ATOM   358  O OD1 . ASN A 1 46  ? -48.088 28.807 47.009 1.00 43.61 ? 46  ASN A OD1 1 
ATOM   359  N ND2 . ASN A 1 46  ? -46.512 28.591 48.631 1.00 42.75 ? 46  ASN A ND2 1 
ATOM   360  N N   . THR A 1 47  ? -51.410 26.346 49.098 1.00 47.42 ? 47  THR A N   1 
ATOM   361  C CA  . THR A 1 47  ? -52.428 25.351 49.496 1.00 48.63 ? 47  THR A CA  1 
ATOM   362  C C   . THR A 1 47  ? -51.788 24.325 50.403 1.00 48.09 ? 47  THR A C   1 
ATOM   363  O O   . THR A 1 47  ? -52.325 24.008 51.479 1.00 49.83 ? 47  THR A O   1 
ATOM   364  C CB  . THR A 1 47  ? -53.128 24.842 48.172 1.00 49.20 ? 47  THR A CB  1 
ATOM   365  O OG1 . THR A 1 47  ? -54.246 23.979 48.533 1.00 49.98 ? 47  THR A OG1 1 
ATOM   366  C CG2 . THR A 1 47  ? -52.136 24.203 47.190 1.00 49.86 ? 47  THR A CG2 1 
ATOM   367  N N   . ASP A 1 48  ? -50.615 23.854 50.019 1.00 47.10 ? 48  ASP A N   1 
ATOM   368  C CA  . ASP A 1 48  ? -49.873 22.851 50.791 1.00 45.87 ? 48  ASP A CA  1 
ATOM   369  C C   . ASP A 1 48  ? -49.510 23.361 52.184 1.00 43.68 ? 48  ASP A C   1 
ATOM   370  O O   . ASP A 1 48  ? -48.770 22.638 52.868 1.00 45.48 ? 48  ASP A O   1 
ATOM   371  C CB  . ASP A 1 48  ? -48.682 22.381 49.964 1.00 46.36 ? 48  ASP A CB  1 
ATOM   372  C CG  . ASP A 1 48  ? -47.653 23.488 49.761 1.00 47.30 ? 48  ASP A CG  1 
ATOM   373  O OD1 . ASP A 1 48  ? -47.909 24.613 50.246 1.00 46.33 ? 48  ASP A OD1 1 
ATOM   374  O OD2 . ASP A 1 48  ? -46.604 23.207 49.150 1.00 48.37 ? 48  ASP A OD2 1 
ATOM   375  N N   . GLY A 1 49  ? -49.954 24.547 52.577 1.00 41.70 ? 49  GLY A N   1 
ATOM   376  C CA  . GLY A 1 49  ? -49.632 25.071 53.910 1.00 37.56 ? 49  GLY A CA  1 
ATOM   377  C C   . GLY A 1 49  ? -48.380 25.941 53.930 1.00 35.08 ? 49  GLY A C   1 
ATOM   378  O O   . GLY A 1 49  ? -48.109 26.545 54.977 1.00 35.37 ? 49  GLY A O   1 
ATOM   379  N N   . SER A 1 50  ? -47.647 25.986 52.821 1.00 32.13 ? 50  SER A N   1 
ATOM   380  C CA  . SER A 1 50  ? -46.414 26.842 52.818 1.00 28.72 ? 50  SER A CA  1 
ATOM   381  C C   . SER A 1 50  ? -46.813 28.254 52.420 1.00 26.72 ? 50  SER A C   1 
ATOM   382  O O   . SER A 1 50  ? -47.964 28.498 52.007 1.00 26.61 ? 50  SER A O   1 
ATOM   383  C CB  . SER A 1 50  ? -45.340 26.264 51.938 1.00 28.56 ? 50  SER A CB  1 
ATOM   384  O OG  . SER A 1 50  ? -45.580 26.104 50.559 1.00 30.01 ? 50  SER A OG  1 
ATOM   385  N N   . THR A 1 51  ? -45.851 29.166 52.548 1.00 24.36 ? 51  THR A N   1 
ATOM   386  C CA  . THR A 1 51  ? -46.059 30.565 52.160 1.00 22.01 ? 51  THR A CA  1 
ATOM   387  C C   . THR A 1 51  ? -44.829 31.033 51.352 1.00 22.38 ? 51  THR A C   1 
ATOM   388  O O   . THR A 1 51  ? -43.684 30.663 51.704 1.00 17.88 ? 51  THR A O   1 
ATOM   389  C CB  . THR A 1 51  ? -46.288 31.470 53.426 1.00 22.65 ? 51  THR A CB  1 
ATOM   390  O OG1 . THR A 1 51  ? -47.496 31.031 54.098 1.00 25.53 ? 51  THR A OG1 1 
ATOM   391  C CG2 . THR A 1 51  ? -46.324 32.985 53.092 1.00 22.74 ? 51  THR A CG2 1 
ATOM   392  N N   . ASP A 1 52  ? -45.022 31.901 50.371 1.00 21.36 ? 52  ASP A N   1 
ATOM   393  C CA  . ASP A 1 52  ? -43.937 32.473 49.579 1.00 22.94 ? 52  ASP A CA  1 
ATOM   394  C C   . ASP A 1 52  ? -43.748 33.900 50.105 1.00 21.38 ? 52  ASP A C   1 
ATOM   395  O O   . ASP A 1 52  ? -44.695 34.668 50.265 1.00 21.12 ? 52  ASP A O   1 
ATOM   396  C CB  . ASP A 1 52  ? -44.178 32.489 48.081 1.00 23.74 ? 52  ASP A CB  1 
ATOM   397  C CG  . ASP A 1 52  ? -44.351 31.151 47.453 1.00 26.97 ? 52  ASP A CG  1 
ATOM   398  O OD1 . ASP A 1 52  ? -43.931 30.134 48.020 1.00 27.22 ? 52  ASP A OD1 1 
ATOM   399  O OD2 . ASP A 1 52  ? -44.926 31.055 46.342 1.00 29.72 ? 52  ASP A OD2 1 
ATOM   400  N N   . TYR A 1 53  ? -42.493 34.278 50.248 1.00 19.88 ? 53  TYR A N   1 
ATOM   401  C CA  . TYR A 1 53  ? -42.167 35.583 50.800 1.00 19.48 ? 53  TYR A CA  1 
ATOM   402  C C   . TYR A 1 53  ? -41.264 36.522 50.038 1.00 20.32 ? 53  TYR A C   1 
ATOM   403  O O   . TYR A 1 53  ? -40.293 36.013 49.510 1.00 18.52 ? 53  TYR A O   1 
ATOM   404  C CB  . TYR A 1 53  ? -41.384 35.333 52.141 1.00 19.49 ? 53  TYR A CB  1 
ATOM   405  C CG  . TYR A 1 53  ? -42.190 34.738 53.242 1.00 20.75 ? 53  TYR A CG  1 
ATOM   406  C CD1 . TYR A 1 53  ? -42.329 33.366 53.414 1.00 20.86 ? 53  TYR A CD1 1 
ATOM   407  C CD2 . TYR A 1 53  ? -42.858 35.572 54.162 1.00 21.99 ? 53  TYR A CD2 1 
ATOM   408  C CE1 . TYR A 1 53  ? -43.108 32.835 54.447 1.00 21.66 ? 53  TYR A CE1 1 
ATOM   409  C CE2 . TYR A 1 53  ? -43.640 35.053 55.184 1.00 20.39 ? 53  TYR A CE2 1 
ATOM   410  C CZ  . TYR A 1 53  ? -43.732 33.683 55.363 1.00 23.00 ? 53  TYR A CZ  1 
ATOM   411  O OH  . TYR A 1 53  ? -44.544 33.119 56.339 1.00 23.50 ? 53  TYR A OH  1 
ATOM   412  N N   . GLY A 1 54  ? -41.659 37.777 50.043 1.00 20.81 ? 54  GLY A N   1 
ATOM   413  C CA  . GLY A 1 54  ? -40.877 38.826 49.462 1.00 20.04 ? 54  GLY A CA  1 
ATOM   414  C C   . GLY A 1 54  ? -40.799 39.003 47.976 1.00 18.39 ? 54  GLY A C   1 
ATOM   415  O O   . GLY A 1 54  ? -41.551 38.414 47.194 1.00 17.36 ? 54  GLY A O   1 
ATOM   416  N N   . ILE A 1 55  ? -39.796 39.815 47.655 1.00 19.03 ? 55  ILE A N   1 
ATOM   417  C CA  . ILE A 1 55  ? -39.614 40.177 46.210 1.00 19.48 ? 55  ILE A CA  1 
ATOM   418  C C   . ILE A 1 55  ? -39.458 39.071 45.189 1.00 20.16 ? 55  ILE A C   1 
ATOM   419  O O   . ILE A 1 55  ? -39.952 39.271 44.084 1.00 19.28 ? 55  ILE A O   1 
ATOM   420  C CB  . ILE A 1 55  ? -38.516 41.289 46.125 1.00 21.68 ? 55  ILE A CB  1 
ATOM   421  C CG1 . ILE A 1 55  ? -38.651 41.982 44.717 1.00 22.49 ? 55  ILE A CG1 1 
ATOM   422  C CG2 . ILE A 1 55  ? -37.095 40.678 46.368 1.00 21.49 ? 55  ILE A CG2 1 
ATOM   423  C CD1 . ILE A 1 55  ? -38.222 43.465 44.754 1.00 24.69 ? 55  ILE A CD1 1 
ATOM   424  N N   . LEU A 1 56  ? -38.857 37.954 45.550 1.00 20.57 ? 56  LEU A N   1 
ATOM   425  C CA  . LEU A 1 56  ? -38.641 36.760 44.732 1.00 20.24 ? 56  LEU A CA  1 
ATOM   426  C C   . LEU A 1 56  ? -39.483 35.564 45.238 1.00 20.84 ? 56  LEU A C   1 
ATOM   427  O O   . LEU A 1 56  ? -39.283 34.428 44.778 1.00 19.71 ? 56  LEU A O   1 
ATOM   428  C CB  . LEU A 1 56  ? -37.166 36.521 44.607 1.00 21.75 ? 56  LEU A CB  1 
ATOM   429  C CG  . LEU A 1 56  ? -36.218 36.903 43.495 1.00 25.81 ? 56  LEU A CG  1 
ATOM   430  C CD1 . LEU A 1 56  ? -36.922 37.354 42.226 1.00 25.87 ? 56  LEU A CD1 1 
ATOM   431  C CD2 . LEU A 1 56  ? -35.142 37.863 43.988 1.00 25.77 ? 56  LEU A CD2 1 
ATOM   432  N N   . GLN A 1 57  ? -40.458 35.814 46.087 1.00 19.20 ? 57  GLN A N   1 
ATOM   433  C CA  . GLN A 1 57  ? -41.442 34.836 46.573 1.00 19.14 ? 57  GLN A CA  1 
ATOM   434  C C   . GLN A 1 57  ? -40.828 33.488 46.924 1.00 19.37 ? 57  GLN A C   1 
ATOM   435  O O   . GLN A 1 57  ? -41.206 32.438 46.401 1.00 19.38 ? 57  GLN A O   1 
ATOM   436  C CB  . GLN A 1 57  ? -42.460 34.677 45.408 1.00 21.12 ? 57  GLN A CB  1 
ATOM   437  C CG  . GLN A 1 57  ? -43.415 35.853 45.326 1.00 20.13 ? 57  GLN A CG  1 
ATOM   438  C CD  . GLN A 1 57  ? -44.316 35.951 46.513 1.00 19.89 ? 57  GLN A CD  1 
ATOM   439  O OE1 . GLN A 1 57  ? -45.325 35.228 46.620 1.00 19.19 ? 57  GLN A OE1 1 
ATOM   440  N NE2 . GLN A 1 57  ? -43.911 36.793 47.488 1.00 20.28 ? 57  GLN A NE2 1 
ATOM   441  N N   . ILE A 1 58  ? -39.931 33.512 47.873 1.00 18.58 ? 58  ILE A N   1 
ATOM   442  C CA  . ILE A 1 58  ? -39.196 32.285 48.325 1.00 19.46 ? 58  ILE A CA  1 
ATOM   443  C C   . ILE A 1 58  ? -40.083 31.513 49.298 1.00 18.95 ? 58  ILE A C   1 
ATOM   444  O O   . ILE A 1 58  ? -40.622 32.102 50.239 1.00 18.07 ? 58  ILE A O   1 
ATOM   445  C CB  . ILE A 1 58  ? -37.822 32.780 48.856 1.00 21.08 ? 58  ILE A CB  1 
ATOM   446  C CG1 . ILE A 1 58  ? -36.994 33.258 47.623 1.00 23.20 ? 58  ILE A CG1 1 
ATOM   447  C CG2 . ILE A 1 58  ? -37.080 31.717 49.745 1.00 22.64 ? 58  ILE A CG2 1 
ATOM   448  C CD1 . ILE A 1 58  ? -35.748 34.055 48.084 1.00 21.73 ? 58  ILE A CD1 1 
ATOM   449  N N   . ASN A 1 59  ? -40.222 30.230 49.092 1.00 18.04 ? 59  ASN A N   1 
ATOM   450  C CA  . ASN A 1 59  ? -41.021 29.232 49.750 1.00 21.21 ? 59  ASN A CA  1 
ATOM   451  C C   . ASN A 1 59  ? -40.527 28.710 51.095 1.00 20.43 ? 59  ASN A C   1 
ATOM   452  O O   . ASN A 1 59  ? -39.384 28.345 51.278 1.00 17.19 ? 59  ASN A O   1 
ATOM   453  C CB  . ASN A 1 59  ? -41.351 28.121 48.735 1.00 22.75 ? 59  ASN A CB  1 
ATOM   454  C CG  . ASN A 1 59  ? -42.336 27.163 49.361 1.00 24.32 ? 59  ASN A CG  1 
ATOM   455  O OD1 . ASN A 1 59  ? -41.856 26.173 49.944 1.00 25.56 ? 59  ASN A OD1 1 
ATOM   456  N ND2 . ASN A 1 59  ? -43.608 27.556 49.306 1.00 26.41 ? 59  ASN A ND2 1 
ATOM   457  N N   . SER A 1 60  ? -41.450 28.776 52.041 1.00 19.90 ? 60  SER A N   1 
ATOM   458  C CA  . SER A 1 60  ? -41.263 28.366 53.443 1.00 20.67 ? 60  SER A CA  1 
ATOM   459  C C   . SER A 1 60  ? -41.208 26.849 53.612 1.00 21.11 ? 60  SER A C   1 
ATOM   460  O O   . SER A 1 60  ? -40.842 26.423 54.715 1.00 21.64 ? 60  SER A O   1 
ATOM   461  C CB  . SER A 1 60  ? -42.296 29.023 54.352 1.00 20.73 ? 60  SER A CB  1 
ATOM   462  O OG  . SER A 1 60  ? -43.544 28.384 54.186 1.00 21.04 ? 60  SER A OG  1 
ATOM   463  N N   . ARG A 1 61  ? -41.478 26.058 52.568 1.00 23.30 ? 61  ARG A N   1 
ATOM   464  C CA  . ARG A 1 61  ? -41.352 24.616 52.838 1.00 25.18 ? 61  ARG A CA  1 
ATOM   465  C C   . ARG A 1 61  ? -39.937 24.169 52.563 1.00 25.39 ? 61  ARG A C   1 
ATOM   466  O O   . ARG A 1 61  ? -39.422 23.278 53.258 1.00 25.06 ? 61  ARG A O   1 
ATOM   467  C CB  . ARG A 1 61  ? -42.360 23.744 52.132 1.00 28.77 ? 61  ARG A CB  1 
ATOM   468  C CG  . ARG A 1 61  ? -42.213 22.263 52.545 1.00 32.63 ? 61  ARG A CG  1 
ATOM   469  C CD  . ARG A 1 61  ? -43.552 21.635 52.286 1.00 35.49 ? 61  ARG A CD  1 
ATOM   470  N NE  . ARG A 1 61  ? -44.324 21.791 53.524 1.00 39.21 ? 61  ARG A NE  1 
ATOM   471  C CZ  . ARG A 1 61  ? -45.621 22.113 53.530 1.00 39.64 ? 61  ARG A CZ  1 
ATOM   472  N NH1 . ARG A 1 61  ? -46.257 22.355 52.387 1.00 39.95 ? 61  ARG A NH1 1 
ATOM   473  N NH2 . ARG A 1 61  ? -46.242 22.227 54.699 1.00 40.17 ? 61  ARG A NH2 1 
ATOM   474  N N   . TRP A 1 62  ? -39.261 24.795 51.615 1.00 23.36 ? 62  TRP A N   1 
ATOM   475  C CA  . TRP A 1 62  ? -37.912 24.406 51.272 1.00 23.80 ? 62  TRP A CA  1 
ATOM   476  C C   . TRP A 1 62  ? -36.783 25.347 51.617 1.00 21.88 ? 62  TRP A C   1 
ATOM   477  O O   . TRP A 1 62  ? -35.697 24.816 51.852 1.00 19.97 ? 62  TRP A O   1 
ATOM   478  C CB  . TRP A 1 62  ? -37.891 24.407 49.707 1.00 28.87 ? 62  TRP A CB  1 
ATOM   479  C CG  . TRP A 1 62  ? -38.815 23.388 49.149 0.50 34.47 ? 62  TRP A CG  1 
ATOM   480  C CD1 . TRP A 1 62  ? -40.127 23.507 48.776 0.50 35.88 ? 62  TRP A CD1 1 
ATOM   481  C CD2 . TRP A 1 62  ? -38.463 22.018 48.941 0.50 37.42 ? 62  TRP A CD2 1 
ATOM   482  N NE1 . TRP A 1 62  ? -40.620 22.295 48.338 0.50 37.89 ? 62  TRP A NE1 1 
ATOM   483  C CE2 . TRP A 1 62  ? -39.610 21.376 48.424 0.50 37.82 ? 62  TRP A CE2 1 
ATOM   484  C CE3 . TRP A 1 62  ? -37.277 21.315 49.129 0.50 38.40 ? 62  TRP A CE3 1 
ATOM   485  C CZ2 . TRP A 1 62  ? -39.606 20.028 48.099 0.50 39.05 ? 62  TRP A CZ2 1 
ATOM   486  C CZ3 . TRP A 1 62  ? -37.269 19.975 48.801 0.50 39.61 ? 62  TRP A CZ3 1 
ATOM   487  C CH2 . TRP A 1 62  ? -38.414 19.352 48.301 0.50 39.62 ? 62  TRP A CH2 1 
ATOM   488  N N   . TRP A 1 63  ? -37.109 26.647 51.478 1.00 19.16 ? 63  TRP A N   1 
ATOM   489  C CA  . TRP A 1 63  ? -36.006 27.627 51.614 1.00 18.31 ? 63  TRP A CA  1 
ATOM   490  C C   . TRP A 1 63  ? -35.794 28.486 52.772 1.00 18.65 ? 63  TRP A C   1 
ATOM   491  O O   . TRP A 1 63  ? -34.636 28.835 53.100 1.00 18.92 ? 63  TRP A O   1 
ATOM   492  C CB  . TRP A 1 63  ? -36.064 28.492 50.267 1.00 18.16 ? 63  TRP A CB  1 
ATOM   493  C CG  . TRP A 1 63  ? -36.064 27.666 49.012 1.00 21.05 ? 63  TRP A CG  1 
ATOM   494  C CD1 . TRP A 1 63  ? -37.120 27.411 48.167 1.00 22.77 ? 63  TRP A CD1 1 
ATOM   495  C CD2 . TRP A 1 63  ? -34.954 26.920 48.479 1.00 22.70 ? 63  TRP A CD2 1 
ATOM   496  N NE1 . TRP A 1 63  ? -36.727 26.512 47.161 1.00 23.22 ? 63  TRP A NE1 1 
ATOM   497  C CE2 . TRP A 1 63  ? -35.409 26.262 47.327 1.00 23.56 ? 63  TRP A CE2 1 
ATOM   498  C CE3 . TRP A 1 63  ? -33.633 26.807 48.874 1.00 23.79 ? 63  TRP A CE3 1 
ATOM   499  C CZ2 . TRP A 1 63  ? -34.579 25.402 46.575 1.00 23.69 ? 63  TRP A CZ2 1 
ATOM   500  C CZ3 . TRP A 1 63  ? -32.769 25.995 48.135 1.00 23.91 ? 63  TRP A CZ3 1 
ATOM   501  C CH2 . TRP A 1 63  ? -33.273 25.351 47.010 1.00 23.54 ? 63  TRP A CH2 1 
ATOM   502  N N   . CYS A 1 64  ? -36.809 28.912 53.523 1.00 17.65 ? 64  CYS A N   1 
ATOM   503  C CA  . CYS A 1 64  ? -36.614 29.793 54.703 1.00 18.67 ? 64  CYS A CA  1 
ATOM   504  C C   . CYS A 1 64  ? -37.562 29.211 55.764 1.00 20.23 ? 64  CYS A C   1 
ATOM   505  O O   . CYS A 1 64  ? -38.498 28.482 55.383 1.00 20.22 ? 64  CYS A O   1 
ATOM   506  C CB  . CYS A 1 64  ? -36.877 31.239 54.308 1.00 16.28 ? 64  CYS A CB  1 
ATOM   507  S SG  . CYS A 1 64  ? -38.619 31.531 53.828 1.00 18.05 ? 64  CYS A SG  1 
ATOM   508  N N   . ASN A 1 65  ? -37.321 29.555 57.021 1.00 20.49 ? 65  ASN A N   1 
ATOM   509  C CA  . ASN A 1 65  ? -38.237 29.004 58.048 1.00 23.03 ? 65  ASN A CA  1 
ATOM   510  C C   . ASN A 1 65  ? -39.132 30.135 58.546 1.00 21.98 ? 65  ASN A C   1 
ATOM   511  O O   . ASN A 1 65  ? -38.608 31.189 58.884 1.00 21.28 ? 65  ASN A O   1 
ATOM   512  C CB  . ASN A 1 65  ? -37.377 28.247 59.044 1.00 26.22 ? 65  ASN A CB  1 
ATOM   513  C CG  . ASN A 1 65  ? -38.143 27.778 60.278 1.00 29.98 ? 65  ASN A CG  1 
ATOM   514  O OD1 . ASN A 1 65  ? -39.349 27.500 60.204 1.00 31.56 ? 65  ASN A OD1 1 
ATOM   515  N ND2 . ASN A 1 65  ? -37.356 27.727 61.368 1.00 32.58 ? 65  ASN A ND2 1 
ATOM   516  N N   . ASP A 1 66  ? -40.443 29.907 58.499 1.00 21.85 ? 66  ASP A N   1 
ATOM   517  C CA  . ASP A 1 66  ? -41.384 30.941 58.967 1.00 24.79 ? 66  ASP A CA  1 
ATOM   518  C C   . ASP A 1 66  ? -42.012 30.547 60.344 1.00 25.88 ? 66  ASP A C   1 
ATOM   519  O O   . ASP A 1 66  ? -42.873 31.347 60.756 1.00 27.83 ? 66  ASP A O   1 
ATOM   520  C CB  . ASP A 1 66  ? -42.473 31.306 57.987 1.00 24.05 ? 66  ASP A CB  1 
ATOM   521  C CG  . ASP A 1 66  ? -43.464 30.246 57.619 1.00 23.94 ? 66  ASP A CG  1 
ATOM   522  O OD1 . ASP A 1 66  ? -43.440 29.084 58.046 1.00 22.59 ? 66  ASP A OD1 1 
ATOM   523  O OD2 . ASP A 1 66  ? -44.357 30.583 56.796 1.00 25.64 ? 66  ASP A OD2 1 
ATOM   524  N N   . GLY A 1 67  ? -41.625 29.395 60.801 1.00 27.99 ? 67  GLY A N   1 
ATOM   525  C CA  . GLY A 1 67  ? -42.151 28.932 62.108 1.00 29.88 ? 67  GLY A CA  1 
ATOM   526  C C   . GLY A 1 67  ? -43.559 28.321 62.035 1.00 31.74 ? 67  GLY A C   1 
ATOM   527  O O   . GLY A 1 67  ? -44.115 28.076 63.142 1.00 32.30 ? 67  GLY A O   1 
ATOM   528  N N   . ARG A 1 68  ? -44.090 28.084 60.831 1.00 31.63 ? 68  ARG A N   1 
ATOM   529  C CA  . ARG A 1 68  ? -45.455 27.510 60.753 1.00 31.16 ? 68  ARG A CA  1 
ATOM   530  C C   . ARG A 1 68  ? -45.678 26.592 59.570 1.00 29.62 ? 68  ARG A C   1 
ATOM   531  O O   . ARG A 1 68  ? -46.830 26.265 59.225 1.00 32.10 ? 68  ARG A O   1 
ATOM   532  C CB  . ARG A 1 68  ? -46.494 28.643 60.775 1.00 31.99 ? 68  ARG A CB  1 
ATOM   533  C CG  . ARG A 1 68  ? -46.474 29.654 59.674 1.00 33.12 ? 68  ARG A CG  1 
ATOM   534  C CD  . ARG A 1 68  ? -47.401 30.818 59.857 1.00 33.65 ? 68  ARG A CD  1 
ATOM   535  N N   . THR A 1 69  ? -44.610 26.096 58.963 1.00 27.98 ? 69  THR A N   1 
ATOM   536  C CA  . THR A 1 69  ? -44.700 25.203 57.837 1.00 28.02 ? 69  THR A CA  1 
ATOM   537  C C   . THR A 1 69  ? -44.232 23.805 58.178 1.00 28.90 ? 69  THR A C   1 
ATOM   538  O O   . THR A 1 69  ? -43.027 23.695 58.469 1.00 29.37 ? 69  THR A O   1 
ATOM   539  C CB  . THR A 1 69  ? -43.871 25.761 56.611 1.00 26.39 ? 69  THR A CB  1 
ATOM   540  O OG1 . THR A 1 69  ? -44.296 27.150 56.451 1.00 25.84 ? 69  THR A OG1 1 
ATOM   541  C CG2 . THR A 1 69  ? -44.103 24.919 55.365 1.00 26.96 ? 69  THR A CG2 1 
ATOM   542  N N   . PRO A 1 70  ? -45.136 22.845 58.147 1.00 29.23 ? 70  PRO A N   1 
ATOM   543  C CA  . PRO A 1 70  ? -44.764 21.460 58.464 1.00 29.18 ? 70  PRO A CA  1 
ATOM   544  C C   . PRO A 1 70  ? -43.678 21.011 57.482 1.00 30.57 ? 70  PRO A C   1 
ATOM   545  O O   . PRO A 1 70  ? -43.768 21.240 56.263 1.00 29.49 ? 70  PRO A O   1 
ATOM   546  C CB  . PRO A 1 70  ? -46.098 20.727 58.367 1.00 29.94 ? 70  PRO A CB  1 
ATOM   547  C CG  . PRO A 1 70  ? -47.107 21.834 58.720 1.00 30.33 ? 70  PRO A CG  1 
ATOM   548  C CD  . PRO A 1 70  ? -46.580 22.989 57.832 1.00 30.10 ? 70  PRO A CD  1 
ATOM   549  N N   . GLY A 1 71  ? -42.624 20.431 58.030 1.00 31.18 ? 71  GLY A N   1 
ATOM   550  C CA  . GLY A 1 71  ? -41.488 19.966 57.286 1.00 32.33 ? 71  GLY A CA  1 
ATOM   551  C C   . GLY A 1 71  ? -40.619 20.966 56.540 1.00 32.04 ? 71  GLY A C   1 
ATOM   552  O O   . GLY A 1 71  ? -40.236 20.570 55.407 1.00 34.70 ? 71  GLY A O   1 
ATOM   553  N N   . SER A 1 72  ? -40.277 22.105 57.072 1.00 31.83 ? 72  SER A N   1 
ATOM   554  C CA  . SER A 1 72  ? -39.414 23.097 56.442 1.00 29.55 ? 72  SER A CA  1 
ATOM   555  C C   . SER A 1 72  ? -37.945 22.628 56.479 1.00 28.61 ? 72  SER A C   1 
ATOM   556  O O   . SER A 1 72  ? -37.380 22.372 57.562 1.00 29.00 ? 72  SER A O   1 
ATOM   557  C CB  . SER A 1 72  ? -39.417 24.489 57.035 1.00 30.89 ? 72  SER A CB  1 
ATOM   558  O OG  . SER A 1 72  ? -38.554 25.382 56.307 1.00 31.37 ? 72  SER A OG  1 
ATOM   559  N N   . LYS A 1 73  ? -37.361 22.611 55.307 1.00 26.90 ? 73  LYS A N   1 
ATOM   560  C CA  . LYS A 1 73  ? -35.963 22.211 55.100 1.00 25.41 ? 73  LYS A CA  1 
ATOM   561  C C   . LYS A 1 73  ? -35.045 23.384 55.312 1.00 22.69 ? 73  LYS A C   1 
ATOM   562  O O   . LYS A 1 73  ? -33.819 23.227 55.503 1.00 20.54 ? 73  LYS A O   1 
ATOM   563  C CB  . LYS A 1 73  ? -35.773 21.603 53.707 1.00 26.28 ? 73  LYS A CB  1 
ATOM   564  C CG  . LYS A 1 73  ? -36.603 20.336 53.563 1.00 29.50 ? 73  LYS A CG  1 
ATOM   565  C CD  . LYS A 1 73  ? -36.497 19.681 52.199 1.00 32.37 ? 73  LYS A CD  1 
ATOM   566  C CE  . LYS A 1 73  ? -37.157 18.301 52.240 1.00 34.12 ? 73  LYS A CE  1 
ATOM   567  N NZ  . LYS A 1 73  ? -36.094 17.293 51.953 1.00 37.12 ? 73  LYS A NZ  1 
ATOM   568  N N   . ASN A 1 74  ? -35.667 24.583 55.222 1.00 19.83 ? 74  ASN A N   1 
ATOM   569  C CA  . ASN A 1 74  ? -34.856 25.796 55.411 1.00 18.37 ? 74  ASN A CA  1 
ATOM   570  C C   . ASN A 1 74  ? -33.467 25.662 54.772 1.00 18.64 ? 74  ASN A C   1 
ATOM   571  O O   . ASN A 1 74  ? -32.464 25.779 55.498 1.00 20.14 ? 74  ASN A O   1 
ATOM   572  C CB  . ASN A 1 74  ? -34.800 26.053 56.937 1.00 16.46 ? 74  ASN A CB  1 
ATOM   573  C CG  . ASN A 1 74  ? -34.211 27.355 57.425 1.00 16.98 ? 74  ASN A CG  1 
ATOM   574  O OD1 . ASN A 1 74  ? -33.839 27.635 58.608 1.00 17.57 ? 74  ASN A OD1 1 
ATOM   575  N ND2 . ASN A 1 74  ? -34.152 28.237 56.494 1.00 14.77 ? 74  ASN A ND2 1 
ATOM   576  N N   . LEU A 1 75  ? -33.365 25.453 53.493 1.00 20.48 ? 75  LEU A N   1 
ATOM   577  C CA  . LEU A 1 75  ? -32.066 25.321 52.774 1.00 19.13 ? 75  LEU A CA  1 
ATOM   578  C C   . LEU A 1 75  ? -31.296 26.613 52.699 1.00 19.14 ? 75  LEU A C   1 
ATOM   579  O O   . LEU A 1 75  ? -30.035 26.510 52.581 1.00 18.23 ? 75  LEU A O   1 
ATOM   580  C CB  . LEU A 1 75  ? -32.393 24.653 51.464 1.00 21.57 ? 75  LEU A CB  1 
ATOM   581  C CG  . LEU A 1 75  ? -32.137 23.224 51.101 1.00 24.94 ? 75  LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 75  ? -31.819 22.371 52.338 1.00 22.27 ? 75  LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 75  ? -33.230 22.616 50.224 1.00 24.44 ? 75  LEU A CD2 1 
ATOM   584  N N   . CYS A 1 76  ? -31.953 27.760 52.812 1.00 16.96 ? 76  CYS A N   1 
ATOM   585  C CA  . CYS A 1 76  ? -31.209 29.008 52.836 1.00 17.49 ? 76  CYS A CA  1 
ATOM   586  C C   . CYS A 1 76  ? -30.757 29.321 54.283 1.00 14.40 ? 76  CYS A C   1 
ATOM   587  O O   . CYS A 1 76  ? -29.927 30.229 54.423 1.00 15.88 ? 76  CYS A O   1 
ATOM   588  C CB  . CYS A 1 76  ? -31.991 30.201 52.276 1.00 16.03 ? 76  CYS A CB  1 
ATOM   589  S SG  . CYS A 1 76  ? -31.901 30.053 50.443 1.00 17.17 ? 76  CYS A SG  1 
ATOM   590  N N   . ASN A 1 77  ? -31.265 28.626 55.253 1.00 16.42 ? 77  ASN A N   1 
ATOM   591  C CA  . ASN A 1 77  ? -30.886 28.809 56.675 1.00 16.90 ? 77  ASN A CA  1 
ATOM   592  C C   . ASN A 1 77  ? -31.109 30.247 57.064 1.00 17.12 ? 77  ASN A C   1 
ATOM   593  O O   . ASN A 1 77  ? -30.188 30.966 57.538 1.00 17.80 ? 77  ASN A O   1 
ATOM   594  C CB  . ASN A 1 77  ? -29.426 28.369 56.816 1.00 20.72 ? 77  ASN A CB  1 
ATOM   595  C CG  . ASN A 1 77  ? -29.006 28.286 58.285 1.00 22.10 ? 77  ASN A CG  1 
ATOM   596  O OD1 . ASN A 1 77  ? -27.824 28.470 58.593 1.00 25.19 ? 77  ASN A OD1 1 
ATOM   597  N ND2 . ASN A 1 77  ? -29.935 28.108 59.181 1.00 20.70 ? 77  ASN A ND2 1 
ATOM   598  N N   . ILE A 1 78  ? -32.380 30.654 56.939 1.00 18.18 ? 78  ILE A N   1 
ATOM   599  C CA  . ILE A 1 78  ? -32.768 32.011 57.331 1.00 21.41 ? 78  ILE A CA  1 
ATOM   600  C C   . ILE A 1 78  ? -34.263 32.030 57.665 1.00 20.76 ? 78  ILE A C   1 
ATOM   601  O O   . ILE A 1 78  ? -34.941 31.260 57.014 1.00 20.42 ? 78  ILE A O   1 
ATOM   602  C CB  . ILE A 1 78  ? -32.523 32.968 56.101 1.00 23.96 ? 78  ILE A CB  1 
ATOM   603  C CG1 A ILE A 1 78  ? -33.162 32.436 54.785 0.50 27.06 ? 78  ILE A CG1 1 
ATOM   604  C CG1 B ILE A 1 78  ? -32.522 34.457 56.527 0.50 27.92 ? 78  ILE A CG1 1 
ATOM   605  C CG2 A ILE A 1 78  ? -31.051 33.361 55.896 0.50 25.86 ? 78  ILE A CG2 1 
ATOM   606  C CG2 B ILE A 1 78  ? -33.526 32.733 54.934 0.50 27.18 ? 78  ILE A CG2 1 
ATOM   607  C CD1 A ILE A 1 78  ? -33.496 33.632 53.813 0.50 27.91 ? 78  ILE A CD1 1 
ATOM   608  C CD1 B ILE A 1 78  ? -32.045 35.479 55.481 0.50 27.92 ? 78  ILE A CD1 1 
ATOM   609  N N   . PRO A 1 79  ? -34.658 32.920 58.558 1.00 20.46 ? 79  PRO A N   1 
ATOM   610  C CA  . PRO A 1 79  ? -36.098 33.076 58.828 1.00 20.50 ? 79  PRO A CA  1 
ATOM   611  C C   . PRO A 1 79  ? -36.672 33.817 57.632 1.00 19.34 ? 79  PRO A C   1 
ATOM   612  O O   . PRO A 1 79  ? -36.073 34.732 57.045 1.00 20.52 ? 79  PRO A O   1 
ATOM   613  C CB  . PRO A 1 79  ? -36.176 33.858 60.123 1.00 19.48 ? 79  PRO A CB  1 
ATOM   614  C CG  . PRO A 1 79  ? -34.809 34.485 60.357 1.00 20.40 ? 79  PRO A CG  1 
ATOM   615  C CD  . PRO A 1 79  ? -33.886 33.846 59.335 1.00 20.17 ? 79  PRO A CD  1 
ATOM   616  N N   . CYS A 1 80  ? -37.860 33.485 57.217 1.00 19.19 ? 80  CYS A N   1 
ATOM   617  C CA  . CYS A 1 80  ? -38.622 34.072 56.121 1.00 18.25 ? 80  CYS A CA  1 
ATOM   618  C C   . CYS A 1 80  ? -38.829 35.561 56.351 1.00 20.00 ? 80  CYS A C   1 
ATOM   619  O O   . CYS A 1 80  ? -38.711 36.364 55.413 1.00 21.46 ? 80  CYS A O   1 
ATOM   620  C CB  . CYS A 1 80  ? -39.948 33.350 55.919 1.00 17.36 ? 80  CYS A CB  1 
ATOM   621  S SG  . CYS A 1 80  ? -39.765 31.597 55.497 1.00 17.71 ? 80  CYS A SG  1 
ATOM   622  N N   . SER A 1 81  ? -38.958 35.917 57.628 1.00 21.98 ? 81  SER A N   1 
ATOM   623  C CA  . SER A 1 81  ? -39.124 37.356 57.963 1.00 23.43 ? 81  SER A CA  1 
ATOM   624  C C   . SER A 1 81  ? -37.968 38.182 57.421 1.00 25.60 ? 81  SER A C   1 
ATOM   625  O O   . SER A 1 81  ? -38.156 39.377 57.093 1.00 24.93 ? 81  SER A O   1 
ATOM   626  C CB  . SER A 1 81  ? -39.347 37.493 59.464 1.00 25.32 ? 81  SER A CB  1 
ATOM   627  O OG  . SER A 1 81  ? -38.280 37.009 60.216 1.00 26.53 ? 81  SER A OG  1 
ATOM   628  N N   . ALA A 1 82  ? -36.755 37.606 57.264 1.00 25.40 ? 82  ALA A N   1 
ATOM   629  C CA  . ALA A 1 82  ? -35.580 38.317 56.757 1.00 25.93 ? 82  ALA A CA  1 
ATOM   630  C C   . ALA A 1 82  ? -35.723 38.696 55.287 1.00 26.29 ? 82  ALA A C   1 
ATOM   631  O O   . ALA A 1 82  ? -35.013 39.584 54.743 1.00 26.75 ? 82  ALA A O   1 
ATOM   632  C CB  . ALA A 1 82  ? -34.265 37.566 56.992 1.00 27.42 ? 82  ALA A CB  1 
ATOM   633  N N   . LEU A 1 83  ? -36.627 38.027 54.614 1.00 26.23 ? 83  LEU A N   1 
ATOM   634  C CA  . LEU A 1 83  ? -36.952 38.201 53.206 1.00 27.19 ? 83  LEU A CA  1 
ATOM   635  C C   . LEU A 1 83  ? -37.992 39.315 53.007 1.00 28.48 ? 83  LEU A C   1 
ATOM   636  O O   . LEU A 1 83  ? -38.296 39.588 51.843 1.00 31.24 ? 83  LEU A O   1 
ATOM   637  C CB  . LEU A 1 83  ? -37.420 36.837 52.657 1.00 26.33 ? 83  LEU A CB  1 
ATOM   638  C CG  . LEU A 1 83  ? -36.433 35.693 52.763 1.00 26.49 ? 83  LEU A CG  1 
ATOM   639  C CD1 . LEU A 1 83  ? -36.971 34.413 52.136 1.00 26.39 ? 83  LEU A CD1 1 
ATOM   640  C CD2 . LEU A 1 83  ? -35.108 36.112 52.140 1.00 26.52 ? 83  LEU A CD2 1 
ATOM   641  N N   . LEU A 1 84  ? -38.479 39.882 54.107 1.00 28.79 ? 84  LEU A N   1 
ATOM   642  C CA  . LEU A 1 84  ? -39.504 40.945 53.923 1.00 29.45 ? 84  LEU A CA  1 
ATOM   643  C C   . LEU A 1 84  ? -38.950 42.344 54.093 1.00 30.01 ? 84  LEU A C   1 
ATOM   644  O O   . LEU A 1 84  ? -39.812 43.268 54.200 1.00 34.59 ? 84  LEU A O   1 
ATOM   645  C CB  . LEU A 1 84  ? -40.676 40.581 54.850 1.00 27.11 ? 84  LEU A CB  1 
ATOM   646  C CG  . LEU A 1 84  ? -41.378 39.264 54.547 1.00 26.30 ? 84  LEU A CG  1 
ATOM   647  C CD1 . LEU A 1 84  ? -42.426 38.953 55.621 1.00 25.77 ? 84  LEU A CD1 1 
ATOM   648  C CD2 . LEU A 1 84  ? -42.067 39.304 53.180 1.00 26.05 ? 84  LEU A CD2 1 
ATOM   649  N N   . SER A 1 85  ? -37.654 42.558 54.100 1.00 30.83 ? 85  SER A N   1 
ATOM   650  C CA  . SER A 1 85  ? -37.198 43.961 54.272 1.00 30.48 ? 85  SER A CA  1 
ATOM   651  C C   . SER A 1 85  ? -37.018 44.661 52.944 1.00 30.72 ? 85  SER A C   1 
ATOM   652  O O   . SER A 1 85  ? -36.902 44.085 51.856 1.00 29.87 ? 85  SER A O   1 
ATOM   653  C CB  . SER A 1 85  ? -35.989 44.062 55.175 1.00 31.55 ? 85  SER A CB  1 
ATOM   654  O OG  . SER A 1 85  ? -34.801 43.999 54.440 1.00 31.29 ? 85  SER A OG  1 
ATOM   655  N N   . SER A 1 86  ? -36.939 45.981 53.076 1.00 30.63 ? 86  SER A N   1 
ATOM   656  C CA  . SER A 1 86  ? -36.768 46.874 51.908 1.00 30.98 ? 86  SER A CA  1 
ATOM   657  C C   . SER A 1 86  ? -35.417 46.607 51.256 1.00 29.99 ? 86  SER A C   1 
ATOM   658  O O   . SER A 1 86  ? -35.261 46.866 50.067 1.00 29.95 ? 86  SER A O   1 
ATOM   659  C CB  . SER A 1 86  ? -37.051 48.308 52.331 1.00 31.51 ? 86  SER A CB  1 
ATOM   660  O OG  . SER A 1 86  ? -36.203 48.560 53.442 1.00 35.58 ? 86  SER A OG  1 
ATOM   661  N N   . ASP A 1 87  ? -34.452 46.113 52.009 1.00 28.71 ? 87  ASP A N   1 
ATOM   662  C CA  . ASP A 1 87  ? -33.120 45.749 51.482 1.00 28.58 ? 87  ASP A CA  1 
ATOM   663  C C   . ASP A 1 87  ? -33.322 44.347 50.865 1.00 25.02 ? 87  ASP A C   1 
ATOM   664  O O   . ASP A 1 87  ? -33.675 43.413 51.606 1.00 25.81 ? 87  ASP A O   1 
ATOM   665  C CB  . ASP A 1 87  ? -32.129 45.751 52.634 1.00 30.37 ? 87  ASP A CB  1 
ATOM   666  C CG  . ASP A 1 87  ? -30.816 45.048 52.383 1.00 32.10 ? 87  ASP A CG  1 
ATOM   667  O OD1 . ASP A 1 87  ? -30.402 44.875 51.239 1.00 34.70 ? 87  ASP A OD1 1 
ATOM   668  O OD2 . ASP A 1 87  ? -30.196 44.684 53.415 1.00 34.93 ? 87  ASP A OD2 1 
ATOM   669  N N   . ILE A 1 88  ? -33.082 44.186 49.583 1.00 22.28 ? 88  ILE A N   1 
ATOM   670  C CA  . ILE A 1 88  ? -33.276 42.885 48.900 1.00 19.22 ? 88  ILE A CA  1 
ATOM   671  C C   . ILE A 1 88  ? -32.102 41.926 49.105 1.00 20.94 ? 88  ILE A C   1 
ATOM   672  O O   . ILE A 1 88  ? -32.180 40.804 48.541 1.00 16.74 ? 88  ILE A O   1 
ATOM   673  C CB  . ILE A 1 88  ? -33.478 43.075 47.353 1.00 21.32 ? 88  ILE A CB  1 
ATOM   674  C CG1 . ILE A 1 88  ? -32.288 43.725 46.598 1.00 21.50 ? 88  ILE A CG1 1 
ATOM   675  C CG2 . ILE A 1 88  ? -34.843 43.817 47.108 1.00 22.48 ? 88  ILE A CG2 1 
ATOM   676  C CD1 . ILE A 1 88  ? -32.422 43.679 45.032 1.00 23.26 ? 88  ILE A CD1 1 
ATOM   677  N N   . THR A 1 89  ? -31.059 42.283 49.854 1.00 19.25 ? 89  THR A N   1 
ATOM   678  C CA  . THR A 1 89  ? -29.889 41.419 49.985 1.00 19.58 ? 89  THR A CA  1 
ATOM   679  C C   . THR A 1 89  ? -30.159 39.977 50.394 1.00 19.32 ? 89  THR A C   1 
ATOM   680  O O   . THR A 1 89  ? -29.585 39.108 49.738 1.00 16.91 ? 89  THR A O   1 
ATOM   681  C CB  . THR A 1 89  ? -28.707 42.010 50.872 1.00 20.74 ? 89  THR A CB  1 
ATOM   682  O OG1 . THR A 1 89  ? -28.488 43.360 50.404 1.00 23.25 ? 89  THR A OG1 1 
ATOM   683  C CG2 . THR A 1 89  ? -27.355 41.304 50.547 1.00 22.12 ? 89  THR A CG2 1 
ATOM   684  N N   . ALA A 1 90  ? -30.917 39.735 51.447 1.00 19.36 ? 90  ALA A N   1 
ATOM   685  C CA  . ALA A 1 90  ? -31.168 38.339 51.899 1.00 20.64 ? 90  ALA A CA  1 
ATOM   686  C C   . ALA A 1 90  ? -31.916 37.553 50.804 1.00 18.11 ? 90  ALA A C   1 
ATOM   687  O O   . ALA A 1 90  ? -31.662 36.356 50.628 1.00 18.05 ? 90  ALA A O   1 
ATOM   688  C CB  . ALA A 1 90  ? -31.916 38.303 53.178 1.00 20.64 ? 90  ALA A CB  1 
ATOM   689  N N   . SER A 1 91  ? -32.891 38.201 50.171 1.00 19.20 ? 91  SER A N   1 
ATOM   690  C CA  . SER A 1 91  ? -33.645 37.511 49.050 1.00 16.64 ? 91  SER A CA  1 
ATOM   691  C C   . SER A 1 91  ? -32.707 37.178 47.926 1.00 18.18 ? 91  SER A C   1 
ATOM   692  O O   . SER A 1 91  ? -32.799 36.020 47.411 1.00 16.59 ? 91  SER A O   1 
ATOM   693  C CB  . SER A 1 91  ? -34.731 38.496 48.550 1.00 15.14 ? 91  SER A CB  1 
ATOM   694  O OG  . SER A 1 91  ? -35.729 38.470 49.591 1.00 18.52 ? 91  SER A OG  1 
ATOM   695  N N   . VAL A 1 92  ? -31.813 38.054 47.584 1.00 16.25 ? 92  VAL A N   1 
ATOM   696  C CA  . VAL A 1 92  ? -30.854 37.759 46.469 1.00 15.54 ? 92  VAL A CA  1 
ATOM   697  C C   . VAL A 1 92  ? -29.885 36.650 46.808 1.00 14.67 ? 92  VAL A C   1 
ATOM   698  O O   . VAL A 1 92  ? -29.552 35.774 46.048 1.00 14.32 ? 92  VAL A O   1 
ATOM   699  C CB  . VAL A 1 92  ? -30.078 39.016 45.989 1.00 16.62 ? 92  VAL A CB  1 
ATOM   700  C CG1 . VAL A 1 92  ? -28.913 38.716 45.012 1.00 17.45 ? 92  VAL A CG1 1 
ATOM   701  C CG2 . VAL A 1 92  ? -31.104 40.002 45.419 1.00 17.91 ? 92  VAL A CG2 1 
ATOM   702  N N   . ASN A 1 93  ? -29.434 36.666 48.084 1.00 15.36 ? 93  ASN A N   1 
ATOM   703  C CA  . ASN A 1 93  ? -28.467 35.646 48.522 1.00 17.01 ? 93  ASN A CA  1 
ATOM   704  C C   . ASN A 1 93  ? -29.139 34.282 48.482 1.00 17.35 ? 93  ASN A C   1 
ATOM   705  O O   . ASN A 1 93  ? -28.441 33.332 48.138 1.00 16.17 ? 93  ASN A O   1 
ATOM   706  C CB  . ASN A 1 93  ? -27.950 35.999 49.943 1.00 21.13 ? 93  ASN A CB  1 
ATOM   707  C CG  . ASN A 1 93  ? -26.893 37.093 49.960 1.00 24.83 ? 93  ASN A CG  1 
ATOM   708  O OD1 . ASN A 1 93  ? -26.324 37.492 48.915 1.00 28.81 ? 93  ASN A OD1 1 
ATOM   709  N ND2 . ASN A 1 93  ? -26.614 37.627 51.167 1.00 28.34 ? 93  ASN A ND2 1 
ATOM   710  N N   . CYS A 1 94  ? -30.378 34.145 48.886 1.00 15.16 ? 94  CYS A N   1 
ATOM   711  C CA  . CYS A 1 94  ? -31.093 32.894 48.872 1.00 15.27 ? 94  CYS A CA  1 
ATOM   712  C C   . CYS A 1 94  ? -31.431 32.495 47.416 1.00 14.32 ? 94  CYS A C   1 
ATOM   713  O O   . CYS A 1 94  ? -31.270 31.321 47.058 1.00 14.87 ? 94  CYS A O   1 
ATOM   714  C CB  . CYS A 1 94  ? -32.308 32.946 49.798 1.00 14.39 ? 94  CYS A CB  1 
ATOM   715  S SG  . CYS A 1 94  ? -33.281 31.463 49.930 1.00 15.38 ? 94  CYS A SG  1 
ATOM   716  N N   . ALA A 1 95  ? -31.777 33.520 46.662 1.00 13.56 ? 95  ALA A N   1 
ATOM   717  C CA  . ALA A 1 95  ? -32.114 33.224 45.235 1.00 13.78 ? 95  ALA A CA  1 
ATOM   718  C C   . ALA A 1 95  ? -30.864 32.658 44.572 1.00 15.30 ? 95  ALA A C   1 
ATOM   719  O O   . ALA A 1 95  ? -31.016 31.844 43.648 1.00 14.37 ? 95  ALA A O   1 
ATOM   720  C CB  . ALA A 1 95  ? -32.573 34.475 44.479 1.00 13.87 ? 95  ALA A CB  1 
ATOM   721  N N   . LYS A 1 96  ? -29.670 33.157 44.890 1.00 14.20 ? 96  LYS A N   1 
ATOM   722  C CA  . LYS A 1 96  ? -28.431 32.636 44.348 1.00 15.86 ? 96  LYS A CA  1 
ATOM   723  C C   . LYS A 1 96  ? -28.260 31.146 44.634 1.00 17.58 ? 96  LYS A C   1 
ATOM   724  O O   . LYS A 1 96  ? -27.887 30.325 43.792 1.00 19.51 ? 96  LYS A O   1 
ATOM   725  C CB  . LYS A 1 96  ? -27.224 33.445 44.775 1.00 17.10 ? 96  LYS A CB  1 
ATOM   726  C CG  . LYS A 1 96  ? -27.156 34.736 43.975 1.00 18.23 ? 96  LYS A CG  1 
ATOM   727  C CD  . LYS A 1 96  ? -25.852 35.446 44.294 1.00 20.62 ? 96  LYS A CD  1 
ATOM   728  C CE  . LYS A 1 96  ? -25.816 36.860 43.822 1.00 23.29 ? 96  LYS A CE  1 
ATOM   729  N NZ  . LYS A 1 96  ? -24.509 37.499 44.234 1.00 22.86 ? 96  LYS A NZ  1 
ATOM   730  N N   . LYS A 1 97  ? -28.620 30.831 45.868 1.00 16.65 ? 97  LYS A N   1 
ATOM   731  C CA  . LYS A 1 97  ? -28.570 29.405 46.305 1.00 16.12 ? 97  LYS A CA  1 
ATOM   732  C C   . LYS A 1 97  ? -29.516 28.568 45.515 1.00 16.82 ? 97  LYS A C   1 
ATOM   733  O O   . LYS A 1 97  ? -29.209 27.457 45.005 1.00 16.99 ? 97  LYS A O   1 
ATOM   734  C CB  . LYS A 1 97  ? -28.860 29.324 47.827 1.00 15.03 ? 97  LYS A CB  1 
ATOM   735  C CG  . LYS A 1 97  ? -27.551 29.838 48.484 1.00 14.78 ? 97  LYS A CG  1 
ATOM   736  C CD  . LYS A 1 97  ? -27.729 29.748 49.996 1.00 14.63 ? 97  LYS A CD  1 
ATOM   737  C CE  . LYS A 1 97  ? -26.446 30.164 50.719 1.00 15.19 ? 97  LYS A CE  1 
ATOM   738  N NZ  . LYS A 1 97  ? -26.308 31.649 50.604 1.00 16.71 ? 97  LYS A NZ  1 
ATOM   739  N N   . ILE A 1 98  ? -30.784 29.010 45.385 1.00 14.99 ? 98  ILE A N   1 
ATOM   740  C CA  . ILE A 1 98  ? -31.795 28.253 44.633 1.00 17.27 ? 98  ILE A CA  1 
ATOM   741  C C   . ILE A 1 98  ? -31.414 28.055 43.164 1.00 16.88 ? 98  ILE A C   1 
ATOM   742  O O   . ILE A 1 98  ? -31.591 26.940 42.592 1.00 18.06 ? 98  ILE A O   1 
ATOM   743  C CB  . ILE A 1 98  ? -33.117 29.073 44.722 1.00 17.42 ? 98  ILE A CB  1 
ATOM   744  C CG1 . ILE A 1 98  ? -33.655 29.134 46.202 1.00 17.93 ? 98  ILE A CG1 1 
ATOM   745  C CG2 . ILE A 1 98  ? -34.236 28.483 43.796 1.00 19.69 ? 98  ILE A CG2 1 
ATOM   746  C CD1 . ILE A 1 98  ? -34.837 30.180 46.297 1.00 18.27 ? 98  ILE A CD1 1 
ATOM   747  N N   . ALA A 1 99  ? -30.854 29.108 42.543 1.00 13.90 ? 99  ALA A N   1 
ATOM   748  C CA  . ALA A 1 99  ? -30.540 29.059 41.102 1.00 17.74 ? 99  ALA A CA  1 
ATOM   749  C C   . ALA A 1 99  ? -29.237 28.319 40.845 1.00 16.16 ? 99  ALA A C   1 
ATOM   750  O O   . ALA A 1 99  ? -29.053 28.014 39.673 1.00 18.83 ? 99  ALA A O   1 
ATOM   751  C CB  . ALA A 1 99  ? -30.566 30.475 40.520 1.00 16.32 ? 99  ALA A CB  1 
ATOM   752  N N   . SER A 1 100 ? -28.489 28.028 41.885 1.00 18.16 ? 100 SER A N   1 
ATOM   753  C CA  . SER A 1 100 ? -27.262 27.220 41.752 1.00 19.79 ? 100 SER A CA  1 
ATOM   754  C C   . SER A 1 100 ? -27.614 25.756 41.500 1.00 20.87 ? 100 SER A C   1 
ATOM   755  O O   . SER A 1 100 ? -26.733 24.967 41.044 1.00 19.52 ? 100 SER A O   1 
ATOM   756  C CB  . SER A 1 100 ? -26.303 27.407 42.923 1.00 20.94 ? 100 SER A CB  1 
ATOM   757  O OG  . SER A 1 100 ? -26.761 26.692 44.091 1.00 24.35 ? 100 SER A OG  1 
ATOM   758  N N   . GLY A 1 101 ? -28.862 25.412 41.701 1.00 20.68 ? 101 GLY A N   1 
ATOM   759  C CA  . GLY A 1 101 ? -29.426 24.065 41.479 1.00 21.68 ? 101 GLY A CA  1 
ATOM   760  C C   . GLY A 1 101 ? -29.397 23.791 39.979 1.00 21.56 ? 101 GLY A C   1 
ATOM   761  O O   . GLY A 1 101 ? -29.310 24.718 39.123 1.00 20.60 ? 101 GLY A O   1 
ATOM   762  N N   . GLY A 1 102 ? -29.431 22.508 39.625 1.00 23.49 ? 102 GLY A N   1 
ATOM   763  C CA  . GLY A 1 102 ? -29.381 22.101 38.219 1.00 22.17 ? 102 GLY A CA  1 
ATOM   764  C C   . GLY A 1 102 ? -30.490 22.681 37.365 1.00 23.57 ? 102 GLY A C   1 
ATOM   765  O O   . GLY A 1 102 ? -30.258 22.784 36.148 1.00 23.50 ? 102 GLY A O   1 
ATOM   766  N N   . ASN A 1 103 ? -31.635 23.048 37.950 1.00 22.64 ? 103 ASN A N   1 
ATOM   767  C CA  . ASN A 1 103 ? -32.764 23.612 37.183 1.00 24.08 ? 103 ASN A CA  1 
ATOM   768  C C   . ASN A 1 103 ? -32.781 25.137 37.049 1.00 21.26 ? 103 ASN A C   1 
ATOM   769  O O   . ASN A 1 103 ? -33.744 25.629 36.416 1.00 21.33 ? 103 ASN A O   1 
ATOM   770  C CB  . ASN A 1 103 ? -34.093 23.038 37.718 1.00 25.41 ? 103 ASN A CB  1 
ATOM   771  C CG  . ASN A 1 103 ? -34.005 21.507 37.625 1.00 28.60 ? 103 ASN A CG  1 
ATOM   772  O OD1 . ASN A 1 103 ? -33.511 21.020 36.594 1.00 29.85 ? 103 ASN A OD1 1 
ATOM   773  N ND2 . ASN A 1 103 ? -34.401 20.848 38.610 1.00 30.34 ? 103 ASN A ND2 1 
ATOM   774  N N   . GLY A 1 104 ? -31.806 25.783 37.653 1.00 20.81 ? 104 GLY A N   1 
ATOM   775  C CA  . GLY A 1 104 ? -31.681 27.236 37.549 1.00 20.45 ? 104 GLY A CA  1 
ATOM   776  C C   . GLY A 1 104 ? -32.978 27.980 37.909 1.00 18.78 ? 104 GLY A C   1 
ATOM   777  O O   . GLY A 1 104 ? -33.558 27.689 38.954 1.00 18.96 ? 104 GLY A O   1 
ATOM   778  N N   . MET A 1 105 ? -33.316 28.947 37.031 1.00 18.15 ? 105 MET A N   1 
ATOM   779  C CA  . MET A 1 105 ? -34.458 29.833 37.202 1.00 18.16 ? 105 MET A CA  1 
ATOM   780  C C   . MET A 1 105 ? -35.800 29.102 37.091 1.00 19.42 ? 105 MET A C   1 
ATOM   781  O O   . MET A 1 105 ? -36.834 29.702 37.442 1.00 18.73 ? 105 MET A O   1 
ATOM   782  C CB  . MET A 1 105 ? -34.336 31.075 36.342 1.00 17.37 ? 105 MET A CB  1 
ATOM   783  C CG  . MET A 1 105 ? -33.223 31.954 36.882 1.00 17.86 ? 105 MET A CG  1 
ATOM   784  S SD  . MET A 1 105 ? -33.396 33.676 36.347 1.00 18.54 ? 105 MET A SD  1 
ATOM   785  C CE  . MET A 1 105 ? -34.781 34.261 37.300 1.00 17.55 ? 105 MET A CE  1 
ATOM   786  N N   . ASN A 1 106 ? -35.746 27.848 36.627 1.00 20.23 ? 106 ASN A N   1 
ATOM   787  C CA  . ASN A 1 106 ? -37.056 27.116 36.566 1.00 21.88 ? 106 ASN A CA  1 
ATOM   788  C C   . ASN A 1 106 ? -37.744 26.981 37.891 1.00 22.26 ? 106 ASN A C   1 
ATOM   789  O O   . ASN A 1 106 ? -38.989 26.721 37.921 1.00 23.32 ? 106 ASN A O   1 
ATOM   790  C CB  . ASN A 1 106 ? -36.882 25.750 35.874 1.00 24.81 ? 106 ASN A CB  1 
ATOM   791  C CG  . ASN A 1 106 ? -36.793 26.045 34.395 1.00 26.46 ? 106 ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 106 ? -37.806 26.391 33.754 1.00 30.40 ? 106 ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 106 ? -35.609 25.936 33.803 1.00 31.09 ? 106 ASN A ND2 1 
ATOM   794  N N   . ALA A 1 107 ? -37.075 27.159 38.983 1.00 21.26 ? 107 ALA A N   1 
ATOM   795  C CA  . ALA A 1 107 ? -37.721 27.112 40.327 1.00 20.02 ? 107 ALA A CA  1 
ATOM   796  C C   . ALA A 1 107 ? -38.783 28.173 40.519 1.00 19.87 ? 107 ALA A C   1 
ATOM   797  O O   . ALA A 1 107 ? -39.626 28.073 41.437 1.00 22.78 ? 107 ALA A O   1 
ATOM   798  C CB  . ALA A 1 107 ? -36.615 27.193 41.368 1.00 20.53 ? 107 ALA A CB  1 
ATOM   799  N N   . TRP A 1 108 ? -38.817 29.274 39.796 1.00 20.03 ? 108 TRP A N   1 
ATOM   800  C CA  . TRP A 1 108 ? -39.802 30.351 39.920 1.00 17.90 ? 108 TRP A CA  1 
ATOM   801  C C   . TRP A 1 108 ? -40.871 30.154 38.835 1.00 18.24 ? 108 TRP A C   1 
ATOM   802  O O   . TRP A 1 108 ? -40.528 30.311 37.697 1.00 18.07 ? 108 TRP A O   1 
ATOM   803  C CB  . TRP A 1 108 ? -39.080 31.715 39.642 1.00 17.57 ? 108 TRP A CB  1 
ATOM   804  C CG  . TRP A 1 108 ? -38.343 32.106 40.880 1.00 16.49 ? 108 TRP A CG  1 
ATOM   805  C CD1 . TRP A 1 108 ? -38.898 32.611 42.030 1.00 16.50 ? 108 TRP A CD1 1 
ATOM   806  C CD2 . TRP A 1 108 ? -36.922 31.945 41.151 1.00 16.71 ? 108 TRP A CD2 1 
ATOM   807  N NE1 . TRP A 1 108 ? -37.927 32.824 42.983 1.00 17.13 ? 108 TRP A NE1 1 
ATOM   808  C CE2 . TRP A 1 108 ? -36.728 32.422 42.485 1.00 15.67 ? 108 TRP A CE2 1 
ATOM   809  C CE3 . TRP A 1 108 ? -35.868 31.448 40.424 1.00 16.72 ? 108 TRP A CE3 1 
ATOM   810  C CZ2 . TRP A 1 108 ? -35.452 32.419 43.043 1.00 16.91 ? 108 TRP A CZ2 1 
ATOM   811  C CZ3 . TRP A 1 108 ? -34.591 31.431 40.970 1.00 16.44 ? 108 TRP A CZ3 1 
ATOM   812  C CH2 . TRP A 1 108 ? -34.432 31.869 42.305 1.00 15.86 ? 108 TRP A CH2 1 
ATOM   813  N N   . VAL A 1 109 ? -42.090 29.809 39.260 1.00 19.24 ? 109 VAL A N   1 
ATOM   814  C CA  . VAL A 1 109 ? -43.132 29.585 38.258 1.00 21.29 ? 109 VAL A CA  1 
ATOM   815  C C   . VAL A 1 109 ? -43.407 30.760 37.337 1.00 21.78 ? 109 VAL A C   1 
ATOM   816  O O   . VAL A 1 109 ? -43.583 30.501 36.151 1.00 24.03 ? 109 VAL A O   1 
ATOM   817  C CB  . VAL A 1 109 ? -44.433 29.177 38.976 1.00 22.28 ? 109 VAL A CB  1 
ATOM   818  C CG1 . VAL A 1 109 ? -45.489 28.696 37.980 1.00 23.01 ? 109 VAL A CG1 1 
ATOM   819  C CG2 . VAL A 1 109 ? -44.153 28.055 39.981 1.00 23.93 ? 109 VAL A CG2 1 
ATOM   820  N N   . ALA A 1 110 ? -43.425 31.941 37.961 1.00 20.64 ? 110 ALA A N   1 
ATOM   821  C CA  . ALA A 1 110 ? -43.717 33.153 37.176 1.00 21.90 ? 110 ALA A CA  1 
ATOM   822  C C   . ALA A 1 110 ? -42.650 33.383 36.128 1.00 21.46 ? 110 ALA A C   1 
ATOM   823  O O   . ALA A 1 110 ? -43.048 33.813 35.031 1.00 21.72 ? 110 ALA A O   1 
ATOM   824  C CB  . ALA A 1 110 ? -43.960 34.355 38.053 1.00 22.46 ? 110 ALA A CB  1 
ATOM   825  N N   . TRP A 1 111 ? -41.399 33.097 36.474 1.00 20.46 ? 111 TRP A N   1 
ATOM   826  C CA  . TRP A 1 111 ? -40.327 33.268 35.460 1.00 21.80 ? 111 TRP A CA  1 
ATOM   827  C C   . TRP A 1 111 ? -40.577 32.324 34.306 1.00 23.53 ? 111 TRP A C   1 
ATOM   828  O O   . TRP A 1 111 ? -40.537 32.633 33.089 1.00 22.51 ? 111 TRP A O   1 
ATOM   829  C CB  . TRP A 1 111 ? -38.947 33.024 36.182 1.00 21.18 ? 111 TRP A CB  1 
ATOM   830  C CG  . TRP A 1 111 ? -37.871 33.115 35.112 1.00 21.89 ? 111 TRP A CG  1 
ATOM   831  C CD1 . TRP A 1 111 ? -37.266 34.269 34.696 1.00 21.65 ? 111 TRP A CD1 1 
ATOM   832  C CD2 . TRP A 1 111 ? -37.256 32.051 34.410 1.00 22.72 ? 111 TRP A CD2 1 
ATOM   833  N NE1 . TRP A 1 111 ? -36.369 33.959 33.721 1.00 21.28 ? 111 TRP A NE1 1 
ATOM   834  C CE2 . TRP A 1 111 ? -36.339 32.615 33.509 1.00 22.79 ? 111 TRP A CE2 1 
ATOM   835  C CE3 . TRP A 1 111 ? -37.449 30.651 34.408 1.00 22.89 ? 111 TRP A CE3 1 
ATOM   836  C CZ2 . TRP A 1 111 ? -35.554 31.855 32.655 1.00 22.73 ? 111 TRP A CZ2 1 
ATOM   837  C CZ3 . TRP A 1 111 ? -36.680 29.908 33.554 1.00 22.98 ? 111 TRP A CZ3 1 
ATOM   838  C CH2 . TRP A 1 111 ? -35.753 30.464 32.675 1.00 23.53 ? 111 TRP A CH2 1 
ATOM   839  N N   . ARG A 1 112 ? -40.776 31.051 34.646 1.00 24.29 ? 112 ARG A N   1 
ATOM   840  C CA  . ARG A 1 112 ? -40.984 29.967 33.675 1.00 26.28 ? 112 ARG A CA  1 
ATOM   841  C C   . ARG A 1 112 ? -42.108 30.346 32.711 1.00 26.19 ? 112 ARG A C   1 
ATOM   842  O O   . ARG A 1 112 ? -41.999 30.271 31.467 1.00 27.49 ? 112 ARG A O   1 
ATOM   843  C CB  . ARG A 1 112 ? -41.281 28.663 34.461 1.00 26.47 ? 112 ARG A CB  1 
ATOM   844  C CG  . ARG A 1 112 ? -40.803 27.350 33.858 1.00 30.09 ? 112 ARG A CG  1 
ATOM   845  C CD  . ARG A 1 112 ? -40.963 26.222 34.825 1.00 31.49 ? 112 ARG A CD  1 
ATOM   846  N NE  . ARG A 1 112 ? -42.369 25.860 35.012 1.00 34.34 ? 112 ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 112 ? -42.885 25.715 36.263 1.00 34.93 ? 112 ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 112 ? -42.078 25.901 37.311 1.00 36.59 ? 112 ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 112 ? -44.148 25.388 36.464 1.00 35.77 ? 112 ARG A NH2 1 
ATOM   850  N N   . ASN A 1 113 ? -43.190 30.793 33.219 1.00 28.07 ? 113 ASN A N   1 
ATOM   851  C CA  . ASN A 1 113 ? -44.413 31.176 32.510 1.00 30.28 ? 113 ASN A CA  1 
ATOM   852  C C   . ASN A 1 113 ? -44.373 32.497 31.787 1.00 30.21 ? 113 ASN A C   1 
ATOM   853  O O   . ASN A 1 113 ? -44.830 32.529 30.618 1.00 30.97 ? 113 ASN A O   1 
ATOM   854  C CB  . ASN A 1 113 ? -45.593 31.100 33.470 1.00 31.97 ? 113 ASN A CB  1 
ATOM   855  C CG  . ASN A 1 113 ? -45.970 29.724 33.961 1.00 34.23 ? 113 ASN A CG  1 
ATOM   856  O OD1 . ASN A 1 113 ? -45.521 28.657 33.514 1.00 34.88 ? 113 ASN A OD1 1 
ATOM   857  N ND2 . ASN A 1 113 ? -46.853 29.716 34.980 1.00 35.05 ? 113 ASN A ND2 1 
ATOM   858  N N   . ARG A 1 114 ? -43.927 33.584 32.393 1.00 28.86 ? 114 ARG A N   1 
ATOM   859  C CA  . ARG A 1 114 ? -43.911 34.893 31.726 1.00 28.05 ? 114 ARG A CA  1 
ATOM   860  C C   . ARG A 1 114 ? -42.598 35.437 31.224 1.00 27.60 ? 114 ARG A C   1 
ATOM   861  O O   . ARG A 1 114 ? -42.623 36.407 30.410 1.00 27.66 ? 114 ARG A O   1 
ATOM   862  C CB  . ARG A 1 114 ? -44.552 35.928 32.684 1.00 28.61 ? 114 ARG A CB  1 
ATOM   863  C CG  . ARG A 1 114 ? -45.741 35.494 33.495 1.00 31.88 ? 114 ARG A CG  1 
ATOM   864  C CD  . ARG A 1 114 ? -47.003 35.465 32.698 1.00 33.22 ? 114 ARG A CD  1 
ATOM   865  N NE  . ARG A 1 114 ? -47.252 36.692 31.975 1.00 35.44 ? 114 ARG A NE  1 
ATOM   866  C CZ  . ARG A 1 114 ? -47.812 37.839 32.327 1.00 36.56 ? 114 ARG A CZ  1 
ATOM   867  N NH1 . ARG A 1 114 ? -48.299 38.067 33.550 1.00 37.38 ? 114 ARG A NH1 1 
ATOM   868  N NH2 . ARG A 1 114 ? -47.863 38.814 31.394 1.00 37.26 ? 114 ARG A NH2 1 
ATOM   869  N N   . CYS A 1 115 ? -41.449 34.945 31.657 1.00 25.33 ? 115 CYS A N   1 
ATOM   870  C CA  . CYS A 1 115 ? -40.147 35.478 31.242 1.00 24.46 ? 115 CYS A CA  1 
ATOM   871  C C   . CYS A 1 115 ? -39.326 34.638 30.302 1.00 25.82 ? 115 CYS A C   1 
ATOM   872  O O   . CYS A 1 115 ? -38.710 35.155 29.324 1.00 26.49 ? 115 CYS A O   1 
ATOM   873  C CB  . CYS A 1 115 ? -39.343 35.722 32.563 1.00 22.12 ? 115 CYS A CB  1 
ATOM   874  S SG  . CYS A 1 115 ? -40.217 36.827 33.692 1.00 20.74 ? 115 CYS A SG  1 
ATOM   875  N N   . LYS A 1 116 ? -39.261 33.342 30.565 1.00 28.06 ? 116 LYS A N   1 
ATOM   876  C CA  . LYS A 1 116 ? -38.475 32.383 29.749 1.00 29.98 ? 116 LYS A CA  1 
ATOM   877  C C   . LYS A 1 116 ? -38.902 32.519 28.299 1.00 30.82 ? 116 LYS A C   1 
ATOM   878  O O   . LYS A 1 116 ? -40.106 32.605 28.026 1.00 30.37 ? 116 LYS A O   1 
ATOM   879  C CB  . LYS A 1 116 ? -38.654 30.980 30.314 1.00 30.00 ? 116 LYS A CB  1 
ATOM   880  C CG  . LYS A 1 116 ? -37.850 29.834 29.681 1.00 31.04 ? 116 LYS A CG  1 
ATOM   881  C CD  . LYS A 1 116 ? -37.841 28.620 30.627 1.00 34.19 ? 116 LYS A CD  1 
ATOM   882  C CE  . LYS A 1 116 ? -36.863 27.540 30.225 1.00 36.21 ? 116 LYS A CE  1 
ATOM   883  N NZ  . LYS A 1 116 ? -36.444 26.574 31.292 1.00 37.20 ? 116 LYS A NZ  1 
ATOM   884  N N   . GLY A 1 117 ? -37.940 32.631 27.396 1.00 32.85 ? 117 GLY A N   1 
ATOM   885  C CA  . GLY A 1 117 ? -38.118 32.773 25.961 1.00 34.11 ? 117 GLY A CA  1 
ATOM   886  C C   . GLY A 1 117 ? -38.639 34.098 25.454 1.00 34.47 ? 117 GLY A C   1 
ATOM   887  O O   . GLY A 1 117 ? -39.079 34.225 24.282 1.00 34.93 ? 117 GLY A O   1 
ATOM   888  N N   . THR A 1 118 ? -38.627 35.126 26.307 1.00 32.44 ? 118 THR A N   1 
ATOM   889  C CA  . THR A 1 118 ? -39.090 36.455 25.889 1.00 31.36 ? 118 THR A CA  1 
ATOM   890  C C   . THR A 1 118 ? -37.875 37.378 25.786 1.00 29.97 ? 118 THR A C   1 
ATOM   891  O O   . THR A 1 118 ? -36.776 36.968 26.144 1.00 29.79 ? 118 THR A O   1 
ATOM   892  C CB  . THR A 1 118 ? -40.146 37.080 26.857 1.00 30.84 ? 118 THR A CB  1 
ATOM   893  O OG1 . THR A 1 118 ? -39.478 37.468 28.124 1.00 29.63 ? 118 THR A OG1 1 
ATOM   894  C CG2 . THR A 1 118 ? -41.320 36.112 27.088 1.00 30.95 ? 118 THR A CG2 1 
ATOM   895  N N   . ASP A 1 119 ? -38.144 38.588 25.362 1.00 29.33 ? 119 ASP A N   1 
ATOM   896  C CA  . ASP A 1 119 ? -37.131 39.642 25.213 1.00 29.44 ? 119 ASP A CA  1 
ATOM   897  C C   . ASP A 1 119 ? -36.874 40.209 26.611 1.00 27.78 ? 119 ASP A C   1 
ATOM   898  O O   . ASP A 1 119 ? -37.441 41.284 26.891 1.00 27.74 ? 119 ASP A O   1 
ATOM   899  C CB  . ASP A 1 119 ? -37.681 40.720 24.278 1.00 32.12 ? 119 ASP A CB  1 
ATOM   900  C CG  . ASP A 1 119 ? -36.606 41.794 24.051 1.00 34.48 ? 119 ASP A CG  1 
ATOM   901  O OD1 . ASP A 1 119 ? -35.401 41.518 24.243 1.00 34.82 ? 119 ASP A OD1 1 
ATOM   902  O OD2 . ASP A 1 119 ? -37.083 42.888 23.643 1.00 35.70 ? 119 ASP A OD2 1 
ATOM   903  N N   . VAL A 1 120 ? -36.071 39.475 27.375 1.00 27.41 ? 120 VAL A N   1 
ATOM   904  C CA  . VAL A 1 120 ? -35.837 39.963 28.765 1.00 25.42 ? 120 VAL A CA  1 
ATOM   905  C C   . VAL A 1 120 ? -35.066 41.264 28.780 1.00 22.84 ? 120 VAL A C   1 
ATOM   906  O O   . VAL A 1 120 ? -35.134 41.968 29.805 1.00 23.10 ? 120 VAL A O   1 
ATOM   907  C CB  . VAL A 1 120 ? -35.331 38.850 29.738 1.00 24.92 ? 120 VAL A CB  1 
ATOM   908  C CG1 . VAL A 1 120 ? -36.413 37.832 30.008 1.00 28.03 ? 120 VAL A CG1 1 
ATOM   909  C CG2 . VAL A 1 120 ? -33.995 38.333 29.255 1.00 26.58 ? 120 VAL A CG2 1 
ATOM   910  N N   . HIS A 1 121 ? -34.405 41.624 27.694 1.00 23.08 ? 121 HIS A N   1 
ATOM   911  C CA  . HIS A 1 121 ? -33.669 42.911 27.701 1.00 22.58 ? 121 HIS A CA  1 
ATOM   912  C C   . HIS A 1 121 ? -34.617 44.080 27.838 1.00 21.56 ? 121 HIS A C   1 
ATOM   913  O O   . HIS A 1 121 ? -34.246 45.176 28.315 1.00 22.72 ? 121 HIS A O   1 
ATOM   914  C CB  . HIS A 1 121 ? -32.782 43.154 26.444 1.00 23.03 ? 121 HIS A CB  1 
ATOM   915  C CG  . HIS A 1 121 ? -31.578 42.267 26.540 1.00 24.60 ? 121 HIS A CG  1 
ATOM   916  N ND1 . HIS A 1 121 ? -31.379 41.144 25.781 1.00 25.94 ? 121 HIS A ND1 1 
ATOM   917  C CD2 . HIS A 1 121 ? -30.497 42.394 27.318 1.00 24.90 ? 121 HIS A CD2 1 
ATOM   918  C CE1 . HIS A 1 121 ? -30.228 40.581 26.137 1.00 24.89 ? 121 HIS A CE1 1 
ATOM   919  N NE2 . HIS A 1 121 ? -29.675 41.340 27.055 1.00 25.46 ? 121 HIS A NE2 1 
ATOM   920  N N   . ALA A 1 122 ? -35.883 43.900 27.515 1.00 23.43 ? 122 ALA A N   1 
ATOM   921  C CA  . ALA A 1 122 ? -36.872 45.006 27.643 1.00 21.32 ? 122 ALA A CA  1 
ATOM   922  C C   . ALA A 1 122 ? -37.022 45.464 29.073 1.00 22.28 ? 122 ALA A C   1 
ATOM   923  O O   . ALA A 1 122 ? -37.375 46.652 29.357 1.00 23.64 ? 122 ALA A O   1 
ATOM   924  C CB  . ALA A 1 122 ? -38.233 44.577 27.132 1.00 21.25 ? 122 ALA A CB  1 
ATOM   925  N N   . TRP A 1 123 ? -36.780 44.584 30.026 1.00 21.88 ? 123 TRP A N   1 
ATOM   926  C CA  . TRP A 1 123 ? -36.905 44.877 31.450 1.00 22.27 ? 123 TRP A CA  1 
ATOM   927  C C   . TRP A 1 123 ? -35.818 45.861 31.872 1.00 22.24 ? 123 TRP A C   1 
ATOM   928  O O   . TRP A 1 123 ? -36.111 46.561 32.844 1.00 24.10 ? 123 TRP A O   1 
ATOM   929  C CB  . TRP A 1 123 ? -37.010 43.632 32.383 1.00 19.99 ? 123 TRP A CB  1 
ATOM   930  C CG  . TRP A 1 123 ? -38.315 42.955 32.108 1.00 19.27 ? 123 TRP A CG  1 
ATOM   931  C CD1 . TRP A 1 123 ? -38.580 41.932 31.215 1.00 19.10 ? 123 TRP A CD1 1 
ATOM   932  C CD2 . TRP A 1 123 ? -39.578 43.439 32.556 1.00 18.62 ? 123 TRP A CD2 1 
ATOM   933  N NE1 . TRP A 1 123 ? -39.940 41.699 31.174 1.00 20.65 ? 123 TRP A NE1 1 
ATOM   934  C CE2 . TRP A 1 123 ? -40.571 42.586 32.019 1.00 19.31 ? 123 TRP A CE2 1 
ATOM   935  C CE3 . TRP A 1 123 ? -39.928 44.465 33.392 1.00 16.33 ? 123 TRP A CE3 1 
ATOM   936  C CZ2 . TRP A 1 123 ? -41.911 42.802 32.312 1.00 19.59 ? 123 TRP A CZ2 1 
ATOM   937  C CZ3 . TRP A 1 123 ? -41.259 44.683 33.718 1.00 20.49 ? 123 TRP A CZ3 1 
ATOM   938  C CH2 . TRP A 1 123 ? -42.239 43.850 33.153 1.00 19.74 ? 123 TRP A CH2 1 
ATOM   939  N N   . ILE A 1 124 ? -34.696 45.982 31.153 1.00 22.29 ? 124 ILE A N   1 
ATOM   940  C CA  . ILE A 1 124 ? -33.687 46.966 31.644 1.00 24.38 ? 124 ILE A CA  1 
ATOM   941  C C   . ILE A 1 124 ? -33.465 48.059 30.598 1.00 27.15 ? 124 ILE A C   1 
ATOM   942  O O   . ILE A 1 124 ? -32.558 48.878 30.777 1.00 27.56 ? 124 ILE A O   1 
ATOM   943  C CB  . ILE A 1 124 ? -32.386 46.205 32.088 1.00 23.59 ? 124 ILE A CB  1 
ATOM   944  C CG1 . ILE A 1 124 ? -31.777 45.602 30.798 1.00 21.20 ? 124 ILE A CG1 1 
ATOM   945  C CG2 . ILE A 1 124 ? -32.657 45.051 33.110 1.00 23.05 ? 124 ILE A CG2 1 
ATOM   946  C CD1 . ILE A 1 124 ? -30.237 45.453 30.788 1.00 25.43 ? 124 ILE A CD1 1 
ATOM   947  N N   . ARG A 1 125 ? -34.231 48.026 29.532 1.00 30.74 ? 125 ARG A N   1 
ATOM   948  C CA  . ARG A 1 125 ? -34.133 49.035 28.455 1.00 32.00 ? 125 ARG A CA  1 
ATOM   949  C C   . ARG A 1 125 ? -34.517 50.380 29.060 1.00 34.08 ? 125 ARG A C   1 
ATOM   950  O O   . ARG A 1 125 ? -35.488 50.465 29.813 1.00 33.93 ? 125 ARG A O   1 
ATOM   951  C CB  . ARG A 1 125 ? -35.018 48.605 27.278 1.00 33.83 ? 125 ARG A CB  1 
ATOM   952  C CG  . ARG A 1 125 ? -34.911 49.429 26.012 1.00 36.03 ? 125 ARG A CG  1 
ATOM   953  C CD  . ARG A 1 125 ? -35.658 48.758 24.886 1.00 36.99 ? 125 ARG A CD  1 
ATOM   954  N NE  . ARG A 1 125 ? -34.998 47.504 24.555 1.00 38.04 ? 125 ARG A NE  1 
ATOM   955  C CZ  . ARG A 1 125 ? -35.572 46.325 24.300 1.00 39.37 ? 125 ARG A CZ  1 
ATOM   956  N NH1 . ARG A 1 125 ? -36.894 46.180 24.255 1.00 39.71 ? 125 ARG A NH1 1 
ATOM   957  N NH2 . ARG A 1 125 ? -34.804 45.254 24.068 1.00 39.09 ? 125 ARG A NH2 1 
ATOM   958  N N   . GLY A 1 126 ? -33.712 51.414 28.787 1.00 35.15 ? 126 GLY A N   1 
ATOM   959  C CA  . GLY A 1 126 ? -33.990 52.743 29.345 1.00 36.06 ? 126 GLY A CA  1 
ATOM   960  C C   . GLY A 1 126 ? -33.532 53.003 30.766 1.00 36.37 ? 126 GLY A C   1 
ATOM   961  O O   . GLY A 1 126 ? -33.857 54.102 31.291 1.00 38.21 ? 126 GLY A O   1 
ATOM   962  N N   . CYS A 1 127 ? -32.850 52.072 31.409 1.00 36.37 ? 127 CYS A N   1 
ATOM   963  C CA  . CYS A 1 127 ? -32.398 52.265 32.797 1.00 35.62 ? 127 CYS A CA  1 
ATOM   964  C C   . CYS A 1 127 ? -31.011 52.908 32.767 1.00 38.04 ? 127 CYS A C   1 
ATOM   965  O O   . CYS A 1 127 ? -30.465 52.889 31.653 1.00 38.78 ? 127 CYS A O   1 
ATOM   966  C CB  . CYS A 1 127 ? -32.320 50.966 33.582 1.00 32.92 ? 127 CYS A CB  1 
ATOM   967  S SG  . CYS A 1 127 ? -33.983 50.266 33.791 1.00 29.76 ? 127 CYS A SG  1 
ATOM   968  N N   . ARG A 1 128 ? -30.557 53.358 33.910 1.00 40.58 ? 128 ARG A N   1 
ATOM   969  C CA  . ARG A 1 128 ? -29.219 53.964 34.046 1.00 43.17 ? 128 ARG A CA  1 
ATOM   970  C C   . ARG A 1 128 ? -28.172 53.016 33.441 1.00 45.31 ? 128 ARG A C   1 
ATOM   971  O O   . ARG A 1 128 ? -27.518 52.248 34.204 1.00 45.94 ? 128 ARG A O   1 
HETATM 972  S S   . SCN B 2 .   ? -27.777 46.968 47.034 1.00 40.03 ? 130 SCN A S   1 
HETATM 973  C C   . SCN B 2 .   ? -27.569 47.812 48.314 1.00 39.76 ? 130 SCN A C   1 
HETATM 974  N N   . SCN B 2 .   ? -27.403 48.473 49.315 1.00 40.73 ? 130 SCN A N   1 
HETATM 975  O O   . HOH C 3 .   ? -30.919 46.287 48.589 1.00 31.50 ? 131 HOH A O   1 
HETATM 976  O O   . HOH C 3 .   ? -31.060 50.729 43.320 1.00 34.94 ? 132 HOH A O   1 
HETATM 977  O O   . HOH C 3 .   ? -31.397 49.289 47.593 0.50 21.53 ? 133 HOH A O   1 
HETATM 978  O O   . HOH C 3 .   ? -25.580 49.365 39.411 1.00 37.83 ? 134 HOH A O   1 
HETATM 979  O O   . HOH C 3 .   ? -25.876 51.732 41.902 1.00 37.26 ? 135 HOH A O   1 
HETATM 980  O O   . HOH C 3 .   ? -24.200 41.985 38.425 1.00 27.79 ? 136 HOH A O   1 
HETATM 981  O O   . HOH C 3 .   ? -20.782 47.462 41.003 1.00 40.65 ? 137 HOH A O   1 
HETATM 982  O O   . HOH C 3 .   ? -22.926 47.919 39.065 1.00 54.23 ? 138 HOH A O   1 
HETATM 983  O O   . HOH C 3 .   ? -25.532 32.991 47.990 1.00 43.06 ? 139 HOH A O   1 
HETATM 984  O O   . HOH C 3 .   ? -24.272 25.404 40.515 1.00 36.29 ? 140 HOH A O   1 
HETATM 985  O O   . HOH C 3 .   ? -29.300 34.862 29.932 1.00 35.80 ? 141 HOH A O   1 
HETATM 986  O O   . HOH C 3 .   ? -35.034 34.132 29.391 1.00 35.81 ? 142 HOH A O   1 
HETATM 987  O O   . HOH C 3 .   ? -33.304 27.937 32.359 1.00 35.98 ? 143 HOH A O   1 
HETATM 988  O O   . HOH C 3 .   ? -47.030 41.974 38.493 1.00 34.07 ? 144 HOH A O   1 
HETATM 989  O O   . HOH C 3 .   ? -49.860 41.491 33.763 1.00 42.52 ? 145 HOH A O   1 
HETATM 990  O O   . HOH C 3 .   ? -44.911 32.151 42.317 1.00 38.59 ? 146 HOH A O   1 
HETATM 991  O O   . HOH C 3 .   ? -45.782 32.821 44.894 1.00 39.43 ? 147 HOH A O   1 
HETATM 992  O O   . HOH C 3 .   ? -39.213 29.370 46.334 1.00 30.85 ? 148 HOH A O   1 
HETATM 993  O O   . HOH C 3 .   ? -42.264 29.488 42.060 1.00 38.82 ? 149 HOH A O   1 
HETATM 994  O O   . HOH C 3 .   ? -36.209 42.365 50.097 1.00 30.45 ? 150 HOH A O   1 
HETATM 995  O O   . HOH C 3 .   ? -34.626 40.483 51.340 1.00 25.68 ? 151 HOH A O   1 
HETATM 996  O O   . HOH C 3 .   ? -31.617 41.660 53.230 1.00 27.45 ? 152 HOH A O   1 
HETATM 997  O O   . HOH C 3 .   ? -38.403 41.064 49.840 1.00 26.75 ? 153 HOH A O   1 
HETATM 998  O O   . HOH C 3 .   ? -44.849 47.738 40.682 0.50 21.87 ? 154 HOH A O   1 
HETATM 999  O O   . HOH C 3 .   ? -44.351 47.234 50.337 1.00 31.49 ? 155 HOH A O   1 
HETATM 1000 O O   . HOH C 3 .   ? -56.969 43.681 50.927 1.00 34.87 ? 156 HOH A O   1 
HETATM 1001 O O   . HOH C 3 .   ? -46.695 29.270 56.160 1.00 26.01 ? 157 HOH A O   1 
HETATM 1002 O O   . HOH C 3 .   ? -50.116 22.909 57.015 0.75 35.04 ? 158 HOH A O   1 
HETATM 1003 O O   . HOH C 3 .   ? -50.977 25.893 58.480 0.50 29.73 ? 159 HOH A O   1 
HETATM 1004 O O   . HOH C 3 .   ? -52.066 21.960 54.653 1.00 73.72 ? 160 HOH A O   1 
HETATM 1005 O O   . HOH C 3 .   ? -37.910 37.048 48.154 1.00 18.41 ? 161 HOH A O   1 
HETATM 1006 O O   . HOH C 3 .   ? -34.504 25.194 60.555 1.00 29.92 ? 162 HOH A O   1 
HETATM 1007 O O   . HOH C 3 .   ? -39.135 32.357 61.962 1.00 33.35 ? 163 HOH A O   1 
HETATM 1008 O O   . HOH C 3 .   ? -32.324 29.837 60.394 1.00 29.30 ? 164 HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? -36.472 23.963 60.049 1.00 51.51 ? 165 HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? -41.585 25.759 59.783 1.00 34.57 ? 166 HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? -56.656 44.694 48.360 1.00 49.99 ? 167 HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? -33.625 18.303 56.191 1.00 52.23 ? 168 HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? -29.924 19.745 55.940 1.00 25.02 ? 169 HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? -33.432 17.093 52.217 1.00 51.52 ? 170 HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? -31.549 21.908 56.254 1.00 22.95 ? 171 HOH A O   1 
HETATM 1016 O O   . HOH C 3 .   ? -28.600 23.893 51.094 1.00 32.27 ? 172 HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? -29.290 32.425 52.341 1.00 30.52 ? 173 HOH A O   1 
HETATM 1018 O O   . HOH C 3 .   ? -30.376 34.766 52.531 1.00 24.99 ? 174 HOH A O   1 
HETATM 1019 O O   . HOH C 3 .   ? -42.436 34.783 59.145 1.00 50.81 ? 175 HOH A O   1 
HETATM 1020 O O   . HOH C 3 .   ? -43.365 42.991 58.678 1.00 62.74 ? 176 HOH A O   1 
HETATM 1021 O O   . HOH C 3 .   ? -32.705 41.001 56.065 1.00 36.64 ? 177 HOH A O   1 
HETATM 1022 O O   . HOH C 3 .   ? -22.506 32.281 37.501 0.75 39.81 ? 178 HOH A O   1 
HETATM 1023 O O   . HOH C 3 .   ? -39.826 23.566 32.910 1.00 54.52 ? 179 HOH A O   1 
HETATM 1024 O O   . HOH C 3 .   ? -45.630 28.284 30.447 1.00 58.77 ? 180 HOH A O   1 
HETATM 1025 O O   . HOH C 3 .   ? -37.869 52.799 36.654 1.00 30.16 ? 181 HOH A O   1 
HETATM 1026 O O   . HOH C 3 .   ? -29.338 26.941 34.465 1.00 39.58 ? 182 HOH A O   1 
HETATM 1027 O O   . HOH C 3 .   ? -36.737 53.069 39.275 1.00 37.70 ? 183 HOH A O   1 
HETATM 1028 O O   . HOH C 3 .   ? -42.812 49.594 40.403 1.00 34.96 ? 184 HOH A O   1 
HETATM 1029 O O   . HOH C 3 .   ? -22.506 33.055 44.513 0.50 31.39 ? 185 HOH A O   1 
HETATM 1030 O O   . HOH C 3 .   ? -23.005 28.435 36.267 0.50 27.27 ? 186 HOH A O   1 
HETATM 1031 O O   . HOH C 3 .   ? -23.552 28.969 41.729 1.00 48.31 ? 187 HOH A O   1 
HETATM 1032 O O   . HOH C 3 .   ? -46.953 35.649 42.285 0.50 31.27 ? 188 HOH A O   1 
HETATM 1033 O O   . HOH C 3 .   ? -42.107 30.989 44.248 1.00 44.12 ? 189 HOH A O   1 
HETATM 1034 O O   . HOH C 3 .   ? -35.230 30.232 61.671 0.50 30.49 ? 190 HOH A O   1 
HETATM 1035 O O   . HOH C 3 .   ? -32.251 18.899 54.093 1.00 56.96 ? 191 HOH A O   1 
HETATM 1036 O O   . HOH C 3 .   ? -27.420 27.189 52.151 1.00 33.28 ? 192 HOH A O   1 
HETATM 1037 O O   . HOH C 3 .   ? -40.383 39.864 29.080 1.00 43.33 ? 193 HOH A O   1 
HETATM 1038 O O   . HOH C 3 .   ? -29.917 49.715 30.607 0.50 29.25 ? 194 HOH A O   1 
HETATM 1039 O O   . HOH C 3 .   ? -42.828 53.044 44.988 1.00 76.64 ? 195 HOH A O   1 
HETATM 1040 O O   . HOH C 3 .   ? -42.599 52.009 48.294 1.00 44.03 ? 196 HOH A O   1 
HETATM 1041 O O   . HOH C 3 .   ? -36.207 46.835 56.070 1.00 42.74 ? 197 HOH A O   1 
HETATM 1042 O O   . HOH C 3 .   ? -41.093 51.491 34.178 1.00 38.10 ? 198 HOH A O   1 
HETATM 1043 O O   . HOH C 3 .   ? -21.911 40.462 37.029 1.00 54.04 ? 199 HOH A O   1 
HETATM 1044 O O   . HOH C 3 .   ? -30.759 41.731 30.228 1.00 31.48 ? 200 HOH A O   1 
HETATM 1045 O O   . HOH C 3 .   ? -27.015 39.490 28.064 1.00 68.00 ? 201 HOH A O   1 
HETATM 1046 O O   . HOH C 3 .   ? -47.709 33.043 57.038 1.00 54.99 ? 202 HOH A O   1 
HETATM 1047 O O   . HOH C 3 .   ? -49.848 32.405 55.132 1.00 54.90 ? 203 HOH A O   1 
HETATM 1048 O O   . HOH C 3 .   ? -39.283 26.384 45.826 1.00 60.23 ? 204 HOH A O   1 
HETATM 1049 O O   . HOH C 3 .   ? -28.065 32.066 56.420 1.00 43.32 ? 205 HOH A O   1 
HETATM 1050 O O   . HOH C 3 .   ? -24.413 39.518 49.872 1.00 58.80 ? 206 HOH A O   1 
HETATM 1051 O O   . HOH C 3 .   ? -40.452 25.745 42.710 1.00 44.55 ? 207 HOH A O   1 
HETATM 1052 O O   . HOH C 3 .   ? -40.402 40.589 21.150 1.00 58.20 ? 208 HOH A O   1 
HETATM 1053 O O   . HOH C 3 .   ? -34.875 41.064 21.265 0.50 29.05 ? 209 HOH A O   1 
HETATM 1054 O O   . HOH C 3 .   ? -37.390 45.176 20.801 0.50 42.51 ? 210 HOH A O   1 
HETATM 1055 O O   . HOH C 3 .   ? -35.649 48.988 20.912 0.50 46.63 ? 211 HOH A O   1 
HETATM 1056 O O   . HOH C 3 .   ? -30.860 53.944 28.418 0.50 28.60 ? 212 HOH A O   1 
HETATM 1057 O O   . HOH C 3 .   ? -47.570 42.088 44.966 1.00 40.12 ? 213 HOH A O   1 
HETATM 1058 O O   . HOH C 3 .   ? -22.326 37.041 38.080 1.00 50.72 ? 214 HOH A O   1 
HETATM 1059 O O   . HOH C 3 .   ? -42.045 27.591 45.626 1.00 57.88 ? 215 HOH A O   1 
HETATM 1060 O O   . HOH C 3 .   ? -41.128 51.037 37.540 1.00 35.00 ? 216 HOH A O   1 
#