data_1TFF
# 
_entry.id   1TFF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TFF         
RCSB  RCSB022604   
WWPDB D_1000022604 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TFF 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nanao, M.H.'     1 
'Tcherniuk, S.O.' 2 
'Chroboczek, J.'  3 
'Dideberg, O.'    4 
'Dessen, A.'      5 
'Balakirev, M.Y.' 6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human otubain 2.' 
_citation.journal_abbrev            'Embo Rep.' 
_citation.journal_volume            5 
_citation.page_first                783 
_citation.page_last                 788 
_citation.year                      2004 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1469-221X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15258613 
_citation.pdbx_database_id_DOI      10.1038/sj.embor.7400201 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nanao, M.H.'     1 
primary 'Tcherniuk, S.O.' 2 
primary 'Chroboczek, J.'  3 
primary 'Dideberg, O.'    4 
primary 'Dessen, A.'      5 
primary 'Balakirev, M.Y.' 6 
# 
_cell.entry_id           1TFF 
_cell.length_a           46.433 
_cell.length_b           65.401 
_cell.length_c           76.259 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TFF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Ubiquitin thiolesterase protein OTUB2' 27444.861 1   3.4.-.- G49R Otubain-2 ? 
2 water   nat water                                   18.015    100 ?       ?    ?         ? 
# 
_entity_keywords.entity_id   1 
_entity_keywords.text        HYDROLASE 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Otubain 2, OTU domain-containing ubiquitin aldehyde-binding protein 2, Ubiquitin- specific processing protease OTUB2, Deubiquitinating enzyme OTUB2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDRNCFYRALGYSYLESLLGKSREIFKFKERVLQ
TPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEE
(MSE)DIKDFCTHEVEP(MSE)ATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILY
AADKH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDRNCFYRALGYSYLESLLGKSREIFKFKERVLQ
TPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDI
KDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLU n 
1 4   THR n 
1 5   SER n 
1 6   PHE n 
1 7   ASN n 
1 8   LEU n 
1 9   ILE n 
1 10  SER n 
1 11  GLU n 
1 12  LYS n 
1 13  CYS n 
1 14  ASP n 
1 15  ILE n 
1 16  LEU n 
1 17  SER n 
1 18  ILE n 
1 19  LEU n 
1 20  ARG n 
1 21  ASP n 
1 22  HIS n 
1 23  PRO n 
1 24  GLU n 
1 25  ASN n 
1 26  ARG n 
1 27  ILE n 
1 28  TYR n 
1 29  ARG n 
1 30  ARG n 
1 31  LYS n 
1 32  ILE n 
1 33  GLU n 
1 34  GLU n 
1 35  LEU n 
1 36  SER n 
1 37  LYS n 
1 38  ARG n 
1 39  PHE n 
1 40  THR n 
1 41  ALA n 
1 42  ILE n 
1 43  ARG n 
1 44  LYS n 
1 45  THR n 
1 46  LYS n 
1 47  GLY n 
1 48  ASP n 
1 49  ARG n 
1 50  ASN n 
1 51  CYS n 
1 52  PHE n 
1 53  TYR n 
1 54  ARG n 
1 55  ALA n 
1 56  LEU n 
1 57  GLY n 
1 58  TYR n 
1 59  SER n 
1 60  TYR n 
1 61  LEU n 
1 62  GLU n 
1 63  SER n 
1 64  LEU n 
1 65  LEU n 
1 66  GLY n 
1 67  LYS n 
1 68  SER n 
1 69  ARG n 
1 70  GLU n 
1 71  ILE n 
1 72  PHE n 
1 73  LYS n 
1 74  PHE n 
1 75  LYS n 
1 76  GLU n 
1 77  ARG n 
1 78  VAL n 
1 79  LEU n 
1 80  GLN n 
1 81  THR n 
1 82  PRO n 
1 83  ASN n 
1 84  ASP n 
1 85  LEU n 
1 86  LEU n 
1 87  ALA n 
1 88  ALA n 
1 89  GLY n 
1 90  PHE n 
1 91  GLU n 
1 92  GLU n 
1 93  HIS n 
1 94  LYS n 
1 95  PHE n 
1 96  ARG n 
1 97  ASN n 
1 98  PHE n 
1 99  PHE n 
1 100 ASN n 
1 101 ALA n 
1 102 PHE n 
1 103 TYR n 
1 104 SER n 
1 105 VAL n 
1 106 VAL n 
1 107 GLU n 
1 108 LEU n 
1 109 VAL n 
1 110 GLU n 
1 111 LYS n 
1 112 ASP n 
1 113 GLY n 
1 114 SER n 
1 115 VAL n 
1 116 SER n 
1 117 SER n 
1 118 LEU n 
1 119 LEU n 
1 120 LYS n 
1 121 VAL n 
1 122 PHE n 
1 123 ASN n 
1 124 ASP n 
1 125 GLN n 
1 126 SER n 
1 127 ALA n 
1 128 SER n 
1 129 ASP n 
1 130 HIS n 
1 131 ILE n 
1 132 VAL n 
1 133 GLN n 
1 134 PHE n 
1 135 LEU n 
1 136 ARG n 
1 137 LEU n 
1 138 LEU n 
1 139 THR n 
1 140 SER n 
1 141 ALA n 
1 142 PHE n 
1 143 ILE n 
1 144 ARG n 
1 145 ASN n 
1 146 ARG n 
1 147 ALA n 
1 148 ASP n 
1 149 PHE n 
1 150 PHE n 
1 151 ARG n 
1 152 HIS n 
1 153 PHE n 
1 154 ILE n 
1 155 ASP n 
1 156 GLU n 
1 157 GLU n 
1 158 MSE n 
1 159 ASP n 
1 160 ILE n 
1 161 LYS n 
1 162 ASP n 
1 163 PHE n 
1 164 CYS n 
1 165 THR n 
1 166 HIS n 
1 167 GLU n 
1 168 VAL n 
1 169 GLU n 
1 170 PRO n 
1 171 MSE n 
1 172 ALA n 
1 173 THR n 
1 174 GLU n 
1 175 CYS n 
1 176 ASP n 
1 177 HIS n 
1 178 ILE n 
1 179 GLN n 
1 180 ILE n 
1 181 THR n 
1 182 ALA n 
1 183 LEU n 
1 184 SER n 
1 185 GLN n 
1 186 ALA n 
1 187 LEU n 
1 188 SER n 
1 189 ILE n 
1 190 ALA n 
1 191 LEU n 
1 192 GLN n 
1 193 VAL n 
1 194 GLU n 
1 195 TYR n 
1 196 VAL n 
1 197 ASP n 
1 198 GLU n 
1 199 MET n 
1 200 ASP n 
1 201 THR n 
1 202 ALA n 
1 203 LEU n 
1 204 ASN n 
1 205 HIS n 
1 206 HIS n 
1 207 VAL n 
1 208 PHE n 
1 209 PRO n 
1 210 GLU n 
1 211 ALA n 
1 212 ALA n 
1 213 THR n 
1 214 PRO n 
1 215 SER n 
1 216 VAL n 
1 217 TYR n 
1 218 LEU n 
1 219 LEU n 
1 220 TYR n 
1 221 LYS n 
1 222 THR n 
1 223 SER n 
1 224 HIS n 
1 225 TYR n 
1 226 ASN n 
1 227 ILE n 
1 228 LEU n 
1 229 TYR n 
1 230 ALA n 
1 231 ALA n 
1 232 ASP n 
1 233 LYS n 
1 234 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'OTUB2, OTB2, OTU2, C14ORF137' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    OTUB2_HUMAN 
_struct_ref.pdbx_db_accession          Q96DC9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERVLQ
TPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDI
KDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1TFF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 234 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96DC9 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  234 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       234 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TFF ARG A 49  ? UNP Q96DC9 GLY 49  ENGINEERED         49  1 
1 1TFF MSE A 158 ? UNP Q96DC9 MET 158 'MODIFIED RESIDUE' 158 2 
1 1TFF MSE A 171 ? UNP Q96DC9 MET 171 'MODIFIED RESIDUE' 171 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1TFF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   41.7 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'14% PEG 4000, 0.1 M HEPES, pH 7.0, 12 % isopropanol and 5 mM DTT., VAPOR DIFFUSION, HANGING DROP, temperature 288.15K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 105 ? 1 
2 105 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD MARRESEARCH      ? ? 
2 CCD 'ADSC QUANTUM 4' ? ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? MAD                 x-ray 
2 2 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97630 1.0 
2 0.97990 1.0 
3 0.98010 1.0 
4 0.97950 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ESRF BEAMLINE BM30A'  ESRF BM30A  ? '0.97630, 0.97990, 0.98010' 
2 SYNCHROTRON 'ESRF BEAMLINE ID14-4' ESRF ID14-4 ? 0.97950                     
# 
_reflns.entry_id                     1TFF 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.1 
_reflns.d_resolution_low             100 
_reflns.number_all                   14128 
_reflns.number_obs                   14128 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.11 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              27 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.273 
_reflns_shell.meanI_over_sigI_obs    5.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1TFF 
_refine.ls_number_reflns_obs                     13320 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.39 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.51 
_refine.ls_R_factor_obs                          0.19125 
_refine.ls_R_factor_all                          0.19125 
_refine.ls_R_factor_R_work                       0.18792 
_refine.ls_R_factor_R_free                       0.25689 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  700 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.933 
_refine.correlation_coeff_Fo_to_Fc_free          0.896 
_refine.B_iso_mean                               26.717 
_refine.aniso_B[1][1]                            -0.08 
_refine.aniso_B[2][2]                            -0.82 
_refine.aniso_B[3][3]                            0.90 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.234 
_refine.pdbx_overall_ESU_R_Free                  0.208 
_refine.overall_SU_ML                            0.119 
_refine.overall_SU_B                             4.348 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1826 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             100 
_refine_hist.number_atoms_total               1926 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        49.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.028 0.021 ? 1859 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 1664 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.382 1.941 ? 2505 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.060 3.000 ? 3864 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.707 5.000 ? 219  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.150 0.200 ? 274  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.010 0.020 ? 2055 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.007 0.020 ? 415  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.233 0.200 ? 428  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.253 0.200 ? 1921 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.096 0.200 ? 1155 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.187 0.200 ? 86   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.180 0.200 ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.319 0.200 ? 36   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.218 0.200 ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.792 1.500 ? 1102 'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.076 2.000 ? 1779 'X-RAY DIFFRACTION' ? 
r_scbond_it              4.341 3.000 ? 757  'X-RAY DIFFRACTION' ? 
r_scangle_it             6.521 4.500 ? 726  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.1 
_refine_ls_shell.d_res_low                        2.151 
_refine_ls_shell.number_reflns_R_work             864 
_refine_ls_shell.R_factor_R_work                  0.158 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.266 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1TFF 
_struct.title                     'Structure of Otubain-2' 
_struct.pdbx_descriptor           'Ubiquitin thiolesterase protein OTUB2 (E.C.3.4.-.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TFF 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 16  ? ASP A 21  ? LEU A 16  ASP A 21  1 ? 6  
HELX_P HELX_P2  2  PRO A 23  ? ILE A 27  ? PRO A 23  ILE A 27  5 ? 5  
HELX_P HELX_P3  3  TYR A 28  ? ARG A 38  ? TYR A 28  ARG A 38  1 ? 11 
HELX_P HELX_P4  4  ASN A 50  ? LEU A 65  ? ASN A 50  LEU A 65  1 ? 16 
HELX_P HELX_P5  5  LYS A 67  ? ALA A 88  ? LYS A 67  ALA A 88  1 ? 22 
HELX_P HELX_P6  6  GLU A 91  ? ASP A 112 ? GLU A 91  ASP A 112 1 ? 22 
HELX_P HELX_P7  7  SER A 114 ? ASN A 123 ? SER A 114 ASN A 123 1 ? 10 
HELX_P HELX_P8  8  ASP A 124 ? ARG A 146 ? ASP A 124 ARG A 146 1 ? 23 
HELX_P HELX_P9  9  ARG A 146 ? ARG A 151 ? ARG A 146 ARG A 151 1 ? 6  
HELX_P HELX_P10 10 HIS A 152 ? ILE A 154 ? HIS A 152 ILE A 154 5 ? 3  
HELX_P HELX_P11 11 ASP A 159 ? VAL A 168 ? ASP A 159 VAL A 168 1 ? 10 
HELX_P HELX_P12 12 ASP A 176 ? SER A 188 ? ASP A 176 SER A 188 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A GLU 157 C ? ? ? 1_555 A MSE 158 N ? ? A GLU 157 A MSE 158 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale2 covale ? ? A MSE 158 C ? ? ? 1_555 A ASP 159 N ? ? A MSE 158 A ASP 159 1_555 ? ? ? ? ? ? ? 1.304 ? 
covale3 covale ? ? A PRO 170 C ? ? ? 1_555 A MSE 171 N ? ? A PRO 170 A MSE 171 1_555 ? ? ? ? ? ? ? 1.306 ? 
covale4 covale ? ? A MSE 171 C ? ? ? 1_555 A ALA 172 N ? ? A MSE 171 A ALA 172 1_555 ? ? ? ? ? ? ? 1.321 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 39  ? ARG A 43  ? PHE A 39  ARG A 43  
A 2 HIS A 224 ? ALA A 230 ? HIS A 224 ALA A 230 
A 3 VAL A 216 ? LYS A 221 ? VAL A 216 LYS A 221 
A 4 LEU A 191 ? TYR A 195 ? LEU A 191 TYR A 195 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 43  ? N ARG A 43  O ILE A 227 ? O ILE A 227 
A 2 3 O LEU A 228 ? O LEU A 228 N TYR A 217 ? N TYR A 217 
A 3 4 O TYR A 220 ? O TYR A 220 N GLU A 194 ? N GLU A 194 
# 
_database_PDB_matrix.entry_id          1TFF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TFF 
_atom_sites.fract_transf_matrix[1][1]   0.021536 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015290 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013113 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 7   ? 27.240 46.304 31.049 1.00 37.57 ? 7   ASN A N   1 
ATOM   2    C  CA  . ASN A 1 7   ? 27.907 45.745 29.868 1.00 38.83 ? 7   ASN A CA  1 
ATOM   3    C  C   . ASN A 1 7   ? 27.311 46.466 28.577 1.00 37.19 ? 7   ASN A C   1 
ATOM   4    O  O   . ASN A 1 7   ? 26.208 47.060 28.611 1.00 38.91 ? 7   ASN A O   1 
ATOM   5    C  CB  . ASN A 1 7   ? 27.637 44.238 29.789 1.00 39.56 ? 7   ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 7   ? 28.809 43.332 30.335 1.00 46.40 ? 7   ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 7   ? 28.717 42.101 30.219 1.00 53.82 ? 7   ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 7   ? 29.856 43.912 30.942 1.00 47.58 ? 7   ASN A ND2 1 
ATOM   9    N  N   . LEU A 1 8   ? 28.016 46.344 27.460 1.00 31.79 ? 8   LEU A N   1 
ATOM   10   C  CA  . LEU A 1 8   ? 27.619 46.947 26.184 1.00 29.61 ? 8   LEU A CA  1 
ATOM   11   C  C   . LEU A 1 8   ? 26.438 46.275 25.571 1.00 26.74 ? 8   LEU A C   1 
ATOM   12   O  O   . LEU A 1 8   ? 25.592 46.958 24.980 1.00 24.17 ? 8   LEU A O   1 
ATOM   13   C  CB  . LEU A 1 8   ? 28.823 46.908 25.206 1.00 28.56 ? 8   LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 8   ? 30.005 47.605 25.908 1.00 28.51 ? 8   LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 8   ? 31.287 47.606 25.131 1.00 28.70 ? 8   LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 8   ? 29.595 48.988 26.193 1.00 27.93 ? 8   LEU A CD2 1 
ATOM   17   N  N   . ILE A 1 9   ? 26.377 44.940 25.690 1.00 25.12 ? 9   ILE A N   1 
ATOM   18   C  CA  . ILE A 1 9   ? 25.231 44.165 25.242 1.00 24.54 ? 9   ILE A CA  1 
ATOM   19   C  C   . ILE A 1 9   ? 24.801 43.146 26.336 1.00 25.75 ? 9   ILE A C   1 
ATOM   20   O  O   . ILE A 1 9   ? 25.630 42.286 26.710 1.00 26.36 ? 9   ILE A O   1 
ATOM   21   C  CB  . ILE A 1 9   ? 25.652 43.311 24.060 1.00 23.53 ? 9   ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 9   ? 26.385 44.132 22.990 1.00 26.47 ? 9   ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 9   ? 24.443 42.539 23.579 1.00 25.12 ? 9   ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 9   ? 25.587 44.462 21.864 1.00 21.43 ? 9   ILE A CD1 1 
ATOM   25   N  N   . SER A 1 10  ? 23.536 43.185 26.730 1.00 22.76 ? 10  SER A N   1 
ATOM   26   C  CA  . SER A 1 10  ? 23.014 42.453 27.844 1.00 23.19 ? 10  SER A CA  1 
ATOM   27   C  C   . SER A 1 10  ? 22.729 41.030 27.474 1.00 23.33 ? 10  SER A C   1 
ATOM   28   O  O   . SER A 1 10  ? 22.781 40.621 26.282 1.00 23.37 ? 10  SER A O   1 
ATOM   29   C  CB  . SER A 1 10  ? 21.775 43.156 28.422 1.00 22.42 ? 10  SER A CB  1 
ATOM   30   O  OG  . SER A 1 10  ? 20.511 42.873 27.706 1.00 22.40 ? 10  SER A OG  1 
ATOM   31   N  N   . GLU A 1 11  ? 22.446 40.226 28.508 1.00 23.87 ? 11  GLU A N   1 
ATOM   32   C  CA  . GLU A 1 11  ? 21.771 38.937 28.345 1.00 21.92 ? 11  GLU A CA  1 
ATOM   33   C  C   . GLU A 1 11  ? 20.310 39.113 27.875 1.00 22.18 ? 11  GLU A C   1 
ATOM   34   O  O   . GLU A 1 11  ? 19.774 40.217 27.867 1.00 21.94 ? 11  GLU A O   1 
ATOM   35   C  CB  . GLU A 1 11  ? 21.843 38.163 29.693 1.00 25.03 ? 11  GLU A CB  1 
ATOM   36   C  CG  . GLU A 1 11  ? 20.771 38.605 30.740 1.00 25.25 ? 11  GLU A CG  1 
ATOM   37   C  CD  . GLU A 1 11  ? 20.981 39.940 31.423 1.00 30.40 ? 11  GLU A CD  1 
ATOM   38   O  OE1 . GLU A 1 11  ? 22.005 40.614 31.183 1.00 40.37 ? 11  GLU A OE1 1 
ATOM   39   O  OE2 . GLU A 1 11  ? 20.065 40.323 32.214 1.00 36.98 ? 11  GLU A OE2 1 
ATOM   40   N  N   . LYS A 1 12  ? 19.667 38.013 27.421 1.00 21.91 ? 12  LYS A N   1 
ATOM   41   C  CA  . LYS A 1 12  ? 18.292 38.068 26.944 1.00 21.16 ? 12  LYS A CA  1 
ATOM   42   C  C   . LYS A 1 12  ? 17.371 38.186 28.188 1.00 24.40 ? 12  LYS A C   1 
ATOM   43   O  O   . LYS A 1 12  ? 17.634 37.550 29.204 1.00 20.03 ? 12  LYS A O   1 
ATOM   44   C  CB  . LYS A 1 12  ? 17.917 36.840 26.185 1.00 22.34 ? 12  LYS A CB  1 
ATOM   45   C  CG  . LYS A 1 12  ? 18.481 36.738 24.806 1.00 19.38 ? 12  LYS A CG  1 
ATOM   46   C  CD  . LYS A 1 12  ? 18.070 35.493 24.158 1.00 19.80 ? 12  LYS A CD  1 
ATOM   47   C  CE  . LYS A 1 12  ? 18.636 35.214 22.795 1.00 27.62 ? 12  LYS A CE  1 
ATOM   48   N  NZ  . LYS A 1 12  ? 18.265 33.906 22.250 1.00 31.70 ? 12  LYS A NZ  1 
ATOM   49   N  N   . CYS A 1 13  ? 16.353 39.042 28.131 1.00 24.27 ? 13  CYS A N   1 
ATOM   50   C  CA  . CYS A 1 13  ? 15.418 39.243 29.237 1.00 25.07 ? 13  CYS A CA  1 
ATOM   51   C  C   . CYS A 1 13  ? 14.057 39.187 28.637 1.00 23.65 ? 13  CYS A C   1 
ATOM   52   O  O   . CYS A 1 13  ? 13.917 39.268 27.376 1.00 20.94 ? 13  CYS A O   1 
ATOM   53   C  CB  . CYS A 1 13  ? 15.531 40.617 29.888 1.00 27.25 ? 13  CYS A CB  1 
ATOM   54   S  SG  . CYS A 1 13  ? 17.089 40.966 30.680 1.00 35.86 ? 13  CYS A SG  1 
ATOM   55   N  N   . ASP A 1 14  ? 13.056 39.065 29.520 1.00 22.33 ? 14  ASP A N   1 
ATOM   56   C  CA  . ASP A 1 14  ? 11.625 39.074 29.125 1.00 23.59 ? 14  ASP A CA  1 
ATOM   57   C  C   . ASP A 1 14  ? 11.267 40.351 28.444 1.00 20.71 ? 14  ASP A C   1 
ATOM   58   O  O   . ASP A 1 14  ? 11.724 41.382 28.856 1.00 22.03 ? 14  ASP A O   1 
ATOM   59   C  CB  . ASP A 1 14  ? 10.650 38.885 30.350 1.00 25.61 ? 14  ASP A CB  1 
ATOM   60   C  CG  . ASP A 1 14  ? 10.761 37.472 31.026 1.00 34.19 ? 14  ASP A CG  1 
ATOM   61   O  OD1 . ASP A 1 14  ? 11.321 36.512 30.384 1.00 40.12 ? 14  ASP A OD1 1 
ATOM   62   O  OD2 . ASP A 1 14  ? 10.336 37.244 32.215 1.00 40.35 ? 14  ASP A OD2 1 
ATOM   63   N  N   . ILE A 1 15  ? 10.411 40.312 27.465 1.00 21.06 ? 15  ILE A N   1 
ATOM   64   C  CA  . ILE A 1 15  ? 9.821  41.537 26.918 1.00 24.43 ? 15  ILE A CA  1 
ATOM   65   C  C   . ILE A 1 15  ? 9.165  42.462 27.945 1.00 27.11 ? 15  ILE A C   1 
ATOM   66   O  O   . ILE A 1 15  ? 9.410  43.748 28.022 1.00 26.20 ? 15  ILE A O   1 
ATOM   67   C  CB  . ILE A 1 15  ? 8.815  41.214 25.855 1.00 24.63 ? 15  ILE A CB  1 
ATOM   68   C  CG1 . ILE A 1 15  ? 9.515  40.523 24.677 1.00 26.32 ? 15  ILE A CG1 1 
ATOM   69   C  CG2 . ILE A 1 15  ? 8.140  42.596 25.355 1.00 28.02 ? 15  ILE A CG2 1 
ATOM   70   C  CD1 . ILE A 1 15  ? 10.623 41.306 24.081 1.00 25.01 ? 15  ILE A CD1 1 
ATOM   71   N  N   . LEU A 1 16  ? 8.395  41.815 28.796 1.00 30.99 ? 16  LEU A N   1 
ATOM   72   C  CA  . LEU A 1 16  ? 7.666  42.563 29.826 1.00 36.72 ? 16  LEU A CA  1 
ATOM   73   C  C   . LEU A 1 16  ? 8.597  43.287 30.802 1.00 39.34 ? 16  LEU A C   1 
ATOM   74   O  O   . LEU A 1 16  ? 8.142  44.112 31.567 1.00 41.70 ? 16  LEU A O   1 
ATOM   75   C  CB  . LEU A 1 16  ? 6.704  41.664 30.572 1.00 36.90 ? 16  LEU A CB  1 
ATOM   76   C  CG  . LEU A 1 16  ? 5.211  41.782 30.238 1.00 43.02 ? 16  LEU A CG  1 
ATOM   77   C  CD1 . LEU A 1 16  ? 4.855  42.244 28.830 1.00 47.29 ? 16  LEU A CD1 1 
ATOM   78   C  CD2 . LEU A 1 16  ? 4.453  40.484 30.575 1.00 41.59 ? 16  LEU A CD2 1 
ATOM   79   N  N   . SER A 1 17  ? 9.896  42.996 30.756 1.00 41.42 ? 17  SER A N   1 
ATOM   80   C  CA  . SER A 1 17  ? 10.901 43.654 31.597 1.00 43.54 ? 17  SER A CA  1 
ATOM   81   C  C   . SER A 1 17  ? 11.118 45.119 31.204 1.00 45.28 ? 17  SER A C   1 
ATOM   82   O  O   . SER A 1 17  ? 11.652 45.930 32.004 1.00 45.73 ? 17  SER A O   1 
ATOM   83   C  CB  . SER A 1 17  ? 12.218 42.843 31.622 1.00 42.79 ? 17  SER A CB  1 
ATOM   84   O  OG  . SER A 1 17  ? 12.932 42.920 30.375 1.00 43.53 ? 17  SER A OG  1 
ATOM   85   N  N   . ILE A 1 18  ? 10.676 45.457 29.989 1.00 46.95 ? 18  ILE A N   1 
ATOM   86   C  CA  . ILE A 1 18  ? 10.675 46.828 29.531 1.00 48.27 ? 18  ILE A CA  1 
ATOM   87   C  C   . ILE A 1 18  ? 9.728  47.655 30.433 1.00 50.98 ? 18  ILE A C   1 
ATOM   88   O  O   . ILE A 1 18  ? 10.004 48.818 30.648 1.00 51.43 ? 18  ILE A O   1 
ATOM   89   C  CB  . ILE A 1 18  ? 10.228 46.896 28.075 1.00 48.04 ? 18  ILE A CB  1 
ATOM   90   C  CG1 . ILE A 1 18  ? 11.216 46.217 27.136 1.00 46.61 ? 18  ILE A CG1 1 
ATOM   91   C  CG2 . ILE A 1 18  ? 10.071 48.314 27.609 1.00 48.40 ? 18  ILE A CG2 1 
ATOM   92   C  CD1 . ILE A 1 18  ? 10.523 45.874 25.769 1.00 44.13 ? 18  ILE A CD1 1 
ATOM   93   N  N   . LEU A 1 19  ? 8.620  47.079 30.931 1.00 53.74 ? 19  LEU A N   1 
ATOM   94   C  CA  . LEU A 1 19  ? 7.718  47.774 31.871 1.00 56.42 ? 19  LEU A CA  1 
ATOM   95   C  C   . LEU A 1 19  ? 8.197  47.713 33.331 1.00 58.23 ? 19  LEU A C   1 
ATOM   96   O  O   . LEU A 1 19  ? 8.524  48.748 33.909 1.00 56.58 ? 19  LEU A O   1 
ATOM   97   C  CB  . LEU A 1 19  ? 6.311  47.210 31.812 1.00 56.47 ? 19  LEU A CB  1 
ATOM   98   C  CG  . LEU A 1 19  ? 5.614  47.291 30.464 1.00 57.75 ? 19  LEU A CG  1 
ATOM   99   C  CD1 . LEU A 1 19  ? 4.301  46.562 30.509 1.00 58.53 ? 19  LEU A CD1 1 
ATOM   100  C  CD2 . LEU A 1 19  ? 5.406  48.736 30.094 1.00 60.56 ? 19  LEU A CD2 1 
ATOM   101  N  N   . ARG A 1 20  ? 8.231  46.495 33.889 1.00 60.99 ? 20  ARG A N   1 
ATOM   102  C  CA  . ARG A 1 20  ? 8.696  46.214 35.268 1.00 62.76 ? 20  ARG A CA  1 
ATOM   103  C  C   . ARG A 1 20  ? 9.933  47.006 35.741 1.00 64.21 ? 20  ARG A C   1 
ATOM   104  O  O   . ARG A 1 20  ? 9.918  47.585 36.837 1.00 63.46 ? 20  ARG A O   1 
ATOM   105  C  CB  . ARG A 1 20  ? 8.956  44.710 35.454 1.00 62.79 ? 20  ARG A CB  1 
ATOM   106  C  CG  . ARG A 1 20  ? 9.063  44.253 36.906 0.01 63.57 ? 20  ARG A CG  1 
ATOM   107  C  CD  . ARG A 1 20  ? 7.874  44.642 37.776 0.01 64.49 ? 20  ARG A CD  1 
ATOM   108  N  NE  . ARG A 1 20  ? 7.722  43.772 38.942 0.01 65.24 ? 20  ARG A NE  1 
ATOM   109  C  CZ  . ARG A 1 20  ? 6.773  43.905 39.865 0.01 65.98 ? 20  ARG A CZ  1 
ATOM   110  N  NH1 . ARG A 1 20  ? 5.870  44.877 39.778 0.01 66.24 ? 20  ARG A NH1 1 
ATOM   111  N  NH2 . ARG A 1 20  ? 6.724  43.058 40.887 0.01 66.23 ? 20  ARG A NH2 1 
ATOM   112  N  N   . ASP A 1 21  ? 10.990 47.021 34.928 1.00 65.87 ? 21  ASP A N   1 
ATOM   113  C  CA  . ASP A 1 21  ? 12.063 47.997 35.090 1.00 67.46 ? 21  ASP A CA  1 
ATOM   114  C  C   . ASP A 1 21  ? 11.454 49.414 34.905 1.00 68.95 ? 21  ASP A C   1 
ATOM   115  O  O   . ASP A 1 21  ? 10.328 49.643 35.361 1.00 70.20 ? 21  ASP A O   1 
ATOM   116  C  CB  . ASP A 1 21  ? 13.216 47.732 34.113 0.01 67.49 ? 21  ASP A CB  1 
ATOM   117  C  CG  . ASP A 1 21  ? 13.834 46.354 34.290 0.01 67.57 ? 21  ASP A CG  1 
ATOM   118  O  OD1 . ASP A 1 21  ? 13.867 45.850 35.433 0.01 67.65 ? 21  ASP A OD1 1 
ATOM   119  O  OD2 . ASP A 1 21  ? 14.315 45.699 33.341 0.01 67.64 ? 21  ASP A OD2 1 
ATOM   120  N  N   . HIS A 1 22  ? 12.178 50.361 34.291 1.00 69.16 ? 22  HIS A N   1 
ATOM   121  C  CA  . HIS A 1 22  ? 11.574 51.583 33.712 1.00 69.33 ? 22  HIS A CA  1 
ATOM   122  C  C   . HIS A 1 22  ? 10.073 51.891 34.028 1.00 68.99 ? 22  HIS A C   1 
ATOM   123  O  O   . HIS A 1 22  ? 9.188  51.428 33.311 1.00 69.77 ? 22  HIS A O   1 
ATOM   124  C  CB  . HIS A 1 22  ? 11.719 51.542 32.181 0.01 69.32 ? 22  HIS A CB  1 
ATOM   125  C  CG  . HIS A 1 22  ? 13.136 51.502 31.689 0.01 69.66 ? 22  HIS A CG  1 
ATOM   126  N  ND1 . HIS A 1 22  ? 14.118 50.739 32.284 0.01 69.94 ? 22  HIS A ND1 1 
ATOM   127  C  CD2 . HIS A 1 22  ? 13.728 52.122 30.641 0.01 69.95 ? 22  HIS A CD2 1 
ATOM   128  C  CE1 . HIS A 1 22  ? 15.255 50.898 31.632 0.01 70.09 ? 22  HIS A CE1 1 
ATOM   129  N  NE2 . HIS A 1 22  ? 15.046 51.732 30.629 0.01 70.05 ? 22  HIS A NE2 1 
ATOM   130  N  N   . PRO A 1 23  ? 9.782  52.686 35.062 1.00 68.58 ? 23  PRO A N   1 
ATOM   131  C  CA  . PRO A 1 23  ? 8.463  53.340 35.201 1.00 67.53 ? 23  PRO A CA  1 
ATOM   132  C  C   . PRO A 1 23  ? 8.096  54.397 34.134 1.00 66.15 ? 23  PRO A C   1 
ATOM   133  O  O   . PRO A 1 23  ? 6.923  54.666 33.932 1.00 64.67 ? 23  PRO A O   1 
ATOM   134  C  CB  . PRO A 1 23  ? 8.545  54.036 36.571 1.00 67.95 ? 23  PRO A CB  1 
ATOM   135  C  CG  . PRO A 1 23  ? 9.752  53.408 37.289 1.00 69.34 ? 23  PRO A CG  1 
ATOM   136  C  CD  . PRO A 1 23  ? 10.691 53.018 36.184 1.00 69.11 ? 23  PRO A CD  1 
ATOM   137  N  N   . GLU A 1 24  ? 9.068  55.011 33.472 1.00 65.22 ? 24  GLU A N   1 
ATOM   138  C  CA  . GLU A 1 24  ? 8.755  55.925 32.376 1.00 65.52 ? 24  GLU A CA  1 
ATOM   139  C  C   . GLU A 1 24  ? 7.907  55.237 31.290 1.00 65.51 ? 24  GLU A C   1 
ATOM   140  O  O   . GLU A 1 24  ? 7.038  55.853 30.659 1.00 66.08 ? 24  GLU A O   1 
ATOM   141  C  CB  . GLU A 1 24  ? 10.038 56.495 31.763 0.01 65.50 ? 24  GLU A CB  1 
ATOM   142  C  CG  . GLU A 1 24  ? 10.898 55.474 31.031 0.01 65.65 ? 24  GLU A CG  1 
ATOM   143  C  CD  . GLU A 1 24  ? 12.375 55.814 31.070 0.01 65.71 ? 24  GLU A CD  1 
ATOM   144  O  OE1 . GLU A 1 24  ? 13.087 55.277 31.944 0.01 65.77 ? 24  GLU A OE1 1 
ATOM   145  O  OE2 . GLU A 1 24  ? 12.824 56.619 30.227 0.01 65.79 ? 24  GLU A OE2 1 
ATOM   146  N  N   . ASN A 1 25  ? 8.151  53.940 31.113 1.00 65.12 ? 25  ASN A N   1 
ATOM   147  C  CA  . ASN A 1 25  ? 7.551  53.141 30.045 1.00 63.95 ? 25  ASN A CA  1 
ATOM   148  C  C   . ASN A 1 25  ? 6.095  52.727 30.212 1.00 62.94 ? 25  ASN A C   1 
ATOM   149  O  O   . ASN A 1 25  ? 5.570  52.086 29.291 1.00 61.54 ? 25  ASN A O   1 
ATOM   150  C  CB  . ASN A 1 25  ? 8.406  51.888 29.793 0.01 64.00 ? 25  ASN A CB  1 
ATOM   151  C  CG  . ASN A 1 25  ? 9.580  52.158 28.871 0.01 64.00 ? 25  ASN A CG  1 
ATOM   152  O  OD1 . ASN A 1 25  ? 9.415  52.264 27.656 0.01 63.98 ? 25  ASN A OD1 1 
ATOM   153  N  ND2 . ASN A 1 25  ? 10.772 52.271 29.445 0.01 64.05 ? 25  ASN A ND2 1 
ATOM   154  N  N   . ARG A 1 26  ? 5.435  53.083 31.323 1.00 62.03 ? 26  ARG A N   1 
ATOM   155  C  CA  . ARG A 1 26  ? 4.039  52.613 31.588 1.00 61.93 ? 26  ARG A CA  1 
ATOM   156  C  C   . ARG A 1 26  ? 2.930  53.155 30.633 1.00 60.53 ? 26  ARG A C   1 
ATOM   157  O  O   . ARG A 1 26  ? 1.916  52.471 30.416 1.00 59.79 ? 26  ARG A O   1 
ATOM   158  C  CB  . ARG A 1 26  ? 3.568  52.818 33.054 1.00 62.73 ? 26  ARG A CB  1 
ATOM   159  C  CG  . ARG A 1 26  ? 4.532  52.522 34.200 1.00 65.19 ? 26  ARG A CG  1 
ATOM   160  C  CD  . ARG A 1 26  ? 4.176  53.302 35.506 1.00 69.73 ? 26  ARG A CD  1 
ATOM   161  N  NE  . ARG A 1 26  ? 4.784  54.644 35.621 1.00 72.67 ? 26  ARG A NE  1 
ATOM   162  C  CZ  . ARG A 1 26  ? 4.843  55.382 36.747 1.00 74.52 ? 26  ARG A CZ  1 
ATOM   163  N  NH1 . ARG A 1 26  ? 4.309  54.942 37.883 1.00 75.97 ? 26  ARG A NH1 1 
ATOM   164  N  NH2 . ARG A 1 26  ? 5.434  56.577 36.744 1.00 74.01 ? 26  ARG A NH2 1 
ATOM   165  N  N   . ILE A 1 27  ? 3.110  54.354 30.066 1.00 59.70 ? 27  ILE A N   1 
ATOM   166  C  CA  . ILE A 1 27  ? 2.201  54.879 28.997 1.00 59.31 ? 27  ILE A CA  1 
ATOM   167  C  C   . ILE A 1 27  ? 2.152  53.983 27.714 1.00 58.89 ? 27  ILE A C   1 
ATOM   168  O  O   . ILE A 1 27  ? 1.114  53.874 27.035 1.00 57.00 ? 27  ILE A O   1 
ATOM   169  C  CB  . ILE A 1 27  ? 2.580  56.341 28.636 0.01 59.37 ? 27  ILE A CB  1 
ATOM   170  C  CG1 . ILE A 1 27  ? 1.486  57.008 27.794 0.01 59.51 ? 27  ILE A CG1 1 
ATOM   171  C  CG2 . ILE A 1 27  ? 3.917  56.398 27.901 0.01 59.41 ? 27  ILE A CG2 1 
ATOM   172  C  CD1 . ILE A 1 27  ? 0.162  57.174 28.512 0.01 59.66 ? 27  ILE A CD1 1 
ATOM   173  N  N   . TYR A 1 28  ? 3.267  53.307 27.405 1.00 57.49 ? 28  TYR A N   1 
ATOM   174  C  CA  . TYR A 1 28  ? 3.270  52.374 26.274 1.00 56.48 ? 28  TYR A CA  1 
ATOM   175  C  C   . TYR A 1 28  ? 3.007  50.884 26.668 1.00 54.58 ? 28  TYR A C   1 
ATOM   176  O  O   . TYR A 1 28  ? 3.410  49.983 25.964 1.00 52.49 ? 28  TYR A O   1 
ATOM   177  C  CB  . TYR A 1 28  ? 4.587  52.479 25.454 1.00 56.66 ? 28  TYR A CB  1 
ATOM   178  C  CG  . TYR A 1 28  ? 5.331  53.809 25.371 1.00 58.96 ? 28  TYR A CG  1 
ATOM   179  C  CD1 . TYR A 1 28  ? 4.793  54.942 24.737 1.00 63.95 ? 28  TYR A CD1 1 
ATOM   180  C  CD2 . TYR A 1 28  ? 6.607  53.909 25.885 1.00 62.45 ? 28  TYR A CD2 1 
ATOM   181  C  CE1 . TYR A 1 28  ? 5.526  56.155 24.675 1.00 65.07 ? 28  TYR A CE1 1 
ATOM   182  C  CE2 . TYR A 1 28  ? 7.339  55.086 25.826 1.00 65.91 ? 28  TYR A CE2 1 
ATOM   183  C  CZ  . TYR A 1 28  ? 6.811  56.197 25.229 1.00 66.64 ? 28  TYR A CZ  1 
ATOM   184  O  OH  . TYR A 1 28  ? 7.625  57.305 25.209 1.00 70.58 ? 28  TYR A OH  1 
ATOM   185  N  N   . ARG A 1 29  ? 2.329  50.617 27.774 1.00 52.66 ? 29  ARG A N   1 
ATOM   186  C  CA  . ARG A 1 29  ? 2.098  49.263 28.224 1.00 51.47 ? 29  ARG A CA  1 
ATOM   187  C  C   . ARG A 1 29  ? 1.357  48.368 27.232 1.00 50.91 ? 29  ARG A C   1 
ATOM   188  O  O   . ARG A 1 29  ? 1.632  47.139 27.140 1.00 50.09 ? 29  ARG A O   1 
ATOM   189  C  CB  . ARG A 1 29  ? 1.276  49.313 29.514 1.00 52.47 ? 29  ARG A CB  1 
ATOM   190  C  CG  . ARG A 1 29  ? 0.895  47.960 30.093 0.01 52.29 ? 29  ARG A CG  1 
ATOM   191  C  CD  . ARG A 1 29  ? 0.595  47.982 31.587 0.01 52.90 ? 29  ARG A CD  1 
ATOM   192  N  NE  . ARG A 1 29  ? -0.533 47.122 31.945 0.01 53.32 ? 29  ARG A NE  1 
ATOM   193  C  CZ  . ARG A 1 29  ? -1.814 47.399 31.707 0.01 53.77 ? 29  ARG A CZ  1 
ATOM   194  N  NH1 . ARG A 1 29  ? -2.171 48.526 31.098 0.01 53.92 ? 29  ARG A NH1 1 
ATOM   195  N  NH2 . ARG A 1 29  ? -2.753 46.537 32.081 0.01 53.91 ? 29  ARG A NH2 1 
ATOM   196  N  N   . ARG A 1 30  ? 0.397  48.933 26.508 1.00 48.46 ? 30  ARG A N   1 
ATOM   197  C  CA  . ARG A 1 30  ? -0.375 48.087 25.599 1.00 47.66 ? 30  ARG A CA  1 
ATOM   198  C  C   . ARG A 1 30  ? 0.513  47.715 24.427 1.00 45.04 ? 30  ARG A C   1 
ATOM   199  O  O   . ARG A 1 30  ? 0.366  46.614 23.901 1.00 44.84 ? 30  ARG A O   1 
ATOM   200  C  CB  . ARG A 1 30  ? -1.656 48.756 25.076 1.00 48.72 ? 30  ARG A CB  1 
ATOM   201  C  CG  . ARG A 1 30  ? -2.526 47.897 24.172 0.01 51.06 ? 30  ARG A CG  1 
ATOM   202  C  CD  . ARG A 1 30  ? -3.414 46.932 24.926 0.01 55.19 ? 30  ARG A CD  1 
ATOM   203  N  NE  . ARG A 1 30  ? -3.920 45.863 24.070 0.01 59.25 ? 30  ARG A NE  1 
ATOM   204  C  CZ  . ARG A 1 30  ? -4.880 45.013 24.417 1.00 64.39 ? 30  ARG A CZ  1 
ATOM   205  N  NH1 . ARG A 1 30  ? -5.472 45.106 25.615 1.00 65.96 ? 30  ARG A NH1 1 
ATOM   206  N  NH2 . ARG A 1 30  ? -5.280 44.075 23.555 1.00 65.60 ? 30  ARG A NH2 1 
ATOM   207  N  N   . LYS A 1 31  ? 1.403  48.620 24.011 1.00 41.29 ? 31  LYS A N   1 
ATOM   208  C  CA  . LYS A 1 31  ? 2.278  48.321 22.864 1.00 39.05 ? 31  LYS A CA  1 
ATOM   209  C  C   . LYS A 1 31  ? 3.317  47.262 23.262 1.00 37.07 ? 31  LYS A C   1 
ATOM   210  O  O   . LYS A 1 31  ? 3.613  46.353 22.495 1.00 34.76 ? 31  LYS A O   1 
ATOM   211  C  CB  . LYS A 1 31  ? 2.975  49.554 22.322 1.00 38.80 ? 31  LYS A CB  1 
ATOM   212  C  CG  . LYS A 1 31  ? 3.690  49.296 20.968 1.00 39.41 ? 31  LYS A CG  1 
ATOM   213  C  CD  . LYS A 1 31  ? 5.121  48.810 21.040 0.01 39.21 ? 31  LYS A CD  1 
ATOM   214  C  CE  . LYS A 1 31  ? 5.508  48.137 19.726 0.01 39.21 ? 31  LYS A CE  1 
ATOM   215  N  NZ  . LYS A 1 31  ? 5.035  48.876 18.520 0.01 39.10 ? 31  LYS A NZ  1 
ATOM   216  N  N   . ILE A 1 32  ? 3.820  47.376 24.481 1.00 34.88 ? 32  ILE A N   1 
ATOM   217  C  CA  . ILE A 1 32  ? 4.818  46.470 25.019 1.00 34.79 ? 32  ILE A CA  1 
ATOM   218  C  C   . ILE A 1 32  ? 4.176  45.127 25.161 1.00 34.14 ? 32  ILE A C   1 
ATOM   219  O  O   . ILE A 1 32  ? 4.819  44.114 24.861 1.00 30.42 ? 32  ILE A O   1 
ATOM   220  C  CB  . ILE A 1 32  ? 5.329  46.902 26.381 1.00 35.53 ? 32  ILE A CB  1 
ATOM   221  C  CG1 . ILE A 1 32  ? 6.147  48.179 26.305 1.00 36.20 ? 32  ILE A CG1 1 
ATOM   222  C  CG2 . ILE A 1 32  ? 6.167  45.760 27.025 1.00 37.40 ? 32  ILE A CG2 1 
ATOM   223  C  CD1 . ILE A 1 32  ? 6.255  48.773 25.040 1.00 40.62 ? 32  ILE A CD1 1 
ATOM   224  N  N   . GLU A 1 33  ? 2.912  45.103 25.583 1.00 33.60 ? 33  GLU A N   1 
ATOM   225  C  CA  . GLU A 1 33  ? 2.213  43.828 25.669 1.00 35.22 ? 33  GLU A CA  1 
ATOM   226  C  C   . GLU A 1 33  ? 1.962  43.211 24.283 1.00 33.25 ? 33  GLU A C   1 
ATOM   227  O  O   . GLU A 1 33  ? 2.052  41.981 24.151 1.00 34.07 ? 33  GLU A O   1 
ATOM   228  C  CB  . GLU A 1 33  ? 0.895  43.907 26.525 1.00 37.37 ? 33  GLU A CB  1 
ATOM   229  C  CG  . GLU A 1 33  ? 1.186  44.303 27.992 1.00 39.67 ? 33  GLU A CG  1 
ATOM   230  C  CD  . GLU A 1 33  ? -0.025 44.792 28.821 1.00 48.92 ? 33  GLU A CD  1 
ATOM   231  O  OE1 . GLU A 1 33  ? -1.173 44.888 28.284 1.00 48.46 ? 33  GLU A OE1 1 
ATOM   232  O  OE2 . GLU A 1 33  ? 0.180  45.058 30.063 1.00 52.89 ? 33  GLU A OE2 1 
ATOM   233  N  N   . GLU A 1 34  ? 1.645  43.997 23.273 1.00 30.48 ? 34  GLU A N   1 
ATOM   234  C  CA  . GLU A 1 34  ? 1.594  43.430 21.902 1.00 31.46 ? 34  GLU A CA  1 
ATOM   235  C  C   . GLU A 1 34  ? 2.993  42.930 21.388 1.00 28.83 ? 34  GLU A C   1 
ATOM   236  O  O   . GLU A 1 34  ? 3.121  41.901 20.694 1.00 29.65 ? 34  GLU A O   1 
ATOM   237  C  CB  . GLU A 1 34  ? 1.093  44.509 20.908 1.00 31.76 ? 34  GLU A CB  1 
ATOM   238  C  CG  . GLU A 1 34  ? 0.819  43.999 19.499 0.01 31.58 ? 34  GLU A CG  1 
ATOM   239  C  CD  . GLU A 1 34  ? 1.747  44.599 18.458 0.01 31.63 ? 34  GLU A CD  1 
ATOM   240  O  OE1 . GLU A 1 34  ? 2.968  44.673 18.713 0.01 31.60 ? 34  GLU A OE1 1 
ATOM   241  O  OE2 . GLU A 1 34  ? 1.254  44.998 17.381 0.01 31.81 ? 34  GLU A OE2 1 
ATOM   242  N  N   . LEU A 1 35  ? 4.046  43.637 21.717 1.00 25.66 ? 35  LEU A N   1 
ATOM   243  C  CA  . LEU A 1 35  ? 5.361  43.132 21.382 1.00 27.30 ? 35  LEU A CA  1 
ATOM   244  C  C   . LEU A 1 35  ? 5.607  41.778 22.014 1.00 28.26 ? 35  LEU A C   1 
ATOM   245  O  O   . LEU A 1 35  ? 6.221  40.893 21.344 1.00 25.53 ? 35  LEU A O   1 
ATOM   246  C  CB  . LEU A 1 35  ? 6.439  44.073 21.867 1.00 29.06 ? 35  LEU A CB  1 
ATOM   247  C  CG  . LEU A 1 35  ? 6.611  45.343 21.086 1.00 30.13 ? 35  LEU A CG  1 
ATOM   248  C  CD1 . LEU A 1 35  ? 7.741  46.157 21.783 1.00 38.10 ? 35  LEU A CD1 1 
ATOM   249  C  CD2 . LEU A 1 35  ? 6.915  45.095 19.693 1.00 30.68 ? 35  LEU A CD2 1 
ATOM   250  N  N   . SER A 1 36  ? 5.117  41.609 23.255 1.00 27.57 ? 36  SER A N   1 
ATOM   251  C  CA  . SER A 1 36  ? 5.358  40.378 24.029 1.00 31.89 ? 36  SER A CA  1 
ATOM   252  C  C   . SER A 1 36  ? 4.660  39.203 23.329 1.00 33.10 ? 36  SER A C   1 
ATOM   253  O  O   . SER A 1 36  ? 5.020  38.082 23.529 1.00 31.37 ? 36  SER A O   1 
ATOM   254  C  CB  . SER A 1 36  ? 4.932  40.481 25.529 1.00 31.26 ? 36  SER A CB  1 
ATOM   255  O  OG  . SER A 1 36  ? 3.524  40.731 25.528 1.00 40.35 ? 36  SER A OG  1 
ATOM   256  N  N   . LYS A 1 37  ? 3.705  39.440 22.438 1.00 33.81 ? 37  LYS A N   1 
ATOM   257  C  CA  . LYS A 1 37  ? 3.156  38.295 21.748 1.00 35.12 ? 37  LYS A CA  1 
ATOM   258  C  C   . LYS A 1 37  ? 3.866  37.931 20.464 1.00 34.57 ? 37  LYS A C   1 
ATOM   259  O  O   . LYS A 1 37  ? 3.658  36.807 19.947 1.00 34.84 ? 37  LYS A O   1 
ATOM   260  C  CB  . LYS A 1 37  ? 1.646  38.478 21.449 1.00 37.31 ? 37  LYS A CB  1 
ATOM   261  C  CG  . LYS A 1 37  ? 0.807  38.423 22.724 1.00 40.51 ? 37  LYS A CG  1 
ATOM   262  C  CD  . LYS A 1 37  ? -0.352 39.419 22.642 1.00 44.73 ? 37  LYS A CD  1 
ATOM   263  C  CE  . LYS A 1 37  ? -1.320 39.235 23.801 0.01 43.82 ? 37  LYS A CE  1 
ATOM   264  N  NZ  . LYS A 1 37  ? -0.668 39.471 25.119 0.01 44.15 ? 37  LYS A NZ  1 
ATOM   265  N  N   . ARG A 1 38  ? 4.670  38.848 19.938 1.00 32.33 ? 38  ARG A N   1 
ATOM   266  C  CA  . ARG A 1 38  ? 5.448  38.581 18.748 1.00 30.52 ? 38  ARG A CA  1 
ATOM   267  C  C   . ARG A 1 38  ? 6.879  38.321 18.932 1.00 27.00 ? 38  ARG A C   1 
ATOM   268  O  O   . ARG A 1 38  ? 7.466  37.709 18.097 1.00 27.61 ? 38  ARG A O   1 
ATOM   269  C  CB  . ARG A 1 38  ? 5.294  39.712 17.764 1.00 32.78 ? 38  ARG A CB  1 
ATOM   270  C  CG  . ARG A 1 38  ? 3.883  39.815 17.278 1.00 33.59 ? 38  ARG A CG  1 
ATOM   271  C  CD  . ARG A 1 38  ? 3.821  40.708 16.076 1.00 35.02 ? 38  ARG A CD  1 
ATOM   272  N  NE  . ARG A 1 38  ? 4.089  42.092 16.395 1.00 28.56 ? 38  ARG A NE  1 
ATOM   273  C  CZ  . ARG A 1 38  ? 4.969  42.880 15.776 1.00 29.96 ? 38  ARG A CZ  1 
ATOM   274  N  NH1 . ARG A 1 38  ? 5.760  42.472 14.758 1.00 25.31 ? 38  ARG A NH1 1 
ATOM   275  N  NH2 . ARG A 1 38  ? 5.069  44.130 16.205 1.00 30.66 ? 38  ARG A NH2 1 
ATOM   276  N  N   . PHE A 1 39  ? 7.425  38.744 20.045 1.00 24.68 ? 39  PHE A N   1 
ATOM   277  C  CA  . PHE A 1 39  ? 8.855  38.604 20.394 1.00 23.45 ? 39  PHE A CA  1 
ATOM   278  C  C   . PHE A 1 39  ? 8.990  37.818 21.690 1.00 23.80 ? 39  PHE A C   1 
ATOM   279  O  O   . PHE A 1 39  ? 8.119  37.924 22.545 1.00 24.05 ? 39  PHE A O   1 
ATOM   280  C  CB  . PHE A 1 39  ? 9.455  40.008 20.504 1.00 20.31 ? 39  PHE A CB  1 
ATOM   281  C  CG  . PHE A 1 39  ? 9.395  40.667 19.172 1.00 20.53 ? 39  PHE A CG  1 
ATOM   282  C  CD1 . PHE A 1 39  ? 10.277 40.249 18.182 1.00 16.55 ? 39  PHE A CD1 1 
ATOM   283  C  CD2 . PHE A 1 39  ? 8.409  41.585 18.856 1.00 13.98 ? 39  PHE A CD2 1 
ATOM   284  C  CE1 . PHE A 1 39  ? 10.238 40.821 16.858 1.00 18.96 ? 39  PHE A CE1 1 
ATOM   285  C  CE2 . PHE A 1 39  ? 8.303  42.115 17.557 1.00 21.20 ? 39  PHE A CE2 1 
ATOM   286  C  CZ  . PHE A 1 39  ? 9.259  41.695 16.527 1.00 18.29 ? 39  PHE A CZ  1 
ATOM   287  N  N   . THR A 1 40  ? 10.063 37.081 21.878 1.00 22.12 ? 40  THR A N   1 
ATOM   288  C  CA  . THR A 1 40  ? 10.245 36.330 23.149 1.00 23.59 ? 40  THR A CA  1 
ATOM   289  C  C   . THR A 1 40  ? 11.307 36.881 24.043 1.00 21.00 ? 40  THR A C   1 
ATOM   290  O  O   . THR A 1 40  ? 11.413 36.434 25.178 1.00 22.48 ? 40  THR A O   1 
ATOM   291  C  CB  . THR A 1 40  ? 10.683 34.792 22.900 1.00 26.19 ? 40  THR A CB  1 
ATOM   292  O  OG1 . THR A 1 40  ? 11.896 34.749 22.106 1.00 28.95 ? 40  THR A OG1 1 
ATOM   293  C  CG2 . THR A 1 40  ? 9.713  34.064 22.058 1.00 23.19 ? 40  THR A CG2 1 
ATOM   294  N  N   . ALA A 1 41  ? 12.104 37.867 23.592 1.00 19.98 ? 41  ALA A N   1 
ATOM   295  C  CA  . ALA A 1 41  ? 13.221 38.340 24.396 1.00 16.93 ? 41  ALA A CA  1 
ATOM   296  C  C   . ALA A 1 41  ? 13.690 39.645 23.872 1.00 17.36 ? 41  ALA A C   1 
ATOM   297  O  O   . ALA A 1 41  ? 13.424 39.990 22.750 1.00 19.07 ? 41  ALA A O   1 
ATOM   298  C  CB  . ALA A 1 41  ? 14.412 37.319 24.394 1.00 19.87 ? 41  ALA A CB  1 
ATOM   299  N  N   . ILE A 1 42  ? 14.405 40.371 24.691 1.00 17.68 ? 42  ILE A N   1 
ATOM   300  C  CA  . ILE A 1 42  ? 15.087 41.602 24.309 1.00 19.95 ? 42  ILE A CA  1 
ATOM   301  C  C   . ILE A 1 42  ? 16.494 41.545 24.915 1.00 21.59 ? 42  ILE A C   1 
ATOM   302  O  O   . ILE A 1 42  ? 16.667 41.053 26.079 1.00 19.97 ? 42  ILE A O   1 
ATOM   303  C  CB  . ILE A 1 42  ? 14.291 42.832 24.824 1.00 20.03 ? 42  ILE A CB  1 
ATOM   304  C  CG1 . ILE A 1 42  ? 14.954 44.127 24.392 1.00 21.40 ? 42  ILE A CG1 1 
ATOM   305  C  CG2 . ILE A 1 42  ? 14.020 42.732 26.331 1.00 22.60 ? 42  ILE A CG2 1 
ATOM   306  C  CD1 . ILE A 1 42  ? 14.154 45.399 24.589 1.00 24.60 ? 42  ILE A CD1 1 
ATOM   307  N  N   . ARG A 1 43  ? 17.493 41.990 24.163 1.00 20.76 ? 43  ARG A N   1 
ATOM   308  C  CA  . ARG A 1 43  ? 18.766 42.426 24.750 1.00 21.87 ? 43  ARG A CA  1 
ATOM   309  C  C   . ARG A 1 43  ? 18.957 43.952 24.635 1.00 24.59 ? 43  ARG A C   1 
ATOM   310  O  O   . ARG A 1 43  ? 18.697 44.599 23.549 1.00 21.47 ? 43  ARG A O   1 
ATOM   311  C  CB  . ARG A 1 43  ? 19.963 41.945 23.991 1.00 21.73 ? 43  ARG A CB  1 
ATOM   312  C  CG  . ARG A 1 43  ? 20.323 40.593 24.098 1.00 20.29 ? 43  ARG A CG  1 
ATOM   313  C  CD  . ARG A 1 43  ? 21.637 40.277 23.430 1.00 15.83 ? 43  ARG A CD  1 
ATOM   314  N  NE  . ARG A 1 43  ? 21.549 38.875 23.051 1.00 15.39 ? 43  ARG A NE  1 
ATOM   315  C  CZ  . ARG A 1 43  ? 22.086 37.885 23.718 1.00 16.32 ? 43  ARG A CZ  1 
ATOM   316  N  NH1 . ARG A 1 43  ? 22.607 38.075 24.856 1.00 19.63 ? 43  ARG A NH1 1 
ATOM   317  N  NH2 . ARG A 1 43  ? 22.013 36.668 23.281 1.00 18.61 ? 43  ARG A NH2 1 
ATOM   318  N  N   . LYS A 1 44  ? 19.469 44.481 25.739 1.00 24.48 ? 44  LYS A N   1 
ATOM   319  C  CA  . LYS A 1 44  ? 19.756 45.884 25.955 1.00 27.50 ? 44  LYS A CA  1 
ATOM   320  C  C   . LYS A 1 44  ? 21.169 46.169 25.510 1.00 29.50 ? 44  LYS A C   1 
ATOM   321  O  O   . LYS A 1 44  ? 22.042 45.327 25.673 1.00 30.61 ? 44  LYS A O   1 
ATOM   322  C  CB  . LYS A 1 44  ? 19.561 46.269 27.416 1.00 28.27 ? 44  LYS A CB  1 
ATOM   323  C  CG  . LYS A 1 44  ? 18.040 46.227 27.704 1.00 32.78 ? 44  LYS A CG  1 
ATOM   324  C  CD  . LYS A 1 44  ? 17.594 45.170 28.692 1.00 38.61 ? 44  LYS A CD  1 
ATOM   325  C  CE  . LYS A 1 44  ? 16.576 45.719 29.683 0.01 37.54 ? 44  LYS A CE  1 
ATOM   326  N  NZ  . LYS A 1 44  ? 17.191 46.665 30.656 0.01 37.82 ? 44  LYS A NZ  1 
ATOM   327  N  N   . THR A 1 45  ? 21.333 47.315 24.864 1.00 28.72 ? 45  THR A N   1 
ATOM   328  C  CA  . THR A 1 45  ? 22.606 47.810 24.398 1.00 31.18 ? 45  THR A CA  1 
ATOM   329  C  C   . THR A 1 45  ? 22.910 49.059 25.202 1.00 29.48 ? 45  THR A C   1 
ATOM   330  O  O   . THR A 1 45  ? 22.012 49.732 25.563 1.00 30.62 ? 45  THR A O   1 
ATOM   331  C  CB  . THR A 1 45  ? 22.486 48.105 22.909 1.00 32.29 ? 45  THR A CB  1 
ATOM   332  O  OG1 . THR A 1 45  ? 21.454 49.091 22.714 1.00 33.63 ? 45  THR A OG1 1 
ATOM   333  C  CG2 . THR A 1 45  ? 21.935 46.796 22.263 1.00 33.35 ? 45  THR A CG2 1 
ATOM   334  N  N   . LYS A 1 46  ? 24.139 49.349 25.542 1.00 29.50 ? 46  LYS A N   1 
ATOM   335  C  CA  . LYS A 1 46  ? 24.428 50.623 26.157 1.00 31.09 ? 46  LYS A CA  1 
ATOM   336  C  C   . LYS A 1 46  ? 24.029 51.778 25.288 1.00 31.25 ? 46  LYS A C   1 
ATOM   337  O  O   . LYS A 1 46  ? 24.227 51.754 24.077 1.00 28.80 ? 46  LYS A O   1 
ATOM   338  C  CB  . LYS A 1 46  ? 25.927 50.830 26.370 1.00 32.96 ? 46  LYS A CB  1 
ATOM   339  C  CG  . LYS A 1 46  ? 26.202 52.037 27.244 1.00 34.11 ? 46  LYS A CG  1 
ATOM   340  C  CD  . LYS A 1 46  ? 27.600 51.893 27.794 1.00 43.13 ? 46  LYS A CD  1 
ATOM   341  C  CE  . LYS A 1 46  ? 28.282 53.235 28.093 1.00 47.51 ? 46  LYS A CE  1 
ATOM   342  N  NZ  . LYS A 1 46  ? 28.887 53.911 26.892 1.00 46.72 ? 46  LYS A NZ  1 
ATOM   343  N  N   . GLY A 1 47  ? 23.519 52.797 25.962 1.00 32.67 ? 47  GLY A N   1 
ATOM   344  C  CA  . GLY A 1 47  ? 23.087 54.062 25.384 1.00 34.06 ? 47  GLY A CA  1 
ATOM   345  C  C   . GLY A 1 47  ? 24.205 55.097 25.304 1.00 34.95 ? 47  GLY A C   1 
ATOM   346  O  O   . GLY A 1 47  ? 24.191 56.083 26.038 1.00 35.48 ? 47  GLY A O   1 
ATOM   347  N  N   . ASP A 1 48  ? 25.133 54.931 24.335 1.00 32.17 ? 48  ASP A N   1 
ATOM   348  C  CA  . ASP A 1 48  ? 26.315 55.788 24.230 1.00 28.74 ? 48  ASP A CA  1 
ATOM   349  C  C   . ASP A 1 48  ? 26.448 56.468 22.807 1.00 27.52 ? 48  ASP A C   1 
ATOM   350  O  O   . ASP A 1 48  ? 27.547 56.834 22.373 1.00 28.87 ? 48  ASP A O   1 
ATOM   351  C  CB  . ASP A 1 48  ? 27.457 54.857 24.510 1.00 27.13 ? 48  ASP A CB  1 
ATOM   352  C  CG  . ASP A 1 48  ? 27.610 53.762 23.401 1.00 29.05 ? 48  ASP A CG  1 
ATOM   353  O  OD1 . ASP A 1 48  ? 26.705 53.559 22.512 1.00 20.01 ? 48  ASP A OD1 1 
ATOM   354  O  OD2 . ASP A 1 48  ? 28.674 53.121 23.304 1.00 30.80 ? 48  ASP A OD2 1 
ATOM   355  N  N   . ARG A 1 49  ? 25.381 56.562 22.063 1.00 25.64 ? 49  ARG A N   1 
ATOM   356  C  CA  . ARG A 1 49  ? 25.391 57.180 20.727 1.00 26.53 ? 49  ARG A CA  1 
ATOM   357  C  C   . ARG A 1 49  ? 26.000 56.281 19.644 1.00 25.50 ? 49  ARG A C   1 
ATOM   358  O  O   . ARG A 1 49  ? 26.091 56.750 18.504 1.00 30.73 ? 49  ARG A O   1 
ATOM   359  C  CB  . ARG A 1 49  ? 26.166 58.499 20.753 0.00 20.00 ? 49  ARG A CB  1 
ATOM   360  C  CG  . ARG A 1 49  ? 25.593 59.537 21.705 0.00 20.00 ? 49  ARG A CG  1 
ATOM   361  C  CD  . ARG A 1 49  ? 26.252 60.892 21.505 0.00 20.00 ? 49  ARG A CD  1 
ATOM   362  N  NE  . ARG A 1 49  ? 25.713 61.901 22.413 0.00 20.00 ? 49  ARG A NE  1 
ATOM   363  C  CZ  . ARG A 1 49  ? 26.114 63.167 22.445 0.00 20.00 ? 49  ARG A CZ  1 
ATOM   364  N  NH1 . ARG A 1 49  ? 27.063 63.583 21.617 0.00 20.00 ? 49  ARG A NH1 1 
ATOM   365  N  NH2 . ARG A 1 49  ? 25.566 64.014 23.306 0.00 20.00 ? 49  ARG A NH2 1 
ATOM   366  N  N   . ASN A 1 50  ? 26.371 55.035 19.961 1.00 23.92 ? 50  ASN A N   1 
ATOM   367  C  CA  . ASN A 1 50  ? 26.875 53.996 19.062 1.00 21.43 ? 50  ASN A CA  1 
ATOM   368  C  C   . ASN A 1 50  ? 25.995 52.716 18.957 1.00 22.75 ? 50  ASN A C   1 
ATOM   369  O  O   . ASN A 1 50  ? 26.341 51.726 18.279 1.00 19.62 ? 50  ASN A O   1 
ATOM   370  C  CB  . ASN A 1 50  ? 28.242 53.562 19.545 1.00 23.02 ? 50  ASN A CB  1 
ATOM   371  C  CG  . ASN A 1 50  ? 29.274 54.645 19.563 1.00 23.61 ? 50  ASN A CG  1 
ATOM   372  O  OD1 . ASN A 1 50  ? 29.516 55.348 18.554 1.00 23.91 ? 50  ASN A OD1 1 
ATOM   373  N  ND2 . ASN A 1 50  ? 29.948 54.778 20.716 1.00 21.86 ? 50  ASN A ND2 1 
ATOM   374  N  N   . CYS A 1 51  ? 24.791 52.729 19.574 1.00 21.95 ? 51  CYS A N   1 
ATOM   375  C  CA  . CYS A 1 51  ? 24.096 51.497 19.835 1.00 22.58 ? 51  CYS A CA  1 
ATOM   376  C  C   . CYS A 1 51  ? 23.451 51.011 18.580 1.00 20.81 ? 51  CYS A C   1 
ATOM   377  O  O   . CYS A 1 51  ? 23.313 49.821 18.479 1.00 21.60 ? 51  CYS A O   1 
ATOM   378  C  CB  . CYS A 1 51  ? 22.976 51.674 20.917 1.00 25.46 ? 51  CYS A CB  1 
ATOM   379  S  SG  . CYS A 1 51  ? 21.820 53.035 20.523 1.00 33.23 ? 51  CYS A SG  1 
ATOM   380  N  N   . PHE A 1 52  ? 23.074 51.869 17.605 1.00 19.23 ? 52  PHE A N   1 
ATOM   381  C  CA  . PHE A 1 52  ? 22.644 51.314 16.337 1.00 16.20 ? 52  PHE A CA  1 
ATOM   382  C  C   . PHE A 1 52  ? 23.748 50.439 15.701 1.00 16.97 ? 52  PHE A C   1 
ATOM   383  O  O   . PHE A 1 52  ? 23.491 49.305 15.304 1.00 17.55 ? 52  PHE A O   1 
ATOM   384  C  CB  . PHE A 1 52  ? 22.219 52.380 15.322 1.00 19.73 ? 52  PHE A CB  1 
ATOM   385  C  CG  . PHE A 1 52  ? 21.952 51.770 14.006 1.00 14.42 ? 52  PHE A CG  1 
ATOM   386  C  CD1 . PHE A 1 52  ? 20.862 50.990 13.865 1.00 22.22 ? 52  PHE A CD1 1 
ATOM   387  C  CD2 . PHE A 1 52  ? 22.851 51.844 13.011 1.00 16.40 ? 52  PHE A CD2 1 
ATOM   388  C  CE1 . PHE A 1 52  ? 20.627 50.300 12.675 1.00 24.96 ? 52  PHE A CE1 1 
ATOM   389  C  CE2 . PHE A 1 52  ? 22.617 51.204 11.829 1.00 24.75 ? 52  PHE A CE2 1 
ATOM   390  C  CZ  . PHE A 1 52  ? 21.467 50.408 11.677 1.00 22.03 ? 52  PHE A CZ  1 
ATOM   391  N  N   . TYR A 1 53  ? 24.972 50.943 15.611 1.00 16.11 ? 53  TYR A N   1 
ATOM   392  C  CA  . TYR A 1 53  ? 26.015 50.165 14.991 1.00 16.06 ? 53  TYR A CA  1 
ATOM   393  C  C   . TYR A 1 53  ? 26.341 48.884 15.789 1.00 16.05 ? 53  TYR A C   1 
ATOM   394  O  O   . TYR A 1 53  ? 26.583 47.831 15.247 1.00 15.81 ? 53  TYR A O   1 
ATOM   395  C  CB  . TYR A 1 53  ? 27.257 51.005 14.781 1.00 16.87 ? 53  TYR A CB  1 
ATOM   396  C  CG  . TYR A 1 53  ? 27.052 52.195 13.901 1.00 16.67 ? 53  TYR A CG  1 
ATOM   397  C  CD1 . TYR A 1 53  ? 27.123 52.102 12.515 1.00 17.95 ? 53  TYR A CD1 1 
ATOM   398  C  CD2 . TYR A 1 53  ? 26.719 53.414 14.446 1.00 16.91 ? 53  TYR A CD2 1 
ATOM   399  C  CE1 . TYR A 1 53  ? 26.943 53.236 11.711 1.00 15.97 ? 53  TYR A CE1 1 
ATOM   400  C  CE2 . TYR A 1 53  ? 26.477 54.516 13.656 1.00 16.91 ? 53  TYR A CE2 1 
ATOM   401  C  CZ  . TYR A 1 53  ? 26.617 54.444 12.286 1.00 13.80 ? 53  TYR A CZ  1 
ATOM   402  O  OH  . TYR A 1 53  ? 26.293 55.626 11.544 1.00 20.50 ? 53  TYR A OH  1 
ATOM   403  N  N   . ARG A 1 54  ? 26.358 49.017 17.115 1.00 16.33 ? 54  ARG A N   1 
ATOM   404  C  CA  . ARG A 1 54  ? 26.727 47.899 17.990 1.00 17.65 ? 54  ARG A CA  1 
ATOM   405  C  C   . ARG A 1 54  ? 25.680 46.809 18.023 1.00 18.22 ? 54  ARG A C   1 
ATOM   406  O  O   . ARG A 1 54  ? 25.997 45.623 17.889 1.00 22.09 ? 54  ARG A O   1 
ATOM   407  C  CB  . ARG A 1 54  ? 26.990 48.414 19.373 1.00 17.33 ? 54  ARG A CB  1 
ATOM   408  C  CG  . ARG A 1 54  ? 27.977 47.577 20.218 1.00 18.57 ? 54  ARG A CG  1 
ATOM   409  C  CD  . ARG A 1 54  ? 28.057 48.265 21.656 1.00 22.06 ? 54  ARG A CD  1 
ATOM   410  N  NE  . ARG A 1 54  ? 29.408 48.672 21.532 1.00 35.95 ? 54  ARG A NE  1 
ATOM   411  C  CZ  . ARG A 1 54  ? 30.030 49.783 21.585 1.00 25.10 ? 54  ARG A CZ  1 
ATOM   412  N  NH1 . ARG A 1 54  ? 29.631 50.962 21.942 1.00 31.45 ? 54  ARG A NH1 1 
ATOM   413  N  NH2 . ARG A 1 54  ? 31.261 49.547 21.342 1.00 33.73 ? 54  ARG A NH2 1 
ATOM   414  N  N   . ALA A 1 55  ? 24.442 47.235 18.059 1.00 17.17 ? 55  ALA A N   1 
ATOM   415  C  CA  . ALA A 1 55  ? 23.283 46.350 17.993 1.00 18.73 ? 55  ALA A CA  1 
ATOM   416  C  C   . ALA A 1 55  ? 23.166 45.665 16.695 1.00 19.01 ? 55  ALA A C   1 
ATOM   417  O  O   . ALA A 1 55  ? 22.958 44.451 16.693 1.00 21.50 ? 55  ALA A O   1 
ATOM   418  C  CB  . ALA A 1 55  ? 21.887 47.135 18.349 1.00 16.88 ? 55  ALA A CB  1 
ATOM   419  N  N   . LEU A 1 56  ? 23.264 46.390 15.598 1.00 18.46 ? 56  LEU A N   1 
ATOM   420  C  CA  . LEU A 1 56  ? 23.046 45.736 14.310 1.00 17.94 ? 56  LEU A CA  1 
ATOM   421  C  C   . LEU A 1 56  ? 24.190 44.764 14.083 1.00 19.02 ? 56  LEU A C   1 
ATOM   422  O  O   . LEU A 1 56  ? 24.017 43.672 13.574 1.00 18.08 ? 56  LEU A O   1 
ATOM   423  C  CB  . LEU A 1 56  ? 23.085 46.727 13.148 1.00 18.77 ? 56  LEU A CB  1 
ATOM   424  C  CG  . LEU A 1 56  ? 22.833 46.203 11.688 1.00 22.00 ? 56  LEU A CG  1 
ATOM   425  C  CD1 . LEU A 1 56  ? 21.424 45.857 11.669 1.00 22.29 ? 56  LEU A CD1 1 
ATOM   426  C  CD2 . LEU A 1 56  ? 22.866 47.199 10.587 1.00 23.00 ? 56  LEU A CD2 1 
ATOM   427  N  N   . GLY A 1 57  ? 25.411 45.196 14.401 1.00 18.05 ? 57  GLY A N   1 
ATOM   428  C  CA  . GLY A 1 57  ? 26.543 44.327 14.087 1.00 18.19 ? 57  GLY A CA  1 
ATOM   429  C  C   . GLY A 1 57  ? 26.470 43.077 14.996 1.00 17.46 ? 57  GLY A C   1 
ATOM   430  O  O   . GLY A 1 57  ? 26.650 42.015 14.518 1.00 16.50 ? 57  GLY A O   1 
ATOM   431  N  N   . TYR A 1 58  ? 26.162 43.197 16.277 1.00 15.51 ? 58  TYR A N   1 
ATOM   432  C  CA  . TYR A 1 58  ? 26.076 41.989 17.091 1.00 15.43 ? 58  TYR A CA  1 
ATOM   433  C  C   . TYR A 1 58  ? 24.991 41.090 16.637 1.00 16.64 ? 58  TYR A C   1 
ATOM   434  O  O   . TYR A 1 58  ? 25.176 39.891 16.537 1.00 16.48 ? 58  TYR A O   1 
ATOM   435  C  CB  . TYR A 1 58  ? 25.804 42.301 18.558 1.00 16.42 ? 58  TYR A CB  1 
ATOM   436  C  CG  . TYR A 1 58  ? 25.545 41.040 19.324 1.00 17.49 ? 58  TYR A CG  1 
ATOM   437  C  CD1 . TYR A 1 58  ? 26.617 40.194 19.686 1.00 19.60 ? 58  TYR A CD1 1 
ATOM   438  C  CD2 . TYR A 1 58  ? 24.259 40.666 19.700 1.00 16.13 ? 58  TYR A CD2 1 
ATOM   439  C  CE1 . TYR A 1 58  ? 26.394 39.008 20.359 1.00 19.15 ? 58  TYR A CE1 1 
ATOM   440  C  CE2 . TYR A 1 58  ? 24.027 39.444 20.350 1.00 18.29 ? 58  TYR A CE2 1 
ATOM   441  C  CZ  . TYR A 1 58  ? 25.107 38.621 20.698 1.00 19.97 ? 58  TYR A CZ  1 
ATOM   442  O  OH  . TYR A 1 58  ? 24.914 37.382 21.351 1.00 20.34 ? 58  TYR A OH  1 
ATOM   443  N  N   . SER A 1 59  ? 23.821 41.661 16.394 1.00 15.39 ? 59  SER A N   1 
ATOM   444  C  CA  . SER A 1 59  ? 22.633 40.864 16.170 1.00 19.02 ? 59  SER A CA  1 
ATOM   445  C  C   . SER A 1 59  ? 22.706 40.170 14.875 1.00 16.50 ? 59  SER A C   1 
ATOM   446  O  O   . SER A 1 59  ? 22.287 38.975 14.749 1.00 16.35 ? 59  SER A O   1 
ATOM   447  C  CB  . SER A 1 59  ? 21.346 41.719 16.262 1.00 21.07 ? 59  SER A CB  1 
ATOM   448  O  OG  . SER A 1 59  ? 20.296 40.856 15.893 1.00 28.21 ? 59  SER A OG  1 
ATOM   449  N  N   . TYR A 1 60  ? 23.323 40.846 13.892 1.00 16.15 ? 60  TYR A N   1 
ATOM   450  C  CA  . TYR A 1 60  ? 23.461 40.187 12.591 1.00 13.56 ? 60  TYR A CA  1 
ATOM   451  C  C   . TYR A 1 60  ? 24.469 39.045 12.641 1.00 12.65 ? 60  TYR A C   1 
ATOM   452  O  O   . TYR A 1 60  ? 24.254 37.957 12.062 1.00 13.33 ? 60  TYR A O   1 
ATOM   453  C  CB  . TYR A 1 60  ? 23.871 41.146 11.488 1.00 14.78 ? 60  TYR A CB  1 
ATOM   454  C  CG  . TYR A 1 60  ? 24.026 40.410 10.137 1.00 18.11 ? 60  TYR A CG  1 
ATOM   455  C  CD1 . TYR A 1 60  ? 22.940 39.853 9.499  1.00 15.18 ? 60  TYR A CD1 1 
ATOM   456  C  CD2 . TYR A 1 60  ? 25.257 40.337 9.517  1.00 25.20 ? 60  TYR A CD2 1 
ATOM   457  C  CE1 . TYR A 1 60  ? 23.068 39.166 8.260  1.00 25.04 ? 60  TYR A CE1 1 
ATOM   458  C  CE2 . TYR A 1 60  ? 25.395 39.675 8.288  1.00 20.34 ? 60  TYR A CE2 1 
ATOM   459  C  CZ  . TYR A 1 60  ? 24.317 39.121 7.679  1.00 26.35 ? 60  TYR A CZ  1 
ATOM   460  O  OH  . TYR A 1 60  ? 24.605 38.461 6.499  1.00 30.68 ? 60  TYR A OH  1 
ATOM   461  N  N   . LEU A 1 61  ? 25.621 39.270 13.235 1.00 16.75 ? 61  LEU A N   1 
ATOM   462  C  CA  . LEU A 1 61  ? 26.649 38.192 13.357 1.00 17.28 ? 61  LEU A CA  1 
ATOM   463  C  C   . LEU A 1 61  ? 26.075 37.010 14.194 1.00 18.31 ? 61  LEU A C   1 
ATOM   464  O  O   . LEU A 1 61  ? 26.239 35.885 13.841 1.00 18.53 ? 61  LEU A O   1 
ATOM   465  C  CB  . LEU A 1 61  ? 27.910 38.713 14.045 1.00 18.03 ? 61  LEU A CB  1 
ATOM   466  C  CG  . LEU A 1 61  ? 28.724 39.648 13.123 1.00 19.40 ? 61  LEU A CG  1 
ATOM   467  C  CD1 . LEU A 1 61  ? 29.839 40.255 13.863 1.00 19.18 ? 61  LEU A CD1 1 
ATOM   468  C  CD2 . LEU A 1 61  ? 29.257 39.032 11.907 1.00 23.13 ? 61  LEU A CD2 1 
ATOM   469  N  N   . GLU A 1 62  ? 25.324 37.288 15.254 1.00 16.63 ? 62  GLU A N   1 
ATOM   470  C  CA  . GLU A 1 62  ? 24.619 36.253 15.993 1.00 18.66 ? 62  GLU A CA  1 
ATOM   471  C  C   . GLU A 1 62  ? 23.685 35.425 15.135 1.00 20.48 ? 62  GLU A C   1 
ATOM   472  O  O   . GLU A 1 62  ? 23.695 34.179 15.198 1.00 20.77 ? 62  GLU A O   1 
ATOM   473  C  CB  . GLU A 1 62  ? 23.898 36.874 17.184 1.00 17.00 ? 62  GLU A CB  1 
ATOM   474  C  CG  . GLU A 1 62  ? 23.261 35.938 18.143 1.00 19.24 ? 62  GLU A CG  1 
ATOM   475  C  CD  . GLU A 1 62  ? 22.459 36.705 19.133 1.00 23.88 ? 62  GLU A CD  1 
ATOM   476  O  OE1 . GLU A 1 62  ? 21.648 37.600 18.705 1.00 26.54 ? 62  GLU A OE1 1 
ATOM   477  O  OE2 . GLU A 1 62  ? 22.667 36.446 20.356 1.00 24.37 ? 62  GLU A OE2 1 
ATOM   478  N  N   . SER A 1 63  ? 22.974 36.053 14.228 1.00 20.62 ? 63  SER A N   1 
ATOM   479  C  CA  . SER A 1 63  ? 22.092 35.331 13.375 1.00 19.96 ? 63  SER A CA  1 
ATOM   480  C  C   . SER A 1 63  ? 22.790 34.424 12.438 1.00 23.35 ? 63  SER A C   1 
ATOM   481  O  O   . SER A 1 63  ? 22.105 33.511 11.943 1.00 20.30 ? 63  SER A O   1 
ATOM   482  C  CB  . SER A 1 63  ? 21.181 36.309 12.538 1.00 19.69 ? 63  SER A CB  1 
ATOM   483  O  OG  . SER A 1 63  ? 21.858 36.933 11.463 1.00 19.94 ? 63  SER A OG  1 
ATOM   484  N  N   . LEU A 1 64  ? 24.104 34.661 12.151 1.00 22.95 ? 64  LEU A N   1 
ATOM   485  C  CA  . LEU A 1 64  ? 24.795 33.815 11.184 1.00 23.62 ? 64  LEU A CA  1 
ATOM   486  C  C   . LEU A 1 64  ? 25.324 32.522 11.844 1.00 24.79 ? 64  LEU A C   1 
ATOM   487  O  O   . LEU A 1 64  ? 25.722 31.596 11.098 1.00 25.51 ? 64  LEU A O   1 
ATOM   488  C  CB  . LEU A 1 64  ? 26.038 34.468 10.527 1.00 21.46 ? 64  LEU A CB  1 
ATOM   489  C  CG  . LEU A 1 64  ? 25.665 35.687 9.675  1.00 23.09 ? 64  LEU A CG  1 
ATOM   490  C  CD1 . LEU A 1 64  ? 26.873 36.356 9.212  1.00 22.81 ? 64  LEU A CD1 1 
ATOM   491  C  CD2 . LEU A 1 64  ? 24.826 35.310 8.544  1.00 23.20 ? 64  LEU A CD2 1 
ATOM   492  N  N   . LEU A 1 65  ? 25.361 32.473 13.159 1.00 23.37 ? 65  LEU A N   1 
ATOM   493  C  CA  . LEU A 1 65  ? 26.043 31.342 13.828 1.00 28.41 ? 65  LEU A CA  1 
ATOM   494  C  C   . LEU A 1 65  ? 25.497 30.018 13.335 1.00 29.20 ? 65  LEU A C   1 
ATOM   495  O  O   . LEU A 1 65  ? 24.312 29.876 13.241 1.00 29.02 ? 65  LEU A O   1 
ATOM   496  C  CB  . LEU A 1 65  ? 25.894 31.409 15.349 1.00 27.34 ? 65  LEU A CB  1 
ATOM   497  C  CG  . LEU A 1 65  ? 26.502 32.624 16.017 1.00 28.58 ? 65  LEU A CG  1 
ATOM   498  C  CD1 . LEU A 1 65  ? 26.204 32.602 17.482 1.00 29.71 ? 65  LEU A CD1 1 
ATOM   499  C  CD2 . LEU A 1 65  ? 27.952 32.663 15.847 1.00 26.01 ? 65  LEU A CD2 1 
ATOM   500  N  N   . GLY A 1 66  ? 26.358 29.088 12.953 1.00 33.00 ? 66  GLY A N   1 
ATOM   501  C  CA  . GLY A 1 66  ? 25.948 27.787 12.415 1.00 32.71 ? 66  GLY A CA  1 
ATOM   502  C  C   . GLY A 1 66  ? 25.410 27.759 10.991 1.00 34.02 ? 66  GLY A C   1 
ATOM   503  O  O   . GLY A 1 66  ? 25.054 26.712 10.483 1.00 35.59 ? 66  GLY A O   1 
ATOM   504  N  N   . LYS A 1 67  ? 25.362 28.865 10.273 1.00 33.07 ? 67  LYS A N   1 
ATOM   505  C  CA  . LYS A 1 67  ? 24.820 28.836 8.940  1.00 31.92 ? 67  LYS A CA  1 
ATOM   506  C  C   . LYS A 1 67  ? 26.017 29.005 7.986  1.00 32.76 ? 67  LYS A C   1 
ATOM   507  O  O   . LYS A 1 67  ? 26.462 30.136 7.613  1.00 30.20 ? 67  LYS A O   1 
ATOM   508  C  CB  . LYS A 1 67  ? 23.782 29.974 8.802  1.00 33.15 ? 67  LYS A CB  1 
ATOM   509  C  CG  . LYS A 1 67  ? 22.584 29.828 9.764  1.00 34.03 ? 67  LYS A CG  1 
ATOM   510  C  CD  . LYS A 1 67  ? 21.616 30.985 9.600  1.00 41.10 ? 67  LYS A CD  1 
ATOM   511  C  CE  . LYS A 1 67  ? 20.525 31.045 10.727 1.00 43.93 ? 67  LYS A CE  1 
ATOM   512  N  NZ  . LYS A 1 67  ? 19.886 32.403 10.990 1.00 39.71 ? 67  LYS A NZ  1 
ATOM   513  N  N   . SER A 1 68  ? 26.554 27.868 7.595  1.00 32.02 ? 68  SER A N   1 
ATOM   514  C  CA  . SER A 1 68  ? 27.780 27.774 6.757  1.00 33.32 ? 68  SER A CA  1 
ATOM   515  C  C   . SER A 1 68  ? 27.783 28.587 5.484  1.00 33.06 ? 68  SER A C   1 
ATOM   516  O  O   . SER A 1 68  ? 28.655 29.376 5.240  1.00 33.77 ? 68  SER A O   1 
ATOM   517  C  CB  . SER A 1 68  ? 27.998 26.279 6.372  1.00 33.81 ? 68  SER A CB  1 
ATOM   518  O  OG  . SER A 1 68  ? 28.905 25.818 7.347  1.00 34.55 ? 68  SER A OG  1 
ATOM   519  N  N   . ARG A 1 69  ? 26.788 28.363 4.670  1.00 32.89 ? 69  ARG A N   1 
ATOM   520  C  CA  . ARG A 1 69  ? 26.641 29.097 3.422  1.00 35.27 ? 69  ARG A CA  1 
ATOM   521  C  C   . ARG A 1 69  ? 26.311 30.596 3.521  1.00 32.35 ? 69  ARG A C   1 
ATOM   522  O  O   . ARG A 1 69  ? 26.738 31.307 2.655  1.00 31.35 ? 69  ARG A O   1 
ATOM   523  C  CB  . ARG A 1 69  ? 25.549 28.460 2.507  1.00 36.28 ? 69  ARG A CB  1 
ATOM   524  C  CG  . ARG A 1 69  ? 25.942 27.119 1.905  0.01 37.20 ? 69  ARG A CG  1 
ATOM   525  C  CD  . ARG A 1 69  ? 25.208 26.788 0.613  0.01 39.26 ? 69  ARG A CD  1 
ATOM   526  N  NE  . ARG A 1 69  ? 24.976 25.353 0.453  0.01 40.93 ? 69  ARG A NE  1 
ATOM   527  C  CZ  . ARG A 1 69  ? 24.182 24.811 -0.468 0.01 42.62 ? 69  ARG A CZ  1 
ATOM   528  N  NH1 . ARG A 1 69  ? 23.523 25.573 -1.337 0.01 43.19 ? 69  ARG A NH1 1 
ATOM   529  N  NH2 . ARG A 1 69  ? 24.043 23.492 -0.522 0.01 43.20 ? 69  ARG A NH2 1 
ATOM   530  N  N   . GLU A 1 70  ? 25.582 31.030 4.550  1.00 30.27 ? 70  GLU A N   1 
ATOM   531  C  CA  . GLU A 1 70  ? 25.332 32.422 4.821  1.00 28.46 ? 70  GLU A CA  1 
ATOM   532  C  C   . GLU A 1 70  ? 26.615 33.032 5.317  1.00 26.36 ? 70  GLU A C   1 
ATOM   533  O  O   . GLU A 1 70  ? 26.911 34.161 4.957  1.00 25.88 ? 70  GLU A O   1 
ATOM   534  C  CB  . GLU A 1 70  ? 24.213 32.615 5.868  1.00 28.40 ? 70  GLU A CB  1 
ATOM   535  C  CG  . GLU A 1 70  ? 22.822 32.628 5.186  1.00 35.79 ? 70  GLU A CG  1 
ATOM   536  C  CD  . GLU A 1 70  ? 21.739 31.950 6.006  0.01 33.74 ? 70  GLU A CD  1 
ATOM   537  O  OE1 . GLU A 1 70  ? 21.761 30.708 6.112  0.01 34.18 ? 70  GLU A OE1 1 
ATOM   538  O  OE2 . GLU A 1 70  ? 20.860 32.658 6.538  0.01 34.13 ? 70  GLU A OE2 1 
ATOM   539  N  N   . ILE A 1 71  ? 27.341 32.317 6.173  1.00 25.03 ? 71  ILE A N   1 
ATOM   540  C  CA  . ILE A 1 71  ? 28.633 32.779 6.661  1.00 24.59 ? 71  ILE A CA  1 
ATOM   541  C  C   . ILE A 1 71  ? 29.656 32.919 5.589  1.00 25.17 ? 71  ILE A C   1 
ATOM   542  O  O   . ILE A 1 71  ? 30.363 33.928 5.545  1.00 23.91 ? 71  ILE A O   1 
ATOM   543  C  CB  . ILE A 1 71  ? 29.226 31.870 7.659  1.00 25.10 ? 71  ILE A CB  1 
ATOM   544  C  CG1 . ILE A 1 71  ? 28.425 31.946 8.943  1.00 26.47 ? 71  ILE A CG1 1 
ATOM   545  C  CG2 . ILE A 1 71  ? 30.748 32.143 7.845  1.00 25.36 ? 71  ILE A CG2 1 
ATOM   546  C  CD1 . ILE A 1 71  ? 28.662 30.600 9.853  1.00 27.94 ? 71  ILE A CD1 1 
ATOM   547  N  N   . PHE A 1 72  ? 29.717 31.918 4.732  1.00 26.30 ? 72  PHE A N   1 
ATOM   548  C  CA  . PHE A 1 72  ? 30.474 31.985 3.486  1.00 28.25 ? 72  PHE A CA  1 
ATOM   549  C  C   . PHE A 1 72  ? 30.194 33.262 2.665  1.00 27.14 ? 72  PHE A C   1 
ATOM   550  O  O   . PHE A 1 72  ? 31.142 33.972 2.353  1.00 24.77 ? 72  PHE A O   1 
ATOM   551  C  CB  . PHE A 1 72  ? 30.236 30.774 2.576  1.00 29.31 ? 72  PHE A CB  1 
ATOM   552  C  CG  . PHE A 1 72  ? 31.078 30.792 1.333  1.00 36.91 ? 72  PHE A CG  1 
ATOM   553  C  CD1 . PHE A 1 72  ? 32.412 30.418 1.395  1.00 43.56 ? 72  PHE A CD1 1 
ATOM   554  C  CD2 . PHE A 1 72  ? 30.544 31.213 0.120  1.00 43.10 ? 72  PHE A CD2 1 
ATOM   555  C  CE1 . PHE A 1 72  ? 33.240 30.421 0.223  1.00 47.99 ? 72  PHE A CE1 1 
ATOM   556  C  CE2 . PHE A 1 72  ? 31.347 31.238 -1.056 1.00 50.89 ? 72  PHE A CE2 1 
ATOM   557  C  CZ  . PHE A 1 72  ? 32.714 30.838 -0.997 1.00 50.70 ? 72  PHE A CZ  1 
ATOM   558  N  N   . LYS A 1 73  ? 28.931 33.575 2.383  1.00 25.86 ? 73  LYS A N   1 
ATOM   559  C  CA  . LYS A 1 73  ? 28.646 34.655 1.507  1.00 26.78 ? 73  LYS A CA  1 
ATOM   560  C  C   . LYS A 1 73  ? 28.955 35.948 2.241  1.00 25.58 ? 73  LYS A C   1 
ATOM   561  O  O   . LYS A 1 73  ? 29.369 36.871 1.581  1.00 27.65 ? 73  LYS A O   1 
ATOM   562  C  CB  . LYS A 1 73  ? 27.189 34.714 1.059  1.00 28.59 ? 73  LYS A CB  1 
ATOM   563  C  CG  . LYS A 1 73  ? 26.876 35.670 -0.075 0.01 27.73 ? 73  LYS A CG  1 
ATOM   564  C  CD  . LYS A 1 73  ? 25.452 35.467 -0.589 0.01 28.12 ? 73  LYS A CD  1 
ATOM   565  C  CE  . LYS A 1 73  ? 24.683 36.776 -0.705 0.01 28.21 ? 73  LYS A CE  1 
ATOM   566  N  NZ  . LYS A 1 73  ? 23.210 36.547 -0.732 0.01 28.25 ? 73  LYS A NZ  1 
ATOM   567  N  N   . PHE A 1 74  ? 28.750 36.021 3.574  1.00 23.80 ? 74  PHE A N   1 
ATOM   568  C  CA  . PHE A 1 74  ? 28.993 37.275 4.310  1.00 22.22 ? 74  PHE A CA  1 
ATOM   569  C  C   . PHE A 1 74  ? 30.533 37.538 4.333  1.00 23.77 ? 74  PHE A C   1 
ATOM   570  O  O   . PHE A 1 74  ? 31.051 38.701 4.320  1.00 23.41 ? 74  PHE A O   1 
ATOM   571  C  CB  . PHE A 1 74  ? 28.483 37.239 5.732  1.00 20.35 ? 74  PHE A CB  1 
ATOM   572  C  CG  . PHE A 1 74  ? 28.647 38.541 6.476  1.00 16.47 ? 74  PHE A CG  1 
ATOM   573  C  CD1 . PHE A 1 74  ? 28.087 39.715 5.982  1.00 20.66 ? 74  PHE A CD1 1 
ATOM   574  C  CD2 . PHE A 1 74  ? 29.306 38.629 7.629  1.00 20.99 ? 74  PHE A CD2 1 
ATOM   575  C  CE1 . PHE A 1 74  ? 28.183 40.940 6.681  1.00 23.65 ? 74  PHE A CE1 1 
ATOM   576  C  CE2 . PHE A 1 74  ? 29.422 39.873 8.339  1.00 18.73 ? 74  PHE A CE2 1 
ATOM   577  C  CZ  . PHE A 1 74  ? 28.874 41.021 7.812  1.00 21.34 ? 74  PHE A CZ  1 
ATOM   578  N  N   . LYS A 1 75  ? 31.277 36.457 4.504  1.00 23.08 ? 75  LYS A N   1 
ATOM   579  C  CA  . LYS A 1 75  ? 32.722 36.579 4.647  1.00 24.68 ? 75  LYS A CA  1 
ATOM   580  C  C   . LYS A 1 75  ? 33.258 37.140 3.300  1.00 23.10 ? 75  LYS A C   1 
ATOM   581  O  O   . LYS A 1 75  ? 34.072 37.998 3.286  1.00 21.46 ? 75  LYS A O   1 
ATOM   582  C  CB  . LYS A 1 75  ? 33.340 35.239 4.977  1.00 25.81 ? 75  LYS A CB  1 
ATOM   583  C  CG  . LYS A 1 75  ? 34.795 35.246 5.383  1.00 32.78 ? 75  LYS A CG  1 
ATOM   584  C  CD  . LYS A 1 75  ? 35.268 33.856 5.925  1.00 38.55 ? 75  LYS A CD  1 
ATOM   585  C  CE  . LYS A 1 75  ? 36.349 33.199 5.078  1.00 45.28 ? 75  LYS A CE  1 
ATOM   586  N  NZ  . LYS A 1 75  ? 36.614 31.783 5.519  1.00 49.46 ? 75  LYS A NZ  1 
ATOM   587  N  N   . GLU A 1 76  ? 32.735 36.658 2.200  1.00 22.32 ? 76  GLU A N   1 
ATOM   588  C  CA  . GLU A 1 76  ? 33.162 37.121 0.917  1.00 24.74 ? 76  GLU A CA  1 
ATOM   589  C  C   . GLU A 1 76  ? 32.804 38.619 0.712  1.00 24.93 ? 76  GLU A C   1 
ATOM   590  O  O   . GLU A 1 76  ? 33.590 39.373 0.132  1.00 24.26 ? 76  GLU A O   1 
ATOM   591  C  CB  . GLU A 1 76  ? 32.607 36.181 -0.190 1.00 24.41 ? 76  GLU A CB  1 
ATOM   592  C  CG  . GLU A 1 76  ? 33.050 34.721 -0.149 0.01 24.48 ? 76  GLU A CG  1 
ATOM   593  C  CD  . GLU A 1 76  ? 34.351 34.483 0.595  0.01 24.47 ? 76  GLU A CD  1 
ATOM   594  O  OE1 . GLU A 1 76  ? 35.418 34.839 0.053  0.01 24.32 ? 76  GLU A OE1 1 
ATOM   595  O  OE2 . GLU A 1 76  ? 34.305 33.936 1.718  0.01 24.36 ? 76  GLU A OE2 1 
ATOM   596  N  N   . ARG A 1 77  ? 31.670 39.091 1.250  1.00 23.83 ? 77  ARG A N   1 
ATOM   597  C  CA  . ARG A 1 77  ? 31.302 40.521 1.106  1.00 21.39 ? 77  ARG A CA  1 
ATOM   598  C  C   . ARG A 1 77  ? 32.236 41.355 1.949  1.00 19.89 ? 77  ARG A C   1 
ATOM   599  O  O   . ARG A 1 77  ? 32.648 42.366 1.474  1.00 18.85 ? 77  ARG A O   1 
ATOM   600  C  CB  . ARG A 1 77  ? 29.863 40.743 1.501  1.00 22.12 ? 77  ARG A CB  1 
ATOM   601  C  CG  . ARG A 1 77  ? 29.484 42.159 1.883  1.00 27.57 ? 77  ARG A CG  1 
ATOM   602  C  CD  . ARG A 1 77  ? 29.500 43.006 0.599  1.00 33.37 ? 77  ARG A CD  1 
ATOM   603  N  NE  . ARG A 1 77  ? 29.219 44.427 0.853  1.00 36.71 ? 77  ARG A NE  1 
ATOM   604  C  CZ  . ARG A 1 77  ? 29.990 45.429 0.387  1.00 47.88 ? 77  ARG A CZ  1 
ATOM   605  N  NH1 . ARG A 1 77  ? 31.141 45.153 -0.283 1.00 38.49 ? 77  ARG A NH1 1 
ATOM   606  N  NH2 . ARG A 1 77  ? 29.628 46.722 0.653  1.00 48.11 ? 77  ARG A NH2 1 
ATOM   607  N  N   . VAL A 1 78  ? 32.590 40.904 3.160  1.00 17.27 ? 78  VAL A N   1 
ATOM   608  C  CA  . VAL A 1 78  ? 33.400 41.652 4.046  1.00 17.26 ? 78  VAL A CA  1 
ATOM   609  C  C   . VAL A 1 78  ? 34.793 41.745 3.493  1.00 19.16 ? 78  VAL A C   1 
ATOM   610  O  O   . VAL A 1 78  ? 35.503 42.756 3.698  1.00 16.73 ? 78  VAL A O   1 
ATOM   611  C  CB  . VAL A 1 78  ? 33.362 41.074 5.413  1.00 18.29 ? 78  VAL A CB  1 
ATOM   612  C  CG1 . VAL A 1 78  ? 34.527 41.620 6.297  1.00 20.30 ? 78  VAL A CG1 1 
ATOM   613  C  CG2 . VAL A 1 78  ? 31.902 41.389 6.054  1.00 21.15 ? 78  VAL A CG2 1 
ATOM   614  N  N   . LEU A 1 79  ? 35.214 40.699 2.807  1.00 20.65 ? 79  LEU A N   1 
ATOM   615  C  CA  . LEU A 1 79  ? 36.519 40.787 2.156  1.00 21.22 ? 79  LEU A CA  1 
ATOM   616  C  C   . LEU A 1 79  ? 36.656 41.816 1.004  1.00 21.41 ? 79  LEU A C   1 
ATOM   617  O  O   . LEU A 1 79  ? 37.777 42.179 0.679  1.00 19.29 ? 79  LEU A O   1 
ATOM   618  C  CB  . LEU A 1 79  ? 36.981 39.419 1.659  1.00 22.53 ? 79  LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 79  ? 37.390 38.473 2.773  1.00 24.90 ? 79  LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 79  ? 37.462 37.059 2.211  1.00 30.81 ? 79  LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 79  ? 38.699 38.915 3.477  1.00 29.01 ? 79  LEU A CD2 1 
ATOM   622  N  N   . GLN A 1 80  ? 35.534 42.246 0.405  1.00 23.09 ? 80  GLN A N   1 
ATOM   623  C  CA  . GLN A 1 80  ? 35.463 43.223 -0.625 1.00 21.71 ? 80  GLN A CA  1 
ATOM   624  C  C   . GLN A 1 80  ? 35.378 44.644 -0.004 1.00 23.74 ? 80  GLN A C   1 
ATOM   625  O  O   . GLN A 1 80  ? 35.619 45.683 -0.681 1.00 20.60 ? 80  GLN A O   1 
ATOM   626  C  CB  . GLN A 1 80  ? 34.297 42.842 -1.467 1.00 24.80 ? 80  GLN A CB  1 
ATOM   627  C  CG  . GLN A 1 80  ? 34.686 41.674 -2.480 1.00 31.56 ? 80  GLN A CG  1 
ATOM   628  C  CD  . GLN A 1 80  ? 35.799 42.060 -3.439 0.01 29.63 ? 80  GLN A CD  1 
ATOM   629  O  OE1 . GLN A 1 80  ? 35.914 43.222 -3.833 0.01 29.96 ? 80  GLN A OE1 1 
ATOM   630  N  NE2 . GLN A 1 80  ? 36.623 41.088 -3.812 0.01 30.03 ? 80  GLN A NE2 1 
ATOM   631  N  N   . THR A 1 81  ? 35.118 44.709 1.323  1.00 20.86 ? 81  THR A N   1 
ATOM   632  C  CA  . THR A 1 81  ? 34.934 45.995 1.907  1.00 19.43 ? 81  THR A CA  1 
ATOM   633  C  C   . THR A 1 81  ? 36.083 46.912 1.882  1.00 19.64 ? 81  THR A C   1 
ATOM   634  O  O   . THR A 1 81  ? 35.856 48.106 1.785  1.00 18.62 ? 81  THR A O   1 
ATOM   635  C  CB  . THR A 1 81  ? 34.284 46.074 3.333  1.00 21.15 ? 81  THR A CB  1 
ATOM   636  O  OG1 . THR A 1 81  ? 35.088 45.472 4.323  1.00 19.28 ? 81  THR A OG1 1 
ATOM   637  C  CG2 . THR A 1 81  ? 32.920 45.430 3.301  1.00 18.30 ? 81  THR A CG2 1 
ATOM   638  N  N   . PRO A 1 82  ? 37.310 46.452 1.949  1.00 19.66 ? 82  PRO A N   1 
ATOM   639  C  CA  . PRO A 1 82  ? 38.421 47.375 1.756  1.00 20.51 ? 82  PRO A CA  1 
ATOM   640  C  C   . PRO A 1 82  ? 38.419 48.184 0.444  1.00 20.11 ? 82  PRO A C   1 
ATOM   641  O  O   . PRO A 1 82  ? 38.857 49.324 0.424  1.00 15.97 ? 82  PRO A O   1 
ATOM   642  C  CB  . PRO A 1 82  ? 39.622 46.441 1.867  1.00 22.20 ? 82  PRO A CB  1 
ATOM   643  C  CG  . PRO A 1 82  ? 39.057 45.267 2.829  1.00 17.74 ? 82  PRO A CG  1 
ATOM   644  C  CD  . PRO A 1 82  ? 37.773 45.098 2.286  1.00 20.82 ? 82  PRO A CD  1 
ATOM   645  N  N   . ASN A 1 83  ? 37.872 47.590 -0.587 1.00 21.59 ? 83  ASN A N   1 
ATOM   646  C  CA  . ASN A 1 83  ? 37.706 48.231 -1.877 1.00 23.80 ? 83  ASN A CA  1 
ATOM   647  C  C   . ASN A 1 83  ? 36.618 49.275 -1.841 1.00 22.61 ? 83  ASN A C   1 
ATOM   648  O  O   . ASN A 1 83  ? 36.776 50.293 -2.496 1.00 21.98 ? 83  ASN A O   1 
ATOM   649  C  CB  . ASN A 1 83  ? 37.321 47.180 -2.919 1.00 22.53 ? 83  ASN A CB  1 
ATOM   650  C  CG  . ASN A 1 83  ? 38.468 46.212 -3.148 1.00 26.36 ? 83  ASN A CG  1 
ATOM   651  O  OD1 . ASN A 1 83  ? 39.606 46.618 -3.028 1.00 40.42 ? 83  ASN A OD1 1 
ATOM   652  N  ND2 . ASN A 1 83  ? 38.189 44.980 -3.452 1.00 35.18 ? 83  ASN A ND2 1 
ATOM   653  N  N   . ASP A 1 84  ? 35.549 49.057 -1.068 1.00 20.19 ? 84  ASP A N   1 
ATOM   654  C  CA  . ASP A 1 84  ? 34.529 50.143 -0.955 1.00 18.98 ? 84  ASP A CA  1 
ATOM   655  C  C   . ASP A 1 84  ? 35.179 51.352 -0.252 1.00 15.18 ? 84  ASP A C   1 
ATOM   656  O  O   . ASP A 1 84  ? 34.959 52.506 -0.534 1.00 14.50 ? 84  ASP A O   1 
ATOM   657  C  CB  . ASP A 1 84  ? 33.355 49.679 -0.069 1.00 20.43 ? 84  ASP A CB  1 
ATOM   658  C  CG  . ASP A 1 84  ? 32.455 48.617 -0.771 1.00 32.35 ? 84  ASP A CG  1 
ATOM   659  O  OD1 . ASP A 1 84  ? 31.265 48.972 -1.155 1.00 43.69 ? 84  ASP A OD1 1 
ATOM   660  O  OD2 . ASP A 1 84  ? 32.805 47.410 -0.945 1.00 29.69 ? 84  ASP A OD2 1 
ATOM   661  N  N   . LEU A 1 85  ? 36.003 51.078 0.740  1.00 13.50 ? 85  LEU A N   1 
ATOM   662  C  CA  . LEU A 1 85  ? 36.615 52.128 1.560  1.00 14.48 ? 85  LEU A CA  1 
ATOM   663  C  C   . LEU A 1 85  ? 37.581 52.972 0.773  1.00 14.62 ? 85  LEU A C   1 
ATOM   664  O  O   . LEU A 1 85  ? 37.611 54.204 0.883  1.00 12.69 ? 85  LEU A O   1 
ATOM   665  C  CB  . LEU A 1 85  ? 37.319 51.465 2.741  1.00 13.60 ? 85  LEU A CB  1 
ATOM   666  C  CG  . LEU A 1 85  ? 36.247 50.926 3.742  1.00 19.90 ? 85  LEU A CG  1 
ATOM   667  C  CD1 . LEU A 1 85  ? 36.950 50.026 4.737  1.00 21.22 ? 85  LEU A CD1 1 
ATOM   668  C  CD2 . LEU A 1 85  ? 35.669 52.020 4.483  1.00 24.94 ? 85  LEU A CD2 1 
ATOM   669  N  N   . LEU A 1 86  ? 38.438 52.233 0.052  1.00 14.76 ? 86  LEU A N   1 
ATOM   670  C  CA  . LEU A 1 86  ? 39.409 52.808 -0.841 1.00 17.17 ? 86  LEU A CA  1 
ATOM   671  C  C   . LEU A 1 86  ? 38.689 53.549 -1.938 1.00 15.98 ? 86  LEU A C   1 
ATOM   672  O  O   . LEU A 1 86  ? 39.086 54.659 -2.227 1.00 18.51 ? 86  LEU A O   1 
ATOM   673  C  CB  . LEU A 1 86  ? 40.360 51.741 -1.447 1.00 14.57 ? 86  LEU A CB  1 
ATOM   674  C  CG  . LEU A 1 86  ? 41.551 52.400 -2.189 1.00 23.06 ? 86  LEU A CG  1 
ATOM   675  C  CD1 . LEU A 1 86  ? 42.628 52.939 -1.276 1.00 28.31 ? 86  LEU A CD1 1 
ATOM   676  C  CD2 . LEU A 1 86  ? 42.111 51.277 -3.061 1.00 24.76 ? 86  LEU A CD2 1 
ATOM   677  N  N   . ALA A 1 87  ? 37.642 52.986 -2.570 1.00 15.67 ? 87  ALA A N   1 
ATOM   678  C  CA  . ALA A 1 87  ? 36.941 53.733 -3.543 1.00 14.47 ? 87  ALA A CA  1 
ATOM   679  C  C   . ALA A 1 87  ? 36.315 54.999 -3.053 1.00 16.04 ? 87  ALA A C   1 
ATOM   680  O  O   . ALA A 1 87  ? 36.150 55.951 -3.826 1.00 14.88 ? 87  ALA A O   1 
ATOM   681  C  CB  . ALA A 1 87  ? 35.876 52.863 -4.390 1.00 15.37 ? 87  ALA A CB  1 
ATOM   682  N  N   . ALA A 1 88  ? 35.974 55.036 -1.785 1.00 15.59 ? 88  ALA A N   1 
ATOM   683  C  CA  . ALA A 1 88  ? 35.408 56.215 -1.199 1.00 16.44 ? 88  ALA A CA  1 
ATOM   684  C  C   . ALA A 1 88  ? 36.461 57.237 -0.823 1.00 18.37 ? 88  ALA A C   1 
ATOM   685  O  O   . ALA A 1 88  ? 36.109 58.291 -0.459 1.00 17.71 ? 88  ALA A O   1 
ATOM   686  C  CB  . ALA A 1 88  ? 34.480 55.897 -0.018 1.00 12.98 ? 88  ALA A CB  1 
ATOM   687  N  N   . GLY A 1 89  ? 37.751 56.933 -0.921 1.00 18.66 ? 89  GLY A N   1 
ATOM   688  C  CA  . GLY A 1 89  ? 38.750 57.919 -0.528 1.00 19.98 ? 89  GLY A CA  1 
ATOM   689  C  C   . GLY A 1 89  ? 39.505 57.639 0.732  1.00 18.95 ? 89  GLY A C   1 
ATOM   690  O  O   . GLY A 1 89  ? 40.345 58.401 1.079  1.00 22.51 ? 89  GLY A O   1 
ATOM   691  N  N   . PHE A 1 90  ? 39.229 56.550 1.434  1.00 19.89 ? 90  PHE A N   1 
ATOM   692  C  CA  . PHE A 1 90  ? 39.893 56.286 2.706  1.00 22.15 ? 90  PHE A CA  1 
ATOM   693  C  C   . PHE A 1 90  ? 41.198 55.596 2.348  1.00 23.45 ? 90  PHE A C   1 
ATOM   694  O  O   . PHE A 1 90  ? 41.236 54.767 1.453  1.00 27.41 ? 90  PHE A O   1 
ATOM   695  C  CB  . PHE A 1 90  ? 39.033 55.434 3.646  1.00 20.17 ? 90  PHE A CB  1 
ATOM   696  C  CG  . PHE A 1 90  ? 37.734 56.139 4.110  1.00 22.70 ? 90  PHE A CG  1 
ATOM   697  C  CD1 . PHE A 1 90  ? 37.768 57.137 5.065  1.00 27.51 ? 90  PHE A CD1 1 
ATOM   698  C  CD2 . PHE A 1 90  ? 36.493 55.741 3.668  1.00 22.23 ? 90  PHE A CD2 1 
ATOM   699  C  CE1 . PHE A 1 90  ? 36.598 57.793 5.491  1.00 28.39 ? 90  PHE A CE1 1 
ATOM   700  C  CE2 . PHE A 1 90  ? 35.328 56.346 4.183  1.00 19.70 ? 90  PHE A CE2 1 
ATOM   701  C  CZ  . PHE A 1 90  ? 35.388 57.371 5.001  1.00 25.64 ? 90  PHE A CZ  1 
ATOM   702  N  N   . GLU A 1 91  ? 42.248 55.919 3.041  1.00 26.10 ? 91  GLU A N   1 
ATOM   703  C  CA  . GLU A 1 91  ? 43.536 55.296 2.831  1.00 30.99 ? 91  GLU A CA  1 
ATOM   704  C  C   . GLU A 1 91  ? 43.640 54.012 3.696  1.00 30.88 ? 91  GLU A C   1 
ATOM   705  O  O   . GLU A 1 91  ? 43.219 54.047 4.822  1.00 28.09 ? 91  GLU A O   1 
ATOM   706  C  CB  . GLU A 1 91  ? 44.631 56.262 3.283  1.00 31.78 ? 91  GLU A CB  1 
ATOM   707  C  CG  . GLU A 1 91  ? 44.731 57.580 2.526  1.00 38.16 ? 91  GLU A CG  1 
ATOM   708  C  CD  . GLU A 1 91  ? 46.200 57.932 2.332  1.00 51.37 ? 91  GLU A CD  1 
ATOM   709  O  OE1 . GLU A 1 91  ? 46.789 57.674 1.226  1.00 53.29 ? 91  GLU A OE1 1 
ATOM   710  O  OE2 . GLU A 1 91  ? 46.777 58.427 3.337  1.00 59.01 ? 91  GLU A OE2 1 
ATOM   711  N  N   . GLU A 1 92  ? 44.161 52.931 3.114  1.00 31.96 ? 92  GLU A N   1 
ATOM   712  C  CA  . GLU A 1 92  ? 44.299 51.597 3.691  1.00 35.73 ? 92  GLU A CA  1 
ATOM   713  C  C   . GLU A 1 92  ? 44.945 51.708 5.040  1.00 36.04 ? 92  GLU A C   1 
ATOM   714  O  O   . GLU A 1 92  ? 44.553 51.119 6.004  1.00 38.04 ? 92  GLU A O   1 
ATOM   715  C  CB  . GLU A 1 92  ? 45.127 50.698 2.770  1.00 36.98 ? 92  GLU A CB  1 
ATOM   716  C  CG  . GLU A 1 92  ? 45.250 49.253 3.215  1.00 41.35 ? 92  GLU A CG  1 
ATOM   717  C  CD  . GLU A 1 92  ? 46.547 48.955 4.005  1.00 43.63 ? 92  GLU A CD  1 
ATOM   718  O  OE1 . GLU A 1 92  ? 47.642 49.526 3.746  1.00 45.06 ? 92  GLU A OE1 1 
ATOM   719  O  OE2 . GLU A 1 92  ? 46.423 48.103 4.900  1.00 53.66 ? 92  GLU A OE2 1 
ATOM   720  N  N   . HIS A 1 93  ? 45.866 52.602 5.113  1.00 37.17 ? 93  HIS A N   1 
ATOM   721  C  CA  . HIS A 1 93  ? 46.593 52.909 6.321  1.00 38.50 ? 93  HIS A CA  1 
ATOM   722  C  C   . HIS A 1 93  ? 45.624 53.146 7.459  1.00 37.64 ? 93  HIS A C   1 
ATOM   723  O  O   . HIS A 1 93  ? 45.768 52.555 8.523  1.00 40.23 ? 93  HIS A O   1 
ATOM   724  C  CB  . HIS A 1 93  ? 47.483 54.141 6.121  0.01 38.00 ? 93  HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 93  ? 48.127 54.632 7.381  0.01 38.26 ? 93  HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 93  ? 48.869 53.813 8.205  0.01 38.21 ? 93  HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 93  ? 48.137 55.856 7.959  0.01 38.19 ? 93  HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 93  ? 49.310 54.513 9.236  0.01 38.21 ? 93  HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 93  ? 48.879 55.755 9.110  0.01 38.27 ? 93  HIS A NE2 1 
ATOM   730  N  N   . LYS A 1 94  ? 44.666 54.000 7.227  1.00 37.07 ? 94  LYS A N   1 
ATOM   731  C  CA  . LYS A 1 94  ? 43.705 54.450 8.261  1.00 36.24 ? 94  LYS A CA  1 
ATOM   732  C  C   . LYS A 1 94  ? 42.533 53.484 8.660  1.00 35.08 ? 94  LYS A C   1 
ATOM   733  O  O   . LYS A 1 94  ? 42.054 53.544 9.784  1.00 39.20 ? 94  LYS A O   1 
ATOM   734  C  CB  . LYS A 1 94  ? 43.081 55.769 7.806  1.00 36.46 ? 94  LYS A CB  1 
ATOM   735  C  CG  . LYS A 1 94  ? 42.434 56.585 8.918  0.01 36.25 ? 94  LYS A CG  1 
ATOM   736  C  CD  . LYS A 1 94  ? 41.974 57.948 8.417  0.01 36.23 ? 94  LYS A CD  1 
ATOM   737  C  CE  . LYS A 1 94  ? 40.679 57.847 7.622  0.01 36.17 ? 94  LYS A CE  1 
ATOM   738  N  NZ  . LYS A 1 94  ? 40.208 59.176 7.144  0.01 36.03 ? 94  LYS A NZ  1 
ATOM   739  N  N   . PHE A 1 95  ? 42.045 52.634 7.778  1.00 31.73 ? 95  PHE A N   1 
ATOM   740  C  CA  . PHE A 1 95  ? 40.908 51.791 8.121  1.00 28.08 ? 95  PHE A CA  1 
ATOM   741  C  C   . PHE A 1 95  ? 41.384 50.380 8.503  1.00 29.01 ? 95  PHE A C   1 
ATOM   742  O  O   . PHE A 1 95  ? 40.604 49.587 9.036  1.00 24.17 ? 95  PHE A O   1 
ATOM   743  C  CB  . PHE A 1 95  ? 39.910 51.766 6.963  1.00 28.28 ? 95  PHE A CB  1 
ATOM   744  C  CG  . PHE A 1 95  ? 40.424 51.178 5.716  1.00 19.82 ? 95  PHE A CG  1 
ATOM   745  C  CD1 . PHE A 1 95  ? 40.721 49.867 5.629  1.00 23.72 ? 95  PHE A CD1 1 
ATOM   746  C  CD2 . PHE A 1 95  ? 40.649 51.950 4.665  1.00 21.51 ? 95  PHE A CD2 1 
ATOM   747  C  CE1 . PHE A 1 95  ? 41.202 49.353 4.464  1.00 28.85 ? 95  PHE A CE1 1 
ATOM   748  C  CE2 . PHE A 1 95  ? 41.082 51.463 3.453  1.00 25.88 ? 95  PHE A CE2 1 
ATOM   749  C  CZ  . PHE A 1 95  ? 41.400 50.166 3.361  1.00 26.02 ? 95  PHE A CZ  1 
ATOM   750  N  N   . ARG A 1 96  ? 42.677 50.094 8.255  1.00 25.47 ? 96  ARG A N   1 
ATOM   751  C  CA  . ARG A 1 96  ? 43.231 48.774 8.450  1.00 27.10 ? 96  ARG A CA  1 
ATOM   752  C  C   . ARG A 1 96  ? 42.962 48.057 9.813  1.00 25.10 ? 96  ARG A C   1 
ATOM   753  O  O   . ARG A 1 96  ? 42.684 46.876 9.844  1.00 26.19 ? 96  ARG A O   1 
ATOM   754  C  CB  . ARG A 1 96  ? 44.751 48.789 8.253  1.00 27.14 ? 96  ARG A CB  1 
ATOM   755  C  CG  . ARG A 1 96  ? 45.268 47.398 8.131  1.00 32.56 ? 96  ARG A CG  1 
ATOM   756  C  CD  . ARG A 1 96  ? 46.792 47.303 8.070  0.01 32.15 ? 96  ARG A CD  1 
ATOM   757  N  NE  . ARG A 1 96  ? 47.453 48.052 9.140  0.01 32.90 ? 96  ARG A NE  1 
ATOM   758  C  CZ  . ARG A 1 96  ? 47.738 47.583 10.354 0.01 33.52 ? 96  ARG A CZ  1 
ATOM   759  N  NH1 . ARG A 1 96  ? 47.428 46.338 10.706 0.01 33.80 ? 96  ARG A NH1 1 
ATOM   760  N  NH2 . ARG A 1 96  ? 48.343 48.373 11.234 0.01 33.76 ? 96  ARG A NH2 1 
ATOM   761  N  N   . ASN A 1 97  ? 43.087 48.758 10.894 1.00 24.53 ? 97  ASN A N   1 
ATOM   762  C  CA  . ASN A 1 97  ? 43.009 48.165 12.180 1.00 26.83 ? 97  ASN A CA  1 
ATOM   763  C  C   . ASN A 1 97  ? 41.502 47.919 12.428 1.00 25.59 ? 97  ASN A C   1 
ATOM   764  O  O   . ASN A 1 97  ? 41.094 46.930 13.081 1.00 23.81 ? 97  ASN A O   1 
ATOM   765  C  CB  . ASN A 1 97  ? 43.538 49.122 13.190 1.00 27.31 ? 97  ASN A CB  1 
ATOM   766  C  CG  . ASN A 1 97  ? 45.002 49.271 13.138 1.00 37.02 ? 97  ASN A CG  1 
ATOM   767  O  OD1 . ASN A 1 97  ? 45.725 48.347 12.761 1.00 44.96 ? 97  ASN A OD1 1 
ATOM   768  N  ND2 . ASN A 1 97  ? 45.481 50.453 13.569 1.00 41.15 ? 97  ASN A ND2 1 
ATOM   769  N  N   . PHE A 1 98  ? 40.668 48.776 11.826 1.00 22.51 ? 98  PHE A N   1 
ATOM   770  C  CA  . PHE A 1 98  ? 39.215 48.595 12.037 1.00 19.68 ? 98  PHE A CA  1 
ATOM   771  C  C   . PHE A 1 98  ? 38.728 47.479 11.227 1.00 20.71 ? 98  PHE A C   1 
ATOM   772  O  O   . PHE A 1 98  ? 37.985 46.634 11.706 1.00 19.10 ? 98  PHE A O   1 
ATOM   773  C  CB  . PHE A 1 98  ? 38.458 49.909 11.859 1.00 21.19 ? 98  PHE A CB  1 
ATOM   774  C  CG  . PHE A 1 98  ? 39.061 51.026 12.601 1.00 20.36 ? 98  PHE A CG  1 
ATOM   775  C  CD1 . PHE A 1 98  ? 39.093 51.016 13.984 1.00 24.72 ? 98  PHE A CD1 1 
ATOM   776  C  CD2 . PHE A 1 98  ? 39.640 52.120 11.937 1.00 29.05 ? 98  PHE A CD2 1 
ATOM   777  C  CE1 . PHE A 1 98  ? 39.711 52.061 14.729 1.00 20.35 ? 98  PHE A CE1 1 
ATOM   778  C  CE2 . PHE A 1 98  ? 40.241 53.231 12.650 1.00 23.16 ? 98  PHE A CE2 1 
ATOM   779  C  CZ  . PHE A 1 98  ? 40.313 53.196 14.048 1.00 22.00 ? 98  PHE A CZ  1 
ATOM   780  N  N   . PHE A 1 99  ? 39.180 47.368 9.994  1.00 20.57 ? 99  PHE A N   1 
ATOM   781  C  CA  . PHE A 1 99  ? 38.882 46.203 9.228  1.00 21.12 ? 99  PHE A CA  1 
ATOM   782  C  C   . PHE A 1 99  ? 39.346 44.886 9.864  1.00 22.32 ? 99  PHE A C   1 
ATOM   783  O  O   . PHE A 1 99  ? 38.573 43.913 9.930  1.00 21.70 ? 99  PHE A O   1 
ATOM   784  C  CB  . PHE A 1 99  ? 39.466 46.313 7.808  1.00 21.93 ? 99  PHE A CB  1 
ATOM   785  C  CG  . PHE A 1 99  ? 39.357 45.075 7.086  1.00 19.48 ? 99  PHE A CG  1 
ATOM   786  C  CD1 . PHE A 1 99  ? 38.185 44.740 6.468  1.00 20.99 ? 99  PHE A CD1 1 
ATOM   787  C  CD2 . PHE A 1 99  ? 40.411 44.167 7.086  1.00 25.39 ? 99  PHE A CD2 1 
ATOM   788  C  CE1 . PHE A 1 99  ? 38.055 43.532 5.831  1.00 23.79 ? 99  PHE A CE1 1 
ATOM   789  C  CE2 . PHE A 1 99  ? 40.276 42.935 6.438  1.00 22.24 ? 99  PHE A CE2 1 
ATOM   790  C  CZ  . PHE A 1 99  ? 39.074 42.648 5.771  1.00 20.45 ? 99  PHE A CZ  1 
ATOM   791  N  N   . ASN A 1 100 ? 40.592 44.844 10.307 1.00 20.65 ? 100 ASN A N   1 
ATOM   792  C  CA  . ASN A 1 100 ? 41.093 43.640 10.950 1.00 22.42 ? 100 ASN A CA  1 
ATOM   793  C  C   . ASN A 1 100 ? 40.186 43.243 12.095 1.00 22.85 ? 100 ASN A C   1 
ATOM   794  O  O   . ASN A 1 100 ? 39.851 42.112 12.218 1.00 22.78 ? 100 ASN A O   1 
ATOM   795  C  CB  . ASN A 1 100 ? 42.510 43.777 11.491 1.00 21.30 ? 100 ASN A CB  1 
ATOM   796  C  CG  . ASN A 1 100 ? 43.537 43.875 10.325 1.00 27.06 ? 100 ASN A CG  1 
ATOM   797  O  OD1 . ASN A 1 100 ? 43.266 43.389 9.266  1.00 32.51 ? 100 ASN A OD1 1 
ATOM   798  N  ND2 . ASN A 1 100 ? 44.651 44.559 10.525 1.00 33.14 ? 100 ASN A ND2 1 
ATOM   799  N  N   . ALA A 1 101 ? 39.765 44.168 12.919 1.00 24.83 ? 101 ALA A N   1 
ATOM   800  C  CA  . ALA A 1 101 ? 38.979 43.774 14.092 1.00 24.13 ? 101 ALA A CA  1 
ATOM   801  C  C   . ALA A 1 101 ? 37.617 43.249 13.649 1.00 23.35 ? 101 ALA A C   1 
ATOM   802  O  O   . ALA A 1 101 ? 37.046 42.337 14.266 1.00 22.98 ? 101 ALA A O   1 
ATOM   803  C  CB  . ALA A 1 101 ? 38.799 44.979 14.973 1.00 25.25 ? 101 ALA A CB  1 
ATOM   804  N  N   . PHE A 1 102 ? 37.032 43.824 12.586 1.00 21.86 ? 102 PHE A N   1 
ATOM   805  C  CA  . PHE A 1 102 ? 35.774 43.306 12.119 1.00 20.95 ? 102 PHE A CA  1 
ATOM   806  C  C   . PHE A 1 102 ? 35.936 41.915 11.568 1.00 22.75 ? 102 PHE A C   1 
ATOM   807  O  O   . PHE A 1 102 ? 35.138 40.970 11.809 1.00 21.50 ? 102 PHE A O   1 
ATOM   808  C  CB  . PHE A 1 102 ? 35.006 44.248 11.161 1.00 19.20 ? 102 PHE A CB  1 
ATOM   809  C  CG  . PHE A 1 102 ? 33.632 43.849 10.963 1.00 17.41 ? 102 PHE A CG  1 
ATOM   810  C  CD1 . PHE A 1 102 ? 32.679 44.140 11.910 1.00 22.75 ? 102 PHE A CD1 1 
ATOM   811  C  CD2 . PHE A 1 102 ? 33.250 43.076 9.887  1.00 18.44 ? 102 PHE A CD2 1 
ATOM   812  C  CE1 . PHE A 1 102 ? 31.374 43.727 11.733 1.00 22.70 ? 102 PHE A CE1 1 
ATOM   813  C  CE2 . PHE A 1 102 ? 31.975 42.717 9.691  1.00 23.01 ? 102 PHE A CE2 1 
ATOM   814  C  CZ  . PHE A 1 102 ? 31.017 42.991 10.631 1.00 23.40 ? 102 PHE A CZ  1 
ATOM   815  N  N   . TYR A 1 103 ? 36.927 41.809 10.721 1.00 22.13 ? 103 TYR A N   1 
ATOM   816  C  CA  . TYR A 1 103 ? 37.188 40.527 10.104 1.00 23.50 ? 103 TYR A CA  1 
ATOM   817  C  C   . TYR A 1 103 ? 37.487 39.425 11.133 1.00 22.59 ? 103 TYR A C   1 
ATOM   818  O  O   . TYR A 1 103 ? 37.145 38.309 10.914 1.00 22.76 ? 103 TYR A O   1 
ATOM   819  C  CB  . TYR A 1 103 ? 38.428 40.564 9.177  1.00 24.55 ? 103 TYR A CB  1 
ATOM   820  C  CG  . TYR A 1 103 ? 38.479 39.310 8.436  1.00 23.67 ? 103 TYR A CG  1 
ATOM   821  C  CD1 . TYR A 1 103 ? 37.603 39.135 7.419  1.00 27.94 ? 103 TYR A CD1 1 
ATOM   822  C  CD2 . TYR A 1 103 ? 39.332 38.267 8.794  1.00 26.92 ? 103 TYR A CD2 1 
ATOM   823  C  CE1 . TYR A 1 103 ? 37.593 37.998 6.696  1.00 32.08 ? 103 TYR A CE1 1 
ATOM   824  C  CE2 . TYR A 1 103 ? 39.322 37.103 8.082  1.00 34.24 ? 103 TYR A CE2 1 
ATOM   825  C  CZ  . TYR A 1 103 ? 38.447 36.994 7.001  1.00 35.36 ? 103 TYR A CZ  1 
ATOM   826  O  OH  . TYR A 1 103 ? 38.299 35.893 6.218  1.00 39.94 ? 103 TYR A OH  1 
ATOM   827  N  N   . SER A 1 104 ? 38.133 39.765 12.196 1.00 20.56 ? 104 SER A N   1 
ATOM   828  C  CA  . SER A 1 104 ? 38.425 38.774 13.242 1.00 25.33 ? 104 SER A CA  1 
ATOM   829  C  C   . SER A 1 104 ? 37.110 38.305 14.016 1.00 23.14 ? 104 SER A C   1 
ATOM   830  O  O   . SER A 1 104 ? 36.969 37.109 14.331 1.00 23.79 ? 104 SER A O   1 
ATOM   831  C  CB  . SER A 1 104 ? 39.568 39.318 14.068 1.00 24.26 ? 104 SER A CB  1 
ATOM   832  O  OG  . SER A 1 104 ? 39.216 39.295 15.403 1.00 37.05 ? 104 SER A OG  1 
ATOM   833  N  N   . VAL A 1 105 ? 36.090 39.148 14.154 1.00 19.95 ? 105 VAL A N   1 
ATOM   834  C  CA  . VAL A 1 105 ? 34.819 38.703 14.619 1.00 19.56 ? 105 VAL A CA  1 
ATOM   835  C  C   . VAL A 1 105 ? 34.080 37.832 13.589 1.00 20.52 ? 105 VAL A C   1 
ATOM   836  O  O   . VAL A 1 105 ? 33.458 36.805 13.927 1.00 20.46 ? 105 VAL A O   1 
ATOM   837  C  CB  . VAL A 1 105 ? 34.042 39.860 15.283 1.00 21.68 ? 105 VAL A CB  1 
ATOM   838  C  CG1 . VAL A 1 105 ? 33.169 40.587 14.281 1.00 18.68 ? 105 VAL A CG1 1 
ATOM   839  C  CG2 . VAL A 1 105 ? 33.208 39.297 16.377 1.00 24.18 ? 105 VAL A CG2 1 
ATOM   840  N  N   . VAL A 1 106 ? 34.214 38.109 12.321 1.00 20.35 ? 106 VAL A N   1 
ATOM   841  C  CA  . VAL A 1 106 ? 33.621 37.255 11.318 1.00 22.98 ? 106 VAL A CA  1 
ATOM   842  C  C   . VAL A 1 106 ? 34.269 35.851 11.369 1.00 23.59 ? 106 VAL A C   1 
ATOM   843  O  O   . VAL A 1 106 ? 33.545 34.862 11.304 1.00 20.36 ? 106 VAL A O   1 
ATOM   844  C  CB  . VAL A 1 106 ? 33.754 37.846 9.886  1.00 24.95 ? 106 VAL A CB  1 
ATOM   845  C  CG1 . VAL A 1 106 ? 33.470 36.850 8.790  1.00 26.36 ? 106 VAL A CG1 1 
ATOM   846  C  CG2 . VAL A 1 106 ? 32.871 39.024 9.712  1.00 25.68 ? 106 VAL A CG2 1 
ATOM   847  N  N   . GLU A 1 107 ? 35.597 35.771 11.469 1.00 24.19 ? 107 GLU A N   1 
ATOM   848  C  CA  . GLU A 1 107 ? 36.286 34.492 11.661 1.00 26.16 ? 107 GLU A CA  1 
ATOM   849  C  C   . GLU A 1 107 ? 35.904 33.748 12.999 1.00 24.73 ? 107 GLU A C   1 
ATOM   850  O  O   . GLU A 1 107 ? 35.815 32.526 13.004 1.00 24.61 ? 107 GLU A O   1 
ATOM   851  C  CB  . GLU A 1 107 ? 37.786 34.648 11.712 1.00 27.15 ? 107 GLU A CB  1 
ATOM   852  C  CG  . GLU A 1 107 ? 38.493 34.624 10.363 1.00 36.62 ? 107 GLU A CG  1 
ATOM   853  C  CD  . GLU A 1 107 ? 40.019 34.529 10.529 1.00 43.66 ? 107 GLU A CD  1 
ATOM   854  O  OE1 . GLU A 1 107 ? 40.770 34.494 9.518  1.00 49.71 ? 107 GLU A OE1 1 
ATOM   855  O  OE2 . GLU A 1 107 ? 40.486 34.432 11.688 1.00 51.04 ? 107 GLU A OE2 1 
ATOM   856  N  N   . LEU A 1 108 ? 35.668 34.473 14.075 1.00 22.20 ? 108 LEU A N   1 
ATOM   857  C  CA  . LEU A 1 108 ? 35.101 33.900 15.265 1.00 24.64 ? 108 LEU A CA  1 
ATOM   858  C  C   . LEU A 1 108 ? 33.747 33.244 14.949 1.00 25.36 ? 108 LEU A C   1 
ATOM   859  O  O   . LEU A 1 108 ? 33.503 32.092 15.196 1.00 25.54 ? 108 LEU A O   1 
ATOM   860  C  CB  . LEU A 1 108 ? 35.056 34.962 16.364 1.00 25.69 ? 108 LEU A CB  1 
ATOM   861  C  CG  . LEU A 1 108 ? 34.382 34.708 17.730 1.00 32.47 ? 108 LEU A CG  1 
ATOM   862  C  CD1 . LEU A 1 108 ? 34.854 35.741 18.752 1.00 36.91 ? 108 LEU A CD1 1 
ATOM   863  C  CD2 . LEU A 1 108 ? 32.870 34.823 17.696 1.00 39.88 ? 108 LEU A CD2 1 
ATOM   864  N  N   . VAL A 1 109 ? 32.861 33.946 14.271 1.00 24.65 ? 109 VAL A N   1 
ATOM   865  C  CA  . VAL A 1 109 ? 31.665 33.362 13.852 1.00 24.78 ? 109 VAL A CA  1 
ATOM   866  C  C   . VAL A 1 109 ? 31.814 32.087 13.068 1.00 25.58 ? 109 VAL A C   1 
ATOM   867  O  O   . VAL A 1 109 ? 31.043 31.123 13.235 1.00 23.85 ? 109 VAL A O   1 
ATOM   868  C  CB  . VAL A 1 109 ? 30.868 34.359 12.974 1.00 24.84 ? 109 VAL A CB  1 
ATOM   869  C  CG1 . VAL A 1 109 ? 29.723 33.656 12.256 1.00 24.61 ? 109 VAL A CG1 1 
ATOM   870  C  CG2 . VAL A 1 109 ? 30.344 35.472 13.916 1.00 25.23 ? 109 VAL A CG2 1 
ATOM   871  N  N   . GLU A 1 110 ? 32.718 32.135 12.107 1.00 26.28 ? 110 GLU A N   1 
ATOM   872  C  CA  . GLU A 1 110 ? 32.949 31.010 11.238 1.00 28.02 ? 110 GLU A CA  1 
ATOM   873  C  C   . GLU A 1 110 ? 33.597 29.817 12.022 1.00 26.75 ? 110 GLU A C   1 
ATOM   874  O  O   . GLU A 1 110 ? 33.284 28.708 11.796 1.00 27.99 ? 110 GLU A O   1 
ATOM   875  C  CB  . GLU A 1 110 ? 33.888 31.452 10.123 1.00 27.66 ? 110 GLU A CB  1 
ATOM   876  C  CG  . GLU A 1 110 ? 33.991 30.452 9.019  1.00 33.80 ? 110 GLU A CG  1 
ATOM   877  C  CD  . GLU A 1 110 ? 35.048 30.841 7.967  1.00 43.60 ? 110 GLU A CD  1 
ATOM   878  O  OE1 . GLU A 1 110 ? 35.869 31.760 8.241  1.00 49.45 ? 110 GLU A OE1 1 
ATOM   879  O  OE2 . GLU A 1 110 ? 35.061 30.212 6.873  1.00 43.97 ? 110 GLU A OE2 1 
ATOM   880  N  N   . LYS A 1 111 ? 34.516 30.056 12.922 1.00 28.67 ? 111 LYS A N   1 
ATOM   881  C  CA  . LYS A 1 111 ? 35.384 28.980 13.432 1.00 30.82 ? 111 LYS A CA  1 
ATOM   882  C  C   . LYS A 1 111 ? 35.091 28.577 14.873 1.00 31.83 ? 111 LYS A C   1 
ATOM   883  O  O   . LYS A 1 111 ? 35.315 27.450 15.313 1.00 34.60 ? 111 LYS A O   1 
ATOM   884  C  CB  . LYS A 1 111 ? 36.809 29.486 13.409 1.00 30.62 ? 111 LYS A CB  1 
ATOM   885  C  CG  . LYS A 1 111 ? 37.429 29.450 12.013 1.00 33.23 ? 111 LYS A CG  1 
ATOM   886  C  CD  . LYS A 1 111 ? 38.842 30.013 12.015 0.01 32.37 ? 111 LYS A CD  1 
ATOM   887  C  CE  . LYS A 1 111 ? 39.455 29.981 10.624 0.01 32.39 ? 111 LYS A CE  1 
ATOM   888  N  NZ  . LYS A 1 111 ? 40.787 30.646 10.583 0.01 32.07 ? 111 LYS A NZ  1 
ATOM   889  N  N   . ASP A 1 112 ? 34.687 29.551 15.666 1.00 30.91 ? 112 ASP A N   1 
ATOM   890  C  CA  . ASP A 1 112 ? 34.271 29.323 17.026 1.00 29.58 ? 112 ASP A CA  1 
ATOM   891  C  C   . ASP A 1 112 ? 32.737 28.998 17.111 1.00 28.78 ? 112 ASP A C   1 
ATOM   892  O  O   . ASP A 1 112 ? 32.349 27.908 17.611 1.00 23.41 ? 112 ASP A O   1 
ATOM   893  C  CB  . ASP A 1 112 ? 34.705 30.517 17.822 1.00 28.42 ? 112 ASP A CB  1 
ATOM   894  C  CG  . ASP A 1 112 ? 34.229 30.455 19.206 1.00 35.01 ? 112 ASP A CG  1 
ATOM   895  O  OD1 . ASP A 1 112 ? 33.011 30.129 19.260 1.00 34.20 ? 112 ASP A OD1 1 
ATOM   896  O  OD2 . ASP A 1 112 ? 34.959 30.749 20.235 1.00 34.58 ? 112 ASP A OD2 1 
ATOM   897  N  N   . GLY A 1 113 ? 31.869 29.910 16.611 1.00 25.95 ? 113 GLY A N   1 
ATOM   898  C  CA  . GLY A 1 113 ? 30.538 29.557 16.265 1.00 25.38 ? 113 GLY A CA  1 
ATOM   899  C  C   . GLY A 1 113 ? 29.661 29.705 17.495 1.00 25.78 ? 113 GLY A C   1 
ATOM   900  O  O   . GLY A 1 113 ? 28.495 29.368 17.429 1.00 28.51 ? 113 GLY A O   1 
ATOM   901  N  N   . SER A 1 114 ? 30.197 30.186 18.586 1.00 24.98 ? 114 SER A N   1 
ATOM   902  C  CA  . SER A 1 114 ? 29.479 30.302 19.832 1.00 26.95 ? 114 SER A CA  1 
ATOM   903  C  C   . SER A 1 114 ? 29.018 31.738 20.211 1.00 26.59 ? 114 SER A C   1 
ATOM   904  O  O   . SER A 1 114 ? 29.746 32.745 20.052 1.00 25.27 ? 114 SER A O   1 
ATOM   905  C  CB  . SER A 1 114 ? 30.268 29.613 20.971 1.00 26.69 ? 114 SER A CB  1 
ATOM   906  O  OG  . SER A 1 114 ? 31.105 30.498 21.640 1.00 29.16 ? 114 SER A OG  1 
ATOM   907  N  N   . VAL A 1 115 ? 27.806 31.815 20.771 1.00 23.69 ? 115 VAL A N   1 
ATOM   908  C  CA  . VAL A 1 115 ? 27.251 33.045 21.188 1.00 23.17 ? 115 VAL A CA  1 
ATOM   909  C  C   . VAL A 1 115 ? 28.053 33.577 22.254 1.00 23.21 ? 115 VAL A C   1 
ATOM   910  O  O   . VAL A 1 115 ? 28.314 34.766 22.238 1.00 23.14 ? 115 VAL A O   1 
ATOM   911  C  CB  . VAL A 1 115 ? 25.767 32.943 21.653 1.00 25.09 ? 115 VAL A CB  1 
ATOM   912  C  CG1 . VAL A 1 115 ? 25.281 34.257 22.307 1.00 28.05 ? 115 VAL A CG1 1 
ATOM   913  C  CG2 . VAL A 1 115 ? 24.902 32.659 20.389 1.00 27.13 ? 115 VAL A CG2 1 
ATOM   914  N  N   . SER A 1 116 ? 28.507 32.777 23.235 1.00 23.06 ? 116 SER A N   1 
ATOM   915  C  CA  . SER A 1 116 ? 29.243 33.395 24.304 1.00 22.59 ? 116 SER A CA  1 
ATOM   916  C  C   . SER A 1 116 ? 30.567 34.048 23.834 1.00 19.36 ? 116 SER A C   1 
ATOM   917  O  O   . SER A 1 116 ? 30.970 35.054 24.387 1.00 19.52 ? 116 SER A O   1 
ATOM   918  C  CB  . SER A 1 116 ? 29.638 32.404 25.423 1.00 25.85 ? 116 SER A CB  1 
ATOM   919  O  OG  . SER A 1 116 ? 29.975 31.172 24.788 1.00 33.10 ? 116 SER A OG  1 
ATOM   920  N  N   . SER A 1 117 ? 31.320 33.465 22.935 1.00 20.43 ? 117 SER A N   1 
ATOM   921  C  CA  . SER A 1 117 ? 32.554 34.146 22.492 1.00 23.30 ? 117 SER A CA  1 
ATOM   922  C  C   . SER A 1 117 ? 32.259 35.503 21.734 1.00 21.29 ? 117 SER A C   1 
ATOM   923  O  O   . SER A 1 117 ? 32.941 36.496 21.892 1.00 22.09 ? 117 SER A O   1 
ATOM   924  C  CB  . SER A 1 117 ? 33.168 33.166 21.507 1.00 24.47 ? 117 SER A CB  1 
ATOM   925  O  OG  . SER A 1 117 ? 33.707 32.087 22.265 1.00 29.15 ? 117 SER A OG  1 
ATOM   926  N  N   . LEU A 1 118 ? 31.155 35.505 20.986 1.00 20.81 ? 118 LEU A N   1 
ATOM   927  C  CA  . LEU A 1 118 ? 30.718 36.679 20.227 1.00 20.16 ? 118 LEU A CA  1 
ATOM   928  C  C   . LEU A 1 118 ? 30.385 37.835 21.156 1.00 19.00 ? 118 LEU A C   1 
ATOM   929  O  O   . LEU A 1 118 ? 30.866 39.020 21.078 1.00 18.07 ? 118 LEU A O   1 
ATOM   930  C  CB  . LEU A 1 118 ? 29.483 36.296 19.391 1.00 21.46 ? 118 LEU A CB  1 
ATOM   931  C  CG  . LEU A 1 118 ? 28.924 37.316 18.412 1.00 19.90 ? 118 LEU A CG  1 
ATOM   932  C  CD1 . LEU A 1 118 ? 30.060 37.743 17.439 1.00 22.52 ? 118 LEU A CD1 1 
ATOM   933  C  CD2 . LEU A 1 118 ? 27.654 36.897 17.686 1.00 22.45 ? 118 LEU A CD2 1 
ATOM   934  N  N   . LEU A 1 119 ? 29.646 37.471 22.160 1.00 19.52 ? 119 LEU A N   1 
ATOM   935  C  CA  . LEU A 1 119 ? 29.178 38.432 23.126 1.00 23.35 ? 119 LEU A CA  1 
ATOM   936  C  C   . LEU A 1 119 ? 30.269 38.948 23.966 1.00 22.69 ? 119 LEU A C   1 
ATOM   937  O  O   . LEU A 1 119 ? 30.291 40.118 24.353 1.00 22.80 ? 119 LEU A O   1 
ATOM   938  C  CB  . LEU A 1 119 ? 28.175 37.728 24.084 1.00 26.12 ? 119 LEU A CB  1 
ATOM   939  C  CG  . LEU A 1 119 ? 26.994 38.469 24.709 1.00 32.29 ? 119 LEU A CG  1 
ATOM   940  C  CD1 . LEU A 1 119 ? 26.436 39.628 23.954 1.00 30.00 ? 119 LEU A CD1 1 
ATOM   941  C  CD2 . LEU A 1 119 ? 25.954 37.339 24.788 1.00 38.51 ? 119 LEU A CD2 1 
ATOM   942  N  N   . LYS A 1 120 ? 31.230 38.071 24.209 1.00 25.46 ? 120 LYS A N   1 
ATOM   943  C  CA  . LYS A 1 120 ? 32.468 38.505 24.856 1.00 26.69 ? 120 LYS A CA  1 
ATOM   944  C  C   . LYS A 1 120 ? 33.245 39.533 24.015 1.00 25.71 ? 120 LYS A C   1 
ATOM   945  O  O   . LYS A 1 120 ? 33.798 40.507 24.545 1.00 26.28 ? 120 LYS A O   1 
ATOM   946  C  CB  . LYS A 1 120 ? 33.364 37.280 25.098 1.00 26.77 ? 120 LYS A CB  1 
ATOM   947  C  CG  . LYS A 1 120 ? 34.490 37.606 26.053 1.00 36.51 ? 120 LYS A CG  1 
ATOM   948  C  CD  . LYS A 1 120 ? 35.556 36.517 26.174 1.00 43.51 ? 120 LYS A CD  1 
ATOM   949  C  CE  . LYS A 1 120 ? 36.678 36.943 27.167 1.00 46.54 ? 120 LYS A CE  1 
ATOM   950  N  NZ  . LYS A 1 120 ? 37.594 35.761 27.385 1.00 46.63 ? 120 LYS A NZ  1 
ATOM   951  N  N   . VAL A 1 121 ? 33.360 39.326 22.696 1.00 25.76 ? 121 VAL A N   1 
ATOM   952  C  CA  . VAL A 1 121 ? 34.020 40.412 21.919 1.00 24.13 ? 121 VAL A CA  1 
ATOM   953  C  C   . VAL A 1 121 ? 33.235 41.717 21.970 1.00 22.25 ? 121 VAL A C   1 
ATOM   954  O  O   . VAL A 1 121 ? 33.761 42.776 22.274 1.00 23.08 ? 121 VAL A O   1 
ATOM   955  C  CB  . VAL A 1 121 ? 34.234 39.986 20.533 1.00 26.18 ? 121 VAL A CB  1 
ATOM   956  C  CG1 . VAL A 1 121 ? 34.682 41.190 19.678 1.00 28.97 ? 121 VAL A CG1 1 
ATOM   957  C  CG2 . VAL A 1 121 ? 35.233 38.723 20.525 1.00 26.27 ? 121 VAL A CG2 1 
ATOM   958  N  N   . PHE A 1 122 ? 31.917 41.658 21.828 1.00 21.72 ? 122 PHE A N   1 
ATOM   959  C  CA  . PHE A 1 122 ? 31.093 42.830 21.761 1.00 19.85 ? 122 PHE A CA  1 
ATOM   960  C  C   . PHE A 1 122 ? 30.965 43.479 23.125 1.00 22.65 ? 122 PHE A C   1 
ATOM   961  O  O   . PHE A 1 122 ? 30.639 44.670 23.227 1.00 20.44 ? 122 PHE A O   1 
ATOM   962  C  CB  . PHE A 1 122 ? 29.719 42.463 21.157 1.00 21.25 ? 122 PHE A CB  1 
ATOM   963  C  CG  . PHE A 1 122 ? 29.696 42.526 19.665 1.00 19.35 ? 122 PHE A CG  1 
ATOM   964  C  CD1 . PHE A 1 122 ? 29.342 43.710 19.056 1.00 20.82 ? 122 PHE A CD1 1 
ATOM   965  C  CD2 . PHE A 1 122 ? 30.098 41.453 18.866 1.00 19.71 ? 122 PHE A CD2 1 
ATOM   966  C  CE1 . PHE A 1 122 ? 29.384 43.848 17.668 1.00 21.29 ? 122 PHE A CE1 1 
ATOM   967  C  CE2 . PHE A 1 122 ? 30.104 41.566 17.484 1.00 19.36 ? 122 PHE A CE2 1 
ATOM   968  C  CZ  . PHE A 1 122 ? 29.724 42.826 16.878 1.00 18.38 ? 122 PHE A CZ  1 
ATOM   969  N  N   . ASN A 1 123 ? 31.295 42.757 24.185 1.00 21.54 ? 123 ASN A N   1 
ATOM   970  C  CA  . ASN A 1 123 ? 31.315 43.397 25.502 1.00 23.20 ? 123 ASN A CA  1 
ATOM   971  C  C   . ASN A 1 123 ? 32.737 43.853 25.911 1.00 24.57 ? 123 ASN A C   1 
ATOM   972  O  O   . ASN A 1 123 ? 32.922 44.410 26.933 1.00 26.14 ? 123 ASN A O   1 
ATOM   973  C  CB  . ASN A 1 123 ? 30.650 42.425 26.551 1.00 23.90 ? 123 ASN A CB  1 
ATOM   974  C  CG  . ASN A 1 123 ? 29.164 42.608 26.532 1.00 21.87 ? 123 ASN A CG  1 
ATOM   975  O  OD1 . ASN A 1 123 ? 28.712 43.752 26.593 1.00 23.82 ? 123 ASN A OD1 1 
ATOM   976  N  ND2 . ASN A 1 123 ? 28.400 41.543 26.395 1.00 31.49 ? 123 ASN A ND2 1 
ATOM   977  N  N   . ASP A 1 124 ? 33.720 43.684 25.059 1.00 24.62 ? 124 ASP A N   1 
ATOM   978  C  CA  . ASP A 1 124 ? 35.068 44.170 25.365 1.00 26.54 ? 124 ASP A CA  1 
ATOM   979  C  C   . ASP A 1 124 ? 35.094 45.574 24.771 1.00 28.37 ? 124 ASP A C   1 
ATOM   980  O  O   . ASP A 1 124 ? 34.978 45.710 23.562 1.00 25.53 ? 124 ASP A O   1 
ATOM   981  C  CB  . ASP A 1 124 ? 36.098 43.222 24.721 1.00 28.39 ? 124 ASP A CB  1 
ATOM   982  C  CG  . ASP A 1 124 ? 37.522 43.800 24.683 1.00 36.20 ? 124 ASP A CG  1 
ATOM   983  O  OD1 . ASP A 1 124 ? 37.728 44.928 25.129 1.00 41.39 ? 124 ASP A OD1 1 
ATOM   984  O  OD2 . ASP A 1 124 ? 38.498 43.184 24.188 1.00 48.12 ? 124 ASP A OD2 1 
ATOM   985  N  N   . GLN A 1 125 ? 35.206 46.595 25.623 1.00 27.59 ? 125 GLN A N   1 
ATOM   986  C  CA  . GLN A 1 125 ? 35.142 47.971 25.211 1.00 30.05 ? 125 GLN A CA  1 
ATOM   987  C  C   . GLN A 1 125 ? 35.995 48.225 23.967 1.00 29.09 ? 125 GLN A C   1 
ATOM   988  O  O   . GLN A 1 125 ? 35.458 48.740 22.940 1.00 29.58 ? 125 GLN A O   1 
ATOM   989  C  CB  . GLN A 1 125 ? 35.556 48.939 26.296 1.00 30.72 ? 125 GLN A CB  1 
ATOM   990  C  CG  . GLN A 1 125 ? 35.212 50.383 25.943 1.00 33.90 ? 125 GLN A CG  1 
ATOM   991  C  CD  . GLN A 1 125 ? 33.729 50.723 26.111 1.00 35.49 ? 125 GLN A CD  1 
ATOM   992  O  OE1 . GLN A 1 125 ? 33.117 50.355 27.117 1.00 39.36 ? 125 GLN A OE1 1 
ATOM   993  N  NE2 . GLN A 1 125 ? 33.152 51.438 25.134 1.00 32.45 ? 125 GLN A NE2 1 
ATOM   994  N  N   . SER A 1 126 ? 37.247 47.823 24.015 1.00 26.10 ? 126 SER A N   1 
ATOM   995  C  CA  . SER A 1 126 ? 38.156 48.092 22.915 1.00 27.11 ? 126 SER A CA  1 
ATOM   996  C  C   . SER A 1 126 ? 37.860 47.414 21.582 1.00 26.17 ? 126 SER A C   1 
ATOM   997  O  O   . SER A 1 126 ? 37.806 48.084 20.593 1.00 25.53 ? 126 SER A O   1 
ATOM   998  C  CB  . SER A 1 126 ? 39.638 47.812 23.225 1.00 28.96 ? 126 SER A CB  1 
ATOM   999  O  OG  . SER A 1 126 ? 40.370 48.058 21.988 1.00 35.46 ? 126 SER A OG  1 
ATOM   1000 N  N   . ALA A 1 127 ? 37.697 46.102 21.539 1.00 24.33 ? 127 ALA A N   1 
ATOM   1001 C  CA  . ALA A 1 127 ? 37.365 45.373 20.331 1.00 24.01 ? 127 ALA A CA  1 
ATOM   1002 C  C   . ALA A 1 127 ? 35.955 45.778 19.834 1.00 23.69 ? 127 ALA A C   1 
ATOM   1003 O  O   . ALA A 1 127 ? 35.674 45.894 18.657 1.00 24.91 ? 127 ALA A O   1 
ATOM   1004 C  CB  . ALA A 1 127 ? 37.471 43.876 20.580 1.00 25.41 ? 127 ALA A CB  1 
ATOM   1005 N  N   . SER A 1 128 ? 35.053 46.053 20.737 1.00 22.83 ? 128 SER A N   1 
ATOM   1006 C  CA  . SER A 1 128 ? 33.732 46.396 20.352 1.00 22.59 ? 128 SER A CA  1 
ATOM   1007 C  C   . SER A 1 128 ? 33.670 47.801 19.672 1.00 23.77 ? 128 SER A C   1 
ATOM   1008 O  O   . SER A 1 128 ? 32.959 47.945 18.733 1.00 22.58 ? 128 SER A O   1 
ATOM   1009 C  CB  . SER A 1 128 ? 32.809 46.348 21.535 1.00 22.58 ? 128 SER A CB  1 
ATOM   1010 O  OG  . SER A 1 128 ? 31.454 46.297 21.085 1.00 23.79 ? 128 SER A OG  1 
ATOM   1011 N  N   . ASP A 1 129 ? 34.391 48.799 20.175 1.00 24.37 ? 129 ASP A N   1 
ATOM   1012 C  CA  . ASP A 1 129 ? 34.497 50.103 19.604 1.00 23.86 ? 129 ASP A CA  1 
ATOM   1013 C  C   . ASP A 1 129 ? 35.219 50.126 18.268 1.00 22.51 ? 129 ASP A C   1 
ATOM   1014 O  O   . ASP A 1 129 ? 34.892 50.965 17.433 1.00 20.74 ? 129 ASP A O   1 
ATOM   1015 C  CB  . ASP A 1 129 ? 35.184 51.095 20.537 1.00 25.38 ? 129 ASP A CB  1 
ATOM   1016 C  CG  . ASP A 1 129 ? 34.250 51.623 21.612 1.00 29.79 ? 129 ASP A CG  1 
ATOM   1017 O  OD1 . ASP A 1 129 ? 32.998 51.387 21.593 1.00 29.50 ? 129 ASP A OD1 1 
ATOM   1018 O  OD2 . ASP A 1 129 ? 34.739 52.235 22.568 1.00 35.07 ? 129 ASP A OD2 1 
ATOM   1019 N  N   . HIS A 1 130 ? 36.211 49.279 18.093 1.00 20.73 ? 130 HIS A N   1 
ATOM   1020 C  CA  . HIS A 1 130 ? 36.786 49.088 16.775 1.00 22.00 ? 130 HIS A CA  1 
ATOM   1021 C  C   . HIS A 1 130 ? 35.858 48.568 15.712 1.00 19.77 ? 130 HIS A C   1 
ATOM   1022 O  O   . HIS A 1 130 ? 35.914 48.994 14.538 1.00 19.68 ? 130 HIS A O   1 
ATOM   1023 C  CB  . HIS A 1 130 ? 37.932 48.089 16.800 1.00 23.20 ? 130 HIS A CB  1 
ATOM   1024 C  CG  . HIS A 1 130 ? 39.204 48.693 17.277 1.00 30.76 ? 130 HIS A CG  1 
ATOM   1025 N  ND1 . HIS A 1 130 ? 39.383 49.042 18.594 1.00 38.43 ? 130 HIS A ND1 1 
ATOM   1026 C  CD2 . HIS A 1 130 ? 40.352 49.011 16.636 1.00 41.31 ? 130 HIS A CD2 1 
ATOM   1027 C  CE1 . HIS A 1 130 ? 40.583 49.568 18.743 1.00 42.46 ? 130 HIS A CE1 1 
ATOM   1028 N  NE2 . HIS A 1 130 ? 41.196 49.552 17.575 1.00 39.36 ? 130 HIS A NE2 1 
ATOM   1029 N  N   . ILE A 1 131 ? 35.039 47.639 16.172 1.00 17.69 ? 131 ILE A N   1 
ATOM   1030 C  CA  . ILE A 1 131 ? 34.005 47.045 15.403 1.00 18.00 ? 131 ILE A CA  1 
ATOM   1031 C  C   . ILE A 1 131 ? 33.013 48.164 15.023 1.00 15.57 ? 131 ILE A C   1 
ATOM   1032 O  O   . ILE A 1 131 ? 32.684 48.242 13.835 1.00 14.76 ? 131 ILE A O   1 
ATOM   1033 C  CB  . ILE A 1 131 ? 33.331 45.796 16.150 1.00 18.29 ? 131 ILE A CB  1 
ATOM   1034 C  CG1 . ILE A 1 131 ? 34.244 44.581 16.104 1.00 18.61 ? 131 ILE A CG1 1 
ATOM   1035 C  CG2 . ILE A 1 131 ? 31.994 45.452 15.479 1.00 22.76 ? 131 ILE A CG2 1 
ATOM   1036 C  CD1 . ILE A 1 131 ? 33.923 43.518 17.148 1.00 18.65 ? 131 ILE A CD1 1 
ATOM   1037 N  N   . VAL A 1 132 ? 32.555 48.995 15.965 1.00 15.84 ? 132 VAL A N   1 
ATOM   1038 C  CA  . VAL A 1 132 ? 31.705 50.155 15.692 1.00 15.27 ? 132 VAL A CA  1 
ATOM   1039 C  C   . VAL A 1 132 ? 32.374 51.095 14.676 1.00 15.79 ? 132 VAL A C   1 
ATOM   1040 O  O   . VAL A 1 132 ? 31.733 51.528 13.703 1.00 12.91 ? 132 VAL A O   1 
ATOM   1041 C  CB  . VAL A 1 132 ? 31.180 50.912 16.907 1.00 14.34 ? 132 VAL A CB  1 
ATOM   1042 C  CG1 . VAL A 1 132 ? 30.507 52.244 16.582 1.00 14.43 ? 132 VAL A CG1 1 
ATOM   1043 C  CG2 . VAL A 1 132 ? 30.221 50.027 17.743 1.00 17.38 ? 132 VAL A CG2 1 
ATOM   1044 N  N   . GLN A 1 133 ? 33.631 51.403 14.901 1.00 16.16 ? 133 GLN A N   1 
ATOM   1045 C  CA  . GLN A 1 133 ? 34.307 52.361 14.032 1.00 17.46 ? 133 GLN A CA  1 
ATOM   1046 C  C   . GLN A 1 133 ? 34.403 51.793 12.583 1.00 15.14 ? 133 GLN A C   1 
ATOM   1047 O  O   . GLN A 1 133 ? 34.201 52.548 11.612 1.00 16.43 ? 133 GLN A O   1 
ATOM   1048 C  CB  . GLN A 1 133 ? 35.635 52.774 14.628 1.00 18.91 ? 133 GLN A CB  1 
ATOM   1049 C  CG  . GLN A 1 133 ? 36.425 53.731 13.719 1.00 20.71 ? 133 GLN A CG  1 
ATOM   1050 C  CD  . GLN A 1 133 ? 35.748 55.043 13.719 1.00 25.58 ? 133 GLN A CD  1 
ATOM   1051 O  OE1 . GLN A 1 133 ? 35.978 55.697 14.641 1.00 20.13 ? 133 GLN A OE1 1 
ATOM   1052 N  NE2 . GLN A 1 133 ? 34.875 55.416 12.698 1.00 19.02 ? 133 GLN A NE2 1 
ATOM   1053 N  N   . PHE A 1 134 ? 34.692 50.500 12.434 1.00 16.14 ? 134 PHE A N   1 
ATOM   1054 C  CA  . PHE A 1 134 ? 34.602 49.878 11.127 1.00 15.62 ? 134 PHE A CA  1 
ATOM   1055 C  C   . PHE A 1 134 ? 33.257 50.092 10.439 1.00 15.15 ? 134 PHE A C   1 
ATOM   1056 O  O   . PHE A 1 134 ? 33.193 50.455 9.256  1.00 13.61 ? 134 PHE A O   1 
ATOM   1057 C  CB  . PHE A 1 134 ? 34.809 48.387 11.187 1.00 15.48 ? 134 PHE A CB  1 
ATOM   1058 C  CG  . PHE A 1 134 ? 34.705 47.713 9.869  1.00 14.22 ? 134 PHE A CG  1 
ATOM   1059 C  CD1 . PHE A 1 134 ? 35.655 47.952 8.877  1.00 22.68 ? 134 PHE A CD1 1 
ATOM   1060 C  CD2 . PHE A 1 134 ? 33.643 46.940 9.585  1.00 14.21 ? 134 PHE A CD2 1 
ATOM   1061 C  CE1 . PHE A 1 134 ? 35.529 47.321 7.655  1.00 25.78 ? 134 PHE A CE1 1 
ATOM   1062 C  CE2 . PHE A 1 134 ? 33.590 46.263 8.390  1.00 23.19 ? 134 PHE A CE2 1 
ATOM   1063 C  CZ  . PHE A 1 134 ? 34.508 46.500 7.437  1.00 20.44 ? 134 PHE A CZ  1 
ATOM   1064 N  N   . LEU A 1 135 ? 32.182 49.746 11.154 1.00 13.75 ? 135 LEU A N   1 
ATOM   1065 C  CA  . LEU A 1 135 ? 30.831 49.795 10.626 1.00 13.77 ? 135 LEU A CA  1 
ATOM   1066 C  C   . LEU A 1 135 ? 30.504 51.249 10.254 1.00 14.51 ? 135 LEU A C   1 
ATOM   1067 O  O   . LEU A 1 135 ? 29.937 51.464 9.205  1.00 15.34 ? 135 LEU A O   1 
ATOM   1068 C  CB  . LEU A 1 135 ? 29.862 49.207 11.574 1.00 15.07 ? 135 LEU A CB  1 
ATOM   1069 C  CG  . LEU A 1 135 ? 30.025 47.700 11.816 1.00 10.06 ? 135 LEU A CG  1 
ATOM   1070 C  CD1 . LEU A 1 135 ? 29.020 47.368 12.898 1.00 16.02 ? 135 LEU A CD1 1 
ATOM   1071 C  CD2 . LEU A 1 135 ? 29.611 46.965 10.565 1.00 14.86 ? 135 LEU A CD2 1 
ATOM   1072 N  N   . ARG A 1 136 ? 30.988 52.226 11.007 1.00 10.39 ? 136 ARG A N   1 
ATOM   1073 C  CA  . ARG A 1 136 ? 30.844 53.637 10.673 1.00 10.98 ? 136 ARG A CA  1 
ATOM   1074 C  C   . ARG A 1 136 ? 31.614 54.088 9.409  1.00 11.97 ? 136 ARG A C   1 
ATOM   1075 O  O   . ARG A 1 136 ? 31.149 54.842 8.555  1.00 12.36 ? 136 ARG A O   1 
ATOM   1076 C  CB  . ARG A 1 136 ? 31.289 54.535 11.847 1.00 11.47 ? 136 ARG A CB  1 
ATOM   1077 C  CG  . ARG A 1 136 ? 30.442 54.566 13.084 1.00 12.24 ? 136 ARG A CG  1 
ATOM   1078 C  CD  . ARG A 1 136 ? 30.932 55.421 14.137 1.00 16.20 ? 136 ARG A CD  1 
ATOM   1079 N  NE  . ARG A 1 136 ? 29.961 55.631 15.184 1.00 14.85 ? 136 ARG A NE  1 
ATOM   1080 C  CZ  . ARG A 1 136 ? 28.915 56.471 15.172 1.00 14.74 ? 136 ARG A CZ  1 
ATOM   1081 N  NH1 . ARG A 1 136 ? 28.648 57.276 14.192 1.00 15.54 ? 136 ARG A NH1 1 
ATOM   1082 N  NH2 . ARG A 1 136 ? 28.131 56.526 16.248 1.00 2.00  ? 136 ARG A NH2 1 
ATOM   1083 N  N   . LEU A 1 137 ? 32.799 53.618 9.266  1.00 11.10 ? 137 LEU A N   1 
ATOM   1084 C  CA  . LEU A 1 137 ? 33.565 53.948 8.075  1.00 12.50 ? 137 LEU A CA  1 
ATOM   1085 C  C   . LEU A 1 137 ? 32.952 53.249 6.878  1.00 13.25 ? 137 LEU A C   1 
ATOM   1086 O  O   . LEU A 1 137 ? 32.946 53.833 5.779  1.00 14.38 ? 137 LEU A O   1 
ATOM   1087 C  CB  . LEU A 1 137 ? 35.003 53.463 8.214  1.00 11.85 ? 137 LEU A CB  1 
ATOM   1088 C  CG  . LEU A 1 137 ? 35.837 54.194 9.241  1.00 14.65 ? 137 LEU A CG  1 
ATOM   1089 C  CD1 . LEU A 1 137 ? 37.154 53.571 9.417  1.00 15.42 ? 137 LEU A CD1 1 
ATOM   1090 C  CD2 . LEU A 1 137 ? 36.114 55.678 8.904  1.00 23.18 ? 137 LEU A CD2 1 
ATOM   1091 N  N   . LEU A 1 138 ? 32.470 52.042 7.038  1.00 12.46 ? 138 LEU A N   1 
ATOM   1092 C  CA  . LEU A 1 138 ? 31.831 51.382 5.954  1.00 14.76 ? 138 LEU A CA  1 
ATOM   1093 C  C   . LEU A 1 138 ? 30.568 52.149 5.479  1.00 15.42 ? 138 LEU A C   1 
ATOM   1094 O  O   . LEU A 1 138 ? 30.251 52.144 4.296  1.00 13.57 ? 138 LEU A O   1 
ATOM   1095 C  CB  . LEU A 1 138 ? 31.433 49.934 6.317  1.00 15.16 ? 138 LEU A CB  1 
ATOM   1096 C  CG  . LEU A 1 138 ? 30.699 49.202 5.226  1.00 22.33 ? 138 LEU A CG  1 
ATOM   1097 C  CD1 . LEU A 1 138 ? 31.665 49.044 4.070  1.00 21.74 ? 138 LEU A CD1 1 
ATOM   1098 C  CD2 . LEU A 1 138 ? 30.251 47.922 5.803  1.00 23.36 ? 138 LEU A CD2 1 
ATOM   1099 N  N   . THR A 1 139 ? 29.785 52.643 6.445  1.00 12.69 ? 139 THR A N   1 
ATOM   1100 C  CA  . THR A 1 139 ? 28.598 53.403 6.204  1.00 11.78 ? 139 THR A CA  1 
ATOM   1101 C  C   . THR A 1 139 ? 28.933 54.668 5.421  1.00 10.88 ? 139 THR A C   1 
ATOM   1102 O  O   . THR A 1 139 ? 28.255 55.047 4.513  1.00 8.14  ? 139 THR A O   1 
ATOM   1103 C  CB  . THR A 1 139 ? 27.914 53.774 7.587  1.00 11.39 ? 139 THR A CB  1 
ATOM   1104 O  OG1 . THR A 1 139 ? 27.557 52.559 8.262  1.00 11.02 ? 139 THR A OG1 1 
ATOM   1105 C  CG2 . THR A 1 139 ? 26.608 54.515 7.441  1.00 13.31 ? 139 THR A CG2 1 
ATOM   1106 N  N   . SER A 1 140 ? 29.943 55.377 5.887  1.00 10.67 ? 140 SER A N   1 
ATOM   1107 C  CA  . SER A 1 140 ? 30.380 56.563 5.263  1.00 12.21 ? 140 SER A CA  1 
ATOM   1108 C  C   . SER A 1 140 ? 30.852 56.285 3.817  1.00 12.21 ? 140 SER A C   1 
ATOM   1109 O  O   . SER A 1 140 ? 30.499 57.041 2.907  1.00 13.31 ? 140 SER A O   1 
ATOM   1110 C  CB  . SER A 1 140 ? 31.555 57.072 6.053  1.00 12.13 ? 140 SER A CB  1 
ATOM   1111 O  OG  . SER A 1 140 ? 32.037 58.208 5.418  1.00 13.94 ? 140 SER A OG  1 
ATOM   1112 N  N   . ALA A 1 141 ? 31.665 55.250 3.631  1.00 11.69 ? 141 ALA A N   1 
ATOM   1113 C  CA  . ALA A 1 141 ? 32.115 54.847 2.260  1.00 13.53 ? 141 ALA A CA  1 
ATOM   1114 C  C   . ALA A 1 141 ? 30.933 54.644 1.379  1.00 14.76 ? 141 ALA A C   1 
ATOM   1115 O  O   . ALA A 1 141 ? 30.867 55.074 0.227  1.00 15.06 ? 141 ALA A O   1 
ATOM   1116 C  CB  . ALA A 1 141 ? 32.971 53.605 2.275  1.00 11.07 ? 141 ALA A CB  1 
ATOM   1117 N  N   . PHE A 1 142 ? 29.958 53.932 1.918  1.00 15.82 ? 142 PHE A N   1 
ATOM   1118 C  CA  . PHE A 1 142 ? 28.795 53.553 1.108  1.00 13.66 ? 142 PHE A CA  1 
ATOM   1119 C  C   . PHE A 1 142 ? 27.996 54.751 0.725  1.00 16.62 ? 142 PHE A C   1 
ATOM   1120 O  O   . PHE A 1 142 ? 27.493 54.851 -0.429 1.00 16.85 ? 142 PHE A O   1 
ATOM   1121 C  CB  . PHE A 1 142 ? 27.983 52.492 1.852  1.00 15.43 ? 142 PHE A CB  1 
ATOM   1122 C  CG  . PHE A 1 142 ? 26.846 51.940 1.061  1.00 17.62 ? 142 PHE A CG  1 
ATOM   1123 C  CD1 . PHE A 1 142 ? 27.087 50.846 0.224  1.00 23.50 ? 142 PHE A CD1 1 
ATOM   1124 C  CD2 . PHE A 1 142 ? 25.578 52.579 1.046  1.00 17.01 ? 142 PHE A CD2 1 
ATOM   1125 C  CE1 . PHE A 1 142 ? 26.079 50.308 -0.503 1.00 21.68 ? 142 PHE A CE1 1 
ATOM   1126 C  CE2 . PHE A 1 142 ? 24.590 52.027 0.256  1.00 18.71 ? 142 PHE A CE2 1 
ATOM   1127 C  CZ  . PHE A 1 142 ? 24.847 50.901 -0.508 1.00 19.62 ? 142 PHE A CZ  1 
ATOM   1128 N  N   . ILE A 1 143 ? 27.836 55.680 1.689  1.00 14.98 ? 143 ILE A N   1 
ATOM   1129 C  CA  . ILE A 1 143 ? 27.268 56.972 1.377  1.00 13.72 ? 143 ILE A CA  1 
ATOM   1130 C  C   . ILE A 1 143 ? 27.984 57.753 0.282  1.00 13.76 ? 143 ILE A C   1 
ATOM   1131 O  O   . ILE A 1 143 ? 27.382 58.253 -0.712 1.00 16.32 ? 143 ILE A O   1 
ATOM   1132 C  CB  . ILE A 1 143 ? 27.058 57.809 2.688  1.00 14.57 ? 143 ILE A CB  1 
ATOM   1133 C  CG1 . ILE A 1 143 ? 26.037 57.108 3.675  1.00 11.11 ? 143 ILE A CG1 1 
ATOM   1134 C  CG2 . ILE A 1 143 ? 26.496 59.148 2.295  1.00 15.74 ? 143 ILE A CG2 1 
ATOM   1135 C  CD1 . ILE A 1 143 ? 26.062 57.735 4.992  1.00 14.35 ? 143 ILE A CD1 1 
ATOM   1136 N  N   . ARG A 1 144 ? 29.254 57.935 0.476  1.00 13.16 ? 144 ARG A N   1 
ATOM   1137 C  CA  . ARG A 1 144 ? 30.070 58.730 -0.404 1.00 14.61 ? 144 ARG A CA  1 
ATOM   1138 C  C   . ARG A 1 144 ? 30.080 58.090 -1.813 1.00 15.78 ? 144 ARG A C   1 
ATOM   1139 O  O   . ARG A 1 144 ? 29.992 58.833 -2.780 1.00 13.93 ? 144 ARG A O   1 
ATOM   1140 C  CB  . ARG A 1 144 ? 31.509 58.790 0.111  1.00 12.80 ? 144 ARG A CB  1 
ATOM   1141 C  CG  . ARG A 1 144 ? 31.720 59.668 1.305  1.00 12.03 ? 144 ARG A CG  1 
ATOM   1142 C  CD  . ARG A 1 144 ? 33.068 59.349 1.961  1.00 11.59 ? 144 ARG A CD  1 
ATOM   1143 N  NE  . ARG A 1 144 ? 33.212 60.052 3.207  1.00 18.15 ? 144 ARG A NE  1 
ATOM   1144 C  CZ  . ARG A 1 144 ? 33.576 61.337 3.276  1.00 22.82 ? 144 ARG A CZ  1 
ATOM   1145 N  NH1 . ARG A 1 144 ? 33.851 61.963 2.147  1.00 23.28 ? 144 ARG A NH1 1 
ATOM   1146 N  NH2 . ARG A 1 144 ? 33.660 61.977 4.447  1.00 22.16 ? 144 ARG A NH2 1 
ATOM   1147 N  N   . ASN A 1 145 ? 30.177 56.760 -1.911 1.00 13.48 ? 145 ASN A N   1 
ATOM   1148 C  CA  . ASN A 1 145 ? 30.230 56.089 -3.284 1.00 16.22 ? 145 ASN A CA  1 
ATOM   1149 C  C   . ASN A 1 145 ? 28.863 56.116 -3.997 1.00 17.80 ? 145 ASN A C   1 
ATOM   1150 O  O   . ASN A 1 145 ? 28.723 55.849 -5.158 1.00 17.48 ? 145 ASN A O   1 
ATOM   1151 C  CB  . ASN A 1 145 ? 30.696 54.643 -3.089 1.00 13.92 ? 145 ASN A CB  1 
ATOM   1152 C  CG  . ASN A 1 145 ? 32.110 54.558 -2.672 1.00 16.75 ? 145 ASN A CG  1 
ATOM   1153 O  OD1 . ASN A 1 145 ? 32.865 55.509 -2.897 1.00 16.21 ? 145 ASN A OD1 1 
ATOM   1154 N  ND2 . ASN A 1 145 ? 32.526 53.439 -1.992 1.00 12.10 ? 145 ASN A ND2 1 
ATOM   1155 N  N   . ARG A 1 146 ? 27.794 56.395 -3.235 1.00 17.87 ? 146 ARG A N   1 
ATOM   1156 C  CA  . ARG A 1 146 ? 26.470 56.532 -3.721 1.00 17.57 ? 146 ARG A CA  1 
ATOM   1157 C  C   . ARG A 1 146 ? 25.898 57.932 -3.434 1.00 17.36 ? 146 ARG A C   1 
ATOM   1158 O  O   . ARG A 1 146 ? 24.690 58.115 -3.123 1.00 18.17 ? 146 ARG A O   1 
ATOM   1159 C  CB  . ARG A 1 146 ? 25.665 55.443 -3.073 1.00 19.90 ? 146 ARG A CB  1 
ATOM   1160 C  CG  . ARG A 1 146 ? 25.913 53.984 -3.396 1.00 24.65 ? 146 ARG A CG  1 
ATOM   1161 C  CD  . ARG A 1 146 ? 24.648 53.159 -3.577 0.01 23.51 ? 146 ARG A CD  1 
ATOM   1162 N  NE  . ARG A 1 146 ? 23.760 53.729 -4.592 0.01 23.57 ? 146 ARG A NE  1 
ATOM   1163 C  CZ  . ARG A 1 146 ? 22.442 53.546 -4.649 0.01 23.39 ? 146 ARG A CZ  1 
ATOM   1164 N  NH1 . ARG A 1 146 ? 21.810 52.797 -3.750 0.01 23.25 ? 146 ARG A NH1 1 
ATOM   1165 N  NH2 . ARG A 1 146 ? 21.744 54.121 -5.622 0.01 23.53 ? 146 ARG A NH2 1 
ATOM   1166 N  N   . ALA A 1 147 ? 26.725 58.948 -3.606 1.00 18.00 ? 147 ALA A N   1 
ATOM   1167 C  CA  . ALA A 1 147 ? 26.356 60.285 -3.260 1.00 19.98 ? 147 ALA A CA  1 
ATOM   1168 C  C   . ALA A 1 147 ? 25.143 60.801 -4.119 1.00 23.34 ? 147 ALA A C   1 
ATOM   1169 O  O   . ALA A 1 147 ? 24.362 61.667 -3.652 1.00 22.93 ? 147 ALA A O   1 
ATOM   1170 C  CB  . ALA A 1 147 ? 27.491 61.275 -3.462 1.00 20.23 ? 147 ALA A CB  1 
ATOM   1171 N  N   . ASP A 1 148 ? 24.964 60.252 -5.306 1.00 22.81 ? 148 ASP A N   1 
ATOM   1172 C  CA  . ASP A 1 148 ? 23.922 60.711 -6.183 1.00 25.18 ? 148 ASP A CA  1 
ATOM   1173 C  C   . ASP A 1 148 ? 22.533 60.322 -5.687 1.00 26.41 ? 148 ASP A C   1 
ATOM   1174 O  O   . ASP A 1 148 ? 21.554 60.995 -6.015 1.00 27.82 ? 148 ASP A O   1 
ATOM   1175 C  CB  . ASP A 1 148 ? 24.130 60.077 -7.565 1.00 26.87 ? 148 ASP A CB  1 
ATOM   1176 C  CG  . ASP A 1 148 ? 23.792 58.592 -7.597 0.01 25.82 ? 148 ASP A CG  1 
ATOM   1177 O  OD1 . ASP A 1 148 ? 22.755 58.229 -8.191 0.01 26.11 ? 148 ASP A OD1 1 
ATOM   1178 O  OD2 . ASP A 1 148 ? 24.502 57.717 -7.057 0.01 26.11 ? 148 ASP A OD2 1 
ATOM   1179 N  N   . PHE A 1 149 ? 22.486 59.215 -4.931 1.00 23.65 ? 149 PHE A N   1 
ATOM   1180 C  CA  . PHE A 1 149 ? 21.316 58.806 -4.202 1.00 22.41 ? 149 PHE A CA  1 
ATOM   1181 C  C   . PHE A 1 149 ? 21.182 59.521 -2.862 1.00 18.74 ? 149 PHE A C   1 
ATOM   1182 O  O   . PHE A 1 149 ? 20.182 60.068 -2.541 1.00 18.26 ? 149 PHE A O   1 
ATOM   1183 C  CB  . PHE A 1 149 ? 21.364 57.246 -4.078 1.00 21.35 ? 149 PHE A CB  1 
ATOM   1184 C  CG  . PHE A 1 149 ? 20.243 56.695 -3.253 1.00 24.55 ? 149 PHE A CG  1 
ATOM   1185 C  CD1 . PHE A 1 149 ? 18.961 56.750 -3.730 1.00 25.81 ? 149 PHE A CD1 1 
ATOM   1186 C  CD2 . PHE A 1 149 ? 20.469 56.141 -1.968 1.00 21.48 ? 149 PHE A CD2 1 
ATOM   1187 C  CE1 . PHE A 1 149 ? 17.889 56.290 -2.916 1.00 23.42 ? 149 PHE A CE1 1 
ATOM   1188 C  CE2 . PHE A 1 149 ? 19.423 55.659 -1.224 1.00 23.39 ? 149 PHE A CE2 1 
ATOM   1189 C  CZ  . PHE A 1 149 ? 18.137 55.755 -1.700 1.00 18.57 ? 149 PHE A CZ  1 
ATOM   1190 N  N   . PHE A 1 150 ? 22.195 59.516 -2.036 1.00 18.94 ? 150 PHE A N   1 
ATOM   1191 C  CA  . PHE A 1 150 ? 22.049 59.971 -0.646 1.00 18.37 ? 150 PHE A CA  1 
ATOM   1192 C  C   . PHE A 1 150 ? 21.960 61.478 -0.509 1.00 17.20 ? 150 PHE A C   1 
ATOM   1193 O  O   . PHE A 1 150 ? 21.412 61.970 0.452  1.00 15.23 ? 150 PHE A O   1 
ATOM   1194 C  CB  . PHE A 1 150 ? 23.189 59.393 0.188  1.00 18.77 ? 150 PHE A CB  1 
ATOM   1195 C  CG  . PHE A 1 150 ? 22.951 58.027 0.543  1.00 18.10 ? 150 PHE A CG  1 
ATOM   1196 C  CD1 . PHE A 1 150 ? 22.016 57.740 1.512  1.00 17.14 ? 150 PHE A CD1 1 
ATOM   1197 C  CD2 . PHE A 1 150 ? 23.678 56.983 -0.062 1.00 14.99 ? 150 PHE A CD2 1 
ATOM   1198 C  CE1 . PHE A 1 150 ? 21.783 56.500 1.864  1.00 17.45 ? 150 PHE A CE1 1 
ATOM   1199 C  CE2 . PHE A 1 150 ? 23.441 55.699 0.342  1.00 17.69 ? 150 PHE A CE2 1 
ATOM   1200 C  CZ  . PHE A 1 150 ? 22.417 55.448 1.226  1.00 14.15 ? 150 PHE A CZ  1 
ATOM   1201 N  N   . ARG A 1 151 ? 22.421 62.208 -1.510 1.00 17.62 ? 151 ARG A N   1 
ATOM   1202 C  CA  . ARG A 1 151 ? 22.243 63.606 -1.515 1.00 19.70 ? 151 ARG A CA  1 
ATOM   1203 C  C   . ARG A 1 151 ? 20.820 64.041 -1.492 1.00 21.45 ? 151 ARG A C   1 
ATOM   1204 O  O   . ARG A 1 151 ? 20.541 65.122 -0.939 1.00 21.75 ? 151 ARG A O   1 
ATOM   1205 C  CB  . ARG A 1 151 ? 22.931 64.259 -2.710 1.00 23.34 ? 151 ARG A CB  1 
ATOM   1206 C  CG  . ARG A 1 151 ? 22.212 63.996 -3.997 1.00 30.45 ? 151 ARG A CG  1 
ATOM   1207 C  CD  . ARG A 1 151 ? 22.962 64.602 -5.210 1.00 39.38 ? 151 ARG A CD  1 
ATOM   1208 N  NE  . ARG A 1 151 ? 22.622 63.969 -6.492 1.00 42.16 ? 151 ARG A NE  1 
ATOM   1209 C  CZ  . ARG A 1 151 ? 21.700 64.369 -7.362 1.00 48.98 ? 151 ARG A CZ  1 
ATOM   1210 N  NH1 . ARG A 1 151 ? 20.934 65.446 -7.149 1.00 50.65 ? 151 ARG A NH1 1 
ATOM   1211 N  NH2 . ARG A 1 151 ? 21.565 63.664 -8.488 1.00 50.72 ? 151 ARG A NH2 1 
ATOM   1212 N  N   . HIS A 1 152 ? 19.898 63.248 -2.046 1.00 23.31 ? 152 HIS A N   1 
ATOM   1213 C  CA  . HIS A 1 152 ? 18.438 63.553 -1.943 1.00 23.44 ? 152 HIS A CA  1 
ATOM   1214 C  C   . HIS A 1 152 ? 17.924 63.537 -0.533 1.00 24.85 ? 152 HIS A C   1 
ATOM   1215 O  O   . HIS A 1 152 ? 16.793 63.976 -0.260 1.00 25.46 ? 152 HIS A O   1 
ATOM   1216 C  CB  . HIS A 1 152 ? 17.576 62.606 -2.799 1.00 24.85 ? 152 HIS A CB  1 
ATOM   1217 C  CG  . HIS A 1 152 ? 18.002 62.581 -4.205 1.00 23.71 ? 152 HIS A CG  1 
ATOM   1218 N  ND1 . HIS A 1 152 ? 18.261 63.754 -4.896 1.00 29.02 ? 152 HIS A ND1 1 
ATOM   1219 C  CD2 . HIS A 1 152 ? 18.340 61.560 -5.033 1.00 29.85 ? 152 HIS A CD2 1 
ATOM   1220 C  CE1 . HIS A 1 152 ? 18.761 63.449 -6.077 1.00 31.30 ? 152 HIS A CE1 1 
ATOM   1221 N  NE2 . HIS A 1 152 ? 18.782 62.125 -6.206 1.00 30.85 ? 152 HIS A NE2 1 
ATOM   1222 N  N   . PHE A 1 153 ? 18.715 63.087 0.432  1.00 24.96 ? 153 PHE A N   1 
ATOM   1223 C  CA  . PHE A 1 153 ? 18.198 63.093 1.800  1.00 25.67 ? 153 PHE A CA  1 
ATOM   1224 C  C   . PHE A 1 153 ? 18.589 64.244 2.705  1.00 26.88 ? 153 PHE A C   1 
ATOM   1225 O  O   . PHE A 1 153 ? 18.221 64.284 3.848  1.00 26.70 ? 153 PHE A O   1 
ATOM   1226 C  CB  . PHE A 1 153 ? 18.616 61.846 2.531  1.00 25.93 ? 153 PHE A CB  1 
ATOM   1227 C  CG  . PHE A 1 153 ? 18.005 60.655 2.004  1.00 25.32 ? 153 PHE A CG  1 
ATOM   1228 C  CD1 . PHE A 1 153 ? 16.690 60.359 2.319  1.00 34.03 ? 153 PHE A CD1 1 
ATOM   1229 C  CD2 . PHE A 1 153 ? 18.663 59.888 1.120  1.00 26.94 ? 153 PHE A CD2 1 
ATOM   1230 C  CE1 . PHE A 1 153 ? 16.060 59.196 1.757  1.00 34.94 ? 153 PHE A CE1 1 
ATOM   1231 C  CE2 . PHE A 1 153 ? 18.035 58.781 0.515  1.00 25.86 ? 153 PHE A CE2 1 
ATOM   1232 C  CZ  . PHE A 1 153 ? 16.772 58.406 0.868  1.00 27.73 ? 153 PHE A CZ  1 
ATOM   1233 N  N   . ILE A 1 154 ? 19.392 65.149 2.224  1.00 29.59 ? 154 ILE A N   1 
ATOM   1234 C  CA  . ILE A 1 154 ? 19.742 66.331 2.987  1.00 30.41 ? 154 ILE A CA  1 
ATOM   1235 C  C   . ILE A 1 154 ? 19.457 67.506 2.056  1.00 32.35 ? 154 ILE A C   1 
ATOM   1236 O  O   . ILE A 1 154 ? 19.136 67.285 0.875  1.00 29.67 ? 154 ILE A O   1 
ATOM   1237 C  CB  . ILE A 1 154 ? 21.204 66.300 3.336  1.00 30.27 ? 154 ILE A CB  1 
ATOM   1238 C  CG1 . ILE A 1 154 ? 22.014 66.392 2.058  1.00 32.25 ? 154 ILE A CG1 1 
ATOM   1239 C  CG2 . ILE A 1 154 ? 21.607 65.035 4.112  1.00 29.77 ? 154 ILE A CG2 1 
ATOM   1240 C  CD1 . ILE A 1 154 ? 23.435 66.093 2.266  1.00 37.27 ? 154 ILE A CD1 1 
ATOM   1241 N  N   . ASP A 1 155 ? 19.661 68.730 2.557  1.00 35.68 ? 155 ASP A N   1 
ATOM   1242 C  CA  . ASP A 1 155 ? 19.443 69.928 1.738  1.00 38.25 ? 155 ASP A CA  1 
ATOM   1243 C  C   . ASP A 1 155 ? 20.322 70.024 0.513  1.00 39.59 ? 155 ASP A C   1 
ATOM   1244 O  O   . ASP A 1 155 ? 21.494 69.712 0.554  1.00 38.33 ? 155 ASP A O   1 
ATOM   1245 C  CB  . ASP A 1 155 ? 19.596 71.238 2.530  1.00 40.24 ? 155 ASP A CB  1 
ATOM   1246 C  CG  . ASP A 1 155 ? 19.395 72.431 1.613  1.00 44.86 ? 155 ASP A CG  1 
ATOM   1247 O  OD1 . ASP A 1 155 ? 18.241 72.568 1.111  1.00 47.97 ? 155 ASP A OD1 1 
ATOM   1248 O  OD2 . ASP A 1 155 ? 20.328 73.208 1.289  1.00 53.41 ? 155 ASP A OD2 1 
ATOM   1249 N  N   . GLU A 1 156 ? 19.764 70.468 -0.606 1.00 41.71 ? 156 GLU A N   1 
ATOM   1250 C  CA  . GLU A 1 156 ? 20.514 70.465 -1.858 1.00 43.34 ? 156 GLU A CA  1 
ATOM   1251 C  C   . GLU A 1 156 ? 21.791 71.323 -1.765 1.00 43.70 ? 156 GLU A C   1 
ATOM   1252 O  O   . GLU A 1 156 ? 22.736 71.080 -2.518 1.00 45.20 ? 156 GLU A O   1 
ATOM   1253 C  CB  . GLU A 1 156 ? 19.670 70.971 -3.039 1.00 45.40 ? 156 GLU A CB  1 
ATOM   1254 C  CG  . GLU A 1 156 ? 18.310 70.275 -3.268 1.00 48.96 ? 156 GLU A CG  1 
ATOM   1255 C  CD  . GLU A 1 156 ? 17.118 70.914 -2.522 1.00 57.62 ? 156 GLU A CD  1 
ATOM   1256 O  OE1 . GLU A 1 156 ? 16.868 70.531 -1.319 1.00 50.98 ? 156 GLU A OE1 1 
ATOM   1257 O  OE2 . GLU A 1 156 ? 16.424 71.800 -3.163 1.00 61.76 ? 156 GLU A OE2 1 
ATOM   1258 N  N   . GLU A 1 157 ? 21.840 72.319 -0.879 1.00 42.63 ? 157 GLU A N   1 
ATOM   1259 C  CA  . GLU A 1 157 ? 23.058 73.148 -0.703 1.00 42.60 ? 157 GLU A CA  1 
ATOM   1260 C  C   . GLU A 1 157 ? 24.008 72.612 0.373  1.00 42.16 ? 157 GLU A C   1 
ATOM   1261 O  O   . GLU A 1 157 ? 25.062 73.216 0.575  1.00 43.68 ? 157 GLU A O   1 
ATOM   1262 C  CB  . GLU A 1 157 ? 22.712 74.632 -0.349 1.00 42.43 ? 157 GLU A CB  1 
ATOM   1263 C  CG  . GLU A 1 157 ? 23.328 75.664 -1.281 0.01 42.56 ? 157 GLU A CG  1 
ATOM   1264 C  CD  . GLU A 1 157 ? 24.829 75.796 -1.108 0.01 42.61 ? 157 GLU A CD  1 
ATOM   1265 O  OE1 . GLU A 1 157 ? 25.566 75.537 -2.083 0.01 42.65 ? 157 GLU A OE1 1 
ATOM   1266 O  OE2 . GLU A 1 157 ? 25.273 76.159 0.002  0.01 42.57 ? 157 GLU A OE2 1 
HETATM 1267 N  N   . MSE A 1 158 ? 23.620 71.555 1.103  1.00 40.13 ? 158 MSE A N   1 
HETATM 1268 C  CA  . MSE A 1 158 ? 24.529 70.851 2.006  1.00 39.66 ? 158 MSE A CA  1 
HETATM 1269 C  C   . MSE A 1 158 ? 25.420 69.872 1.258  1.00 36.53 ? 158 MSE A C   1 
HETATM 1270 O  O   . MSE A 1 158 ? 25.092 69.364 0.214  1.00 36.46 ? 158 MSE A O   1 
HETATM 1271 C  CB  . MSE A 1 158 ? 23.726 70.138 3.091  1.00 40.36 ? 158 MSE A CB  1 
HETATM 1272 C  CG  . MSE A 1 158 ? 23.125 71.136 4.061  1.00 45.37 ? 158 MSE A CG  1 
HETATM 1273 SE SE  . MSE A 1 158 ? 21.906 70.264 5.318  1.00 62.13 ? 158 MSE A SE  1 
HETATM 1274 C  CE  . MSE A 1 158 ? 20.885 72.003 6.145  1.00 58.31 ? 158 MSE A CE  1 
ATOM   1275 N  N   . ASP A 1 159 ? 26.594 69.636 1.773  1.00 34.91 ? 159 ASP A N   1 
ATOM   1276 C  CA  . ASP A 1 159 ? 27.525 68.735 1.124  1.00 34.34 ? 159 ASP A CA  1 
ATOM   1277 C  C   . ASP A 1 159 ? 27.494 67.365 1.794  1.00 31.72 ? 159 ASP A C   1 
ATOM   1278 O  O   . ASP A 1 159 ? 27.794 67.223 2.966  1.00 27.89 ? 159 ASP A O   1 
ATOM   1279 C  CB  . ASP A 1 159 ? 28.925 69.323 1.202  1.00 35.62 ? 159 ASP A CB  1 
ATOM   1280 C  CG  . ASP A 1 159 ? 29.928 68.520 0.380  1.00 41.92 ? 159 ASP A CG  1 
ATOM   1281 O  OD1 . ASP A 1 159 ? 29.526 67.470 -0.213 1.00 47.41 ? 159 ASP A OD1 1 
ATOM   1282 O  OD2 . ASP A 1 159 ? 31.148 68.851 0.292  1.00 50.03 ? 159 ASP A OD2 1 
ATOM   1283 N  N   . ILE A 1 160 ? 27.099 66.356 1.033  1.00 29.64 ? 160 ILE A N   1 
ATOM   1284 C  CA  . ILE A 1 160 ? 27.100 64.923 1.471  1.00 29.92 ? 160 ILE A CA  1 
ATOM   1285 C  C   . ILE A 1 160 ? 28.417 64.466 2.177  1.00 26.13 ? 160 ILE A C   1 
ATOM   1286 O  O   . ILE A 1 160 ? 28.395 63.765 3.160  1.00 26.13 ? 160 ILE A O   1 
ATOM   1287 C  CB  . ILE A 1 160 ? 26.717 64.056 0.212  1.00 30.43 ? 160 ILE A CB  1 
ATOM   1288 C  CG1 . ILE A 1 160 ? 25.837 62.864 0.534  1.00 32.90 ? 160 ILE A CG1 1 
ATOM   1289 C  CG2 . ILE A 1 160 ? 27.894 63.703 -0.477 1.00 32.67 ? 160 ILE A CG2 1 
ATOM   1290 C  CD1 . ILE A 1 160 ? 25.312 62.743 1.964  1.00 32.03 ? 160 ILE A CD1 1 
ATOM   1291 N  N   . LYS A 1 161 ? 29.536 64.987 1.749  1.00 24.45 ? 161 LYS A N   1 
ATOM   1292 C  CA  . LYS A 1 161 ? 30.840 64.722 2.321  1.00 26.94 ? 161 LYS A CA  1 
ATOM   1293 C  C   . LYS A 1 161 ? 31.007 65.252 3.761  1.00 26.47 ? 161 LYS A C   1 
ATOM   1294 O  O   . LYS A 1 161 ? 31.683 64.627 4.552  1.00 23.15 ? 161 LYS A O   1 
ATOM   1295 C  CB  . LYS A 1 161 ? 31.943 65.360 1.474  1.00 27.01 ? 161 LYS A CB  1 
ATOM   1296 C  CG  . LYS A 1 161 ? 31.939 64.741 0.057  1.00 32.00 ? 161 LYS A CG  1 
ATOM   1297 C  CD  . LYS A 1 161 ? 33.165 65.168 -0.773 1.00 36.00 ? 161 LYS A CD  1 
ATOM   1298 C  CE  . LYS A 1 161 ? 32.958 64.914 -2.261 0.01 35.02 ? 161 LYS A CE  1 
ATOM   1299 N  NZ  . LYS A 1 161 ? 33.770 65.833 -3.104 0.01 35.10 ? 161 LYS A NZ  1 
ATOM   1300 N  N   . ASP A 1 162 ? 30.404 66.420 4.034  1.00 25.42 ? 162 ASP A N   1 
ATOM   1301 C  CA  . ASP A 1 162 ? 30.370 66.975 5.356  1.00 24.49 ? 162 ASP A CA  1 
ATOM   1302 C  C   . ASP A 1 162 ? 29.535 66.149 6.247  1.00 22.94 ? 162 ASP A C   1 
ATOM   1303 O  O   . ASP A 1 162 ? 29.826 65.898 7.436  1.00 21.52 ? 162 ASP A O   1 
ATOM   1304 C  CB  . ASP A 1 162 ? 29.682 68.302 5.350  1.00 27.69 ? 162 ASP A CB  1 
ATOM   1305 C  CG  . ASP A 1 162 ? 30.569 69.435 4.812  1.00 34.89 ? 162 ASP A CG  1 
ATOM   1306 O  OD1 . ASP A 1 162 ? 31.841 69.265 4.759  1.00 33.99 ? 162 ASP A OD1 1 
ATOM   1307 O  OD2 . ASP A 1 162 ? 29.992 70.531 4.456  1.00 42.38 ? 162 ASP A OD2 1 
ATOM   1308 N  N   . PHE A 1 163 ? 28.407 65.775 5.705  1.00 16.70 ? 163 PHE A N   1 
ATOM   1309 C  CA  . PHE A 1 163 ? 27.559 64.875 6.414  1.00 16.26 ? 163 PHE A CA  1 
ATOM   1310 C  C   . PHE A 1 163 ? 28.313 63.597 6.841  1.00 17.77 ? 163 PHE A C   1 
ATOM   1311 O  O   . PHE A 1 163 ? 28.154 63.187 7.999  1.00 17.90 ? 163 PHE A O   1 
ATOM   1312 C  CB  . PHE A 1 163 ? 26.299 64.523 5.607  1.00 14.52 ? 163 PHE A CB  1 
ATOM   1313 C  CG  . PHE A 1 163 ? 25.379 63.588 6.315  1.00 17.76 ? 163 PHE A CG  1 
ATOM   1314 C  CD1 . PHE A 1 163 ? 24.383 64.074 7.172  1.00 22.15 ? 163 PHE A CD1 1 
ATOM   1315 C  CD2 . PHE A 1 163 ? 25.452 62.275 6.132  1.00 16.11 ? 163 PHE A CD2 1 
ATOM   1316 C  CE1 . PHE A 1 163 ? 23.507 63.180 7.805  1.00 23.72 ? 163 PHE A CE1 1 
ATOM   1317 C  CE2 . PHE A 1 163 ? 24.624 61.372 6.814  1.00 18.06 ? 163 PHE A CE2 1 
ATOM   1318 C  CZ  . PHE A 1 163 ? 23.638 61.857 7.673  1.00 23.98 ? 163 PHE A CZ  1 
ATOM   1319 N  N   . CYS A 1 164 ? 29.113 62.973 5.966  1.00 15.31 ? 164 CYS A N   1 
ATOM   1320 C  CA  . CYS A 1 164 ? 29.836 61.767 6.320  1.00 15.73 ? 164 CYS A CA  1 
ATOM   1321 C  C   . CYS A 1 164 ? 30.921 62.065 7.398  1.00 17.86 ? 164 CYS A C   1 
ATOM   1322 O  O   . CYS A 1 164 ? 31.081 61.332 8.366  1.00 14.58 ? 164 CYS A O   1 
ATOM   1323 C  CB  . CYS A 1 164 ? 30.394 61.059 5.109  1.00 15.54 ? 164 CYS A CB  1 
ATOM   1324 S  SG  . CYS A 1 164 ? 29.056 60.426 4.037  1.00 15.94 ? 164 CYS A SG  1 
ATOM   1325 N  N   . THR A 1 165 ? 31.623 63.147 7.211  1.00 15.61 ? 165 THR A N   1 
ATOM   1326 C  CA  . THR A 1 165 ? 32.713 63.484 8.075  1.00 18.47 ? 165 THR A CA  1 
ATOM   1327 C  C   . THR A 1 165 ? 32.240 63.772 9.489  1.00 18.96 ? 165 THR A C   1 
ATOM   1328 O  O   . THR A 1 165 ? 32.910 63.362 10.442 1.00 17.99 ? 165 THR A O   1 
ATOM   1329 C  CB  . THR A 1 165 ? 33.322 64.777 7.519  1.00 19.04 ? 165 THR A CB  1 
ATOM   1330 O  OG1 . THR A 1 165 ? 33.843 64.490 6.229  1.00 19.35 ? 165 THR A OG1 1 
ATOM   1331 C  CG2 . THR A 1 165 ? 34.539 65.299 8.400  1.00 22.69 ? 165 THR A CG2 1 
ATOM   1332 N  N   . HIS A 1 166 ? 31.105 64.404 9.606  1.00 17.05 ? 166 HIS A N   1 
ATOM   1333 C  CA  . HIS A 1 166 ? 30.600 64.846 10.882 1.00 20.62 ? 166 HIS A CA  1 
ATOM   1334 C  C   . HIS A 1 166 ? 29.473 64.091 11.593 1.00 20.78 ? 166 HIS A C   1 
ATOM   1335 O  O   . HIS A 1 166 ? 29.270 64.270 12.805 1.00 20.06 ? 166 HIS A O   1 
ATOM   1336 C  CB  . HIS A 1 166 ? 30.195 66.315 10.723 1.00 21.90 ? 166 HIS A CB  1 
ATOM   1337 C  CG  . HIS A 1 166 ? 31.313 67.214 10.296 1.00 16.79 ? 166 HIS A CG  1 
ATOM   1338 N  ND1 . HIS A 1 166 ? 32.194 67.745 11.184 1.00 19.89 ? 166 HIS A ND1 1 
ATOM   1339 C  CD2 . HIS A 1 166 ? 31.724 67.624 9.073  1.00 24.36 ? 166 HIS A CD2 1 
ATOM   1340 C  CE1 . HIS A 1 166 ? 33.099 68.453 10.531 1.00 26.73 ? 166 HIS A CE1 1 
ATOM   1341 N  NE2 . HIS A 1 166 ? 32.828 68.422 9.250  1.00 22.37 ? 166 HIS A NE2 1 
ATOM   1342 N  N   . GLU A 1 167 ? 28.714 63.285 10.851 1.00 19.77 ? 167 GLU A N   1 
ATOM   1343 C  CA  . GLU A 1 167 ? 27.543 62.613 11.383 1.00 18.78 ? 167 GLU A CA  1 
ATOM   1344 C  C   . GLU A 1 167 ? 27.591 61.113 11.218 1.00 18.66 ? 167 GLU A C   1 
ATOM   1345 O  O   . GLU A 1 167 ? 26.616 60.452 11.649 1.00 17.49 ? 167 GLU A O   1 
ATOM   1346 C  CB  . GLU A 1 167 ? 26.324 63.041 10.600 1.00 19.90 ? 167 GLU A CB  1 
ATOM   1347 C  CG  . GLU A 1 167 ? 26.036 64.503 10.582 1.00 24.69 ? 167 GLU A CG  1 
ATOM   1348 C  CD  . GLU A 1 167 ? 25.700 64.923 11.994 1.00 34.09 ? 167 GLU A CD  1 
ATOM   1349 O  OE1 . GLU A 1 167 ? 25.228 64.040 12.841 1.00 40.91 ? 167 GLU A OE1 1 
ATOM   1350 O  OE2 . GLU A 1 167 ? 25.910 66.134 12.265 1.00 41.83 ? 167 GLU A OE2 1 
ATOM   1351 N  N   . VAL A 1 168 ? 28.612 60.619 10.509 1.00 14.38 ? 168 VAL A N   1 
ATOM   1352 C  CA  . VAL A 1 168 ? 28.733 59.168 10.281 1.00 15.54 ? 168 VAL A CA  1 
ATOM   1353 C  C   . VAL A 1 168 ? 30.058 58.655 10.860 1.00 16.45 ? 168 VAL A C   1 
ATOM   1354 O  O   . VAL A 1 168 ? 30.064 57.759 11.693 1.00 15.29 ? 168 VAL A O   1 
ATOM   1355 C  CB  . VAL A 1 168 ? 28.527 58.814 8.800  1.00 16.55 ? 168 VAL A CB  1 
ATOM   1356 C  CG1 . VAL A 1 168 ? 28.592 57.267 8.554  1.00 14.95 ? 168 VAL A CG1 1 
ATOM   1357 C  CG2 . VAL A 1 168 ? 27.258 59.435 8.234  1.00 20.56 ? 168 VAL A CG2 1 
ATOM   1358 N  N   . GLU A 1 169 ? 31.194 59.212 10.422 1.00 16.16 ? 169 GLU A N   1 
ATOM   1359 C  CA  . GLU A 1 169 ? 32.486 58.684 10.842 1.00 15.60 ? 169 GLU A CA  1 
ATOM   1360 C  C   . GLU A 1 169 ? 32.840 58.779 12.361 1.00 17.15 ? 169 GLU A C   1 
ATOM   1361 O  O   . GLU A 1 169 ? 33.452 57.795 12.854 1.00 14.61 ? 169 GLU A O   1 
ATOM   1362 C  CB  . GLU A 1 169 ? 33.672 59.321 10.071 1.00 15.34 ? 169 GLU A CB  1 
ATOM   1363 C  CG  . GLU A 1 169 ? 33.534 58.993 8.582  1.00 16.31 ? 169 GLU A CG  1 
ATOM   1364 C  CD  . GLU A 1 169 ? 34.249 59.935 7.620  1.00 17.39 ? 169 GLU A CD  1 
ATOM   1365 O  OE1 . GLU A 1 169 ? 35.283 60.502 8.021  1.00 23.02 ? 169 GLU A OE1 1 
ATOM   1366 O  OE2 . GLU A 1 169 ? 33.761 60.038 6.438  1.00 23.66 ? 169 GLU A OE2 1 
ATOM   1367 N  N   . PRO A 1 170 ? 32.558 59.868 13.068 1.00 16.34 ? 170 PRO A N   1 
ATOM   1368 C  CA  . PRO A 1 170 ? 33.070 59.932 14.445 1.00 18.78 ? 170 PRO A CA  1 
ATOM   1369 C  C   . PRO A 1 170 ? 32.282 59.029 15.343 1.00 17.65 ? 170 PRO A C   1 
ATOM   1370 O  O   . PRO A 1 170 ? 31.060 58.929 15.230 1.00 18.82 ? 170 PRO A O   1 
ATOM   1371 C  CB  . PRO A 1 170 ? 32.866 61.407 14.872 1.00 19.51 ? 170 PRO A CB  1 
ATOM   1372 C  CG  . PRO A 1 170 ? 32.533 62.080 13.489 1.00 21.02 ? 170 PRO A CG  1 
ATOM   1373 C  CD  . PRO A 1 170 ? 31.841 61.095 12.710 1.00 16.21 ? 170 PRO A CD  1 
HETATM 1374 N  N   . MSE A 1 171 ? 32.968 58.426 16.276 1.00 16.93 ? 171 MSE A N   1 
HETATM 1375 C  CA  . MSE A 1 171 ? 32.320 57.641 17.362 1.00 19.53 ? 171 MSE A CA  1 
HETATM 1376 C  C   . MSE A 1 171 ? 31.320 58.545 18.101 1.00 20.57 ? 171 MSE A C   1 
HETATM 1377 O  O   . MSE A 1 171 ? 31.461 59.737 18.081 1.00 19.71 ? 171 MSE A O   1 
HETATM 1378 C  CB  . MSE A 1 171 ? 33.426 57.245 18.340 1.00 19.08 ? 171 MSE A CB  1 
HETATM 1379 C  CG  . MSE A 1 171 ? 34.385 56.237 17.704 1.00 22.50 ? 171 MSE A CG  1 
HETATM 1380 SE SE  . MSE A 1 171 ? 33.503 54.506 17.176 1.00 36.27 ? 171 MSE A SE  1 
HETATM 1381 C  CE  . MSE A 1 171 ? 33.213 53.624 19.177 1.00 29.01 ? 171 MSE A CE  1 
ATOM   1382 N  N   . ALA A 1 172 ? 30.260 57.992 18.662 1.00 22.46 ? 172 ALA A N   1 
ATOM   1383 C  CA  . ALA A 1 172 ? 29.350 58.792 19.473 1.00 24.47 ? 172 ALA A CA  1 
ATOM   1384 C  C   . ALA A 1 172 ? 28.551 59.857 18.778 1.00 26.66 ? 172 ALA A C   1 
ATOM   1385 O  O   . ALA A 1 172 ? 28.170 60.836 19.394 1.00 25.04 ? 172 ALA A O   1 
ATOM   1386 C  CB  . ALA A 1 172 ? 30.099 59.345 20.757 1.00 24.07 ? 172 ALA A CB  1 
ATOM   1387 N  N   . THR A 1 173 ? 28.303 59.664 17.470 1.00 29.05 ? 173 THR A N   1 
ATOM   1388 C  CA  . THR A 1 173 ? 27.330 60.422 16.723 1.00 28.07 ? 173 THR A CA  1 
ATOM   1389 C  C   . THR A 1 173 ? 26.175 59.497 16.435 1.00 30.03 ? 173 THR A C   1 
ATOM   1390 O  O   . THR A 1 173 ? 26.326 58.324 15.869 1.00 27.73 ? 173 THR A O   1 
ATOM   1391 C  CB  . THR A 1 173 ? 27.930 61.035 15.414 1.00 28.93 ? 173 THR A CB  1 
ATOM   1392 O  OG1 . THR A 1 173 ? 28.567 60.025 14.617 1.00 27.99 ? 173 THR A OG1 1 
ATOM   1393 C  CG2 . THR A 1 173 ? 29.160 61.867 15.746 1.00 33.37 ? 173 THR A CG2 1 
ATOM   1394 N  N   . GLU A 1 174 ? 24.985 60.038 16.781 1.00 31.70 ? 174 GLU A N   1 
ATOM   1395 C  CA  . GLU A 1 174 ? 23.737 59.301 16.677 1.00 31.93 ? 174 GLU A CA  1 
ATOM   1396 C  C   . GLU A 1 174 ? 23.410 59.048 15.236 1.00 31.01 ? 174 GLU A C   1 
ATOM   1397 O  O   . GLU A 1 174 ? 23.720 59.821 14.392 1.00 30.20 ? 174 GLU A O   1 
ATOM   1398 C  CB  . GLU A 1 174 ? 22.587 59.954 17.448 1.00 35.17 ? 174 GLU A CB  1 
ATOM   1399 C  CG  . GLU A 1 174 ? 22.148 61.345 16.940 1.00 40.66 ? 174 GLU A CG  1 
ATOM   1400 C  CD  . GLU A 1 174 ? 20.729 61.775 17.462 1.00 42.52 ? 174 GLU A CD  1 
ATOM   1401 O  OE1 . GLU A 1 174 ? 19.863 61.968 16.629 1.00 38.98 ? 174 GLU A OE1 1 
ATOM   1402 O  OE2 . GLU A 1 174 ? 20.468 61.905 18.685 1.00 48.77 ? 174 GLU A OE2 1 
ATOM   1403 N  N   . CYS A 1 175 ? 22.793 57.907 14.955 1.00 30.32 ? 175 CYS A N   1 
ATOM   1404 C  CA  . CYS A 1 175 ? 22.446 57.540 13.610 1.00 31.47 ? 175 CYS A CA  1 
ATOM   1405 C  C   . CYS A 1 175 ? 21.051 58.106 13.341 1.00 30.17 ? 175 CYS A C   1 
ATOM   1406 O  O   . CYS A 1 175 ? 20.406 58.631 14.228 1.00 30.90 ? 175 CYS A O   1 
ATOM   1407 C  CB  . CYS A 1 175 ? 22.537 56.006 13.496 1.00 31.36 ? 175 CYS A CB  1 
ATOM   1408 S  SG  . CYS A 1 175 ? 21.024 55.438 14.196 1.00 47.17 ? 175 CYS A SG  1 
ATOM   1409 N  N   . ASP A 1 176 ? 20.601 58.062 12.104 1.00 28.38 ? 176 ASP A N   1 
ATOM   1410 C  CA  . ASP A 1 176 ? 19.272 58.438 11.750 1.00 26.82 ? 176 ASP A CA  1 
ATOM   1411 C  C   . ASP A 1 176 ? 19.023 57.662 10.480 1.00 25.52 ? 176 ASP A C   1 
ATOM   1412 O  O   . ASP A 1 176 ? 19.855 56.769 10.134 1.00 21.66 ? 176 ASP A O   1 
ATOM   1413 C  CB  . ASP A 1 176 ? 19.301 59.935 11.562 1.00 30.06 ? 176 ASP A CB  1 
ATOM   1414 C  CG  . ASP A 1 176 ? 17.928 60.576 11.308 1.00 39.50 ? 176 ASP A CG  1 
ATOM   1415 O  OD1 . ASP A 1 176 ? 16.852 59.908 11.436 1.00 46.80 ? 176 ASP A OD1 1 
ATOM   1416 O  OD2 . ASP A 1 176 ? 17.863 61.804 10.984 1.00 49.12 ? 176 ASP A OD2 1 
ATOM   1417 N  N   . HIS A 1 177 ? 17.961 57.985 9.728  1.00 22.43 ? 177 HIS A N   1 
ATOM   1418 C  CA  . HIS A 1 177 ? 17.531 57.091 8.721  1.00 23.68 ? 177 HIS A CA  1 
ATOM   1419 C  C   . HIS A 1 177 ? 18.578 56.905 7.624  1.00 21.08 ? 177 HIS A C   1 
ATOM   1420 O  O   . HIS A 1 177 ? 18.566 55.880 7.000  1.00 19.87 ? 177 HIS A O   1 
ATOM   1421 C  CB  . HIS A 1 177 ? 16.175 57.499 8.056  1.00 26.96 ? 177 HIS A CB  1 
ATOM   1422 C  CG  . HIS A 1 177 ? 16.199 58.848 7.429  1.00 30.95 ? 177 HIS A CG  1 
ATOM   1423 N  ND1 . HIS A 1 177 ? 16.382 59.035 6.075  1.00 44.64 ? 177 HIS A ND1 1 
ATOM   1424 C  CD2 . HIS A 1 177 ? 16.112 60.086 7.973  1.00 39.08 ? 177 HIS A CD2 1 
ATOM   1425 C  CE1 . HIS A 1 177 ? 16.386 60.340 5.814  1.00 41.82 ? 177 HIS A CE1 1 
ATOM   1426 N  NE2 . HIS A 1 177 ? 16.202 60.994 6.945  1.00 41.71 ? 177 HIS A NE2 1 
ATOM   1427 N  N   . ILE A 1 178 ? 19.404 57.910 7.344  1.00 18.58 ? 178 ILE A N   1 
ATOM   1428 C  CA  . ILE A 1 178 ? 20.406 57.810 6.282  1.00 19.00 ? 178 ILE A CA  1 
ATOM   1429 C  C   . ILE A 1 178 ? 21.399 56.741 6.621  1.00 16.47 ? 178 ILE A C   1 
ATOM   1430 O  O   . ILE A 1 178 ? 21.750 55.867 5.827  1.00 15.91 ? 178 ILE A O   1 
ATOM   1431 C  CB  . ILE A 1 178 ? 21.125 59.140 6.054  1.00 20.55 ? 178 ILE A CB  1 
ATOM   1432 C  CG1 . ILE A 1 178 ? 20.202 60.208 5.414  1.00 28.04 ? 178 ILE A CG1 1 
ATOM   1433 C  CG2 . ILE A 1 178 ? 22.288 58.901 5.096  1.00 21.46 ? 178 ILE A CG2 1 
ATOM   1434 C  CD1 . ILE A 1 178 ? 20.736 61.641 5.616  1.00 31.46 ? 178 ILE A CD1 1 
ATOM   1435 N  N   . GLN A 1 179 ? 21.902 56.797 7.854  1.00 16.59 ? 179 GLN A N   1 
ATOM   1436 C  CA  . GLN A 1 179 ? 22.910 55.861 8.277  1.00 17.37 ? 179 GLN A CA  1 
ATOM   1437 C  C   . GLN A 1 179 ? 22.385 54.406 8.333  1.00 16.69 ? 179 GLN A C   1 
ATOM   1438 O  O   . GLN A 1 179 ? 23.052 53.473 7.918  1.00 16.49 ? 179 GLN A O   1 
ATOM   1439 C  CB  . GLN A 1 179 ? 23.482 56.283 9.637  1.00 17.55 ? 179 GLN A CB  1 
ATOM   1440 C  CG  . GLN A 1 179 ? 24.229 57.506 9.603  1.00 15.48 ? 179 GLN A CG  1 
ATOM   1441 C  CD  . GLN A 1 179 ? 23.367 58.682 10.029 1.00 17.63 ? 179 GLN A CD  1 
ATOM   1442 O  OE1 . GLN A 1 179 ? 22.126 58.718 9.733  1.00 20.97 ? 179 GLN A OE1 1 
ATOM   1443 N  NE2 . GLN A 1 179 ? 23.986 59.622 10.750 1.00 19.41 ? 179 GLN A NE2 1 
ATOM   1444 N  N   . ILE A 1 180 ? 21.169 54.234 8.822  1.00 16.27 ? 180 ILE A N   1 
ATOM   1445 C  CA  . ILE A 1 180 ? 20.559 52.917 8.899  1.00 17.24 ? 180 ILE A CA  1 
ATOM   1446 C  C   . ILE A 1 180 ? 20.341 52.377 7.532  1.00 17.11 ? 180 ILE A C   1 
ATOM   1447 O  O   . ILE A 1 180 ? 20.703 51.254 7.254  1.00 16.01 ? 180 ILE A O   1 
ATOM   1448 C  CB  . ILE A 1 180 ? 19.208 53.050 9.594  1.00 19.62 ? 180 ILE A CB  1 
ATOM   1449 C  CG1 . ILE A 1 180 ? 19.440 53.498 11.016 1.00 19.15 ? 180 ILE A CG1 1 
ATOM   1450 C  CG2 . ILE A 1 180 ? 18.403 51.752 9.503  1.00 19.71 ? 180 ILE A CG2 1 
ATOM   1451 C  CD1 . ILE A 1 180 ? 18.138 53.835 11.738 1.00 26.01 ? 180 ILE A CD1 1 
ATOM   1452 N  N   . THR A 1 181 ? 19.835 53.190 6.615  1.00 16.53 ? 181 THR A N   1 
ATOM   1453 C  CA  . THR A 1 181 ? 19.652 52.737 5.230  1.00 17.53 ? 181 THR A CA  1 
ATOM   1454 C  C   . THR A 1 181 ? 21.014 52.387 4.635  1.00 16.47 ? 181 THR A C   1 
ATOM   1455 O  O   . THR A 1 181 ? 21.165 51.312 4.045  1.00 17.76 ? 181 THR A O   1 
ATOM   1456 C  CB  . THR A 1 181 ? 19.086 53.900 4.416  1.00 20.65 ? 181 THR A CB  1 
ATOM   1457 O  OG1 . THR A 1 181 ? 17.765 54.174 4.873  1.00 20.85 ? 181 THR A OG1 1 
ATOM   1458 C  CG2 . THR A 1 181 ? 19.100 53.637 2.807  1.00 18.86 ? 181 THR A CG2 1 
ATOM   1459 N  N   . ALA A 1 182 ? 21.991 53.280 4.767  1.00 13.39 ? 182 ALA A N   1 
ATOM   1460 C  CA  . ALA A 1 182 ? 23.352 52.991 4.204  1.00 13.67 ? 182 ALA A CA  1 
ATOM   1461 C  C   . ALA A 1 182 ? 24.056 51.704 4.734  1.00 13.30 ? 182 ALA A C   1 
ATOM   1462 O  O   . ALA A 1 182 ? 24.526 50.838 3.998  1.00 12.80 ? 182 ALA A O   1 
ATOM   1463 C  CB  . ALA A 1 182 ? 24.191 54.083 4.485  1.00 13.84 ? 182 ALA A CB  1 
ATOM   1464 N  N   . LEU A 1 183 ? 24.020 51.471 6.027  1.00 15.14 ? 183 LEU A N   1 
ATOM   1465 C  CA  . LEU A 1 183 ? 24.712 50.302 6.549  1.00 13.39 ? 183 LEU A CA  1 
ATOM   1466 C  C   . LEU A 1 183 ? 23.980 49.037 6.204  1.00 17.70 ? 183 LEU A C   1 
ATOM   1467 O  O   . LEU A 1 183 ? 24.589 48.072 5.731  1.00 18.87 ? 183 LEU A O   1 
ATOM   1468 C  CB  . LEU A 1 183 ? 24.875 50.450 8.048  1.00 14.38 ? 183 LEU A CB  1 
ATOM   1469 C  CG  . LEU A 1 183 ? 25.628 49.329 8.759  1.00 17.08 ? 183 LEU A CG  1 
ATOM   1470 C  CD1 . LEU A 1 183 ? 27.017 49.107 8.090  1.00 17.52 ? 183 LEU A CD1 1 
ATOM   1471 C  CD2 . LEU A 1 183 ? 25.892 49.716 10.143 1.00 21.51 ? 183 LEU A CD2 1 
ATOM   1472 N  N   . SER A 1 184 ? 22.640 49.024 6.338  1.00 16.45 ? 184 SER A N   1 
ATOM   1473 C  CA  . SER A 1 184 ? 21.902 47.879 5.970  1.00 16.77 ? 184 SER A CA  1 
ATOM   1474 C  C   . SER A 1 184 ? 22.108 47.548 4.521  1.00 17.21 ? 184 SER A C   1 
ATOM   1475 O  O   . SER A 1 184 ? 22.287 46.385 4.159  1.00 14.60 ? 184 SER A O   1 
ATOM   1476 C  CB  . SER A 1 184 ? 20.405 48.049 6.449  1.00 18.97 ? 184 SER A CB  1 
ATOM   1477 O  OG  . SER A 1 184 ? 19.869 49.076 5.616  1.00 24.70 ? 184 SER A OG  1 
ATOM   1478 N  N   . GLN A 1 185 ? 22.152 48.516 3.625  1.00 18.33 ? 185 GLN A N   1 
ATOM   1479 C  CA  . GLN A 1 185 ? 22.318 48.191 2.213  1.00 17.02 ? 185 GLN A CA  1 
ATOM   1480 C  C   . GLN A 1 185 ? 23.787 47.716 1.979  1.00 18.52 ? 185 GLN A C   1 
ATOM   1481 O  O   . GLN A 1 185 ? 24.059 46.862 1.176  1.00 18.24 ? 185 GLN A O   1 
ATOM   1482 C  CB  . GLN A 1 185 ? 22.128 49.458 1.386  1.00 18.20 ? 185 GLN A CB  1 
ATOM   1483 C  CG  . GLN A 1 185 ? 20.656 49.727 0.985  1.00 22.54 ? 185 GLN A CG  1 
ATOM   1484 C  CD  . GLN A 1 185 ? 20.497 50.950 0.009  1.00 31.98 ? 185 GLN A CD  1 
ATOM   1485 O  OE1 . GLN A 1 185 ? 21.413 51.334 -0.680 1.00 34.15 ? 185 GLN A OE1 1 
ATOM   1486 N  NE2 . GLN A 1 185 ? 19.319 51.528 -0.028 1.00 34.24 ? 185 GLN A NE2 1 
ATOM   1487 N  N   . ALA A 1 186 ? 24.725 48.322 2.669  1.00 18.69 ? 186 ALA A N   1 
ATOM   1488 C  CA  . ALA A 1 186 ? 26.129 47.960 2.503  1.00 19.77 ? 186 ALA A CA  1 
ATOM   1489 C  C   . ALA A 1 186 ? 26.367 46.496 2.821  1.00 20.54 ? 186 ALA A C   1 
ATOM   1490 O  O   . ALA A 1 186 ? 27.233 45.826 2.229  1.00 19.59 ? 186 ALA A O   1 
ATOM   1491 C  CB  . ALA A 1 186 ? 26.980 48.854 3.386  1.00 17.96 ? 186 ALA A CB  1 
ATOM   1492 N  N   . LEU A 1 187 ? 25.620 45.973 3.763  1.00 20.71 ? 187 LEU A N   1 
ATOM   1493 C  CA  . LEU A 1 187 ? 25.960 44.638 4.254  1.00 21.66 ? 187 LEU A CA  1 
ATOM   1494 C  C   . LEU A 1 187 ? 24.900 43.687 3.796  1.00 22.89 ? 187 LEU A C   1 
ATOM   1495 O  O   . LEU A 1 187 ? 25.036 42.551 4.074  1.00 21.98 ? 187 LEU A O   1 
ATOM   1496 C  CB  . LEU A 1 187 ? 26.102 44.617 5.762  1.00 20.06 ? 187 LEU A CB  1 
ATOM   1497 C  CG  . LEU A 1 187 ? 27.267 45.352 6.422  1.00 23.35 ? 187 LEU A CG  1 
ATOM   1498 C  CD1 . LEU A 1 187 ? 27.058 45.331 7.823  1.00 25.76 ? 187 LEU A CD1 1 
ATOM   1499 C  CD2 . LEU A 1 187 ? 28.606 44.732 6.041  1.00 24.65 ? 187 LEU A CD2 1 
ATOM   1500 N  N   . SER A 1 188 ? 23.918 44.166 3.018  1.00 20.46 ? 188 SER A N   1 
ATOM   1501 C  CA  . SER A 1 188 ? 22.747 43.419 2.616  1.00 20.06 ? 188 SER A CA  1 
ATOM   1502 C  C   . SER A 1 188 ? 21.976 42.817 3.761  1.00 18.21 ? 188 SER A C   1 
ATOM   1503 O  O   . SER A 1 188 ? 21.595 41.694 3.647  1.00 18.99 ? 188 SER A O   1 
ATOM   1504 C  CB  . SER A 1 188 ? 22.977 42.267 1.594  1.00 21.06 ? 188 SER A CB  1 
ATOM   1505 O  OG  . SER A 1 188 ? 23.603 42.696 0.440  1.00 25.64 ? 188 SER A OG  1 
ATOM   1506 N  N   . ILE A 1 189 ? 21.707 43.552 4.811  1.00 17.13 ? 189 ILE A N   1 
ATOM   1507 C  CA  . ILE A 1 189 ? 20.982 43.083 5.938  1.00 17.34 ? 189 ILE A CA  1 
ATOM   1508 C  C   . ILE A 1 189 ? 19.490 43.377 5.840  1.00 17.51 ? 189 ILE A C   1 
ATOM   1509 O  O   . ILE A 1 189 ? 19.103 44.495 5.647  1.00 16.07 ? 189 ILE A O   1 
ATOM   1510 C  CB  . ILE A 1 189 ? 21.532 43.710 7.157  1.00 19.02 ? 189 ILE A CB  1 
ATOM   1511 C  CG1 . ILE A 1 189 ? 22.969 43.264 7.338  1.00 20.27 ? 189 ILE A CG1 1 
ATOM   1512 C  CG2 . ILE A 1 189 ? 20.729 43.237 8.378  1.00 19.81 ? 189 ILE A CG2 1 
ATOM   1513 C  CD1 . ILE A 1 189 ? 23.523 43.796 8.688  1.00 27.99 ? 189 ILE A CD1 1 
ATOM   1514 N  N   . ALA A 1 190 ? 18.659 42.353 5.992  1.00 17.98 ? 190 ALA A N   1 
ATOM   1515 C  CA  . ALA A 1 190 ? 17.191 42.503 6.083  1.00 18.30 ? 190 ALA A CA  1 
ATOM   1516 C  C   . ALA A 1 190 ? 16.887 42.764 7.519  1.00 18.36 ? 190 ALA A C   1 
ATOM   1517 O  O   . ALA A 1 190 ? 17.073 41.887 8.339  1.00 18.53 ? 190 ALA A O   1 
ATOM   1518 C  CB  . ALA A 1 190 ? 16.460 41.287 5.584  1.00 18.32 ? 190 ALA A CB  1 
ATOM   1519 N  N   . LEU A 1 191 ? 16.470 43.971 7.809  1.00 17.73 ? 191 LEU A N   1 
ATOM   1520 C  CA  . LEU A 1 191 ? 16.283 44.515 9.179  1.00 20.85 ? 191 LEU A CA  1 
ATOM   1521 C  C   . LEU A 1 191 ? 14.841 44.939 9.325  1.00 19.26 ? 191 LEU A C   1 
ATOM   1522 O  O   . LEU A 1 191 ? 14.253 45.500 8.395  1.00 18.72 ? 191 LEU A O   1 
ATOM   1523 C  CB  . LEU A 1 191 ? 17.194 45.749 9.354  1.00 22.17 ? 191 LEU A CB  1 
ATOM   1524 C  CG  . LEU A 1 191 ? 16.954 46.784 10.433 1.00 25.42 ? 191 LEU A CG  1 
ATOM   1525 C  CD1 . LEU A 1 191 ? 17.210 46.173 11.763 1.00 26.02 ? 191 LEU A CD1 1 
ATOM   1526 C  CD2 . LEU A 1 191 ? 17.755 48.125 10.241 1.00 25.06 ? 191 LEU A CD2 1 
ATOM   1527 N  N   . GLN A 1 192 ? 14.241 44.585 10.458 1.00 18.83 ? 192 GLN A N   1 
ATOM   1528 C  CA  . GLN A 1 192 ? 12.949 45.142 10.870 1.00 17.82 ? 192 GLN A CA  1 
ATOM   1529 C  C   . GLN A 1 192 ? 13.120 45.925 12.182 1.00 17.43 ? 192 GLN A C   1 
ATOM   1530 O  O   . GLN A 1 192 ? 13.706 45.416 13.182 1.00 17.44 ? 192 GLN A O   1 
ATOM   1531 C  CB  . GLN A 1 192 ? 11.919 44.049 10.972 1.00 18.39 ? 192 GLN A CB  1 
ATOM   1532 C  CG  . GLN A 1 192 ? 10.473 44.533 11.311 1.00 18.22 ? 192 GLN A CG  1 
ATOM   1533 C  CD  . GLN A 1 192 ? 9.477  43.425 11.115 1.00 25.38 ? 192 GLN A CD  1 
ATOM   1534 O  OE1 . GLN A 1 192 ? 9.553  42.704 10.119 1.00 20.32 ? 192 GLN A OE1 1 
ATOM   1535 N  NE2 . GLN A 1 192 ? 8.534  43.264 12.071 1.00 24.89 ? 192 GLN A NE2 1 
ATOM   1536 N  N   . VAL A 1 193 ? 12.673 47.176 12.171 1.00 16.06 ? 193 VAL A N   1 
ATOM   1537 C  CA  . VAL A 1 193 ? 12.724 48.052 13.346 1.00 19.12 ? 193 VAL A CA  1 
ATOM   1538 C  C   . VAL A 1 193 ? 11.290 48.075 13.868 1.00 21.56 ? 193 VAL A C   1 
ATOM   1539 O  O   . VAL A 1 193 ? 10.303 48.334 13.120 1.00 20.66 ? 193 VAL A O   1 
ATOM   1540 C  CB  . VAL A 1 193 ? 13.214 49.440 13.069 1.00 19.01 ? 193 VAL A CB  1 
ATOM   1541 C  CG1 . VAL A 1 193 ? 13.290 50.280 14.361 1.00 20.20 ? 193 VAL A CG1 1 
ATOM   1542 C  CG2 . VAL A 1 193 ? 14.551 49.367 12.414 1.00 20.32 ? 193 VAL A CG2 1 
ATOM   1543 N  N   . GLU A 1 194 ? 11.169 47.769 15.152 1.00 21.92 ? 194 GLU A N   1 
ATOM   1544 C  CA  . GLU A 1 194 ? 9.910  48.007 15.872 1.00 23.67 ? 194 GLU A CA  1 
ATOM   1545 C  C   . GLU A 1 194 ? 9.999  49.283 16.682 1.00 25.42 ? 194 GLU A C   1 
ATOM   1546 O  O   . GLU A 1 194 ? 11.119 49.767 17.041 1.00 23.22 ? 194 GLU A O   1 
ATOM   1547 C  CB  . GLU A 1 194 ? 9.623  46.857 16.779 1.00 23.10 ? 194 GLU A CB  1 
ATOM   1548 C  CG  . GLU A 1 194 ? 9.545  45.501 16.134 1.00 26.64 ? 194 GLU A CG  1 
ATOM   1549 C  CD  . GLU A 1 194 ? 8.227  45.261 15.436 1.00 31.40 ? 194 GLU A CD  1 
ATOM   1550 O  OE1 . GLU A 1 194 ? 7.191  45.782 15.917 1.00 32.41 ? 194 GLU A OE1 1 
ATOM   1551 O  OE2 . GLU A 1 194 ? 8.240  44.507 14.422 1.00 34.49 ? 194 GLU A OE2 1 
ATOM   1552 N  N   . TYR A 1 195 ? 8.853  49.881 16.929 1.00 28.05 ? 195 TYR A N   1 
ATOM   1553 C  CA  . TYR A 1 195 ? 8.827  51.272 17.431 1.00 32.32 ? 195 TYR A CA  1 
ATOM   1554 C  C   . TYR A 1 195 ? 7.921  51.174 18.701 1.00 36.38 ? 195 TYR A C   1 
ATOM   1555 O  O   . TYR A 1 195 ? 6.788  50.655 18.644 1.00 35.82 ? 195 TYR A O   1 
ATOM   1556 C  CB  . TYR A 1 195 ? 8.311  52.264 16.360 1.00 31.57 ? 195 TYR A CB  1 
ATOM   1557 C  CG  . TYR A 1 195 ? 9.238  52.466 15.240 1.00 34.79 ? 195 TYR A CG  1 
ATOM   1558 C  CD1 . TYR A 1 195 ? 10.333 53.306 15.350 1.00 30.95 ? 195 TYR A CD1 1 
ATOM   1559 C  CD2 . TYR A 1 195 ? 9.069  51.776 14.025 1.00 37.85 ? 195 TYR A CD2 1 
ATOM   1560 C  CE1 . TYR A 1 195 ? 11.288 53.435 14.266 1.00 32.08 ? 195 TYR A CE1 1 
ATOM   1561 C  CE2 . TYR A 1 195 ? 10.007 51.951 12.937 1.00 34.19 ? 195 TYR A CE2 1 
ATOM   1562 C  CZ  . TYR A 1 195 ? 11.077 52.760 13.065 1.00 25.80 ? 195 TYR A CZ  1 
ATOM   1563 O  OH  . TYR A 1 195 ? 12.001 52.852 12.052 1.00 27.76 ? 195 TYR A OH  1 
ATOM   1564 N  N   . VAL A 1 196 ? 8.446  51.595 19.856 1.00 39.77 ? 196 VAL A N   1 
ATOM   1565 C  CA  . VAL A 1 196 ? 7.745  51.474 21.121 1.00 42.15 ? 196 VAL A CA  1 
ATOM   1566 C  C   . VAL A 1 196 ? 6.588  52.471 21.143 1.00 46.24 ? 196 VAL A C   1 
ATOM   1567 O  O   . VAL A 1 196 ? 5.512  52.160 21.642 1.00 46.27 ? 196 VAL A O   1 
ATOM   1568 C  CB  . VAL A 1 196 ? 8.610  51.794 22.347 1.00 42.38 ? 196 VAL A CB  1 
ATOM   1569 C  CG1 . VAL A 1 196 ? 7.708  52.011 23.556 1.00 43.04 ? 196 VAL A CG1 1 
ATOM   1570 C  CG2 . VAL A 1 196 ? 9.564  50.679 22.642 1.00 41.30 ? 196 VAL A CG2 1 
ATOM   1571 N  N   . ASP A 1 197 ? 6.833  53.676 20.627 1.00 49.31 ? 197 ASP A N   1 
ATOM   1572 C  CA  . ASP A 1 197 ? 5.804  54.701 20.483 1.00 51.32 ? 197 ASP A CA  1 
ATOM   1573 C  C   . ASP A 1 197 ? 5.464  54.999 19.006 1.00 50.84 ? 197 ASP A C   1 
ATOM   1574 O  O   . ASP A 1 197 ? 5.936  56.003 18.479 1.00 49.69 ? 197 ASP A O   1 
ATOM   1575 C  CB  . ASP A 1 197 ? 6.307  55.948 21.214 1.00 52.38 ? 197 ASP A CB  1 
ATOM   1576 C  CG  . ASP A 1 197 ? 5.437  57.178 20.988 1.00 54.51 ? 197 ASP A CG  1 
ATOM   1577 O  OD1 . ASP A 1 197 ? 4.448  57.122 20.193 1.00 57.14 ? 197 ASP A OD1 1 
ATOM   1578 O  OD2 . ASP A 1 197 ? 5.740  58.231 21.601 1.00 51.94 ? 197 ASP A OD2 1 
ATOM   1579 N  N   . HIS A 1 205 ? 9.372  61.246 11.565 1.00 60.78 ? 205 HIS A N   1 
ATOM   1580 C  CA  . HIS A 1 205 ? 10.582 61.304 10.724 1.00 60.67 ? 205 HIS A CA  1 
ATOM   1581 C  C   . HIS A 1 205 ? 11.015 59.921 10.117 1.00 60.63 ? 205 HIS A C   1 
ATOM   1582 O  O   . HIS A 1 205 ? 12.067 59.337 10.461 1.00 59.40 ? 205 HIS A O   1 
ATOM   1583 C  CB  . HIS A 1 205 ? 11.724 61.967 11.521 1.00 60.92 ? 205 HIS A CB  1 
ATOM   1584 C  CG  . HIS A 1 205 ? 12.946 62.284 10.707 1.00 60.63 ? 205 HIS A CG  1 
ATOM   1585 N  ND1 . HIS A 1 205 ? 12.879 62.715 9.400  0.01 60.69 ? 205 HIS A ND1 1 
ATOM   1586 C  CD2 . HIS A 1 205 ? 14.262 62.233 11.019 0.01 60.70 ? 205 HIS A CD2 1 
ATOM   1587 C  CE1 . HIS A 1 205 ? 14.101 62.915 8.941  0.01 60.70 ? 205 HIS A CE1 1 
ATOM   1588 N  NE2 . HIS A 1 205 ? 14.959 62.630 9.904  0.01 60.70 ? 205 HIS A NE2 1 
ATOM   1589 N  N   . HIS A 1 206 ? 10.210 59.412 9.175  1.00 59.51 ? 206 HIS A N   1 
ATOM   1590 C  CA  . HIS A 1 206 ? 10.550 58.180 8.435  1.00 58.69 ? 206 HIS A CA  1 
ATOM   1591 C  C   . HIS A 1 206 ? 10.620 56.927 9.343  1.00 55.82 ? 206 HIS A C   1 
ATOM   1592 O  O   . HIS A 1 206 ? 11.573 56.766 10.111 1.00 54.56 ? 206 HIS A O   1 
ATOM   1593 C  CB  . HIS A 1 206 ? 11.876 58.274 7.635  1.00 59.77 ? 206 HIS A CB  1 
ATOM   1594 C  CG  . HIS A 1 206 ? 11.891 59.324 6.559  1.00 65.42 ? 206 HIS A CG  1 
ATOM   1595 N  ND1 . HIS A 1 206 ? 10.816 59.576 5.731  1.00 72.15 ? 206 HIS A ND1 1 
ATOM   1596 C  CD2 . HIS A 1 206 ? 12.865 60.181 6.172  1.00 70.32 ? 206 HIS A CD2 1 
ATOM   1597 C  CE1 . HIS A 1 206 ? 11.125 60.544 4.884  1.00 73.39 ? 206 HIS A CE1 1 
ATOM   1598 N  NE2 . HIS A 1 206 ? 12.364 60.930 5.132  1.00 73.44 ? 206 HIS A NE2 1 
ATOM   1599 N  N   . VAL A 1 207 ? 9.577  56.099 9.225  1.00 52.99 ? 207 VAL A N   1 
ATOM   1600 C  CA  . VAL A 1 207 ? 9.517  54.690 9.676  1.00 51.14 ? 207 VAL A CA  1 
ATOM   1601 C  C   . VAL A 1 207 ? 10.186 53.716 8.657  1.00 48.17 ? 207 VAL A C   1 
ATOM   1602 O  O   . VAL A 1 207 ? 10.054 53.840 7.421  1.00 49.16 ? 207 VAL A O   1 
ATOM   1603 C  CB  . VAL A 1 207 ? 8.009  54.220 9.904  1.00 50.25 ? 207 VAL A CB  1 
ATOM   1604 C  CG1 . VAL A 1 207 ? 7.898  52.707 10.074 0.01 50.73 ? 207 VAL A CG1 1 
ATOM   1605 C  CG2 . VAL A 1 207 ? 7.404  54.943 11.097 0.01 50.76 ? 207 VAL A CG2 1 
ATOM   1606 N  N   . PHE A 1 208 ? 10.883 52.738 9.199  1.00 44.37 ? 208 PHE A N   1 
ATOM   1607 C  CA  . PHE A 1 208 ? 11.313 51.550 8.448  1.00 42.85 ? 208 PHE A CA  1 
ATOM   1608 C  C   . PHE A 1 208 ? 10.241 50.410 8.237  1.00 37.96 ? 208 PHE A C   1 
ATOM   1609 O  O   . PHE A 1 208 ? 9.434  50.044 9.074  1.00 35.58 ? 208 PHE A O   1 
ATOM   1610 C  CB  . PHE A 1 208 ? 12.646 51.003 8.993  1.00 42.60 ? 208 PHE A CB  1 
ATOM   1611 C  CG  . PHE A 1 208 ? 13.855 51.748 8.456  1.00 45.46 ? 208 PHE A CG  1 
ATOM   1612 C  CD1 . PHE A 1 208 ? 14.239 52.960 9.028  1.00 43.25 ? 208 PHE A CD1 1 
ATOM   1613 C  CD2 . PHE A 1 208 ? 14.595 51.249 7.362  1.00 47.48 ? 208 PHE A CD2 1 
ATOM   1614 C  CE1 . PHE A 1 208 ? 15.307 53.663 8.568  1.00 45.34 ? 208 PHE A CE1 1 
ATOM   1615 C  CE2 . PHE A 1 208 ? 15.726 51.950 6.863  1.00 45.99 ? 208 PHE A CE2 1 
ATOM   1616 C  CZ  . PHE A 1 208 ? 16.077 53.163 7.476  1.00 48.25 ? 208 PHE A CZ  1 
ATOM   1617 N  N   . PRO A 1 209 ? 10.256 49.866 7.058  1.00 36.01 ? 209 PRO A N   1 
ATOM   1618 C  CA  . PRO A 1 209 ? 9.232  48.920 6.652  1.00 36.49 ? 209 PRO A CA  1 
ATOM   1619 C  C   . PRO A 1 209 ? 9.399  47.561 7.412  1.00 33.82 ? 209 PRO A C   1 
ATOM   1620 O  O   . PRO A 1 209 ? 10.412 47.192 7.916  1.00 33.95 ? 209 PRO A O   1 
ATOM   1621 C  CB  . PRO A 1 209 ? 9.468  48.789 5.142  1.00 36.29 ? 209 PRO A CB  1 
ATOM   1622 C  CG  . PRO A 1 209 ? 10.872 48.938 4.960  1.00 35.48 ? 209 PRO A CG  1 
ATOM   1623 C  CD  . PRO A 1 209 ? 11.249 50.009 5.994  1.00 39.02 ? 209 PRO A CD  1 
ATOM   1624 N  N   . GLU A 1 210 ? 8.318  46.866 7.498  1.00 31.02 ? 210 GLU A N   1 
ATOM   1625 C  CA  . GLU A 1 210 ? 8.261  45.497 7.875  1.00 32.99 ? 210 GLU A CA  1 
ATOM   1626 C  C   . GLU A 1 210 ? 9.038  44.639 6.854  1.00 27.69 ? 210 GLU A C   1 
ATOM   1627 O  O   . GLU A 1 210 ? 9.065  44.990 5.708  1.00 27.00 ? 210 GLU A O   1 
ATOM   1628 C  CB  . GLU A 1 210 ? 6.753  45.153 7.953  1.00 34.43 ? 210 GLU A CB  1 
ATOM   1629 C  CG  . GLU A 1 210 ? 5.932  45.318 6.629  1.00 45.72 ? 210 GLU A CG  1 
ATOM   1630 C  CD  . GLU A 1 210 ? 6.127  46.627 5.804  1.00 53.89 ? 210 GLU A CD  1 
ATOM   1631 O  OE1 . GLU A 1 210 ? 5.855  47.773 6.379  1.00 52.33 ? 210 GLU A OE1 1 
ATOM   1632 O  OE2 . GLU A 1 210 ? 6.541  46.466 4.590  1.00 46.24 ? 210 GLU A OE2 1 
ATOM   1633 N  N   . ALA A 1 211 ? 9.742  43.602 7.287  1.00 22.73 ? 211 ALA A N   1 
ATOM   1634 C  CA  . ALA A 1 211 ? 10.595 42.830 6.385  1.00 21.71 ? 211 ALA A CA  1 
ATOM   1635 C  C   . ALA A 1 211 ? 10.023 41.446 6.179  1.00 20.46 ? 211 ALA A C   1 
ATOM   1636 O  O   . ALA A 1 211 ? 9.385  40.970 7.069  1.00 21.72 ? 211 ALA A O   1 
ATOM   1637 C  CB  . ALA A 1 211 ? 11.939 42.719 7.005  1.00 20.86 ? 211 ALA A CB  1 
ATOM   1638 N  N   . ALA A 1 212 ? 10.371 40.748 5.115  1.00 21.10 ? 212 ALA A N   1 
ATOM   1639 C  CA  . ALA A 1 212 ? 9.833  39.433 4.764  1.00 22.07 ? 212 ALA A CA  1 
ATOM   1640 C  C   . ALA A 1 212 ? 10.448 38.374 5.713  1.00 21.34 ? 212 ALA A C   1 
ATOM   1641 O  O   . ALA A 1 212 ? 9.735  37.686 6.438  1.00 19.98 ? 212 ALA A O   1 
ATOM   1642 C  CB  . ALA A 1 212 ? 10.230 39.047 3.321  1.00 21.74 ? 212 ALA A CB  1 
ATOM   1643 N  N   . THR A 1 213 ? 11.758 38.304 5.679  1.00 20.67 ? 213 THR A N   1 
ATOM   1644 C  CA  . THR A 1 213 ? 12.465 37.338 6.500  1.00 23.46 ? 213 THR A CA  1 
ATOM   1645 C  C   . THR A 1 213 ? 13.710 37.975 7.076  1.00 19.61 ? 213 THR A C   1 
ATOM   1646 O  O   . THR A 1 213 ? 14.752 37.587 6.667  1.00 20.14 ? 213 THR A O   1 
ATOM   1647 C  CB  . THR A 1 213 ? 12.970 36.049 5.673  1.00 23.77 ? 213 THR A CB  1 
ATOM   1648 O  OG1 . THR A 1 213 ? 14.042 36.493 4.840  1.00 29.73 ? 213 THR A OG1 1 
ATOM   1649 C  CG2 . THR A 1 213 ? 11.989 35.453 4.663  1.00 28.17 ? 213 THR A CG2 1 
ATOM   1650 N  N   . PRO A 1 214 ? 13.578 38.866 8.020  1.00 16.64 ? 214 PRO A N   1 
ATOM   1651 C  CA  . PRO A 1 214 ? 14.686 39.678 8.467  1.00 18.19 ? 214 PRO A CA  1 
ATOM   1652 C  C   . PRO A 1 214 ? 15.612 38.816 9.268  1.00 17.49 ? 214 PRO A C   1 
ATOM   1653 O  O   . PRO A 1 214 ? 15.179 37.928 9.948  1.00 17.79 ? 214 PRO A O   1 
ATOM   1654 C  CB  . PRO A 1 214 ? 14.041 40.745 9.394  1.00 17.29 ? 214 PRO A CB  1 
ATOM   1655 C  CG  . PRO A 1 214 ? 12.892 40.102 9.987  1.00 19.04 ? 214 PRO A CG  1 
ATOM   1656 C  CD  . PRO A 1 214 ? 12.365 39.112 8.823  1.00 19.76 ? 214 PRO A CD  1 
ATOM   1657 N  N   . SER A 1 215 ? 16.869 39.113 9.194  1.00 16.30 ? 215 SER A N   1 
ATOM   1658 C  CA  . SER A 1 215 ? 17.783 38.450 10.060 1.00 19.74 ? 215 SER A CA  1 
ATOM   1659 C  C   . SER A 1 215 ? 17.839 39.168 11.446 1.00 19.71 ? 215 SER A C   1 
ATOM   1660 O  O   . SER A 1 215 ? 18.216 38.556 12.442 1.00 19.13 ? 215 SER A O   1 
ATOM   1661 C  CB  . SER A 1 215 ? 19.097 38.474 9.376  1.00 19.30 ? 215 SER A CB  1 
ATOM   1662 O  OG  . SER A 1 215 ? 19.405 39.806 9.520  1.00 25.86 ? 215 SER A OG  1 
ATOM   1663 N  N   . VAL A 1 216 ? 17.506 40.477 11.483 1.00 19.77 ? 216 VAL A N   1 
ATOM   1664 C  CA  . VAL A 1 216 ? 17.725 41.300 12.675 1.00 16.75 ? 216 VAL A CA  1 
ATOM   1665 C  C   . VAL A 1 216 ? 16.367 42.021 12.946 1.00 17.15 ? 216 VAL A C   1 
ATOM   1666 O  O   . VAL A 1 216 ? 15.842 42.683 12.056 1.00 17.11 ? 216 VAL A O   1 
ATOM   1667 C  CB  . VAL A 1 216 ? 18.801 42.426 12.452 1.00 16.41 ? 216 VAL A CB  1 
ATOM   1668 C  CG1 . VAL A 1 216 ? 18.864 43.276 13.607 1.00 18.14 ? 216 VAL A CG1 1 
ATOM   1669 C  CG2 . VAL A 1 216 ? 20.162 41.801 12.294 1.00 21.08 ? 216 VAL A CG2 1 
ATOM   1670 N  N   . TYR A 1 217 ? 15.888 41.974 14.181 1.00 14.74 ? 217 TYR A N   1 
ATOM   1671 C  CA  . TYR A 1 217 ? 14.881 42.870 14.662 1.00 15.02 ? 217 TYR A CA  1 
ATOM   1672 C  C   . TYR A 1 217 ? 15.429 43.803 15.774 1.00 15.51 ? 217 TYR A C   1 
ATOM   1673 O  O   . TYR A 1 217 ? 16.029 43.305 16.736 1.00 16.01 ? 217 TYR A O   1 
ATOM   1674 C  CB  . TYR A 1 217 ? 13.803 42.056 15.350 1.00 14.51 ? 217 TYR A CB  1 
ATOM   1675 C  CG  . TYR A 1 217 ? 12.971 41.125 14.463 1.00 20.29 ? 217 TYR A CG  1 
ATOM   1676 C  CD1 . TYR A 1 217 ? 11.756 41.542 13.915 1.00 21.20 ? 217 TYR A CD1 1 
ATOM   1677 C  CD2 . TYR A 1 217 ? 13.388 39.826 14.236 1.00 26.32 ? 217 TYR A CD2 1 
ATOM   1678 C  CE1 . TYR A 1 217 ? 11.034 40.718 13.172 1.00 22.14 ? 217 TYR A CE1 1 
ATOM   1679 C  CE2 . TYR A 1 217 ? 12.685 39.028 13.463 1.00 23.87 ? 217 TYR A CE2 1 
ATOM   1680 C  CZ  . TYR A 1 217 ? 11.510 39.471 12.965 1.00 23.19 ? 217 TYR A CZ  1 
ATOM   1681 O  OH  . TYR A 1 217 ? 10.816 38.583 12.216 1.00 35.61 ? 217 TYR A OH  1 
ATOM   1682 N  N   . LEU A 1 218 ? 15.200 45.096 15.670 1.00 13.09 ? 218 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 218 ? 15.557 46.093 16.648 1.00 14.05 ? 218 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 218 ? 14.363 46.766 17.200 1.00 16.54 ? 218 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 218 ? 13.351 46.945 16.551 1.00 20.02 ? 218 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 218 ? 16.457 47.147 16.064 1.00 14.72 ? 218 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 218 ? 17.803 46.608 15.484 1.00 15.28 ? 218 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 218 ? 18.703 47.698 14.865 1.00 14.56 ? 218 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 218 ? 18.653 45.828 16.482 1.00 16.54 ? 218 LEU A CD2 1 
ATOM   1690 N  N   . LEU A 1 219 ? 14.455 47.201 18.435 1.00 17.14 ? 219 LEU A N   1 
ATOM   1691 C  CA  . LEU A 1 219 ? 13.391 47.939 19.030 1.00 15.94 ? 219 LEU A CA  1 
ATOM   1692 C  C   . LEU A 1 219 ? 13.901 49.337 19.231 1.00 19.35 ? 219 LEU A C   1 
ATOM   1693 O  O   . LEU A 1 219 ? 14.937 49.591 19.867 1.00 19.66 ? 219 LEU A O   1 
ATOM   1694 C  CB  . LEU A 1 219 ? 12.984 47.364 20.354 1.00 16.81 ? 219 LEU A CB  1 
ATOM   1695 C  CG  . LEU A 1 219 ? 11.905 48.162 21.129 1.00 21.53 ? 219 LEU A CG  1 
ATOM   1696 C  CD1 . LEU A 1 219 ? 10.569 48.139 20.493 1.00 23.32 ? 219 LEU A CD1 1 
ATOM   1697 C  CD2 . LEU A 1 219 ? 11.759 47.566 22.544 1.00 23.20 ? 219 LEU A CD2 1 
ATOM   1698 N  N   . TYR A 1 220 ? 13.147 50.279 18.684 1.00 18.45 ? 220 TYR A N   1 
ATOM   1699 C  CA  . TYR A 1 220 ? 13.481 51.650 18.763 1.00 19.80 ? 220 TYR A CA  1 
ATOM   1700 C  C   . TYR A 1 220 ? 12.617 52.378 19.793 1.00 19.92 ? 220 TYR A C   1 
ATOM   1701 O  O   . TYR A 1 220 ? 11.398 52.286 19.756 1.00 21.22 ? 220 TYR A O   1 
ATOM   1702 C  CB  . TYR A 1 220 ? 13.291 52.265 17.373 1.00 19.09 ? 220 TYR A CB  1 
ATOM   1703 C  CG  . TYR A 1 220 ? 13.585 53.742 17.327 1.00 22.08 ? 220 TYR A CG  1 
ATOM   1704 C  CD1 . TYR A 1 220 ? 14.847 54.196 17.115 1.00 26.98 ? 220 TYR A CD1 1 
ATOM   1705 C  CD2 . TYR A 1 220 ? 12.588 54.681 17.559 1.00 26.33 ? 220 TYR A CD2 1 
ATOM   1706 C  CE1 . TYR A 1 220 ? 15.149 55.549 17.073 1.00 32.24 ? 220 TYR A CE1 1 
ATOM   1707 C  CE2 . TYR A 1 220 ? 12.884 56.056 17.529 1.00 28.86 ? 220 TYR A CE2 1 
ATOM   1708 C  CZ  . TYR A 1 220 ? 14.133 56.478 17.278 1.00 33.07 ? 220 TYR A CZ  1 
ATOM   1709 O  OH  . TYR A 1 220 ? 14.415 57.818 17.254 1.00 38.97 ? 220 TYR A OH  1 
ATOM   1710 N  N   . LYS A 1 221 ? 13.275 53.129 20.646 1.00 22.84 ? 221 LYS A N   1 
ATOM   1711 C  CA  . LYS A 1 221 ? 12.667 54.060 21.612 1.00 25.94 ? 221 LYS A CA  1 
ATOM   1712 C  C   . LYS A 1 221 ? 13.676 55.180 22.049 1.00 25.29 ? 221 LYS A C   1 
ATOM   1713 O  O   . LYS A 1 221 ? 14.798 54.884 22.455 1.00 23.51 ? 221 LYS A O   1 
ATOM   1714 C  CB  . LYS A 1 221 ? 12.237 53.311 22.837 1.00 28.28 ? 221 LYS A CB  1 
ATOM   1715 C  CG  . LYS A 1 221 ? 11.549 54.280 23.833 1.00 34.68 ? 221 LYS A CG  1 
ATOM   1716 C  CD  . LYS A 1 221 ? 11.243 53.575 25.133 1.00 41.23 ? 221 LYS A CD  1 
ATOM   1717 C  CE  . LYS A 1 221 ? 11.733 54.408 26.404 1.00 47.24 ? 221 LYS A CE  1 
ATOM   1718 N  NZ  . LYS A 1 221 ? 13.239 54.518 26.728 1.00 43.73 ? 221 LYS A NZ  1 
ATOM   1719 N  N   . THR A 1 222 ? 13.261 56.459 21.912 1.00 27.68 ? 222 THR A N   1 
ATOM   1720 C  CA  . THR A 1 222 ? 14.062 57.660 22.273 1.00 28.59 ? 222 THR A CA  1 
ATOM   1721 C  C   . THR A 1 222 ? 15.475 57.589 21.707 1.00 28.28 ? 222 THR A C   1 
ATOM   1722 O  O   . THR A 1 222 ? 16.519 57.717 22.418 1.00 28.90 ? 222 THR A O   1 
ATOM   1723 C  CB  . THR A 1 222 ? 14.050 57.797 23.804 1.00 30.76 ? 222 THR A CB  1 
ATOM   1724 O  OG1 . THR A 1 222 ? 12.659 57.708 24.225 1.00 34.12 ? 222 THR A OG1 1 
ATOM   1725 C  CG2 . THR A 1 222 ? 14.531 59.162 24.277 1.00 32.03 ? 222 THR A CG2 1 
ATOM   1726 N  N   . SER A 1 223 ? 15.506 57.282 20.424 1.00 28.60 ? 223 SER A N   1 
ATOM   1727 C  CA  . SER A 1 223 ? 16.707 57.377 19.621 1.00 30.66 ? 223 SER A CA  1 
ATOM   1728 C  C   . SER A 1 223 ? 17.735 56.334 20.104 1.00 31.16 ? 223 SER A C   1 
ATOM   1729 O  O   . SER A 1 223 ? 18.929 56.542 20.002 1.00 34.16 ? 223 SER A O   1 
ATOM   1730 C  CB  . SER A 1 223 ? 17.271 58.802 19.749 1.00 31.58 ? 223 SER A CB  1 
ATOM   1731 O  OG  . SER A 1 223 ? 16.526 59.684 18.930 1.00 35.35 ? 223 SER A OG  1 
ATOM   1732 N  N   . HIS A 1 224 ? 17.251 55.216 20.650 1.00 29.99 ? 224 HIS A N   1 
ATOM   1733 C  CA  . HIS A 1 224 ? 18.046 54.116 21.163 1.00 26.53 ? 224 HIS A CA  1 
ATOM   1734 C  C   . HIS A 1 224 ? 17.505 52.826 20.554 1.00 23.60 ? 224 HIS A C   1 
ATOM   1735 O  O   . HIS A 1 224 ? 16.288 52.708 20.345 1.00 20.70 ? 224 HIS A O   1 
ATOM   1736 C  CB  . HIS A 1 224 ? 17.863 54.041 22.658 1.00 29.02 ? 224 HIS A CB  1 
ATOM   1737 C  CG  . HIS A 1 224 ? 18.709 53.005 23.315 1.00 32.87 ? 224 HIS A CG  1 
ATOM   1738 N  ND1 . HIS A 1 224 ? 19.863 53.309 23.997 1.00 44.73 ? 224 HIS A ND1 1 
ATOM   1739 C  CD2 . HIS A 1 224 ? 18.596 51.658 23.377 1.00 38.43 ? 224 HIS A CD2 1 
ATOM   1740 C  CE1 . HIS A 1 224 ? 20.400 52.202 24.493 1.00 39.99 ? 224 HIS A CE1 1 
ATOM   1741 N  NE2 . HIS A 1 224 ? 19.668 51.180 24.109 1.00 39.69 ? 224 HIS A NE2 1 
ATOM   1742 N  N   . TYR A 1 225 ? 18.409 51.872 20.332 1.00 20.30 ? 225 TYR A N   1 
ATOM   1743 C  CA  . TYR A 1 225 ? 18.081 50.604 19.686 1.00 20.50 ? 225 TYR A CA  1 
ATOM   1744 C  C   . TYR A 1 225 ? 18.450 49.460 20.627 1.00 20.79 ? 225 TYR A C   1 
ATOM   1745 O  O   . TYR A 1 225 ? 19.577 49.347 20.985 1.00 22.20 ? 225 TYR A O   1 
ATOM   1746 C  CB  . TYR A 1 225 ? 18.898 50.519 18.347 1.00 18.57 ? 225 TYR A CB  1 
ATOM   1747 C  CG  . TYR A 1 225 ? 18.458 51.569 17.338 1.00 19.36 ? 225 TYR A CG  1 
ATOM   1748 C  CD1 . TYR A 1 225 ? 17.488 51.265 16.506 1.00 20.70 ? 225 TYR A CD1 1 
ATOM   1749 C  CD2 . TYR A 1 225 ? 19.054 52.867 17.208 1.00 22.30 ? 225 TYR A CD2 1 
ATOM   1750 C  CE1 . TYR A 1 225 ? 17.068 52.111 15.536 1.00 27.01 ? 225 TYR A CE1 1 
ATOM   1751 C  CE2 . TYR A 1 225 ? 18.604 53.762 16.243 1.00 22.97 ? 225 TYR A CE2 1 
ATOM   1752 C  CZ  . TYR A 1 225 ? 17.583 53.384 15.427 1.00 27.36 ? 225 TYR A CZ  1 
ATOM   1753 O  OH  . TYR A 1 225 ? 16.981 54.081 14.360 1.00 31.10 ? 225 TYR A OH  1 
ATOM   1754 N  N   . ASN A 1 226 ? 17.516 48.590 20.968 1.00 18.84 ? 226 ASN A N   1 
ATOM   1755 C  CA  . ASN A 1 226 ? 17.819 47.300 21.550 1.00 16.70 ? 226 ASN A CA  1 
ATOM   1756 C  C   . ASN A 1 226 ? 17.507 46.193 20.566 1.00 16.58 ? 226 ASN A C   1 
ATOM   1757 O  O   . ASN A 1 226 ? 16.968 46.441 19.460 1.00 16.79 ? 226 ASN A O   1 
ATOM   1758 C  CB  . ASN A 1 226 ? 16.931 47.231 22.788 1.00 19.11 ? 226 ASN A CB  1 
ATOM   1759 C  CG  . ASN A 1 226 ? 17.446 48.185 23.864 1.00 20.69 ? 226 ASN A CG  1 
ATOM   1760 O  OD1 . ASN A 1 226 ? 18.708 48.450 23.986 1.00 23.34 ? 226 ASN A OD1 1 
ATOM   1761 N  ND2 . ASN A 1 226 ? 16.528 48.721 24.625 1.00 22.67 ? 226 ASN A ND2 1 
ATOM   1762 N  N   . ILE A 1 227 ? 17.830 44.959 20.902 1.00 14.42 ? 227 ILE A N   1 
ATOM   1763 C  CA  . ILE A 1 227 ? 17.669 43.832 19.977 1.00 15.30 ? 227 ILE A CA  1 
ATOM   1764 C  C   . ILE A 1 227 ? 16.496 42.999 20.427 1.00 17.14 ? 227 ILE A C   1 
ATOM   1765 O  O   . ILE A 1 227 ? 16.408 42.639 21.626 1.00 14.21 ? 227 ILE A O   1 
ATOM   1766 C  CB  . ILE A 1 227 ? 18.927 43.014 19.998 1.00 14.96 ? 227 ILE A CB  1 
ATOM   1767 C  CG1 . ILE A 1 227 ? 20.164 43.893 19.683 1.00 15.60 ? 227 ILE A CG1 1 
ATOM   1768 C  CG2 . ILE A 1 227 ? 18.789 41.709 19.218 1.00 19.97 ? 227 ILE A CG2 1 
ATOM   1769 C  CD1 . ILE A 1 227 ? 21.463 43.178 20.040 1.00 14.66 ? 227 ILE A CD1 1 
ATOM   1770 N  N   . LEU A 1 228 ? 15.603 42.649 19.479 1.00 15.79 ? 228 LEU A N   1 
ATOM   1771 C  CA  . LEU A 1 228 ? 14.495 41.735 19.713 1.00 15.50 ? 228 LEU A CA  1 
ATOM   1772 C  C   . LEU A 1 228 ? 14.751 40.367 19.048 1.00 16.02 ? 228 LEU A C   1 
ATOM   1773 O  O   . LEU A 1 228 ? 15.509 40.221 18.010 1.00 15.89 ? 228 LEU A O   1 
ATOM   1774 C  CB  . LEU A 1 228 ? 13.170 42.397 19.172 1.00 16.35 ? 228 LEU A CB  1 
ATOM   1775 C  CG  . LEU A 1 228 ? 12.614 43.640 19.856 1.00 16.25 ? 228 LEU A CG  1 
ATOM   1776 C  CD1 . LEU A 1 228 ? 11.526 44.269 19.116 1.00 14.07 ? 228 LEU A CD1 1 
ATOM   1777 C  CD2 . LEU A 1 228 ? 12.023 43.207 21.127 1.00 19.00 ? 228 LEU A CD2 1 
ATOM   1778 N  N   . TYR A 1 229 ? 14.092 39.345 19.611 1.00 16.65 ? 229 TYR A N   1 
ATOM   1779 C  CA  . TYR A 1 229 ? 14.165 37.899 19.188 1.00 18.38 ? 229 TYR A CA  1 
ATOM   1780 C  C   . TYR A 1 229 ? 12.698 37.440 18.957 1.00 21.06 ? 229 TYR A C   1 
ATOM   1781 O  O   . TYR A 1 229 ? 11.870 37.608 19.847 1.00 17.35 ? 229 TYR A O   1 
ATOM   1782 C  CB  . TYR A 1 229 ? 14.829 37.071 20.270 1.00 17.36 ? 229 TYR A CB  1 
ATOM   1783 C  CG  . TYR A 1 229 ? 16.263 37.467 20.403 1.00 19.75 ? 229 TYR A CG  1 
ATOM   1784 C  CD1 . TYR A 1 229 ? 17.223 36.856 19.611 1.00 23.95 ? 229 TYR A CD1 1 
ATOM   1785 C  CD2 . TYR A 1 229 ? 16.645 38.527 21.154 1.00 17.45 ? 229 TYR A CD2 1 
ATOM   1786 C  CE1 . TYR A 1 229 ? 18.575 37.270 19.639 1.00 18.54 ? 229 TYR A CE1 1 
ATOM   1787 C  CE2 . TYR A 1 229 ? 18.001 38.913 21.220 1.00 17.55 ? 229 TYR A CE2 1 
ATOM   1788 C  CZ  . TYR A 1 229 ? 18.924 38.340 20.459 1.00 19.67 ? 229 TYR A CZ  1 
ATOM   1789 O  OH  . TYR A 1 229 ? 20.239 38.767 20.497 1.00 19.34 ? 229 TYR A OH  1 
ATOM   1790 N  N   . ALA A 1 230 ? 12.396 36.972 17.773 1.00 23.26 ? 230 ALA A N   1 
ATOM   1791 C  CA  . ALA A 1 230 ? 11.046 36.694 17.371 1.00 30.62 ? 230 ALA A CA  1 
ATOM   1792 C  C   . ALA A 1 230 ? 10.690 35.328 17.864 1.00 36.38 ? 230 ALA A C   1 
ATOM   1793 O  O   . ALA A 1 230 ? 11.478 34.385 17.670 1.00 34.56 ? 230 ALA A O   1 
ATOM   1794 C  CB  . ALA A 1 230 ? 10.822 36.738 15.798 1.00 31.09 ? 230 ALA A CB  1 
ATOM   1795 N  N   . ALA A 1 231 ? 9.455  35.285 18.408 1.00 42.84 ? 231 ALA A N   1 
ATOM   1796 C  CA  . ALA A 1 231 ? 8.735  34.089 18.782 1.00 47.38 ? 231 ALA A CA  1 
ATOM   1797 C  C   . ALA A 1 231 ? 7.979  33.782 17.534 1.00 52.18 ? 231 ALA A C   1 
ATOM   1798 O  O   . ALA A 1 231 ? 6.731  33.816 17.610 1.00 56.96 ? 231 ALA A O   1 
ATOM   1799 C  CB  . ALA A 1 231 ? 7.653  34.411 19.878 1.00 48.44 ? 231 ALA A CB  1 
ATOM   1800 N  N   . ASP A 1 232 ? 8.598  33.526 16.383 1.00 54.62 ? 232 ASP A N   1 
ATOM   1801 C  CA  . ASP A 1 232 ? 7.759  33.462 15.178 1.00 56.84 ? 232 ASP A CA  1 
ATOM   1802 C  C   . ASP A 1 232 ? 7.161  32.023 15.085 1.00 59.45 ? 232 ASP A C   1 
ATOM   1803 O  O   . ASP A 1 232 ? 7.111  31.405 14.017 1.00 61.26 ? 232 ASP A O   1 
ATOM   1804 C  CB  . ASP A 1 232 ? 8.562  33.916 13.937 1.00 57.26 ? 232 ASP A CB  1 
ATOM   1805 C  CG  . ASP A 1 232 ? 8.018  35.194 13.322 0.01 56.12 ? 232 ASP A CG  1 
ATOM   1806 O  OD1 . ASP A 1 232 ? 6.840  35.201 12.902 0.01 55.30 ? 232 ASP A OD1 1 
ATOM   1807 O  OD2 . ASP A 1 232 ? 8.694  36.239 13.215 0.01 55.31 ? 232 ASP A OD2 1 
ATOM   1808 N  N   . LYS A 1 233 ? 6.677  31.514 16.227 1.00 60.69 ? 233 LYS A N   1 
ATOM   1809 C  CA  . LYS A 1 233 ? 6.714  30.088 16.521 1.00 60.83 ? 233 LYS A CA  1 
ATOM   1810 C  C   . LYS A 1 233 ? 5.832  29.741 17.755 1.00 63.37 ? 233 LYS A C   1 
ATOM   1811 O  O   . LYS A 1 233 ? 5.862  30.459 18.769 1.00 64.86 ? 233 LYS A O   1 
ATOM   1812 C  CB  . LYS A 1 233 ? 8.185  29.693 16.781 0.01 59.95 ? 233 LYS A CB  1 
ATOM   1813 C  CG  . LYS A 1 233 ? 9.131  29.914 15.584 0.01 56.03 ? 233 LYS A CG  1 
ATOM   1814 C  CD  . LYS A 1 233 ? 10.226 28.860 15.472 0.01 51.25 ? 233 LYS A CD  1 
ATOM   1815 C  CE  . LYS A 1 233 ? 10.825 28.849 14.069 0.01 48.88 ? 233 LYS A CE  1 
ATOM   1816 N  NZ  . LYS A 1 233 ? 11.918 27.848 13.926 0.01 47.45 ? 233 LYS A NZ  1 
ATOM   1817 N  N   . HIS A 1 234 ? 4.982  28.717 17.599 1.00 64.89 ? 234 HIS A N   1 
ATOM   1818 C  CA  . HIS A 1 234 ? 4.650  27.690 18.617 1.00 66.31 ? 234 HIS A CA  1 
ATOM   1819 C  C   . HIS A 1 234 ? 4.195  28.061 20.048 1.00 66.48 ? 234 HIS A C   1 
ATOM   1820 O  O   . HIS A 1 234 ? 3.224  27.477 20.569 1.00 66.63 ? 234 HIS A O   1 
ATOM   1821 C  CB  . HIS A 1 234 ? 5.807  26.657 18.627 1.00 66.87 ? 234 HIS A CB  1 
ATOM   1822 C  CG  . HIS A 1 234 ? 6.306  26.320 17.244 1.00 69.13 ? 234 HIS A CG  1 
ATOM   1823 N  ND1 . HIS A 1 234 ? 5.690  25.396 16.423 1.00 75.25 ? 234 HIS A ND1 1 
ATOM   1824 C  CD2 . HIS A 1 234 ? 7.337  26.820 16.523 1.00 70.30 ? 234 HIS A CD2 1 
ATOM   1825 C  CE1 . HIS A 1 234 ? 6.333  25.329 15.265 1.00 75.06 ? 234 HIS A CE1 1 
ATOM   1826 N  NE2 . HIS A 1 234 ? 7.337  26.189 15.300 1.00 72.99 ? 234 HIS A NE2 1 
HETATM 1827 O  O   . HOH B 2 .   ? 36.878 58.640 -3.840 1.00 22.32 ? 235 HOH A O   1 
HETATM 1828 O  O   . HOH B 2 .   ? 4.602  45.938 2.248  1.00 37.34 ? 236 HOH A O   1 
HETATM 1829 O  O   . HOH B 2 .   ? 17.415 40.314 16.149 1.00 17.11 ? 237 HOH A O   1 
HETATM 1830 O  O   . HOH B 2 .   ? 38.355 49.943 -4.990 1.00 24.29 ? 238 HOH A O   1 
HETATM 1831 O  O   . HOH B 2 .   ? 19.695 39.648 6.118  1.00 18.79 ? 239 HOH A O   1 
HETATM 1832 O  O   . HOH B 2 .   ? 19.050 35.270 29.826 1.00 22.39 ? 240 HOH A O   1 
HETATM 1833 O  O   . HOH B 2 .   ? 16.508 45.644 5.484  1.00 20.71 ? 241 HOH A O   1 
HETATM 1834 O  O   . HOH B 2 .   ? 20.544 37.747 16.288 1.00 22.85 ? 242 HOH A O   1 
HETATM 1835 O  O   . HOH B 2 .   ? 25.935 58.034 12.800 1.00 27.94 ? 243 HOH A O   1 
HETATM 1836 O  O   . HOH B 2 .   ? 33.460 61.561 -0.710 1.00 23.15 ? 244 HOH A O   1 
HETATM 1837 O  O   . HOH B 2 .   ? 14.725 36.575 15.975 1.00 23.98 ? 245 HOH A O   1 
HETATM 1838 O  O   . HOH B 2 .   ? 40.869 47.673 -1.499 1.00 33.72 ? 246 HOH A O   1 
HETATM 1839 O  O   . HOH B 2 .   ? 32.169 56.228 21.752 1.00 24.76 ? 247 HOH A O   1 
HETATM 1840 O  O   . HOH B 2 .   ? 26.644 43.086 0.264  1.00 41.08 ? 248 HOH A O   1 
HETATM 1841 O  O   . HOH B 2 .   ? 30.577 65.275 14.753 1.00 22.79 ? 249 HOH A O   1 
HETATM 1842 O  O   . HOH B 2 .   ? 26.341 51.138 22.129 1.00 24.98 ? 250 HOH A O   1 
HETATM 1843 O  O   . HOH B 2 .   ? 32.768 66.417 13.620 1.00 27.79 ? 251 HOH A O   1 
HETATM 1844 O  O   . HOH B 2 .   ? 15.763 38.260 3.748  1.00 26.50 ? 252 HOH A O   1 
HETATM 1845 O  O   . HOH B 2 .   ? 22.359 67.673 -1.239 1.00 35.00 ? 253 HOH A O   1 
HETATM 1846 O  O   . HOH B 2 .   ? 30.332 51.407 -1.584 1.00 27.28 ? 254 HOH A O   1 
HETATM 1847 O  O   . HOH B 2 .   ? 22.310 44.900 -0.505 1.00 25.48 ? 255 HOH A O   1 
HETATM 1848 O  O   . HOH B 2 .   ? 31.134 61.431 -2.262 1.00 26.51 ? 256 HOH A O   1 
HETATM 1849 O  O   . HOH B 2 .   ? 30.634 53.138 25.065 1.00 31.45 ? 257 HOH A O   1 
HETATM 1850 O  O   . HOH B 2 .   ? 35.602 35.946 22.638 1.00 27.12 ? 258 HOH A O   1 
HETATM 1851 O  O   . HOH B 2 .   ? 9.111  37.528 27.068 1.00 31.46 ? 259 HOH A O   1 
HETATM 1852 O  O   . HOH B 2 .   ? 37.641 55.336 16.484 1.00 25.58 ? 260 HOH A O   1 
HETATM 1853 O  O   . HOH B 2 .   ? 29.174 29.049 12.886 1.00 27.06 ? 261 HOH A O   1 
HETATM 1854 O  O   . HOH B 2 .   ? 17.822 38.241 15.322 1.00 34.44 ? 262 HOH A O   1 
HETATM 1855 O  O   . HOH B 2 .   ? 36.322 62.320 6.594  1.00 34.37 ? 263 HOH A O   1 
HETATM 1856 O  O   . HOH B 2 .   ? 17.061 49.621 4.892  1.00 30.42 ? 264 HOH A O   1 
HETATM 1857 O  O   . HOH B 2 .   ? 34.128 40.748 27.199 1.00 34.70 ? 265 HOH A O   1 
HETATM 1858 O  O   . HOH B 2 .   ? 35.297 62.538 10.866 1.00 28.88 ? 266 HOH A O   1 
HETATM 1859 O  O   . HOH B 2 .   ? 25.129 35.803 3.934  1.00 26.02 ? 267 HOH A O   1 
HETATM 1860 O  O   . HOH B 2 .   ? 8.245  38.234 8.460  1.00 36.73 ? 268 HOH A O   1 
HETATM 1861 O  O   . HOH B 2 .   ? 44.121 51.518 11.083 1.00 47.97 ? 269 HOH A O   1 
HETATM 1862 O  O   . HOH B 2 .   ? 20.745 35.480 27.560 1.00 27.47 ? 270 HOH A O   1 
HETATM 1863 O  O   . HOH B 2 .   ? 12.816 59.405 18.528 1.00 33.46 ? 271 HOH A O   1 
HETATM 1864 O  O   . HOH B 2 .   ? 7.323  37.296 25.385 1.00 29.04 ? 272 HOH A O   1 
HETATM 1865 O  O   . HOH B 2 .   ? 24.955 62.771 17.950 1.00 35.21 ? 273 HOH A O   1 
HETATM 1866 O  O   . HOH B 2 .   ? 9.656  63.031 13.997 1.00 44.83 ? 274 HOH A O   1 
HETATM 1867 O  O   . HOH B 2 .   ? 17.529 35.648 12.503 1.00 31.34 ? 275 HOH A O   1 
HETATM 1868 O  O   . HOH B 2 .   ? 11.529 48.062 9.711  1.00 30.36 ? 276 HOH A O   1 
HETATM 1869 O  O   . HOH B 2 .   ? 28.992 37.517 -0.940 1.00 29.47 ? 277 HOH A O   1 
HETATM 1870 O  O   . HOH B 2 .   ? 25.685 46.206 -0.798 1.00 39.94 ? 278 HOH A O   1 
HETATM 1871 O  O   . HOH B 2 .   ? 15.229 56.644 11.770 1.00 56.06 ? 279 HOH A O   1 
HETATM 1872 O  O   . HOH B 2 .   ? 24.663 39.769 4.366  1.00 32.63 ? 280 HOH A O   1 
HETATM 1873 O  O   . HOH B 2 .   ? 7.842  38.291 32.230 1.00 43.00 ? 281 HOH A O   1 
HETATM 1874 O  O   . HOH B 2 .   ? 19.706 61.145 -8.278 1.00 37.22 ? 282 HOH A O   1 
HETATM 1875 O  O   . HOH B 2 .   ? 22.869 36.834 6.083  1.00 39.45 ? 283 HOH A O   1 
HETATM 1876 O  O   . HOH B 2 .   ? 27.098 57.954 -6.725 1.00 36.18 ? 284 HOH A O   1 
HETATM 1877 O  O   . HOH B 2 .   ? 14.803 50.234 22.572 1.00 36.96 ? 285 HOH A O   1 
HETATM 1878 O  O   . HOH B 2 .   ? 6.515  48.712 15.870 1.00 38.54 ? 286 HOH A O   1 
HETATM 1879 O  O   . HOH B 2 .   ? 35.911 45.994 28.335 1.00 33.53 ? 287 HOH A O   1 
HETATM 1880 O  O   . HOH B 2 .   ? 29.257 59.155 -5.545 1.00 34.79 ? 288 HOH A O   1 
HETATM 1881 O  O   . HOH B 2 .   ? 8.882  40.196 9.876  1.00 29.25 ? 289 HOH A O   1 
HETATM 1882 O  O   . HOH B 2 .   ? 7.365  39.041 28.666 1.00 37.02 ? 290 HOH A O   1 
HETATM 1883 O  O   . HOH B 2 .   ? 29.129 58.191 24.133 1.00 49.25 ? 291 HOH A O   1 
HETATM 1884 O  O   . HOH B 2 .   ? 23.696 36.302 27.078 1.00 42.04 ? 292 HOH A O   1 
HETATM 1885 O  O   . HOH B 2 .   ? 35.652 59.354 16.600 1.00 36.18 ? 293 HOH A O   1 
HETATM 1886 O  O   . HOH B 2 .   ? 24.386 44.930 30.453 1.00 37.03 ? 294 HOH A O   1 
HETATM 1887 O  O   . HOH B 2 .   ? 13.235 35.899 10.041 1.00 39.40 ? 295 HOH A O   1 
HETATM 1888 O  O   . HOH B 2 .   ? 10.382 57.033 20.813 1.00 32.07 ? 296 HOH A O   1 
HETATM 1889 O  O   . HOH B 2 .   ? 13.178 47.607 7.204  1.00 42.53 ? 297 HOH A O   1 
HETATM 1890 O  O   . HOH B 2 .   ? 37.395 41.716 16.873 1.00 31.41 ? 298 HOH A O   1 
HETATM 1891 O  O   . HOH B 2 .   ? 30.170 35.851 26.707 1.00 33.37 ? 299 HOH A O   1 
HETATM 1892 O  O   . HOH B 2 .   ? 22.974 28.732 5.049  1.00 46.74 ? 300 HOH A O   1 
HETATM 1893 O  O   . HOH B 2 .   ? 9.627  35.564 28.683 1.00 34.42 ? 301 HOH A O   1 
HETATM 1894 O  O   . HOH B 2 .   ? 19.595 42.751 31.982 1.00 47.11 ? 302 HOH A O   1 
HETATM 1895 O  O   . HOH B 2 .   ? 17.322 37.496 5.936  1.00 44.18 ? 303 HOH A O   1 
HETATM 1896 O  O   . HOH B 2 .   ? 50.197 50.921 9.120  1.00 49.59 ? 304 HOH A O   1 
HETATM 1897 O  O   . HOH B 2 .   ? 21.811 34.959 7.097  1.00 44.26 ? 305 HOH A O   1 
HETATM 1898 O  O   . HOH B 2 .   ? 29.074 57.279 26.988 1.00 55.00 ? 306 HOH A O   1 
HETATM 1899 O  O   . HOH B 2 .   ? 6.732  60.537 9.836  1.00 48.10 ? 307 HOH A O   1 
HETATM 1900 O  O   . HOH B 2 .   ? 19.052 35.665 5.183  1.00 39.45 ? 308 HOH A O   1 
HETATM 1901 O  O   . HOH B 2 .   ? 30.424 27.827 10.678 1.00 42.90 ? 309 HOH A O   1 
HETATM 1902 O  O   . HOH B 2 .   ? 35.343 64.343 2.953  1.00 30.93 ? 310 HOH A O   1 
HETATM 1903 O  O   . HOH B 2 .   ? 23.681 66.847 13.455 1.00 46.57 ? 311 HOH A O   1 
HETATM 1904 O  O   . HOH B 2 .   ? 30.534 50.439 1.354  1.00 51.39 ? 312 HOH A O   1 
HETATM 1905 O  O   . HOH B 2 .   ? 35.509 38.497 -1.640 1.00 38.83 ? 313 HOH A O   1 
HETATM 1906 O  O   . HOH B 2 .   ? 21.353 33.886 20.923 1.00 42.25 ? 314 HOH A O   1 
HETATM 1907 O  O   . HOH B 2 .   ? 21.093 35.742 9.199  1.00 39.27 ? 315 HOH A O   1 
HETATM 1908 O  O   . HOH B 2 .   ? 20.416 35.623 32.818 1.00 31.01 ? 316 HOH A O   1 
HETATM 1909 O  O   . HOH B 2 .   ? 38.912 35.426 15.446 1.00 30.98 ? 317 HOH A O   1 
HETATM 1910 O  O   . HOH B 2 .   ? 30.696 43.466 -2.489 1.00 31.68 ? 318 HOH A O   1 
HETATM 1911 O  O   . HOH B 2 .   ? 34.604 64.569 12.645 1.00 31.46 ? 319 HOH A O   1 
HETATM 1912 O  O   . HOH B 2 .   ? 32.675 71.721 5.809  1.00 36.05 ? 320 HOH A O   1 
HETATM 1913 O  O   . HOH B 2 .   ? 42.837 45.587 14.841 1.00 33.68 ? 321 HOH A O   1 
HETATM 1914 O  O   . HOH B 2 .   ? 27.357 70.855 4.220  1.00 38.57 ? 322 HOH A O   1 
HETATM 1915 O  O   . HOH B 2 .   ? 9.393  54.282 20.088 1.00 38.78 ? 323 HOH A O   1 
HETATM 1916 O  O   . HOH B 2 .   ? 31.256 28.908 6.283  1.00 38.81 ? 324 HOH A O   1 
HETATM 1917 O  O   . HOH B 2 .   ? 32.295 39.727 28.630 1.00 29.85 ? 325 HOH A O   1 
HETATM 1918 O  O   . HOH B 2 .   ? 26.058 66.543 -1.623 1.00 39.76 ? 326 HOH A O   1 
HETATM 1919 O  O   . HOH B 2 .   ? 37.137 25.615 15.559 1.00 36.34 ? 327 HOH A O   1 
HETATM 1920 O  O   . HOH B 2 .   ? 22.148 31.378 14.524 1.00 45.58 ? 328 HOH A O   1 
HETATM 1921 O  O   . HOH B 2 .   ? 22.310 52.781 28.588 1.00 46.74 ? 329 HOH A O   1 
HETATM 1922 O  O   . HOH B 2 .   ? 35.774 33.349 24.142 1.00 46.87 ? 330 HOH A O   1 
HETATM 1923 O  O   . HOH B 2 .   ? 24.245 54.767 16.890 1.00 36.96 ? 331 HOH A O   1 
HETATM 1924 O  O   . HOH B 2 .   ? 21.538 38.897 4.789  1.00 41.84 ? 332 HOH A O   1 
HETATM 1925 O  O   . HOH B 2 .   ? 36.404 64.605 5.412  1.00 52.15 ? 333 HOH A O   1 
HETATM 1926 O  O   . HOH B 2 .   ? 7.520  48.120 12.679 1.00 39.47 ? 334 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   PHE 6   6   ?   ?   ?   A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  HIS 22  22  22  HIS HIS A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  CYS 51  51  51  CYS CYS A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  HIS 93  93  93  HIS HIS A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  PHE 95  95  95  PHE PHE A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 PHE 122 122 122 PHE PHE A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 HIS 130 130 130 HIS HIS A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 MSE 158 158 158 MSE MSE A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 CYS 164 164 164 CYS CYS A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 HIS 166 166 166 HIS HIS A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 MSE 171 171 171 MSE MSE A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 CYS 175 175 175 CYS CYS A . n 
A 1 176 ASP 176 176 176 ASP ASP A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 GLU 198 198 ?   ?   ?   A . n 
A 1 199 MET 199 199 ?   ?   ?   A . n 
A 1 200 ASP 200 200 ?   ?   ?   A . n 
A 1 201 THR 201 201 ?   ?   ?   A . n 
A 1 202 ALA 202 202 ?   ?   ?   A . n 
A 1 203 LEU 203 203 ?   ?   ?   A . n 
A 1 204 ASN 204 204 ?   ?   ?   A . n 
A 1 205 HIS 205 205 205 HIS HIS A . n 
A 1 206 HIS 206 206 206 HIS HIS A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 GLU 210 210 210 GLU GLU A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 PRO 214 214 214 PRO PRO A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 VAL 216 216 216 VAL VAL A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 TYR 220 220 220 TYR TYR A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 HIS 224 224 224 HIS HIS A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   235 1   HOH HOH A . 
B 2 HOH 2   236 2   HOH HOH A . 
B 2 HOH 3   237 3   HOH HOH A . 
B 2 HOH 4   238 4   HOH HOH A . 
B 2 HOH 5   239 5   HOH HOH A . 
B 2 HOH 6   240 6   HOH HOH A . 
B 2 HOH 7   241 7   HOH HOH A . 
B 2 HOH 8   242 8   HOH HOH A . 
B 2 HOH 9   243 9   HOH HOH A . 
B 2 HOH 10  244 10  HOH HOH A . 
B 2 HOH 11  245 11  HOH HOH A . 
B 2 HOH 12  246 12  HOH HOH A . 
B 2 HOH 13  247 13  HOH HOH A . 
B 2 HOH 14  248 14  HOH HOH A . 
B 2 HOH 15  249 15  HOH HOH A . 
B 2 HOH 16  250 16  HOH HOH A . 
B 2 HOH 17  251 17  HOH HOH A . 
B 2 HOH 18  252 18  HOH HOH A . 
B 2 HOH 19  253 19  HOH HOH A . 
B 2 HOH 20  254 20  HOH HOH A . 
B 2 HOH 21  255 21  HOH HOH A . 
B 2 HOH 22  256 22  HOH HOH A . 
B 2 HOH 23  257 23  HOH HOH A . 
B 2 HOH 24  258 24  HOH HOH A . 
B 2 HOH 25  259 25  HOH HOH A . 
B 2 HOH 26  260 26  HOH HOH A . 
B 2 HOH 27  261 27  HOH HOH A . 
B 2 HOH 28  262 28  HOH HOH A . 
B 2 HOH 29  263 29  HOH HOH A . 
B 2 HOH 30  264 30  HOH HOH A . 
B 2 HOH 31  265 31  HOH HOH A . 
B 2 HOH 32  266 32  HOH HOH A . 
B 2 HOH 33  267 33  HOH HOH A . 
B 2 HOH 34  268 34  HOH HOH A . 
B 2 HOH 35  269 35  HOH HOH A . 
B 2 HOH 36  270 36  HOH HOH A . 
B 2 HOH 37  271 37  HOH HOH A . 
B 2 HOH 38  272 38  HOH HOH A . 
B 2 HOH 39  273 39  HOH HOH A . 
B 2 HOH 40  274 40  HOH HOH A . 
B 2 HOH 41  275 41  HOH HOH A . 
B 2 HOH 42  276 42  HOH HOH A . 
B 2 HOH 43  277 43  HOH HOH A . 
B 2 HOH 44  278 44  HOH HOH A . 
B 2 HOH 45  279 45  HOH HOH A . 
B 2 HOH 46  280 46  HOH HOH A . 
B 2 HOH 47  281 47  HOH HOH A . 
B 2 HOH 48  282 48  HOH HOH A . 
B 2 HOH 49  283 49  HOH HOH A . 
B 2 HOH 50  284 50  HOH HOH A . 
B 2 HOH 51  285 51  HOH HOH A . 
B 2 HOH 52  286 52  HOH HOH A . 
B 2 HOH 53  287 53  HOH HOH A . 
B 2 HOH 54  288 54  HOH HOH A . 
B 2 HOH 55  289 55  HOH HOH A . 
B 2 HOH 56  290 56  HOH HOH A . 
B 2 HOH 57  291 57  HOH HOH A . 
B 2 HOH 58  292 58  HOH HOH A . 
B 2 HOH 59  293 59  HOH HOH A . 
B 2 HOH 60  294 60  HOH HOH A . 
B 2 HOH 61  295 61  HOH HOH A . 
B 2 HOH 62  296 62  HOH HOH A . 
B 2 HOH 63  297 63  HOH HOH A . 
B 2 HOH 64  298 64  HOH HOH A . 
B 2 HOH 65  299 65  HOH HOH A . 
B 2 HOH 66  300 66  HOH HOH A . 
B 2 HOH 67  301 67  HOH HOH A . 
B 2 HOH 68  302 68  HOH HOH A . 
B 2 HOH 69  303 69  HOH HOH A . 
B 2 HOH 70  304 70  HOH HOH A . 
B 2 HOH 71  305 71  HOH HOH A . 
B 2 HOH 72  306 72  HOH HOH A . 
B 2 HOH 73  307 73  HOH HOH A . 
B 2 HOH 74  308 74  HOH HOH A . 
B 2 HOH 75  309 75  HOH HOH A . 
B 2 HOH 76  310 76  HOH HOH A . 
B 2 HOH 77  311 77  HOH HOH A . 
B 2 HOH 78  312 78  HOH HOH A . 
B 2 HOH 79  313 79  HOH HOH A . 
B 2 HOH 80  314 80  HOH HOH A . 
B 2 HOH 81  315 81  HOH HOH A . 
B 2 HOH 82  316 82  HOH HOH A . 
B 2 HOH 83  317 83  HOH HOH A . 
B 2 HOH 84  318 84  HOH HOH A . 
B 2 HOH 85  319 85  HOH HOH A . 
B 2 HOH 86  320 86  HOH HOH A . 
B 2 HOH 87  321 87  HOH HOH A . 
B 2 HOH 88  322 88  HOH HOH A . 
B 2 HOH 89  323 89  HOH HOH A . 
B 2 HOH 90  324 90  HOH HOH A . 
B 2 HOH 91  325 91  HOH HOH A . 
B 2 HOH 92  326 92  HOH HOH A . 
B 2 HOH 93  327 93  HOH HOH A . 
B 2 HOH 94  328 94  HOH HOH A . 
B 2 HOH 95  329 95  HOH HOH A . 
B 2 HOH 96  330 96  HOH HOH A . 
B 2 HOH 97  331 97  HOH HOH A . 
B 2 HOH 98  332 98  HOH HOH A . 
B 2 HOH 99  333 99  HOH HOH A . 
B 2 HOH 100 334 100 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 158 A MSE 158 ? MET SELENOMETHIONINE 
2 A MSE 171 A MSE 171 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-03 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
SHARP     phasing          .      ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     49 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     328 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_655 
_pdbx_validate_symm_contact.dist              1.32 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 38  ? ? CZ A ARG 38  ? ? NH1 A ARG 38  ? ? 123.86 120.30 3.56   0.50 N 
2 1 NE A ARG 38  ? ? CZ A ARG 38  ? ? NH2 A ARG 38  ? ? 117.18 120.30 -3.12  0.50 N 
3 1 CG A ARG 54  ? ? CD A ARG 54  ? ? NE  A ARG 54  ? ? 95.32  111.80 -16.48 2.10 N 
4 1 CD A ARG 54  ? ? NE A ARG 54  ? ? CZ  A ARG 54  ? ? 135.43 123.60 11.83  1.40 N 
5 1 NE A ARG 54  ? ? CZ A ARG 54  ? ? NH1 A ARG 54  ? ? 130.91 120.30 10.61  0.50 N 
6 1 NE A ARG 54  ? ? CZ A ARG 54  ? ? NH2 A ARG 54  ? ? 107.55 120.30 -12.75 0.50 N 
7 1 CB A ASP 112 ? ? CG A ASP 112 ? ? OD1 A ASP 112 ? ? 111.41 118.30 -6.89  0.90 N 
8 1 CB A ASP 112 ? ? CG A ASP 112 ? ? OD2 A ASP 112 ? ? 123.90 118.30 5.60   0.90 N 
9 1 NE A ARG 136 ? ? CZ A ARG 136 ? ? NH1 A ARG 136 ? ? 123.80 120.30 3.50   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 21  ? ? -61.33  -143.54 
2 1 HIS A 22  ? ? 10.03   93.58   
3 1 VAL A 168 ? ? -120.35 -57.14  
4 1 HIS A 206 ? ? 64.16   105.17  
5 1 ASP A 232 ? ? -84.03  44.49   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASP A 232 ? ? LYS A 233 ? ? -148.34 
2 1 LYS A 233 ? ? HIS A 234 ? ? 141.38  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A ARG 49 ? CB  ? A ARG 49 CB  
2 1 Y 0 A ARG 49 ? CG  ? A ARG 49 CG  
3 1 Y 0 A ARG 49 ? CD  ? A ARG 49 CD  
4 1 Y 0 A ARG 49 ? NE  ? A ARG 49 NE  
5 1 Y 0 A ARG 49 ? CZ  ? A ARG 49 CZ  
6 1 Y 0 A ARG 49 ? NH1 ? A ARG 49 NH1 
7 1 Y 0 A ARG 49 ? NH2 ? A ARG 49 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A GLU 3   ? A GLU 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A PHE 6   ? A PHE 6   
7  1 Y 1 A GLU 198 ? A GLU 198 
8  1 Y 1 A MET 199 ? A MET 199 
9  1 Y 1 A ASP 200 ? A ASP 200 
10 1 Y 1 A THR 201 ? A THR 201 
11 1 Y 1 A ALA 202 ? A ALA 202 
12 1 Y 1 A LEU 203 ? A LEU 203 
13 1 Y 1 A ASN 204 ? A ASN 204 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#