data_1TLF
# 
_entry.id   1TLF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TLF         
WWPDB D_1000176718 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TLF 
_pdbx_database_status.recvd_initial_deposition_date   1995-03-06 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Friedman, A.M.'  1 
'Fischmann, T.O.' 2 
'Steitz, T.A.'    3 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of lac repressor core tetramer and its implications for DNA looping.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            268 
_citation.page_first                1721 
_citation.page_last                 1727 
_citation.year                      1995 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7792597 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Friedman, A.M.'  1 ? 
primary 'Fischmann, T.O.' 2 ? 
primary 'Steitz, T.A.'    3 ? 
# 
_cell.entry_id           1TLF 
_cell.length_a           90.160 
_cell.length_b           64.730 
_cell.length_c           117.940 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.75 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1TLF 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'LAC REPRESSOR'                                 32154.693 4 ? ? ? ? 
2 non-polymer syn 'ETHYL MERCURY ION'                             229.651   4 ? ? ? ? 
3 non-polymer syn '1-methylethyl 1-thio-beta-D-galactopyranoside' 238.301   4 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAA
CTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGD
WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQT
SVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAA
CTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGD
WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQT
SVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   SER n 
1 3   LEU n 
1 4   LEU n 
1 5   ILE n 
1 6   GLY n 
1 7   VAL n 
1 8   ALA n 
1 9   THR n 
1 10  SER n 
1 11  SER n 
1 12  LEU n 
1 13  ALA n 
1 14  LEU n 
1 15  HIS n 
1 16  ALA n 
1 17  PRO n 
1 18  SER n 
1 19  GLN n 
1 20  ILE n 
1 21  VAL n 
1 22  ALA n 
1 23  ALA n 
1 24  ILE n 
1 25  LYS n 
1 26  SER n 
1 27  ARG n 
1 28  ALA n 
1 29  ASP n 
1 30  GLN n 
1 31  LEU n 
1 32  GLY n 
1 33  ALA n 
1 34  SER n 
1 35  VAL n 
1 36  VAL n 
1 37  VAL n 
1 38  SER n 
1 39  MET n 
1 40  VAL n 
1 41  GLU n 
1 42  ARG n 
1 43  SER n 
1 44  GLY n 
1 45  VAL n 
1 46  GLU n 
1 47  ALA n 
1 48  CYS n 
1 49  LYS n 
1 50  ALA n 
1 51  ALA n 
1 52  VAL n 
1 53  HIS n 
1 54  ASN n 
1 55  LEU n 
1 56  LEU n 
1 57  ALA n 
1 58  GLN n 
1 59  ARG n 
1 60  VAL n 
1 61  SER n 
1 62  GLY n 
1 63  LEU n 
1 64  ILE n 
1 65  ILE n 
1 66  ASN n 
1 67  TYR n 
1 68  PRO n 
1 69  LEU n 
1 70  ASP n 
1 71  ASP n 
1 72  GLN n 
1 73  ASP n 
1 74  ALA n 
1 75  ILE n 
1 76  ALA n 
1 77  VAL n 
1 78  GLU n 
1 79  ALA n 
1 80  ALA n 
1 81  CYS n 
1 82  THR n 
1 83  ASN n 
1 84  VAL n 
1 85  PRO n 
1 86  ALA n 
1 87  LEU n 
1 88  PHE n 
1 89  LEU n 
1 90  ASP n 
1 91  VAL n 
1 92  SER n 
1 93  ASP n 
1 94  GLN n 
1 95  THR n 
1 96  PRO n 
1 97  ILE n 
1 98  ASN n 
1 99  SER n 
1 100 ILE n 
1 101 ILE n 
1 102 PHE n 
1 103 SER n 
1 104 HIS n 
1 105 GLU n 
1 106 ASP n 
1 107 GLY n 
1 108 THR n 
1 109 ARG n 
1 110 LEU n 
1 111 GLY n 
1 112 VAL n 
1 113 GLU n 
1 114 HIS n 
1 115 LEU n 
1 116 VAL n 
1 117 ALA n 
1 118 LEU n 
1 119 GLY n 
1 120 HIS n 
1 121 GLN n 
1 122 GLN n 
1 123 ILE n 
1 124 ALA n 
1 125 LEU n 
1 126 LEU n 
1 127 ALA n 
1 128 GLY n 
1 129 PRO n 
1 130 LEU n 
1 131 SER n 
1 132 SER n 
1 133 VAL n 
1 134 SER n 
1 135 ALA n 
1 136 ARG n 
1 137 LEU n 
1 138 ARG n 
1 139 LEU n 
1 140 ALA n 
1 141 GLY n 
1 142 TRP n 
1 143 HIS n 
1 144 LYS n 
1 145 TYR n 
1 146 LEU n 
1 147 THR n 
1 148 ARG n 
1 149 ASN n 
1 150 GLN n 
1 151 ILE n 
1 152 GLN n 
1 153 PRO n 
1 154 ILE n 
1 155 ALA n 
1 156 GLU n 
1 157 ARG n 
1 158 GLU n 
1 159 GLY n 
1 160 ASP n 
1 161 TRP n 
1 162 SER n 
1 163 ALA n 
1 164 MET n 
1 165 SER n 
1 166 GLY n 
1 167 PHE n 
1 168 GLN n 
1 169 GLN n 
1 170 THR n 
1 171 MET n 
1 172 GLN n 
1 173 MET n 
1 174 LEU n 
1 175 ASN n 
1 176 GLU n 
1 177 GLY n 
1 178 ILE n 
1 179 VAL n 
1 180 PRO n 
1 181 THR n 
1 182 ALA n 
1 183 MET n 
1 184 LEU n 
1 185 VAL n 
1 186 ALA n 
1 187 ASN n 
1 188 ASP n 
1 189 GLN n 
1 190 MET n 
1 191 ALA n 
1 192 LEU n 
1 193 GLY n 
1 194 ALA n 
1 195 MET n 
1 196 ARG n 
1 197 ALA n 
1 198 ILE n 
1 199 THR n 
1 200 GLU n 
1 201 SER n 
1 202 GLY n 
1 203 LEU n 
1 204 ARG n 
1 205 VAL n 
1 206 GLY n 
1 207 ALA n 
1 208 ASP n 
1 209 ILE n 
1 210 SER n 
1 211 VAL n 
1 212 VAL n 
1 213 GLY n 
1 214 TYR n 
1 215 ASP n 
1 216 ASP n 
1 217 THR n 
1 218 GLU n 
1 219 ASP n 
1 220 SER n 
1 221 SER n 
1 222 CYS n 
1 223 TYR n 
1 224 ILE n 
1 225 PRO n 
1 226 PRO n 
1 227 LEU n 
1 228 THR n 
1 229 THR n 
1 230 ILE n 
1 231 LYS n 
1 232 GLN n 
1 233 ASP n 
1 234 PHE n 
1 235 ARG n 
1 236 LEU n 
1 237 LEU n 
1 238 GLY n 
1 239 GLN n 
1 240 THR n 
1 241 SER n 
1 242 VAL n 
1 243 ASP n 
1 244 ARG n 
1 245 LEU n 
1 246 LEU n 
1 247 GLN n 
1 248 LEU n 
1 249 SER n 
1 250 GLN n 
1 251 GLY n 
1 252 GLN n 
1 253 ALA n 
1 254 VAL n 
1 255 LYS n 
1 256 GLY n 
1 257 ASN n 
1 258 GLN n 
1 259 LEU n 
1 260 LEU n 
1 261 PRO n 
1 262 VAL n 
1 263 SER n 
1 264 LEU n 
1 265 VAL n 
1 266 LYS n 
1 267 ARG n 
1 268 LYS n 
1 269 THR n 
1 270 THR n 
1 271 LEU n 
1 272 ALA n 
1 273 PRO n 
1 274 ASN n 
1 275 THR n 
1 276 GLN n 
1 277 THR n 
1 278 ALA n 
1 279 SER n 
1 280 PRO n 
1 281 ARG n 
1 282 ALA n 
1 283 LEU n 
1 284 ALA n 
1 285 ASP n 
1 286 SER n 
1 287 LEU n 
1 288 MET n 
1 289 GLN n 
1 290 LEU n 
1 291 ALA n 
1 292 ARG n 
1 293 GLN n 
1 294 VAL n 
1 295 SER n 
1 296 ARG n 
1 297 LEU n 
1 298 GLU n 
1 299 SER n 
1 300 GLY n 
1 301 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          LAC 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LACI_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03023 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSG
LIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGW
HKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1TLF A 1 ? 301 ? P03023 19 ? 319 ? 60 360 
2 1 1TLF B 1 ? 301 ? P03023 19 ? 319 ? 60 360 
3 1 1TLF C 1 ? 301 ? P03023 19 ? 319 ? 60 360 
4 1 1TLF D 1 ? 301 ? P03023 19 ? 319 ? 60 360 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                         ?                                         'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                        ?                                         
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                         'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                         'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                         'C3 H7 N O2 S' 
121.158 
EMC non-polymer         . 'ETHYL MERCURY ION'                             ?                                         'C2 H5 Hg 1' 
229.651 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                         'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                         'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                         'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                         
'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                         'C6 H13 N O2' 
131.173 
IPT D-saccharide        . '1-methylethyl 1-thio-beta-D-galactopyranoside' '1-(ISOPROPYLTHIO)-BETA-GALACTOPYRANSIDE' 'C9 H18 O5 S' 
238.301 
LEU 'L-peptide linking' y LEUCINE                                         ?                                         'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                         
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                         
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                         'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                         'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                          ?                                         'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                       ?                                         'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                         
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                         'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                          ?                                         'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          1TLF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.67 
_exptl_crystal.density_percent_sol   53.99 
_exptl_crystal.description           ? 
# 
_reflns.entry_id                     1TLF 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             8. 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   37549 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1TLF 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2220000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2220000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THE C1 AND HG ATOMS OF THE EMC HET GROUP ARE CHEMICALLY
BOUND.  THE BOND DISTANCE BETWEEN THEM IS GREATER THAN
EXPECTED DUE TO THE LACK OF BONDING RESTRAINT IN THE
REFINEMENT AND LIMITED RESOLUTION.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10712 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               10828 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.8   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1TLF 
_struct.title                     
'UNPRECEDENTED QUATERNARY STRUCTURE OF E. COLI LAC REPRESSOR CORE TETRAMER: IMPLICATIONS FOR DNA LOOPING' 
_struct.pdbx_descriptor           'TRYPTIC CORE FRAGMENT OF THE LACTOSE REPRESSOR OF ESCHERICHIA COLI' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TLF 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'TRANSCRIPTION REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  A1 HIS A 15  ? GLN A 30  ? HIS A 74  GLN A 89  1 ? 16 
HELX_P HELX_P2  B1 VAL A 45  ? LEU A 56  ? VAL A 104 LEU A 115 1 ? 12 
HELX_P HELX_P3  C1 ASP A 71  ? ALA A 80  ? ASP A 130 ALA A 139 1 ? 10 
HELX_P HELX_P4  D1 HIS A 104 ? ALA A 117 ? HIS A 163 ALA A 176 1 ? 14 
HELX_P HELX_P5  E1 VAL A 133 ? ARG A 148 ? VAL A 192 ARG A 207 1 ? 16 
HELX_P HELX_P6  F1 ALA A 163 ? ASN A 175 ? ALA A 222 ASN A 234 1 ? 13 
HELX_P HELX_P7  G1 ASP A 188 ? GLU A 200 ? ASP A 247 GLU A 259 1 ? 13 
HELX_P HELX_P8  H1 PHE A 234 ? SER A 249 ? PHE A 293 SER A 308 1 ? 16 
HELX_P HELX_P9  I1 PRO A 280 ? ARG A 296 ? PRO A 339 ARG A 355 1 ? 17 
HELX_P HELX_P10 A2 HIS B 15  ? GLN B 30  ? HIS B 74  GLN B 89  1 ? 16 
HELX_P HELX_P11 B2 VAL B 45  ? LEU B 56  ? VAL B 104 LEU B 115 1 ? 12 
HELX_P HELX_P12 C2 ASP B 71  ? ALA B 80  ? ASP B 130 ALA B 139 1 ? 10 
HELX_P HELX_P13 D2 HIS B 104 ? ALA B 117 ? HIS B 163 ALA B 176 1 ? 14 
HELX_P HELX_P14 E2 VAL B 133 ? ARG B 148 ? VAL B 192 ARG B 207 1 ? 16 
HELX_P HELX_P15 F2 ALA B 163 ? ASN B 175 ? ALA B 222 ASN B 234 1 ? 13 
HELX_P HELX_P16 G2 ASP B 188 ? GLU B 200 ? ASP B 247 GLU B 259 1 ? 13 
HELX_P HELX_P17 H2 PHE B 234 ? SER B 249 ? PHE B 293 SER B 308 1 ? 16 
HELX_P HELX_P18 I2 PRO B 280 ? ARG B 296 ? PRO B 339 ARG B 355 1 ? 17 
HELX_P HELX_P19 A3 HIS C 15  ? GLN C 30  ? HIS C 74  GLN C 89  1 ? 16 
HELX_P HELX_P20 B3 VAL C 45  ? LEU C 56  ? VAL C 104 LEU C 115 1 ? 12 
HELX_P HELX_P21 C3 ASP C 71  ? ALA C 80  ? ASP C 130 ALA C 139 1 ? 10 
HELX_P HELX_P22 D3 HIS C 104 ? ALA C 117 ? HIS C 163 ALA C 176 1 ? 14 
HELX_P HELX_P23 E3 VAL C 133 ? ARG C 148 ? VAL C 192 ARG C 207 1 ? 16 
HELX_P HELX_P24 F3 ALA C 163 ? ASN C 175 ? ALA C 222 ASN C 234 1 ? 13 
HELX_P HELX_P25 G3 ASP C 188 ? GLU C 200 ? ASP C 247 GLU C 259 1 ? 13 
HELX_P HELX_P26 H3 PHE C 234 ? SER C 249 ? PHE C 293 SER C 308 1 ? 16 
HELX_P HELX_P27 I3 PRO C 280 ? ARG C 296 ? PRO C 339 ARG C 355 1 ? 17 
HELX_P HELX_P28 A4 HIS D 15  ? GLN D 30  ? HIS D 74  GLN D 89  1 ? 16 
HELX_P HELX_P29 B4 VAL D 45  ? LEU D 56  ? VAL D 104 LEU D 115 1 ? 12 
HELX_P HELX_P30 C4 ASP D 71  ? ALA D 80  ? ASP D 130 ALA D 139 1 ? 10 
HELX_P HELX_P31 D4 HIS D 104 ? ALA D 117 ? HIS D 163 ALA D 176 1 ? 14 
HELX_P HELX_P32 E4 VAL D 133 ? ARG D 148 ? VAL D 192 ARG D 207 1 ? 16 
HELX_P HELX_P33 F4 ALA D 163 ? ASN D 175 ? ALA D 222 ASN D 234 1 ? 13 
HELX_P HELX_P34 G4 ASP D 188 ? GLU D 200 ? ASP D 247 GLU D 259 1 ? 13 
HELX_P HELX_P35 H4 PHE D 234 ? SER D 249 ? PHE D 293 SER D 308 1 ? 16 
HELX_P HELX_P36 I4 PRO D 280 ? ARG D 296 ? PRO D 339 ARG D 355 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 224 A . ? ILE 283 A PRO 225 A ? PRO 284 A 1 -0.53 
2 ILE 224 B . ? ILE 283 B PRO 225 B ? PRO 284 B 1 -0.24 
3 ILE 224 C . ? ILE 283 C PRO 225 C ? PRO 284 C 1 -0.25 
4 ALA 272 C . ? ALA 331 C PRO 273 C ? PRO 332 C 1 -1.53 
5 ILE 224 D . ? ILE 283 D PRO 225 D ? PRO 284 D 1 -0.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 6 ? 
S2 ? 6 ? 
S3 ? 6 ? 
S4 ? 6 ? 
S5 ? 6 ? 
S6 ? 6 ? 
S7 ? 6 ? 
S8 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? parallel      
S1 2 3 ? parallel      
S1 3 4 ? parallel      
S1 4 5 ? parallel      
S1 5 6 ? parallel      
S2 1 2 ? parallel      
S2 2 3 ? parallel      
S2 3 4 ? parallel      
S2 4 5 ? parallel      
S2 5 6 ? anti-parallel 
S3 1 2 ? parallel      
S3 2 3 ? parallel      
S3 3 4 ? parallel      
S3 4 5 ? parallel      
S3 5 6 ? parallel      
S4 1 2 ? parallel      
S4 2 3 ? parallel      
S4 3 4 ? parallel      
S4 4 5 ? parallel      
S4 5 6 ? anti-parallel 
S5 1 2 ? parallel      
S5 2 3 ? parallel      
S5 3 4 ? parallel      
S5 4 5 ? parallel      
S5 5 6 ? parallel      
S6 1 2 ? parallel      
S6 2 3 ? parallel      
S6 3 4 ? parallel      
S6 4 5 ? parallel      
S6 5 6 ? anti-parallel 
S7 1 2 ? parallel      
S7 2 3 ? parallel      
S7 3 4 ? parallel      
S7 4 5 ? parallel      
S7 5 6 ? parallel      
S8 1 2 ? parallel      
S8 2 3 ? parallel      
S8 3 4 ? parallel      
S8 4 5 ? parallel      
S8 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 SER A 34  ? MET A 39  ? SER A 93  MET A 98  
S1 2 LEU A 4   ? THR A 9   ? LEU A 63  THR A 68  
S1 3 GLY A 62  ? PRO A 68  ? GLY A 121 PRO A 127 
S1 4 ALA A 86  ? ASP A 90  ? ALA A 145 ASP A 149 
S1 5 SER A 99  ? PHE A 102 ? SER A 158 PHE A 161 
S1 6 ASN A 257 ? LEU A 260 ? ASN A 316 LEU A 319 
S2 1 ALA A 155 ? GLU A 158 ? ALA A 214 GLU A 217 
S2 2 ILE A 123 ? ALA A 127 ? ILE A 182 ALA A 186 
S2 3 ALA A 182 ? VAL A 185 ? ALA A 241 VAL A 244 
S2 4 SER A 210 ? ASP A 215 ? SER A 269 ASP A 274 
S2 5 THR A 228 ? LYS A 231 ? THR A 287 LYS A 290 
S2 6 SER A 263 ? VAL A 265 ? SER A 322 VAL A 324 
S3 1 SER B 34  ? MET B 39  ? SER B 93  MET B 98  
S3 2 LEU B 4   ? THR B 9   ? LEU B 63  THR B 68  
S3 3 GLY B 62  ? PRO B 68  ? GLY B 121 PRO B 127 
S3 4 ALA B 86  ? ASP B 90  ? ALA B 145 ASP B 149 
S3 5 SER B 99  ? PHE B 102 ? SER B 158 PHE B 161 
S3 6 ASN B 257 ? LEU B 260 ? ASN B 316 LEU B 319 
S4 1 ALA B 155 ? GLU B 158 ? ALA B 214 GLU B 217 
S4 2 ILE B 123 ? ALA B 127 ? ILE B 182 ALA B 186 
S4 3 ALA B 182 ? VAL B 185 ? ALA B 241 VAL B 244 
S4 4 SER B 210 ? ASP B 215 ? SER B 269 ASP B 274 
S4 5 THR B 228 ? LYS B 231 ? THR B 287 LYS B 290 
S4 6 SER B 263 ? VAL B 265 ? SER B 322 VAL B 324 
S5 1 SER C 34  ? MET C 39  ? SER C 93  MET C 98  
S5 2 LEU C 4   ? THR C 9   ? LEU C 63  THR C 68  
S5 3 GLY C 62  ? PRO C 68  ? GLY C 121 PRO C 127 
S5 4 ALA C 86  ? ASP C 90  ? ALA C 145 ASP C 149 
S5 5 SER C 99  ? PHE C 102 ? SER C 158 PHE C 161 
S5 6 ASN C 257 ? LEU C 260 ? ASN C 316 LEU C 319 
S6 1 ALA C 155 ? GLU C 158 ? ALA C 214 GLU C 217 
S6 2 ILE C 123 ? ALA C 127 ? ILE C 182 ALA C 186 
S6 3 ALA C 182 ? VAL C 185 ? ALA C 241 VAL C 244 
S6 4 SER C 210 ? ASP C 215 ? SER C 269 ASP C 274 
S6 5 THR C 228 ? LYS C 231 ? THR C 287 LYS C 290 
S6 6 SER C 263 ? VAL C 265 ? SER C 322 VAL C 324 
S7 1 SER D 34  ? MET D 39  ? SER D 93  MET D 98  
S7 2 LEU D 4   ? THR D 9   ? LEU D 63  THR D 68  
S7 3 GLY D 62  ? PRO D 68  ? GLY D 121 PRO D 127 
S7 4 ALA D 86  ? ASP D 90  ? ALA D 145 ASP D 149 
S7 5 SER D 99  ? PHE D 102 ? SER D 158 PHE D 161 
S7 6 ASN D 257 ? LEU D 260 ? ASN D 316 LEU D 319 
S8 1 ALA D 155 ? GLU D 158 ? ALA D 214 GLU D 217 
S8 2 ILE D 123 ? ALA D 127 ? ILE D 182 ALA D 186 
S8 3 ALA D 182 ? VAL D 185 ? ALA D 241 VAL D 244 
S8 4 SER D 210 ? ASP D 215 ? SER D 269 ASP D 274 
S8 5 THR D 228 ? LYS D 231 ? THR D 287 LYS D 290 
S8 6 SER D 263 ? VAL D 265 ? SER D 322 VAL D 324 
# 
_database_PDB_matrix.entry_id          1TLF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TLF 
_atom_sites.fract_transf_matrix[1][1]   0.011091 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000339 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015449 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008483 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO A   284' 
2 'CIS PROLINE - PRO B   284' 
3 'CIS PROLINE - PRO C   284' 
4 'CIS PROLINE - PRO C   332' 
5 'CIS PROLINE - PRO D   284' 
# 
loop_
_atom_type.symbol 
C  
H  
HG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1 2   ? 9.729   21.466 60.286 1.00 83.43  ? 61  SER A N     1 
ATOM   2     C  CA    . SER A 1 2   ? 9.851   20.164 60.997 1.00 83.43  ? 61  SER A CA    1 
ATOM   3     C  C     . SER A 1 2   ? 11.076  20.203 61.929 1.00 83.43  ? 61  SER A C     1 
ATOM   4     O  O     . SER A 1 2   ? 11.087  20.997 62.872 1.00 78.08  ? 61  SER A O     1 
ATOM   5     C  CB    . SER A 1 2   ? 9.923   19.018 59.975 1.00 78.08  ? 61  SER A CB    1 
ATOM   6     O  OG    . SER A 1 2   ? 8.848   19.111 59.039 1.00 78.08  ? 61  SER A OG    1 
ATOM   7     H  HG    . SER A 1 2   ? 8.925   18.418 58.362 1.00 30.00  ? 61  SER A HG    1 
ATOM   8     N  N     . LEU A 1 3   ? 12.105  19.392 61.668 1.00 59.40  ? 62  LEU A N     1 
ATOM   9     C  CA    . LEU A 1 3   ? 13.303  19.385 62.525 1.00 59.40  ? 62  LEU A CA    1 
ATOM   10    C  C     . LEU A 1 3   ? 14.200  20.620 62.347 1.00 59.40  ? 62  LEU A C     1 
ATOM   11    O  O     . LEU A 1 3   ? 13.932  21.476 61.502 1.00 81.55  ? 62  LEU A O     1 
ATOM   12    C  CB    . LEU A 1 3   ? 14.102  18.094 62.330 1.00 81.55  ? 62  LEU A CB    1 
ATOM   13    C  CG    . LEU A 1 3   ? 14.483  17.674 60.910 1.00 81.55  ? 62  LEU A CG    1 
ATOM   14    C  CD1   . LEU A 1 3   ? 15.519  18.615 60.318 1.00 81.55  ? 62  LEU A CD1   1 
ATOM   15    C  CD2   . LEU A 1 3   ? 15.028  16.256 60.959 1.00 81.55  ? 62  LEU A CD2   1 
ATOM   16    H  H     . LEU A 1 3   ? 12.122  18.781 60.906 1.00 0.00   ? 62  LEU A H     1 
ATOM   17    N  N     . LEU A 1 4   ? 15.293  20.672 63.101 1.00 46.19  ? 63  LEU A N     1 
ATOM   18    C  CA    . LEU A 1 4   ? 16.196  21.814 63.067 1.00 46.19  ? 63  LEU A CA    1 
ATOM   19    C  C     . LEU A 1 4   ? 17.623  21.355 62.843 1.00 46.19  ? 63  LEU A C     1 
ATOM   20    O  O     . LEU A 1 4   ? 18.111  20.442 63.523 1.00 27.13  ? 63  LEU A O     1 
ATOM   21    C  CB    . LEU A 1 4   ? 16.070  22.583 64.380 1.00 27.13  ? 63  LEU A CB    1 
ATOM   22    C  CG    . LEU A 1 4   ? 16.756  23.912 64.706 1.00 27.13  ? 63  LEU A CG    1 
ATOM   23    C  CD1   . LEU A 1 4   ? 18.144  23.649 65.207 1.00 27.13  ? 63  LEU A CD1   1 
ATOM   24    C  CD2   . LEU A 1 4   ? 16.745  24.867 63.532 1.00 27.13  ? 63  LEU A CD2   1 
ATOM   25    H  H     . LEU A 1 4   ? 15.528  19.921 63.691 1.00 0.00   ? 63  LEU A H     1 
ATOM   26    N  N     . ILE A 1 5   ? 18.277  22.001 61.881 1.00 42.64  ? 64  ILE A N     1 
ATOM   27    C  CA    . ILE A 1 5   ? 19.647  21.701 61.489 1.00 42.64  ? 64  ILE A CA    1 
ATOM   28    C  C     . ILE A 1 5   ? 20.589  22.794 61.987 1.00 42.64  ? 64  ILE A C     1 
ATOM   29    O  O     . ILE A 1 5   ? 20.346  23.980 61.749 1.00 28.29  ? 64  ILE A O     1 
ATOM   30    C  CB    . ILE A 1 5   ? 19.753  21.629 59.962 1.00 28.29  ? 64  ILE A CB    1 
ATOM   31    C  CG1   . ILE A 1 5   ? 18.795  20.576 59.417 1.00 28.29  ? 64  ILE A CG1   1 
ATOM   32    C  CG2   . ILE A 1 5   ? 21.169  21.292 59.543 1.00 28.29  ? 64  ILE A CG2   1 
ATOM   33    C  CD1   . ILE A 1 5   ? 18.779  20.519 57.928 1.00 28.29  ? 64  ILE A CD1   1 
ATOM   34    H  H     . ILE A 1 5   ? 17.856  22.752 61.445 1.00 0.00   ? 64  ILE A H     1 
ATOM   35    N  N     . GLY A 1 6   ? 21.656  22.399 62.675 1.00 17.78  ? 65  GLY A N     1 
ATOM   36    C  CA    . GLY A 1 6   ? 22.610  23.369 63.190 1.00 17.78  ? 65  GLY A CA    1 
ATOM   37    C  C     . GLY A 1 6   ? 23.820  23.373 62.292 1.00 17.78  ? 65  GLY A C     1 
ATOM   38    O  O     . GLY A 1 6   ? 24.357  22.302 61.993 1.00 25.46  ? 65  GLY A O     1 
ATOM   39    H  H     . GLY A 1 6   ? 21.841  21.454 62.794 1.00 0.00   ? 65  GLY A H     1 
ATOM   40    N  N     . VAL A 1 7   ? 24.269  24.548 61.868 1.00 32.95  ? 66  VAL A N     1 
ATOM   41    C  CA    . VAL A 1 7   ? 25.415  24.626 60.966 1.00 32.95  ? 66  VAL A CA    1 
ATOM   42    C  C     . VAL A 1 7   ? 26.581  25.375 61.612 1.00 32.95  ? 66  VAL A C     1 
ATOM   43    O  O     . VAL A 1 7   ? 26.391  26.505 62.051 1.00 20.44  ? 66  VAL A O     1 
ATOM   44    C  CB    . VAL A 1 7   ? 25.023  25.350 59.658 1.00 20.44  ? 66  VAL A CB    1 
ATOM   45    C  CG1   . VAL A 1 7   ? 26.127  25.286 58.670 1.00 20.44  ? 66  VAL A CG1   1 
ATOM   46    C  CG2   . VAL A 1 7   ? 23.800  24.745 59.077 1.00 20.44  ? 66  VAL A CG2   1 
ATOM   47    H  H     . VAL A 1 7   ? 23.838  25.380 62.167 1.00 0.00   ? 66  VAL A H     1 
ATOM   48    N  N     . ALA A 1 8   ? 27.756  24.739 61.712 1.00 17.91  ? 67  ALA A N     1 
ATOM   49    C  CA    . ALA A 1 8   ? 28.965  25.358 62.285 1.00 17.91  ? 67  ALA A CA    1 
ATOM   50    C  C     . ALA A 1 8   ? 29.754  25.751 61.068 1.00 17.91  ? 67  ALA A C     1 
ATOM   51    O  O     . ALA A 1 8   ? 30.341  24.917 60.379 1.00 23.74  ? 67  ALA A O     1 
ATOM   52    C  CB    . ALA A 1 8   ? 29.749  24.371 63.097 1.00 23.74  ? 67  ALA A CB    1 
ATOM   53    H  H     . ALA A 1 8   ? 27.826  23.831 61.356 1.00 0.00   ? 67  ALA A H     1 
ATOM   54    N  N     . THR A 1 9   ? 29.766  27.031 60.787 1.00 17.39  ? 68  THR A N     1 
ATOM   55    C  CA    . THR A 1 9   ? 30.424  27.494 59.608 1.00 17.39  ? 68  THR A CA    1 
ATOM   56    C  C     . THR A 1 9   ? 31.623  28.337 59.935 1.00 17.39  ? 68  THR A C     1 
ATOM   57    O  O     . THR A 1 9   ? 31.713  28.884 61.024 1.00 34.36  ? 68  THR A O     1 
ATOM   58    C  CB    . THR A 1 9   ? 29.435  28.305 58.789 1.00 34.36  ? 68  THR A CB    1 
ATOM   59    O  OG1   . THR A 1 9   ? 30.079  28.828 57.624 1.00 34.36  ? 68  THR A OG1   1 
ATOM   60    C  CG2   . THR A 1 9   ? 28.873  29.441 59.618 1.00 34.36  ? 68  THR A CG2   1 
ATOM   61    H  H     . THR A 1 9   ? 29.361  27.676 61.395 1.00 0.00   ? 68  THR A H     1 
ATOM   62    H  HG1   . THR A 1 9   ? 30.666  29.566 57.820 1.00 30.00  ? 68  THR A HG1   1 
ATOM   63    N  N     . SER A 1 10  ? 32.584  28.368 59.018 1.00 28.66  ? 69  SER A N     1 
ATOM   64    C  CA    . SER A 1 10  ? 33.759  29.200 59.169 1.00 28.66  ? 69  SER A CA    1 
ATOM   65    C  C     . SER A 1 10  ? 33.300  30.555 58.610 1.00 28.66  ? 69  SER A C     1 
ATOM   66    O  O     . SER A 1 10  ? 32.135  30.691 58.190 1.00 49.64  ? 69  SER A O     1 
ATOM   67    C  CB    . SER A 1 10  ? 34.963  28.631 58.403 1.00 49.64  ? 69  SER A CB    1 
ATOM   68    O  OG    . SER A 1 10  ? 34.663  28.261 57.069 1.00 49.64  ? 69  SER A OG    1 
ATOM   69    H  H     . SER A 1 10  ? 32.458  27.860 58.193 1.00 0.00   ? 69  SER A H     1 
ATOM   70    H  HG    . SER A 1 10  ? 34.055  27.508 57.013 1.00 30.00  ? 69  SER A HG    1 
ATOM   71    N  N     . SER A 1 11  ? 34.187  31.549 58.592 1.00 67.31  ? 70  SER A N     1 
ATOM   72    C  CA    . SER A 1 11  ? 33.835  32.894 58.128 1.00 67.31  ? 70  SER A CA    1 
ATOM   73    C  C     . SER A 1 11  ? 33.008  33.018 56.853 1.00 67.31  ? 70  SER A C     1 
ATOM   74    O  O     . SER A 1 11  ? 33.457  32.669 55.754 1.00 46.20  ? 70  SER A O     1 
ATOM   75    C  CB    . SER A 1 11  ? 35.068  33.788 58.013 1.00 46.20  ? 70  SER A CB    1 
ATOM   76    O  OG    . SER A 1 11  ? 34.673  35.142 57.891 1.00 46.20  ? 70  SER A OG    1 
ATOM   77    H  H     . SER A 1 11  ? 35.095  31.377 58.901 1.00 0.00   ? 70  SER A H     1 
ATOM   78    H  HG    . SER A 1 11  ? 35.466  35.690 57.970 1.00 30.00  ? 70  SER A HG    1 
ATOM   79    N  N     . LEU A 1 12  ? 31.832  33.618 57.027 1.00 18.17  ? 71  LEU A N     1 
ATOM   80    C  CA    . LEU A 1 12  ? 30.889  33.869 55.968 1.00 18.17  ? 71  LEU A CA    1 
ATOM   81    C  C     . LEU A 1 12  ? 31.369  35.069 55.195 1.00 18.17  ? 71  LEU A C     1 
ATOM   82    O  O     . LEU A 1 12  ? 30.580  35.700 54.521 1.00 21.64  ? 71  LEU A O     1 
ATOM   83    C  CB    . LEU A 1 12  ? 29.523  34.205 56.554 1.00 21.64  ? 71  LEU A CB    1 
ATOM   84    C  CG    . LEU A 1 12  ? 28.744  33.203 57.415 1.00 21.64  ? 71  LEU A CG    1 
ATOM   85    C  CD1   . LEU A 1 12  ? 27.486  33.880 57.968 1.00 21.64  ? 71  LEU A CD1   1 
ATOM   86    C  CD2   . LEU A 1 12  ? 28.401  31.966 56.621 1.00 21.64  ? 71  LEU A CD2   1 
ATOM   87    H  H     . LEU A 1 12  ? 31.597  33.907 57.930 1.00 0.00   ? 71  LEU A H     1 
ATOM   88    N  N     . ALA A 1 13  ? 32.616  35.482 55.414 1.00 16.19  ? 72  ALA A N     1 
ATOM   89    C  CA    . ALA A 1 13  ? 33.191  36.615 54.691 1.00 16.19  ? 72  ALA A CA    1 
ATOM   90    C  C     . ALA A 1 13  ? 33.723  36.054 53.391 1.00 16.19  ? 72  ALA A C     1 
ATOM   91    O  O     . ALA A 1 13  ? 33.834  36.782 52.408 1.00 29.16  ? 72  ALA A O     1 
ATOM   92    C  CB    . ALA A 1 13  ? 34.329  37.213 55.467 1.00 29.16  ? 72  ALA A CB    1 
ATOM   93    H  H     . ALA A 1 13  ? 33.183  35.071 56.083 1.00 0.00   ? 72  ALA A H     1 
ATOM   94    N  N     . LEU A 1 14  ? 34.127  34.777 53.406 1.00 12.52  ? 73  LEU A N     1 
ATOM   95    C  CA    . LEU A 1 14  ? 34.644  34.123 52.211 1.00 12.52  ? 73  LEU A CA    1 
ATOM   96    C  C     . LEU A 1 14  ? 33.401  33.648 51.440 1.00 12.52  ? 73  LEU A C     1 
ATOM   97    O  O     . LEU A 1 14  ? 32.391  33.305 52.055 1.00 14.85  ? 73  LEU A O     1 
ATOM   98    C  CB    . LEU A 1 14  ? 35.566  32.973 52.607 1.00 14.85  ? 73  LEU A CB    1 
ATOM   99    C  CG    . LEU A 1 14  ? 36.747  33.290 53.541 1.00 14.85  ? 73  LEU A CG    1 
ATOM   100   C  CD1   . LEU A 1 14  ? 37.400  32.018 53.942 1.00 14.85  ? 73  LEU A CD1   1 
ATOM   101   C  CD2   . LEU A 1 14  ? 37.762  34.167 52.903 1.00 14.85  ? 73  LEU A CD2   1 
ATOM   102   H  H     . LEU A 1 14  ? 34.034  34.243 54.222 1.00 0.00   ? 73  LEU A H     1 
ATOM   103   N  N     . HIS A 1 15  ? 33.445  33.627 50.113 1.00 31.14  ? 74  HIS A N     1 
ATOM   104   C  CA    . HIS A 1 15  ? 32.257  33.243 49.334 1.00 31.14  ? 74  HIS A CA    1 
ATOM   105   C  C     . HIS A 1 15  ? 31.860  31.764 49.339 1.00 31.14  ? 74  HIS A C     1 
ATOM   106   O  O     . HIS A 1 15  ? 30.681  31.430 49.417 1.00 22.33  ? 74  HIS A O     1 
ATOM   107   C  CB    . HIS A 1 15  ? 32.366  33.767 47.888 1.00 22.33  ? 74  HIS A CB    1 
ATOM   108   C  CG    . HIS A 1 15  ? 32.884  35.170 47.800 1.00 22.33  ? 74  HIS A CG    1 
ATOM   109   N  ND1   . HIS A 1 15  ? 32.915  36.021 48.887 1.00 22.33  ? 74  HIS A ND1   1 
ATOM   110   C  CD2   . HIS A 1 15  ? 33.466  35.845 46.780 1.00 22.33  ? 74  HIS A CD2   1 
ATOM   111   C  CE1   . HIS A 1 15  ? 33.502  37.154 48.542 1.00 22.33  ? 74  HIS A CE1   1 
ATOM   112   N  NE2   . HIS A 1 15  ? 33.847  37.073 47.270 1.00 22.33  ? 74  HIS A NE2   1 
ATOM   113   H  H     . HIS A 1 15  ? 34.309  33.825 49.683 1.00 0.00   ? 74  HIS A H     1 
ATOM   114   H  HD1   . HIS A 1 15  ? 32.597  35.830 49.808 1.00 0.00   ? 74  HIS A HD1   1 
ATOM   115   H  HE2   . HIS A 1 15  ? 34.330  37.757 46.749 1.00 0.00   ? 74  HIS A HE2   1 
ATOM   116   N  N     . ALA A 1 16  ? 32.828  30.870 49.264 1.00 10.67  ? 75  ALA A N     1 
ATOM   117   C  CA    . ALA A 1 16  ? 32.507  29.463 49.257 1.00 10.67  ? 75  ALA A CA    1 
ATOM   118   C  C     . ALA A 1 16  ? 31.623  29.133 50.452 1.00 10.67  ? 75  ALA A C     1 
ATOM   119   O  O     . ALA A 1 16  ? 30.509  28.624 50.286 1.00 20.49  ? 75  ALA A O     1 
ATOM   120   C  CB    . ALA A 1 16  ? 33.754  28.654 49.246 1.00 20.49  ? 75  ALA A CB    1 
ATOM   121   H  H     . ALA A 1 16  ? 33.762  31.153 49.209 1.00 0.00   ? 75  ALA A H     1 
ATOM   122   N  N     . PRO A 1 17  ? 32.066  29.488 51.671 1.00 16.91  ? 76  PRO A N     1 
ATOM   123   C  CA    . PRO A 1 17  ? 31.241  29.201 52.840 1.00 16.91  ? 76  PRO A CA    1 
ATOM   124   C  C     . PRO A 1 17  ? 29.815  29.788 52.738 1.00 16.91  ? 76  PRO A C     1 
ATOM   125   O  O     . PRO A 1 17  ? 28.821  29.062 52.854 1.00 22.34  ? 76  PRO A O     1 
ATOM   126   C  CB    . PRO A 1 17  ? 32.063  29.815 53.952 1.00 22.34  ? 76  PRO A CB    1 
ATOM   127   C  CG    . PRO A 1 17  ? 33.420  29.468 53.545 1.00 22.34  ? 76  PRO A CG    1 
ATOM   128   C  CD    . PRO A 1 17  ? 33.410  29.899 52.107 1.00 22.34  ? 76  PRO A CD    1 
ATOM   129   N  N     . SER A 1 18  ? 29.706  31.081 52.462 1.00 20.84  ? 77  SER A N     1 
ATOM   130   C  CA    . SER A 1 18  ? 28.396  31.689 52.341 1.00 20.84  ? 77  SER A CA    1 
ATOM   131   C  C     . SER A 1 18  ? 27.574  30.948 51.280 1.00 20.84  ? 77  SER A C     1 
ATOM   132   O  O     . SER A 1 18  ? 26.360  30.778 51.435 1.00 51.60  ? 77  SER A O     1 
ATOM   133   C  CB    . SER A 1 18  ? 28.526  33.168 51.986 1.00 51.60  ? 77  SER A CB    1 
ATOM   134   O  OG    . SER A 1 18  ? 29.188  33.875 53.017 1.00 51.60  ? 77  SER A OG    1 
ATOM   135   H  H     . SER A 1 18  ? 30.485  31.671 52.379 1.00 0.00   ? 77  SER A H     1 
ATOM   136   H  HG    . SER A 1 18  ? 29.016  34.836 52.987 1.00 30.00  ? 77  SER A HG    1 
ATOM   137   N  N     . GLN A 1 19  ? 28.229  30.456 50.233 1.00 19.62  ? 78  GLN A N     1 
ATOM   138   C  CA    . GLN A 1 19  ? 27.500  29.753 49.196 1.00 19.62  ? 78  GLN A CA    1 
ATOM   139   C  C     . GLN A 1 19  ? 27.065  28.395 49.674 1.00 19.62  ? 78  GLN A C     1 
ATOM   140   O  O     . GLN A 1 19  ? 25.963  27.952 49.367 1.00 23.01  ? 78  GLN A O     1 
ATOM   141   C  CB    . GLN A 1 19  ? 28.331  29.635 47.931 1.00 23.01  ? 78  GLN A CB    1 
ATOM   142   C  CG    . GLN A 1 19  ? 28.325  30.949 47.179 1.00 23.01  ? 78  GLN A CG    1 
ATOM   143   C  CD    . GLN A 1 19  ? 29.017  30.914 45.847 1.00 23.01  ? 78  GLN A CD    1 
ATOM   144   O  OE1   . GLN A 1 19  ? 28.883  29.967 45.090 1.00 23.01  ? 78  GLN A OE1   1 
ATOM   145   N  NE2   . GLN A 1 19  ? 29.727  31.980 45.532 1.00 23.01  ? 78  GLN A NE2   1 
ATOM   146   H  H     . GLN A 1 19  ? 29.195  30.544 50.153 1.00 0.00   ? 78  GLN A H     1 
ATOM   147   N  N     . ILE A 1 20  ? 27.892  27.747 50.483 1.00 21.85  ? 79  ILE A N     1 
ATOM   148   C  CA    . ILE A 1 20  ? 27.514  26.438 50.957 1.00 21.85  ? 79  ILE A CA    1 
ATOM   149   C  C     . ILE A 1 20  ? 26.315  26.575 51.842 1.00 21.85  ? 79  ILE A C     1 
ATOM   150   O  O     . ILE A 1 20  ? 25.273  25.942 51.576 1.00 20.79  ? 79  ILE A O     1 
ATOM   151   C  CB    . ILE A 1 20  ? 28.639  25.735 51.672 1.00 20.79  ? 79  ILE A CB    1 
ATOM   152   C  CG1   . ILE A 1 20  ? 29.760  25.462 50.658 1.00 20.79  ? 79  ILE A CG1   1 
ATOM   153   C  CG2   . ILE A 1 20  ? 28.104  24.439 52.302 1.00 20.79  ? 79  ILE A CG2   1 
ATOM   154   C  CD1   . ILE A 1 20  ? 31.081  25.264 51.247 1.00 20.79  ? 79  ILE A CD1   1 
ATOM   155   H  H     . ILE A 1 20  ? 28.732  28.159 50.774 1.00 0.00   ? 79  ILE A H     1 
ATOM   156   N  N     . VAL A 1 21  ? 26.399  27.475 52.824 1.00 23.18  ? 80  VAL A N     1 
ATOM   157   C  CA    . VAL A 1 21  ? 25.272  27.674 53.737 1.00 23.18  ? 80  VAL A CA    1 
ATOM   158   C  C     . VAL A 1 21  ? 24.006  27.975 52.949 1.00 23.18  ? 80  VAL A C     1 
ATOM   159   O  O     . VAL A 1 21  ? 22.971  27.381 53.188 1.00 23.14  ? 80  VAL A O     1 
ATOM   160   C  CB    . VAL A 1 21  ? 25.514  28.807 54.723 1.00 23.14  ? 80  VAL A CB    1 
ATOM   161   C  CG1   . VAL A 1 21  ? 24.261  29.093 55.495 1.00 23.14  ? 80  VAL A CG1   1 
ATOM   162   C  CG2   . VAL A 1 21  ? 26.608  28.441 55.676 1.00 23.14  ? 80  VAL A CG2   1 
ATOM   163   H  H     . VAL A 1 21  ? 27.222  27.998 52.931 1.00 0.00   ? 80  VAL A H     1 
ATOM   164   N  N     . ALA A 1 22  ? 24.089  28.845 51.962 1.00 19.53  ? 81  ALA A N     1 
ATOM   165   C  CA    . ALA A 1 22  ? 22.892  29.160 51.194 1.00 19.53  ? 81  ALA A CA    1 
ATOM   166   C  C     . ALA A 1 22  ? 22.283  27.915 50.616 1.00 19.53  ? 81  ALA A C     1 
ATOM   167   O  O     . ALA A 1 22  ? 21.082  27.714 50.717 1.00 26.19  ? 81  ALA A O     1 
ATOM   168   C  CB    . ALA A 1 22  ? 23.200  30.136 50.083 1.00 26.19  ? 81  ALA A CB    1 
ATOM   169   H  H     . ALA A 1 22  ? 24.942  29.281 51.747 1.00 0.00   ? 81  ALA A H     1 
ATOM   170   N  N     . ALA A 1 23  ? 23.117  27.071 50.023 1.00 38.55  ? 82  ALA A N     1 
ATOM   171   C  CA    . ALA A 1 23  ? 22.629  25.843 49.409 1.00 38.55  ? 82  ALA A CA    1 
ATOM   172   C  C     . ALA A 1 23  ? 21.985  24.959 50.438 1.00 38.55  ? 82  ALA A C     1 
ATOM   173   O  O     . ALA A 1 23  ? 20.934  24.379 50.168 1.00 33.00  ? 82  ALA A O     1 
ATOM   174   C  CB    . ALA A 1 23  ? 23.732  25.101 48.708 1.00 33.00  ? 82  ALA A CB    1 
ATOM   175   H  H     . ALA A 1 23  ? 24.080  27.271 49.997 1.00 0.00   ? 82  ALA A H     1 
ATOM   176   N  N     . ILE A 1 24  ? 22.587  24.875 51.622 1.00 19.51  ? 83  ILE A N     1 
ATOM   177   C  CA    . ILE A 1 24  ? 22.025  24.049 52.685 1.00 19.51  ? 83  ILE A CA    1 
ATOM   178   C  C     . ILE A 1 24  ? 20.604  24.520 53.003 1.00 19.51  ? 83  ILE A C     1 
ATOM   179   O  O     . ILE A 1 24  ? 19.686  23.703 53.079 1.00 31.84  ? 83  ILE A O     1 
ATOM   180   C  CB    . ILE A 1 24  ? 22.888  24.075 53.961 1.00 31.84  ? 83  ILE A CB    1 
ATOM   181   C  CG1   . ILE A 1 24  ? 24.172  23.280 53.731 1.00 31.84  ? 83  ILE A CG1   1 
ATOM   182   C  CG2   . ILE A 1 24  ? 22.102  23.516 55.145 1.00 31.84  ? 83  ILE A CG2   1 
ATOM   183   C  CD1   . ILE A 1 24  ? 25.114  23.273 54.908 1.00 31.84  ? 83  ILE A CD1   1 
ATOM   184   H  H     . ILE A 1 24  ? 23.414  25.385 51.762 1.00 0.00   ? 83  ILE A H     1 
ATOM   185   N  N     . LYS A 1 25  ? 20.413  25.831 53.119 1.00 19.82  ? 84  LYS A N     1 
ATOM   186   C  CA    . LYS A 1 25  ? 19.104  26.421 53.413 1.00 19.82  ? 84  LYS A CA    1 
ATOM   187   C  C     . LYS A 1 25  ? 18.032  26.105 52.369 1.00 19.82  ? 84  LYS A C     1 
ATOM   188   O  O     . LYS A 1 25  ? 16.913  25.796 52.699 1.00 27.13  ? 84  LYS A O     1 
ATOM   189   C  CB    . LYS A 1 25  ? 19.256  27.929 53.523 1.00 27.13  ? 84  LYS A CB    1 
ATOM   190   C  CG    . LYS A 1 25  ? 18.233  28.607 54.373 1.00 27.13  ? 84  LYS A CG    1 
ATOM   191   C  CD    . LYS A 1 25  ? 17.264  29.381 53.518 1.00 27.13  ? 84  LYS A CD    1 
ATOM   192   C  CE    . LYS A 1 25  ? 16.267  30.120 54.402 1.00 27.13  ? 84  LYS A CE    1 
ATOM   193   N  NZ    . LYS A 1 25  ? 15.834  29.273 55.569 1.00 27.13  ? 84  LYS A NZ    1 
ATOM   194   H  H     . LYS A 1 25  ? 21.193  26.422 52.997 1.00 0.00   ? 84  LYS A H     1 
ATOM   195   H  HZ1   . LYS A 1 25  ? 16.659  28.979 56.130 1.00 0.00   ? 84  LYS A HZ1   1 
ATOM   196   H  HZ2   . LYS A 1 25  ? 15.198  29.830 56.176 1.00 0.00   ? 84  LYS A HZ2   1 
ATOM   197   H  HZ3   . LYS A 1 25  ? 15.338  28.435 55.209 1.00 0.00   ? 84  LYS A HZ3   1 
ATOM   198   N  N     . SER A 1 26  ? 18.380  26.190 51.099 1.00 24.66  ? 85  SER A N     1 
ATOM   199   C  CA    . SER A 1 26  ? 17.433  25.912 50.014 1.00 24.66  ? 85  SER A CA    1 
ATOM   200   C  C     . SER A 1 26  ? 16.895  24.506 50.133 1.00 24.66  ? 85  SER A C     1 
ATOM   201   O  O     . SER A 1 26  ? 15.682  24.287 50.044 1.00 55.01  ? 85  SER A O     1 
ATOM   202   C  CB    . SER A 1 26  ? 18.118  26.074 48.664 1.00 55.01  ? 85  SER A CB    1 
ATOM   203   O  OG    . SER A 1 26  ? 18.750  27.341 48.587 1.00 55.01  ? 85  SER A OG    1 
ATOM   204   H  H     . SER A 1 26  ? 19.305  26.433 50.891 1.00 0.00   ? 85  SER A H     1 
ATOM   205   H  HG    . SER A 1 26  ? 19.399  27.461 49.292 1.00 30.00  ? 85  SER A HG    1 
ATOM   206   N  N     . ARG A 1 27  ? 17.801  23.563 50.397 1.00 49.23  ? 86  ARG A N     1 
ATOM   207   C  CA    . ARG A 1 27  ? 17.436  22.162 50.548 1.00 49.23  ? 86  ARG A CA    1 
ATOM   208   C  C     . ARG A 1 27  ? 16.523  21.964 51.748 1.00 49.23  ? 86  ARG A C     1 
ATOM   209   O  O     . ARG A 1 27  ? 15.386  21.517 51.590 1.00 46.24  ? 86  ARG A O     1 
ATOM   210   C  CB    . ARG A 1 27  ? 18.676  21.277 50.667 1.00 46.24  ? 86  ARG A CB    1 
ATOM   211   C  CG    . ARG A 1 27  ? 18.346  19.812 50.710 1.00 46.24  ? 86  ARG A CG    1 
ATOM   212   C  CD    . ARG A 1 27  ? 17.317  19.504 49.665 1.00 46.24  ? 86  ARG A CD    1 
ATOM   213   N  NE    . ARG A 1 27  ? 17.007  18.089 49.609 1.00 46.24  ? 86  ARG A NE    1 
ATOM   214   C  CZ    . ARG A 1 27  ? 16.396  17.510 48.584 1.00 46.24  ? 86  ARG A CZ    1 
ATOM   215   N  NH1   . ARG A 1 27  ? 16.026  18.234 47.533 1.00 46.24  ? 86  ARG A NH1   1 
ATOM   216   N  NH2   . ARG A 1 27  ? 16.199  16.201 48.588 1.00 46.24  ? 86  ARG A NH2   1 
ATOM   217   H  H     . ARG A 1 27  ? 18.745  23.818 50.491 1.00 0.00   ? 86  ARG A H     1 
ATOM   218   H  HE    . ARG A 1 27  ? 17.272  17.525 50.364 1.00 0.00   ? 86  ARG A HE    1 
ATOM   219   H  HH11  . ARG A 1 27  ? 16.204  19.215 47.504 1.00 0.00   ? 86  ARG A HH11  1 
ATOM   220   H  HH12  . ARG A 1 27  ? 15.561  17.790 46.767 1.00 0.00   ? 86  ARG A HH12  1 
ATOM   221   H  HH21  . ARG A 1 27  ? 16.503  15.647 49.358 1.00 0.00   ? 86  ARG A HH21  1 
ATOM   222   H  HH22  . ARG A 1 27  ? 15.736  15.766 47.814 1.00 0.00   ? 86  ARG A HH22  1 
ATOM   223   N  N     . ALA A 1 28  ? 17.015  22.289 52.938 1.00 32.79  ? 87  ALA A N     1 
ATOM   224   C  CA    . ALA A 1 28  ? 16.217  22.164 54.160 1.00 32.79  ? 87  ALA A CA    1 
ATOM   225   C  C     . ALA A 1 28  ? 14.830  22.738 53.894 1.00 32.79  ? 87  ALA A C     1 
ATOM   226   O  O     . ALA A 1 28  ? 13.819  22.058 54.104 1.00 29.75  ? 87  ALA A O     1 
ATOM   227   C  CB    . ALA A 1 28  ? 16.871  22.921 55.317 1.00 29.75  ? 87  ALA A CB    1 
ATOM   228   H  H     . ALA A 1 28  ? 17.936  22.620 53.001 1.00 0.00   ? 87  ALA A H     1 
ATOM   229   N  N     . ASP A 1 29  ? 14.795  23.954 53.354 1.00 28.89  ? 88  ASP A N     1 
ATOM   230   C  CA    . ASP A 1 29  ? 13.541  24.614 53.051 1.00 28.89  ? 88  ASP A CA    1 
ATOM   231   C  C     . ASP A 1 29  ? 12.604  23.637 52.381 1.00 28.89  ? 88  ASP A C     1 
ATOM   232   O  O     . ASP A 1 29  ? 11.502  23.402 52.877 1.00 45.02  ? 88  ASP A O     1 
ATOM   233   C  CB    . ASP A 1 29  ? 13.765  25.823 52.150 1.00 45.02  ? 88  ASP A CB    1 
ATOM   234   C  CG    . ASP A 1 29  ? 14.275  27.029 52.909 1.00 45.02  ? 88  ASP A CG    1 
ATOM   235   O  OD1   . ASP A 1 29  ? 14.421  26.924 54.143 1.00 45.02  ? 88  ASP A OD1   1 
ATOM   236   O  OD2   . ASP A 1 29  ? 14.528  28.082 52.274 1.00 45.02  ? 88  ASP A OD2   1 
ATOM   237   H  H     . ASP A 1 29  ? 15.629  24.420 53.142 1.00 0.00   ? 88  ASP A H     1 
ATOM   238   N  N     . GLN A 1 30  ? 13.082  23.002 51.315 1.00 35.38  ? 89  GLN A N     1 
ATOM   239   C  CA    . GLN A 1 30  ? 12.281  22.031 50.582 1.00 35.38  ? 89  GLN A CA    1 
ATOM   240   C  C     . GLN A 1 30  ? 11.765  20.886 51.461 1.00 35.38  ? 89  GLN A C     1 
ATOM   241   O  O     . GLN A 1 30  ? 10.566  20.580 51.454 1.00 49.93  ? 89  GLN A O     1 
ATOM   242   C  CB    . GLN A 1 30  ? 13.081  21.448 49.426 1.00 49.93  ? 89  GLN A CB    1 
ATOM   243   C  CG    . GLN A 1 30  ? 13.459  22.467 48.393 1.00 49.93  ? 89  GLN A CG    1 
ATOM   244   C  CD    . GLN A 1 30  ? 14.460  21.953 47.374 1.00 49.93  ? 89  GLN A CD    1 
ATOM   245   O  OE1   . GLN A 1 30  ? 14.682  22.596 46.357 1.00 49.93  ? 89  GLN A OE1   1 
ATOM   246   N  NE2   . GLN A 1 30  ? 15.094  20.812 47.651 1.00 49.93  ? 89  GLN A NE2   1 
ATOM   247   H  H     . GLN A 1 30  ? 14.001  23.200 51.032 1.00 0.00   ? 89  GLN A H     1 
ATOM   248   N  N     . LEU A 1 31  ? 12.649  20.288 52.252 1.00 26.95  ? 90  LEU A N     1 
ATOM   249   C  CA    . LEU A 1 31  ? 12.268  19.157 53.100 1.00 26.95  ? 90  LEU A CA    1 
ATOM   250   C  C     . LEU A 1 31  ? 11.660  19.611 54.418 1.00 26.95  ? 90  LEU A C     1 
ATOM   251   O  O     . LEU A 1 31  ? 11.596  18.854 55.393 1.00 50.44  ? 90  LEU A O     1 
ATOM   252   C  CB    . LEU A 1 31  ? 13.490  18.282 53.351 1.00 50.44  ? 90  LEU A CB    1 
ATOM   253   C  CG    . LEU A 1 31  ? 14.163  17.766 52.076 1.00 50.44  ? 90  LEU A CG    1 
ATOM   254   C  CD1   . LEU A 1 31  ? 15.534  17.190 52.396 1.00 50.44  ? 90  LEU A CD1   1 
ATOM   255   C  CD2   . LEU A 1 31  ? 13.286  16.737 51.387 1.00 50.44  ? 90  LEU A CD2   1 
ATOM   256   H  H     . LEU A 1 31  ? 13.555  20.662 52.278 1.00 0.00   ? 90  LEU A H     1 
ATOM   257   N  N     . GLY A 1 32  ? 11.278  20.879 54.454 1.00 24.02  ? 91  GLY A N     1 
ATOM   258   C  CA    . GLY A 1 32  ? 10.678  21.448 55.639 1.00 24.02  ? 91  GLY A CA    1 
ATOM   259   C  C     . GLY A 1 32  ? 11.551  21.519 56.873 1.00 24.02  ? 91  GLY A C     1 
ATOM   260   O  O     . GLY A 1 32  ? 11.034  21.795 57.967 1.00 59.72  ? 91  GLY A O     1 
ATOM   261   H  H     . GLY A 1 32  ? 11.403  21.477 53.691 1.00 0.00   ? 91  GLY A H     1 
ATOM   262   N  N     . ALA A 1 33  ? 12.848  21.263 56.745 1.00 37.90  ? 92  ALA A N     1 
ATOM   263   C  CA    . ALA A 1 33  ? 13.730  21.330 57.908 1.00 37.90  ? 92  ALA A CA    1 
ATOM   264   C  C     . ALA A 1 33  ? 14.017  22.798 58.219 1.00 37.90  ? 92  ALA A C     1 
ATOM   265   O  O     . ALA A 1 33  ? 13.725  23.667 57.406 1.00 45.57  ? 92  ALA A O     1 
ATOM   266   C  CB    . ALA A 1 33  ? 15.019  20.578 57.633 1.00 45.57  ? 92  ALA A CB    1 
ATOM   267   H  H     . ALA A 1 33  ? 13.208  21.097 55.850 1.00 0.00   ? 92  ALA A H     1 
ATOM   268   N  N     . SER A 1 34  ? 14.559  23.074 59.398 1.00 24.12  ? 93  SER A N     1 
ATOM   269   C  CA    . SER A 1 34  ? 14.901  24.437 59.806 1.00 24.12  ? 93  SER A CA    1 
ATOM   270   C  C     . SER A 1 34  ? 16.420  24.522 59.922 1.00 24.12  ? 93  SER A C     1 
ATOM   271   O  O     . SER A 1 34  ? 17.087  23.494 60.021 1.00 50.36  ? 93  SER A O     1 
ATOM   272   C  CB    . SER A 1 34  ? 14.270  24.764 61.156 1.00 50.36  ? 93  SER A CB    1 
ATOM   273   O  OG    . SER A 1 34  ? 12.946  24.272 61.236 1.00 50.36  ? 93  SER A OG    1 
ATOM   274   H  H     . SER A 1 34  ? 14.777  22.348 60.011 1.00 0.00   ? 93  SER A H     1 
ATOM   275   H  HG    . SER A 1 34  ? 13.043  23.312 61.270 1.00 30.00  ? 93  SER A HG    1 
ATOM   276   N  N     . VAL A 1 35  ? 16.967  25.736 59.954 1.00 43.08  ? 94  VAL A N     1 
ATOM   277   C  CA    . VAL A 1 35  ? 18.420  25.908 60.025 1.00 43.08  ? 94  VAL A CA    1 
ATOM   278   C  C     . VAL A 1 35  ? 18.894  27.072 60.903 1.00 43.08  ? 94  VAL A C     1 
ATOM   279   O  O     . VAL A 1 35  ? 18.470  28.215 60.713 1.00 35.04  ? 94  VAL A O     1 
ATOM   280   C  CB    . VAL A 1 35  ? 19.011  26.119 58.613 1.00 35.04  ? 94  VAL A CB    1 
ATOM   281   C  CG1   . VAL A 1 35  ? 20.536  26.144 58.668 1.00 35.04  ? 94  VAL A CG1   1 
ATOM   282   C  CG2   . VAL A 1 35  ? 18.522  25.044 57.662 1.00 35.04  ? 94  VAL A CG2   1 
ATOM   283   H  H     . VAL A 1 35  ? 16.403  26.535 59.916 1.00 0.00   ? 94  VAL A H     1 
ATOM   284   N  N     . VAL A 1 36  ? 19.797  26.777 61.836 1.00 24.76  ? 95  VAL A N     1 
ATOM   285   C  CA    . VAL A 1 36  ? 20.359  27.778 62.742 1.00 24.76  ? 95  VAL A CA    1 
ATOM   286   C  C     . VAL A 1 36  ? 21.862  27.750 62.502 1.00 24.76  ? 95  VAL A C     1 
ATOM   287   O  O     . VAL A 1 36  ? 22.485  26.703 62.580 1.00 31.97  ? 95  VAL A O     1 
ATOM   288   C  CB    . VAL A 1 36  ? 19.961  27.503 64.248 1.00 31.97  ? 95  VAL A CB    1 
ATOM   289   C  CG1   . VAL A 1 36  ? 20.379  26.125 64.685 1.00 31.97  ? 95  VAL A CG1   1 
ATOM   290   C  CG2   . VAL A 1 36  ? 20.542  28.556 65.183 1.00 31.97  ? 95  VAL A CG2   1 
ATOM   291   H  H     . VAL A 1 36  ? 20.113  25.854 61.915 1.00 0.00   ? 95  VAL A H     1 
ATOM   292   N  N     . VAL A 1 37  ? 22.415  28.900 62.138 1.00 22.67  ? 96  VAL A N     1 
ATOM   293   C  CA    . VAL A 1 37  ? 23.834  29.053 61.812 1.00 22.67  ? 96  VAL A CA    1 
ATOM   294   C  C     . VAL A 1 37  ? 24.702  29.577 62.965 1.00 22.67  ? 96  VAL A C     1 
ATOM   295   O  O     . VAL A 1 37  ? 24.315  30.510 63.662 1.00 24.79  ? 96  VAL A O     1 
ATOM   296   C  CB    . VAL A 1 37  ? 23.983  30.035 60.615 1.00 24.79  ? 96  VAL A CB    1 
ATOM   297   C  CG1   . VAL A 1 37  ? 25.429  30.100 60.118 1.00 24.79  ? 96  VAL A CG1   1 
ATOM   298   C  CG2   . VAL A 1 37  ? 23.054  29.641 59.503 1.00 24.79  ? 96  VAL A CG2   1 
ATOM   299   H  H     . VAL A 1 37  ? 21.843  29.689 62.117 1.00 0.00   ? 96  VAL A H     1 
ATOM   300   N  N     . SER A 1 38  ? 25.891  29.010 63.132 1.00 12.18  ? 97  SER A N     1 
ATOM   301   C  CA    . SER A 1 38  ? 26.830  29.441 64.170 1.00 12.18  ? 97  SER A CA    1 
ATOM   302   C  C     . SER A 1 38  ? 28.202  29.543 63.504 1.00 12.18  ? 97  SER A C     1 
ATOM   303   O  O     . SER A 1 38  ? 28.646  28.625 62.806 1.00 45.02  ? 97  SER A O     1 
ATOM   304   C  CB    . SER A 1 38  ? 26.873  28.447 65.340 1.00 45.02  ? 97  SER A CB    1 
ATOM   305   O  OG    . SER A 1 38  ? 27.559  28.983 66.469 1.00 45.02  ? 97  SER A OG    1 
ATOM   306   H  H     . SER A 1 38  ? 26.191  28.290 62.543 1.00 0.00   ? 97  SER A H     1 
ATOM   307   H  HG    . SER A 1 38  ? 27.095  29.782 66.740 1.00 30.00  ? 97  SER A HG    1 
ATOM   308   N  N     . MET A 1 39  ? 28.851  30.687 63.705 1.00 22.52  ? 98  MET A N     1 
ATOM   309   C  CA    . MET A 1 39  ? 30.146  30.967 63.093 1.00 22.52  ? 98  MET A CA    1 
ATOM   310   C  C     . MET A 1 39  ? 31.362  30.677 63.978 1.00 22.52  ? 98  MET A C     1 
ATOM   311   O  O     . MET A 1 39  ? 31.376  30.974 65.177 1.00 55.57  ? 98  MET A O     1 
ATOM   312   C  CB    . MET A 1 39  ? 30.145  32.402 62.592 1.00 55.57  ? 98  MET A CB    1 
ATOM   313   C  CG    . MET A 1 39  ? 28.913  32.718 61.763 1.00 55.57  ? 98  MET A CG    1 
ATOM   314   S  SD    . MET A 1 39  ? 28.644  34.475 61.591 1.00 55.57  ? 98  MET A SD    1 
ATOM   315   C  CE    . MET A 1 39  ? 30.141  34.898 60.556 1.00 55.57  ? 98  MET A CE    1 
ATOM   316   H  H     . MET A 1 39  ? 28.466  31.350 64.314 1.00 0.00   ? 98  MET A H     1 
ATOM   317   N  N     . VAL A 1 40  ? 32.379  30.087 63.356 1.00 33.51  ? 99  VAL A N     1 
ATOM   318   C  CA    . VAL A 1 40  ? 33.601  29.678 64.036 1.00 33.51  ? 99  VAL A CA    1 
ATOM   319   C  C     . VAL A 1 40  ? 34.767  30.590 63.699 1.00 33.51  ? 99  VAL A C     1 
ATOM   320   O  O     . VAL A 1 40  ? 34.817  31.186 62.621 1.00 26.22  ? 99  VAL A O     1 
ATOM   321   C  CB    . VAL A 1 40  ? 33.968  28.220 63.656 1.00 26.22  ? 99  VAL A CB    1 
ATOM   322   C  CG1   . VAL A 1 40  ? 35.137  27.736 64.448 1.00 26.22  ? 99  VAL A CG1   1 
ATOM   323   C  CG2   . VAL A 1 40  ? 32.804  27.305 63.895 1.00 26.22  ? 99  VAL A CG2   1 
ATOM   324   H  H     . VAL A 1 40  ? 32.324  29.960 62.390 1.00 0.00   ? 99  VAL A H     1 
ATOM   325   N  N     . GLU A 1 41  ? 35.691  30.701 64.644 1.00 20.67  ? 100 GLU A N     1 
ATOM   326   C  CA    . GLU A 1 41  ? 36.864  31.526 64.480 1.00 20.67  ? 100 GLU A CA    1 
ATOM   327   C  C     . GLU A 1 41  ? 37.944  30.627 63.945 1.00 20.67  ? 100 GLU A C     1 
ATOM   328   O  O     . GLU A 1 41  ? 37.987  29.446 64.280 1.00 63.82  ? 100 GLU A O     1 
ATOM   329   C  CB    . GLU A 1 41  ? 37.305  32.103 65.820 1.00 63.82  ? 100 GLU A CB    1 
ATOM   330   C  CG    . GLU A 1 41  ? 36.221  32.885 66.522 1.00 63.82  ? 100 GLU A CG    1 
ATOM   331   C  CD    . GLU A 1 41  ? 35.331  32.021 67.410 1.00 63.82  ? 100 GLU A CD    1 
ATOM   332   O  OE1   . GLU A 1 41  ? 34.302  31.491 66.922 1.00 63.82  ? 100 GLU A OE1   1 
ATOM   333   O  OE2   . GLU A 1 41  ? 35.659  31.904 68.618 1.00 63.82  ? 100 GLU A OE2   1 
ATOM   334   H  H     . GLU A 1 41  ? 35.587  30.183 65.466 1.00 0.00   ? 100 GLU A H     1 
ATOM   335   N  N     . ARG A 1 42  ? 38.882  31.220 63.216 1.00 51.54  ? 101 ARG A N     1 
ATOM   336   C  CA    . ARG A 1 42  ? 39.977  30.487 62.597 1.00 51.54  ? 101 ARG A CA    1 
ATOM   337   C  C     . ARG A 1 42  ? 40.884  29.755 63.593 1.00 51.54  ? 101 ARG A C     1 
ATOM   338   O  O     . ARG A 1 42  ? 41.896  29.163 63.204 1.00 82.35  ? 101 ARG A O     1 
ATOM   339   C  CB    . ARG A 1 42  ? 40.800  31.448 61.728 1.00 82.35  ? 101 ARG A CB    1 
ATOM   340   C  CG    . ARG A 1 42  ? 39.980  32.275 60.716 1.00 82.35  ? 101 ARG A CG    1 
ATOM   341   C  CD    . ARG A 1 42  ? 39.331  31.416 59.617 1.00 82.35  ? 101 ARG A CD    1 
ATOM   342   N  NE    . ARG A 1 42  ? 38.623  32.210 58.605 1.00 82.35  ? 101 ARG A NE    1 
ATOM   343   C  CZ    . ARG A 1 42  ? 39.205  32.865 57.597 1.00 82.35  ? 101 ARG A CZ    1 
ATOM   344   N  NH1   . ARG A 1 42  ? 40.524  32.838 57.437 1.00 82.35  ? 101 ARG A NH1   1 
ATOM   345   N  NH2   . ARG A 1 42  ? 38.462  33.561 56.745 1.00 82.35  ? 101 ARG A NH2   1 
ATOM   346   H  H     . ARG A 1 42  ? 38.827  32.187 63.104 1.00 0.00   ? 101 ARG A H     1 
ATOM   347   H  HE    . ARG A 1 42  ? 37.646  32.259 58.669 1.00 0.00   ? 101 ARG A HE    1 
ATOM   348   H  HH11  . ARG A 1 42  ? 41.097  32.321 58.073 1.00 0.00   ? 101 ARG A HH11  1 
ATOM   349   H  HH12  . ARG A 1 42  ? 40.942  33.328 56.673 1.00 0.00   ? 101 ARG A HH12  1 
ATOM   350   H  HH21  . ARG A 1 42  ? 37.468  33.588 56.855 1.00 0.00   ? 101 ARG A HH21  1 
ATOM   351   H  HH22  . ARG A 1 42  ? 38.893  34.044 55.984 1.00 0.00   ? 101 ARG A HH22  1 
ATOM   352   N  N     . SER A 1 43  ? 40.494  29.765 64.866 1.00 54.42  ? 102 SER A N     1 
ATOM   353   C  CA    . SER A 1 43  ? 41.257  29.131 65.940 1.00 54.42  ? 102 SER A CA    1 
ATOM   354   C  C     . SER A 1 43  ? 41.378  27.602 65.886 1.00 54.42  ? 102 SER A C     1 
ATOM   355   O  O     . SER A 1 43  ? 42.327  27.048 66.437 1.00 30.76  ? 102 SER A O     1 
ATOM   356   C  CB    . SER A 1 43  ? 40.678  29.553 67.288 1.00 30.76  ? 102 SER A CB    1 
ATOM   357   O  OG    . SER A 1 43  ? 40.262  30.911 67.238 1.00 30.76  ? 102 SER A OG    1 
ATOM   358   H  H     . SER A 1 43  ? 39.696  30.216 65.173 1.00 0.00   ? 102 SER A H     1 
ATOM   359   H  HG    . SER A 1 43  ? 40.120  31.223 68.138 1.00 30.00  ? 102 SER A HG    1 
ATOM   360   N  N     . GLY A 1 44  ? 40.406  26.918 65.280 1.00 26.66  ? 103 GLY A N     1 
ATOM   361   C  CA    . GLY A 1 44  ? 40.470  25.469 65.199 1.00 26.66  ? 103 GLY A CA    1 
ATOM   362   C  C     . GLY A 1 44  ? 39.704  24.697 66.270 1.00 26.66  ? 103 GLY A C     1 
ATOM   363   O  O     . GLY A 1 44  ? 38.732  25.207 66.844 1.00 44.90  ? 103 GLY A O     1 
ATOM   364   H  H     . GLY A 1 44  ? 39.648  27.429 64.915 1.00 0.00   ? 103 GLY A H     1 
ATOM   365   N  N     . VAL A 1 45  ? 40.162  23.473 66.541 1.00 21.92  ? 104 VAL A N     1 
ATOM   366   C  CA    . VAL A 1 45  ? 39.556  22.554 67.517 1.00 21.92  ? 104 VAL A CA    1 
ATOM   367   C  C     . VAL A 1 45  ? 38.624  23.140 68.565 1.00 21.92  ? 104 VAL A C     1 
ATOM   368   O  O     . VAL A 1 45  ? 37.453  22.775 68.664 1.00 39.21  ? 104 VAL A O     1 
ATOM   369   C  CB    . VAL A 1 45  ? 40.601  21.797 68.355 1.00 39.21  ? 104 VAL A CB    1 
ATOM   370   C  CG1   . VAL A 1 45  ? 40.136  20.366 68.602 1.00 39.21  ? 104 VAL A CG1   1 
ATOM   371   C  CG2   . VAL A 1 45  ? 41.973  21.898 67.743 1.00 39.21  ? 104 VAL A CG2   1 
ATOM   372   H  H     . VAL A 1 45  ? 40.935  23.193 66.014 1.00 0.00   ? 104 VAL A H     1 
ATOM   373   N  N     . GLU A 1 46  ? 39.179  24.009 69.392 1.00 26.65  ? 105 GLU A N     1 
ATOM   374   C  CA    . GLU A 1 46  ? 38.422  24.602 70.477 1.00 26.65  ? 105 GLU A CA    1 
ATOM   375   C  C     . GLU A 1 46  ? 37.296  25.529 70.033 1.00 26.65  ? 105 GLU A C     1 
ATOM   376   O  O     . GLU A 1 46  ? 36.154  25.383 70.478 1.00 60.53  ? 105 GLU A O     1 
ATOM   377   C  CB    . GLU A 1 46  ? 39.389  25.291 71.452 1.00 60.53  ? 105 GLU A CB    1 
ATOM   378   C  CG    . GLU A 1 46  ? 39.043  25.118 72.938 1.00 60.53  ? 105 GLU A CG    1 
ATOM   379   C  CD    . GLU A 1 46  ? 38.668  23.681 73.322 1.00 60.53  ? 105 GLU A CD    1 
ATOM   380   O  OE1   . GLU A 1 46  ? 39.575  22.826 73.429 1.00 60.53  ? 105 GLU A OE1   1 
ATOM   381   O  OE2   . GLU A 1 46  ? 37.457  23.415 73.527 1.00 60.53  ? 105 GLU A OE2   1 
ATOM   382   H  H     . GLU A 1 46  ? 40.115  24.256 69.266 1.00 0.00   ? 105 GLU A H     1 
ATOM   383   N  N     . ALA A 1 47  ? 37.601  26.431 69.106 1.00 29.19  ? 106 ALA A N     1 
ATOM   384   C  CA    . ALA A 1 47  ? 36.612  27.376 68.618 1.00 29.19  ? 106 ALA A CA    1 
ATOM   385   C  C     . ALA A 1 47  ? 35.475  26.604 67.989 1.00 29.19  ? 106 ALA A C     1 
ATOM   386   O  O     . ALA A 1 47  ? 34.308  26.914 68.208 1.00 29.29  ? 106 ALA A O     1 
ATOM   387   C  CB    . ALA A 1 47  ? 37.233  28.293 67.616 1.00 29.29  ? 106 ALA A CB    1 
ATOM   388   H  H     . ALA A 1 47  ? 38.489  26.431 68.698 1.00 0.00   ? 106 ALA A H     1 
ATOM   389   N  N     . CYS A 1 48  ? 35.821  25.578 67.220 1.00 29.07  ? 107 CYS A N     1 
ATOM   390   C  CA    . CYS A 1 48  ? 34.838  24.739 66.551 1.00 29.07  ? 107 CYS A CA    1 
ATOM   391   C  C     . CYS A 1 48  ? 34.030  23.949 67.590 1.00 29.07  ? 107 CYS A C     1 
ATOM   392   O  O     . CYS A 1 48  ? 32.802  23.840 67.497 1.00 27.08  ? 107 CYS A O     1 
ATOM   393   C  CB    . CYS A 1 48  ? 35.541  23.802 65.586 1.00 27.08  ? 107 CYS A CB    1 
ATOM   394   S  SG    . CYS A 1 48  ? 34.464  23.203 64.319 1.00 27.08  ? 107 CYS A SG    1 
ATOM   395   H  H     . CYS A 1 48  ? 36.772  25.394 67.094 1.00 0.00   ? 107 CYS A H     1 
ATOM   396   N  N     . LYS A 1 49  ? 34.719  23.410 68.589 1.00 28.45  ? 108 LYS A N     1 
ATOM   397   C  CA    . LYS A 1 49  ? 34.054  22.668 69.646 1.00 28.45  ? 108 LYS A CA    1 
ATOM   398   C  C     . LYS A 1 49  ? 33.047  23.602 70.308 1.00 28.45  ? 108 LYS A C     1 
ATOM   399   O  O     . LYS A 1 49  ? 31.913  23.221 70.584 1.00 40.21  ? 108 LYS A O     1 
ATOM   400   C  CB    . LYS A 1 49  ? 35.053  22.241 70.713 1.00 40.21  ? 108 LYS A CB    1 
ATOM   401   C  CG    . LYS A 1 49  ? 35.869  21.029 70.415 1.00 40.21  ? 108 LYS A CG    1 
ATOM   402   C  CD    . LYS A 1 49  ? 36.520  20.583 71.699 1.00 40.21  ? 108 LYS A CD    1 
ATOM   403   C  CE    . LYS A 1 49  ? 37.564  19.513 71.462 1.00 40.21  ? 108 LYS A CE    1 
ATOM   404   N  NZ    . LYS A 1 49  ? 38.237  19.064 72.723 1.00 40.21  ? 108 LYS A NZ    1 
ATOM   405   H  H     . LYS A 1 49  ? 35.690  23.503 68.633 1.00 0.00   ? 108 LYS A H     1 
ATOM   406   H  HZ1   . LYS A 1 49  ? 37.525  18.678 73.376 1.00 0.00   ? 108 LYS A HZ1   1 
ATOM   407   H  HZ2   . LYS A 1 49  ? 38.931  18.325 72.491 1.00 0.00   ? 108 LYS A HZ2   1 
ATOM   408   H  HZ3   . LYS A 1 49  ? 38.721  19.868 73.175 1.00 0.00   ? 108 LYS A HZ3   1 
ATOM   409   N  N     . ALA A 1 50  ? 33.482  24.828 70.576 1.00 15.27  ? 109 ALA A N     1 
ATOM   410   C  CA    . ALA A 1 50  ? 32.637  25.832 71.215 1.00 15.27  ? 109 ALA A CA    1 
ATOM   411   C  C     . ALA A 1 50  ? 31.413  26.099 70.361 1.00 15.27  ? 109 ALA A C     1 
ATOM   412   O  O     . ALA A 1 50  ? 30.326  26.328 70.877 1.00 75.50  ? 109 ALA A O     1 
ATOM   413   C  CB    . ALA A 1 50  ? 33.418  27.103 71.427 1.00 75.50  ? 109 ALA A CB    1 
ATOM   414   H  H     . ALA A 1 50  ? 34.384  25.072 70.312 1.00 0.00   ? 109 ALA A H     1 
ATOM   415   N  N     . ALA A 1 51  ? 31.582  26.046 69.053 1.00 37.86  ? 110 ALA A N     1 
ATOM   416   C  CA    . ALA A 1 51  ? 30.468  26.263 68.161 1.00 37.86  ? 110 ALA A CA    1 
ATOM   417   C  C     . ALA A 1 51  ? 29.494  25.111 68.384 1.00 37.86  ? 110 ALA A C     1 
ATOM   418   O  O     . ALA A 1 51  ? 28.353  25.323 68.782 1.00 27.94  ? 110 ALA A O     1 
ATOM   419   C  CB    . ALA A 1 51  ? 30.956  26.290 66.702 1.00 27.94  ? 110 ALA A CB    1 
ATOM   420   H  H     . ALA A 1 51  ? 32.473  25.884 68.679 1.00 0.00   ? 110 ALA A H     1 
ATOM   421   N  N     . VAL A 1 52  ? 29.992  23.889 68.236 1.00 32.48  ? 111 VAL A N     1 
ATOM   422   C  CA    . VAL A 1 52  ? 29.169  22.692 68.391 1.00 32.48  ? 111 VAL A CA    1 
ATOM   423   C  C     . VAL A 1 52  ? 28.388  22.679 69.699 1.00 32.48  ? 111 VAL A C     1 
ATOM   424   O  O     . VAL A 1 52  ? 27.176  22.490 69.681 1.00 20.69  ? 111 VAL A O     1 
ATOM   425   C  CB    . VAL A 1 52  ? 30.001  21.371 68.198 1.00 20.69  ? 111 VAL A CB    1 
ATOM   426   C  CG1   . VAL A 1 52  ? 29.237  20.193 68.685 1.00 20.69  ? 111 VAL A CG1   1 
ATOM   427   C  CG2   . VAL A 1 52  ? 30.323  21.148 66.713 1.00 20.69  ? 111 VAL A CG2   1 
ATOM   428   H  H     . VAL A 1 52  ? 30.945  23.789 68.023 1.00 0.00   ? 111 VAL A H     1 
ATOM   429   N  N     . HIS A 1 53  ? 29.048  22.937 70.824 1.00 20.76  ? 112 HIS A N     1 
ATOM   430   C  CA    . HIS A 1 53  ? 28.351  22.935 72.114 1.00 20.76  ? 112 HIS A CA    1 
ATOM   431   C  C     . HIS A 1 53  ? 27.216  23.969 72.151 1.00 20.76  ? 112 HIS A C     1 
ATOM   432   O  O     . HIS A 1 53  ? 26.151  23.712 72.711 1.00 96.53  ? 112 HIS A O     1 
ATOM   433   C  CB    . HIS A 1 53  ? 29.341  23.092 73.289 1.00 96.53  ? 112 HIS A CB    1 
ATOM   434   C  CG    . HIS A 1 53  ? 29.257  24.406 74.011 1.00 96.53  ? 112 HIS A CG    1 
ATOM   435   N  ND1   . HIS A 1 53  ? 29.942  25.531 73.599 1.00 96.53  ? 112 HIS A ND1   1 
ATOM   436   C  CD2   . HIS A 1 53  ? 28.606  24.760 75.146 1.00 96.53  ? 112 HIS A CD2   1 
ATOM   437   C  CE1   . HIS A 1 53  ? 29.721  26.519 74.448 1.00 96.53  ? 112 HIS A CE1   1 
ATOM   438   N  NE2   . HIS A 1 53  ? 28.912  26.078 75.395 1.00 96.53  ? 112 HIS A NE2   1 
ATOM   439   H  H     . HIS A 1 53  ? 30.010  23.097 70.762 1.00 0.00   ? 112 HIS A H     1 
ATOM   440   H  HD1   . HIS A 1 53  ? 30.448  25.650 72.766 1.00 0.00   ? 112 HIS A HD1   1 
ATOM   441   H  HE2   . HIS A 1 53  ? 28.565  26.624 76.133 1.00 0.00   ? 112 HIS A HE2   1 
ATOM   442   N  N     . ASN A 1 54  ? 27.432  25.102 71.492 1.00 37.01  ? 113 ASN A N     1 
ATOM   443   C  CA    . ASN A 1 54  ? 26.439  26.165 71.443 1.00 37.01  ? 113 ASN A CA    1 
ATOM   444   C  C     . ASN A 1 54  ? 25.186  25.658 70.766 1.00 37.01  ? 113 ASN A C     1 
ATOM   445   O  O     . ASN A 1 54  ? 24.074  25.927 71.215 1.00 66.36  ? 113 ASN A O     1 
ATOM   446   C  CB    . ASN A 1 54  ? 26.974  27.380 70.669 1.00 66.36  ? 113 ASN A CB    1 
ATOM   447   C  CG    . ASN A 1 54  ? 27.764  28.345 71.552 1.00 66.36  ? 113 ASN A CG    1 
ATOM   448   O  OD1   . ASN A 1 54  ? 28.119  28.025 72.701 1.00 66.36  ? 113 ASN A OD1   1 
ATOM   449   N  ND2   . ASN A 1 54  ? 28.049  29.535 71.017 1.00 66.36  ? 113 ASN A ND2   1 
ATOM   450   H  H     . ASN A 1 54  ? 28.258  25.232 70.977 1.00 0.00   ? 113 ASN A H     1 
ATOM   451   H  HD21  . ASN A 1 54  ? 28.536  30.176 71.571 1.00 0.00   ? 113 ASN A HD21  1 
ATOM   452   H  HD22  . ASN A 1 54  ? 27.751  29.694 70.098 1.00 0.00   ? 113 ASN A HD22  1 
ATOM   453   N  N     . LEU A 1 55  ? 25.389  24.908 69.688 1.00 44.90  ? 114 LEU A N     1 
ATOM   454   C  CA    . LEU A 1 55  ? 24.299  24.342 68.908 1.00 44.90  ? 114 LEU A CA    1 
ATOM   455   C  C     . LEU A 1 55  ? 23.619  23.197 69.628 1.00 44.90  ? 114 LEU A C     1 
ATOM   456   O  O     . LEU A 1 55  ? 22.416  23.043 69.536 1.00 19.51  ? 114 LEU A O     1 
ATOM   457   C  CB    . LEU A 1 55  ? 24.808  23.863 67.555 1.00 19.51  ? 114 LEU A CB    1 
ATOM   458   C  CG    . LEU A 1 55  ? 25.289  24.990 66.656 1.00 19.51  ? 114 LEU A CG    1 
ATOM   459   C  CD1   . LEU A 1 55  ? 25.982  24.429 65.449 1.00 19.51  ? 114 LEU A CD1   1 
ATOM   460   C  CD2   . LEU A 1 55  ? 24.105  25.824 66.266 1.00 19.51  ? 114 LEU A CD2   1 
ATOM   461   H  H     . LEU A 1 55  ? 26.313  24.717 69.413 1.00 0.00   ? 114 LEU A H     1 
ATOM   462   N  N     . LEU A 1 56  ? 24.374  22.382 70.347 1.00 22.65  ? 115 LEU A N     1 
ATOM   463   C  CA    . LEU A 1 56  ? 23.751  21.284 71.050 1.00 22.65  ? 115 LEU A CA    1 
ATOM   464   C  C     . LEU A 1 56  ? 22.745  21.902 72.004 1.00 22.65  ? 115 LEU A C     1 
ATOM   465   O  O     . LEU A 1 56  ? 21.620  21.428 72.133 1.00 41.98  ? 115 LEU A O     1 
ATOM   466   C  CB    . LEU A 1 56  ? 24.789  20.457 71.800 1.00 41.98  ? 115 LEU A CB    1 
ATOM   467   C  CG    . LEU A 1 56  ? 25.767  19.691 70.920 1.00 41.98  ? 115 LEU A CG    1 
ATOM   468   C  CD1   . LEU A 1 56  ? 26.621  18.790 71.774 1.00 41.98  ? 115 LEU A CD1   1 
ATOM   469   C  CD2   . LEU A 1 56  ? 24.997  18.883 69.918 1.00 41.98  ? 115 LEU A CD2   1 
ATOM   470   H  H     . LEU A 1 56  ? 25.341  22.525 70.390 1.00 0.00   ? 115 LEU A H     1 
ATOM   471   N  N     . ALA A 1 57  ? 23.125  23.022 72.601 1.00 50.87  ? 116 ALA A N     1 
ATOM   472   C  CA    . ALA A 1 57  ? 22.256  23.726 73.535 1.00 50.87  ? 116 ALA A CA    1 
ATOM   473   C  C     . ALA A 1 57  ? 21.081  24.386 72.806 1.00 50.87  ? 116 ALA A C     1 
ATOM   474   O  O     . ALA A 1 57  ? 20.081  24.754 73.413 1.00 80.50  ? 116 ALA A O     1 
ATOM   475   C  CB    . ALA A 1 57  ? 23.061  24.769 74.292 1.00 80.50  ? 116 ALA A CB    1 
ATOM   476   H  H     . ALA A 1 57  ? 24.016  23.387 72.414 1.00 0.00   ? 116 ALA A H     1 
ATOM   477   N  N     . GLN A 1 58  ? 21.215  24.524 71.494 1.00 36.80  ? 117 GLN A N     1 
ATOM   478   C  CA    . GLN A 1 58  ? 20.201  25.139 70.656 1.00 36.80  ? 117 GLN A CA    1 
ATOM   479   C  C     . GLN A 1 58  ? 19.203  24.086 70.196 1.00 36.80  ? 117 GLN A C     1 
ATOM   480   O  O     . GLN A 1 58  ? 18.492  24.300 69.207 1.00 55.99  ? 117 GLN A O     1 
ATOM   481   C  CB    . GLN A 1 58  ? 20.872  25.743 69.428 1.00 55.99  ? 117 GLN A CB    1 
ATOM   482   C  CG    . GLN A 1 58  ? 20.220  26.979 68.939 1.00 55.99  ? 117 GLN A CG    1 
ATOM   483   C  CD    . GLN A 1 58  ? 20.446  28.120 69.884 1.00 55.99  ? 117 GLN A CD    1 
ATOM   484   O  OE1   . GLN A 1 58  ? 21.466  28.801 69.810 1.00 55.99  ? 117 GLN A OE1   1 
ATOM   485   N  NE2   . GLN A 1 58  ? 19.508  28.329 70.801 1.00 55.99  ? 117 GLN A NE2   1 
ATOM   486   H  H     . GLN A 1 58  ? 22.038  24.215 71.078 1.00 0.00   ? 117 GLN A H     1 
ATOM   487   N  N     . ARG A 1 59  ? 19.150  22.963 70.915 1.00 47.89  ? 118 ARG A N     1 
ATOM   488   C  CA    . ARG A 1 59  ? 18.264  21.848 70.582 1.00 47.89  ? 118 ARG A CA    1 
ATOM   489   C  C     . ARG A 1 59  ? 18.976  21.084 69.475 1.00 47.89  ? 118 ARG A C     1 
ATOM   490   O  O     . ARG A 1 59  ? 19.678  20.118 69.751 1.00 141.34 ? 118 ARG A O     1 
ATOM   491   C  CB    . ARG A 1 59  ? 16.877  22.366 70.149 1.00 141.34 ? 118 ARG A CB    1 
ATOM   492   C  CG    . ARG A 1 59  ? 16.085  21.517 69.160 1.00 141.34 ? 118 ARG A CG    1 
ATOM   493   C  CD    . ARG A 1 59  ? 14.905  22.330 68.640 1.00 141.34 ? 118 ARG A CD    1 
ATOM   494   N  NE    . ARG A 1 59  ? 14.205  21.691 67.531 1.00 141.34 ? 118 ARG A NE    1 
ATOM   495   C  CZ    . ARG A 1 59  ? 13.425  22.340 66.672 1.00 141.34 ? 118 ARG A CZ    1 
ATOM   496   N  NH1   . ARG A 1 59  ? 13.238  23.651 66.787 1.00 141.34 ? 118 ARG A NH1   1 
ATOM   497   N  NH2   . ARG A 1 59  ? 12.846  21.681 65.679 1.00 141.34 ? 118 ARG A NH2   1 
ATOM   498   H  H     . ARG A 1 59  ? 19.761  22.817 71.665 1.00 0.00   ? 118 ARG A H     1 
ATOM   499   H  HE    . ARG A 1 59  ? 14.320  20.727 67.404 1.00 0.00   ? 118 ARG A HE    1 
ATOM   500   H  HH11  . ARG A 1 59  ? 13.685  24.166 67.517 1.00 0.00   ? 118 ARG A HH11  1 
ATOM   501   H  HH12  . ARG A 1 59  ? 12.648  24.126 66.134 1.00 0.00   ? 118 ARG A HH12  1 
ATOM   502   H  HH21  . ARG A 1 59  ? 12.999  20.699 65.573 1.00 0.00   ? 118 ARG A HH21  1 
ATOM   503   H  HH22  . ARG A 1 59  ? 12.258  22.167 65.032 1.00 0.00   ? 118 ARG A HH22  1 
ATOM   504   N  N     . VAL A 1 60  ? 18.854  21.578 68.249 1.00 47.71  ? 119 VAL A N     1 
ATOM   505   C  CA    . VAL A 1 60  ? 19.503  20.987 67.085 1.00 47.71  ? 119 VAL A CA    1 
ATOM   506   C  C     . VAL A 1 60  ? 19.318  19.470 66.921 1.00 47.71  ? 119 VAL A C     1 
ATOM   507   O  O     . VAL A 1 60  ? 19.647  18.676 67.803 1.00 33.29  ? 119 VAL A O     1 
ATOM   508   C  CB    . VAL A 1 60  ? 21.011  21.384 67.025 1.00 33.29  ? 119 VAL A CB    1 
ATOM   509   C  CG1   . VAL A 1 60  ? 21.689  20.698 65.869 1.00 33.29  ? 119 VAL A CG1   1 
ATOM   510   C  CG2   . VAL A 1 60  ? 21.147  22.895 66.852 1.00 33.29  ? 119 VAL A CG2   1 
ATOM   511   H  H     . VAL A 1 60  ? 18.341  22.400 68.129 1.00 0.00   ? 119 VAL A H     1 
ATOM   512   N  N     . SER A 1 61  ? 18.776  19.087 65.769 1.00 41.12  ? 120 SER A N     1 
ATOM   513   C  CA    . SER A 1 61  ? 18.515  17.692 65.442 1.00 41.12  ? 120 SER A CA    1 
ATOM   514   C  C     . SER A 1 61  ? 19.745  17.049 64.848 1.00 41.12  ? 120 SER A C     1 
ATOM   515   O  O     . SER A 1 61  ? 19.964  15.849 65.003 1.00 41.04  ? 120 SER A O     1 
ATOM   516   C  CB    . SER A 1 61  ? 17.355  17.605 64.456 1.00 41.04  ? 120 SER A CB    1 
ATOM   517   O  OG    . SER A 1 61  ? 16.180  18.192 65.013 1.00 41.04  ? 120 SER A OG    1 
ATOM   518   H  H     . SER A 1 61  ? 18.530  19.772 65.134 1.00 0.00   ? 120 SER A H     1 
ATOM   519   H  HG    . SER A 1 61  ? 16.010  17.729 65.846 1.00 30.00  ? 120 SER A HG    1 
ATOM   520   N  N     . GLY A 1 62  ? 20.549  17.863 64.177 1.00 50.89  ? 121 GLY A N     1 
ATOM   521   C  CA    . GLY A 1 62  ? 21.765  17.379 63.551 1.00 50.89  ? 121 GLY A CA    1 
ATOM   522   C  C     . GLY A 1 62  ? 22.635  18.566 63.216 1.00 50.89  ? 121 GLY A C     1 
ATOM   523   O  O     . GLY A 1 62  ? 22.118  19.677 63.134 1.00 36.67  ? 121 GLY A O     1 
ATOM   524   H  H     . GLY A 1 62  ? 20.345  18.819 64.101 1.00 0.00   ? 121 GLY A H     1 
ATOM   525   N  N     . LEU A 1 63  ? 23.928  18.350 63.005 1.00 35.69  ? 122 LEU A N     1 
ATOM   526   C  CA    . LEU A 1 63  ? 24.841  19.448 62.703 1.00 35.69  ? 122 LEU A CA    1 
ATOM   527   C  C     . LEU A 1 63  ? 25.623  19.220 61.413 1.00 35.69  ? 122 LEU A C     1 
ATOM   528   O  O     . LEU A 1 63  ? 25.994  18.082 61.097 1.00 33.54  ? 122 LEU A O     1 
ATOM   529   C  CB    . LEU A 1 63  ? 25.890  19.606 63.825 1.00 33.54  ? 122 LEU A CB    1 
ATOM   530   C  CG    . LEU A 1 63  ? 25.618  19.441 65.323 1.00 33.54  ? 122 LEU A CG    1 
ATOM   531   C  CD1   . LEU A 1 63  ? 26.887  19.035 66.018 1.00 33.54  ? 122 LEU A CD1   1 
ATOM   532   C  CD2   . LEU A 1 63  ? 25.082  20.698 65.917 1.00 33.54  ? 122 LEU A CD2   1 
ATOM   533   H  H     . LEU A 1 63  ? 24.289  17.440 63.046 1.00 0.00   ? 122 LEU A H     1 
ATOM   534   N  N     . ILE A 1 64  ? 25.875  20.297 60.672 1.00 11.47  ? 123 ILE A N     1 
ATOM   535   C  CA    . ILE A 1 64  ? 26.698  20.214 59.477 1.00 11.47  ? 123 ILE A CA    1 
ATOM   536   C  C     . ILE A 1 64  ? 27.894  21.095 59.858 1.00 11.47  ? 123 ILE A C     1 
ATOM   537   O  O     . ILE A 1 64  ? 27.728  22.255 60.246 1.00 22.87  ? 123 ILE A O     1 
ATOM   538   C  CB    . ILE A 1 64  ? 25.976  20.737 58.255 1.00 22.87  ? 123 ILE A CB    1 
ATOM   539   C  CG1   . ILE A 1 64  ? 24.686  19.943 58.062 1.00 22.87  ? 123 ILE A CG1   1 
ATOM   540   C  CG2   . ILE A 1 64  ? 26.864  20.620 57.039 1.00 22.87  ? 123 ILE A CG2   1 
ATOM   541   C  CD1   . ILE A 1 64  ? 23.882  20.348 56.864 1.00 22.87  ? 123 ILE A CD1   1 
ATOM   542   H  H     . ILE A 1 64  ? 25.522  21.172 60.944 1.00 0.00   ? 123 ILE A H     1 
ATOM   543   N  N     . ILE A 1 65  ? 29.079  20.504 59.899 1.00 18.37  ? 124 ILE A N     1 
ATOM   544   C  CA    . ILE A 1 65  ? 30.299  21.221 60.289 1.00 18.37  ? 124 ILE A CA    1 
ATOM   545   C  C     . ILE A 1 65  ? 31.109  21.635 59.051 1.00 18.37  ? 124 ILE A C     1 
ATOM   546   O  O     . ILE A 1 65  ? 31.853  20.843 58.478 1.00 15.62  ? 124 ILE A O     1 
ATOM   547   C  CB    . ILE A 1 65  ? 31.094  20.346 61.269 1.00 15.62  ? 124 ILE A CB    1 
ATOM   548   C  CG1   . ILE A 1 65  ? 30.278  20.206 62.567 1.00 15.62  ? 124 ILE A CG1   1 
ATOM   549   C  CG2   . ILE A 1 65  ? 32.429  20.959 61.578 1.00 15.62  ? 124 ILE A CG2   1 
ATOM   550   C  CD1   . ILE A 1 65  ? 30.160  18.828 63.102 1.00 15.62  ? 124 ILE A CD1   1 
ATOM   551   H  H     . ILE A 1 65  ? 29.148  19.573 59.713 1.00 0.00   ? 124 ILE A H     1 
ATOM   552   N  N     . ASN A 1 66  ? 30.925  22.869 58.604 1.00 17.54  ? 125 ASN A N     1 
ATOM   553   C  CA    . ASN A 1 66  ? 31.606  23.338 57.412 1.00 17.54  ? 125 ASN A CA    1 
ATOM   554   C  C     . ASN A 1 66  ? 32.892  24.105 57.760 1.00 17.54  ? 125 ASN A C     1 
ATOM   555   O  O     . ASN A 1 66  ? 33.264  25.069 57.105 1.00 30.74  ? 125 ASN A O     1 
ATOM   556   C  CB    . ASN A 1 66  ? 30.632  24.173 56.596 1.00 30.74  ? 125 ASN A CB    1 
ATOM   557   C  CG    . ASN A 1 66  ? 31.242  24.710 55.338 1.00 30.74  ? 125 ASN A CG    1 
ATOM   558   O  OD1   . ASN A 1 66  ? 30.845  25.770 54.858 1.00 30.74  ? 125 ASN A OD1   1 
ATOM   559   N  ND2   . ASN A 1 66  ? 32.222  24.002 54.795 1.00 30.74  ? 125 ASN A ND2   1 
ATOM   560   H  H     . ASN A 1 66  ? 30.324  23.469 59.093 1.00 0.00   ? 125 ASN A H     1 
ATOM   561   H  HD21  . ASN A 1 66  ? 32.607  24.404 53.990 1.00 0.00   ? 125 ASN A HD21  1 
ATOM   562   H  HD22  . ASN A 1 66  ? 32.537  23.162 55.170 1.00 0.00   ? 125 ASN A HD22  1 
ATOM   563   N  N     . TYR A 1 67  ? 33.630  23.563 58.724 1.00 16.07  ? 126 TYR A N     1 
ATOM   564   C  CA    . TYR A 1 67  ? 34.854  24.150 59.232 1.00 16.07  ? 126 TYR A CA    1 
ATOM   565   C  C     . TYR A 1 67  ? 36.029  23.183 59.039 1.00 16.07  ? 126 TYR A C     1 
ATOM   566   O  O     . TYR A 1 67  ? 35.845  21.970 58.994 1.00 32.84  ? 126 TYR A O     1 
ATOM   567   C  CB    . TYR A 1 67  ? 34.641  24.469 60.716 1.00 32.84  ? 126 TYR A CB    1 
ATOM   568   C  CG    . TYR A 1 67  ? 35.734  25.262 61.370 1.00 32.84  ? 126 TYR A CG    1 
ATOM   569   C  CD1   . TYR A 1 67  ? 35.829  26.637 61.194 1.00 32.84  ? 126 TYR A CD1   1 
ATOM   570   C  CD2   . TYR A 1 67  ? 36.688  24.633 62.157 1.00 32.84  ? 126 TYR A CD2   1 
ATOM   571   C  CE1   . TYR A 1 67  ? 36.847  27.361 61.783 1.00 32.84  ? 126 TYR A CE1   1 
ATOM   572   C  CE2   . TYR A 1 67  ? 37.712  25.342 62.751 1.00 32.84  ? 126 TYR A CE2   1 
ATOM   573   C  CZ    . TYR A 1 67  ? 37.793  26.705 62.565 1.00 32.84  ? 126 TYR A CZ    1 
ATOM   574   O  OH    . TYR A 1 67  ? 38.836  27.388 63.159 1.00 32.84  ? 126 TYR A OH    1 
ATOM   575   H  H     . TYR A 1 67  ? 33.361  22.706 59.116 1.00 0.00   ? 126 TYR A H     1 
ATOM   576   H  HH    . TYR A 1 67  ? 39.565  26.774 63.267 1.00 0.00   ? 126 TYR A HH    1 
ATOM   577   N  N     . PRO A 1 68  ? 37.239  23.728 58.813 1.00 43.33  ? 127 PRO A N     1 
ATOM   578   C  CA    . PRO A 1 68  ? 38.514  23.029 58.606 1.00 43.33  ? 127 PRO A CA    1 
ATOM   579   C  C     . PRO A 1 68  ? 39.056  22.317 59.855 1.00 43.33  ? 127 PRO A C     1 
ATOM   580   O  O     . PRO A 1 68  ? 39.340  22.959 60.890 1.00 29.27  ? 127 PRO A O     1 
ATOM   581   C  CB    . PRO A 1 68  ? 39.455  24.164 58.215 1.00 29.27  ? 127 PRO A CB    1 
ATOM   582   C  CG    . PRO A 1 68  ? 38.547  25.138 57.547 1.00 29.27  ? 127 PRO A CG    1 
ATOM   583   C  CD    . PRO A 1 68  ? 37.374  25.151 58.446 1.00 29.27  ? 127 PRO A CD    1 
ATOM   584   N  N     . LEU A 1 69  ? 39.280  21.007 59.742 1.00 31.23  ? 128 LEU A N     1 
ATOM   585   C  CA    . LEU A 1 69  ? 39.806  20.246 60.870 1.00 31.23  ? 128 LEU A CA    1 
ATOM   586   C  C     . LEU A 1 69  ? 40.765  19.108 60.444 1.00 31.23  ? 128 LEU A C     1 
ATOM   587   O  O     . LEU A 1 69  ? 40.502  18.373 59.489 1.00 18.39  ? 128 LEU A O     1 
ATOM   588   C  CB    . LEU A 1 69  ? 38.632  19.679 61.673 1.00 18.39  ? 128 LEU A CB    1 
ATOM   589   C  CG    . LEU A 1 69  ? 37.586  20.661 62.239 1.00 18.39  ? 128 LEU A CG    1 
ATOM   590   C  CD1   . LEU A 1 69  ? 36.224  19.964 62.231 1.00 18.39  ? 128 LEU A CD1   1 
ATOM   591   C  CD2   . LEU A 1 69  ? 37.989  21.169 63.646 1.00 18.39  ? 128 LEU A CD2   1 
ATOM   592   H  H     . LEU A 1 69  ? 39.071  20.530 58.912 1.00 0.00   ? 128 LEU A H     1 
ATOM   593   N  N     . ASP A 1 70  ? 41.915  19.001 61.104 1.00 14.50  ? 129 ASP A N     1 
ATOM   594   C  CA    . ASP A 1 70  ? 42.829  17.922 60.771 1.00 14.50  ? 129 ASP A CA    1 
ATOM   595   C  C     . ASP A 1 70  ? 42.137  16.679 61.347 1.00 14.50  ? 129 ASP A C     1 
ATOM   596   O  O     . ASP A 1 70  ? 41.181  16.806 62.114 1.00 65.61  ? 129 ASP A O     1 
ATOM   597   C  CB    . ASP A 1 70  ? 44.208  18.158 61.407 1.00 65.61  ? 129 ASP A CB    1 
ATOM   598   C  CG    . ASP A 1 70  ? 44.803  19.543 61.067 1.00 65.61  ? 129 ASP A CG    1 
ATOM   599   O  OD1   . ASP A 1 70  ? 44.202  20.303 60.271 1.00 65.61  ? 129 ASP A OD1   1 
ATOM   600   O  OD2   . ASP A 1 70  ? 45.887  19.876 61.614 1.00 65.61  ? 129 ASP A OD2   1 
ATOM   601   H  H     . ASP A 1 70  ? 42.145  19.659 61.790 1.00 0.00   ? 129 ASP A H     1 
ATOM   602   N  N     . ASP A 1 71  ? 42.638  15.498 61.026 1.00 15.96  ? 130 ASP A N     1 
ATOM   603   C  CA    . ASP A 1 71  ? 42.032  14.263 61.502 1.00 15.96  ? 130 ASP A CA    1 
ATOM   604   C  C     . ASP A 1 71  ? 41.665  14.296 62.970 1.00 15.96  ? 130 ASP A C     1 
ATOM   605   O  O     . ASP A 1 71  ? 40.520  14.039 63.354 1.00 60.12  ? 130 ASP A O     1 
ATOM   606   C  CB    . ASP A 1 71  ? 42.954  13.052 61.243 1.00 60.12  ? 130 ASP A CB    1 
ATOM   607   C  CG    . ASP A 1 71  ? 43.076  12.686 59.748 1.00 60.12  ? 130 ASP A CG    1 
ATOM   608   O  OD1   . ASP A 1 71  ? 43.661  13.490 58.971 1.00 60.12  ? 130 ASP A OD1   1 
ATOM   609   O  OD2   . ASP A 1 71  ? 42.612  11.573 59.367 1.00 60.12  ? 130 ASP A OD2   1 
ATOM   610   H  H     . ASP A 1 71  ? 43.414  15.471 60.433 1.00 0.00   ? 130 ASP A H     1 
ATOM   611   N  N     . GLN A 1 72  ? 42.636  14.670 63.786 1.00 2.00   ? 131 GLN A N     1 
ATOM   612   C  CA    . GLN A 1 72  ? 42.427  14.686 65.223 1.00 2.00   ? 131 GLN A CA    1 
ATOM   613   C  C     . GLN A 1 72  ? 41.392  15.664 65.678 1.00 2.00   ? 131 GLN A C     1 
ATOM   614   O  O     . GLN A 1 72  ? 40.602  15.349 66.568 1.00 36.59  ? 131 GLN A O     1 
ATOM   615   C  CB    . GLN A 1 72  ? 43.730  14.887 65.974 1.00 36.59  ? 131 GLN A CB    1 
ATOM   616   C  CG    . GLN A 1 72  ? 44.535  13.622 66.053 1.00 36.59  ? 131 GLN A CG    1 
ATOM   617   C  CD    . GLN A 1 72  ? 45.749  13.728 66.946 1.00 36.59  ? 131 GLN A CD    1 
ATOM   618   O  OE1   . GLN A 1 72  ? 46.447  12.746 67.139 1.00 36.59  ? 131 GLN A OE1   1 
ATOM   619   N  NE2   . GLN A 1 72  ? 46.003  14.911 67.504 1.00 36.59  ? 131 GLN A NE2   1 
ATOM   620   H  H     . GLN A 1 72  ? 43.498  14.936 63.413 1.00 0.00   ? 131 GLN A H     1 
ATOM   621   N  N     . ASP A 1 73  ? 41.379  16.852 65.085 1.00 15.09  ? 132 ASP A N     1 
ATOM   622   C  CA    . ASP A 1 73  ? 40.410  17.860 65.480 1.00 15.09  ? 132 ASP A CA    1 
ATOM   623   C  C     . ASP A 1 73  ? 39.035  17.465 64.988 1.00 15.09  ? 132 ASP A C     1 
ATOM   624   O  O     . ASP A 1 73  ? 38.043  17.739 65.650 1.00 50.91  ? 132 ASP A O     1 
ATOM   625   C  CB    . ASP A 1 73  ? 40.805  19.224 64.932 1.00 50.91  ? 132 ASP A CB    1 
ATOM   626   C  CG    . ASP A 1 73  ? 42.132  19.713 65.489 1.00 50.91  ? 132 ASP A CG    1 
ATOM   627   O  OD1   . ASP A 1 73  ? 42.688  19.052 66.398 1.00 50.91  ? 132 ASP A OD1   1 
ATOM   628   O  OD2   . ASP A 1 73  ? 42.612  20.774 65.022 1.00 50.91  ? 132 ASP A OD2   1 
ATOM   629   H  H     . ASP A 1 73  ? 41.996  17.037 64.351 1.00 0.00   ? 132 ASP A H     1 
ATOM   630   N  N     . ALA A 1 74  ? 38.981  16.788 63.846 1.00 19.70  ? 133 ALA A N     1 
ATOM   631   C  CA    . ALA A 1 74  ? 37.722  16.348 63.269 1.00 19.70  ? 133 ALA A CA    1 
ATOM   632   C  C     . ALA A 1 74  ? 37.044  15.376 64.230 1.00 19.70  ? 133 ALA A C     1 
ATOM   633   O  O     . ALA A 1 74  ? 35.865  15.530 64.567 1.00 32.48  ? 133 ALA A O     1 
ATOM   634   C  CB    . ALA A 1 74  ? 37.980  15.681 61.949 1.00 32.48  ? 133 ALA A CB    1 
ATOM   635   H  H     . ALA A 1 74  ? 39.802  16.568 63.365 1.00 0.00   ? 133 ALA A H     1 
ATOM   636   N  N     . ILE A 1 75  ? 37.818  14.397 64.694 1.00 52.93  ? 134 ILE A N     1 
ATOM   637   C  CA    . ILE A 1 75  ? 37.354  13.375 65.629 1.00 52.93  ? 134 ILE A CA    1 
ATOM   638   C  C     . ILE A 1 75  ? 37.002  13.989 66.980 1.00 52.93  ? 134 ILE A C     1 
ATOM   639   O  O     . ILE A 1 75  ? 36.085  13.523 67.666 1.00 22.18  ? 134 ILE A O     1 
ATOM   640   C  CB    . ILE A 1 75  ? 38.425  12.295 65.851 1.00 22.18  ? 134 ILE A CB    1 
ATOM   641   C  CG1   . ILE A 1 75  ? 38.756  11.600 64.526 1.00 22.18  ? 134 ILE A CG1   1 
ATOM   642   C  CG2   . ILE A 1 75  ? 37.977  11.323 66.947 1.00 22.18  ? 134 ILE A CG2   1 
ATOM   643   C  CD1   . ILE A 1 75  ? 39.843  10.578 64.640 1.00 22.18  ? 134 ILE A CD1   1 
ATOM   644   H  H     . ILE A 1 75  ? 38.740  14.352 64.358 1.00 0.00   ? 134 ILE A H     1 
ATOM   645   N  N     . ALA A 1 76  ? 37.759  14.998 67.391 1.00 28.33  ? 135 ALA A N     1 
ATOM   646   C  CA    . ALA A 1 76  ? 37.485  15.663 68.655 1.00 28.33  ? 135 ALA A CA    1 
ATOM   647   C  C     . ALA A 1 76  ? 36.117  16.335 68.539 1.00 28.33  ? 135 ALA A C     1 
ATOM   648   O  O     . ALA A 1 76  ? 35.223  16.145 69.378 1.00 25.64  ? 135 ALA A O     1 
ATOM   649   C  CB    . ALA A 1 76  ? 38.552  16.692 68.933 1.00 25.64  ? 135 ALA A CB    1 
ATOM   650   H  H     . ALA A 1 76  ? 38.526  15.280 66.847 1.00 0.00   ? 135 ALA A H     1 
ATOM   651   N  N     . VAL A 1 77  ? 35.963  17.084 67.453 1.00 25.36  ? 136 VAL A N     1 
ATOM   652   C  CA    . VAL A 1 77  ? 34.750  17.812 67.161 1.00 25.36  ? 136 VAL A CA    1 
ATOM   653   C  C     . VAL A 1 77  ? 33.543  16.886 67.106 1.00 25.36  ? 136 VAL A C     1 
ATOM   654   O  O     . VAL A 1 77  ? 32.529  17.166 67.718 1.00 21.76  ? 136 VAL A O     1 
ATOM   655   C  CB    . VAL A 1 77  ? 34.930  18.627 65.868 1.00 21.76  ? 136 VAL A CB    1 
ATOM   656   C  CG1   . VAL A 1 77  ? 33.647  19.346 65.468 1.00 21.76  ? 136 VAL A CG1   1 
ATOM   657   C  CG2   . VAL A 1 77  ? 36.015  19.632 66.093 1.00 21.76  ? 136 VAL A CG2   1 
ATOM   658   H  H     . VAL A 1 77  ? 36.698  17.140 66.815 1.00 0.00   ? 136 VAL A H     1 
ATOM   659   N  N     . GLU A 1 78  ? 33.644  15.788 66.371 1.00 19.59  ? 137 GLU A N     1 
ATOM   660   C  CA    . GLU A 1 78  ? 32.550  14.822 66.303 1.00 19.59  ? 137 GLU A CA    1 
ATOM   661   C  C     . GLU A 1 78  ? 32.197  14.337 67.713 1.00 19.59  ? 137 GLU A C     1 
ATOM   662   O  O     . GLU A 1 78  ? 31.042  14.386 68.116 1.00 34.80  ? 137 GLU A O     1 
ATOM   663   C  CB    . GLU A 1 78  ? 32.967  13.628 65.460 1.00 34.80  ? 137 GLU A CB    1 
ATOM   664   C  CG    . GLU A 1 78  ? 32.079  12.434 65.636 1.00 34.80  ? 137 GLU A CG    1 
ATOM   665   C  CD    . GLU A 1 78  ? 32.473  11.305 64.741 1.00 34.80  ? 137 GLU A CD    1 
ATOM   666   O  OE1   . GLU A 1 78  ? 33.361  10.532 65.134 1.00 34.80  ? 137 GLU A OE1   1 
ATOM   667   O  OE2   . GLU A 1 78  ? 31.898  11.197 63.636 1.00 34.80  ? 137 GLU A OE2   1 
ATOM   668   H  H     . GLU A 1 78  ? 34.464  15.634 65.860 1.00 0.00   ? 137 GLU A H     1 
ATOM   669   N  N     . ALA A 1 79  ? 33.197  13.894 68.471 1.00 22.67  ? 138 ALA A N     1 
ATOM   670   C  CA    . ALA A 1 79  ? 32.995  13.408 69.844 1.00 22.67  ? 138 ALA A CA    1 
ATOM   671   C  C     . ALA A 1 79  ? 32.324  14.471 70.716 1.00 22.67  ? 138 ALA A C     1 
ATOM   672   O  O     . ALA A 1 79  ? 31.708  14.161 71.736 1.00 28.88  ? 138 ALA A O     1 
ATOM   673   C  CB    . ALA A 1 79  ? 34.336  12.989 70.464 1.00 28.88  ? 138 ALA A CB    1 
ATOM   674   H  H     . ALA A 1 79  ? 34.114  13.893 68.115 1.00 0.00   ? 138 ALA A H     1 
ATOM   675   N  N     . ALA A 1 80  ? 32.499  15.733 70.338 1.00 39.35  ? 139 ALA A N     1 
ATOM   676   C  CA    . ALA A 1 80  ? 31.894  16.837 71.065 1.00 39.35  ? 139 ALA A CA    1 
ATOM   677   C  C     . ALA A 1 80  ? 30.412  16.959 70.694 1.00 39.35  ? 139 ALA A C     1 
ATOM   678   O  O     . ALA A 1 80  ? 29.616  17.509 71.460 1.00 34.59  ? 139 ALA A O     1 
ATOM   679   C  CB    . ALA A 1 80  ? 32.632  18.136 70.762 1.00 34.59  ? 139 ALA A CB    1 
ATOM   680   H  H     . ALA A 1 80  ? 33.078  15.928 69.570 1.00 0.00   ? 139 ALA A H     1 
ATOM   681   N  N     . CYS A 1 81  ? 30.038  16.416 69.539 1.00 19.14  ? 140 CYS A N     1 
ATOM   682   C  CA    . CYS A 1 81  ? 28.664  16.472 69.072 1.00 19.14  ? 140 CYS A CA    1 
ATOM   683   C  C     . CYS A 1 81  ? 27.681  15.684 69.903 1.00 19.14  ? 140 CYS A C     1 
ATOM   684   O  O     . CYS A 1 81  ? 26.486  15.713 69.637 1.00 42.52  ? 140 CYS A O     1 
ATOM   685   C  CB    . CYS A 1 81  ? 28.585  16.044 67.624 1.00 42.52  ? 140 CYS A CB    1 
ATOM   686   S  SG    . CYS A 1 81  ? 29.573  17.103 66.622 1.00 42.52  ? 140 CYS A SG    1 
ATOM   687   H  H     . CYS A 1 81  ? 30.723  16.018 68.971 1.00 0.00   ? 140 CYS A H     1 
ATOM   688   N  N     . THR A 1 82  ? 28.190  14.932 70.861 1.00 30.48  ? 141 THR A N     1 
ATOM   689   C  CA    . THR A 1 82  ? 27.353  14.165 71.755 1.00 30.48  ? 141 THR A CA    1 
ATOM   690   C  C     . THR A 1 82  ? 26.128  13.549 71.089 1.00 30.48  ? 141 THR A C     1 
ATOM   691   O  O     . THR A 1 82  ? 25.058  14.153 71.091 1.00 55.23  ? 141 THR A O     1 
ATOM   692   C  CB    . THR A 1 82  ? 26.874  15.043 72.937 1.00 55.23  ? 141 THR A CB    1 
ATOM   693   O  OG1   . THR A 1 82  ? 28.002  15.635 73.596 1.00 55.23  ? 141 THR A OG1   1 
ATOM   694   C  CG2   . THR A 1 82  ? 26.107  14.195 73.941 1.00 55.23  ? 141 THR A CG2   1 
ATOM   695   H  H     . THR A 1 82  ? 29.157  14.878 70.988 1.00 0.00   ? 141 THR A H     1 
ATOM   696   H  HG1   . THR A 1 82  ? 28.485  16.199 72.978 1.00 30.00  ? 141 THR A HG1   1 
ATOM   697   N  N     . ASN A 1 83  ? 26.295  12.349 70.533 1.00 82.64  ? 142 ASN A N     1 
ATOM   698   C  CA    . ASN A 1 83  ? 25.229  11.575 69.860 1.00 82.64  ? 142 ASN A CA    1 
ATOM   699   C  C     . ASN A 1 83  ? 24.476  12.161 68.646 1.00 82.64  ? 142 ASN A C     1 
ATOM   700   O  O     . ASN A 1 83  ? 24.170  11.428 67.699 1.00 122.06 ? 142 ASN A O     1 
ATOM   701   C  CB    . ASN A 1 83  ? 24.235  10.954 70.879 1.00 122.06 ? 142 ASN A CB    1 
ATOM   702   C  CG    . ASN A 1 83  ? 23.246  11.968 71.473 1.00 122.06 ? 142 ASN A CG    1 
ATOM   703   O  OD1   . ASN A 1 83  ? 22.197  12.251 70.891 1.00 122.06 ? 142 ASN A OD1   1 
ATOM   704   N  ND2   . ASN A 1 83  ? 23.554  12.465 72.664 1.00 122.06 ? 142 ASN A ND2   1 
ATOM   705   H  H     . ASN A 1 83  ? 27.198  11.970 70.567 1.00 0.00   ? 142 ASN A H     1 
ATOM   706   H  HD21  . ASN A 1 83  ? 22.942  13.137 73.021 1.00 0.00   ? 142 ASN A HD21  1 
ATOM   707   H  HD22  . ASN A 1 83  ? 24.363  12.159 73.117 1.00 0.00   ? 142 ASN A HD22  1 
ATOM   708   N  N     . VAL A 1 84  ? 24.198  13.460 68.658 1.00 25.19  ? 143 VAL A N     1 
ATOM   709   C  CA    . VAL A 1 84  ? 23.488  14.119 67.567 1.00 25.19  ? 143 VAL A CA    1 
ATOM   710   C  C     . VAL A 1 84  ? 24.259  13.935 66.261 1.00 25.19  ? 143 VAL A C     1 
ATOM   711   O  O     . VAL A 1 84  ? 25.445  14.242 66.183 1.00 30.24  ? 143 VAL A O     1 
ATOM   712   C  CB    . VAL A 1 84  ? 23.353  15.625 67.868 1.00 30.24  ? 143 VAL A CB    1 
ATOM   713   C  CG1   . VAL A 1 84  ? 22.559  16.322 66.803 1.00 30.24  ? 143 VAL A CG1   1 
ATOM   714   C  CG2   . VAL A 1 84  ? 22.698  15.822 69.219 1.00 30.24  ? 143 VAL A CG2   1 
ATOM   715   H  H     . VAL A 1 84  ? 24.480  14.039 69.384 1.00 0.00   ? 143 VAL A H     1 
ATOM   716   N  N     . PRO A 1 85  ? 23.598  13.426 65.214 1.00 21.21  ? 144 PRO A N     1 
ATOM   717   C  CA    . PRO A 1 85  ? 24.311  13.238 63.945 1.00 21.21  ? 144 PRO A CA    1 
ATOM   718   C  C     . PRO A 1 85  ? 25.028  14.512 63.479 1.00 21.21  ? 144 PRO A C     1 
ATOM   719   O  O     . PRO A 1 85  ? 24.453  15.607 63.504 1.00 39.00  ? 144 PRO A O     1 
ATOM   720   C  CB    . PRO A 1 85  ? 23.189  12.829 62.983 1.00 39.00  ? 144 PRO A CB    1 
ATOM   721   C  CG    . PRO A 1 85  ? 21.941  13.399 63.609 1.00 39.00  ? 144 PRO A CG    1 
ATOM   722   C  CD    . PRO A 1 85  ? 22.166  13.116 65.062 1.00 39.00  ? 144 PRO A CD    1 
ATOM   723   N  N     . ALA A 1 86  ? 26.283  14.347 63.054 1.00 52.24  ? 145 ALA A N     1 
ATOM   724   C  CA    . ALA A 1 86  ? 27.119  15.445 62.569 1.00 52.24  ? 145 ALA A CA    1 
ATOM   725   C  C     . ALA A 1 86  ? 27.772  15.089 61.238 1.00 52.24  ? 145 ALA A C     1 
ATOM   726   O  O     . ALA A 1 86  ? 28.229  13.955 61.051 1.00 49.75  ? 145 ALA A O     1 
ATOM   727   C  CB    . ALA A 1 86  ? 28.194  15.772 63.588 1.00 49.75  ? 145 ALA A CB    1 
ATOM   728   H  H     . ALA A 1 86  ? 26.685  13.454 63.055 1.00 0.00   ? 145 ALA A H     1 
ATOM   729   N  N     . LEU A 1 87  ? 27.833  16.059 60.326 1.00 23.36  ? 146 LEU A N     1 
ATOM   730   C  CA    . LEU A 1 87  ? 28.447  15.849 59.024 1.00 23.36  ? 146 LEU A CA    1 
ATOM   731   C  C     . LEU A 1 87  ? 29.513  16.918 58.738 1.00 23.36  ? 146 LEU A C     1 
ATOM   732   O  O     . LEU A 1 87  ? 29.222  18.126 58.785 1.00 16.25  ? 146 LEU A O     1 
ATOM   733   C  CB    . LEU A 1 87  ? 27.373  15.896 57.959 1.00 16.25  ? 146 LEU A CB    1 
ATOM   734   C  CG    . LEU A 1 87  ? 27.544  14.982 56.750 1.00 16.25  ? 146 LEU A CG    1 
ATOM   735   C  CD1   . LEU A 1 87  ? 27.678  13.501 57.214 1.00 16.25  ? 146 LEU A CD1   1 
ATOM   736   C  CD2   . LEU A 1 87  ? 26.339  15.178 55.811 1.00 16.25  ? 146 LEU A CD2   1 
ATOM   737   H  H     . LEU A 1 87  ? 27.446  16.939 60.515 1.00 0.00   ? 146 LEU A H     1 
ATOM   738   N  N     . PHE A 1 88  ? 30.737  16.470 58.439 1.00 28.88  ? 147 PHE A N     1 
ATOM   739   C  CA    . PHE A 1 88  ? 31.864  17.358 58.143 1.00 28.88  ? 147 PHE A CA    1 
ATOM   740   C  C     . PHE A 1 88  ? 32.066  17.569 56.648 1.00 28.88  ? 147 PHE A C     1 
ATOM   741   O  O     . PHE A 1 88  ? 32.175  16.611 55.900 1.00 21.26  ? 147 PHE A O     1 
ATOM   742   C  CB    . PHE A 1 88  ? 33.158  16.795 58.724 1.00 21.26  ? 147 PHE A CB    1 
ATOM   743   C  CG    . PHE A 1 88  ? 33.123  16.605 60.202 1.00 21.26  ? 147 PHE A CG    1 
ATOM   744   C  CD1   . PHE A 1 88  ? 32.460  15.524 60.756 1.00 21.26  ? 147 PHE A CD1   1 
ATOM   745   C  CD2   . PHE A 1 88  ? 33.723  17.531 61.042 1.00 21.26  ? 147 PHE A CD2   1 
ATOM   746   C  CE1   . PHE A 1 88  ? 32.387  15.364 62.131 1.00 21.26  ? 147 PHE A CE1   1 
ATOM   747   C  CE2   . PHE A 1 88  ? 33.659  17.385 62.422 1.00 21.26  ? 147 PHE A CE2   1 
ATOM   748   C  CZ    . PHE A 1 88  ? 32.988  16.297 62.969 1.00 21.26  ? 147 PHE A CZ    1 
ATOM   749   H  H     . PHE A 1 88  ? 30.865  15.498 58.382 1.00 0.00   ? 147 PHE A H     1 
ATOM   750   N  N     . LEU A 1 89  ? 32.180  18.830 56.235 1.00 33.35  ? 148 LEU A N     1 
ATOM   751   C  CA    . LEU A 1 89  ? 32.374  19.182 54.838 1.00 33.35  ? 148 LEU A CA    1 
ATOM   752   C  C     . LEU A 1 89  ? 33.761  19.693 54.514 1.00 33.35  ? 148 LEU A C     1 
ATOM   753   O  O     . LEU A 1 89  ? 34.088  19.850 53.345 1.00 21.49  ? 148 LEU A O     1 
ATOM   754   C  CB    . LEU A 1 89  ? 31.386  20.260 54.401 1.00 21.49  ? 148 LEU A CB    1 
ATOM   755   C  CG    . LEU A 1 89  ? 29.910  20.084 54.715 1.00 21.49  ? 148 LEU A CG    1 
ATOM   756   C  CD1   . LEU A 1 89  ? 29.134  21.184 54.040 1.00 21.49  ? 148 LEU A CD1   1 
ATOM   757   C  CD2   . LEU A 1 89  ? 29.425  18.770 54.243 1.00 21.49  ? 148 LEU A CD2   1 
ATOM   758   H  H     . LEU A 1 89  ? 32.113  19.543 56.907 1.00 0.00   ? 148 LEU A H     1 
ATOM   759   N  N     . ASP A 1 90  ? 34.567  19.980 55.523 1.00 12.39  ? 149 ASP A N     1 
ATOM   760   C  CA    . ASP A 1 90  ? 35.907  20.507 55.288 1.00 12.39  ? 149 ASP A CA    1 
ATOM   761   C  C     . ASP A 1 90  ? 36.969  19.641 55.970 1.00 12.39  ? 149 ASP A C     1 
ATOM   762   O  O     . ASP A 1 90  ? 37.748  20.114 56.802 1.00 29.08  ? 149 ASP A O     1 
ATOM   763   C  CB    . ASP A 1 90  ? 35.981  21.938 55.812 1.00 29.08  ? 149 ASP A CB    1 
ATOM   764   C  CG    . ASP A 1 90  ? 36.949  22.793 55.048 1.00 29.08  ? 149 ASP A CG    1 
ATOM   765   O  OD1   . ASP A 1 90  ? 38.008  22.277 54.631 1.00 29.08  ? 149 ASP A OD1   1 
ATOM   766   O  OD2   . ASP A 1 90  ? 36.650  23.998 54.880 1.00 29.08  ? 149 ASP A OD2   1 
ATOM   767   H  H     . ASP A 1 90  ? 34.286  19.852 56.453 1.00 0.00   ? 149 ASP A H     1 
ATOM   768   N  N     . VAL A 1 91  ? 36.977  18.362 55.616 1.00 25.82  ? 150 VAL A N     1 
ATOM   769   C  CA    . VAL A 1 91  ? 37.932  17.410 56.174 1.00 25.82  ? 150 VAL A CA    1 
ATOM   770   C  C     . VAL A 1 91  ? 38.720  16.664 55.084 1.00 25.82  ? 150 VAL A C     1 
ATOM   771   O  O     . VAL A 1 91  ? 38.656  17.007 53.894 1.00 27.80  ? 150 VAL A O     1 
ATOM   772   C  CB    . VAL A 1 91  ? 37.223  16.348 57.064 1.00 27.80  ? 150 VAL A CB    1 
ATOM   773   C  CG1   . VAL A 1 91  ? 36.701  16.990 58.328 1.00 27.80  ? 150 VAL A CG1   1 
ATOM   774   C  CG2   . VAL A 1 91  ? 36.104  15.660 56.296 1.00 27.80  ? 150 VAL A CG2   1 
ATOM   775   H  H     . VAL A 1 91  ? 36.352  18.064 54.923 1.00 0.00   ? 150 VAL A H     1 
ATOM   776   N  N     . SER A 1 92  ? 39.498  15.673 55.522 1.00 18.28  ? 151 SER A N     1 
ATOM   777   C  CA    . SER A 1 92  ? 40.269  14.836 54.636 1.00 18.28  ? 151 SER A CA    1 
ATOM   778   C  C     . SER A 1 92  ? 39.361  13.658 54.367 1.00 18.28  ? 151 SER A C     1 
ATOM   779   O  O     . SER A 1 92  ? 38.821  13.052 55.308 1.00 38.31  ? 151 SER A O     1 
ATOM   780   C  CB    . SER A 1 92  ? 41.517  14.340 55.339 1.00 38.31  ? 151 SER A CB    1 
ATOM   781   O  OG    . SER A 1 92  ? 42.130  13.312 54.585 1.00 38.31  ? 151 SER A OG    1 
ATOM   782   H  H     . SER A 1 92  ? 39.558  15.487 56.482 1.00 0.00   ? 151 SER A H     1 
ATOM   783   H  HG    . SER A 1 92  ? 42.882  12.945 55.078 1.00 30.00  ? 151 SER A HG    1 
ATOM   784   N  N     . ASP A 1 93  ? 39.207  13.293 53.100 1.00 43.27  ? 152 ASP A N     1 
ATOM   785   C  CA    . ASP A 1 93  ? 38.351  12.158 52.758 1.00 43.27  ? 152 ASP A CA    1 
ATOM   786   C  C     . ASP A 1 93  ? 38.743  10.859 53.480 1.00 43.27  ? 152 ASP A C     1 
ATOM   787   O  O     . ASP A 1 93  ? 38.048  9.850  53.389 1.00 41.71  ? 152 ASP A O     1 
ATOM   788   C  CB    . ASP A 1 93  ? 38.284  11.951 51.235 1.00 41.71  ? 152 ASP A CB    1 
ATOM   789   C  CG    . ASP A 1 93  ? 39.649  11.803 50.587 1.00 41.71  ? 152 ASP A CG    1 
ATOM   790   O  OD1   . ASP A 1 93  ? 40.511  12.687 50.768 1.00 41.71  ? 152 ASP A OD1   1 
ATOM   791   O  OD2   . ASP A 1 93  ? 39.843  10.809 49.861 1.00 41.71  ? 152 ASP A OD2   1 
ATOM   792   H  H     . ASP A 1 93  ? 39.651  13.826 52.415 1.00 0.00   ? 152 ASP A H     1 
ATOM   793   N  N     . GLN A 1 94  ? 39.857  10.890 54.200 1.00 37.51  ? 153 GLN A N     1 
ATOM   794   C  CA    . GLN A 1 94  ? 40.326  9.725  54.924 1.00 37.51  ? 153 GLN A CA    1 
ATOM   795   C  C     . GLN A 1 94  ? 40.091  9.863  56.418 1.00 37.51  ? 153 GLN A C     1 
ATOM   796   O  O     . GLN A 1 94  ? 40.738  9.170  57.209 1.00 72.53  ? 153 GLN A O     1 
ATOM   797   C  CB    . GLN A 1 94  ? 41.811  9.487  54.671 1.00 72.53  ? 153 GLN A CB    1 
ATOM   798   C  CG    . GLN A 1 94  ? 42.155  9.125  53.249 1.00 72.53  ? 153 GLN A CG    1 
ATOM   799   C  CD    . GLN A 1 94  ? 43.631  8.837  53.080 1.00 72.53  ? 153 GLN A CD    1 
ATOM   800   O  OE1   . GLN A 1 94  ? 44.488  9.545  53.614 1.00 72.53  ? 153 GLN A OE1   1 
ATOM   801   N  NE2   . GLN A 1 94  ? 43.939  7.786  52.340 1.00 72.53  ? 153 GLN A NE2   1 
ATOM   802   H  H     . GLN A 1 94  ? 40.419  11.684 54.259 1.00 0.00   ? 153 GLN A H     1 
ATOM   803   N  N     . THR A 1 95  ? 39.224  10.781 56.830 1.00 36.86  ? 154 THR A N     1 
ATOM   804   C  CA    . THR A 1 95  ? 38.980  10.885 58.254 1.00 36.86  ? 154 THR A CA    1 
ATOM   805   C  C     . THR A 1 95  ? 37.709  10.093 58.555 1.00 36.86  ? 154 THR A C     1 
ATOM   806   O  O     . THR A 1 95  ? 36.695  10.220 57.843 1.00 32.58  ? 154 THR A O     1 
ATOM   807   C  CB    . THR A 1 95  ? 38.971  12.352 58.735 1.00 32.58  ? 154 THR A CB    1 
ATOM   808   O  OG1   . THR A 1 95  ? 40.228  12.956 58.374 1.00 32.58  ? 154 THR A OG1   1 
ATOM   809   C  CG2   . THR A 1 95  ? 38.837  12.426 60.253 1.00 32.58  ? 154 THR A CG2   1 
ATOM   810   H  H     . THR A 1 95  ? 38.734  11.360 56.211 1.00 0.00   ? 154 THR A H     1 
ATOM   811   H  HG1   . THR A 1 95  ? 40.901  12.327 58.624 1.00 30.00  ? 154 THR A HG1   1 
ATOM   812   N  N     . PRO A 1 96  ? 37.788  9.174  59.544 1.00 33.01  ? 155 PRO A N     1 
ATOM   813   C  CA    . PRO A 1 96  ? 36.734  8.272  60.035 1.00 33.01  ? 155 PRO A CA    1 
ATOM   814   C  C     . PRO A 1 96  ? 35.576  8.980  60.710 1.00 33.01  ? 155 PRO A C     1 
ATOM   815   O  O     . PRO A 1 96  ? 35.317  8.789  61.901 1.00 33.42  ? 155 PRO A O     1 
ATOM   816   C  CB    . PRO A 1 96  ? 37.484  7.398  61.018 1.00 33.42  ? 155 PRO A CB    1 
ATOM   817   C  CG    . PRO A 1 96  ? 38.460  8.357  61.595 1.00 33.42  ? 155 PRO A CG    1 
ATOM   818   C  CD    . PRO A 1 96  ? 38.995  9.045  60.379 1.00 33.42  ? 155 PRO A CD    1 
ATOM   819   N  N     . ILE A 1 97  ? 34.885  9.797  59.925 1.00 4.23   ? 156 ILE A N     1 
ATOM   820   C  CA    . ILE A 1 97  ? 33.753  10.568 60.386 1.00 4.23   ? 156 ILE A CA    1 
ATOM   821   C  C     . ILE A 1 97  ? 32.868  10.660 59.155 1.00 4.23   ? 156 ILE A C     1 
ATOM   822   O  O     . ILE A 1 97  ? 33.358  10.462 58.034 1.00 19.28  ? 156 ILE A O     1 
ATOM   823   C  CB    . ILE A 1 97  ? 34.192  11.984 60.786 1.00 19.28  ? 156 ILE A CB    1 
ATOM   824   C  CG1   . ILE A 1 97  ? 35.026  12.585 59.657 1.00 19.28  ? 156 ILE A CG1   1 
ATOM   825   C  CG2   . ILE A 1 97  ? 34.966  11.961 62.094 1.00 19.28  ? 156 ILE A CG2   1 
ATOM   826   C  CD1   . ILE A 1 97  ? 35.458  13.997 59.894 1.00 19.28  ? 156 ILE A CD1   1 
ATOM   827   H  H     . ILE A 1 97  ? 35.098  9.878  58.966 1.00 0.00   ? 156 ILE A H     1 
ATOM   828   N  N     . ASN A 1 98  ? 31.590  10.975 59.333 1.00 32.82  ? 157 ASN A N     1 
ATOM   829   C  CA    . ASN A 1 98  ? 30.678  11.077 58.202 1.00 32.82  ? 157 ASN A CA    1 
ATOM   830   C  C     . ASN A 1 98  ? 30.917  12.411 57.496 1.00 32.82  ? 157 ASN A C     1 
ATOM   831   O  O     . ASN A 1 98  ? 30.712  13.471 58.076 1.00 44.83  ? 157 ASN A O     1 
ATOM   832   C  CB    . ASN A 1 98  ? 29.229  10.981 58.688 1.00 44.83  ? 157 ASN A CB    1 
ATOM   833   C  CG    . ASN A 1 98  ? 29.051  9.978  59.830 1.00 44.83  ? 157 ASN A CG    1 
ATOM   834   O  OD1   . ASN A 1 98  ? 29.536  10.185 60.942 1.00 44.83  ? 157 ASN A OD1   1 
ATOM   835   N  ND2   . ASN A 1 98  ? 28.332  8.907  59.564 1.00 44.83  ? 157 ASN A ND2   1 
ATOM   836   H  H     . ASN A 1 98  ? 31.245  11.149 60.234 1.00 0.00   ? 157 ASN A H     1 
ATOM   837   H  HD21  . ASN A 1 98  ? 28.236  8.271  60.303 1.00 0.00   ? 157 ASN A HD21  1 
ATOM   838   H  HD22  . ASN A 1 98  ? 27.952  8.816  58.671 1.00 0.00   ? 157 ASN A HD22  1 
ATOM   839   N  N     . SER A 1 99  ? 31.371  12.368 56.251 1.00 13.44  ? 158 SER A N     1 
ATOM   840   C  CA    . SER A 1 99  ? 31.639  13.598 55.515 1.00 13.44  ? 158 SER A CA    1 
ATOM   841   C  C     . SER A 1 99  ? 31.277  13.481 54.059 1.00 13.44  ? 158 SER A C     1 
ATOM   842   O  O     . SER A 1 99  ? 30.911  12.411 53.595 1.00 29.67  ? 158 SER A O     1 
ATOM   843   C  CB    . SER A 1 99  ? 33.114  13.965 55.622 1.00 29.67  ? 158 SER A CB    1 
ATOM   844   O  OG    . SER A 1 99  ? 33.943  12.934 55.101 1.00 29.67  ? 158 SER A OG    1 
ATOM   845   H  H     . SER A 1 99  ? 31.531  11.497 55.824 1.00 0.00   ? 158 SER A H     1 
ATOM   846   H  HG    . SER A 1 99  ? 33.961  12.191 55.719 1.00 30.00  ? 158 SER A HG    1 
ATOM   847   N  N     . ILE A 1 100 ? 31.363  14.611 53.354 1.00 15.30  ? 159 ILE A N     1 
ATOM   848   C  CA    . ILE A 1 100 ? 31.074  14.712 51.916 1.00 15.30  ? 159 ILE A CA    1 
ATOM   849   C  C     . ILE A 1 100 ? 32.020  15.787 51.403 1.00 15.30  ? 159 ILE A C     1 
ATOM   850   O  O     . ILE A 1 100 ? 31.725  16.979 51.486 1.00 24.12  ? 159 ILE A O     1 
ATOM   851   C  CB    . ILE A 1 100 ? 29.656  15.225 51.640 1.00 24.12  ? 159 ILE A CB    1 
ATOM   852   C  CG1   . ILE A 1 100 ? 28.626  14.441 52.448 1.00 24.12  ? 159 ILE A CG1   1 
ATOM   853   C  CG2   . ILE A 1 100 ? 29.379  15.187 50.150 1.00 24.12  ? 159 ILE A CG2   1 
ATOM   854   C  CD1   . ILE A 1 100 ? 27.240  14.665 51.979 1.00 24.12  ? 159 ILE A CD1   1 
ATOM   855   H  H     . ILE A 1 100 ? 31.628  15.447 53.804 1.00 0.00   ? 159 ILE A H     1 
ATOM   856   N  N     . ILE A 1 101 ? 33.195  15.387 50.940 1.00 25.82  ? 160 ILE A N     1 
ATOM   857   C  CA    . ILE A 1 101 ? 34.140  16.359 50.443 1.00 25.82  ? 160 ILE A CA    1 
ATOM   858   C  C     . ILE A 1 101 ? 34.279  16.148 48.953 1.00 25.82  ? 160 ILE A C     1 
ATOM   859   O  O     . ILE A 1 101 ? 33.993  15.065 48.470 1.00 37.69  ? 160 ILE A O     1 
ATOM   860   C  CB    . ILE A 1 101 ? 35.515  16.235 51.154 1.00 37.69  ? 160 ILE A CB    1 
ATOM   861   C  CG1   . ILE A 1 101 ? 36.201  14.909 50.814 1.00 37.69  ? 160 ILE A CG1   1 
ATOM   862   C  CG2   . ILE A 1 101 ? 35.344  16.388 52.657 1.00 37.69  ? 160 ILE A CG2   1 
ATOM   863   C  CD1   . ILE A 1 101 ? 37.508  15.064 50.043 1.00 37.69  ? 160 ILE A CD1   1 
ATOM   864   H  H     . ILE A 1 101 ? 33.407  14.433 50.893 1.00 0.00   ? 160 ILE A H     1 
ATOM   865   N  N     . PHE A 1 102 ? 34.615  17.211 48.216 1.00 34.34  ? 161 PHE A N     1 
ATOM   866   C  CA    . PHE A 1 102 ? 34.796  17.124 46.766 1.00 34.34  ? 161 PHE A CA    1 
ATOM   867   C  C     . PHE A 1 102 ? 36.125  16.420 46.549 1.00 34.34  ? 161 PHE A C     1 
ATOM   868   O  O     . PHE A 1 102 ? 36.911  16.253 47.500 1.00 19.84  ? 161 PHE A O     1 
ATOM   869   C  CB    . PHE A 1 102 ? 34.874  18.510 46.122 1.00 19.84  ? 161 PHE A CB    1 
ATOM   870   C  CG    . PHE A 1 102 ? 33.556  19.227 46.031 1.00 19.84  ? 161 PHE A CG    1 
ATOM   871   C  CD1   . PHE A 1 102 ? 32.694  18.971 44.990 1.00 19.84  ? 161 PHE A CD1   1 
ATOM   872   C  CD2   . PHE A 1 102 ? 33.201  20.182 46.978 1.00 19.84  ? 161 PHE A CD2   1 
ATOM   873   C  CE1   . PHE A 1 102 ? 31.503  19.651 44.891 1.00 19.84  ? 161 PHE A CE1   1 
ATOM   874   C  CE2   . PHE A 1 102 ? 32.014  20.865 46.887 1.00 19.84  ? 161 PHE A CE2   1 
ATOM   875   C  CZ    . PHE A 1 102 ? 31.158  20.599 45.840 1.00 19.84  ? 161 PHE A CZ    1 
ATOM   876   H  H     . PHE A 1 102 ? 34.777  18.054 48.684 1.00 0.00   ? 161 PHE A H     1 
ATOM   877   N  N     . SER A 1 103 ? 36.393  16.019 45.313 1.00 19.15  ? 162 SER A N     1 
ATOM   878   C  CA    . SER A 1 103 ? 37.637  15.345 45.018 1.00 19.15  ? 162 SER A CA    1 
ATOM   879   C  C     . SER A 1 103 ? 38.787  16.271 44.667 1.00 19.15  ? 162 SER A C     1 
ATOM   880   O  O     . SER A 1 103 ? 38.859  16.836 43.585 1.00 51.57  ? 162 SER A O     1 
ATOM   881   C  CB    . SER A 1 103 ? 37.456  14.317 43.908 1.00 51.57  ? 162 SER A CB    1 
ATOM   882   O  OG    . SER A 1 103 ? 38.694  13.668 43.634 1.00 51.57  ? 162 SER A OG    1 
ATOM   883   H  H     . SER A 1 103 ? 35.732  16.157 44.601 1.00 0.00   ? 162 SER A H     1 
ATOM   884   H  HG    . SER A 1 103 ? 38.479  13.012 42.958 1.00 30.00  ? 162 SER A HG    1 
ATOM   885   N  N     . HIS A 1 104 ? 39.724  16.365 45.586 1.00 17.55  ? 163 HIS A N     1 
ATOM   886   C  CA    . HIS A 1 104 ? 40.909  17.175 45.379 1.00 17.55  ? 163 HIS A CA    1 
ATOM   887   C  C     . HIS A 1 104 ? 41.887  16.531 44.394 1.00 17.55  ? 163 HIS A C     1 
ATOM   888   O  O     . HIS A 1 104 ? 42.722  17.219 43.799 1.00 34.27  ? 163 HIS A O     1 
ATOM   889   C  CB    . HIS A 1 104 ? 41.623  17.356 46.683 1.00 34.27  ? 163 HIS A CB    1 
ATOM   890   C  CG    . HIS A 1 104 ? 41.830  16.077 47.412 1.00 34.27  ? 163 HIS A CG    1 
ATOM   891   N  ND1   . HIS A 1 104 ? 43.081  15.543 47.639 1.00 34.27  ? 163 HIS A ND1   1 
ATOM   892   C  CD2   . HIS A 1 104 ? 40.947  15.262 48.038 1.00 34.27  ? 163 HIS A CD2   1 
ATOM   893   C  CE1   . HIS A 1 104 ? 42.958  14.463 48.388 1.00 34.27  ? 163 HIS A CE1   1 
ATOM   894   N  NE2   . HIS A 1 104 ? 41.673  14.271 48.644 1.00 34.27  ? 163 HIS A NE2   1 
ATOM   895   H  H     . HIS A 1 104 ? 39.500  15.891 46.406 1.00 0.00   ? 163 HIS A H     1 
ATOM   896   H  HD1   . HIS A 1 104 ? 43.957  15.877 47.320 1.00 0.00   ? 163 HIS A HD1   1 
ATOM   897   H  HE2   . HIS A 1 104 ? 41.312  13.516 49.148 1.00 0.00   ? 163 HIS A HE2   1 
ATOM   898   N  N     . GLU A 1 105 ? 41.843  15.206 44.284 1.00 45.43  ? 164 GLU A N     1 
ATOM   899   C  CA    . GLU A 1 105 ? 42.741  14.517 43.363 1.00 45.43  ? 164 GLU A CA    1 
ATOM   900   C  C     . GLU A 1 105 ? 42.394  14.995 41.959 1.00 45.43  ? 164 GLU A C     1 
ATOM   901   O  O     . GLU A 1 105 ? 43.276  15.291 41.165 1.00 40.06  ? 164 GLU A O     1 
ATOM   902   C  CB    . GLU A 1 105 ? 42.576  12.990 43.462 1.00 40.06  ? 164 GLU A CB    1 
ATOM   903   C  CG    . GLU A 1 105 ? 43.041  12.358 44.780 1.00 40.06  ? 164 GLU A CG    1 
ATOM   904   C  CD    . GLU A 1 105 ? 44.573  12.277 44.967 1.00 40.06  ? 164 GLU A CD    1 
ATOM   905   O  OE1   . GLU A 1 105 ? 45.348  12.798 44.128 1.00 40.06  ? 164 GLU A OE1   1 
ATOM   906   O  OE2   . GLU A 1 105 ? 45.013  11.686 45.984 1.00 40.06  ? 164 GLU A OE2   1 
ATOM   907   H  H     . GLU A 1 105 ? 41.154  14.691 44.753 1.00 0.00   ? 164 GLU A H     1 
ATOM   908   N  N     . ASP A 1 106 ? 41.099  15.126 41.688 1.00 19.27  ? 165 ASP A N     1 
ATOM   909   C  CA    . ASP A 1 106 ? 40.639  15.575 40.388 1.00 19.27  ? 165 ASP A CA    1 
ATOM   910   C  C     . ASP A 1 106 ? 40.950  17.034 40.116 1.00 19.27  ? 165 ASP A C     1 
ATOM   911   O  O     . ASP A 1 106 ? 41.476  17.375 39.061 1.00 34.39  ? 165 ASP A O     1 
ATOM   912   C  CB    . ASP A 1 106 ? 39.153  15.296 40.235 1.00 34.39  ? 165 ASP A CB    1 
ATOM   913   C  CG    . ASP A 1 106 ? 38.854  13.805 40.114 1.00 34.39  ? 165 ASP A CG    1 
ATOM   914   O  OD1   . ASP A 1 106 ? 39.813  13.024 39.920 1.00 34.39  ? 165 ASP A OD1   1 
ATOM   915   O  OD2   . ASP A 1 106 ? 37.663  13.411 40.210 1.00 34.39  ? 165 ASP A OD2   1 
ATOM   916   H  H     . ASP A 1 106 ? 40.438  14.910 42.378 1.00 0.00   ? 165 ASP A H     1 
ATOM   917   N  N     . GLY A 1 107 ? 40.668  17.886 41.087 1.00 14.55  ? 166 GLY A N     1 
ATOM   918   C  CA    . GLY A 1 107 ? 40.945  19.294 40.926 1.00 14.55  ? 166 GLY A CA    1 
ATOM   919   C  C     . GLY A 1 107 ? 42.399  19.570 40.611 1.00 14.55  ? 166 GLY A C     1 
ATOM   920   O  O     . GLY A 1 107 ? 42.711  20.229 39.626 1.00 35.03  ? 166 GLY A O     1 
ATOM   921   H  H     . GLY A 1 107 ? 40.251  17.564 41.913 1.00 0.00   ? 166 GLY A H     1 
ATOM   922   N  N     . THR A 1 108 ? 43.305  19.067 41.431 1.00 37.49  ? 167 THR A N     1 
ATOM   923   C  CA    . THR A 1 108 ? 44.733  19.293 41.207 1.00 37.49  ? 167 THR A CA    1 
ATOM   924   C  C     . THR A 1 108 ? 45.279  18.666 39.898 1.00 37.49  ? 167 THR A C     1 
ATOM   925   O  O     . THR A 1 108 ? 46.070  19.299 39.189 1.00 36.96  ? 167 THR A O     1 
ATOM   926   C  CB    . THR A 1 108 ? 45.526  18.819 42.405 1.00 36.96  ? 167 THR A CB    1 
ATOM   927   O  OG1   . THR A 1 108 ? 45.147  17.476 42.720 1.00 36.96  ? 167 THR A OG1   1 
ATOM   928   C  CG2   . THR A 1 108 ? 45.207  19.688 43.593 1.00 36.96  ? 167 THR A CG2   1 
ATOM   929   H  H     . THR A 1 108 ? 43.020  18.513 42.186 1.00 0.00   ? 167 THR A H     1 
ATOM   930   H  HG1   . THR A 1 108 ? 44.380  17.507 43.282 1.00 30.00  ? 167 THR A HG1   1 
ATOM   931   N  N     . ARG A 1 109 ? 44.846  17.439 39.585 1.00 26.58  ? 168 ARG A N     1 
ATOM   932   C  CA    . ARG A 1 109 ? 45.244  16.740 38.362 1.00 26.58  ? 168 ARG A CA    1 
ATOM   933   C  C     . ARG A 1 109 ? 44.759  17.594 37.196 1.00 26.58  ? 168 ARG A C     1 
ATOM   934   O  O     . ARG A 1 109 ? 45.547  18.043 36.372 1.00 35.72  ? 168 ARG A O     1 
ATOM   935   C  CB    . ARG A 1 109 ? 44.563  15.368 38.324 1.00 35.72  ? 168 ARG A CB    1 
ATOM   936   C  CG    . ARG A 1 109 ? 45.011  14.421 37.229 1.00 35.72  ? 168 ARG A CG    1 
ATOM   937   C  CD    . ARG A 1 109 ? 43.960  14.266 36.143 1.00 35.72  ? 168 ARG A CD    1 
ATOM   938   N  NE    . ARG A 1 109 ? 42.733  13.570 36.546 1.00 35.72  ? 168 ARG A NE    1 
ATOM   939   C  CZ    . ARG A 1 109 ? 41.552  13.753 35.945 1.00 35.72  ? 168 ARG A CZ    1 
ATOM   940   N  NH1   . ARG A 1 109 ? 41.448  14.614 34.944 1.00 35.72  ? 168 ARG A NH1   1 
ATOM   941   N  NH2   . ARG A 1 109 ? 40.486  13.026 36.274 1.00 35.72  ? 168 ARG A NH2   1 
ATOM   942   H  H     . ARG A 1 109 ? 44.256  16.971 40.218 1.00 0.00   ? 168 ARG A H     1 
ATOM   943   H  HE    . ARG A 1 109 ? 42.768  12.947 37.301 1.00 0.00   ? 168 ARG A HE    1 
ATOM   944   H  HH11  . ARG A 1 109 ? 42.247  15.125 34.629 1.00 0.00   ? 168 ARG A HH11  1 
ATOM   945   H  HH12  . ARG A 1 109 ? 40.562  14.751 34.500 1.00 0.00   ? 168 ARG A HH12  1 
ATOM   946   H  HH21  . ARG A 1 109 ? 40.553  12.325 36.983 1.00 0.00   ? 168 ARG A HH21  1 
ATOM   947   H  HH22  . ARG A 1 109 ? 39.614  13.189 35.812 1.00 0.00   ? 168 ARG A HH22  1 
ATOM   948   N  N     . LEU A 1 110 ? 43.457  17.850 37.167 1.00 21.03  ? 169 LEU A N     1 
ATOM   949   C  CA    . LEU A 1 110 ? 42.841  18.664 36.125 1.00 21.03  ? 169 LEU A CA    1 
ATOM   950   C  C     . LEU A 1 110 ? 43.567  19.990 35.949 1.00 21.03  ? 169 LEU A C     1 
ATOM   951   O  O     . LEU A 1 110 ? 43.733  20.482 34.828 1.00 36.95  ? 169 LEU A O     1 
ATOM   952   C  CB    . LEU A 1 110 ? 41.393  18.970 36.494 1.00 36.95  ? 169 LEU A CB    1 
ATOM   953   C  CG    . LEU A 1 110 ? 40.292  17.956 36.211 1.00 36.95  ? 169 LEU A CG    1 
ATOM   954   C  CD1   . LEU A 1 110 ? 39.106  18.142 37.119 1.00 36.95  ? 169 LEU A CD1   1 
ATOM   955   C  CD2   . LEU A 1 110 ? 39.879  18.114 34.784 1.00 36.95  ? 169 LEU A CD2   1 
ATOM   956   H  H     . LEU A 1 110 ? 42.895  17.484 37.876 1.00 0.00   ? 169 LEU A H     1 
ATOM   957   N  N     . GLY A 1 111 ? 44.006  20.568 37.057 1.00 24.72  ? 170 GLY A N     1 
ATOM   958   C  CA    . GLY A 1 111 ? 44.670  21.857 37.002 1.00 24.72  ? 170 GLY A CA    1 
ATOM   959   C  C     . GLY A 1 111 ? 46.021  21.875 36.341 1.00 24.72  ? 170 GLY A C     1 
ATOM   960   O  O     . GLY A 1 111 ? 46.243  22.637 35.403 1.00 37.80  ? 170 GLY A O     1 
ATOM   961   H  H     . GLY A 1 111 ? 43.862  20.134 37.922 1.00 0.00   ? 170 GLY A H     1 
ATOM   962   N  N     . VAL A 1 112 ? 46.922  21.037 36.843 1.00 48.07  ? 171 VAL A N     1 
ATOM   963   C  CA    . VAL A 1 112 ? 48.280  20.942 36.325 1.00 48.07  ? 171 VAL A CA    1 
ATOM   964   C  C     . VAL A 1 112 ? 48.314  20.423 34.905 1.00 48.07  ? 171 VAL A C     1 
ATOM   965   O  O     . VAL A 1 112 ? 49.188  20.798 34.145 1.00 38.84  ? 171 VAL A O     1 
ATOM   966   C  CB    . VAL A 1 112 ? 49.170  20.005 37.167 1.00 38.84  ? 171 VAL A CB    1 
ATOM   967   C  CG1   . VAL A 1 112 ? 50.627  20.161 36.734 1.00 38.84  ? 171 VAL A CG1   1 
ATOM   968   C  CG2   . VAL A 1 112 ? 49.013  20.290 38.658 1.00 38.84  ? 171 VAL A CG2   1 
ATOM   969   H  H     . VAL A 1 112 ? 46.639  20.449 37.580 1.00 0.00   ? 171 VAL A H     1 
ATOM   970   N  N     . GLU A 1 113 ? 47.393  19.534 34.553 1.00 54.20  ? 172 GLU A N     1 
ATOM   971   C  CA    . GLU A 1 113 ? 47.364  18.979 33.201 1.00 54.20  ? 172 GLU A CA    1 
ATOM   972   C  C     . GLU A 1 113 ? 47.015  20.052 32.188 1.00 54.20  ? 172 GLU A C     1 
ATOM   973   O  O     . GLU A 1 113 ? 47.621  20.140 31.112 1.00 49.45  ? 172 GLU A O     1 
ATOM   974   C  CB    . GLU A 1 113 ? 46.381  17.798 33.099 1.00 49.45  ? 172 GLU A CB    1 
ATOM   975   C  CG    . GLU A 1 113 ? 46.805  16.598 33.943 1.00 49.45  ? 172 GLU A CG    1 
ATOM   976   C  CD    . GLU A 1 113 ? 46.347  15.250 33.391 1.00 49.45  ? 172 GLU A CD    1 
ATOM   977   O  OE1   . GLU A 1 113 ? 45.220  15.164 32.839 1.00 49.45  ? 172 GLU A OE1   1 
ATOM   978   O  OE2   . GLU A 1 113 ? 47.126  14.273 33.531 1.00 49.45  ? 172 GLU A OE2   1 
ATOM   979   H  H     . GLU A 1 113 ? 46.737  19.226 35.218 1.00 0.00   ? 172 GLU A H     1 
ATOM   980   N  N     . HIS A 1 114 ? 46.073  20.904 32.569 1.00 33.64  ? 173 HIS A N     1 
ATOM   981   C  CA    . HIS A 1 114 ? 45.617  21.987 31.715 1.00 33.64  ? 173 HIS A CA    1 
ATOM   982   C  C     . HIS A 1 114 ? 46.765  22.958 31.424 1.00 33.64  ? 173 HIS A C     1 
ATOM   983   O  O     . HIS A 1 114 ? 46.963  23.358 30.277 1.00 28.98  ? 173 HIS A O     1 
ATOM   984   C  CB    . HIS A 1 114 ? 44.449  22.694 32.396 1.00 28.98  ? 173 HIS A CB    1 
ATOM   985   C  CG    . HIS A 1 114 ? 43.904  23.852 31.632 1.00 28.98  ? 173 HIS A CG    1 
ATOM   986   N  ND1   . HIS A 1 114 ? 44.141  25.157 32.000 1.00 28.98  ? 173 HIS A ND1   1 
ATOM   987   C  CD2   . HIS A 1 114 ? 43.093  23.906 30.552 1.00 28.98  ? 173 HIS A CD2   1 
ATOM   988   C  CE1   . HIS A 1 114 ? 43.500  25.967 31.178 1.00 28.98  ? 173 HIS A CE1   1 
ATOM   989   N  NE2   . HIS A 1 114 ? 42.855  25.233 30.290 1.00 28.98  ? 173 HIS A NE2   1 
ATOM   990   H  H     . HIS A 1 114 ? 45.661  20.792 33.454 1.00 0.00   ? 173 HIS A H     1 
ATOM   991   H  HD1   . HIS A 1 114 ? 44.688  25.462 32.758 1.00 0.00   ? 173 HIS A HD1   1 
ATOM   992   H  HE2   . HIS A 1 114 ? 42.301  25.584 29.557 1.00 0.00   ? 173 HIS A HE2   1 
ATOM   993   N  N     . LEU A 1 115 ? 47.553  23.299 32.440 1.00 21.60  ? 174 LEU A N     1 
ATOM   994   C  CA    . LEU A 1 115 ? 48.667  24.218 32.252 1.00 21.60  ? 174 LEU A CA    1 
ATOM   995   C  C     . LEU A 1 115 ? 49.842  23.629 31.473 1.00 21.60  ? 174 LEU A C     1 
ATOM   996   O  O     . LEU A 1 115 ? 50.643  24.372 30.911 1.00 22.52  ? 174 LEU A O     1 
ATOM   997   C  CB    . LEU A 1 115 ? 49.163  24.742 33.598 1.00 22.52  ? 174 LEU A CB    1 
ATOM   998   C  CG    . LEU A 1 115 ? 48.293  25.698 34.402 1.00 22.52  ? 174 LEU A CG    1 
ATOM   999   C  CD1   . LEU A 1 115 ? 49.104  26.100 35.578 1.00 22.52  ? 174 LEU A CD1   1 
ATOM   1000  C  CD2   . LEU A 1 115 ? 47.881  26.936 33.607 1.00 22.52  ? 174 LEU A CD2   1 
ATOM   1001  H  H     . LEU A 1 115 ? 47.388  22.919 33.331 1.00 0.00   ? 174 LEU A H     1 
ATOM   1002  N  N     . VAL A 1 116 ? 50.008  22.312 31.504 1.00 30.64  ? 175 VAL A N     1 
ATOM   1003  C  CA    . VAL A 1 116 ? 51.100  21.699 30.762 1.00 30.64  ? 175 VAL A CA    1 
ATOM   1004  C  C     . VAL A 1 116 ? 50.660  21.491 29.322 1.00 30.64  ? 175 VAL A C     1 
ATOM   1005  O  O     . VAL A 1 116 ? 51.440  21.721 28.412 1.00 62.01  ? 175 VAL A O     1 
ATOM   1006  C  CB    . VAL A 1 116 ? 51.597  20.365 31.380 1.00 62.01  ? 175 VAL A CB    1 
ATOM   1007  C  CG1   . VAL A 1 116 ? 51.845  20.541 32.861 1.00 62.01  ? 175 VAL A CG1   1 
ATOM   1008  C  CG2   . VAL A 1 116 ? 50.623  19.226 31.105 1.00 62.01  ? 175 VAL A CG2   1 
ATOM   1009  H  H     . VAL A 1 116 ? 49.424  21.753 32.060 1.00 0.00   ? 175 VAL A H     1 
ATOM   1010  N  N     . ALA A 1 117 ? 49.406  21.095 29.106 1.00 16.03  ? 176 ALA A N     1 
ATOM   1011  C  CA    . ALA A 1 117 ? 48.898  20.912 27.743 1.00 16.03  ? 176 ALA A CA    1 
ATOM   1012  C  C     . ALA A 1 117 ? 49.107  22.207 26.956 1.00 16.03  ? 176 ALA A C     1 
ATOM   1013  O  O     . ALA A 1 117 ? 49.405  22.181 25.765 1.00 42.99  ? 176 ALA A O     1 
ATOM   1014  C  CB    . ALA A 1 117 ? 47.439  20.545 27.766 1.00 42.99  ? 176 ALA A CB    1 
ATOM   1015  H  H     . ALA A 1 117 ? 48.822  20.919 29.868 1.00 0.00   ? 176 ALA A H     1 
ATOM   1016  N  N     . LEU A 1 118 ? 48.925  23.334 27.641 1.00 41.75  ? 177 LEU A N     1 
ATOM   1017  C  CA    . LEU A 1 118 ? 49.100  24.666 27.069 1.00 41.75  ? 177 LEU A CA    1 
ATOM   1018  C  C     . LEU A 1 118 ? 50.572  24.950 26.861 1.00 41.75  ? 177 LEU A C     1 
ATOM   1019  O  O     . LEU A 1 118 ? 50.940  25.944 26.248 1.00 52.71  ? 177 LEU A O     1 
ATOM   1020  C  CB    . LEU A 1 118 ? 48.547  25.721 28.007 1.00 52.71  ? 177 LEU A CB    1 
ATOM   1021  C  CG    . LEU A 1 118 ? 47.077  25.635 28.359 1.00 52.71  ? 177 LEU A CG    1 
ATOM   1022  C  CD1   . LEU A 1 118 ? 46.767  26.761 29.324 1.00 52.71  ? 177 LEU A CD1   1 
ATOM   1023  C  CD2   . LEU A 1 118 ? 46.237  25.716 27.094 1.00 52.71  ? 177 LEU A CD2   1 
ATOM   1024  H  H     . LEU A 1 118 ? 48.611  23.255 28.564 1.00 0.00   ? 177 LEU A H     1 
ATOM   1025  N  N     . GLY A 1 119 ? 51.401  24.155 27.513 1.00 26.99  ? 178 GLY A N     1 
ATOM   1026  C  CA    . GLY A 1 119 ? 52.832  24.283 27.350 1.00 26.99  ? 178 GLY A CA    1 
ATOM   1027  C  C     . GLY A 1 119 ? 53.580  25.049 28.403 1.00 26.99  ? 178 GLY A C     1 
ATOM   1028  O  O     . GLY A 1 119 ? 54.773  25.323 28.239 1.00 54.09  ? 178 GLY A O     1 
ATOM   1029  H  H     . GLY A 1 119 ? 51.048  23.477 28.101 1.00 0.00   ? 178 GLY A H     1 
ATOM   1030  N  N     . HIS A 1 120 ? 52.926  25.350 29.515 1.00 28.41  ? 179 HIS A N     1 
ATOM   1031  C  CA    . HIS A 1 120 ? 53.597  26.120 30.546 1.00 28.41  ? 179 HIS A CA    1 
ATOM   1032  C  C     . HIS A 1 120 ? 54.692  25.339 31.206 1.00 28.41  ? 179 HIS A C     1 
ATOM   1033  O  O     . HIS A 1 120 ? 54.605  24.126 31.343 1.00 21.26  ? 179 HIS A O     1 
ATOM   1034  C  CB    . HIS A 1 120 ? 52.590  26.659 31.554 1.00 21.26  ? 179 HIS A CB    1 
ATOM   1035  C  CG    . HIS A 1 120 ? 51.620  27.623 30.950 1.00 21.26  ? 179 HIS A CG    1 
ATOM   1036  N  ND1   . HIS A 1 120 ? 51.922  28.953 30.751 1.00 21.26  ? 179 HIS A ND1   1 
ATOM   1037  C  CD2   . HIS A 1 120 ? 50.372  27.438 30.460 1.00 21.26  ? 179 HIS A CD2   1 
ATOM   1038  C  CE1   . HIS A 1 120 ? 50.900  29.546 30.163 1.00 21.26  ? 179 HIS A CE1   1 
ATOM   1039  N  NE2   . HIS A 1 120 ? 49.949  28.648 29.977 1.00 21.26  ? 179 HIS A NE2   1 
ATOM   1040  H  H     . HIS A 1 120 ? 52.031  24.990 29.659 1.00 0.00   ? 179 HIS A H     1 
ATOM   1041  H  HD1   . HIS A 1 120 ? 52.758  29.415 31.005 1.00 0.00   ? 179 HIS A HD1   1 
ATOM   1042  H  HE2   . HIS A 1 120 ? 49.084  28.861 29.560 1.00 0.00   ? 179 HIS A HE2   1 
ATOM   1043  N  N     . GLN A 1 121 ? 55.744  26.054 31.574 1.00 39.83  ? 180 GLN A N     1 
ATOM   1044  C  CA    . GLN A 1 121 ? 56.909  25.461 32.211 1.00 39.83  ? 180 GLN A CA    1 
ATOM   1045  C  C     . GLN A 1 121 ? 57.053  26.130 33.567 1.00 39.83  ? 180 GLN A C     1 
ATOM   1046  O  O     . GLN A 1 121 ? 57.243  25.469 34.588 1.00 117.72 ? 180 GLN A O     1 
ATOM   1047  C  CB    . GLN A 1 121 ? 58.174  25.734 31.376 1.00 117.72 ? 180 GLN A CB    1 
ATOM   1048  C  CG    . GLN A 1 121 ? 57.952  25.964 29.860 1.00 117.72 ? 180 GLN A CG    1 
ATOM   1049  C  CD    . GLN A 1 121 ? 57.454  27.381 29.503 1.00 117.72 ? 180 GLN A CD    1 
ATOM   1050  O  OE1   . GLN A 1 121 ? 56.748  28.033 30.284 1.00 117.72 ? 180 GLN A OE1   1 
ATOM   1051  N  NE2   . GLN A 1 121 ? 57.819  27.849 28.312 1.00 117.72 ? 180 GLN A NE2   1 
ATOM   1052  H  H     . GLN A 1 121 ? 55.722  27.013 31.407 1.00 0.00   ? 180 GLN A H     1 
ATOM   1053  N  N     . GLN A 1 122 ? 56.937  27.454 33.566 1.00 63.49  ? 181 GLN A N     1 
ATOM   1054  C  CA    . GLN A 1 122 ? 57.056  28.241 34.786 1.00 63.49  ? 181 GLN A CA    1 
ATOM   1055  C  C     . GLN A 1 122 ? 55.728  28.405 35.523 1.00 63.49  ? 181 GLN A C     1 
ATOM   1056  O  O     . GLN A 1 122 ? 55.010  29.389 35.320 1.00 68.42  ? 181 GLN A O     1 
ATOM   1057  C  CB    . GLN A 1 122 ? 57.674  29.600 34.464 1.00 68.42  ? 181 GLN A CB    1 
ATOM   1058  C  CG    . GLN A 1 122 ? 59.150  29.530 34.095 1.00 68.42  ? 181 GLN A CG    1 
ATOM   1059  C  CD    . GLN A 1 122 ? 59.424  30.001 32.688 1.00 68.42  ? 181 GLN A CD    1 
ATOM   1060  O  OE1   . GLN A 1 122 ? 59.938  29.248 31.867 1.00 68.42  ? 181 GLN A OE1   1 
ATOM   1061  N  NE2   . GLN A 1 122 ? 59.095  31.253 32.404 1.00 68.42  ? 181 GLN A NE2   1 
ATOM   1062  H  H     . GLN A 1 122 ? 56.803  27.888 32.698 1.00 0.00   ? 181 GLN A H     1 
ATOM   1063  N  N     . ILE A 1 123 ? 55.412  27.428 36.369 1.00 33.66  ? 182 ILE A N     1 
ATOM   1064  C  CA    . ILE A 1 123 ? 54.175  27.419 37.147 1.00 33.66  ? 182 ILE A CA    1 
ATOM   1065  C  C     . ILE A 1 123 ? 54.455  27.723 38.606 1.00 33.66  ? 182 ILE A C     1 
ATOM   1066  O  O     . ILE A 1 123 ? 55.268  27.053 39.247 1.00 39.37  ? 182 ILE A O     1 
ATOM   1067  C  CB    . ILE A 1 123 ? 53.448  26.037 37.079 1.00 39.37  ? 182 ILE A CB    1 
ATOM   1068  C  CG1   . ILE A 1 123 ? 52.853  25.796 35.689 1.00 39.37  ? 182 ILE A CG1   1 
ATOM   1069  C  CG2   . ILE A 1 123 ? 52.332  25.961 38.107 1.00 39.37  ? 182 ILE A CG2   1 
ATOM   1070  C  CD1   . ILE A 1 123 ? 52.204  24.442 35.542 1.00 39.37  ? 182 ILE A CD1   1 
ATOM   1071  H  H     . ILE A 1 123 ? 56.033  26.674 36.479 1.00 0.00   ? 182 ILE A H     1 
ATOM   1072  N  N     . ALA A 1 124 ? 53.808  28.760 39.115 1.00 29.41  ? 183 ALA A N     1 
ATOM   1073  C  CA    . ALA A 1 124 ? 53.960  29.123 40.507 1.00 29.41  ? 183 ALA A CA    1 
ATOM   1074  C  C     . ALA A 1 124 ? 52.717  28.562 41.190 1.00 29.41  ? 183 ALA A C     1 
ATOM   1075  O  O     . ALA A 1 124 ? 51.764  28.139 40.516 1.00 28.90  ? 183 ALA A O     1 
ATOM   1076  C  CB    . ALA A 1 124 ? 54.022  30.617 40.657 1.00 28.90  ? 183 ALA A CB    1 
ATOM   1077  H  H     . ALA A 1 124 ? 53.178  29.254 38.549 1.00 0.00   ? 183 ALA A H     1 
ATOM   1078  N  N     . LEU A 1 125 ? 52.724  28.549 42.518 1.00 49.41  ? 184 LEU A N     1 
ATOM   1079  C  CA    . LEU A 1 125 ? 51.602  28.019 43.277 1.00 49.41  ? 184 LEU A CA    1 
ATOM   1080  C  C     . LEU A 1 125 ? 51.176  28.982 44.348 1.00 49.41  ? 184 LEU A C     1 
ATOM   1081  O  O     . LEU A 1 125 ? 52.013  29.450 45.120 1.00 13.01  ? 184 LEU A O     1 
ATOM   1082  C  CB    . LEU A 1 125 ? 51.976  26.698 43.954 1.00 13.01  ? 184 LEU A CB    1 
ATOM   1083  C  CG    . LEU A 1 125 ? 52.453  25.555 43.063 1.00 13.01  ? 184 LEU A CG    1 
ATOM   1084  C  CD1   . LEU A 1 125 ? 52.779  24.389 43.947 1.00 13.01  ? 184 LEU A CD1   1 
ATOM   1085  C  CD2   . LEU A 1 125 ? 51.409  25.162 42.023 1.00 13.01  ? 184 LEU A CD2   1 
ATOM   1086  H  H     . LEU A 1 125 ? 53.503  28.884 43.010 1.00 0.00   ? 184 LEU A H     1 
ATOM   1087  N  N     . LEU A 1 126 ? 49.875  29.254 44.407 1.00 36.38  ? 185 LEU A N     1 
ATOM   1088  C  CA    . LEU A 1 126 ? 49.318  30.137 45.416 1.00 36.38  ? 185 LEU A CA    1 
ATOM   1089  C  C     . LEU A 1 126 ? 48.376  29.262 46.230 1.00 36.38  ? 185 LEU A C     1 
ATOM   1090  O  O     . LEU A 1 126 ? 47.228  29.095 45.849 1.00 20.90  ? 185 LEU A O     1 
ATOM   1091  C  CB    . LEU A 1 126 ? 48.555  31.286 44.754 1.00 20.90  ? 185 LEU A CB    1 
ATOM   1092  C  CG    . LEU A 1 126 ? 48.034  32.429 45.622 1.00 20.90  ? 185 LEU A CG    1 
ATOM   1093  C  CD1   . LEU A 1 126 ? 49.133  33.007 46.454 1.00 20.90  ? 185 LEU A CD1   1 
ATOM   1094  C  CD2   . LEU A 1 126 ? 47.478  33.493 44.754 1.00 20.90  ? 185 LEU A CD2   1 
ATOM   1095  H  H     . LEU A 1 126 ? 49.262  28.845 43.759 1.00 0.00   ? 185 LEU A H     1 
ATOM   1096  N  N     . ALA A 1 127 ? 48.889  28.617 47.280 1.00 18.16  ? 186 ALA A N     1 
ATOM   1097  C  CA    . ALA A 1 127 ? 48.065  27.754 48.136 1.00 18.16  ? 186 ALA A CA    1 
ATOM   1098  C  C     . ALA A 1 127 ? 47.278  28.551 49.174 1.00 18.16  ? 186 ALA A C     1 
ATOM   1099  O  O     . ALA A 1 127 ? 47.578  29.712 49.419 1.00 25.10  ? 186 ALA A O     1 
ATOM   1100  C  CB    . ALA A 1 127 ? 48.932  26.739 48.839 1.00 25.10  ? 186 ALA A CB    1 
ATOM   1101  H  H     . ALA A 1 127 ? 49.829  28.753 47.511 1.00 0.00   ? 186 ALA A H     1 
ATOM   1102  N  N     . GLY A 1 128 ? 46.253  27.924 49.744 1.00 17.73  ? 187 GLY A N     1 
ATOM   1103  C  CA    . GLY A 1 128 ? 45.440  28.563 50.765 1.00 17.73  ? 187 GLY A CA    1 
ATOM   1104  C  C     . GLY A 1 128 ? 46.128  28.435 52.120 1.00 17.73  ? 187 GLY A C     1 
ATOM   1105  O  O     . GLY A 1 128 ? 47.210  27.840 52.183 1.00 61.39  ? 187 GLY A O     1 
ATOM   1106  H  H     . GLY A 1 128 ? 46.064  26.999 49.500 1.00 0.00   ? 187 GLY A H     1 
ATOM   1107  N  N     . PRO A 1 129 ? 45.513  28.902 53.232 1.00 28.51  ? 188 PRO A N     1 
ATOM   1108  C  CA    . PRO A 1 129 ? 46.150  28.802 54.547 1.00 28.51  ? 188 PRO A CA    1 
ATOM   1109  C  C     . PRO A 1 129 ? 46.515  27.348 54.742 1.00 28.51  ? 188 PRO A C     1 
ATOM   1110  O  O     . PRO A 1 129 ? 45.728  26.486 54.379 1.00 16.29  ? 188 PRO A O     1 
ATOM   1111  C  CB    . PRO A 1 129 ? 45.017  29.193 55.505 1.00 16.29  ? 188 PRO A CB    1 
ATOM   1112  C  CG    . PRO A 1 129 ? 44.090  29.957 54.690 1.00 16.29  ? 188 PRO A CG    1 
ATOM   1113  C  CD    . PRO A 1 129 ? 44.084  29.179 53.415 1.00 16.29  ? 188 PRO A CD    1 
ATOM   1114  N  N     . LEU A 1 130 ? 47.700  27.068 55.269 1.00 23.46  ? 189 LEU A N     1 
ATOM   1115  C  CA    . LEU A 1 130 ? 48.119  25.690 55.474 1.00 23.46  ? 189 LEU A CA    1 
ATOM   1116  C  C     . LEU A 1 130 ? 47.536  25.099 56.731 1.00 23.46  ? 189 LEU A C     1 
ATOM   1117  O  O     . LEU A 1 130 ? 47.917  24.008 57.153 1.00 28.08  ? 189 LEU A O     1 
ATOM   1118  C  CB    . LEU A 1 130 ? 49.637  25.553 55.461 1.00 28.08  ? 189 LEU A CB    1 
ATOM   1119  C  CG    . LEU A 1 130 ? 50.292  25.876 54.108 1.00 28.08  ? 189 LEU A CG    1 
ATOM   1120  C  CD1   . LEU A 1 130 ? 51.721  25.298 54.148 1.00 28.08  ? 189 LEU A CD1   1 
ATOM   1121  C  CD2   . LEU A 1 130 ? 49.464  25.307 52.919 1.00 28.08  ? 189 LEU A CD2   1 
ATOM   1122  H  H     . LEU A 1 130 ? 48.301  27.806 55.488 1.00 0.00   ? 189 LEU A H     1 
ATOM   1123  N  N     . SER A 1 131 ? 46.638  25.841 57.360 1.00 27.74  ? 190 SER A N     1 
ATOM   1124  C  CA    . SER A 1 131 ? 45.954  25.343 58.546 1.00 27.74  ? 190 SER A CA    1 
ATOM   1125  C  C     . SER A 1 131 ? 44.722  24.615 58.021 1.00 27.74  ? 190 SER A C     1 
ATOM   1126  O  O     . SER A 1 131 ? 44.049  23.879 58.751 1.00 41.67  ? 190 SER A O     1 
ATOM   1127  C  CB    . SER A 1 131 ? 45.549  26.505 59.459 1.00 41.67  ? 190 SER A CB    1 
ATOM   1128  O  OG    . SER A 1 131 ? 44.958  27.568 58.729 1.00 41.67  ? 190 SER A OG    1 
ATOM   1129  H  H     . SER A 1 131 ? 46.392  26.740 57.071 1.00 0.00   ? 190 SER A H     1 
ATOM   1130  H  HG    . SER A 1 131 ? 44.580  28.166 59.392 1.00 30.00  ? 190 SER A HG    1 
ATOM   1131  N  N     . SER A 1 132 ? 44.476  24.797 56.722 1.00 17.27  ? 191 SER A N     1 
ATOM   1132  C  CA    . SER A 1 132 ? 43.340  24.199 56.056 1.00 17.27  ? 191 SER A CA    1 
ATOM   1133  C  C     . SER A 1 132 ? 43.689  22.859 55.418 1.00 17.27  ? 191 SER A C     1 
ATOM   1134  O  O     . SER A 1 132 ? 44.562  22.790 54.562 1.00 23.42  ? 191 SER A O     1 
ATOM   1135  C  CB    . SER A 1 132 ? 42.800  25.160 54.995 1.00 23.42  ? 191 SER A CB    1 
ATOM   1136  O  OG    . SER A 1 132 ? 41.530  24.748 54.523 1.00 23.42  ? 191 SER A OG    1 
ATOM   1137  H  H     . SER A 1 132 ? 45.069  25.324 56.155 1.00 0.00   ? 191 SER A H     1 
ATOM   1138  H  HG    . SER A 1 132 ? 40.854  25.206 55.039 1.00 30.00  ? 191 SER A HG    1 
ATOM   1139  N  N     . VAL A 1 133 ? 42.982  21.808 55.831 1.00 14.59  ? 192 VAL A N     1 
ATOM   1140  C  CA    . VAL A 1 133 ? 43.180  20.479 55.281 1.00 14.59  ? 192 VAL A CA    1 
ATOM   1141  C  C     . VAL A 1 133 ? 42.949  20.515 53.780 1.00 14.59  ? 192 VAL A C     1 
ATOM   1142  O  O     . VAL A 1 133 ? 43.655  19.848 53.032 1.00 46.85  ? 192 VAL A O     1 
ATOM   1143  C  CB    . VAL A 1 133 ? 42.200  19.416 55.856 1.00 46.85  ? 192 VAL A CB    1 
ATOM   1144  C  CG1   . VAL A 1 133 ? 42.967  18.347 56.626 1.00 46.85  ? 192 VAL A CG1   1 
ATOM   1145  C  CG2   . VAL A 1 133 ? 41.125  20.055 56.716 1.00 46.85  ? 192 VAL A CG2   1 
ATOM   1146  H  H     . VAL A 1 133 ? 42.352  21.982 56.559 1.00 0.00   ? 192 VAL A H     1 
ATOM   1147  N  N     . SER A 1 134 ? 41.939  21.258 53.338 1.00 19.41  ? 193 SER A N     1 
ATOM   1148  C  CA    . SER A 1 134 ? 41.644  21.370 51.900 1.00 19.41  ? 193 SER A CA    1 
ATOM   1149  C  C     . SER A 1 134 ? 42.763  22.142 51.209 1.00 19.41  ? 193 SER A C     1 
ATOM   1150  O  O     . SER A 1 134 ? 43.194  21.789 50.122 1.00 35.61  ? 193 SER A O     1 
ATOM   1151  C  CB    . SER A 1 134 ? 40.310  22.070 51.695 1.00 35.61  ? 193 SER A CB    1 
ATOM   1152  O  OG    . SER A 1 134 ? 39.304  21.440 52.474 1.00 35.61  ? 193 SER A OG    1 
ATOM   1153  H  H     . SER A 1 134 ? 41.342  21.743 53.946 1.00 0.00   ? 193 SER A H     1 
ATOM   1154  H  HG    . SER A 1 134 ? 39.139  20.544 52.158 1.00 30.00  ? 193 SER A HG    1 
ATOM   1155  N  N     . ALA A 1 135 ? 43.269  23.168 51.879 1.00 27.69  ? 194 ALA A N     1 
ATOM   1156  C  CA    . ALA A 1 135 ? 44.341  23.958 51.322 1.00 27.69  ? 194 ALA A CA    1 
ATOM   1157  C  C     . ALA A 1 135 ? 45.582  23.078 51.193 1.00 27.69  ? 194 ALA A C     1 
ATOM   1158  O  O     . ALA A 1 135 ? 46.248  23.114 50.168 1.00 21.48  ? 194 ALA A O     1 
ATOM   1159  C  CB    . ALA A 1 135 ? 44.610  25.166 52.189 1.00 21.48  ? 194 ALA A CB    1 
ATOM   1160  H  H     . ALA A 1 135 ? 42.925  23.389 52.763 1.00 0.00   ? 194 ALA A H     1 
ATOM   1161  N  N     . ARG A 1 136 ? 45.872  22.265 52.208 1.00 27.95  ? 195 ARG A N     1 
ATOM   1162  C  CA    . ARG A 1 136 ? 47.031  21.371 52.165 1.00 27.95  ? 195 ARG A CA    1 
ATOM   1163  C  C     . ARG A 1 136 ? 46.836  20.266 51.128 1.00 27.95  ? 195 ARG A C     1 
ATOM   1164  O  O     . ARG A 1 136 ? 47.737  19.992 50.335 1.00 54.51  ? 195 ARG A O     1 
ATOM   1165  C  CB    . ARG A 1 136 ? 47.305  20.744 53.522 1.00 54.51  ? 195 ARG A CB    1 
ATOM   1166  C  CG    . ARG A 1 136 ? 47.647  21.750 54.591 1.00 54.51  ? 195 ARG A CG    1 
ATOM   1167  C  CD    . ARG A 1 136 ? 48.069  21.060 55.893 1.00 54.51  ? 195 ARG A CD    1 
ATOM   1168  N  NE    . ARG A 1 136 ? 47.146  20.006 56.351 1.00 54.51  ? 195 ARG A NE    1 
ATOM   1169  C  CZ    . ARG A 1 136 ? 46.404  20.069 57.461 1.00 54.51  ? 195 ARG A CZ    1 
ATOM   1170  N  NH1   . ARG A 1 136 ? 46.448  21.148 58.240 1.00 54.51  ? 195 ARG A NH1   1 
ATOM   1171  N  NH2   . ARG A 1 136 ? 45.669  19.018 57.830 1.00 54.51  ? 195 ARG A NH2   1 
ATOM   1172  H  H     . ARG A 1 136 ? 45.309  22.259 52.996 1.00 0.00   ? 195 ARG A H     1 
ATOM   1173  H  HE    . ARG A 1 136 ? 47.067  19.192 55.809 1.00 0.00   ? 195 ARG A HE    1 
ATOM   1174  H  HH11  . ARG A 1 136 ? 47.025  21.927 58.001 1.00 0.00   ? 195 ARG A HH11  1 
ATOM   1175  H  HH12  . ARG A 1 136 ? 45.880  21.175 59.063 1.00 0.00   ? 195 ARG A HH12  1 
ATOM   1176  H  HH21  . ARG A 1 136 ? 45.685  18.189 57.271 1.00 0.00   ? 195 ARG A HH21  1 
ATOM   1177  H  HH22  . ARG A 1 136 ? 45.112  19.051 58.658 1.00 0.00   ? 195 ARG A HH22  1 
ATOM   1178  N  N     . LEU A 1 137 ? 45.663  19.646 51.122 1.00 22.87  ? 196 LEU A N     1 
ATOM   1179  C  CA    . LEU A 1 137 ? 45.356  18.592 50.156 1.00 22.87  ? 196 LEU A CA    1 
ATOM   1180  C  C     . LEU A 1 137 ? 45.595  19.054 48.710 1.00 22.87  ? 196 LEU A C     1 
ATOM   1181  O  O     . LEU A 1 137 ? 46.208  18.357 47.903 1.00 39.07  ? 196 LEU A O     1 
ATOM   1182  C  CB    . LEU A 1 137 ? 43.894  18.129 50.310 1.00 39.07  ? 196 LEU A CB    1 
ATOM   1183  C  CG    . LEU A 1 137 ? 43.449  17.354 51.557 1.00 39.07  ? 196 LEU A CG    1 
ATOM   1184  C  CD1   . LEU A 1 137 ? 41.942  17.156 51.527 1.00 39.07  ? 196 LEU A CD1   1 
ATOM   1185  C  CD2   . LEU A 1 137 ? 44.155  16.007 51.646 1.00 39.07  ? 196 LEU A CD2   1 
ATOM   1186  H  H     . LEU A 1 137 ? 45.002  19.888 51.790 1.00 0.00   ? 196 LEU A H     1 
ATOM   1187  N  N     . ARG A 1 138 ? 45.088  20.231 48.389 1.00 39.32  ? 197 ARG A N     1 
ATOM   1188  C  CA    . ARG A 1 138 ? 45.241  20.776 47.059 1.00 39.32  ? 197 ARG A CA    1 
ATOM   1189  C  C     . ARG A 1 138 ? 46.704  21.036 46.736 1.00 39.32  ? 197 ARG A C     1 
ATOM   1190  O  O     . ARG A 1 138 ? 47.161  20.684 45.653 1.00 30.84  ? 197 ARG A O     1 
ATOM   1191  C  CB    . ARG A 1 138 ? 44.435  22.068 46.916 1.00 30.84  ? 197 ARG A CB    1 
ATOM   1192  C  CG    . ARG A 1 138 ? 42.919  21.873 47.039 1.00 30.84  ? 197 ARG A CG    1 
ATOM   1193  C  CD    . ARG A 1 138 ? 42.171  23.199 47.055 1.00 30.84  ? 197 ARG A CD    1 
ATOM   1194  N  NE    . ARG A 1 138 ? 40.836  23.016 47.612 1.00 30.84  ? 197 ARG A NE    1 
ATOM   1195  C  CZ    . ARG A 1 138 ? 39.959  23.987 47.843 1.00 30.84  ? 197 ARG A CZ    1 
ATOM   1196  N  NH1   . ARG A 1 138 ? 40.244  25.255 47.564 1.00 30.84  ? 197 ARG A NH1   1 
ATOM   1197  N  NH2   . ARG A 1 138 ? 38.779  23.674 48.356 1.00 30.84  ? 197 ARG A NH2   1 
ATOM   1198  H  H     . ARG A 1 138 ? 44.605  20.746 49.076 1.00 0.00   ? 197 ARG A H     1 
ATOM   1199  H  HE    . ARG A 1 138 ? 40.548  22.099 47.807 1.00 0.00   ? 197 ARG A HE    1 
ATOM   1200  H  HH11  . ARG A 1 138 ? 41.135  25.485 47.179 1.00 0.00   ? 197 ARG A HH11  1 
ATOM   1201  H  HH12  . ARG A 1 138 ? 39.580  25.978 47.757 1.00 0.00   ? 197 ARG A HH12  1 
ATOM   1202  H  HH21  . ARG A 1 138 ? 38.567  22.716 48.541 1.00 0.00   ? 197 ARG A HH21  1 
ATOM   1203  H  HH22  . ARG A 1 138 ? 38.104  24.382 48.550 1.00 0.00   ? 197 ARG A HH22  1 
ATOM   1204  N  N     . LEU A 1 139 ? 47.451  21.611 47.675 1.00 26.35  ? 198 LEU A N     1 
ATOM   1205  C  CA    . LEU A 1 139 ? 48.868  21.922 47.443 1.00 26.35  ? 198 LEU A CA    1 
ATOM   1206  C  C     . LEU A 1 139 ? 49.625  20.651 47.173 1.00 26.35  ? 198 LEU A C     1 
ATOM   1207  O  O     . LEU A 1 139 ? 50.531  20.619 46.347 1.00 42.23  ? 198 LEU A O     1 
ATOM   1208  C  CB    . LEU A 1 139 ? 49.485  22.580 48.671 1.00 42.23  ? 198 LEU A CB    1 
ATOM   1209  C  CG    . LEU A 1 139 ? 50.571  23.636 48.482 1.00 42.23  ? 198 LEU A CG    1 
ATOM   1210  C  CD1   . LEU A 1 139 ? 51.386  23.714 49.758 1.00 42.23  ? 198 LEU A CD1   1 
ATOM   1211  C  CD2   . LEU A 1 139 ? 51.447  23.324 47.296 1.00 42.23  ? 198 LEU A CD2   1 
ATOM   1212  H  H     . LEU A 1 139 ? 47.051  21.838 48.542 1.00 0.00   ? 198 LEU A H     1 
ATOM   1213  N  N     . ALA A 1 140 ? 49.283  19.619 47.934 1.00 29.14  ? 199 ALA A N     1 
ATOM   1214  C  CA    . ALA A 1 140 ? 49.910  18.311 47.804 1.00 29.14  ? 199 ALA A CA    1 
ATOM   1215  C  C     . ALA A 1 140 ? 49.526  17.721 46.464 1.00 29.14  ? 199 ALA A C     1 
ATOM   1216  O  O     . ALA A 1 140 ? 50.344  17.071 45.805 1.00 64.83  ? 199 ALA A O     1 
ATOM   1217  C  CB    . ALA A 1 140 ? 49.441  17.404 48.911 1.00 64.83  ? 199 ALA A CB    1 
ATOM   1218  H  H     . ALA A 1 140 ? 48.592  19.751 48.615 1.00 0.00   ? 199 ALA A H     1 
ATOM   1219  N  N     . GLY A 1 141 ? 48.277  17.957 46.071 1.00 30.33  ? 200 GLY A N     1 
ATOM   1220  C  CA    . GLY A 1 141 ? 47.782  17.455 44.804 1.00 30.33  ? 200 GLY A CA    1 
ATOM   1221  C  C     . GLY A 1 141 ? 48.563  18.085 43.671 1.00 30.33  ? 200 GLY A C     1 
ATOM   1222  O  O     . GLY A 1 141 ? 49.002  17.394 42.747 1.00 70.67  ? 200 GLY A O     1 
ATOM   1223  H  H     . GLY A 1 141 ? 47.677  18.474 46.645 1.00 0.00   ? 200 GLY A H     1 
ATOM   1224  N  N     . TRP A 1 142 ? 48.743  19.402 43.743 1.00 31.46  ? 201 TRP A N     1 
ATOM   1225  C  CA    . TRP A 1 142 ? 49.490  20.128 42.730 1.00 31.46  ? 201 TRP A CA    1 
ATOM   1226  C  C     . TRP A 1 142 ? 50.850  19.489 42.652 1.00 31.46  ? 201 TRP A C     1 
ATOM   1227  O  O     . TRP A 1 142 ? 51.307  19.180 41.577 1.00 28.58  ? 201 TRP A O     1 
ATOM   1228  C  CB    . TRP A 1 142 ? 49.606  21.597 43.098 1.00 28.58  ? 201 TRP A CB    1 
ATOM   1229  C  CG    . TRP A 1 142 ? 48.295  22.335 43.010 1.00 28.58  ? 201 TRP A CG    1 
ATOM   1230  C  CD1   . TRP A 1 142 ? 47.187  21.972 42.287 1.00 28.58  ? 201 TRP A CD1   1 
ATOM   1231  C  CD2   . TRP A 1 142 ? 47.959  23.563 43.662 1.00 28.58  ? 201 TRP A CD2   1 
ATOM   1232  N  NE1   . TRP A 1 142 ? 46.182  22.903 42.457 1.00 28.58  ? 201 TRP A NE1   1 
ATOM   1233  C  CE2   . TRP A 1 142 ? 46.633  23.885 43.299 1.00 28.58  ? 201 TRP A CE2   1 
ATOM   1234  C  CE3   . TRP A 1 142 ? 48.648  24.422 44.515 1.00 28.58  ? 201 TRP A CE3   1 
ATOM   1235  C  CZ2   . TRP A 1 142 ? 45.993  25.023 43.763 1.00 28.58  ? 201 TRP A CZ2   1 
ATOM   1236  C  CZ3   . TRP A 1 142 ? 48.003  25.559 44.972 1.00 28.58  ? 201 TRP A CZ3   1 
ATOM   1237  C  CH2   . TRP A 1 142 ? 46.695  25.847 44.597 1.00 28.58  ? 201 TRP A CH2   1 
ATOM   1238  H  H     . TRP A 1 142 ? 48.344  19.894 44.485 1.00 0.00   ? 201 TRP A H     1 
ATOM   1239  H  HE1   . TRP A 1 142 ? 45.286  22.867 42.062 1.00 0.00   ? 201 TRP A HE1   1 
ATOM   1240  N  N     . HIS A 1 143 ? 51.448  19.201 43.804 1.00 26.33  ? 202 HIS A N     1 
ATOM   1241  C  CA    . HIS A 1 143 ? 52.761  18.542 43.884 1.00 26.33  ? 202 HIS A CA    1 
ATOM   1242  C  C     . HIS A 1 143 ? 52.835  17.106 43.338 1.00 26.33  ? 202 HIS A C     1 
ATOM   1243  O  O     . HIS A 1 143 ? 53.860  16.725 42.762 1.00 35.32  ? 202 HIS A O     1 
ATOM   1244  C  CB    . HIS A 1 143 ? 53.302  18.568 45.312 1.00 35.32  ? 202 HIS A CB    1 
ATOM   1245  C  CG    . HIS A 1 143 ? 53.924  19.872 45.696 1.00 35.32  ? 202 HIS A CG    1 
ATOM   1246  N  ND1   . HIS A 1 143 ? 53.727  20.458 46.926 1.00 35.32  ? 202 HIS A ND1   1 
ATOM   1247  C  CD2   . HIS A 1 143 ? 54.763  20.690 45.020 1.00 35.32  ? 202 HIS A CD2   1 
ATOM   1248  C  CE1   . HIS A 1 143 ? 54.423  21.577 46.996 1.00 35.32  ? 202 HIS A CE1   1 
ATOM   1249  N  NE2   . HIS A 1 143 ? 55.059  21.742 45.850 1.00 35.32  ? 202 HIS A NE2   1 
ATOM   1250  H  H     . HIS A 1 143 ? 50.973  19.450 44.625 1.00 0.00   ? 202 HIS A H     1 
ATOM   1251  H  HD1   . HIS A 1 143 ? 53.132  20.116 47.637 1.00 0.00   ? 202 HIS A HD1   1 
ATOM   1252  H  HE2   . HIS A 1 143 ? 55.623  22.510 45.609 1.00 0.00   ? 202 HIS A HE2   1 
ATOM   1253  N  N     . LYS A 1 144 ? 51.796  16.296 43.531 1.00 34.21  ? 203 LYS A N     1 
ATOM   1254  C  CA    . LYS A 1 144 ? 51.816  14.937 42.988 1.00 34.21  ? 203 LYS A CA    1 
ATOM   1255  C  C     . LYS A 1 144 ? 51.838  15.000 41.452 1.00 34.21  ? 203 LYS A C     1 
ATOM   1256  O  O     . LYS A 1 144 ? 52.827  14.642 40.820 1.00 41.78  ? 203 LYS A O     1 
ATOM   1257  C  CB    . LYS A 1 144 ? 50.616  14.142 43.475 1.00 41.78  ? 203 LYS A CB    1 
ATOM   1258  C  CG    . LYS A 1 144 ? 50.392  12.855 42.732 1.00 41.78  ? 203 LYS A CG    1 
ATOM   1259  C  CD    . LYS A 1 144 ? 49.239  12.095 43.359 1.00 41.78  ? 203 LYS A CD    1 
ATOM   1260  C  CE    . LYS A 1 144 ? 48.783  10.938 42.476 1.00 41.78  ? 203 LYS A CE    1 
ATOM   1261  N  NZ    . LYS A 1 144 ? 47.344  10.540 42.717 1.00 41.78  ? 203 LYS A NZ    1 
ATOM   1262  H  H     . LYS A 1 144 ? 51.011  16.608 44.034 1.00 0.00   ? 203 LYS A H     1 
ATOM   1263  H  HZ1   . LYS A 1 144 ? 46.726  11.359 42.553 1.00 0.00   ? 203 LYS A HZ1   1 
ATOM   1264  H  HZ2   . LYS A 1 144 ? 47.069  9.769  42.075 1.00 0.00   ? 203 LYS A HZ2   1 
ATOM   1265  H  HZ3   . LYS A 1 144 ? 47.228  10.230 43.703 1.00 0.00   ? 203 LYS A HZ3   1 
ATOM   1266  N  N     . TYR A 1 145 ? 50.803  15.561 40.848 1.00 24.00  ? 204 TYR A N     1 
ATOM   1267  C  CA    . TYR A 1 145 ? 50.763  15.655 39.394 1.00 24.00  ? 204 TYR A CA    1 
ATOM   1268  C  C     . TYR A 1 145 ? 51.767  16.621 38.770 1.00 24.00  ? 204 TYR A C     1 
ATOM   1269  O  O     . TYR A 1 145 ? 52.076  16.496 37.583 1.00 33.72  ? 204 TYR A O     1 
ATOM   1270  C  CB    . TYR A 1 145 ? 49.352  15.975 38.938 1.00 33.72  ? 204 TYR A CB    1 
ATOM   1271  C  CG    . TYR A 1 145 ? 48.357  15.007 39.525 1.00 33.72  ? 204 TYR A CG    1 
ATOM   1272  C  CD1   . TYR A 1 145 ? 48.069  13.808 38.885 1.00 33.72  ? 204 TYR A CD1   1 
ATOM   1273  C  CD2   . TYR A 1 145 ? 47.747  15.261 40.754 1.00 33.72  ? 204 TYR A CD2   1 
ATOM   1274  C  CE1   . TYR A 1 145 ? 47.205  12.883 39.451 1.00 33.72  ? 204 TYR A CE1   1 
ATOM   1275  C  CE2   . TYR A 1 145 ? 46.879  14.341 41.327 1.00 33.72  ? 204 TYR A CE2   1 
ATOM   1276  C  CZ    . TYR A 1 145 ? 46.614  13.154 40.667 1.00 33.72  ? 204 TYR A CZ    1 
ATOM   1277  O  OH    . TYR A 1 145 ? 45.760  12.232 41.214 1.00 33.72  ? 204 TYR A OH    1 
ATOM   1278  H  H     . TYR A 1 145 ? 50.085  15.959 41.390 1.00 0.00   ? 204 TYR A H     1 
ATOM   1279  H  HH    . TYR A 1 145 ? 45.338  12.649 41.969 1.00 0.00   ? 204 TYR A HH    1 
ATOM   1280  N  N     . LEU A 1 146 ? 52.280  17.578 39.549 1.00 33.54  ? 205 LEU A N     1 
ATOM   1281  C  CA    . LEU A 1 146 ? 53.260  18.541 39.035 1.00 33.54  ? 205 LEU A CA    1 
ATOM   1282  C  C     . LEU A 1 146 ? 54.597  17.868 38.840 1.00 33.54  ? 205 LEU A C     1 
ATOM   1283  O  O     . LEU A 1 146 ? 55.198  18.018 37.782 1.00 45.11  ? 205 LEU A O     1 
ATOM   1284  C  CB    . LEU A 1 146 ? 53.465  19.731 39.979 1.00 45.11  ? 205 LEU A CB    1 
ATOM   1285  C  CG    . LEU A 1 146 ? 53.091  21.133 39.491 1.00 45.11  ? 205 LEU A CG    1 
ATOM   1286  C  CD1   . LEU A 1 146 ? 53.807  22.175 40.326 1.00 45.11  ? 205 LEU A CD1   1 
ATOM   1287  C  CD2   . LEU A 1 146 ? 53.492  21.310 38.031 1.00 45.11  ? 205 LEU A CD2   1 
ATOM   1288  H  H     . LEU A 1 146 ? 51.963  17.674 40.471 1.00 0.00   ? 205 LEU A H     1 
ATOM   1289  N  N     . THR A 1 147 ? 55.073  17.169 39.880 1.00 68.23  ? 206 THR A N     1 
ATOM   1290  C  CA    . THR A 1 147 ? 56.354  16.445 39.830 1.00 68.23  ? 206 THR A CA    1 
ATOM   1291  C  C     . THR A 1 147 ? 56.143  15.230 38.937 1.00 68.23  ? 206 THR A C     1 
ATOM   1292  O  O     . THR A 1 147 ? 57.040  14.821 38.184 1.00 61.68  ? 206 THR A O     1 
ATOM   1293  C  CB    . THR A 1 147 ? 56.852  15.963 41.222 1.00 61.68  ? 206 THR A CB    1 
ATOM   1294  O  OG1   . THR A 1 147 ? 55.915  15.039 41.773 1.00 61.68  ? 206 THR A OG1   1 
ATOM   1295  C  CG2   . THR A 1 147 ? 57.024  17.125 42.189 1.00 61.68  ? 206 THR A CG2   1 
ATOM   1296  H  H     . THR A 1 147 ? 54.557  17.137 40.710 1.00 0.00   ? 206 THR A H     1 
ATOM   1297  H  HG1   . THR A 1 147 ? 55.114  15.481 42.085 1.00 30.00  ? 206 THR A HG1   1 
ATOM   1298  N  N     . ARG A 1 148 ? 54.945  14.665 39.004 1.00 29.95  ? 207 ARG A N     1 
ATOM   1299  C  CA    . ARG A 1 148 ? 54.618  13.545 38.143 1.00 29.95  ? 207 ARG A CA    1 
ATOM   1300  C  C     . ARG A 1 148 ? 54.855  13.982 36.698 1.00 29.95  ? 207 ARG A C     1 
ATOM   1301  O  O     . ARG A 1 148 ? 55.199  13.164 35.850 1.00 62.72  ? 207 ARG A O     1 
ATOM   1302  C  CB    . ARG A 1 148 ? 53.153  13.154 38.290 1.00 62.72  ? 207 ARG A CB    1 
ATOM   1303  C  CG    . ARG A 1 148 ? 52.876  11.871 39.069 1.00 62.72  ? 207 ARG A CG    1 
ATOM   1304  C  CD    . ARG A 1 148 ? 51.640  11.234 38.465 1.00 62.72  ? 207 ARG A CD    1 
ATOM   1305  N  NE    . ARG A 1 148 ? 50.990  10.256 39.322 1.00 62.72  ? 207 ARG A NE    1 
ATOM   1306  C  CZ    . ARG A 1 148 ? 49.742  9.844  39.132 1.00 62.72  ? 207 ARG A CZ    1 
ATOM   1307  N  NH1   . ARG A 1 148 ? 49.029  10.337 38.118 1.00 62.72  ? 207 ARG A NH1   1 
ATOM   1308  N  NH2   . ARG A 1 148 ? 49.207  8.941  39.949 1.00 62.72  ? 207 ARG A NH2   1 
ATOM   1309  H  H     . ARG A 1 148 ? 54.301  14.982 39.665 1.00 0.00   ? 207 ARG A H     1 
ATOM   1310  H  HE    . ARG A 1 148 ? 51.494  9.883  40.076 1.00 0.00   ? 207 ARG A HE    1 
ATOM   1311  H  HH11  . ARG A 1 148 ? 49.431  11.010 37.498 1.00 0.00   ? 207 ARG A HH11  1 
ATOM   1312  H  HH12  . ARG A 1 148 ? 48.088  10.032 37.977 1.00 0.00   ? 207 ARG A HH12  1 
ATOM   1313  H  HH21  . ARG A 1 148 ? 49.739  8.571  40.711 1.00 0.00   ? 207 ARG A HH21  1 
ATOM   1314  H  HH22  . ARG A 1 148 ? 48.263  8.643  39.805 1.00 0.00   ? 207 ARG A HH22  1 
ATOM   1315  N  N     . ASN A 1 149 ? 54.650  15.269 36.419 1.00 59.05  ? 208 ASN A N     1 
ATOM   1316  C  CA    . ASN A 1 149 ? 54.860  15.816 35.074 1.00 59.05  ? 208 ASN A CA    1 
ATOM   1317  C  C     . ASN A 1 149 ? 56.247  16.433 34.901 1.00 59.05  ? 208 ASN A C     1 
ATOM   1318  O  O     . ASN A 1 149 ? 56.461  17.275 34.031 1.00 38.78  ? 208 ASN A O     1 
ATOM   1319  C  CB    . ASN A 1 149 ? 53.787  16.850 34.721 1.00 38.78  ? 208 ASN A CB    1 
ATOM   1320  C  CG    . ASN A 1 149 ? 52.552  16.223 34.099 1.00 38.78  ? 208 ASN A CG    1 
ATOM   1321  O  OD1   . ASN A 1 149 ? 52.285  16.393 32.905 1.00 38.78  ? 208 ASN A OD1   1 
ATOM   1322  N  ND2   . ASN A 1 149 ? 51.772  15.518 34.913 1.00 38.78  ? 208 ASN A ND2   1 
ATOM   1323  H  H     . ASN A 1 149 ? 54.332  15.874 37.122 1.00 0.00   ? 208 ASN A H     1 
ATOM   1324  H  HD21  . ASN A 1 149 ? 50.989  15.095 34.514 1.00 0.00   ? 208 ASN A HD21  1 
ATOM   1325  H  HD22  . ASN A 1 149 ? 52.020  15.464 35.861 1.00 0.00   ? 208 ASN A HD22  1 
ATOM   1326  N  N     . GLN A 1 150 ? 57.177  16.022 35.752 1.00 27.93  ? 209 GLN A N     1 
ATOM   1327  C  CA    . GLN A 1 150 ? 58.551  16.500 35.716 1.00 27.93  ? 209 GLN A CA    1 
ATOM   1328  C  C     . GLN A 1 150 ? 58.723  18.004 35.932 1.00 27.93  ? 209 GLN A C     1 
ATOM   1329  O  O     . GLN A 1 150 ? 59.856  18.485 35.987 1.00 115.20 ? 209 GLN A O     1 
ATOM   1330  C  CB    . GLN A 1 150 ? 59.235  16.102 34.396 1.00 115.20 ? 209 GLN A CB    1 
ATOM   1331  C  CG    . GLN A 1 150 ? 59.347  14.596 34.126 1.00 115.20 ? 209 GLN A CG    1 
ATOM   1332  C  CD    . GLN A 1 150 ? 58.062  13.984 33.567 1.00 115.20 ? 209 GLN A CD    1 
ATOM   1333  O  OE1   . GLN A 1 150 ? 57.586  14.375 32.499 1.00 115.20 ? 209 GLN A OE1   1 
ATOM   1334  N  NE2   . GLN A 1 150 ? 57.504  13.013 34.283 1.00 115.20 ? 209 GLN A NE2   1 
ATOM   1335  H  H     . GLN A 1 150 ? 56.928  15.356 36.413 1.00 0.00   ? 209 GLN A H     1 
ATOM   1336  N  N     . ILE A 1 151 ? 57.623  18.749 36.062 1.00 43.37  ? 210 ILE A N     1 
ATOM   1337  C  CA    . ILE A 1 151 ? 57.689  20.201 36.247 1.00 43.37  ? 210 ILE A CA    1 
ATOM   1338  C  C     . ILE A 1 151 ? 57.869  20.559 37.697 1.00 43.37  ? 210 ILE A C     1 
ATOM   1339  O  O     . ILE A 1 151 ? 57.303  19.908 38.570 1.00 59.90  ? 210 ILE A O     1 
ATOM   1340  C  CB    . ILE A 1 151 ? 56.413  20.888 35.746 1.00 59.90  ? 210 ILE A CB    1 
ATOM   1341  C  CG1   . ILE A 1 151 ? 56.270  20.668 34.241 1.00 59.90  ? 210 ILE A CG1   1 
ATOM   1342  C  CG2   . ILE A 1 151 ? 56.418  22.386 36.107 1.00 59.90  ? 210 ILE A CG2   1 
ATOM   1343  C  CD1   . ILE A 1 151 ? 55.003  21.268 33.644 1.00 59.90  ? 210 ILE A CD1   1 
ATOM   1344  H  H     . ILE A 1 151 ? 56.740  18.342 36.103 1.00 0.00   ? 210 ILE A H     1 
ATOM   1345  N  N     . GLN A 1 152 ? 58.618  21.627 37.940 1.00 43.73  ? 211 GLN A N     1 
ATOM   1346  C  CA    . GLN A 1 152 ? 58.884  22.101 39.290 1.00 43.73  ? 211 GLN A CA    1 
ATOM   1347  C  C     . GLN A 1 152 ? 58.512  23.572 39.420 1.00 43.73  ? 211 GLN A C     1 
ATOM   1348  O  O     . GLN A 1 152 ? 58.968  24.403 38.636 1.00 125.25 ? 211 GLN A O     1 
ATOM   1349  C  CB    . GLN A 1 152 ? 60.360  21.901 39.637 1.00 125.25 ? 211 GLN A CB    1 
ATOM   1350  C  CG    . GLN A 1 152 ? 60.618  20.832 40.691 1.00 125.25 ? 211 GLN A CG    1 
ATOM   1351  C  CD    . GLN A 1 152 ? 59.888  19.523 40.417 1.00 125.25 ? 211 GLN A CD    1 
ATOM   1352  O  OE1   . GLN A 1 152 ? 58.862  19.236 41.034 1.00 125.25 ? 211 GLN A OE1   1 
ATOM   1353  N  NE2   . GLN A 1 152 ? 60.416  18.723 39.500 1.00 125.25 ? 211 GLN A NE2   1 
ATOM   1354  H  H     . GLN A 1 152 ? 58.995  22.137 37.194 1.00 0.00   ? 211 GLN A H     1 
ATOM   1355  N  N     . PRO A 1 153 ? 57.646  23.908 40.392 1.00 45.68  ? 212 PRO A N     1 
ATOM   1356  C  CA    . PRO A 1 153 ? 57.212  25.291 40.622 1.00 45.68  ? 212 PRO A CA    1 
ATOM   1357  C  C     . PRO A 1 153 ? 58.347  26.237 41.037 1.00 45.68  ? 212 PRO A C     1 
ATOM   1358  O  O     . PRO A 1 153 ? 58.982  26.052 42.080 1.00 57.87  ? 212 PRO A O     1 
ATOM   1359  C  CB    . PRO A 1 153 ? 56.168  25.136 41.727 1.00 57.87  ? 212 PRO A CB    1 
ATOM   1360  C  CG    . PRO A 1 153 ? 56.630  23.923 42.471 1.00 57.87  ? 212 PRO A CG    1 
ATOM   1361  C  CD    . PRO A 1 153 ? 56.985  22.995 41.337 1.00 57.87  ? 212 PRO A CD    1 
ATOM   1362  N  N     . ILE A 1 154 ? 58.584  27.253 40.208 1.00 25.02  ? 213 ILE A N     1 
ATOM   1363  C  CA    . ILE A 1 154 ? 59.632  28.259 40.443 1.00 25.02  ? 213 ILE A CA    1 
ATOM   1364  C  C     . ILE A 1 154 ? 59.347  29.035 41.721 1.00 25.02  ? 213 ILE A C     1 
ATOM   1365  O  O     . ILE A 1 154 ? 60.258  29.570 42.378 1.00 46.28  ? 213 ILE A O     1 
ATOM   1366  C  CB    . ILE A 1 154 ? 59.730  29.286 39.255 1.00 46.28  ? 213 ILE A CB    1 
ATOM   1367  C  CG1   . ILE A 1 154 ? 58.621  30.336 39.327 1.00 46.28  ? 213 ILE A CG1   1 
ATOM   1368  C  CG2   . ILE A 1 154 ? 59.574  28.568 37.915 1.00 46.28  ? 213 ILE A CG2   1 
ATOM   1369  C  CD1   . ILE A 1 154 ? 58.630  31.298 38.167 1.00 46.28  ? 213 ILE A CD1   1 
ATOM   1370  H  H     . ILE A 1 154 ? 58.007  27.298 39.421 1.00 0.00   ? 213 ILE A H     1 
ATOM   1371  N  N     . ALA A 1 155 ? 58.063  29.076 42.063 1.00 24.63  ? 214 ALA A N     1 
ATOM   1372  C  CA    . ALA A 1 155 ? 57.588  29.778 43.227 1.00 24.63  ? 214 ALA A CA    1 
ATOM   1373  C  C     . ALA A 1 155 ? 56.374  29.081 43.780 1.00 24.63  ? 214 ALA A C     1 
ATOM   1374  O  O     . ALA A 1 155 ? 55.574  28.499 43.044 1.00 56.33  ? 214 ALA A O     1 
ATOM   1375  C  CB    . ALA A 1 155 ? 57.237  31.203 42.867 1.00 56.33  ? 214 ALA A CB    1 
ATOM   1376  H  H     . ALA A 1 155 ? 57.402  28.599 41.524 1.00 0.00   ? 214 ALA A H     1 
ATOM   1377  N  N     . GLU A 1 156 ? 56.226  29.206 45.087 1.00 56.09  ? 215 GLU A N     1 
ATOM   1378  C  CA    . GLU A 1 156 ? 55.132  28.616 45.818 1.00 56.09  ? 215 GLU A CA    1 
ATOM   1379  C  C     . GLU A 1 156 ? 54.921  29.532 47.013 1.00 56.09  ? 215 GLU A C     1 
ATOM   1380  O  O     . GLU A 1 156 ? 55.868  29.820 47.760 1.00 65.54  ? 215 GLU A O     1 
ATOM   1381  C  CB    . GLU A 1 156 ? 55.536  27.222 46.286 1.00 65.54  ? 215 GLU A CB    1 
ATOM   1382  C  CG    . GLU A 1 156 ? 54.578  26.567 47.251 1.00 65.54  ? 215 GLU A CG    1 
ATOM   1383  C  CD    . GLU A 1 156 ? 55.078  25.218 47.700 1.00 65.54  ? 215 GLU A CD    1 
ATOM   1384  O  OE1   . GLU A 1 156 ? 55.502  24.430 46.828 1.00 65.54  ? 215 GLU A OE1   1 
ATOM   1385  O  OE2   . GLU A 1 156 ? 55.055  24.952 48.918 1.00 65.54  ? 215 GLU A OE2   1 
ATOM   1386  H  H     . GLU A 1 156 ? 56.874  29.718 45.622 1.00 0.00   ? 215 GLU A H     1 
ATOM   1387  N  N     . ARG A 1 157 ? 53.696  30.034 47.151 1.00 55.99  ? 216 ARG A N     1 
ATOM   1388  C  CA    . ARG A 1 157 ? 53.338  30.930 48.246 1.00 55.99  ? 216 ARG A CA    1 
ATOM   1389  C  C     . ARG A 1 157 ? 51.984  30.543 48.787 1.00 55.99  ? 216 ARG A C     1 
ATOM   1390  O  O     . ARG A 1 157 ? 51.248  29.791 48.153 1.00 57.02  ? 216 ARG A O     1 
ATOM   1391  C  CB    . ARG A 1 157 ? 53.307  32.390 47.774 1.00 57.02  ? 216 ARG A CB    1 
ATOM   1392  C  CG    . ARG A 1 157 ? 54.539  32.801 47.015 1.00 57.02  ? 216 ARG A CG    1 
ATOM   1393  C  CD    . ARG A 1 157 ? 54.997  34.191 47.340 1.00 57.02  ? 216 ARG A CD    1 
ATOM   1394  N  NE    . ARG A 1 157 ? 56.274  34.447 46.675 1.00 57.02  ? 216 ARG A NE    1 
ATOM   1395  C  CZ    . ARG A 1 157 ? 57.125  35.418 47.003 1.00 57.02  ? 216 ARG A CZ    1 
ATOM   1396  N  NH1   . ARG A 1 157 ? 56.860  36.262 48.005 1.00 57.02  ? 216 ARG A NH1   1 
ATOM   1397  N  NH2   . ARG A 1 157 ? 58.253  35.546 46.316 1.00 57.02  ? 216 ARG A NH2   1 
ATOM   1398  H  H     . ARG A 1 157 ? 52.984  29.772 46.552 1.00 0.00   ? 216 ARG A H     1 
ATOM   1399  H  HE    . ARG A 1 157 ? 56.523  33.868 45.925 1.00 0.00   ? 216 ARG A HE    1 
ATOM   1400  H  HH11  . ARG A 1 157 ? 56.008  36.172 48.521 1.00 0.00   ? 216 ARG A HH11  1 
ATOM   1401  H  HH12  . ARG A 1 157 ? 57.510  36.983 48.241 1.00 0.00   ? 216 ARG A HH12  1 
ATOM   1402  H  HH21  . ARG A 1 157 ? 58.460  34.924 45.562 1.00 0.00   ? 216 ARG A HH21  1 
ATOM   1403  H  HH22  . ARG A 1 157 ? 58.893  36.274 46.558 1.00 0.00   ? 216 ARG A HH22  1 
ATOM   1404  N  N     . GLU A 1 158 ? 51.678  31.055 49.978 1.00 28.75  ? 217 GLU A N     1 
ATOM   1405  C  CA    . GLU A 1 158 ? 50.395  30.756 50.629 1.00 28.75  ? 217 GLU A CA    1 
ATOM   1406  C  C     . GLU A 1 158 ? 49.735  32.053 51.106 1.00 28.75  ? 217 GLU A C     1 
ATOM   1407  O  O     . GLU A 1 158 ? 50.325  32.856 51.820 1.00 95.57  ? 217 GLU A O     1 
ATOM   1408  C  CB    . GLU A 1 158 ? 50.619  29.835 51.829 1.00 95.57  ? 217 GLU A CB    1 
ATOM   1409  C  CG    . GLU A 1 158 ? 51.260  28.501 51.446 1.00 95.57  ? 217 GLU A CG    1 
ATOM   1410  C  CD    . GLU A 1 158 ? 51.489  27.583 52.648 1.00 95.57  ? 217 GLU A CD    1 
ATOM   1411  O  OE1   . GLU A 1 158 ? 51.148  27.971 53.830 1.00 95.57  ? 217 GLU A OE1   1 
ATOM   1412  O  OE2   . GLU A 1 158 ? 52.022  26.420 52.479 1.00 95.57  ? 217 GLU A OE2   1 
ATOM   1413  N  N     . GLY A 1 159 ? 48.505  32.273 50.633 1.00 13.90  ? 218 GLY A N     1 
ATOM   1414  C  CA    . GLY A 1 159 ? 47.704  33.412 51.032 1.00 13.90  ? 218 GLY A CA    1 
ATOM   1415  C  C     . GLY A 1 159 ? 46.742  32.968 52.133 1.00 13.90  ? 218 GLY A C     1 
ATOM   1416  O  O     . GLY A 1 159 ? 47.083  32.081 52.923 1.00 42.84  ? 218 GLY A O     1 
ATOM   1417  H  H     . GLY A 1 159 ? 48.114  31.603 50.031 1.00 0.00   ? 218 GLY A H     1 
ATOM   1418  N  N     . ASP A 1 160 ? 45.540  33.541 52.193 1.00 37.52  ? 219 ASP A N     1 
ATOM   1419  C  CA    . ASP A 1 160 ? 44.599  33.148 53.252 1.00 37.52  ? 219 ASP A CA    1 
ATOM   1420  C  C     . ASP A 1 160 ? 43.116  33.118 52.876 1.00 37.52  ? 219 ASP A C     1 
ATOM   1421  O  O     . ASP A 1 160 ? 42.259  33.430 53.695 1.00 25.84  ? 219 ASP A O     1 
ATOM   1422  C  CB    . ASP A 1 160 ? 44.785  34.030 54.485 1.00 25.84  ? 219 ASP A CB    1 
ATOM   1423  C  CG    . ASP A 1 160 ? 44.293  35.432 54.268 1.00 25.84  ? 219 ASP A CG    1 
ATOM   1424  O  OD1   . ASP A 1 160 ? 43.840  35.732 53.147 1.00 25.84  ? 219 ASP A OD1   1 
ATOM   1425  O  OD2   . ASP A 1 160 ? 44.346  36.242 55.220 1.00 25.84  ? 219 ASP A OD2   1 
ATOM   1426  H  H     . ASP A 1 160 ? 45.296  34.238 51.545 1.00 0.00   ? 219 ASP A H     1 
ATOM   1427  N  N     . TRP A 1 161 ? 42.853  32.817 51.612 1.00 15.72  ? 220 TRP A N     1 
ATOM   1428  C  CA    . TRP A 1 161 ? 41.508  32.695 51.042 1.00 15.72  ? 220 TRP A CA    1 
ATOM   1429  C  C     . TRP A 1 161 ? 40.877  33.964 50.511 1.00 15.72  ? 220 TRP A C     1 
ATOM   1430  O  O     . TRP A 1 161 ? 39.865  33.898 49.799 1.00 26.25  ? 220 TRP A O     1 
ATOM   1431  C  CB    . TRP A 1 161 ? 40.532  31.990 51.999 1.00 26.25  ? 220 TRP A CB    1 
ATOM   1432  C  CG    . TRP A 1 161 ? 40.830  30.534 52.314 1.00 26.25  ? 220 TRP A CG    1 
ATOM   1433  C  CD1   . TRP A 1 161 ? 40.851  29.961 53.547 1.00 26.25  ? 220 TRP A CD1   1 
ATOM   1434  C  CD2   . TRP A 1 161 ? 41.114  29.484 51.385 1.00 26.25  ? 220 TRP A CD2   1 
ATOM   1435  N  NE1   . TRP A 1 161 ? 41.128  28.626 53.449 1.00 26.25  ? 220 TRP A NE1   1 
ATOM   1436  C  CE2   . TRP A 1 161 ? 41.293  28.306 52.129 1.00 26.25  ? 220 TRP A CE2   1 
ATOM   1437  C  CE3   . TRP A 1 161 ? 41.230  29.424 50.000 1.00 26.25  ? 220 TRP A CE3   1 
ATOM   1438  C  CZ2   . TRP A 1 161 ? 41.586  27.082 51.529 1.00 26.25  ? 220 TRP A CZ2   1 
ATOM   1439  C  CZ3   . TRP A 1 161 ? 41.518  28.216 49.412 1.00 26.25  ? 220 TRP A CZ3   1 
ATOM   1440  C  CH2   . TRP A 1 161 ? 41.692  27.061 50.170 1.00 26.25  ? 220 TRP A CH2   1 
ATOM   1441  H  H     . TRP A 1 161 ? 43.611  32.665 51.013 1.00 0.00   ? 220 TRP A H     1 
ATOM   1442  H  HE1   . TRP A 1 161 ? 41.176  28.014 54.216 1.00 0.00   ? 220 TRP A HE1   1 
ATOM   1443  N  N     . SER A 1 162 ? 41.500  35.109 50.786 1.00 14.59  ? 221 SER A N     1 
ATOM   1444  C  CA    . SER A 1 162 ? 40.963  36.392 50.353 1.00 14.59  ? 221 SER A CA    1 
ATOM   1445  C  C     . SER A 1 162 ? 41.686  36.982 49.180 1.00 14.59  ? 221 SER A C     1 
ATOM   1446  O  O     . SER A 1 162 ? 42.887  36.759 48.999 1.00 30.99  ? 221 SER A O     1 
ATOM   1447  C  CB    . SER A 1 162 ? 41.043  37.376 51.504 1.00 30.99  ? 221 SER A CB    1 
ATOM   1448  O  OG    . SER A 1 162 ? 42.382  37.529 51.911 1.00 30.99  ? 221 SER A OG    1 
ATOM   1449  H  H     . SER A 1 162 ? 42.323  35.129 51.310 1.00 0.00   ? 221 SER A H     1 
ATOM   1450  H  HG    . SER A 1 162 ? 42.382  37.918 52.797 1.00 30.00  ? 221 SER A HG    1 
ATOM   1451  N  N     . ALA A 1 163 ? 40.974  37.826 48.436 1.00 38.09  ? 222 ALA A N     1 
ATOM   1452  C  CA    . ALA A 1 163 ? 41.534  38.518 47.265 1.00 38.09  ? 222 ALA A CA    1 
ATOM   1453  C  C     . ALA A 1 163 ? 42.786  39.367 47.558 1.00 38.09  ? 222 ALA A C     1 
ATOM   1454  O  O     . ALA A 1 163 ? 43.757  39.349 46.798 1.00 23.36  ? 222 ALA A O     1 
ATOM   1455  C  CB    . ALA A 1 163 ? 40.463  39.384 46.619 1.00 23.36  ? 222 ALA A CB    1 
ATOM   1456  H  H     . ALA A 1 163 ? 40.037  37.977 48.660 1.00 0.00   ? 222 ALA A H     1 
ATOM   1457  N  N     . MET A 1 164 ? 42.784  40.086 48.676 1.00 39.75  ? 223 MET A N     1 
ATOM   1458  C  CA    . MET A 1 164 ? 43.917  40.948 49.028 1.00 39.75  ? 223 MET A CA    1 
ATOM   1459  C  C     . MET A 1 164 ? 45.228  40.215 49.316 1.00 39.75  ? 223 MET A C     1 
ATOM   1460  O  O     . MET A 1 164 ? 46.301  40.802 49.139 1.00 23.68  ? 223 MET A O     1 
ATOM   1461  C  CB    . MET A 1 164 ? 43.545  41.867 50.186 1.00 23.68  ? 223 MET A CB    1 
ATOM   1462  C  CG    . MET A 1 164 ? 44.465  43.045 50.351 1.00 23.68  ? 223 MET A CG    1 
ATOM   1463  S  SD    . MET A 1 164 ? 44.409  44.196 48.965 1.00 23.68  ? 223 MET A SD    1 
ATOM   1464  C  CE    . MET A 1 164 ? 46.095  44.667 48.884 1.00 23.68  ? 223 MET A CE    1 
ATOM   1465  H  H     . MET A 1 164 ? 42.015  40.048 49.278 1.00 0.00   ? 223 MET A H     1 
ATOM   1466  N  N     . SER A 1 165 ? 45.132  38.949 49.749 1.00 24.18  ? 224 SER A N     1 
ATOM   1467  C  CA    . SER A 1 165 ? 46.290  38.093 50.051 1.00 24.18  ? 224 SER A CA    1 
ATOM   1468  C  C     . SER A 1 165 ? 46.810  37.442 48.786 1.00 24.18  ? 224 SER A C     1 
ATOM   1469  O  O     . SER A 1 165 ? 47.981  37.063 48.720 1.00 30.38  ? 224 SER A O     1 
ATOM   1470  C  CB    . SER A 1 165 ? 45.935  36.992 51.037 1.00 30.38  ? 224 SER A CB    1 
ATOM   1471  O  OG    . SER A 1 165 ? 45.005  36.093 50.466 1.00 30.38  ? 224 SER A OG    1 
ATOM   1472  H  H     . SER A 1 165 ? 44.243  38.560 49.854 1.00 0.00   ? 224 SER A H     1 
ATOM   1473  H  HG    . SER A 1 165 ? 44.154  36.535 50.345 1.00 30.00  ? 224 SER A HG    1 
ATOM   1474  N  N     . GLY A 1 166 ? 45.929  37.233 47.813 1.00 21.46  ? 225 GLY A N     1 
ATOM   1475  C  CA    . GLY A 1 166 ? 46.392  36.680 46.558 1.00 21.46  ? 225 GLY A CA    1 
ATOM   1476  C  C     . GLY A 1 166 ? 47.227  37.788 45.921 1.00 21.46  ? 225 GLY A C     1 
ATOM   1477  O  O     . GLY A 1 166 ? 48.335  37.570 45.411 1.00 51.01  ? 225 GLY A O     1 
ATOM   1478  H  H     . GLY A 1 166 ? 44.977  37.430 47.938 1.00 0.00   ? 225 GLY A H     1 
ATOM   1479  N  N     . PHE A 1 167 ? 46.699  39.004 45.983 1.00 23.92  ? 226 PHE A N     1 
ATOM   1480  C  CA    . PHE A 1 167 ? 47.380  40.162 45.448 1.00 23.92  ? 226 PHE A CA    1 
ATOM   1481  C  C     . PHE A 1 167 ? 48.724  40.268 46.129 1.00 23.92  ? 226 PHE A C     1 
ATOM   1482  O  O     . PHE A 1 167 ? 49.757  40.254 45.478 1.00 15.26  ? 226 PHE A O     1 
ATOM   1483  C  CB    . PHE A 1 167 ? 46.560  41.387 45.738 1.00 15.26  ? 226 PHE A CB    1 
ATOM   1484  C  CG    . PHE A 1 167 ? 47.268  42.650 45.477 1.00 15.26  ? 226 PHE A CG    1 
ATOM   1485  C  CD1   . PHE A 1 167 ? 47.991  43.265 46.482 1.00 15.26  ? 226 PHE A CD1   1 
ATOM   1486  C  CD2   . PHE A 1 167 ? 47.179  43.259 44.237 1.00 15.26  ? 226 PHE A CD2   1 
ATOM   1487  C  CE1   . PHE A 1 167 ? 48.616  44.477 46.263 1.00 15.26  ? 226 PHE A CE1   1 
ATOM   1488  C  CE2   . PHE A 1 167 ? 47.798  44.470 43.997 1.00 15.26  ? 226 PHE A CE2   1 
ATOM   1489  C  CZ    . PHE A 1 167 ? 48.524  45.086 45.021 1.00 15.26  ? 226 PHE A CZ    1 
ATOM   1490  H  H     . PHE A 1 167 ? 45.804  39.108 46.364 1.00 0.00   ? 226 PHE A H     1 
ATOM   1491  N  N     . GLN A 1 168 ? 48.702  40.342 47.450 1.00 19.91  ? 227 GLN A N     1 
ATOM   1492  C  CA    . GLN A 1 168 ? 49.925  40.429 48.255 1.00 19.91  ? 227 GLN A CA    1 
ATOM   1493  C  C     . GLN A 1 168 ? 50.998  39.405 47.861 1.00 19.91  ? 227 GLN A C     1 
ATOM   1494  O  O     . GLN A 1 168 ? 52.089  39.789 47.457 1.00 26.45  ? 227 GLN A O     1 
ATOM   1495  C  CB    . GLN A 1 168 ? 49.588  40.300 49.747 1.00 26.45  ? 227 GLN A CB    1 
ATOM   1496  C  CG    . GLN A 1 168 ? 50.772  40.407 50.685 1.00 26.45  ? 227 GLN A CG    1 
ATOM   1497  C  CD    . GLN A 1 168 ? 50.381  40.319 52.149 1.00 26.45  ? 227 GLN A CD    1 
ATOM   1498  O  OE1   . GLN A 1 168 ? 51.139  40.704 53.015 1.00 26.45  ? 227 GLN A OE1   1 
ATOM   1499  N  NE2   . GLN A 1 168 ? 49.197  39.822 52.425 1.00 26.45  ? 227 GLN A NE2   1 
ATOM   1500  H  H     . GLN A 1 168 ? 47.833  40.384 47.899 1.00 0.00   ? 227 GLN A H     1 
ATOM   1501  N  N     . GLN A 1 169 ? 50.678  38.114 47.916 1.00 15.47  ? 228 GLN A N     1 
ATOM   1502  C  CA    . GLN A 1 169 ? 51.653  37.094 47.584 1.00 15.47  ? 228 GLN A CA    1 
ATOM   1503  C  C     . GLN A 1 169 ? 52.175  37.244 46.185 1.00 15.47  ? 228 GLN A C     1 
ATOM   1504  O  O     . GLN A 1 169 ? 53.382  37.155 45.957 1.00 22.15  ? 228 GLN A O     1 
ATOM   1505  C  CB    . GLN A 1 169 ? 51.067  35.715 47.779 1.00 22.15  ? 228 GLN A CB    1 
ATOM   1506  C  CG    . GLN A 1 169 ? 50.736  35.417 49.216 1.00 22.15  ? 228 GLN A CG    1 
ATOM   1507  C  CD    . GLN A 1 169 ? 51.921  35.566 50.154 1.00 22.15  ? 228 GLN A CD    1 
ATOM   1508  O  OE1   . GLN A 1 169 ? 51.881  36.375 51.058 1.00 22.15  ? 228 GLN A OE1   1 
ATOM   1509  N  NE2   . GLN A 1 169 ? 52.956  34.761 49.963 1.00 22.15  ? 228 GLN A NE2   1 
ATOM   1510  H  H     . GLN A 1 169 ? 49.779  37.837 48.183 1.00 0.00   ? 228 GLN A H     1 
ATOM   1511  N  N     . THR A 1 170 ? 51.275  37.517 45.247 1.00 27.88  ? 229 THR A N     1 
ATOM   1512  C  CA    . THR A 1 170 ? 51.678  37.688 43.854 1.00 27.88  ? 229 THR A CA    1 
ATOM   1513  C  C     . THR A 1 170 ? 52.561  38.922 43.633 1.00 27.88  ? 229 THR A C     1 
ATOM   1514  O  O     . THR A 1 170 ? 53.537  38.864 42.890 1.00 26.34  ? 229 THR A O     1 
ATOM   1515  C  CB    . THR A 1 170 ? 50.471  37.786 42.965 1.00 26.34  ? 229 THR A CB    1 
ATOM   1516  O  OG1   . THR A 1 170 ? 49.655  36.639 43.190 1.00 26.34  ? 229 THR A OG1   1 
ATOM   1517  C  CG2   . THR A 1 170 ? 50.883  37.817 41.528 1.00 26.34  ? 229 THR A CG2   1 
ATOM   1518  H  H     . THR A 1 170 ? 50.332  37.631 45.476 1.00 0.00   ? 229 THR A H     1 
ATOM   1519  H  HG1   . THR A 1 170 ? 49.265  36.628 44.070 1.00 30.00  ? 229 THR A HG1   1 
ATOM   1520  N  N     . MET A 1 171 ? 52.200  40.055 44.232 1.00 20.73  ? 230 MET A N     1 
ATOM   1521  C  CA    . MET A 1 171 ? 53.018  41.250 44.079 1.00 20.73  ? 230 MET A CA    1 
ATOM   1522  C  C     . MET A 1 171 ? 54.401  40.928 44.632 1.00 20.73  ? 230 MET A C     1 
ATOM   1523  O  O     . MET A 1 171 ? 55.393  41.333 44.047 1.00 36.77  ? 230 MET A O     1 
ATOM   1524  C  CB    . MET A 1 171 ? 52.413  42.426 44.827 1.00 36.77  ? 230 MET A CB    1 
ATOM   1525  C  CG    . MET A 1 171 ? 51.343  43.124 44.038 1.00 36.77  ? 230 MET A CG    1 
ATOM   1526  S  SD    . MET A 1 171 ? 51.881  43.625 42.377 1.00 36.77  ? 230 MET A SD    1 
ATOM   1527  C  CE    . MET A 1 171 ? 52.582  45.246 42.748 1.00 36.77  ? 230 MET A CE    1 
ATOM   1528  H  H     . MET A 1 171 ? 51.413  40.070 44.800 1.00 0.00   ? 230 MET A H     1 
ATOM   1529  N  N     . GLN A 1 172 ? 54.465  40.146 45.713 1.00 48.20  ? 231 GLN A N     1 
ATOM   1530  C  CA    . GLN A 1 172 ? 55.748  39.771 46.337 1.00 48.20  ? 231 GLN A CA    1 
ATOM   1531  C  C     . GLN A 1 172 ? 56.571  38.948 45.374 1.00 48.20  ? 231 GLN A C     1 
ATOM   1532  O  O     . GLN A 1 172 ? 57.744  39.220 45.145 1.00 82.30  ? 231 GLN A O     1 
ATOM   1533  C  CB    . GLN A 1 172 ? 55.542  38.943 47.617 1.00 82.30  ? 231 GLN A CB    1 
ATOM   1534  C  CG    . GLN A 1 172 ? 55.326  39.734 48.910 1.00 82.30  ? 231 GLN A CG    1 
ATOM   1535  C  CD    . GLN A 1 172 ? 55.256  38.831 50.148 1.00 82.30  ? 231 GLN A CD    1 
ATOM   1536  O  OE1   . GLN A 1 172 ? 55.522  37.623 50.070 1.00 82.30  ? 231 GLN A OE1   1 
ATOM   1537  N  NE2   . GLN A 1 172 ? 54.900  39.414 51.295 1.00 82.30  ? 231 GLN A NE2   1 
ATOM   1538  H  H     . GLN A 1 172 ? 53.632  39.822 46.115 1.00 0.00   ? 231 GLN A H     1 
ATOM   1539  N  N     . MET A 1 173 ? 55.938  37.920 44.834 1.00 42.89  ? 232 MET A N     1 
ATOM   1540  C  CA    . MET A 1 173 ? 56.571  37.025 43.892 1.00 42.89  ? 232 MET A CA    1 
ATOM   1541  C  C     . MET A 1 173 ? 57.156  37.817 42.717 1.00 42.89  ? 232 MET A C     1 
ATOM   1542  O  O     . MET A 1 173 ? 58.378  37.840 42.507 1.00 35.41  ? 232 MET A O     1 
ATOM   1543  C  CB    . MET A 1 173 ? 55.538  36.024 43.402 1.00 35.41  ? 232 MET A CB    1 
ATOM   1544  C  CG    . MET A 1 173 ? 56.090  34.981 42.512 1.00 35.41  ? 232 MET A CG    1 
ATOM   1545  S  SD    . MET A 1 173 ? 54.783  34.360 41.508 1.00 35.41  ? 232 MET A SD    1 
ATOM   1546  C  CE    . MET A 1 173 ? 54.054  33.144 42.645 1.00 35.41  ? 232 MET A CE    1 
ATOM   1547  H  H     . MET A 1 173 ? 55.010  37.749 45.098 1.00 0.00   ? 232 MET A H     1 
ATOM   1548  N  N     . LEU A 1 174 ? 56.288  38.493 41.976 1.00 17.52  ? 233 LEU A N     1 
ATOM   1549  C  CA    . LEU A 1 174 ? 56.720  39.280 40.833 1.00 17.52  ? 233 LEU A CA    1 
ATOM   1550  C  C     . LEU A 1 174 ? 57.839  40.232 41.251 1.00 17.52  ? 233 LEU A C     1 
ATOM   1551  O  O     . LEU A 1 174 ? 58.884  40.283 40.607 1.00 28.00  ? 233 LEU A O     1 
ATOM   1552  C  CB    . LEU A 1 174 ? 55.551  40.075 40.248 1.00 28.00  ? 233 LEU A CB    1 
ATOM   1553  C  CG    . LEU A 1 174 ? 54.370  39.282 39.687 1.00 28.00  ? 233 LEU A CG    1 
ATOM   1554  C  CD1   . LEU A 1 174 ? 53.290  40.249 39.266 1.00 28.00  ? 233 LEU A CD1   1 
ATOM   1555  C  CD2   . LEU A 1 174 ? 54.797  38.432 38.493 1.00 28.00  ? 233 LEU A CD2   1 
ATOM   1556  H  H     . LEU A 1 174 ? 55.332  38.456 42.190 1.00 0.00   ? 233 LEU A H     1 
ATOM   1557  N  N     . ASN A 1 175 ? 57.623  40.942 42.358 1.00 43.03  ? 234 ASN A N     1 
ATOM   1558  C  CA    . ASN A 1 175 ? 58.579  41.912 42.889 1.00 43.03  ? 234 ASN A CA    1 
ATOM   1559  C  C     . ASN A 1 175 ? 59.959  41.325 43.179 1.00 43.03  ? 234 ASN A C     1 
ATOM   1560  O  O     . ASN A 1 175 ? 60.961  42.041 43.100 1.00 38.96  ? 234 ASN A O     1 
ATOM   1561  C  CB    . ASN A 1 175 ? 58.033  42.589 44.160 1.00 38.96  ? 234 ASN A CB    1 
ATOM   1562  C  CG    . ASN A 1 175 ? 57.080  43.741 43.865 1.00 38.96  ? 234 ASN A CG    1 
ATOM   1563  O  OD1   . ASN A 1 175 ? 56.809  44.561 44.732 1.00 38.96  ? 234 ASN A OD1   1 
ATOM   1564  N  ND2   . ASN A 1 175 ? 56.572  43.806 42.647 1.00 38.96  ? 234 ASN A ND2   1 
ATOM   1565  H  H     . ASN A 1 175 ? 56.792  40.784 42.854 1.00 0.00   ? 234 ASN A H     1 
ATOM   1566  H  HD21  . ASN A 1 175 ? 55.972  44.567 42.517 1.00 0.00   ? 234 ASN A HD21  1 
ATOM   1567  H  HD22  . ASN A 1 175 ? 56.769  43.156 41.951 1.00 0.00   ? 234 ASN A HD22  1 
ATOM   1568  N  N     . GLU A 1 176 ? 60.011  40.037 43.524 1.00 48.86  ? 235 GLU A N     1 
ATOM   1569  C  CA    . GLU A 1 176 ? 61.271  39.366 43.829 1.00 48.86  ? 235 GLU A CA    1 
ATOM   1570  C  C     . GLU A 1 176 ? 61.988  38.929 42.546 1.00 48.86  ? 235 GLU A C     1 
ATOM   1571  O  O     . GLU A 1 176 ? 63.104  38.405 42.596 1.00 109.08 ? 235 GLU A O     1 
ATOM   1572  C  CB    . GLU A 1 176 ? 61.027  38.168 44.743 1.00 109.08 ? 235 GLU A CB    1 
ATOM   1573  C  CG    . GLU A 1 176 ? 62.257  37.740 45.525 1.00 109.08 ? 235 GLU A CG    1 
ATOM   1574  C  CD    . GLU A 1 176 ? 61.981  36.601 46.485 1.00 109.08 ? 235 GLU A CD    1 
ATOM   1575  O  OE1   . GLU A 1 176 ? 60.845  36.512 46.998 1.00 109.08 ? 235 GLU A OE1   1 
ATOM   1576  O  OE2   . GLU A 1 176 ? 62.906  35.797 46.736 1.00 109.08 ? 235 GLU A OE2   1 
ATOM   1577  H  H     . GLU A 1 176 ? 59.178  39.517 43.587 1.00 0.00   ? 235 GLU A H     1 
ATOM   1578  N  N     . GLY A 1 177 ? 61.353  39.153 41.399 1.00 23.84  ? 236 GLY A N     1 
ATOM   1579  C  CA    . GLY A 1 177 ? 61.953  38.796 40.127 1.00 23.84  ? 236 GLY A CA    1 
ATOM   1580  C  C     . GLY A 1 177 ? 61.351  37.545 39.535 1.00 23.84  ? 236 GLY A C     1 
ATOM   1581  O  O     . GLY A 1 177 ? 61.444  37.299 38.337 1.00 67.93  ? 236 GLY A O     1 
ATOM   1582  H  H     . GLY A 1 177 ? 60.460  39.548 41.400 1.00 0.00   ? 236 GLY A H     1 
ATOM   1583  N  N     . ILE A 1 178 ? 60.715  36.755 40.383 1.00 19.37  ? 237 ILE A N     1 
ATOM   1584  C  CA    . ILE A 1 178 ? 60.105  35.517 39.956 1.00 19.37  ? 237 ILE A CA    1 
ATOM   1585  C  C     . ILE A 1 178 ? 58.879  35.920 39.173 1.00 19.37  ? 237 ILE A C     1 
ATOM   1586  O  O     . ILE A 1 178 ? 58.017  36.605 39.714 1.00 26.21  ? 237 ILE A O     1 
ATOM   1587  C  CB    . ILE A 1 178 ? 59.660  34.698 41.188 1.00 26.21  ? 237 ILE A CB    1 
ATOM   1588  C  CG1   . ILE A 1 178 ? 60.864  34.372 42.082 1.00 26.21  ? 237 ILE A CG1   1 
ATOM   1589  C  CG2   . ILE A 1 178 ? 58.900  33.442 40.764 1.00 26.21  ? 237 ILE A CG2   1 
ATOM   1590  C  CD1   . ILE A 1 178 ? 60.503  33.674 43.358 1.00 26.21  ? 237 ILE A CD1   1 
ATOM   1591  H  H     . ILE A 1 178 ? 60.591  37.045 41.307 1.00 0.00   ? 237 ILE A H     1 
ATOM   1592  N  N     . VAL A 1 179 ? 58.803  35.541 37.904 1.00 34.98  ? 238 VAL A N     1 
ATOM   1593  C  CA    . VAL A 1 179 ? 57.637  35.872 37.085 1.00 34.98  ? 238 VAL A CA    1 
ATOM   1594  C  C     . VAL A 1 179 ? 57.254  34.718 36.155 1.00 34.98  ? 238 VAL A C     1 
ATOM   1595  O  O     . VAL A 1 179 ? 57.713  34.616 35.023 1.00 29.79  ? 238 VAL A O     1 
ATOM   1596  C  CB    . VAL A 1 179 ? 57.821  37.226 36.316 1.00 29.79  ? 238 VAL A CB    1 
ATOM   1597  C  CG1   . VAL A 1 179 ? 59.259  37.439 35.973 1.00 29.79  ? 238 VAL A CG1   1 
ATOM   1598  C  CG2   . VAL A 1 179 ? 56.958  37.286 35.044 1.00 29.79  ? 238 VAL A CG2   1 
ATOM   1599  H  H     . VAL A 1 179 ? 59.553  35.074 37.487 1.00 0.00   ? 238 VAL A H     1 
ATOM   1600  N  N     . PRO A 1 180 ? 56.410  33.814 36.655 1.00 29.03  ? 239 PRO A N     1 
ATOM   1601  C  CA    . PRO A 1 180 ? 55.907  32.632 35.951 1.00 29.03  ? 239 PRO A CA    1 
ATOM   1602  C  C     . PRO A 1 180 ? 55.136  32.977 34.692 1.00 29.03  ? 239 PRO A C     1 
ATOM   1603  O  O     . PRO A 1 180 ? 55.208  34.094 34.198 1.00 52.14  ? 239 PRO A O     1 
ATOM   1604  C  CB    . PRO A 1 180 ? 54.995  31.985 36.990 1.00 52.14  ? 239 PRO A CB    1 
ATOM   1605  C  CG    . PRO A 1 180 ? 54.507  33.159 37.779 1.00 52.14  ? 239 PRO A CG    1 
ATOM   1606  C  CD    . PRO A 1 180 ? 55.777  33.936 37.977 1.00 52.14  ? 239 PRO A CD    1 
ATOM   1607  N  N     . THR A 1 181 ? 54.437  31.992 34.148 1.00 28.13  ? 240 THR A N     1 
ATOM   1608  C  CA    . THR A 1 181 ? 53.643  32.203 32.942 1.00 28.13  ? 240 THR A CA    1 
ATOM   1609  C  C     . THR A 1 181 ? 52.295  31.507 33.106 1.00 28.13  ? 240 THR A C     1 
ATOM   1610  O  O     . THR A 1 181 ? 51.489  31.444 32.176 1.00 48.52  ? 240 THR A O     1 
ATOM   1611  C  CB    . THR A 1 181 ? 54.353  31.662 31.656 1.00 48.52  ? 240 THR A CB    1 
ATOM   1612  O  OG1   . THR A 1 181 ? 54.685  30.272 31.821 1.00 48.52  ? 240 THR A OG1   1 
ATOM   1613  C  CG2   . THR A 1 181 ? 55.617  32.464 31.356 1.00 48.52  ? 240 THR A CG2   1 
ATOM   1614  H  H     . THR A 1 181 ? 54.449  31.103 34.553 1.00 0.00   ? 240 THR A H     1 
ATOM   1615  H  HG1   . THR A 1 181 ? 55.414  30.264 32.446 1.00 30.00  ? 240 THR A HG1   1 
ATOM   1616  N  N     . ALA A 1 182 ? 52.094  30.935 34.286 1.00 23.21  ? 241 ALA A N     1 
ATOM   1617  C  CA    . ALA A 1 182 ? 50.868  30.239 34.642 1.00 23.21  ? 241 ALA A CA    1 
ATOM   1618  C  C     . ALA A 1 182 ? 50.883  30.186 36.145 1.00 23.21  ? 241 ALA A C     1 
ATOM   1619  O  O     . ALA A 1 182 ? 51.955  30.129 36.801 1.00 18.60  ? 241 ALA A O     1 
ATOM   1620  C  CB    . ALA A 1 182 ? 50.841  28.837 34.089 1.00 18.60  ? 241 ALA A CB    1 
ATOM   1621  H  H     . ALA A 1 182 ? 52.773  30.973 34.995 1.00 0.00   ? 241 ALA A H     1 
ATOM   1622  N  N     . MET A 1 183 ? 49.690  30.204 36.702 1.00 14.25  ? 242 MET A N     1 
ATOM   1623  C  CA    . MET A 1 183 ? 49.571  30.174 38.138 1.00 14.25  ? 242 MET A CA    1 
ATOM   1624  C  C     . MET A 1 183 ? 48.439  29.300 38.487 1.00 14.25  ? 242 MET A C     1 
ATOM   1625  O  O     . MET A 1 183 ? 47.463  29.270 37.759 1.00 29.26  ? 242 MET A O     1 
ATOM   1626  C  CB    . MET A 1 183 ? 49.275  31.571 38.666 1.00 29.26  ? 242 MET A CB    1 
ATOM   1627  C  CG    . MET A 1 183 ? 50.511  32.377 38.919 1.00 29.26  ? 242 MET A CG    1 
ATOM   1628  S  SD    . MET A 1 183 ? 50.210  33.386 40.350 1.00 29.26  ? 242 MET A SD    1 
ATOM   1629  C  CE    . MET A 1 183 ? 49.698  34.856 39.433 1.00 29.26  ? 242 MET A CE    1 
ATOM   1630  H  H     . MET A 1 183 ? 48.872  30.252 36.163 1.00 0.00   ? 242 MET A H     1 
ATOM   1631  N  N     . LEU A 1 184 ? 48.602  28.560 39.570 1.00 32.27  ? 243 LEU A N     1 
ATOM   1632  C  CA    . LEU A 1 184 ? 47.569  27.692 40.095 1.00 32.27  ? 243 LEU A CA    1 
ATOM   1633  C  C     . LEU A 1 184 ? 47.218  28.337 41.423 1.00 32.27  ? 243 LEU A C     1 
ATOM   1634  O  O     . LEU A 1 184 ? 48.104  28.530 42.269 1.00 15.50  ? 243 LEU A O     1 
ATOM   1635  C  CB    . LEU A 1 184 ? 48.137  26.313 40.366 1.00 15.50  ? 243 LEU A CB    1 
ATOM   1636  C  CG    . LEU A 1 184 ? 48.362  25.337 39.238 1.00 15.50  ? 243 LEU A CG    1 
ATOM   1637  C  CD1   . LEU A 1 184 ? 49.125  24.148 39.845 1.00 15.50  ? 243 LEU A CD1   1 
ATOM   1638  C  CD2   . LEU A 1 184 ? 47.044  24.904 38.643 1.00 15.50  ? 243 LEU A CD2   1 
ATOM   1639  H  H     . LEU A 1 184 ? 49.455  28.606 40.065 1.00 0.00   ? 243 LEU A H     1 
ATOM   1640  N  N     . VAL A 1 185 ? 45.943  28.661 41.619 1.00 40.92  ? 244 VAL A N     1 
ATOM   1641  C  CA    . VAL A 1 185 ? 45.518  29.311 42.863 1.00 40.92  ? 244 VAL A CA    1 
ATOM   1642  C  C     . VAL A 1 185 ? 44.472  28.493 43.635 1.00 40.92  ? 244 VAL A C     1 
ATOM   1643  O  O     . VAL A 1 185 ? 43.561  27.954 43.029 1.00 24.79  ? 244 VAL A O     1 
ATOM   1644  C  CB    . VAL A 1 185 ? 45.026  30.751 42.576 1.00 24.79  ? 244 VAL A CB    1 
ATOM   1645  C  CG1   . VAL A 1 185 ? 44.678  31.443 43.863 1.00 24.79  ? 244 VAL A CG1   1 
ATOM   1646  C  CG2   . VAL A 1 185 ? 46.119  31.538 41.835 1.00 24.79  ? 244 VAL A CG2   1 
ATOM   1647  H  H     . VAL A 1 185 ? 45.250  28.461 40.952 1.00 0.00   ? 244 VAL A H     1 
ATOM   1648  N  N     . ALA A 1 186 ? 44.653  28.369 44.955 1.00 19.31  ? 245 ALA A N     1 
ATOM   1649  C  CA    . ALA A 1 186 ? 43.774  27.593 45.867 1.00 19.31  ? 245 ALA A CA    1 
ATOM   1650  C  C     . ALA A 1 186 ? 42.256  27.860 45.809 1.00 19.31  ? 245 ALA A C     1 
ATOM   1651  O  O     . ALA A 1 186 ? 41.447  26.991 46.148 1.00 22.75  ? 245 ALA A O     1 
ATOM   1652  C  CB    . ALA A 1 186 ? 44.263  27.728 47.276 1.00 22.75  ? 245 ALA A CB    1 
ATOM   1653  H  H     . ALA A 1 186 ? 45.425  28.828 45.345 1.00 0.00   ? 245 ALA A H     1 
ATOM   1654  N  N     . ASN A 1 187 ? 41.880  29.075 45.426 1.00 23.73  ? 246 ASN A N     1 
ATOM   1655  C  CA    . ASN A 1 187 ? 40.485  29.435 45.263 1.00 23.73  ? 246 ASN A CA    1 
ATOM   1656  C  C     . ASN A 1 187 ? 40.425  30.650 44.354 1.00 23.73  ? 246 ASN A C     1 
ATOM   1657  O  O     . ASN A 1 187 ? 41.459  31.215 44.005 1.00 24.06  ? 246 ASN A O     1 
ATOM   1658  C  CB    . ASN A 1 187 ? 39.790  29.664 46.607 1.00 24.06  ? 246 ASN A CB    1 
ATOM   1659  C  CG    . ASN A 1 187 ? 40.131  30.990 47.248 1.00 24.06  ? 246 ASN A CG    1 
ATOM   1660  O  OD1   . ASN A 1 187 ? 40.872  31.799 46.698 1.00 24.06  ? 246 ASN A OD1   1 
ATOM   1661  N  ND2   . ASN A 1 187 ? 39.568  31.228 48.427 1.00 24.06  ? 246 ASN A ND2   1 
ATOM   1662  H  H     . ASN A 1 187 ? 42.545  29.765 45.229 1.00 0.00   ? 246 ASN A H     1 
ATOM   1663  H  HD21  . ASN A 1 187 ? 39.722  32.082 48.889 1.00 0.00   ? 246 ASN A HD21  1 
ATOM   1664  H  HD22  . ASN A 1 187 ? 38.992  30.519 48.778 1.00 0.00   ? 246 ASN A HD22  1 
ATOM   1665  N  N     . ASP A 1 188 ? 39.221  31.030 43.941 1.00 15.82  ? 247 ASP A N     1 
ATOM   1666  C  CA    . ASP A 1 188 ? 39.015  32.172 43.037 1.00 15.82  ? 247 ASP A CA    1 
ATOM   1667  C  C     . ASP A 1 188 ? 39.229  33.562 43.656 1.00 15.82  ? 247 ASP A C     1 
ATOM   1668  O  O     . ASP A 1 188 ? 39.766  34.441 43.001 1.00 26.23  ? 247 ASP A O     1 
ATOM   1669  C  CB    . ASP A 1 188 ? 37.634  32.078 42.367 1.00 26.23  ? 247 ASP A CB    1 
ATOM   1670  C  CG    . ASP A 1 188 ? 37.477  30.828 41.512 1.00 26.23  ? 247 ASP A CG    1 
ATOM   1671  O  OD1   . ASP A 1 188 ? 38.471  30.104 41.309 1.00 26.23  ? 247 ASP A OD1   1 
ATOM   1672  O  OD2   . ASP A 1 188 ? 36.362  30.555 41.034 1.00 26.23  ? 247 ASP A OD2   1 
ATOM   1673  H  H     . ASP A 1 188 ? 38.440  30.503 44.220 1.00 0.00   ? 247 ASP A H     1 
ATOM   1674  N  N     . GLN A 1 189 ? 38.841  33.763 44.911 1.00 7.68   ? 248 GLN A N     1 
ATOM   1675  C  CA    . GLN A 1 189 ? 39.021  35.073 45.531 1.00 7.68   ? 248 GLN A CA    1 
ATOM   1676  C  C     . GLN A 1 189 ? 40.458  35.447 45.440 1.00 7.68   ? 248 GLN A C     1 
ATOM   1677  O  O     . GLN A 1 189 ? 40.793  36.545 45.017 1.00 32.37  ? 248 GLN A O     1 
ATOM   1678  C  CB    . GLN A 1 189 ? 38.572  35.096 46.982 1.00 32.37  ? 248 GLN A CB    1 
ATOM   1679  C  CG    . GLN A 1 189 ? 37.128  35.458 47.121 1.00 32.37  ? 248 GLN A CG    1 
ATOM   1680  C  CD    . GLN A 1 189 ? 36.624  35.235 48.503 1.00 32.37  ? 248 GLN A CD    1 
ATOM   1681  O  OE1   . GLN A 1 189 ? 36.302  34.108 48.883 1.00 32.37  ? 248 GLN A OE1   1 
ATOM   1682  N  NE2   . GLN A 1 189 ? 36.510  36.309 49.269 1.00 32.37  ? 248 GLN A NE2   1 
ATOM   1683  H  H     . GLN A 1 189 ? 38.450  33.035 45.443 1.00 0.00   ? 248 GLN A H     1 
ATOM   1684  N  N     . MET A 1 190 ? 41.321  34.531 45.824 1.00 2.00   ? 249 MET A N     1 
ATOM   1685  C  CA    . MET A 1 190 ? 42.750  34.809 45.703 1.00 2.00   ? 249 MET A CA    1 
ATOM   1686  C  C     . MET A 1 190 ? 43.094  35.011 44.209 1.00 2.00   ? 249 MET A C     1 
ATOM   1687  O  O     . MET A 1 190 ? 43.799  35.961 43.854 1.00 25.97  ? 249 MET A O     1 
ATOM   1688  C  CB    . MET A 1 190 ? 43.579  33.659 46.281 1.00 25.97  ? 249 MET A CB    1 
ATOM   1689  C  CG    . MET A 1 190 ? 43.295  33.349 47.723 1.00 25.97  ? 249 MET A CG    1 
ATOM   1690  S  SD    . MET A 1 190 ? 44.570  32.348 48.431 1.00 25.97  ? 249 MET A SD    1 
ATOM   1691  C  CE    . MET A 1 190 ? 45.737  33.570 48.618 1.00 25.97  ? 249 MET A CE    1 
ATOM   1692  H  H     . MET A 1 190 ? 41.017  33.679 46.201 1.00 0.00   ? 249 MET A H     1 
ATOM   1693  N  N     . ALA A 1 191 ? 42.583  34.120 43.351 1.00 14.03  ? 250 ALA A N     1 
ATOM   1694  C  CA    . ALA A 1 191 ? 42.835  34.173 41.907 1.00 14.03  ? 250 ALA A CA    1 
ATOM   1695  C  C     . ALA A 1 191 ? 42.624  35.576 41.435 1.00 14.03  ? 250 ALA A C     1 
ATOM   1696  O  O     . ALA A 1 191 ? 43.436  36.096 40.704 1.00 34.96  ? 250 ALA A O     1 
ATOM   1697  C  CB    . ALA A 1 191 ? 41.921  33.234 41.169 1.00 34.96  ? 250 ALA A CB    1 
ATOM   1698  H  H     . ALA A 1 191 ? 42.013  33.403 43.709 1.00 0.00   ? 250 ALA A H     1 
ATOM   1699  N  N     . LEU A 1 192 ? 41.572  36.218 41.936 1.00 32.81  ? 251 LEU A N     1 
ATOM   1700  C  CA    . LEU A 1 192 ? 41.257  37.600 41.583 1.00 32.81  ? 251 LEU A CA    1 
ATOM   1701  C  C     . LEU A 1 192 ? 42.427  38.511 41.966 1.00 32.81  ? 251 LEU A C     1 
ATOM   1702  O  O     . LEU A 1 192 ? 42.916  39.300 41.149 1.00 25.58  ? 251 LEU A O     1 
ATOM   1703  C  CB    . LEU A 1 192 ? 39.990  38.069 42.305 1.00 25.58  ? 251 LEU A CB    1 
ATOM   1704  C  CG    . LEU A 1 192 ? 39.650  39.554 42.134 1.00 25.58  ? 251 LEU A CG    1 
ATOM   1705  C  CD1   . LEU A 1 192 ? 39.690  39.955 40.674 1.00 25.58  ? 251 LEU A CD1   1 
ATOM   1706  C  CD2   . LEU A 1 192 ? 38.306  39.860 42.715 1.00 25.58  ? 251 LEU A CD2   1 
ATOM   1707  H  H     . LEU A 1 192 ? 41.021  35.758 42.595 1.00 0.00   ? 251 LEU A H     1 
ATOM   1708  N  N     . GLY A 1 193 ? 42.873  38.385 43.211 1.00 19.41  ? 252 GLY A N     1 
ATOM   1709  C  CA    . GLY A 1 193 ? 43.975  39.187 43.709 1.00 19.41  ? 252 GLY A CA    1 
ATOM   1710  C  C     . GLY A 1 193 ? 45.247  38.963 42.917 1.00 19.41  ? 252 GLY A C     1 
ATOM   1711  O  O     . GLY A 1 193 ? 45.984  39.922 42.658 1.00 49.25  ? 252 GLY A O     1 
ATOM   1712  H  H     . GLY A 1 193 ? 42.446  37.736 43.810 1.00 0.00   ? 252 GLY A H     1 
ATOM   1713  N  N     . ALA A 1 194 ? 45.505  37.712 42.535 1.00 28.11  ? 253 ALA A N     1 
ATOM   1714  C  CA    . ALA A 1 194 ? 46.681  37.366 41.747 1.00 28.11  ? 253 ALA A CA    1 
ATOM   1715  C  C     . ALA A 1 194 ? 46.560  38.069 40.404 1.00 28.11  ? 253 ALA A C     1 
ATOM   1716  O  O     . ALA A 1 194 ? 47.509  38.664 39.910 1.00 27.55  ? 253 ALA A O     1 
ATOM   1717  C  CB    . ALA A 1 194 ? 46.765  35.865 41.553 1.00 27.55  ? 253 ALA A CB    1 
ATOM   1718  H  H     . ALA A 1 194 ? 44.866  37.016 42.775 1.00 0.00   ? 253 ALA A H     1 
ATOM   1719  N  N     . MET A 1 195 ? 45.363  38.039 39.843 1.00 14.40  ? 254 MET A N     1 
ATOM   1720  C  CA    . MET A 1 195 ? 45.077  38.683 38.566 1.00 14.40  ? 254 MET A CA    1 
ATOM   1721  C  C     . MET A 1 195 ? 45.189  40.184 38.641 1.00 14.40  ? 254 MET A C     1 
ATOM   1722  O  O     . MET A 1 195 ? 45.380  40.832 37.625 1.00 32.65  ? 254 MET A O     1 
ATOM   1723  C  CB    . MET A 1 195 ? 43.663  38.380 38.113 1.00 32.65  ? 254 MET A CB    1 
ATOM   1724  C  CG    . MET A 1 195 ? 43.316  36.943 38.003 1.00 32.65  ? 254 MET A CG    1 
ATOM   1725  S  SD    . MET A 1 195 ? 42.041  36.906 36.783 1.00 32.65  ? 254 MET A SD    1 
ATOM   1726  C  CE    . MET A 1 195 ? 40.620  37.397 37.676 1.00 32.65  ? 254 MET A CE    1 
ATOM   1727  H  H     . MET A 1 195 ? 44.638  37.574 40.303 1.00 0.00   ? 254 MET A H     1 
ATOM   1728  N  N     . ARG A 1 196 ? 44.947  40.743 39.824 1.00 23.65  ? 255 ARG A N     1 
ATOM   1729  C  CA    . ARG A 1 196 ? 45.030  42.192 40.039 1.00 23.65  ? 255 ARG A CA    1 
ATOM   1730  C  C     . ARG A 1 196 ? 46.501  42.612 40.026 1.00 23.65  ? 255 ARG A C     1 
ATOM   1731  O  O     . ARG A 1 196 ? 46.879  43.630 39.434 1.00 34.39  ? 255 ARG A O     1 
ATOM   1732  C  CB    . ARG A 1 196 ? 44.417  42.547 41.385 1.00 34.39  ? 255 ARG A CB    1 
ATOM   1733  C  CG    . ARG A 1 196 ? 44.685  43.962 41.797 1.00 34.39  ? 255 ARG A CG    1 
ATOM   1734  C  CD    . ARG A 1 196 ? 43.903  44.931 40.941 1.00 34.39  ? 255 ARG A CD    1 
ATOM   1735  N  NE    . ARG A 1 196 ? 44.676  46.143 40.795 1.00 34.39  ? 255 ARG A NE    1 
ATOM   1736  C  CZ    . ARG A 1 196 ? 44.707  47.107 41.692 1.00 34.39  ? 255 ARG A CZ    1 
ATOM   1737  N  NH1   . ARG A 1 196 ? 43.980  47.012 42.796 1.00 34.39  ? 255 ARG A NH1   1 
ATOM   1738  N  NH2   . ARG A 1 196 ? 45.552  48.108 41.531 1.00 34.39  ? 255 ARG A NH2   1 
ATOM   1739  H  H     . ARG A 1 196 ? 44.669  40.175 40.571 1.00 0.00   ? 255 ARG A H     1 
ATOM   1740  H  HE    . ARG A 1 196 ? 45.213  46.248 39.982 1.00 0.00   ? 255 ARG A HE    1 
ATOM   1741  H  HH11  . ARG A 1 196 ? 43.423  46.213 42.970 1.00 0.00   ? 255 ARG A HH11  1 
ATOM   1742  H  HH12  . ARG A 1 196 ? 43.999  47.753 43.467 1.00 0.00   ? 255 ARG A HH12  1 
ATOM   1743  H  HH21  . ARG A 1 196 ? 46.152  48.107 40.730 1.00 0.00   ? 255 ARG A HH21  1 
ATOM   1744  H  HH22  . ARG A 1 196 ? 45.597  48.854 42.197 1.00 0.00   ? 255 ARG A HH22  1 
ATOM   1745  N  N     . ALA A 1 197 ? 47.312  41.821 40.737 1.00 45.53  ? 256 ALA A N     1 
ATOM   1746  C  CA    . ALA A 1 197 ? 48.758  42.012 40.850 1.00 45.53  ? 256 ALA A CA    1 
ATOM   1747  C  C     . ALA A 1 197 ? 49.383  41.917 39.462 1.00 45.53  ? 256 ALA A C     1 
ATOM   1748  O  O     . ALA A 1 197 ? 50.165  42.780 39.064 1.00 30.23  ? 256 ALA A O     1 
ATOM   1749  C  CB    . ALA A 1 197 ? 49.332  40.961 41.743 1.00 30.23  ? 256 ALA A CB    1 
ATOM   1750  H  H     . ALA A 1 197 ? 46.882  41.076 41.209 1.00 0.00   ? 256 ALA A H     1 
ATOM   1751  N  N     . ILE A 1 198 ? 48.989  40.908 38.699 1.00 28.52  ? 257 ILE A N     1 
ATOM   1752  C  CA    . ILE A 1 198 ? 49.527  40.743 37.369 1.00 28.52  ? 257 ILE A CA    1 
ATOM   1753  C  C     . ILE A 1 198 ? 49.307  41.989 36.520 1.00 28.52  ? 257 ILE A C     1 
ATOM   1754  O  O     . ILE A 1 198 ? 50.228  42.435 35.833 1.00 32.71  ? 257 ILE A O     1 
ATOM   1755  C  CB    . ILE A 1 198 ? 48.962  39.488 36.709 1.00 32.71  ? 257 ILE A CB    1 
ATOM   1756  C  CG1   . ILE A 1 198 ? 49.399  38.266 37.531 1.00 32.71  ? 257 ILE A CG1   1 
ATOM   1757  C  CG2   . ILE A 1 198 ? 49.453  39.380 35.263 1.00 32.71  ? 257 ILE A CG2   1 
ATOM   1758  C  CD1   . ILE A 1 198 ? 48.639  37.007 37.222 1.00 32.71  ? 257 ILE A CD1   1 
ATOM   1759  H  H     . ILE A 1 198 ? 48.326  40.265 39.040 1.00 0.00   ? 257 ILE A H     1 
ATOM   1760  N  N     . THR A 1 199 ? 48.125  42.593 36.614 1.00 31.15  ? 258 THR A N     1 
ATOM   1761  C  CA    . THR A 1 199 ? 47.838  43.814 35.847 1.00 31.15  ? 258 THR A CA    1 
ATOM   1762  C  C     . THR A 1 199 ? 48.549  45.000 36.471 1.00 31.15  ? 258 THR A C     1 
ATOM   1763  O  O     . THR A 1 199 ? 48.901  45.966 35.805 1.00 26.26  ? 258 THR A O     1 
ATOM   1764  C  CB    . THR A 1 199 ? 46.343  44.169 35.851 1.00 26.26  ? 258 THR A CB    1 
ATOM   1765  O  OG1   . THR A 1 199 ? 45.942  44.582 37.165 1.00 26.26  ? 258 THR A OG1   1 
ATOM   1766  C  CG2   . THR A 1 199 ? 45.517  42.996 35.405 1.00 26.26  ? 258 THR A CG2   1 
ATOM   1767  H  H     . THR A 1 199 ? 47.416  42.249 37.196 1.00 0.00   ? 258 THR A H     1 
ATOM   1768  H  HG1   . THR A 1 199 ? 45.001  44.779 37.196 1.00 30.00  ? 258 THR A HG1   1 
ATOM   1769  N  N     . GLU A 1 200 ? 48.649  44.950 37.787 1.00 22.42  ? 259 GLU A N     1 
ATOM   1770  C  CA    . GLU A 1 200 ? 49.289  45.984 38.564 1.00 22.42  ? 259 GLU A CA    1 
ATOM   1771  C  C     . GLU A 1 200 ? 50.727  46.134 38.082 1.00 22.42  ? 259 GLU A C     1 
ATOM   1772  O  O     . GLU A 1 200 ? 51.323  47.206 38.201 1.00 49.08  ? 259 GLU A O     1 
ATOM   1773  C  CB    . GLU A 1 200 ? 49.261  45.583 40.046 1.00 49.08  ? 259 GLU A CB    1 
ATOM   1774  C  CG    . GLU A 1 200 ? 49.908  46.570 40.994 1.00 49.08  ? 259 GLU A CG    1 
ATOM   1775  C  CD    . GLU A 1 200 ? 49.299  47.966 40.922 1.00 49.08  ? 259 GLU A CD    1 
ATOM   1776  O  OE1   . GLU A 1 200 ? 48.142  48.102 40.473 1.00 49.08  ? 259 GLU A OE1   1 
ATOM   1777  O  OE2   . GLU A 1 200 ? 49.982  48.933 41.320 1.00 49.08  ? 259 GLU A OE2   1 
ATOM   1778  H  H     . GLU A 1 200 ? 48.226  44.206 38.254 1.00 0.00   ? 259 GLU A H     1 
ATOM   1779  N  N     . SER A 1 201 ? 51.258  45.066 37.491 1.00 63.26  ? 260 SER A N     1 
ATOM   1780  C  CA    . SER A 1 201 ? 52.631  45.054 37.009 1.00 63.26  ? 260 SER A CA    1 
ATOM   1781  C  C     . SER A 1 201 ? 52.816  45.030 35.472 1.00 63.26  ? 260 SER A C     1 
ATOM   1782  O  O     . SER A 1 201 ? 53.730  44.367 34.966 1.00 50.91  ? 260 SER A O     1 
ATOM   1783  C  CB    . SER A 1 201 ? 53.351  43.871 37.649 1.00 50.91  ? 260 SER A CB    1 
ATOM   1784  O  OG    . SER A 1 201 ? 53.038  43.775 39.034 1.00 50.91  ? 260 SER A OG    1 
ATOM   1785  H  H     . SER A 1 201 ? 50.731  44.246 37.400 1.00 0.00   ? 260 SER A H     1 
ATOM   1786  H  HG    . SER A 1 201 ? 52.106  43.543 39.129 1.00 30.00  ? 260 SER A HG    1 
ATOM   1787  N  N     . GLY A 1 202 ? 51.954  45.737 34.734 1.00 23.09  ? 261 GLY A N     1 
ATOM   1788  C  CA    . GLY A 1 202 ? 52.061  45.799 33.277 1.00 23.09  ? 261 GLY A CA    1 
ATOM   1789  C  C     . GLY A 1 202 ? 51.753  44.514 32.521 1.00 23.09  ? 261 GLY A C     1 
ATOM   1790  O  O     . GLY A 1 202 ? 51.444  44.543 31.322 1.00 38.01  ? 261 GLY A O     1 
ATOM   1791  H  H     . GLY A 1 202 ? 51.216  46.205 35.180 1.00 0.00   ? 261 GLY A H     1 
ATOM   1792  N  N     . LEU A 1 203 ? 51.828  43.386 33.222 1.00 32.24  ? 262 LEU A N     1 
ATOM   1793  C  CA    . LEU A 1 203 ? 51.569  42.082 32.630 1.00 32.24  ? 262 LEU A CA    1 
ATOM   1794  C  C     . LEU A 1 203 ? 50.097  41.875 32.276 1.00 32.24  ? 262 LEU A C     1 
ATOM   1795  O  O     . LEU A 1 203 ? 49.222  42.669 32.653 1.00 35.61  ? 262 LEU A O     1 
ATOM   1796  C  CB    . LEU A 1 203 ? 52.091  40.990 33.553 1.00 35.61  ? 262 LEU A CB    1 
ATOM   1797  C  CG    . LEU A 1 203 ? 53.579  41.267 33.785 1.00 35.61  ? 262 LEU A CG    1 
ATOM   1798  C  CD1   . LEU A 1 203 ? 54.112  40.548 34.995 1.00 35.61  ? 262 LEU A CD1   1 
ATOM   1799  C  CD2   . LEU A 1 203 ? 54.380  40.922 32.545 1.00 35.61  ? 262 LEU A CD2   1 
ATOM   1800  H  H     . LEU A 1 203 ? 52.047  43.394 34.167 1.00 0.00   ? 262 LEU A H     1 
ATOM   1801  N  N     . ARG A 1 204 ? 49.836  40.812 31.522 1.00 27.28  ? 263 ARG A N     1 
ATOM   1802  C  CA    . ARG A 1 204 ? 48.492  40.498 31.073 1.00 27.28  ? 263 ARG A CA    1 
ATOM   1803  C  C     . ARG A 1 204 ? 48.098  39.109 31.496 1.00 27.28  ? 263 ARG A C     1 
ATOM   1804  O  O     . ARG A 1 204 ? 48.922  38.206 31.468 1.00 48.21  ? 263 ARG A O     1 
ATOM   1805  C  CB    . ARG A 1 204 ? 48.413  40.659 29.561 1.00 48.21  ? 263 ARG A CB    1 
ATOM   1806  C  CG    . ARG A 1 204 ? 48.614  42.100 29.157 1.00 48.21  ? 263 ARG A CG    1 
ATOM   1807  C  CD    . ARG A 1 204 ? 49.442  42.226 27.920 1.00 48.21  ? 263 ARG A CD    1 
ATOM   1808  N  NE    . ARG A 1 204 ? 48.655  41.947 26.728 1.00 48.21  ? 263 ARG A NE    1 
ATOM   1809  C  CZ    . ARG A 1 204 ? 49.108  41.270 25.683 1.00 48.21  ? 263 ARG A CZ    1 
ATOM   1810  N  NH1   . ARG A 1 204 ? 50.349  40.780 25.683 1.00 48.21  ? 263 ARG A NH1   1 
ATOM   1811  N  NH2   . ARG A 1 204 ? 48.338  41.153 24.612 1.00 48.21  ? 263 ARG A NH2   1 
ATOM   1812  H  H     . ARG A 1 204 ? 50.570  40.222 31.302 1.00 0.00   ? 263 ARG A H     1 
ATOM   1813  H  HE    . ARG A 1 204 ? 47.731  42.272 26.695 1.00 0.00   ? 263 ARG A HE    1 
ATOM   1814  H  HH11  . ARG A 1 204 ? 50.946  40.926 26.473 1.00 0.00   ? 263 ARG A HH11  1 
ATOM   1815  H  HH12  . ARG A 1 204 ? 50.687  40.273 24.893 1.00 0.00   ? 263 ARG A HH12  1 
ATOM   1816  H  HH21  . ARG A 1 204 ? 47.427  41.565 24.596 1.00 0.00   ? 263 ARG A HH21  1 
ATOM   1817  H  HH22  . ARG A 1 204 ? 48.670  40.641 23.821 1.00 0.00   ? 263 ARG A HH22  1 
ATOM   1818  N  N     . VAL A 1 205 ? 46.836  38.945 31.887 1.00 36.06  ? 264 VAL A N     1 
ATOM   1819  C  CA    . VAL A 1 205 ? 46.330  37.653 32.350 1.00 36.06  ? 264 VAL A CA    1 
ATOM   1820  C  C     . VAL A 1 205 ? 45.935  36.774 31.169 1.00 36.06  ? 264 VAL A C     1 
ATOM   1821  O  O     . VAL A 1 205 ? 45.225  37.212 30.264 1.00 40.23  ? 264 VAL A O     1 
ATOM   1822  C  CB    . VAL A 1 205 ? 45.142  37.826 33.320 1.00 40.23  ? 264 VAL A CB    1 
ATOM   1823  C  CG1   . VAL A 1 205 ? 44.840  36.505 34.025 1.00 40.23  ? 264 VAL A CG1   1 
ATOM   1824  C  CG2   . VAL A 1 205 ? 45.471  38.899 34.348 1.00 40.23  ? 264 VAL A CG2   1 
ATOM   1825  H  H     . VAL A 1 205 ? 46.219  39.702 31.845 1.00 0.00   ? 264 VAL A H     1 
ATOM   1826  N  N     . GLY A 1 206 ? 46.430  35.542 31.172 1.00 28.59  ? 265 GLY A N     1 
ATOM   1827  C  CA    . GLY A 1 206 ? 46.163  34.624 30.086 1.00 28.59  ? 265 GLY A CA    1 
ATOM   1828  C  C     . GLY A 1 206 ? 47.355  34.736 29.176 1.00 28.59  ? 265 GLY A C     1 
ATOM   1829  O  O     . GLY A 1 206 ? 48.294  33.948 29.281 1.00 36.44  ? 265 GLY A O     1 
ATOM   1830  H  H     . GLY A 1 206 ? 47.003  35.266 31.919 1.00 0.00   ? 265 GLY A H     1 
ATOM   1831  N  N     . ALA A 1 207 ? 47.359  35.806 28.383 1.00 52.57  ? 266 ALA A N     1 
ATOM   1832  C  CA    . ALA A 1 207 ? 48.425  36.103 27.418 1.00 52.57  ? 266 ALA A CA    1 
ATOM   1833  C  C     . ALA A 1 207 ? 49.820  36.062 28.032 1.00 52.57  ? 266 ALA A C     1 
ATOM   1834  O  O     . ALA A 1 207 ? 50.694  35.332 27.559 1.00 46.26  ? 266 ALA A O     1 
ATOM   1835  C  CB    . ALA A 1 207 ? 48.180  37.459 26.755 1.00 46.26  ? 266 ALA A CB    1 
ATOM   1836  H  H     . ALA A 1 207 ? 46.593  36.416 28.474 1.00 0.00   ? 266 ALA A H     1 
ATOM   1837  N  N     . ASP A 1 208 ? 50.037  36.875 29.058 1.00 21.28  ? 267 ASP A N     1 
ATOM   1838  C  CA    . ASP A 1 208 ? 51.327  36.903 29.721 1.00 21.28  ? 267 ASP A CA    1 
ATOM   1839  C  C     . ASP A 1 208 ? 51.352  35.835 30.815 1.00 21.28  ? 267 ASP A C     1 
ATOM   1840  O  O     . ASP A 1 208 ? 51.909  34.742 30.628 1.00 45.87  ? 267 ASP A O     1 
ATOM   1841  C  CB    . ASP A 1 208 ? 51.618  38.292 30.311 1.00 45.87  ? 267 ASP A CB    1 
ATOM   1842  C  CG    . ASP A 1 208 ? 51.829  39.354 29.250 1.00 45.87  ? 267 ASP A CG    1 
ATOM   1843  O  OD1   . ASP A 1 208 ? 52.279  39.021 28.137 1.00 45.87  ? 267 ASP A OD1   1 
ATOM   1844  O  OD2   . ASP A 1 208 ? 51.570  40.540 29.531 1.00 45.87  ? 267 ASP A OD2   1 
ATOM   1845  H  H     . ASP A 1 208 ? 49.308  37.421 29.403 1.00 0.00   ? 267 ASP A H     1 
ATOM   1846  N  N     . ILE A 1 209 ? 50.729  36.154 31.950 1.00 42.39  ? 268 ILE A N     1 
ATOM   1847  C  CA    . ILE A 1 209 ? 50.666  35.246 33.095 1.00 42.39  ? 268 ILE A CA    1 
ATOM   1848  C  C     . ILE A 1 209 ? 49.265  34.620 33.201 1.00 42.39  ? 268 ILE A C     1 
ATOM   1849  O  O     . ILE A 1 209 ? 48.300  35.311 33.512 1.00 21.62  ? 268 ILE A O     1 
ATOM   1850  C  CB    . ILE A 1 209 ? 51.032  35.992 34.384 1.00 21.62  ? 268 ILE A CB    1 
ATOM   1851  C  CG1   . ILE A 1 209 ? 52.291  36.820 34.151 1.00 21.62  ? 268 ILE A CG1   1 
ATOM   1852  C  CG2   . ILE A 1 209 ? 51.276  35.004 35.520 1.00 21.62  ? 268 ILE A CG2   1 
ATOM   1853  C  CD1   . ILE A 1 209 ? 52.900  37.335 35.411 1.00 21.62  ? 268 ILE A CD1   1 
ATOM   1854  H  H     . ILE A 1 209 ? 50.271  37.012 32.034 1.00 0.00   ? 268 ILE A H     1 
ATOM   1855  N  N     . SER A 1 210 ? 49.153  33.348 32.824 1.00 32.29  ? 269 SER A N     1 
ATOM   1856  C  CA    . SER A 1 210 ? 47.889  32.615 32.852 1.00 32.29  ? 269 SER A CA    1 
ATOM   1857  C  C     . SER A 1 210 ? 47.489  32.283 34.292 1.00 32.29  ? 269 SER A C     1 
ATOM   1858  O  O     . SER A 1 210 ? 48.360  32.060 35.145 1.00 32.26  ? 269 SER A O     1 
ATOM   1859  C  CB    . SER A 1 210 ? 47.996  31.329 32.012 1.00 32.26  ? 269 SER A CB    1 
ATOM   1860  O  OG    . SER A 1 210 ? 47.978  31.587 30.604 1.00 32.26  ? 269 SER A OG    1 
ATOM   1861  H  H     . SER A 1 210 ? 49.956  32.888 32.497 1.00 0.00   ? 269 SER A H     1 
ATOM   1862  H  HG    . SER A 1 210 ? 48.606  32.277 30.317 1.00 30.00  ? 269 SER A HG    1 
ATOM   1863  N  N     . VAL A 1 211 ? 46.179  32.260 34.562 1.00 21.11  ? 270 VAL A N     1 
ATOM   1864  C  CA    . VAL A 1 211 ? 45.662  31.968 35.908 1.00 21.11  ? 270 VAL A CA    1 
ATOM   1865  C  C     . VAL A 1 211 ? 44.472  31.018 36.015 1.00 21.11  ? 270 VAL A C     1 
ATOM   1866  O  O     . VAL A 1 211 ? 43.435  31.242 35.408 1.00 12.88  ? 270 VAL A O     1 
ATOM   1867  C  CB    . VAL A 1 211 ? 45.235  33.226 36.621 1.00 12.88  ? 270 VAL A CB    1 
ATOM   1868  C  CG1   . VAL A 1 211 ? 44.733  32.866 38.013 1.00 12.88  ? 270 VAL A CG1   1 
ATOM   1869  C  CG2   . VAL A 1 211 ? 46.383  34.210 36.682 1.00 12.88  ? 270 VAL A CG2   1 
ATOM   1870  H  H     . VAL A 1 211 ? 45.538  32.437 33.857 1.00 0.00   ? 270 VAL A H     1 
ATOM   1871  N  N     . VAL A 1 212 ? 44.601  30.036 36.893 1.00 18.86  ? 271 VAL A N     1 
ATOM   1872  C  CA    . VAL A 1 212 ? 43.566  29.048 37.138 1.00 18.86  ? 271 VAL A CA    1 
ATOM   1873  C  C     . VAL A 1 212 ? 43.198  29.079 38.623 1.00 18.86  ? 271 VAL A C     1 
ATOM   1874  O  O     . VAL A 1 212 ? 44.062  29.101 39.487 1.00 28.88  ? 271 VAL A O     1 
ATOM   1875  C  CB    . VAL A 1 212 ? 44.030  27.623 36.681 1.00 28.88  ? 271 VAL A CB    1 
ATOM   1876  C  CG1   . VAL A 1 212 ? 43.056  26.533 37.137 1.00 28.88  ? 271 VAL A CG1   1 
ATOM   1877  C  CG2   . VAL A 1 212 ? 44.134  27.589 35.150 1.00 28.88  ? 271 VAL A CG2   1 
ATOM   1878  H  H     . VAL A 1 212 ? 45.435  29.946 37.407 1.00 0.00   ? 271 VAL A H     1 
ATOM   1879  N  N     . GLY A 1 213 ? 41.901  29.149 38.897 1.00 38.30  ? 272 GLY A N     1 
ATOM   1880  C  CA    . GLY A 1 213 ? 41.413  29.192 40.262 1.00 38.30  ? 272 GLY A CA    1 
ATOM   1881  C  C     . GLY A 1 213 ? 40.694  27.929 40.694 1.00 38.30  ? 272 GLY A C     1 
ATOM   1882  O  O     . GLY A 1 213 ? 40.659  26.935 39.972 1.00 39.07  ? 272 GLY A O     1 
ATOM   1883  H  H     . GLY A 1 213 ? 41.244  29.138 38.178 1.00 0.00   ? 272 GLY A H     1 
ATOM   1884  N  N     . TYR A 1 214 ? 40.030  28.011 41.838 1.00 20.76  ? 273 TYR A N     1 
ATOM   1885  C  CA    . TYR A 1 214 ? 39.328  26.871 42.421 1.00 20.76  ? 273 TYR A CA    1 
ATOM   1886  C  C     . TYR A 1 214 ? 38.015  27.342 43.010 1.00 20.76  ? 273 TYR A C     1 
ATOM   1887  O  O     . TYR A 1 214 ? 37.991  28.428 43.586 1.00 23.85  ? 273 TYR A O     1 
ATOM   1888  C  CB    . TYR A 1 214 ? 40.177  26.312 43.546 1.00 23.85  ? 273 TYR A CB    1 
ATOM   1889  C  CG    . TYR A 1 214 ? 40.243  24.808 43.581 1.00 23.85  ? 273 TYR A CG    1 
ATOM   1890  C  CD1   . TYR A 1 214 ? 39.299  24.067 44.280 1.00 23.85  ? 273 TYR A CD1   1 
ATOM   1891  C  CD2   . TYR A 1 214 ? 41.288  24.124 42.964 1.00 23.85  ? 273 TYR A CD2   1 
ATOM   1892  C  CE1   . TYR A 1 214 ? 39.399  22.711 44.363 1.00 23.85  ? 273 TYR A CE1   1 
ATOM   1893  C  CE2   . TYR A 1 214 ? 41.383  22.763 43.054 1.00 23.85  ? 273 TYR A CE2   1 
ATOM   1894  C  CZ    . TYR A 1 214 ? 40.443  22.069 43.751 1.00 23.85  ? 273 TYR A CZ    1 
ATOM   1895  O  OH    . TYR A 1 214 ? 40.540  20.715 43.849 1.00 23.85  ? 273 TYR A OH    1 
ATOM   1896  H  H     . TYR A 1 214 ? 39.978  28.854 42.328 1.00 0.00   ? 273 TYR A H     1 
ATOM   1897  H  HH    . TYR A 1 214 ? 39.790  20.408 44.369 1.00 0.00   ? 273 TYR A HH    1 
ATOM   1898  N  N     . ASP A 1 215 ? 36.949  26.545 42.838 1.00 37.49  ? 274 ASP A N     1 
ATOM   1899  C  CA    . ASP A 1 215 ? 35.573  26.793 43.351 1.00 37.49  ? 274 ASP A CA    1 
ATOM   1900  C  C     . ASP A 1 215 ? 34.502  27.196 42.350 1.00 37.49  ? 274 ASP A C     1 
ATOM   1901  O  O     . ASP A 1 215 ? 33.353  26.750 42.444 1.00 30.28  ? 274 ASP A O     1 
ATOM   1902  C  CB    . ASP A 1 215 ? 35.504  27.882 44.445 1.00 30.28  ? 274 ASP A CB    1 
ATOM   1903  C  CG    . ASP A 1 215 ? 36.083  27.456 45.771 1.00 30.28  ? 274 ASP A CG    1 
ATOM   1904  O  OD1   . ASP A 1 215 ? 36.200  26.248 46.041 1.00 30.28  ? 274 ASP A OD1   1 
ATOM   1905  O  OD2   . ASP A 1 215 ? 36.409  28.360 46.558 1.00 30.28  ? 274 ASP A OD2   1 
ATOM   1906  H  H     . ASP A 1 215 ? 37.098  25.717 42.346 1.00 0.00   ? 274 ASP A H     1 
ATOM   1907  N  N     . ASP A 1 216 ? 34.873  28.099 41.448 1.00 19.38  ? 275 ASP A N     1 
ATOM   1908  C  CA    . ASP A 1 216 ? 33.956  28.692 40.477 1.00 19.38  ? 275 ASP A CA    1 
ATOM   1909  C  C     . ASP A 1 216 ? 32.817  29.285 41.294 1.00 19.38  ? 275 ASP A C     1 
ATOM   1910  O  O     . ASP A 1 216 ? 31.660  28.859 41.237 1.00 35.22  ? 275 ASP A O     1 
ATOM   1911  C  CB    . ASP A 1 216 ? 33.421  27.734 39.428 1.00 35.22  ? 275 ASP A CB    1 
ATOM   1912  C  CG    . ASP A 1 216 ? 32.590  28.459 38.374 1.00 35.22  ? 275 ASP A CG    1 
ATOM   1913  O  OD1   . ASP A 1 216 ? 32.869  29.658 38.121 1.00 35.22  ? 275 ASP A OD1   1 
ATOM   1914  O  OD2   . ASP A 1 216 ? 31.643  27.849 37.822 1.00 35.22  ? 275 ASP A OD2   1 
ATOM   1915  H  H     . ASP A 1 216 ? 35.808  28.382 41.436 1.00 0.00   ? 275 ASP A H     1 
ATOM   1916  N  N     . THR A 1 217 ? 33.214  30.185 42.183 1.00 29.35  ? 276 THR A N     1 
ATOM   1917  C  CA    . THR A 1 217 ? 32.256  30.859 43.017 1.00 29.35  ? 276 THR A CA    1 
ATOM   1918  C  C     . THR A 1 217 ? 31.584  31.905 42.147 1.00 29.35  ? 276 THR A C     1 
ATOM   1919  O  O     . THR A 1 217 ? 32.158  32.372 41.166 1.00 15.27  ? 276 THR A O     1 
ATOM   1920  C  CB    . THR A 1 217 ? 32.923  31.447 44.282 1.00 15.27  ? 276 THR A CB    1 
ATOM   1921  O  OG1   . THR A 1 217 ? 34.179  32.056 43.956 1.00 15.27  ? 276 THR A OG1   1 
ATOM   1922  C  CG2   . THR A 1 217 ? 33.157  30.327 45.268 1.00 15.27  ? 276 THR A CG2   1 
ATOM   1923  H  H     . THR A 1 217 ? 34.163  30.398 42.264 1.00 0.00   ? 276 THR A H     1 
ATOM   1924  H  HG1   . THR A 1 217 ? 34.224  32.338 43.033 1.00 30.00  ? 276 THR A HG1   1 
ATOM   1925  N  N     . GLU A 1 218 ? 30.315  32.135 42.434 1.00 24.38  ? 277 GLU A N     1 
ATOM   1926  C  CA    . GLU A 1 218 ? 29.459  33.081 41.744 1.00 24.38  ? 277 GLU A CA    1 
ATOM   1927  C  C     . GLU A 1 218 ? 30.118  34.143 40.862 1.00 24.38  ? 277 GLU A C     1 
ATOM   1928  O  O     . GLU A 1 218 ? 29.953  34.146 39.632 1.00 57.56  ? 277 GLU A O     1 
ATOM   1929  C  CB    . GLU A 1 218 ? 28.546  33.752 42.762 1.00 57.56  ? 277 GLU A CB    1 
ATOM   1930  C  CG    . GLU A 1 218 ? 27.097  33.740 42.352 1.00 57.56  ? 277 GLU A CG    1 
ATOM   1931  C  CD    . GLU A 1 218 ? 26.506  32.341 42.311 1.00 57.56  ? 277 GLU A CD    1 
ATOM   1932  O  OE1   . GLU A 1 218 ? 26.160  31.815 43.406 1.00 57.56  ? 277 GLU A OE1   1 
ATOM   1933  O  OE2   . GLU A 1 218 ? 26.377  31.779 41.192 1.00 57.56  ? 277 GLU A OE2   1 
ATOM   1934  H  H     . GLU A 1 218 ? 29.902  31.556 43.107 1.00 0.00   ? 277 GLU A H     1 
ATOM   1935  N  N     . ASP A 1 219 ? 30.892  35.020 41.479 1.00 18.86  ? 278 ASP A N     1 
ATOM   1936  C  CA    . ASP A 1 219 ? 31.511  36.115 40.756 1.00 18.86  ? 278 ASP A CA    1 
ATOM   1937  C  C     . ASP A 1 219 ? 32.560  35.812 39.708 1.00 18.86  ? 278 ASP A C     1 
ATOM   1938  O  O     . ASP A 1 219 ? 32.828  36.646 38.835 1.00 33.67  ? 278 ASP A O     1 
ATOM   1939  C  CB    . ASP A 1 219 ? 32.068  37.111 41.757 1.00 33.67  ? 278 ASP A CB    1 
ATOM   1940  C  CG    . ASP A 1 219 ? 30.995  37.913 42.433 1.00 33.67  ? 278 ASP A CG    1 
ATOM   1941  O  OD1   . ASP A 1 219 ? 29.793  37.598 42.257 1.00 33.67  ? 278 ASP A OD1   1 
ATOM   1942  O  OD2   . ASP A 1 219 ? 31.373  38.882 43.127 1.00 33.67  ? 278 ASP A OD2   1 
ATOM   1943  H  H     . ASP A 1 219 ? 31.069  34.926 42.431 1.00 0.00   ? 278 ASP A H     1 
ATOM   1944  N  N     . SER A 1 220 ? 33.129  34.617 39.778 1.00 27.29  ? 279 SER A N     1 
ATOM   1945  C  CA    . SER A 1 220 ? 34.185  34.202 38.865 1.00 27.29  ? 279 SER A CA    1 
ATOM   1946  C  C     . SER A 1 220 ? 33.910  34.347 37.372 1.00 27.29  ? 279 SER A C     1 
ATOM   1947  O  O     . SER A 1 220 ? 34.799  34.743 36.613 1.00 26.42  ? 279 SER A O     1 
ATOM   1948  C  CB    . SER A 1 220 ? 34.663  32.801 39.222 1.00 26.42  ? 279 SER A CB    1 
ATOM   1949  O  OG    . SER A 1 220 ? 35.241  32.815 40.525 1.00 26.42  ? 279 SER A OG    1 
ATOM   1950  H  H     . SER A 1 220 ? 32.834  33.993 40.467 1.00 0.00   ? 279 SER A H     1 
ATOM   1951  H  HG    . SER A 1 220 ? 36.035  33.358 40.511 1.00 30.00  ? 279 SER A HG    1 
ATOM   1952  N  N     . SER A 1 221 ? 32.684  34.104 36.937 1.00 14.81  ? 280 SER A N     1 
ATOM   1953  C  CA    . SER A 1 221 ? 32.424  34.269 35.518 1.00 14.81  ? 280 SER A CA    1 
ATOM   1954  C  C     . SER A 1 221 ? 32.290  35.740 35.152 1.00 14.81  ? 280 SER A C     1 
ATOM   1955  O  O     . SER A 1 221 ? 31.902  36.047 34.040 1.00 27.46  ? 280 SER A O     1 
ATOM   1956  C  CB    . SER A 1 221 ? 31.177  33.506 35.067 1.00 27.46  ? 280 SER A CB    1 
ATOM   1957  O  OG    . SER A 1 221 ? 30.012  34.000 35.687 1.00 27.46  ? 280 SER A OG    1 
ATOM   1958  H  H     . SER A 1 221 ? 31.973  33.841 37.557 1.00 0.00   ? 280 SER A H     1 
ATOM   1959  H  HG    . SER A 1 221 ? 29.911  33.621 36.575 1.00 30.00  ? 280 SER A HG    1 
ATOM   1960  N  N     . CYS A 1 222 ? 32.541  36.653 36.090 1.00 30.63  ? 281 CYS A N     1 
ATOM   1961  C  CA    . CYS A 1 222 ? 32.436  38.094 35.794 1.00 30.63  ? 281 CYS A CA    1 
ATOM   1962  C  C     . CYS A 1 222 ? 33.752  38.787 35.957 1.00 30.63  ? 281 CYS A C     1 
ATOM   1963  O  O     . CYS A 1 222 ? 33.835  39.992 35.793 1.00 31.13  ? 281 CYS A O     1 
ATOM   1964  C  CB    . CYS A 1 222 ? 31.429  38.789 36.693 1.00 31.13  ? 281 CYS A CB    1 
ATOM   1965  S  SG    . CYS A 1 222 ? 29.808  38.294 36.326 1.00 31.13  ? 281 CYS A SG    1 
ATOM   1966  H  H     . CYS A 1 222 ? 32.815  36.407 36.989 1.00 0.00   ? 281 CYS A H     1 
ATOM   1967  N  N     . TYR A 1 223 ? 34.756  38.038 36.384 1.00 12.30  ? 282 TYR A N     1 
ATOM   1968  C  CA    . TYR A 1 223 ? 36.064  38.603 36.553 1.00 12.30  ? 282 TYR A CA    1 
ATOM   1969  C  C     . TYR A 1 223 ? 36.512  39.028 35.166 1.00 12.30  ? 282 TYR A C     1 
ATOM   1970  O  O     . TYR A 1 223 ? 36.021  38.531 34.154 1.00 27.64  ? 282 TYR A O     1 
ATOM   1971  C  CB    . TYR A 1 223 ? 37.020  37.564 37.151 1.00 27.64  ? 282 TYR A CB    1 
ATOM   1972  C  CG    . TYR A 1 223 ? 36.810  37.317 38.632 1.00 27.64  ? 282 TYR A CG    1 
ATOM   1973  C  CD1   . TYR A 1 223 ? 35.817  37.996 39.326 1.00 27.64  ? 282 TYR A CD1   1 
ATOM   1974  C  CD2   . TYR A 1 223 ? 37.605  36.412 39.338 1.00 27.64  ? 282 TYR A CD2   1 
ATOM   1975  C  CE1   . TYR A 1 223 ? 35.615  37.793 40.670 1.00 27.64  ? 282 TYR A CE1   1 
ATOM   1976  C  CE2   . TYR A 1 223 ? 37.406  36.192 40.700 1.00 27.64  ? 282 TYR A CE2   1 
ATOM   1977  C  CZ    . TYR A 1 223 ? 36.403  36.890 41.356 1.00 27.64  ? 282 TYR A CZ    1 
ATOM   1978  O  OH    . TYR A 1 223 ? 36.136  36.694 42.689 1.00 27.64  ? 282 TYR A OH    1 
ATOM   1979  H  H     . TYR A 1 223 ? 34.633  37.081 36.543 1.00 0.00   ? 282 TYR A H     1 
ATOM   1980  H  HH    . TYR A 1 223 ? 36.773  36.044 42.996 1.00 0.00   ? 282 TYR A HH    1 
ATOM   1981  N  N     . ILE A 1 224 ? 37.434  39.973 35.111 1.00 34.46  ? 283 ILE A N     1 
ATOM   1982  C  CA    . ILE A 1 224 ? 37.922  40.439 33.828 1.00 34.46  ? 283 ILE A CA    1 
ATOM   1983  C  C     . ILE A 1 224 ? 39.399  40.158 33.785 1.00 34.46  ? 283 ILE A C     1 
ATOM   1984  O  O     . ILE A 1 224 ? 40.168  40.803 34.495 1.00 29.58  ? 283 ILE A O     1 
ATOM   1985  C  CB    . ILE A 1 224 ? 37.674  41.939 33.666 1.00 29.58  ? 283 ILE A CB    1 
ATOM   1986  C  CG1   . ILE A 1 224 ? 36.175  42.228 33.805 1.00 29.58  ? 283 ILE A CG1   1 
ATOM   1987  C  CG2   . ILE A 1 224 ? 38.213  42.396 32.334 1.00 29.58  ? 283 ILE A CG2   1 
ATOM   1988  C  CD1   . ILE A 1 224 ? 35.796  43.693 33.891 1.00 29.58  ? 283 ILE A CD1   1 
ATOM   1989  H  H     . ILE A 1 224 ? 37.815  40.353 35.928 1.00 0.00   ? 283 ILE A H     1 
ATOM   1990  N  N     . PRO A 1 225 ? 39.815  39.144 33.011 1.00 16.95  ? 284 PRO A N     1 
ATOM   1991  C  CA    . PRO A 1 225 ? 39.043  38.221 32.175 1.00 16.95  ? 284 PRO A CA    1 
ATOM   1992  C  C     . PRO A 1 225 ? 38.388  37.117 32.991 1.00 16.95  ? 284 PRO A C     1 
ATOM   1993  O  O     . PRO A 1 225 ? 38.855  36.798 34.078 1.00 26.16  ? 284 PRO A O     1 
ATOM   1994  C  CB    . PRO A 1 225 ? 40.116  37.594 31.282 1.00 26.16  ? 284 PRO A CB    1 
ATOM   1995  C  CG    . PRO A 1 225 ? 41.265  38.544 31.345 1.00 26.16  ? 284 PRO A CG    1 
ATOM   1996  C  CD    . PRO A 1 225 ? 41.257  38.964 32.763 1.00 26.16  ? 284 PRO A CD    1 
ATOM   1997  N  N     . PRO A 1 226 ? 37.327  36.485 32.450 1.00 15.99  ? 285 PRO A N     1 
ATOM   1998  C  CA    . PRO A 1 226 ? 36.586  35.396 33.087 1.00 15.99  ? 285 PRO A CA    1 
ATOM   1999  C  C     . PRO A 1 226 ? 37.602  34.396 33.607 1.00 15.99  ? 285 PRO A C     1 
ATOM   2000  O  O     . PRO A 1 226 ? 38.594  34.117 32.932 1.00 17.24  ? 285 PRO A O     1 
ATOM   2001  C  CB    . PRO A 1 226 ? 35.786  34.825 31.923 1.00 17.24  ? 285 PRO A CB    1 
ATOM   2002  C  CG    . PRO A 1 226 ? 35.467  36.002 31.163 1.00 17.24  ? 285 PRO A CG    1 
ATOM   2003  C  CD    . PRO A 1 226 ? 36.762  36.765 31.122 1.00 17.24  ? 285 PRO A CD    1 
ATOM   2004  N  N     . LEU A 1 227 ? 37.338  33.807 34.762 1.00 34.92  ? 286 LEU A N     1 
ATOM   2005  C  CA    . LEU A 1 227 ? 38.308  32.891 35.362 1.00 34.92  ? 286 LEU A CA    1 
ATOM   2006  C  C     . LEU A 1 227 ? 38.153  31.403 35.038 1.00 34.92  ? 286 LEU A C     1 
ATOM   2007  O  O     . LEU A 1 227 ? 37.031  30.858 35.093 1.00 21.19  ? 286 LEU A O     1 
ATOM   2008  C  CB    . LEU A 1 227 ? 38.323  33.107 36.888 1.00 21.19  ? 286 LEU A CB    1 
ATOM   2009  C  CG    . LEU A 1 227 ? 39.405  32.516 37.812 1.00 21.19  ? 286 LEU A CG    1 
ATOM   2010  C  CD1   . LEU A 1 227 ? 40.823  32.950 37.485 1.00 21.19  ? 286 LEU A CD1   1 
ATOM   2011  C  CD2   . LEU A 1 227 ? 39.077  32.948 39.195 1.00 21.19  ? 286 LEU A CD2   1 
ATOM   2012  H  H     . LEU A 1 227 ? 36.479  33.970 35.206 1.00 0.00   ? 286 LEU A H     1 
ATOM   2013  N  N     . THR A 1 228 ? 39.259  30.765 34.636 1.00 35.62  ? 287 THR A N     1 
ATOM   2014  C  CA    . THR A 1 228 ? 39.255  29.319 34.370 1.00 35.62  ? 287 THR A CA    1 
ATOM   2015  C  C     . THR A 1 228 ? 39.406  28.772 35.790 1.00 35.62  ? 287 THR A C     1 
ATOM   2016  O  O     . THR A 1 228 ? 40.234  29.257 36.570 1.00 27.94  ? 287 THR A O     1 
ATOM   2017  C  CB    . THR A 1 228 ? 40.424  28.863 33.451 1.00 27.94  ? 287 THR A CB    1 
ATOM   2018  O  OG1   . THR A 1 228 ? 40.221  29.371 32.123 1.00 27.94  ? 287 THR A OG1   1 
ATOM   2019  C  CG2   . THR A 1 228 ? 40.497  27.355 33.385 1.00 27.94  ? 287 THR A CG2   1 
ATOM   2020  H  H     . THR A 1 228 ? 40.091  31.266 34.552 1.00 0.00   ? 287 THR A H     1 
ATOM   2021  H  HG1   . THR A 1 228 ? 40.196  30.324 32.245 1.00 30.00  ? 287 THR A HG1   1 
ATOM   2022  N  N     . THR A 1 229 ? 38.621  27.760 36.128 1.00 12.67  ? 288 THR A N     1 
ATOM   2023  C  CA    . THR A 1 229 ? 38.626  27.282 37.489 1.00 12.67  ? 288 THR A CA    1 
ATOM   2024  C  C     . THR A 1 229 ? 37.962  25.947 37.636 1.00 12.67  ? 288 THR A C     1 
ATOM   2025  O  O     . THR A 1 229 ? 37.069  25.596 36.882 1.00 21.76  ? 288 THR A O     1 
ATOM   2026  C  CB    . THR A 1 229 ? 37.800  28.274 38.338 1.00 21.76  ? 288 THR A CB    1 
ATOM   2027  O  OG1   . THR A 1 229 ? 37.865  27.943 39.738 1.00 21.76  ? 288 THR A OG1   1 
ATOM   2028  C  CG2   . THR A 1 229 ? 36.345  28.294 37.852 1.00 21.76  ? 288 THR A CG2   1 
ATOM   2029  H  H     . THR A 1 229 ? 38.017  27.339 35.475 1.00 0.00   ? 288 THR A H     1 
ATOM   2030  H  HG1   . THR A 1 229 ? 37.450  27.088 39.893 1.00 30.00  ? 288 THR A HG1   1 
ATOM   2031  N  N     . ILE A 1 230 ? 38.375  25.237 38.671 1.00 9.81   ? 289 ILE A N     1 
ATOM   2032  C  CA    . ILE A 1 230 ? 37.794  23.961 39.009 1.00 9.81   ? 289 ILE A CA    1 
ATOM   2033  C  C     . ILE A 1 230 ? 36.504  24.285 39.750 1.00 9.81   ? 289 ILE A C     1 
ATOM   2034  O  O     . ILE A 1 230 ? 36.536  24.944 40.806 1.00 10.33  ? 289 ILE A O     1 
ATOM   2035  C  CB    . ILE A 1 230 ? 38.706  23.157 39.927 1.00 10.33  ? 289 ILE A CB    1 
ATOM   2036  C  CG1   . ILE A 1 230 ? 40.063  22.964 39.264 1.00 10.33  ? 289 ILE A CG1   1 
ATOM   2037  C  CG2   . ILE A 1 230 ? 38.063  21.830 40.246 1.00 10.33  ? 289 ILE A CG2   1 
ATOM   2038  C  CD1   . ILE A 1 230 ? 39.999  22.239 37.943 1.00 10.33  ? 289 ILE A CD1   1 
ATOM   2039  H  H     . ILE A 1 230 ? 39.100  25.599 39.231 1.00 0.00   ? 289 ILE A H     1 
ATOM   2040  N  N     . LYS A 1 231 ? 35.377  23.891 39.153 1.00 19.84  ? 290 LYS A N     1 
ATOM   2041  C  CA    . LYS A 1 231 ? 34.060  24.122 39.729 1.00 19.84  ? 290 LYS A CA    1 
ATOM   2042  C  C     . LYS A 1 231 ? 33.629  23.057 40.735 1.00 19.84  ? 290 LYS A C     1 
ATOM   2043  O  O     . LYS A 1 231 ? 33.570  21.876 40.412 1.00 19.75  ? 290 LYS A O     1 
ATOM   2044  C  CB    . LYS A 1 231 ? 33.009  24.221 38.643 1.00 19.75  ? 290 LYS A CB    1 
ATOM   2045  C  CG    . LYS A 1 231 ? 31.608  24.408 39.201 1.00 19.75  ? 290 LYS A CG    1 
ATOM   2046  C  CD    . LYS A 1 231 ? 30.559  24.496 38.113 1.00 19.75  ? 290 LYS A CD    1 
ATOM   2047  C  CE    . LYS A 1 231 ? 29.146  24.329 38.648 1.00 19.75  ? 290 LYS A CE    1 
ATOM   2048  N  NZ    . LYS A 1 231 ? 28.681  25.453 39.518 1.00 19.75  ? 290 LYS A NZ    1 
ATOM   2049  H  H     . LYS A 1 231 ? 35.445  23.381 38.320 1.00 0.00   ? 290 LYS A H     1 
ATOM   2050  H  HZ1   . LYS A 1 231 ? 29.307  25.552 40.343 1.00 0.00   ? 290 LYS A HZ1   1 
ATOM   2051  H  HZ2   . LYS A 1 231 ? 28.675  26.344 38.981 1.00 0.00   ? 290 LYS A HZ2   1 
ATOM   2052  H  HZ3   . LYS A 1 231 ? 27.715  25.241 39.842 1.00 0.00   ? 290 LYS A HZ3   1 
ATOM   2053  N  N     . GLN A 1 232 ? 33.358  23.488 41.966 1.00 11.24  ? 291 GLN A N     1 
ATOM   2054  C  CA    . GLN A 1 232 ? 32.906  22.620 43.050 1.00 11.24  ? 291 GLN A CA    1 
ATOM   2055  C  C     . GLN A 1 232 ? 31.422  22.954 43.152 1.00 11.24  ? 291 GLN A C     1 
ATOM   2056  O  O     . GLN A 1 232 ? 31.062  24.105 43.325 1.00 17.91  ? 291 GLN A O     1 
ATOM   2057  C  CB    . GLN A 1 232 ? 33.628  22.983 44.345 1.00 17.91  ? 291 GLN A CB    1 
ATOM   2058  C  CG    . GLN A 1 232 ? 35.163  23.044 44.243 1.00 17.91  ? 291 GLN A CG    1 
ATOM   2059  C  CD    . GLN A 1 232 ? 35.871  22.562 45.518 1.00 17.91  ? 291 GLN A CD    1 
ATOM   2060  O  OE1   . GLN A 1 232 ? 36.018  23.294 46.500 1.00 17.91  ? 291 GLN A OE1   1 
ATOM   2061  N  NE2   . GLN A 1 232 ? 36.283  21.307 45.508 1.00 17.91  ? 291 GLN A NE2   1 
ATOM   2062  H  H     . GLN A 1 232 ? 33.411  24.455 42.156 1.00 0.00   ? 291 GLN A H     1 
ATOM   2063  N  N     . ASP A 1 233 ? 30.541  21.982 42.970 1.00 14.85  ? 292 ASP A N     1 
ATOM   2064  C  CA    . ASP A 1 233 ? 29.109  22.279 43.016 1.00 14.85  ? 292 ASP A CA    1 
ATOM   2065  C  C     . ASP A 1 233 ? 28.568  22.354 44.432 1.00 14.85  ? 292 ASP A C     1 
ATOM   2066  O  O     . ASP A 1 233 ? 28.191  21.348 45.037 1.00 29.37  ? 292 ASP A O     1 
ATOM   2067  C  CB    . ASP A 1 233 ? 28.329  21.245 42.202 1.00 29.37  ? 292 ASP A CB    1 
ATOM   2068  C  CG    . ASP A 1 233 ? 26.905  21.673 41.925 1.00 29.37  ? 292 ASP A CG    1 
ATOM   2069  O  OD1   . ASP A 1 233 ? 26.327  22.414 42.747 1.00 29.37  ? 292 ASP A OD1   1 
ATOM   2070  O  OD2   . ASP A 1 233 ? 26.359  21.269 40.877 1.00 29.37  ? 292 ASP A OD2   1 
ATOM   2071  H  H     . ASP A 1 233 ? 30.856  21.072 42.794 1.00 0.00   ? 292 ASP A H     1 
ATOM   2072  N  N     . PHE A 1 234 ? 28.473  23.577 44.933 1.00 30.31  ? 293 PHE A N     1 
ATOM   2073  C  CA    . PHE A 1 234 ? 27.963  23.834 46.293 1.00 30.31  ? 293 PHE A CA    1 
ATOM   2074  C  C     . PHE A 1 234 ? 26.453  23.673 46.461 1.00 30.31  ? 293 PHE A C     1 
ATOM   2075  O  O     . PHE A 1 234 ? 25.954  23.806 47.556 1.00 2.00   ? 293 PHE A O     1 
ATOM   2076  C  CB    . PHE A 1 234 ? 28.402  25.212 46.779 1.00 2.00   ? 293 PHE A CB    1 
ATOM   2077  C  CG    . PHE A 1 234 ? 29.907  25.450 46.653 1.00 2.00   ? 293 PHE A CG    1 
ATOM   2078  C  CD1   . PHE A 1 234 ? 30.822  24.627 47.324 1.00 2.00   ? 293 PHE A CD1   1 
ATOM   2079  C  CD2   . PHE A 1 234 ? 30.392  26.524 45.927 1.00 2.00   ? 293 PHE A CD2   1 
ATOM   2080  C  CE1   . PHE A 1 234 ? 32.151  24.887 47.272 1.00 2.00   ? 293 PHE A CE1   1 
ATOM   2081  C  CE2   . PHE A 1 234 ? 31.738  26.776 45.880 1.00 2.00   ? 293 PHE A CE2   1 
ATOM   2082  C  CZ    . PHE A 1 234 ? 32.610  25.972 46.548 1.00 2.00   ? 293 PHE A CZ    1 
ATOM   2083  H  H     . PHE A 1 234 ? 28.782  24.346 44.400 1.00 0.00   ? 293 PHE A H     1 
ATOM   2084  N  N     . ARG A 1 235 ? 25.698  23.472 45.385 1.00 20.67  ? 294 ARG A N     1 
ATOM   2085  C  CA    . ARG A 1 235 ? 24.257  23.237 45.573 1.00 20.67  ? 294 ARG A CA    1 
ATOM   2086  C  C     . ARG A 1 235 ? 24.197  21.757 45.866 1.00 20.67  ? 294 ARG A C     1 
ATOM   2087  O  O     . ARG A 1 235 ? 23.545  21.322 46.807 1.00 97.87  ? 294 ARG A O     1 
ATOM   2088  C  CB    . ARG A 1 235 ? 23.464  23.529 44.306 1.00 97.87  ? 294 ARG A CB    1 
ATOM   2089  C  CG    . ARG A 1 235 ? 23.107  24.983 44.102 1.00 97.87  ? 294 ARG A CG    1 
ATOM   2090  C  CD    . ARG A 1 235 ? 22.345  25.151 42.798 1.00 97.87  ? 294 ARG A CD    1 
ATOM   2091  N  NE    . ARG A 1 235 ? 23.106  24.635 41.656 1.00 97.87  ? 294 ARG A NE    1 
ATOM   2092  C  CZ    . ARG A 1 235 ? 22.786  23.540 40.965 1.00 97.87  ? 294 ARG A CZ    1 
ATOM   2093  N  NH1   . ARG A 1 235 ? 21.710  22.832 41.292 1.00 97.87  ? 294 ARG A NH1   1 
ATOM   2094  N  NH2   . ARG A 1 235 ? 23.557  23.136 39.961 1.00 97.87  ? 294 ARG A NH2   1 
ATOM   2095  H  H     . ARG A 1 235 ? 26.087  23.524 44.495 1.00 0.00   ? 294 ARG A H     1 
ATOM   2096  H  HE    . ARG A 1 235 ? 23.908  25.124 41.381 1.00 0.00   ? 294 ARG A HE    1 
ATOM   2097  H  HH11  . ARG A 1 235 ? 21.133  23.115 42.057 1.00 0.00   ? 294 ARG A HH11  1 
ATOM   2098  H  HH12  . ARG A 1 235 ? 21.474  22.013 40.767 1.00 0.00   ? 294 ARG A HH12  1 
ATOM   2099  H  HH21  . ARG A 1 235 ? 24.382  23.649 39.721 1.00 0.00   ? 294 ARG A HH21  1 
ATOM   2100  H  HH22  . ARG A 1 235 ? 23.309  22.314 39.447 1.00 0.00   ? 294 ARG A HH22  1 
ATOM   2101  N  N     . LEU A 1 236 ? 24.954  21.003 45.068 1.00 28.32  ? 295 LEU A N     1 
ATOM   2102  C  CA    . LEU A 1 236 ? 25.052  19.559 45.192 1.00 28.32  ? 295 LEU A CA    1 
ATOM   2103  C  C     . LEU A 1 236 ? 25.588  19.283 46.578 1.00 28.32  ? 295 LEU A C     1 
ATOM   2104  O  O     . LEU A 1 236 ? 25.108  18.380 47.248 1.00 39.07  ? 295 LEU A O     1 
ATOM   2105  C  CB    . LEU A 1 236 ? 26.010  18.997 44.141 1.00 39.07  ? 295 LEU A CB    1 
ATOM   2106  C  CG    . LEU A 1 236 ? 25.898  17.526 43.687 1.00 39.07  ? 295 LEU A CG    1 
ATOM   2107  C  CD1   . LEU A 1 236 ? 26.482  16.576 44.684 1.00 39.07  ? 295 LEU A CD1   1 
ATOM   2108  C  CD2   . LEU A 1 236 ? 24.442  17.168 43.397 1.00 39.07  ? 295 LEU A CD2   1 
ATOM   2109  H  H     . LEU A 1 236 ? 25.490  21.428 44.381 1.00 0.00   ? 295 LEU A H     1 
ATOM   2110  N  N     . LEU A 1 237 ? 26.525  20.119 47.025 1.00 29.08  ? 296 LEU A N     1 
ATOM   2111  C  CA    . LEU A 1 237 ? 27.127  19.977 48.344 1.00 29.08  ? 296 LEU A CA    1 
ATOM   2112  C  C     . LEU A 1 237 ? 26.138  20.309 49.471 1.00 29.08  ? 296 LEU A C     1 
ATOM   2113  O  O     . LEU A 1 237 ? 26.214  19.720 50.554 1.00 28.27  ? 296 LEU A O     1 
ATOM   2114  C  CB    . LEU A 1 237 ? 28.378  20.842 48.450 1.00 28.27  ? 296 LEU A CB    1 
ATOM   2115  C  CG    . LEU A 1 237 ? 29.338  20.618 49.610 1.00 28.27  ? 296 LEU A CG    1 
ATOM   2116  C  CD1   . LEU A 1 237 ? 28.983  21.516 50.718 1.00 28.27  ? 296 LEU A CD1   1 
ATOM   2117  C  CD2   . LEU A 1 237 ? 29.342  19.177 50.066 1.00 28.27  ? 296 LEU A CD2   1 
ATOM   2118  H  H     . LEU A 1 237 ? 26.855  20.830 46.442 1.00 0.00   ? 296 LEU A H     1 
ATOM   2119  N  N     . GLY A 1 238 ? 25.203  21.226 49.224 1.00 9.04   ? 297 GLY A N     1 
ATOM   2120  C  CA    . GLY A 1 238 ? 24.224  21.567 50.247 1.00 9.04   ? 297 GLY A CA    1 
ATOM   2121  C  C     . GLY A 1 238 ? 23.110  20.547 50.343 1.00 9.04   ? 297 GLY A C     1 
ATOM   2122  O  O     . GLY A 1 238 ? 22.741  20.173 51.440 1.00 40.27  ? 297 GLY A O     1 
ATOM   2123  H  H     . GLY A 1 238 ? 25.171  21.695 48.368 1.00 0.00   ? 297 GLY A H     1 
ATOM   2124  N  N     . GLN A 1 239 ? 22.577  20.083 49.214 1.00 29.78  ? 298 GLN A N     1 
ATOM   2125  C  CA    . GLN A 1 239 ? 21.492  19.088 49.228 1.00 29.78  ? 298 GLN A CA    1 
ATOM   2126  C  C     . GLN A 1 239 ? 21.971  17.692 49.580 1.00 29.78  ? 298 GLN A C     1 
ATOM   2127  O  O     . GLN A 1 239 ? 21.264  16.960 50.268 1.00 37.93  ? 298 GLN A O     1 
ATOM   2128  C  CB    . GLN A 1 239 ? 20.682  19.047 47.906 1.00 37.93  ? 298 GLN A CB    1 
ATOM   2129  C  CG    . GLN A 1 239 ? 21.362  18.426 46.676 1.00 37.93  ? 298 GLN A CG    1 
ATOM   2130  C  CD    . GLN A 1 239 ? 21.097  16.926 46.480 1.00 37.93  ? 298 GLN A CD    1 
ATOM   2131  O  OE1   . GLN A 1 239 ? 20.311  16.317 47.204 1.00 37.93  ? 298 GLN A OE1   1 
ATOM   2132  N  NE2   . GLN A 1 239 ? 21.761  16.331 45.490 1.00 37.93  ? 298 GLN A NE2   1 
ATOM   2133  H  H     . GLN A 1 239 ? 22.928  20.420 48.366 1.00 0.00   ? 298 GLN A H     1 
ATOM   2134  N  N     . THR A 1 240 ? 23.148  17.302 49.104 1.00 15.76  ? 299 THR A N     1 
ATOM   2135  C  CA    . THR A 1 240 ? 23.639  15.979 49.439 1.00 15.76  ? 299 THR A CA    1 
ATOM   2136  C  C     . THR A 1 240 ? 23.925  15.924 50.922 1.00 15.76  ? 299 THR A C     1 
ATOM   2137  O  O     . THR A 1 240 ? 23.735  14.891 51.545 1.00 28.06  ? 299 THR A O     1 
ATOM   2138  C  CB    . THR A 1 240 ? 24.901  15.611 48.677 1.00 28.06  ? 299 THR A CB    1 
ATOM   2139  O  OG1   . THR A 1 240 ? 25.917  16.576 48.945 1.00 28.06  ? 299 THR A OG1   1 
ATOM   2140  C  CG2   . THR A 1 240 ? 24.629  15.591 47.211 1.00 28.06  ? 299 THR A CG2   1 
ATOM   2141  H  H     . THR A 1 240 ? 23.717  17.872 48.547 1.00 0.00   ? 299 THR A H     1 
ATOM   2142  H  HG1   . THR A 1 240 ? 26.677  16.414 48.381 1.00 30.00  ? 299 THR A HG1   1 
ATOM   2143  N  N     . SER A 1 241 ? 24.318  17.052 51.503 1.00 27.14  ? 300 SER A N     1 
ATOM   2144  C  CA    . SER A 1 241 ? 24.627  17.082 52.919 1.00 27.14  ? 300 SER A CA    1 
ATOM   2145  C  C     . SER A 1 241 ? 23.396  17.101 53.800 1.00 27.14  ? 300 SER A C     1 
ATOM   2146  O  O     . SER A 1 241 ? 23.362  16.433 54.830 1.00 36.33  ? 300 SER A O     1 
ATOM   2147  C  CB    . SER A 1 241 ? 25.536  18.258 53.235 1.00 36.33  ? 300 SER A CB    1 
ATOM   2148  O  OG    . SER A 1 241 ? 24.952  19.464 52.791 1.00 36.33  ? 300 SER A OG    1 
ATOM   2149  H  H     . SER A 1 241 ? 24.445  17.876 50.988 1.00 0.00   ? 300 SER A H     1 
ATOM   2150  H  HG    . SER A 1 241 ? 25.636  19.962 52.323 1.00 30.00  ? 300 SER A HG    1 
ATOM   2151  N  N     . VAL A 1 242 ? 22.393  17.888 53.431 1.00 37.46  ? 301 VAL A N     1 
ATOM   2152  C  CA    . VAL A 1 242 ? 21.166  17.943 54.227 1.00 37.46  ? 301 VAL A CA    1 
ATOM   2153  C  C     . VAL A 1 242 ? 20.469  16.607 54.121 1.00 37.46  ? 301 VAL A C     1 
ATOM   2154  O  O     . VAL A 1 242 ? 20.061  16.037 55.131 1.00 46.29  ? 301 VAL A O     1 
ATOM   2155  C  CB    . VAL A 1 242 ? 20.193  19.067 53.761 1.00 46.29  ? 301 VAL A CB    1 
ATOM   2156  C  CG1   . VAL A 1 242 ? 18.750  18.674 53.998 1.00 46.29  ? 301 VAL A CG1   1 
ATOM   2157  C  CG2   . VAL A 1 242 ? 20.460  20.332 54.537 1.00 46.29  ? 301 VAL A CG2   1 
ATOM   2158  H  H     . VAL A 1 242 ? 22.513  18.468 52.642 1.00 0.00   ? 301 VAL A H     1 
ATOM   2159  N  N     . ASP A 1 243 ? 20.308  16.112 52.901 1.00 31.54  ? 302 ASP A N     1 
ATOM   2160  C  CA    . ASP A 1 243 ? 19.648  14.835 52.721 1.00 31.54  ? 302 ASP A CA    1 
ATOM   2161  C  C     . ASP A 1 243 ? 20.352  13.808 53.588 1.00 31.54  ? 302 ASP A C     1 
ATOM   2162  O  O     . ASP A 1 243 ? 19.757  13.221 54.491 1.00 35.64  ? 302 ASP A O     1 
ATOM   2163  C  CB    . ASP A 1 243 ? 19.663  14.407 51.253 1.00 35.64  ? 302 ASP A CB    1 
ATOM   2164  C  CG    . ASP A 1 243 ? 18.541  15.034 50.441 1.00 35.64  ? 302 ASP A CG    1 
ATOM   2165  O  OD1   . ASP A 1 243 ? 17.528  15.477 51.020 1.00 35.64  ? 302 ASP A OD1   1 
ATOM   2166  O  OD2   . ASP A 1 243 ? 18.663  15.048 49.202 1.00 35.64  ? 302 ASP A OD2   1 
ATOM   2167  H  H     . ASP A 1 243 ? 20.635  16.597 52.113 1.00 0.00   ? 302 ASP A H     1 
ATOM   2168  N  N     . ARG A 1 244 ? 21.655  13.697 53.405 1.00 19.92  ? 303 ARG A N     1 
ATOM   2169  C  CA    . ARG A 1 244 ? 22.415  12.739 54.175 1.00 19.92  ? 303 ARG A CA    1 
ATOM   2170  C  C     . ARG A 1 244 ? 22.302  12.903 55.685 1.00 19.92  ? 303 ARG A C     1 
ATOM   2171  O  O     . ARG A 1 244 ? 22.277  11.910 56.401 1.00 43.43  ? 303 ARG A O     1 
ATOM   2172  C  CB    . ARG A 1 244 ? 23.881  12.727 53.767 1.00 43.43  ? 303 ARG A CB    1 
ATOM   2173  C  CG    . ARG A 1 244 ? 24.644  11.677 54.531 1.00 43.43  ? 303 ARG A CG    1 
ATOM   2174  C  CD    . ARG A 1 244 ? 25.977  11.354 53.926 1.00 43.43  ? 303 ARG A CD    1 
ATOM   2175  N  NE    . ARG A 1 244 ? 26.694  10.454 54.820 1.00 43.43  ? 303 ARG A NE    1 
ATOM   2176  C  CZ    . ARG A 1 244 ? 28.003  10.236 54.785 1.00 43.43  ? 303 ARG A CZ    1 
ATOM   2177  N  NH1   . ARG A 1 244 ? 28.770  10.846 53.884 1.00 43.43  ? 303 ARG A NH1   1 
ATOM   2178  N  NH2   . ARG A 1 244 ? 28.543  9.442  55.703 1.00 43.43  ? 303 ARG A NH2   1 
ATOM   2179  H  H     . ARG A 1 244 ? 22.126  14.261 52.754 1.00 0.00   ? 303 ARG A H     1 
ATOM   2180  H  HE    . ARG A 1 244 ? 26.176  9.977  55.498 1.00 0.00   ? 303 ARG A HE    1 
ATOM   2181  H  HH11  . ARG A 1 244 ? 28.373  11.469 53.211 1.00 0.00   ? 303 ARG A HH11  1 
ATOM   2182  H  HH12  . ARG A 1 244 ? 29.755  10.668 53.877 1.00 0.00   ? 303 ARG A HH12  1 
ATOM   2183  H  HH21  . ARG A 1 244 ? 27.955  9.018  56.391 1.00 0.00   ? 303 ARG A HH21  1 
ATOM   2184  H  HH22  . ARG A 1 244 ? 29.514  9.256  55.709 1.00 0.00   ? 303 ARG A HH22  1 
ATOM   2185  N  N     . LEU A 1 245 ? 22.228  14.132 56.181 1.00 25.40  ? 304 LEU A N     1 
ATOM   2186  C  CA    . LEU A 1 245 ? 22.136  14.350 57.625 1.00 25.40  ? 304 LEU A CA    1 
ATOM   2187  C  C     . LEU A 1 245 ? 20.797  13.869 58.181 1.00 25.40  ? 304 LEU A C     1 
ATOM   2188  O  O     . LEU A 1 245 ? 20.736  13.249 59.238 1.00 23.63  ? 304 LEU A O     1 
ATOM   2189  C  CB    . LEU A 1 245 ? 22.368  15.835 57.959 1.00 23.63  ? 304 LEU A CB    1 
ATOM   2190  C  CG    . LEU A 1 245 ? 22.434  16.289 59.421 1.00 23.63  ? 304 LEU A CG    1 
ATOM   2191  C  CD1   . LEU A 1 245 ? 21.040  16.359 60.027 1.00 23.63  ? 304 LEU A CD1   1 
ATOM   2192  C  CD2   . LEU A 1 245 ? 23.327  15.357 60.212 1.00 23.63  ? 304 LEU A CD2   1 
ATOM   2193  H  H     . LEU A 1 245 ? 22.251  14.907 55.579 1.00 0.00   ? 304 LEU A H     1 
ATOM   2194  N  N     . LEU A 1 246 ? 19.719  14.182 57.485 1.00 37.88  ? 305 LEU A N     1 
ATOM   2195  C  CA    . LEU A 1 246 ? 18.420  13.754 57.945 1.00 37.88  ? 305 LEU A CA    1 
ATOM   2196  C  C     . LEU A 1 246 ? 18.367  12.231 57.890 1.00 37.88  ? 305 LEU A C     1 
ATOM   2197  O  O     . LEU A 1 246 ? 17.855  11.601 58.809 1.00 48.73  ? 305 LEU A O     1 
ATOM   2198  C  CB    . LEU A 1 246 ? 17.329  14.402 57.102 1.00 48.73  ? 305 LEU A CB    1 
ATOM   2199  C  CG    . LEU A 1 246 ? 17.378  15.936 57.122 1.00 48.73  ? 305 LEU A CG    1 
ATOM   2200  C  CD1   . LEU A 1 246 ? 16.084  16.511 56.566 1.00 48.73  ? 305 LEU A CD1   1 
ATOM   2201  C  CD2   . LEU A 1 246 ? 17.611  16.444 58.554 1.00 48.73  ? 305 LEU A CD2   1 
ATOM   2202  H  H     . LEU A 1 246 ? 19.817  14.701 56.654 1.00 0.00   ? 305 LEU A H     1 
ATOM   2203  N  N     . GLN A 1 247 ? 18.967  11.647 56.851 1.00 22.68  ? 306 GLN A N     1 
ATOM   2204  C  CA    . GLN A 1 247 ? 19.027  10.198 56.681 1.00 22.68  ? 306 GLN A CA    1 
ATOM   2205  C  C     . GLN A 1 247 ? 19.860  9.609  57.814 1.00 22.68  ? 306 GLN A C     1 
ATOM   2206  O  O     . GLN A 1 247 ? 19.436  8.698  58.520 1.00 70.78  ? 306 GLN A O     1 
ATOM   2207  C  CB    . GLN A 1 247 ? 19.666  9.843  55.333 1.00 70.78  ? 306 GLN A CB    1 
ATOM   2208  C  CG    . GLN A 1 247 ? 18.853  10.308 54.133 1.00 70.78  ? 306 GLN A CG    1 
ATOM   2209  C  CD    . GLN A 1 247 ? 19.534  10.050 52.789 1.00 70.78  ? 306 GLN A CD    1 
ATOM   2210  O  OE1   . GLN A 1 247 ? 20.734  9.778  52.719 1.00 70.78  ? 306 GLN A OE1   1 
ATOM   2211  N  NE2   . GLN A 1 247 ? 18.759  10.146 51.712 1.00 70.78  ? 306 GLN A NE2   1 
ATOM   2212  H  H     . GLN A 1 247 ? 19.375  12.226 56.170 1.00 0.00   ? 306 GLN A H     1 
ATOM   2213  N  N     . LEU A 1 248 ? 21.068  10.129 57.940 1.00 33.94  ? 307 LEU A N     1 
ATOM   2214  C  CA    . LEU A 1 248 ? 22.013  9.737  58.966 1.00 33.94  ? 307 LEU A CA    1 
ATOM   2215  C  C     . LEU A 1 248 ? 21.271  9.816  60.296 1.00 33.94  ? 307 LEU A C     1 
ATOM   2216  O  O     . LEU A 1 248 ? 21.406  8.938  61.148 1.00 60.39  ? 307 LEU A O     1 
ATOM   2217  C  CB    . LEU A 1 248 ? 23.184  10.728 58.931 1.00 60.39  ? 307 LEU A CB    1 
ATOM   2218  C  CG    . LEU A 1 248 ? 24.417  10.659 59.829 1.00 60.39  ? 307 LEU A CG    1 
ATOM   2219  C  CD1   . LEU A 1 248 ? 25.041  9.278  59.776 1.00 60.39  ? 307 LEU A CD1   1 
ATOM   2220  C  CD2   . LEU A 1 248 ? 25.403  11.714 59.366 1.00 60.39  ? 307 LEU A CD2   1 
ATOM   2221  H  H     . LEU A 1 248 ? 21.304  10.786 57.285 1.00 0.00   ? 307 LEU A H     1 
ATOM   2222  N  N     . SER A 1 249 ? 20.445  10.851 60.438 1.00 54.18  ? 308 SER A N     1 
ATOM   2223  C  CA    . SER A 1 249 ? 19.651  11.065 61.640 1.00 54.18  ? 308 SER A CA    1 
ATOM   2224  C  C     . SER A 1 249 ? 18.727  9.849  61.833 1.00 54.18  ? 308 SER A C     1 
ATOM   2225  O  O     . SER A 1 249 ? 18.763  9.205  62.886 1.00 83.68  ? 308 SER A O     1 
ATOM   2226  C  CB    . SER A 1 249 ? 18.837  12.364 61.506 1.00 83.68  ? 308 SER A CB    1 
ATOM   2227  O  OG    . SER A 1 249 ? 18.352  12.831 62.756 1.00 83.68  ? 308 SER A OG    1 
ATOM   2228  H  H     . SER A 1 249 ? 20.364  11.486 59.707 1.00 0.00   ? 308 SER A H     1 
ATOM   2229  H  HG    . SER A 1 249 ? 19.096  13.073 63.316 1.00 30.00  ? 308 SER A HG    1 
ATOM   2230  N  N     . GLN A 1 250 ? 17.969  9.493  60.790 1.00 72.57  ? 309 GLN A N     1 
ATOM   2231  C  CA    . GLN A 1 250 ? 17.038  8.352  60.812 1.00 72.57  ? 309 GLN A CA    1 
ATOM   2232  C  C     . GLN A 1 250 ? 17.655  7.043  61.303 1.00 72.57  ? 309 GLN A C     1 
ATOM   2233  O  O     . GLN A 1 250 ? 16.941  6.066  61.532 1.00 107.80 ? 309 GLN A O     1 
ATOM   2234  C  CB    . GLN A 1 250 ? 16.478  8.087  59.414 1.00 107.80 ? 309 GLN A CB    1 
ATOM   2235  C  CG    . GLN A 1 250 ? 15.455  9.069  58.894 1.00 107.80 ? 309 GLN A CG    1 
ATOM   2236  C  CD    . GLN A 1 250 ? 14.986  8.706  57.488 1.00 107.80 ? 309 GLN A CD    1 
ATOM   2237  O  OE1   . GLN A 1 250 ? 15.108  9.496  56.550 1.00 107.80 ? 309 GLN A OE1   1 
ATOM   2238  N  NE2   . GLN A 1 250 ? 14.466  7.497  57.334 1.00 107.80 ? 309 GLN A NE2   1 
ATOM   2239  H  H     . GLN A 1 250 ? 18.043  10.010 59.961 1.00 0.00   ? 309 GLN A H     1 
ATOM   2240  N  N     . GLY A 1 251 ? 18.976  7.001  61.400 1.00 51.08  ? 310 GLY A N     1 
ATOM   2241  C  CA    . GLY A 1 251 ? 19.640  5.794  61.847 1.00 51.08  ? 310 GLY A CA    1 
ATOM   2242  C  C     . GLY A 1 251 ? 19.983  4.920  60.661 1.00 51.08  ? 310 GLY A C     1 
ATOM   2243  O  O     . GLY A 1 251 ? 20.466  3.789  60.809 1.00 46.69  ? 310 GLY A O     1 
ATOM   2244  H  H     . GLY A 1 251 ? 19.542  7.770  61.184 1.00 0.00   ? 310 GLY A H     1 
ATOM   2245  N  N     . GLN A 1 252 ? 19.673  5.422  59.472 1.00 92.45  ? 311 GLN A N     1 
ATOM   2246  C  CA    . GLN A 1 252 ? 19.975  4.696  58.257 1.00 92.45  ? 311 GLN A CA    1 
ATOM   2247  C  C     . GLN A 1 252 ? 21.460  4.887  57.952 1.00 92.45  ? 311 GLN A C     1 
ATOM   2248  O  O     . GLN A 1 252 ? 21.960  6.016  57.881 1.00 115.62 ? 311 GLN A O     1 
ATOM   2249  C  CB    . GLN A 1 252 ? 19.081  5.168  57.107 1.00 115.62 ? 311 GLN A CB    1 
ATOM   2250  C  CG    . GLN A 1 252 ? 17.718  4.477  57.064 1.00 115.62 ? 311 GLN A CG    1 
ATOM   2251  C  CD    . GLN A 1 252 ? 16.836  4.773  58.272 1.00 115.62 ? 311 GLN A CD    1 
ATOM   2252  O  OE1   . GLN A 1 252 ? 15.831  5.466  58.157 1.00 115.62 ? 311 GLN A OE1   1 
ATOM   2253  N  NE2   . GLN A 1 252 ? 17.185  4.215  59.420 1.00 115.62 ? 311 GLN A NE2   1 
ATOM   2254  H  H     . GLN A 1 252 ? 19.285  6.318  59.399 1.00 0.00   ? 311 GLN A H     1 
ATOM   2255  N  N     . ALA A 1 253 ? 22.165  3.764  57.852 1.00 105.24 ? 312 ALA A N     1 
ATOM   2256  C  CA    . ALA A 1 253 ? 23.598  3.740  57.587 1.00 105.24 ? 312 ALA A CA    1 
ATOM   2257  C  C     . ALA A 1 253 ? 24.062  4.503  56.337 1.00 105.24 ? 312 ALA A C     1 
ATOM   2258  O  O     . ALA A 1 253 ? 23.329  4.657  55.359 1.00 71.74  ? 312 ALA A O     1 
ATOM   2259  C  CB    . ALA A 1 253 ? 24.088  2.290  57.541 1.00 71.74  ? 312 ALA A CB    1 
ATOM   2260  H  H     . ALA A 1 253 ? 21.695  2.917  57.966 1.00 0.00   ? 312 ALA A H     1 
ATOM   2261  N  N     . VAL A 1 254 ? 25.304  4.969  56.405 1.00 92.78  ? 313 VAL A N     1 
ATOM   2262  C  CA    . VAL A 1 254 ? 25.988  5.717  55.352 1.00 92.78  ? 313 VAL A CA    1 
ATOM   2263  C  C     . VAL A 1 254 ? 27.425  5.715  55.877 1.00 92.78  ? 313 VAL A C     1 
ATOM   2264  O  O     . VAL A 1 254 ? 28.344  5.227  55.232 1.00 79.87  ? 313 VAL A O     1 
ATOM   2265  C  CB    . VAL A 1 254 ? 25.451  7.184  55.217 1.00 79.87  ? 313 VAL A CB    1 
ATOM   2266  C  CG1   . VAL A 1 254 ? 24.101  7.212  54.504 1.00 79.87  ? 313 VAL A CG1   1 
ATOM   2267  C  CG2   . VAL A 1 254 ? 25.314  7.846  56.578 1.00 79.87  ? 313 VAL A CG2   1 
ATOM   2268  H  H     . VAL A 1 254 ? 25.795  4.764  57.222 1.00 0.00   ? 313 VAL A H     1 
ATOM   2269  N  N     . LYS A 1 255 ? 27.556  6.161  57.121 1.00 70.99  ? 314 LYS A N     1 
ATOM   2270  C  CA    . LYS A 1 255 ? 28.801  6.223  57.876 1.00 70.99  ? 314 LYS A CA    1 
ATOM   2271  C  C     . LYS A 1 255 ? 30.108  6.816  57.342 1.00 70.99  ? 314 LYS A C     1 
ATOM   2272  O  O     . LYS A 1 255 ? 30.685  7.688  57.990 1.00 131.94 ? 314 LYS A O     1 
ATOM   2273  C  CB    . LYS A 1 255 ? 29.058  4.872  58.544 1.00 131.94 ? 314 LYS A CB    1 
ATOM   2274  C  CG    . LYS A 1 255 ? 27.941  4.495  59.498 1.00 131.94 ? 314 LYS A CG    1 
ATOM   2275  C  CD    . LYS A 1 255 ? 28.361  3.433  60.489 1.00 131.94 ? 314 LYS A CD    1 
ATOM   2276  C  CE    . LYS A 1 255 ? 27.230  3.154  61.471 1.00 131.94 ? 314 LYS A CE    1 
ATOM   2277  N  NZ    . LYS A 1 255 ? 26.759  4.401  62.148 1.00 131.94 ? 314 LYS A NZ    1 
ATOM   2278  H  H     . LYS A 1 255 ? 26.767  6.447  57.609 1.00 0.00   ? 314 LYS A H     1 
ATOM   2279  H  HZ1   . LYS A 1 255 ? 26.425  5.078  61.434 1.00 0.00   ? 314 LYS A HZ1   1 
ATOM   2280  H  HZ2   . LYS A 1 255 ? 25.984  4.173  62.803 1.00 0.00   ? 314 LYS A HZ2   1 
ATOM   2281  H  HZ3   . LYS A 1 255 ? 27.545  4.825  62.682 1.00 0.00   ? 314 LYS A HZ3   1 
ATOM   2282  N  N     . GLY A 1 256 ? 30.591  6.349  56.199 1.00 55.21  ? 315 GLY A N     1 
ATOM   2283  C  CA    . GLY A 1 256 ? 31.850  6.863  55.674 1.00 55.21  ? 315 GLY A CA    1 
ATOM   2284  C  C     . GLY A 1 256 ? 31.862  8.272  55.102 1.00 55.21  ? 315 GLY A C     1 
ATOM   2285  O  O     . GLY A 1 256 ? 31.245  9.199  55.625 1.00 32.00  ? 315 GLY A O     1 
ATOM   2286  H  H     . GLY A 1 256 ? 30.114  5.665  55.692 1.00 0.00   ? 315 GLY A H     1 
ATOM   2287  N  N     . ASN A 1 257 ? 32.571  8.429  53.996 1.00 53.75  ? 316 ASN A N     1 
ATOM   2288  C  CA    . ASN A 1 257 ? 32.682  9.721  53.347 1.00 53.75  ? 316 ASN A CA    1 
ATOM   2289  C  C     . ASN A 1 257 ? 32.253  9.609  51.904 1.00 53.75  ? 316 ASN A C     1 
ATOM   2290  O  O     . ASN A 1 257 ? 32.432  8.560  51.278 1.00 83.09  ? 316 ASN A O     1 
ATOM   2291  C  CB    . ASN A 1 257 ? 34.129  10.233 53.438 1.00 83.09  ? 316 ASN A CB    1 
ATOM   2292  C  CG    . ASN A 1 257 ? 34.787  10.390 52.081 1.00 83.09  ? 316 ASN A CG    1 
ATOM   2293  O  OD1   . ASN A 1 257 ? 34.581  11.387 51.392 1.00 83.09  ? 316 ASN A OD1   1 
ATOM   2294  N  ND2   . ASN A 1 257 ? 35.573  9.399  51.687 1.00 83.09  ? 316 ASN A ND2   1 
ATOM   2295  H  H     . ASN A 1 257 ? 33.007  7.668  53.573 1.00 0.00   ? 316 ASN A H     1 
ATOM   2296  H  HD21  . ASN A 1 257 ? 36.024  9.444  50.827 1.00 0.00   ? 316 ASN A HD21  1 
ATOM   2297  H  HD22  . ASN A 1 257 ? 35.689  8.647  52.303 1.00 0.00   ? 316 ASN A HD22  1 
ATOM   2298  N  N     . GLN A 1 258 ? 31.692  10.687 51.373 1.00 31.06  ? 317 GLN A N     1 
ATOM   2299  C  CA    . GLN A 1 258 ? 31.260  10.689 49.994 1.00 31.06  ? 317 GLN A CA    1 
ATOM   2300  C  C     . GLN A 1 258 ? 32.034  11.750 49.244 1.00 31.06  ? 317 GLN A C     1 
ATOM   2301  O  O     . GLN A 1 258 ? 31.921  12.935 49.539 1.00 76.43  ? 317 GLN A O     1 
ATOM   2302  C  CB    . GLN A 1 258 ? 29.753  10.930 49.889 1.00 76.43  ? 317 GLN A CB    1 
ATOM   2303  C  CG    . GLN A 1 258 ? 28.914  10.327 51.023 1.00 76.43  ? 317 GLN A CG    1 
ATOM   2304  C  CD    . GLN A 1 258 ? 28.835  8.793  51.050 1.00 76.43  ? 317 GLN A CD    1 
ATOM   2305  O  OE1   . GLN A 1 258 ? 27.864  8.232  51.561 1.00 76.43  ? 317 GLN A OE1   1 
ATOM   2306  N  NE2   . GLN A 1 258 ? 29.859  8.114  50.540 1.00 76.43  ? 317 GLN A NE2   1 
ATOM   2307  H  H     . GLN A 1 258 ? 31.582  11.498 51.920 1.00 0.00   ? 317 GLN A H     1 
ATOM   2308  N  N     . LEU A 1 259 ? 32.891  11.294 48.339 1.00 18.57  ? 318 LEU A N     1 
ATOM   2309  C  CA    . LEU A 1 259 ? 33.705  12.173 47.505 1.00 18.57  ? 318 LEU A CA    1 
ATOM   2310  C  C     . LEU A 1 259 ? 32.849  12.689 46.348 1.00 18.57  ? 318 LEU A C     1 
ATOM   2311  O  O     . LEU A 1 259 ? 32.363  11.908 45.525 1.00 33.51  ? 318 LEU A O     1 
ATOM   2312  C  CB    . LEU A 1 259 ? 34.921  11.431 46.932 1.00 33.51  ? 318 LEU A CB    1 
ATOM   2313  C  CG    . LEU A 1 259 ? 36.283  11.421 47.631 1.00 33.51  ? 318 LEU A CG    1 
ATOM   2314  C  CD1   . LEU A 1 259 ? 36.990  12.744 47.529 1.00 33.51  ? 318 LEU A CD1   1 
ATOM   2315  C  CD2   . LEU A 1 259 ? 36.098  11.042 49.051 1.00 33.51  ? 318 LEU A CD2   1 
ATOM   2316  H  H     . LEU A 1 259 ? 32.985  10.334 48.213 1.00 0.00   ? 318 LEU A H     1 
ATOM   2317  N  N     . LEU A 1 260 ? 32.653  14.006 46.294 1.00 13.71  ? 319 LEU A N     1 
ATOM   2318  C  CA    . LEU A 1 260 ? 31.867  14.577 45.230 1.00 13.71  ? 319 LEU A CA    1 
ATOM   2319  C  C     . LEU A 1 260 ? 32.809  14.976 44.133 1.00 13.71  ? 319 LEU A C     1 
ATOM   2320  O  O     . LEU A 1 260 ? 34.004  15.204 44.370 1.00 20.33  ? 319 LEU A O     1 
ATOM   2321  C  CB    . LEU A 1 260 ? 31.065  15.770 45.710 1.00 20.33  ? 319 LEU A CB    1 
ATOM   2322  C  CG    . LEU A 1 260 ? 30.045  15.431 46.792 1.00 20.33  ? 319 LEU A CG    1 
ATOM   2323  C  CD1   . LEU A 1 260 ? 29.278  16.679 47.168 1.00 20.33  ? 319 LEU A CD1   1 
ATOM   2324  C  CD2   . LEU A 1 260 ? 29.109  14.357 46.306 1.00 20.33  ? 319 LEU A CD2   1 
ATOM   2325  H  H     . LEU A 1 260 ? 33.069  14.583 46.961 1.00 0.00   ? 319 LEU A H     1 
ATOM   2326  N  N     . PRO A 1 261 ? 32.301  14.971 42.893 1.00 44.95  ? 320 PRO A N     1 
ATOM   2327  C  CA    . PRO A 1 261 ? 32.977  15.313 41.644 1.00 44.95  ? 320 PRO A CA    1 
ATOM   2328  C  C     . PRO A 1 261 ? 33.427  16.766 41.585 1.00 44.95  ? 320 PRO A C     1 
ATOM   2329  O  O     . PRO A 1 261 ? 32.912  17.636 42.303 1.00 56.03  ? 320 PRO A O     1 
ATOM   2330  C  CB    . PRO A 1 261 ? 31.905  15.037 40.597 1.00 56.03  ? 320 PRO A CB    1 
ATOM   2331  C  CG    . PRO A 1 261 ? 31.164  13.901 41.200 1.00 56.03  ? 320 PRO A CG    1 
ATOM   2332  C  CD    . PRO A 1 261 ? 30.983  14.379 42.607 1.00 56.03  ? 320 PRO A CD    1 
ATOM   2333  N  N     . VAL A 1 262 ? 34.367  17.019 40.686 1.00 42.93  ? 321 VAL A N     1 
ATOM   2334  C  CA    . VAL A 1 262 ? 34.925  18.340 40.488 1.00 42.93  ? 321 VAL A CA    1 
ATOM   2335  C  C     . VAL A 1 262 ? 35.219  18.417 39.005 1.00 42.93  ? 321 VAL A C     1 
ATOM   2336  O  O     . VAL A 1 262 ? 35.541  17.407 38.397 1.00 32.15  ? 321 VAL A O     1 
ATOM   2337  C  CB    . VAL A 1 262 ? 36.200  18.508 41.335 1.00 32.15  ? 321 VAL A CB    1 
ATOM   2338  C  CG1   . VAL A 1 262 ? 37.441  18.630 40.467 1.00 32.15  ? 321 VAL A CG1   1 
ATOM   2339  C  CG2   . VAL A 1 262 ? 36.026  19.682 42.267 1.00 32.15  ? 321 VAL A CG2   1 
ATOM   2340  H  H     . VAL A 1 262 ? 34.707  16.307 40.105 1.00 0.00   ? 321 VAL A H     1 
ATOM   2341  N  N     . SER A 1 263 ? 35.110  19.600 38.420 1.00 19.40  ? 322 SER A N     1 
ATOM   2342  C  CA    . SER A 1 263 ? 35.339  19.752 36.988 1.00 19.40  ? 322 SER A CA    1 
ATOM   2343  C  C     . SER A 1 263 ? 36.101  21.022 36.693 1.00 19.40  ? 322 SER A C     1 
ATOM   2344  O  O     . SER A 1 263 ? 36.385  21.795 37.601 1.00 56.20  ? 322 SER A O     1 
ATOM   2345  C  CB    . SER A 1 263 ? 33.988  19.761 36.265 1.00 56.20  ? 322 SER A CB    1 
ATOM   2346  O  OG    . SER A 1 263 ? 32.968  20.380 37.052 1.00 56.20  ? 322 SER A OG    1 
ATOM   2347  H  H     . SER A 1 263 ? 34.875  20.403 38.937 1.00 0.00   ? 322 SER A H     1 
ATOM   2348  H  HG    . SER A 1 263 ? 32.813  19.909 37.879 1.00 30.00  ? 322 SER A HG    1 
ATOM   2349  N  N     . LEU A 1 264 ? 36.436  21.235 35.428 1.00 18.33  ? 323 LEU A N     1 
ATOM   2350  C  CA    . LEU A 1 264 ? 37.170  22.430 35.016 1.00 18.33  ? 323 LEU A CA    1 
ATOM   2351  C  C     . LEU A 1 264 ? 36.405  23.254 34.013 1.00 18.33  ? 323 LEU A C     1 
ATOM   2352  O  O     . LEU A 1 264 ? 36.158  22.811 32.891 1.00 33.56  ? 323 LEU A O     1 
ATOM   2353  C  CB    . LEU A 1 264 ? 38.527  22.074 34.406 1.00 33.56  ? 323 LEU A CB    1 
ATOM   2354  C  CG    . LEU A 1 264 ? 39.209  23.156 33.561 1.00 33.56  ? 323 LEU A CG    1 
ATOM   2355  C  CD1   . LEU A 1 264 ? 40.591  23.511 34.095 1.00 33.56  ? 323 LEU A CD1   1 
ATOM   2356  C  CD2   . LEU A 1 264 ? 39.290  22.663 32.147 1.00 33.56  ? 323 LEU A CD2   1 
ATOM   2357  H  H     . LEU A 1 264 ? 36.187  20.602 34.724 1.00 0.00   ? 323 LEU A H     1 
ATOM   2358  N  N     . VAL A 1 265 ? 36.057  24.467 34.425 1.00 26.46  ? 324 VAL A N     1 
ATOM   2359  C  CA    . VAL A 1 265 ? 35.348  25.407 33.577 1.00 26.46  ? 324 VAL A CA    1 
ATOM   2360  C  C     . VAL A 1 265 ? 36.411  26.294 32.910 1.00 26.46  ? 324 VAL A C     1 
ATOM   2361  O  O     . VAL A 1 265 ? 37.158  27.024 33.584 1.00 21.44  ? 324 VAL A O     1 
ATOM   2362  C  CB    . VAL A 1 265 ? 34.332  26.252 34.406 1.00 21.44  ? 324 VAL A CB    1 
ATOM   2363  C  CG1   . VAL A 1 265 ? 33.672  27.296 33.542 1.00 21.44  ? 324 VAL A CG1   1 
ATOM   2364  C  CG2   . VAL A 1 265 ? 33.260  25.346 34.961 1.00 21.44  ? 324 VAL A CG2   1 
ATOM   2365  H  H     . VAL A 1 265 ? 36.298  24.757 35.328 1.00 0.00   ? 324 VAL A H     1 
ATOM   2366  N  N     . LYS A 1 266 ? 36.512  26.166 31.590 1.00 45.28  ? 325 LYS A N     1 
ATOM   2367  C  CA    . LYS A 1 266 ? 37.465  26.936 30.801 1.00 45.28  ? 325 LYS A CA    1 
ATOM   2368  C  C     . LYS A 1 266 ? 36.915  28.283 30.357 1.00 45.28  ? 325 LYS A C     1 
ATOM   2369  O  O     . LYS A 1 266 ? 35.867  28.359 29.695 1.00 34.87  ? 325 LYS A O     1 
ATOM   2370  C  CB    . LYS A 1 266 ? 37.907  26.142 29.577 1.00 34.87  ? 325 LYS A CB    1 
ATOM   2371  C  CG    . LYS A 1 266 ? 39.007  25.125 29.858 1.00 34.87  ? 325 LYS A CG    1 
ATOM   2372  C  CD    . LYS A 1 266 ? 38.890  23.993 28.861 1.00 34.87  ? 325 LYS A CD    1 
ATOM   2373  C  CE    . LYS A 1 266 ? 40.045  23.018 28.925 1.00 34.87  ? 325 LYS A CE    1 
ATOM   2374  N  NZ    . LYS A 1 266 ? 39.758  21.854 28.030 1.00 34.87  ? 325 LYS A NZ    1 
ATOM   2375  H  H     . LYS A 1 266 ? 35.913  25.545 31.129 1.00 0.00   ? 325 LYS A H     1 
ATOM   2376  H  HZ1   . LYS A 1 266 ? 38.871  21.397 28.332 1.00 0.00   ? 325 LYS A HZ1   1 
ATOM   2377  H  HZ2   . LYS A 1 266 ? 39.655  22.175 27.046 1.00 0.00   ? 325 LYS A HZ2   1 
ATOM   2378  H  HZ3   . LYS A 1 266 ? 40.533  21.163 28.096 1.00 0.00   ? 325 LYS A HZ3   1 
ATOM   2379  N  N     . ARG A 1 267 ? 37.624  29.340 30.755 1.00 25.25  ? 326 ARG A N     1 
ATOM   2380  C  CA    . ARG A 1 267 ? 37.252  30.696 30.407 1.00 25.25  ? 326 ARG A CA    1 
ATOM   2381  C  C     . ARG A 1 267 ? 38.420  31.473 29.779 1.00 25.25  ? 326 ARG A C     1 
ATOM   2382  O  O     . ARG A 1 267 ? 39.258  30.869 29.108 1.00 24.30  ? 326 ARG A O     1 
ATOM   2383  C  CB    . ARG A 1 267 ? 36.663  31.416 31.610 1.00 24.30  ? 326 ARG A CB    1 
ATOM   2384  C  CG    . ARG A 1 267 ? 35.313  30.867 32.055 1.00 24.30  ? 326 ARG A CG    1 
ATOM   2385  C  CD    . ARG A 1 267 ? 34.750  31.672 33.204 1.00 24.30  ? 326 ARG A CD    1 
ATOM   2386  N  NE    . ARG A 1 267 ? 33.509  31.116 33.704 1.00 24.30  ? 326 ARG A NE    1 
ATOM   2387  C  CZ    . ARG A 1 267 ? 33.356  30.686 34.950 1.00 24.30  ? 326 ARG A CZ    1 
ATOM   2388  N  NH1   . ARG A 1 267 ? 34.372  30.757 35.813 1.00 24.30  ? 326 ARG A NH1   1 
ATOM   2389  N  NH2   . ARG A 1 267 ? 32.198  30.160 35.332 1.00 24.30  ? 326 ARG A NH2   1 
ATOM   2390  H  H     . ARG A 1 267 ? 38.439  29.183 31.272 1.00 0.00   ? 326 ARG A H     1 
ATOM   2391  H  HE    . ARG A 1 267 ? 32.758  31.031 33.081 1.00 0.00   ? 326 ARG A HE    1 
ATOM   2392  H  HH11  . ARG A 1 267 ? 35.248  31.140 35.529 1.00 0.00   ? 326 ARG A HH11  1 
ATOM   2393  H  HH12  . ARG A 1 267 ? 34.250  30.432 36.749 1.00 0.00   ? 326 ARG A HH12  1 
ATOM   2394  H  HH21  . ARG A 1 267 ? 31.454  30.094 34.664 1.00 0.00   ? 326 ARG A HH21  1 
ATOM   2395  H  HH22  . ARG A 1 267 ? 32.061  29.829 36.263 1.00 0.00   ? 326 ARG A HH22  1 
ATOM   2396  N  N     . LYS A 1 268 ? 38.554  32.763 30.092 1.00 22.01  ? 327 LYS A N     1 
ATOM   2397  C  CA    . LYS A 1 268 ? 39.569  33.600 29.444 1.00 22.01  ? 327 LYS A CA    1 
ATOM   2398  C  C     . LYS A 1 268 ? 40.817  34.056 30.190 1.00 22.01  ? 327 LYS A C     1 
ATOM   2399  O  O     . LYS A 1 268 ? 41.428  35.056 29.822 1.00 64.62  ? 327 LYS A O     1 
ATOM   2400  C  CB    . LYS A 1 268 ? 38.860  34.807 28.818 1.00 64.62  ? 327 LYS A CB    1 
ATOM   2401  C  CG    . LYS A 1 268 ? 37.742  34.413 27.841 1.00 64.62  ? 327 LYS A CG    1 
ATOM   2402  C  CD    . LYS A 1 268 ? 36.647  35.483 27.711 1.00 64.62  ? 327 LYS A CD    1 
ATOM   2403  C  CE    . LYS A 1 268 ? 37.118  36.763 26.995 1.00 64.62  ? 327 LYS A CE    1 
ATOM   2404  N  NZ    . LYS A 1 268 ? 35.996  37.742 26.769 1.00 64.62  ? 327 LYS A NZ    1 
ATOM   2405  H  H     . LYS A 1 268 ? 38.019  33.187 30.792 1.00 0.00   ? 327 LYS A H     1 
ATOM   2406  H  HZ1   . LYS A 1 268 ? 35.267  37.277 26.190 1.00 0.00   ? 327 LYS A HZ1   1 
ATOM   2407  H  HZ2   . LYS A 1 268 ? 35.582  38.013 27.684 1.00 0.00   ? 327 LYS A HZ2   1 
ATOM   2408  H  HZ3   . LYS A 1 268 ? 36.351  38.586 26.277 1.00 0.00   ? 327 LYS A HZ3   1 
ATOM   2409  N  N     . THR A 1 269 ? 41.209  33.321 31.222 1.00 33.03  ? 328 THR A N     1 
ATOM   2410  C  CA    . THR A 1 269 ? 42.402  33.671 31.987 1.00 33.03  ? 328 THR A CA    1 
ATOM   2411  C  C     . THR A 1 269 ? 43.523  32.683 31.689 1.00 33.03  ? 328 THR A C     1 
ATOM   2412  O  O     . THR A 1 269 ? 44.557  32.675 32.355 1.00 22.54  ? 328 THR A O     1 
ATOM   2413  C  CB    . THR A 1 269 ? 42.115  33.651 33.492 1.00 22.54  ? 328 THR A CB    1 
ATOM   2414  O  OG1   . THR A 1 269 ? 41.466  32.422 33.840 1.00 22.54  ? 328 THR A OG1   1 
ATOM   2415  C  CG2   . THR A 1 269 ? 41.235  34.831 33.874 1.00 22.54  ? 328 THR A CG2   1 
ATOM   2416  H  H     . THR A 1 269 ? 40.693  32.550 31.516 1.00 0.00   ? 328 THR A H     1 
ATOM   2417  H  HG1   . THR A 1 269 ? 41.833  32.224 34.719 1.00 30.00  ? 328 THR A HG1   1 
ATOM   2418  N  N     . THR A 1 270 ? 43.311  31.860 30.669 1.00 50.24  ? 329 THR A N     1 
ATOM   2419  C  CA    . THR A 1 270 ? 44.267  30.846 30.276 1.00 50.24  ? 329 THR A CA    1 
ATOM   2420  C  C     . THR A 1 270 ? 44.664  30.944 28.800 1.00 50.24  ? 329 THR A C     1 
ATOM   2421  O  O     . THR A 1 270 ? 43.829  31.194 27.917 1.00 44.52  ? 329 THR A O     1 
ATOM   2422  C  CB    . THR A 1 270 ? 43.700  29.453 30.600 1.00 44.52  ? 329 THR A CB    1 
ATOM   2423  O  OG1   . THR A 1 270 ? 44.442  28.883 31.682 1.00 44.52  ? 329 THR A OG1   1 
ATOM   2424  C  CG2   . THR A 1 270 ? 43.712  28.520 29.371 1.00 44.52  ? 329 THR A CG2   1 
ATOM   2425  H  H     . THR A 1 270 ? 42.500  31.935 30.125 1.00 0.00   ? 329 THR A H     1 
ATOM   2426  H  HG1   . THR A 1 270 ? 44.342  29.478 32.437 1.00 30.00  ? 329 THR A HG1   1 
ATOM   2427  N  N     . LEU A 1 271 ? 45.951  30.742 28.545 1.00 48.22  ? 330 LEU A N     1 
ATOM   2428  C  CA    . LEU A 1 271 ? 46.485  30.791 27.199 1.00 48.22  ? 330 LEU A CA    1 
ATOM   2429  C  C     . LEU A 1 271 ? 47.830  30.119 27.217 1.00 48.22  ? 330 LEU A C     1 
ATOM   2430  O  O     . LEU A 1 271 ? 48.463  30.020 28.278 1.00 30.94  ? 330 LEU A O     1 
ATOM   2431  C  CB    . LEU A 1 271 ? 46.673  32.228 26.777 1.00 30.94  ? 330 LEU A CB    1 
ATOM   2432  C  CG    . LEU A 1 271 ? 46.290  32.532 25.348 1.00 30.94  ? 330 LEU A CG    1 
ATOM   2433  C  CD1   . LEU A 1 271 ? 44.869  32.072 25.108 1.00 30.94  ? 330 LEU A CD1   1 
ATOM   2434  C  CD2   . LEU A 1 271 ? 46.413  34.027 25.126 1.00 30.94  ? 330 LEU A CD2   1 
ATOM   2435  H  H     . LEU A 1 271 ? 46.597  30.592 29.274 1.00 0.00   ? 330 LEU A H     1 
ATOM   2436  N  N     . ALA A 1 272 ? 48.230  29.600 26.059 1.00 26.55  ? 331 ALA A N     1 
ATOM   2437  C  CA    . ALA A 1 272 ? 49.522  28.946 25.905 1.00 26.55  ? 331 ALA A CA    1 
ATOM   2438  C  C     . ALA A 1 272 ? 50.518  30.096 26.077 1.00 26.55  ? 331 ALA A C     1 
ATOM   2439  O  O     . ALA A 1 272 ? 50.207  31.226 25.707 1.00 47.74  ? 331 ALA A O     1 
ATOM   2440  C  CB    . ALA A 1 272 ? 49.619  28.333 24.526 1.00 47.74  ? 331 ALA A CB    1 
ATOM   2441  H  H     . ALA A 1 272 ? 47.663  29.711 25.273 1.00 0.00   ? 331 ALA A H     1 
ATOM   2442  N  N     . PRO A 1 273 ? 51.709  29.825 26.647 1.00 24.97  ? 332 PRO A N     1 
ATOM   2443  C  CA    . PRO A 1 273 ? 52.791  30.773 26.922 1.00 24.97  ? 332 PRO A CA    1 
ATOM   2444  C  C     . PRO A 1 273 ? 53.017  31.885 25.904 1.00 24.97  ? 332 PRO A C     1 
ATOM   2445  O  O     . PRO A 1 273 ? 52.105  32.669 25.597 1.00 42.42  ? 332 PRO A O     1 
ATOM   2446  C  CB    . PRO A 1 273 ? 54.005  29.864 27.050 1.00 42.42  ? 332 PRO A CB    1 
ATOM   2447  C  CG    . PRO A 1 273 ? 53.451  28.684 27.656 1.00 42.42  ? 332 PRO A CG    1 
ATOM   2448  C  CD    . PRO A 1 273 ? 52.203  28.455 26.845 1.00 42.42  ? 332 PRO A CD    1 
ATOM   2449  N  N     . ASN A 1 274 ? 54.252  32.001 25.429 1.00 67.53  ? 333 ASN A N     1 
ATOM   2450  C  CA    . ASN A 1 274 ? 54.602  33.024 24.454 1.00 67.53  ? 333 ASN A CA    1 
ATOM   2451  C  C     . ASN A 1 274 ? 53.648  32.875 23.285 1.00 67.53  ? 333 ASN A C     1 
ATOM   2452  O  O     . ASN A 1 274 ? 53.648  31.847 22.606 1.00 111.35 ? 333 ASN A O     1 
ATOM   2453  C  CB    . ASN A 1 274 ? 56.044  32.838 23.967 1.00 111.35 ? 333 ASN A CB    1 
ATOM   2454  C  CG    . ASN A 1 274 ? 57.029  32.605 25.108 1.00 111.35 ? 333 ASN A CG    1 
ATOM   2455  O  OD1   . ASN A 1 274 ? 56.819  33.061 26.236 1.00 111.35 ? 333 ASN A OD1   1 
ATOM   2456  N  ND2   . ASN A 1 274 ? 58.097  31.864 24.822 1.00 111.35 ? 333 ASN A ND2   1 
ATOM   2457  H  H     . ASN A 1 274 ? 54.976  31.422 25.714 1.00 0.00   ? 333 ASN A H     1 
ATOM   2458  H  HD21  . ASN A 1 274 ? 58.749  31.723 25.539 1.00 0.00   ? 333 ASN A HD21  1 
ATOM   2459  H  HD22  . ASN A 1 274 ? 58.186  31.505 23.915 1.00 0.00   ? 333 ASN A HD22  1 
ATOM   2460  N  N     . THR A 1 275 ? 52.767  33.851 23.115 1.00 48.37  ? 334 THR A N     1 
ATOM   2461  C  CA    . THR A 1 275 ? 51.831  33.797 22.013 1.00 48.37  ? 334 THR A CA    1 
ATOM   2462  C  C     . THR A 1 275 ? 52.242  34.782 20.933 1.00 48.37  ? 334 THR A C     1 
ATOM   2463  O  O     . THR A 1 275 ? 52.380  35.988 21.171 1.00 62.82  ? 334 THR A O     1 
ATOM   2464  C  CB    . THR A 1 275 ? 50.393  34.020 22.468 1.00 62.82  ? 334 THR A CB    1 
ATOM   2465  O  OG1   . THR A 1 275 ? 50.018  32.955 23.348 1.00 62.82  ? 334 THR A OG1   1 
ATOM   2466  C  CG2   . THR A 1 275 ? 49.449  34.019 21.278 1.00 62.82  ? 334 THR A CG2   1 
ATOM   2467  H  H     . THR A 1 275 ? 52.724  34.592 23.750 1.00 0.00   ? 334 THR A H     1 
ATOM   2468  H  HG1   . THR A 1 275 ? 50.549  32.913 24.170 1.00 30.00  ? 334 THR A HG1   1 
ATOM   2469  N  N     . GLN A 1 276 ? 52.461  34.215 19.750 1.00 94.77  ? 335 GLN A N     1 
ATOM   2470  C  CA    . GLN A 1 276 ? 52.892  34.912 18.541 1.00 94.77  ? 335 GLN A CA    1 
ATOM   2471  C  C     . GLN A 1 276 ? 51.870  35.835 17.853 1.00 94.77  ? 335 GLN A C     1 
ATOM   2472  O  O     . GLN A 1 276 ? 51.787  35.854 16.616 1.00 82.37  ? 335 GLN A O     1 
ATOM   2473  C  CB    . GLN A 1 276 ? 53.408  33.876 17.527 1.00 82.37  ? 335 GLN A CB    1 
ATOM   2474  C  CG    . GLN A 1 276 ? 52.643  32.526 17.512 1.00 82.37  ? 335 GLN A CG    1 
ATOM   2475  C  CD    . GLN A 1 276 ? 51.107  32.661 17.442 1.00 82.37  ? 335 GLN A CD    1 
ATOM   2476  O  OE1   . GLN A 1 276 ? 50.399  32.197 18.343 1.00 82.37  ? 335 GLN A OE1   1 
ATOM   2477  N  NE2   . GLN A 1 276 ? 50.594  33.291 16.375 1.00 82.37  ? 335 GLN A NE2   1 
ATOM   2478  H  H     . GLN A 1 276 ? 52.287  33.249 19.744 1.00 0.00   ? 335 GLN A H     1 
ATOM   2479  N  N     . THR A 1 277 ? 51.114  36.604 18.634 1.00 67.15  ? 336 THR A N     1 
ATOM   2480  C  CA    . THR A 1 277 ? 50.125  37.523 18.071 1.00 67.15  ? 336 THR A CA    1 
ATOM   2481  C  C     . THR A 1 277 ? 48.987  36.802 17.324 1.00 67.15  ? 336 THR A C     1 
ATOM   2482  O  O     . THR A 1 277 ? 49.226  35.966 16.439 1.00 80.51  ? 336 THR A O     1 
ATOM   2483  C  CB    . THR A 1 277 ? 50.821  38.579 17.126 1.00 80.51  ? 336 THR A CB    1 
ATOM   2484  O  OG1   . THR A 1 277 ? 51.855  39.269 17.850 1.00 80.51  ? 336 THR A OG1   1 
ATOM   2485  C  CG2   . THR A 1 277 ? 49.814  39.612 16.582 1.00 80.51  ? 336 THR A CG2   1 
ATOM   2486  H  H     . THR A 1 277 ? 51.240  36.582 19.602 1.00 0.00   ? 336 THR A H     1 
ATOM   2487  H  HG1   . THR A 1 277 ? 52.559  38.640 18.031 1.00 30.00  ? 336 THR A HG1   1 
ATOM   2488  N  N     . ALA A 1 278 ? 47.751  37.121 17.726 1.00 50.89  ? 337 ALA A N     1 
ATOM   2489  C  CA    . ALA A 1 278 ? 46.537  36.554 17.125 1.00 50.89  ? 337 ALA A CA    1 
ATOM   2490  C  C     . ALA A 1 278 ? 45.279  37.029 17.863 1.00 50.89  ? 337 ALA A C     1 
ATOM   2491  O  O     . ALA A 1 278 ? 45.201  38.184 18.301 1.00 65.00  ? 337 ALA A O     1 
ATOM   2492  C  CB    . ALA A 1 278 ? 46.613  35.011 17.130 1.00 65.00  ? 337 ALA A CB    1 
ATOM   2493  H  H     . ALA A 1 278 ? 47.618  37.773 18.447 1.00 0.00   ? 337 ALA A H     1 
ATOM   2494  N  N     . SER A 1 279 ? 44.309  36.112 17.973 1.00 73.60  ? 338 SER A N     1 
ATOM   2495  C  CA    . SER A 1 279 ? 43.013  36.272 18.654 1.00 73.60  ? 338 SER A CA    1 
ATOM   2496  C  C     . SER A 1 279 ? 41.860  36.997 17.949 1.00 73.60  ? 338 SER A C     1 
ATOM   2497  O  O     . SER A 1 279 ? 41.803  38.230 17.886 1.00 63.83  ? 338 SER A O     1 
ATOM   2498  C  CB    . SER A 1 279 ? 43.181  36.803 20.087 1.00 63.83  ? 338 SER A CB    1 
ATOM   2499  O  OG    . SER A 1 279 ? 41.919  36.862 20.747 1.00 63.83  ? 338 SER A OG    1 
ATOM   2500  H  H     . SER A 1 279 ? 44.403  35.245 17.544 1.00 0.00   ? 338 SER A H     1 
ATOM   2501  H  HG    . SER A 1 279 ? 42.100  37.089 21.669 1.00 30.00  ? 338 SER A HG    1 
ATOM   2502  N  N     . PRO A 1 280 ? 40.924  36.223 17.395 1.00 27.96  ? 339 PRO A N     1 
ATOM   2503  C  CA    . PRO A 1 280 ? 39.774  36.799 16.705 1.00 27.96  ? 339 PRO A CA    1 
ATOM   2504  C  C     . PRO A 1 280 ? 38.983  37.766 17.580 1.00 27.96  ? 339 PRO A C     1 
ATOM   2505  O  O     . PRO A 1 280 ? 38.581  38.837 17.113 1.00 30.50  ? 339 PRO A O     1 
ATOM   2506  C  CB    . PRO A 1 280 ? 38.984  35.567 16.310 1.00 30.50  ? 339 PRO A CB    1 
ATOM   2507  C  CG    . PRO A 1 280 ? 40.096  34.632 15.910 1.00 30.50  ? 339 PRO A CG    1 
ATOM   2508  C  CD    . PRO A 1 280 ? 41.067  34.792 17.066 1.00 30.50  ? 339 PRO A CD    1 
ATOM   2509  N  N     . ARG A 1 281 ? 38.791  37.427 18.851 1.00 42.98  ? 340 ARG A N     1 
ATOM   2510  C  CA    . ARG A 1 281 ? 38.067  38.335 19.733 1.00 42.98  ? 340 ARG A CA    1 
ATOM   2511  C  C     . ARG A 1 281 ? 38.910  39.590 19.943 1.00 42.98  ? 340 ARG A C     1 
ATOM   2512  O  O     . ARG A 1 281 ? 38.366  40.687 20.088 1.00 83.26  ? 340 ARG A O     1 
ATOM   2513  C  CB    . ARG A 1 281 ? 37.730  37.706 21.089 1.00 83.26  ? 340 ARG A CB    1 
ATOM   2514  C  CG    . ARG A 1 281 ? 36.935  38.658 22.029 1.00 83.26  ? 340 ARG A CG    1 
ATOM   2515  C  CD    . ARG A 1 281 ? 35.515  38.970 21.501 1.00 83.26  ? 340 ARG A CD    1 
ATOM   2516  N  NE    . ARG A 1 281 ? 35.136  40.385 21.612 1.00 83.26  ? 340 ARG A NE    1 
ATOM   2517  C  CZ    . ARG A 1 281 ? 34.063  40.930 21.027 1.00 83.26  ? 340 ARG A CZ    1 
ATOM   2518  N  NH1   . ARG A 1 281 ? 33.250  40.182 20.291 1.00 83.26  ? 340 ARG A NH1   1 
ATOM   2519  N  NH2   . ARG A 1 281 ? 33.812  42.232 21.141 1.00 83.26  ? 340 ARG A NH2   1 
ATOM   2520  H  H     . ARG A 1 281 ? 39.124  36.567 19.179 1.00 0.00   ? 340 ARG A H     1 
ATOM   2521  H  HE    . ARG A 1 281 ? 35.709  40.972 22.149 1.00 0.00   ? 340 ARG A HE    1 
ATOM   2522  H  HH11  . ARG A 1 281 ? 33.437  39.209 20.168 1.00 0.00   ? 340 ARG A HH11  1 
ATOM   2523  H  HH12  . ARG A 1 281 ? 32.448  40.595 19.857 1.00 0.00   ? 340 ARG A HH12  1 
ATOM   2524  H  HH21  . ARG A 1 281 ? 34.434  42.811 21.670 1.00 0.00   ? 340 ARG A HH21  1 
ATOM   2525  H  HH22  . ARG A 1 281 ? 33.005  42.632 20.706 1.00 0.00   ? 340 ARG A HH22  1 
ATOM   2526  N  N     . ALA A 1 282 ? 40.235  39.425 19.950 1.00 58.66  ? 341 ALA A N     1 
ATOM   2527  C  CA    . ALA A 1 282 ? 41.158  40.554 20.126 1.00 58.66  ? 341 ALA A CA    1 
ATOM   2528  C  C     . ALA A 1 282 ? 40.940  41.549 19.007 1.00 58.66  ? 341 ALA A C     1 
ATOM   2529  O  O     . ALA A 1 282 ? 40.539  42.688 19.241 1.00 59.80  ? 341 ALA A O     1 
ATOM   2530  C  CB    . ALA A 1 282 ? 42.603  40.077 20.113 1.00 59.80  ? 341 ALA A CB    1 
ATOM   2531  H  H     . ALA A 1 282 ? 40.622  38.535 19.825 1.00 0.00   ? 341 ALA A H     1 
ATOM   2532  N  N     . LEU A 1 283 ? 41.176  41.098 17.785 1.00 42.05  ? 342 LEU A N     1 
ATOM   2533  C  CA    . LEU A 1 283 ? 40.988  41.944 16.624 1.00 42.05  ? 342 LEU A CA    1 
ATOM   2534  C  C     . LEU A 1 283 ? 39.564  42.519 16.679 1.00 42.05  ? 342 LEU A C     1 
ATOM   2535  O  O     . LEU A 1 283 ? 39.352  43.723 16.484 1.00 32.26  ? 342 LEU A O     1 
ATOM   2536  C  CB    . LEU A 1 283 ? 41.169  41.109 15.357 1.00 32.26  ? 342 LEU A CB    1 
ATOM   2537  C  CG    . LEU A 1 283 ? 42.401  40.194 15.264 1.00 32.26  ? 342 LEU A CG    1 
ATOM   2538  C  CD1   . LEU A 1 283 ? 42.249  39.244 14.071 1.00 32.26  ? 342 LEU A CD1   1 
ATOM   2539  C  CD2   . LEU A 1 283 ? 43.680  41.027 15.177 1.00 32.26  ? 342 LEU A CD2   1 
ATOM   2540  H  H     . LEU A 1 283 ? 41.469  40.168 17.680 1.00 0.00   ? 342 LEU A H     1 
ATOM   2541  N  N     . ALA A 1 284 ? 38.599  41.657 16.993 1.00 34.51  ? 343 ALA A N     1 
ATOM   2542  C  CA    . ALA A 1 284 ? 37.203  42.066 17.089 1.00 34.51  ? 343 ALA A CA    1 
ATOM   2543  C  C     . ALA A 1 284 ? 37.016  43.140 18.146 1.00 34.51  ? 343 ALA A C     1 
ATOM   2544  O  O     . ALA A 1 284 ? 36.212  44.059 17.961 1.00 44.57  ? 343 ALA A O     1 
ATOM   2545  C  CB    . ALA A 1 284 ? 36.332  40.878 17.405 1.00 44.57  ? 343 ALA A CB    1 
ATOM   2546  H  H     . ALA A 1 284 ? 38.834  40.725 17.155 1.00 0.00   ? 343 ALA A H     1 
ATOM   2547  N  N     . ASP A 1 285 ? 37.762  43.035 19.243 1.00 34.27  ? 344 ASP A N     1 
ATOM   2548  C  CA    . ASP A 1 285 ? 37.675  44.014 20.323 1.00 34.27  ? 344 ASP A CA    1 
ATOM   2549  C  C     . ASP A 1 285 ? 38.230  45.343 19.834 1.00 34.27  ? 344 ASP A C     1 
ATOM   2550  O  O     . ASP A 1 285 ? 37.691  46.410 20.145 1.00 65.18  ? 344 ASP A O     1 
ATOM   2551  C  CB    . ASP A 1 285 ? 38.435  43.538 21.569 1.00 65.18  ? 344 ASP A CB    1 
ATOM   2552  C  CG    . ASP A 1 285 ? 37.511  42.956 22.644 1.00 65.18  ? 344 ASP A CG    1 
ATOM   2553  O  OD1   . ASP A 1 285 ? 36.513  43.618 23.012 1.00 65.18  ? 344 ASP A OD1   1 
ATOM   2554  O  OD2   . ASP A 1 285 ? 37.791  41.841 23.141 1.00 65.18  ? 344 ASP A OD2   1 
ATOM   2555  H  H     . ASP A 1 285 ? 38.417  42.320 19.309 1.00 0.00   ? 344 ASP A H     1 
ATOM   2556  N  N     . SER A 1 286 ? 39.299  45.266 19.046 1.00 50.76  ? 345 SER A N     1 
ATOM   2557  C  CA    . SER A 1 286 ? 39.921  46.456 18.484 1.00 50.76  ? 345 SER A CA    1 
ATOM   2558  C  C     . SER A 1 286 ? 38.899  47.097 17.551 1.00 50.76  ? 345 SER A C     1 
ATOM   2559  O  O     . SER A 1 286 ? 38.639  48.300 17.617 1.00 67.03  ? 345 SER A O     1 
ATOM   2560  C  CB    . SER A 1 286 ? 41.179  46.088 17.686 1.00 67.03  ? 345 SER A CB    1 
ATOM   2561  O  OG    . SER A 1 286 ? 42.066  45.260 18.427 1.00 67.03  ? 345 SER A OG    1 
ATOM   2562  H  H     . SER A 1 286 ? 39.716  44.402 18.856 1.00 0.00   ? 345 SER A H     1 
ATOM   2563  H  HG    . SER A 1 286 ? 42.866  45.124 17.914 1.00 30.00  ? 345 SER A HG    1 
ATOM   2564  N  N     . LEU A 1 287 ? 38.273  46.278 16.714 1.00 31.72  ? 346 LEU A N     1 
ATOM   2565  C  CA    . LEU A 1 287 ? 37.296  46.793 15.775 1.00 31.72  ? 346 LEU A CA    1 
ATOM   2566  C  C     . LEU A 1 287 ? 36.215  47.528 16.504 1.00 31.72  ? 346 LEU A C     1 
ATOM   2567  O  O     . LEU A 1 287 ? 35.908  48.653 16.145 1.00 49.26  ? 346 LEU A O     1 
ATOM   2568  C  CB    . LEU A 1 287 ? 36.739  45.676 14.902 1.00 49.26  ? 346 LEU A CB    1 
ATOM   2569  C  CG    . LEU A 1 287 ? 37.537  45.495 13.606 1.00 49.26  ? 346 LEU A CG    1 
ATOM   2570  C  CD1   . LEU A 1 287 ? 38.046  44.077 13.457 1.00 49.26  ? 346 LEU A CD1   1 
ATOM   2571  C  CD2   . LEU A 1 287 ? 36.658  45.869 12.438 1.00 49.26  ? 346 LEU A CD2   1 
ATOM   2572  H  H     . LEU A 1 287 ? 38.465  45.322 16.750 1.00 0.00   ? 346 LEU A H     1 
ATOM   2573  N  N     . MET A 1 288 ? 35.717  46.940 17.593 1.00 59.05  ? 347 MET A N     1 
ATOM   2574  C  CA    . MET A 1 288 ? 34.644  47.552 18.406 1.00 59.05  ? 347 MET A CA    1 
ATOM   2575  C  C     . MET A 1 288 ? 35.028  48.940 18.939 1.00 59.05  ? 347 MET A C     1 
ATOM   2576  O  O     . MET A 1 288 ? 34.241  49.893 18.864 1.00 44.32  ? 347 MET A O     1 
ATOM   2577  C  CB    . MET A 1 288 ? 34.258  46.636 19.573 1.00 44.32  ? 347 MET A CB    1 
ATOM   2578  C  CG    . MET A 1 288 ? 33.515  45.355 19.180 1.00 44.32  ? 347 MET A CG    1 
ATOM   2579  S  SD    . MET A 1 288 ? 31.859  45.701 18.551 1.00 44.32  ? 347 MET A SD    1 
ATOM   2580  C  CE    . MET A 1 288 ? 31.080  46.410 20.000 1.00 44.32  ? 347 MET A CE    1 
ATOM   2581  H  H     . MET A 1 288 ? 36.077  46.065 17.853 1.00 0.00   ? 347 MET A H     1 
ATOM   2582  N  N     . GLN A 1 289 ? 36.251  49.039 19.455 1.00 33.93  ? 348 GLN A N     1 
ATOM   2583  C  CA    . GLN A 1 289 ? 36.780  50.296 19.979 1.00 33.93  ? 348 GLN A CA    1 
ATOM   2584  C  C     . GLN A 1 289 ? 37.080  51.248 18.818 1.00 33.93  ? 348 GLN A C     1 
ATOM   2585  O  O     . GLN A 1 289 ? 36.895  52.469 18.934 1.00 73.90  ? 348 GLN A O     1 
ATOM   2586  C  CB    . GLN A 1 289 ? 38.054  50.045 20.791 1.00 73.90  ? 348 GLN A CB    1 
ATOM   2587  C  CG    . GLN A 1 289 ? 37.827  49.228 22.049 1.00 73.90  ? 348 GLN A CG    1 
ATOM   2588  C  CD    . GLN A 1 289 ? 39.095  48.592 22.581 1.00 73.90  ? 348 GLN A CD    1 
ATOM   2589  O  OE1   . GLN A 1 289 ? 40.136  48.625 21.929 1.00 73.90  ? 348 GLN A OE1   1 
ATOM   2590  N  NE2   . GLN A 1 289 ? 39.012  47.996 23.772 1.00 73.90  ? 348 GLN A NE2   1 
ATOM   2591  H  H     . GLN A 1 289 ? 36.814  48.236 19.486 1.00 0.00   ? 348 GLN A H     1 
ATOM   2592  N  N     . LEU A 1 290 ? 37.503  50.684 17.688 1.00 36.42  ? 349 LEU A N     1 
ATOM   2593  C  CA    . LEU A 1 290 ? 37.827  51.476 16.505 1.00 36.42  ? 349 LEU A CA    1 
ATOM   2594  C  C     . LEU A 1 290 ? 36.542  52.087 15.965 1.00 36.42  ? 349 LEU A C     1 
ATOM   2595  O  O     . LEU A 1 290 ? 36.467  53.297 15.693 1.00 49.57  ? 349 LEU A O     1 
ATOM   2596  C  CB    . LEU A 1 290 ? 38.476  50.586 15.430 1.00 49.57  ? 349 LEU A CB    1 
ATOM   2597  C  CG    . LEU A 1 290 ? 39.957  50.783 15.048 1.00 49.57  ? 349 LEU A CG    1 
ATOM   2598  C  CD1   . LEU A 1 290 ? 40.153  52.179 14.451 1.00 49.57  ? 349 LEU A CD1   1 
ATOM   2599  C  CD2   . LEU A 1 290 ? 40.876  50.561 16.262 1.00 49.57  ? 349 LEU A CD2   1 
ATOM   2600  H  H     . LEU A 1 290 ? 37.550  49.718 17.657 1.00 0.00   ? 349 LEU A H     1 
ATOM   2601  N  N     . ALA A 1 291 ? 35.517  51.238 15.917 1.00 27.88  ? 350 ALA A N     1 
ATOM   2602  C  CA    . ALA A 1 291 ? 34.186  51.565 15.437 1.00 27.88  ? 350 ALA A CA    1 
ATOM   2603  C  C     . ALA A 1 291 ? 33.503  52.645 16.257 1.00 27.88  ? 350 ALA A C     1 
ATOM   2604  O  O     . ALA A 1 291 ? 32.532  53.230 15.809 1.00 34.36  ? 350 ALA A O     1 
ATOM   2605  C  CB    . ALA A 1 291 ? 33.339  50.321 15.415 1.00 34.36  ? 350 ALA A CB    1 
ATOM   2606  H  H     . ALA A 1 291 ? 35.659  50.363 16.282 1.00 0.00   ? 350 ALA A H     1 
ATOM   2607  N  N     . ARG A 1 292 ? 33.997  52.904 17.464 1.00 60.97  ? 351 ARG A N     1 
ATOM   2608  C  CA    . ARG A 1 292 ? 33.417  53.941 18.315 1.00 60.97  ? 351 ARG A CA    1 
ATOM   2609  C  C     . ARG A 1 292 ? 33.953  55.344 17.974 1.00 60.97  ? 351 ARG A C     1 
ATOM   2610  O  O     . ARG A 1 292 ? 33.208  56.324 17.980 1.00 52.92  ? 351 ARG A O     1 
ATOM   2611  C  CB    . ARG A 1 292 ? 33.651  53.615 19.792 1.00 52.92  ? 351 ARG A CB    1 
ATOM   2612  C  CG    . ARG A 1 292 ? 33.085  52.262 20.255 1.00 52.92  ? 351 ARG A CG    1 
ATOM   2613  C  CD    . ARG A 1 292 ? 31.709  51.985 19.659 1.00 52.92  ? 351 ARG A CD    1 
ATOM   2614  N  NE    . ARG A 1 292 ? 30.783  51.287 20.557 1.00 52.92  ? 351 ARG A NE    1 
ATOM   2615  C  CZ    . ARG A 1 292 ? 31.018  50.110 21.131 1.00 52.92  ? 351 ARG A CZ    1 
ATOM   2616  N  NH1   . ARG A 1 292 ? 32.169  49.478 20.931 1.00 52.92  ? 351 ARG A NH1   1 
ATOM   2617  N  NH2   . ARG A 1 292 ? 30.052  49.514 21.821 1.00 52.92  ? 351 ARG A NH2   1 
ATOM   2618  H  H     . ARG A 1 292 ? 34.751  52.382 17.805 1.00 0.00   ? 351 ARG A H     1 
ATOM   2619  H  HE    . ARG A 1 292 ? 29.924  51.719 20.745 1.00 0.00   ? 351 ARG A HE    1 
ATOM   2620  H  HH11  . ARG A 1 292 ? 32.871  49.867 20.337 1.00 0.00   ? 351 ARG A HH11  1 
ATOM   2621  H  HH12  . ARG A 1 292 ? 32.326  48.594 21.368 1.00 0.00   ? 351 ARG A HH12  1 
ATOM   2622  H  HH21  . ARG A 1 292 ? 29.156  49.952 21.897 1.00 0.00   ? 351 ARG A HH21  1 
ATOM   2623  H  HH22  . ARG A 1 292 ? 30.218  48.629 22.254 1.00 0.00   ? 351 ARG A HH22  1 
ATOM   2624  N  N     . GLN A 1 293 ? 35.247  55.443 17.678 1.00 41.63  ? 352 GLN A N     1 
ATOM   2625  C  CA    . GLN A 1 293 ? 35.835  56.731 17.327 1.00 41.63  ? 352 GLN A CA    1 
ATOM   2626  C  C     . GLN A 1 293 ? 35.204  57.130 16.018 1.00 41.63  ? 352 GLN A C     1 
ATOM   2627  O  O     . GLN A 1 293 ? 34.915  58.303 15.773 1.00 67.15  ? 352 GLN A O     1 
ATOM   2628  C  CB    . GLN A 1 293 ? 37.357  56.637 17.174 1.00 67.15  ? 352 GLN A CB    1 
ATOM   2629  C  CG    . GLN A 1 293 ? 38.106  56.535 18.495 1.00 67.15  ? 352 GLN A CG    1 
ATOM   2630  C  CD    . GLN A 1 293 ? 39.619  56.556 18.336 1.00 67.15  ? 352 GLN A CD    1 
ATOM   2631  O  OE1   . GLN A 1 293 ? 40.228  55.560 17.945 1.00 67.15  ? 352 GLN A OE1   1 
ATOM   2632  N  NE2   . GLN A 1 293 ? 40.233  57.687 18.661 1.00 67.15  ? 352 GLN A NE2   1 
ATOM   2633  H  H     . GLN A 1 293 ? 35.806  54.635 17.683 1.00 0.00   ? 352 GLN A H     1 
ATOM   2634  N  N     . VAL A 1 294 ? 34.972  56.125 15.184 1.00 62.21  ? 353 VAL A N     1 
ATOM   2635  C  CA    . VAL A 1 294 ? 34.353  56.335 13.890 1.00 62.21  ? 353 VAL A CA    1 
ATOM   2636  C  C     . VAL A 1 294 ? 32.939  56.884 14.058 1.00 62.21  ? 353 VAL A C     1 
ATOM   2637  O  O     . VAL A 1 294 ? 32.535  57.792 13.334 1.00 42.27  ? 353 VAL A O     1 
ATOM   2638  C  CB    . VAL A 1 294 ? 34.297  55.034 13.089 1.00 42.27  ? 353 VAL A CB    1 
ATOM   2639  C  CG1   . VAL A 1 294 ? 33.608  55.270 11.738 1.00 42.27  ? 353 VAL A CG1   1 
ATOM   2640  C  CG2   . VAL A 1 294 ? 35.705  54.482 12.910 1.00 42.27  ? 353 VAL A CG2   1 
ATOM   2641  H  H     . VAL A 1 294 ? 35.256  55.225 15.454 1.00 0.00   ? 353 VAL A H     1 
ATOM   2642  N  N     . SER A 1 295 ? 32.187  56.350 15.014 1.00 69.97  ? 354 SER A N     1 
ATOM   2643  C  CA    . SER A 1 295 ? 30.829  56.837 15.227 1.00 69.97  ? 354 SER A CA    1 
ATOM   2644  C  C     . SER A 1 295 ? 30.882  58.307 15.612 1.00 69.97  ? 354 SER A C     1 
ATOM   2645  O  O     . SER A 1 295 ? 30.094  59.113 15.119 1.00 54.73  ? 354 SER A O     1 
ATOM   2646  C  CB    . SER A 1 295 ? 30.122  56.018 16.309 1.00 54.73  ? 354 SER A CB    1 
ATOM   2647  O  OG    . SER A 1 295 ? 30.992  55.733 17.387 1.00 54.73  ? 354 SER A OG    1 
ATOM   2648  H  H     . SER A 1 295 ? 32.499  55.640 15.613 1.00 0.00   ? 354 SER A H     1 
ATOM   2649  H  HG    . SER A 1 295 ? 30.503  55.300 18.090 1.00 30.00  ? 354 SER A HG    1 
ATOM   2650  N  N     . ARG A 1 296 ? 31.861  58.645 16.448 1.00 51.90  ? 355 ARG A N     1 
ATOM   2651  C  CA    . ARG A 1 296 ? 32.049  60.012 16.911 1.00 51.90  ? 355 ARG A CA    1 
ATOM   2652  C  C     . ARG A 1 296 ? 32.765  60.886 15.900 1.00 51.90  ? 355 ARG A C     1 
ATOM   2653  O  O     . ARG A 1 296 ? 32.826  62.103 16.055 1.00 57.90  ? 355 ARG A O     1 
ATOM   2654  C  CB    . ARG A 1 296 ? 32.809  60.029 18.222 1.00 57.90  ? 355 ARG A CB    1 
ATOM   2655  C  CG    . ARG A 1 296 ? 32.909  61.411 18.810 1.00 57.90  ? 355 ARG A CG    1 
ATOM   2656  C  CD    . ARG A 1 296 ? 33.825  61.415 19.966 1.00 57.90  ? 355 ARG A CD    1 
ATOM   2657  N  NE    . ARG A 1 296 ? 35.101  60.786 19.642 1.00 57.90  ? 355 ARG A NE    1 
ATOM   2658  C  CZ    . ARG A 1 296 ? 35.480  59.588 20.083 1.00 57.90  ? 355 ARG A CZ    1 
ATOM   2659  N  NH1   . ARG A 1 296 ? 34.673  58.883 20.872 1.00 57.90  ? 355 ARG A NH1   1 
ATOM   2660  N  NH2   . ARG A 1 296 ? 36.660  59.088 19.725 1.00 57.90  ? 355 ARG A NH2   1 
ATOM   2661  H  H     . ARG A 1 296 ? 32.473  57.945 16.761 1.00 0.00   ? 355 ARG A H     1 
ATOM   2662  H  HE    . ARG A 1 296 ? 35.721  61.271 19.058 1.00 0.00   ? 355 ARG A HE    1 
ATOM   2663  H  HH11  . ARG A 1 296 ? 33.781  59.255 21.133 1.00 0.00   ? 355 ARG A HH11  1 
ATOM   2664  H  HH12  . ARG A 1 296 ? 34.955  57.986 21.207 1.00 0.00   ? 355 ARG A HH12  1 
ATOM   2665  H  HH21  . ARG A 1 296 ? 37.266  59.600 19.120 1.00 0.00   ? 355 ARG A HH21  1 
ATOM   2666  H  HH22  . ARG A 1 296 ? 36.933  58.188 20.064 1.00 0.00   ? 355 ARG A HH22  1 
ATOM   2667  N  N     . LEU A 1 297 ? 33.351  60.256 14.892 1.00 64.68  ? 356 LEU A N     1 
ATOM   2668  C  CA    . LEU A 1 297 ? 34.031  60.982 13.835 1.00 64.68  ? 356 LEU A CA    1 
ATOM   2669  C  C     . LEU A 1 297 ? 33.078  62.048 13.273 1.00 64.68  ? 356 LEU A C     1 
ATOM   2670  O  O     . LEU A 1 297 ? 31.846  61.795 13.221 1.00 87.11  ? 356 LEU A O     1 
ATOM   2671  C  CB    . LEU A 1 297 ? 34.461  59.999 12.734 1.00 87.11  ? 356 LEU A CB    1 
ATOM   2672  C  CG    . LEU A 1 297 ? 35.079  60.424 11.392 1.00 87.11  ? 356 LEU A CG    1 
ATOM   2673  C  CD1   . LEU A 1 297 ? 35.791  59.233 10.777 1.00 87.11  ? 356 LEU A CD1   1 
ATOM   2674  C  CD2   . LEU A 1 297 ? 34.024  60.960 10.422 1.00 87.11  ? 356 LEU A CD2   1 
ATOM   2675  H  H     . LEU A 1 297 ? 33.329  59.285 14.849 1.00 0.00   ? 356 LEU A H     1 
ATOM   2676  N  N     . SER B 1 2   ? 28.293  34.366 76.337 1.00 116.08 ? 61  SER B N     1 
ATOM   2677  C  CA    . SER B 1 2   ? 27.276  35.070 77.164 1.00 116.08 ? 61  SER B CA    1 
ATOM   2678  C  C     . SER B 1 2   ? 26.083  35.424 76.260 1.00 116.08 ? 61  SER B C     1 
ATOM   2679  O  O     . SER B 1 2   ? 25.757  34.648 75.354 1.00 100.78 ? 61  SER B O     1 
ATOM   2680  C  CB    . SER B 1 2   ? 27.903  36.324 77.802 1.00 100.78 ? 61  SER B CB    1 
ATOM   2681  O  OG    . SER B 1 2   ? 29.151  36.016 78.419 1.00 100.78 ? 61  SER B OG    1 
ATOM   2682  H  HG    . SER B 1 2   ? 29.570  36.829 78.738 1.00 30.00  ? 61  SER B HG    1 
ATOM   2683  N  N     . LEU B 1 3   ? 25.445  36.572 76.510 1.00 46.37  ? 62  LEU B N     1 
ATOM   2684  C  CA    . LEU B 1 3   ? 24.288  37.049 75.739 1.00 46.37  ? 62  LEU B CA    1 
ATOM   2685  C  C     . LEU B 1 3   ? 24.176  36.528 74.295 1.00 46.37  ? 62  LEU B C     1 
ATOM   2686  O  O     . LEU B 1 3   ? 24.971  36.886 73.427 1.00 52.97  ? 62  LEU B O     1 
ATOM   2687  C  CB    . LEU B 1 3   ? 24.250  38.582 75.750 1.00 52.97  ? 62  LEU B CB    1 
ATOM   2688  C  CG    . LEU B 1 3   ? 22.931  39.268 75.385 1.00 52.97  ? 62  LEU B CG    1 
ATOM   2689  C  CD1   . LEU B 1 3   ? 22.819  40.564 76.149 1.00 52.97  ? 62  LEU B CD1   1 
ATOM   2690  C  CD2   . LEU B 1 3   ? 22.819  39.511 73.895 1.00 52.97  ? 62  LEU B CD2   1 
ATOM   2691  H  H     . LEU B 1 3   ? 25.709  37.163 77.240 1.00 0.00   ? 62  LEU B H     1 
ATOM   2692  N  N     . LEU B 1 4   ? 23.164  35.690 74.076 1.00 24.05  ? 63  LEU B N     1 
ATOM   2693  C  CA    . LEU B 1 4   ? 22.877  35.092 72.786 1.00 24.05  ? 63  LEU B CA    1 
ATOM   2694  C  C     . LEU B 1 4   ? 22.221  36.155 71.928 1.00 24.05  ? 63  LEU B C     1 
ATOM   2695  O  O     . LEU B 1 4   ? 21.147  36.650 72.258 1.00 35.08  ? 63  LEU B O     1 
ATOM   2696  C  CB    . LEU B 1 4   ? 21.939  33.901 72.975 1.00 35.08  ? 63  LEU B CB    1 
ATOM   2697  C  CG    . LEU B 1 4   ? 21.741  32.867 71.863 1.00 35.08  ? 63  LEU B CG    1 
ATOM   2698  C  CD1   . LEU B 1 4   ? 20.694  33.318 70.847 1.00 35.08  ? 63  LEU B CD1   1 
ATOM   2699  C  CD2   . LEU B 1 4   ? 23.065  32.563 71.207 1.00 35.08  ? 63  LEU B CD2   1 
ATOM   2700  H  H     . LEU B 1 4   ? 22.555  35.472 74.809 1.00 0.00   ? 63  LEU B H     1 
ATOM   2701  N  N     . ILE B 1 5   ? 22.861  36.482 70.812 1.00 21.92  ? 64  ILE B N     1 
ATOM   2702  C  CA    . ILE B 1 5   ? 22.371  37.497 69.878 1.00 21.92  ? 64  ILE B CA    1 
ATOM   2703  C  C     . ILE B 1 5   ? 21.882  36.824 68.609 1.00 21.92  ? 64  ILE B C     1 
ATOM   2704  O  O     . ILE B 1 5   ? 22.536  35.932 68.087 1.00 27.44  ? 64  ILE B O     1 
ATOM   2705  C  CB    . ILE B 1 5   ? 23.483  38.499 69.517 1.00 27.44  ? 64  ILE B CB    1 
ATOM   2706  C  CG1   . ILE B 1 5   ? 24.090  39.070 70.802 1.00 27.44  ? 64  ILE B CG1   1 
ATOM   2707  C  CG2   . ILE B 1 5   ? 22.919  39.619 68.633 1.00 27.44  ? 64  ILE B CG2   1 
ATOM   2708  C  CD1   . ILE B 1 5   ? 25.128  40.151 70.577 1.00 27.44  ? 64  ILE B CD1   1 
ATOM   2709  H  H     . ILE B 1 5   ? 23.643  35.972 70.594 1.00 0.00   ? 64  ILE B H     1 
ATOM   2710  N  N     . GLY B 1 6   ? 20.729  37.249 68.119 1.00 24.42  ? 65  GLY B N     1 
ATOM   2711  C  CA    . GLY B 1 6   ? 20.180  36.640 66.930 1.00 24.42  ? 65  GLY B CA    1 
ATOM   2712  C  C     . GLY B 1 6   ? 20.214  37.567 65.738 1.00 24.42  ? 65  GLY B C     1 
ATOM   2713  O  O     . GLY B 1 6   ? 19.784  38.728 65.793 1.00 21.44  ? 65  GLY B O     1 
ATOM   2714  H  H     . GLY B 1 6   ? 20.241  37.984 68.539 1.00 0.00   ? 65  GLY B H     1 
ATOM   2715  N  N     . VAL B 1 7   ? 20.700  37.036 64.630 1.00 17.61  ? 66  VAL B N     1 
ATOM   2716  C  CA    . VAL B 1 7   ? 20.787  37.811 63.429 1.00 17.61  ? 66  VAL B CA    1 
ATOM   2717  C  C     . VAL B 1 7   ? 19.906  37.083 62.436 1.00 17.61  ? 66  VAL B C     1 
ATOM   2718  O  O     . VAL B 1 7   ? 20.020  35.874 62.295 1.00 13.11  ? 66  VAL B O     1 
ATOM   2719  C  CB    . VAL B 1 7   ? 22.275  37.904 62.968 1.00 13.11  ? 66  VAL B CB    1 
ATOM   2720  C  CG1   . VAL B 1 7   ? 22.470  38.862 61.762 1.00 13.11  ? 66  VAL B CG1   1 
ATOM   2721  C  CG2   . VAL B 1 7   ? 23.141  38.340 64.151 1.00 13.11  ? 66  VAL B CG2   1 
ATOM   2722  H  H     . VAL B 1 7   ? 20.968  36.098 64.604 1.00 0.00   ? 66  VAL B H     1 
ATOM   2723  N  N     . ALA B 1 8   ? 18.893  37.797 61.943 1.00 26.04  ? 67  ALA B N     1 
ATOM   2724  C  CA    . ALA B 1 8   ? 17.958  37.317 60.926 1.00 26.04  ? 67  ALA B CA    1 
ATOM   2725  C  C     . ALA B 1 8   ? 18.551  38.075 59.760 1.00 26.04  ? 67  ALA B C     1 
ATOM   2726  O  O     . ALA B 1 8   ? 18.520  39.314 59.753 1.00 24.10  ? 67  ALA B O     1 
ATOM   2727  C  CB    . ALA B 1 8   ? 16.538  37.815 61.206 1.00 24.10  ? 67  ALA B CB    1 
ATOM   2728  H  H     . ALA B 1 8   ? 18.786  38.713 62.289 1.00 0.00   ? 67  ALA B H     1 
ATOM   2729  N  N     . THR B 1 9   ? 19.074  37.369 58.769 1.00 29.18  ? 68  THR B N     1 
ATOM   2730  C  CA    . THR B 1 9   ? 19.749  38.055 57.679 1.00 29.18  ? 68  THR B CA    1 
ATOM   2731  C  C     . THR B 1 9   ? 19.291  37.786 56.240 1.00 29.18  ? 68  THR B C     1 
ATOM   2732  O  O     . THR B 1 9   ? 18.652  36.779 55.943 1.00 20.31  ? 68  THR B O     1 
ATOM   2733  C  CB    . THR B 1 9   ? 21.311  37.852 57.839 1.00 20.31  ? 68  THR B CB    1 
ATOM   2734  O  OG1   . THR B 1 9   ? 22.023  38.535 56.801 1.00 20.31  ? 68  THR B OG1   1 
ATOM   2735  C  CG2   . THR B 1 9   ? 21.681  36.379 57.822 1.00 20.31  ? 68  THR B CG2   1 
ATOM   2736  H  H     . THR B 1 9   ? 18.966  36.394 58.743 1.00 0.00   ? 68  THR B H     1 
ATOM   2737  H  HG1   . THR B 1 9   ? 21.963  38.061 55.956 1.00 30.00  ? 68  THR B HG1   1 
ATOM   2738  N  N     . SER B 1 10  ? 19.524  38.754 55.363 1.00 27.33  ? 69  SER B N     1 
ATOM   2739  C  CA    . SER B 1 10  ? 19.191  38.561 53.967 1.00 27.33  ? 69  SER B CA    1 
ATOM   2740  C  C     . SER B 1 10  ? 20.283  37.612 53.443 1.00 27.33  ? 69  SER B C     1 
ATOM   2741  O  O     . SER B 1 10  ? 21.217  37.255 54.178 1.00 48.43  ? 69  SER B O     1 
ATOM   2742  C  CB    . SER B 1 10  ? 19.177  39.881 53.198 1.00 48.43  ? 69  SER B CB    1 
ATOM   2743  O  OG    . SER B 1 10  ? 20.335  40.640 53.465 1.00 48.43  ? 69  SER B OG    1 
ATOM   2744  H  H     . SER B 1 10  ? 19.942  39.577 55.684 1.00 0.00   ? 69  SER B H     1 
ATOM   2745  H  HG    . SER B 1 10  ? 20.439  40.800 54.413 1.00 30.00  ? 69  SER B HG    1 
ATOM   2746  N  N     . SER B 1 11  ? 20.154  37.201 52.186 1.00 50.24  ? 70  SER B N     1 
ATOM   2747  C  CA    . SER B 1 11  ? 21.090  36.274 51.572 1.00 50.24  ? 70  SER B CA    1 
ATOM   2748  C  C     . SER B 1 11  ? 22.560  36.411 51.926 1.00 50.24  ? 70  SER B C     1 
ATOM   2749  O  O     . SER B 1 11  ? 23.201  37.416 51.627 1.00 53.66  ? 70  SER B O     1 
ATOM   2750  C  CB    . SER B 1 11  ? 20.974  36.311 50.054 1.00 53.66  ? 70  SER B CB    1 
ATOM   2751  O  OG    . SER B 1 11  ? 21.910  35.404 49.483 1.00 53.66  ? 70  SER B OG    1 
ATOM   2752  H  H     . SER B 1 11  ? 19.415  37.548 51.656 1.00 0.00   ? 70  SER B H     1 
ATOM   2753  H  HG    . SER B 1 11  ? 21.765  35.399 48.528 1.00 30.00  ? 70  SER B HG    1 
ATOM   2754  N  N     . LEU B 1 12  ? 23.109  35.349 52.488 1.00 57.63  ? 71  LEU B N     1 
ATOM   2755  C  CA    . LEU B 1 12  ? 24.511  35.342 52.820 1.00 57.63  ? 71  LEU B CA    1 
ATOM   2756  C  C     . LEU B 1 12  ? 25.344  35.230 51.538 1.00 57.63  ? 71  LEU B C     1 
ATOM   2757  O  O     . LEU B 1 12  ? 26.522  35.585 51.512 1.00 19.64  ? 71  LEU B O     1 
ATOM   2758  C  CB    . LEU B 1 12  ? 24.808  34.199 53.775 1.00 19.64  ? 71  LEU B CB    1 
ATOM   2759  C  CG    . LEU B 1 12  ? 24.325  34.586 55.155 1.00 19.64  ? 71  LEU B CG    1 
ATOM   2760  C  CD1   . LEU B 1 12  ? 24.651  33.503 56.113 1.00 19.64  ? 71  LEU B CD1   1 
ATOM   2761  C  CD2   . LEU B 1 12  ? 24.976  35.880 55.578 1.00 19.64  ? 71  LEU B CD2   1 
ATOM   2762  H  H     . LEU B 1 12  ? 22.545  34.579 52.698 1.00 0.00   ? 71  LEU B H     1 
ATOM   2763  N  N     . ALA B 1 13  ? 24.721  34.775 50.456 1.00 28.74  ? 72  ALA B N     1 
ATOM   2764  C  CA    . ALA B 1 13  ? 25.446  34.648 49.207 1.00 28.74  ? 72  ALA B CA    1 
ATOM   2765  C  C     . ALA B 1 13  ? 25.989  36.013 48.791 1.00 28.74  ? 72  ALA B C     1 
ATOM   2766  O  O     . ALA B 1 13  ? 27.100  36.103 48.253 1.00 45.45  ? 72  ALA B O     1 
ATOM   2767  C  CB    . ALA B 1 13  ? 24.568  34.064 48.145 1.00 45.45  ? 72  ALA B CB    1 
ATOM   2768  H  H     . ALA B 1 13  ? 23.772  34.545 50.485 1.00 0.00   ? 72  ALA B H     1 
ATOM   2769  N  N     . LEU B 1 14  ? 25.228  37.074 49.081 1.00 29.54  ? 73  LEU B N     1 
ATOM   2770  C  CA    . LEU B 1 14  ? 25.662  38.437 48.776 1.00 29.54  ? 73  LEU B CA    1 
ATOM   2771  C  C     . LEU B 1 14  ? 26.796  38.793 49.728 1.00 29.54  ? 73  LEU B C     1 
ATOM   2772  O  O     . LEU B 1 14  ? 26.886  38.252 50.825 1.00 30.18  ? 73  LEU B O     1 
ATOM   2773  C  CB    . LEU B 1 14  ? 24.507  39.411 48.906 1.00 30.18  ? 73  LEU B CB    1 
ATOM   2774  C  CG    . LEU B 1 14  ? 23.515  39.132 47.787 1.00 30.18  ? 73  LEU B CG    1 
ATOM   2775  C  CD1   . LEU B 1 14  ? 22.374  40.110 47.835 1.00 30.18  ? 73  LEU B CD1   1 
ATOM   2776  C  CD2   . LEU B 1 14  ? 24.245  39.229 46.471 1.00 30.18  ? 73  LEU B CD2   1 
ATOM   2777  H  H     . LEU B 1 14  ? 24.394  36.956 49.581 1.00 0.00   ? 73  LEU B H     1 
ATOM   2778  N  N     . HIS B 1 15  ? 27.663  39.699 49.309 1.00 11.21  ? 74  HIS B N     1 
ATOM   2779  C  CA    . HIS B 1 15  ? 28.825  40.067 50.110 1.00 11.21  ? 74  HIS B CA    1 
ATOM   2780  C  C     . HIS B 1 15  ? 28.607  40.954 51.324 1.00 11.21  ? 74  HIS B C     1 
ATOM   2781  O  O     . HIS B 1 15  ? 29.188  40.711 52.379 1.00 47.91  ? 74  HIS B O     1 
ATOM   2782  C  CB    . HIS B 1 15  ? 29.890  40.695 49.220 1.00 47.91  ? 74  HIS B CB    1 
ATOM   2783  C  CG    . HIS B 1 15  ? 30.230  39.883 48.009 1.00 47.91  ? 74  HIS B CG    1 
ATOM   2784  N  ND1   . HIS B 1 15  ? 30.019  38.521 47.935 1.00 47.91  ? 74  HIS B ND1   1 
ATOM   2785  C  CD2   . HIS B 1 15  ? 30.775  40.243 46.821 1.00 47.91  ? 74  HIS B CD2   1 
ATOM   2786  C  CE1   . HIS B 1 15  ? 30.419  38.078 46.756 1.00 47.91  ? 74  HIS B CE1   1 
ATOM   2787  N  NE2   . HIS B 1 15  ? 30.881  39.104 46.061 1.00 47.91  ? 74  HIS B NE2   1 
ATOM   2788  H  H     . HIS B 1 15  ? 27.459  40.114 48.445 1.00 0.00   ? 74  HIS B H     1 
ATOM   2789  H  HD1   . HIS B 1 15  ? 29.573  37.962 48.623 1.00 0.00   ? 74  HIS B HD1   1 
ATOM   2790  H  HE2   . HIS B 1 15  ? 31.220  39.078 45.145 1.00 0.00   ? 74  HIS B HE2   1 
ATOM   2791  N  N     . ALA B 1 16  ? 27.808  42.008 51.183 1.00 10.60  ? 75  ALA B N     1 
ATOM   2792  C  CA    . ALA B 1 16  ? 27.586  42.913 52.300 1.00 10.60  ? 75  ALA B CA    1 
ATOM   2793  C  C     . ALA B 1 16  ? 27.030  42.146 53.484 1.00 10.60  ? 75  ALA B C     1 
ATOM   2794  O  O     . ALA B 1 16  ? 27.669  42.104 54.518 1.00 19.47  ? 75  ALA B O     1 
ATOM   2795  C  CB    . ALA B 1 16  ? 26.715  44.023 51.896 1.00 19.47  ? 75  ALA B CB    1 
ATOM   2796  H  H     . ALA B 1 16  ? 27.348  42.191 50.339 1.00 0.00   ? 75  ALA B H     1 
ATOM   2797  N  N     . PRO B 1 17  ? 25.875  41.467 53.330 1.00 18.67  ? 76  PRO B N     1 
ATOM   2798  C  CA    . PRO B 1 17  ? 25.274  40.683 54.419 1.00 18.67  ? 76  PRO B CA    1 
ATOM   2799  C  C     . PRO B 1 17  ? 26.284  39.754 55.139 1.00 18.67  ? 76  PRO B C     1 
ATOM   2800  O  O     . PRO B 1 17  ? 26.273  39.621 56.356 1.00 18.98  ? 76  PRO B O     1 
ATOM   2801  C  CB    . PRO B 1 17  ? 24.208  39.879 53.680 1.00 18.98  ? 76  PRO B CB    1 
ATOM   2802  C  CG    . PRO B 1 17  ? 23.713  40.863 52.671 1.00 18.98  ? 76  PRO B CG    1 
ATOM   2803  C  CD    . PRO B 1 17  ? 25.000  41.435 52.139 1.00 18.98  ? 76  PRO B CD    1 
ATOM   2804  N  N     . SER B 1 18  ? 27.165  39.126 54.369 1.00 10.17  ? 77  SER B N     1 
ATOM   2805  C  CA    . SER B 1 18  ? 28.195  38.238 54.902 1.00 10.17  ? 77  SER B CA    1 
ATOM   2806  C  C     . SER B 1 18  ? 29.213  39.014 55.720 1.00 10.17  ? 77  SER B C     1 
ATOM   2807  O  O     . SER B 1 18  ? 29.668  38.567 56.771 1.00 20.90  ? 77  SER B O     1 
ATOM   2808  C  CB    . SER B 1 18  ? 28.896  37.560 53.741 1.00 20.90  ? 77  SER B CB    1 
ATOM   2809  O  OG    . SER B 1 18  ? 28.086  36.541 53.192 1.00 20.90  ? 77  SER B OG    1 
ATOM   2810  H  H     . SER B 1 18  ? 27.131  39.222 53.398 1.00 0.00   ? 77  SER B H     1 
ATOM   2811  H  HG    . SER B 1 18  ? 27.520  36.873 52.477 1.00 30.00  ? 77  SER B HG    1 
ATOM   2812  N  N     . GLN B 1 19  ? 29.594  40.175 55.212 1.00 29.83  ? 78  GLN B N     1 
ATOM   2813  C  CA    . GLN B 1 19  ? 30.535  41.022 55.916 1.00 29.83  ? 78  GLN B CA    1 
ATOM   2814  C  C     . GLN B 1 19  ? 29.893  41.576 57.184 1.00 29.83  ? 78  GLN B C     1 
ATOM   2815  O  O     . GLN B 1 19  ? 30.525  41.581 58.229 1.00 22.50  ? 78  GLN B O     1 
ATOM   2816  C  CB    . GLN B 1 19  ? 31.048  42.142 55.008 1.00 22.50  ? 78  GLN B CB    1 
ATOM   2817  C  CG    . GLN B 1 19  ? 31.995  41.621 53.943 1.00 22.50  ? 78  GLN B CG    1 
ATOM   2818  C  CD    . GLN B 1 19  ? 32.621  42.717 53.136 1.00 22.50  ? 78  GLN B CD    1 
ATOM   2819  O  OE1   . GLN B 1 19  ? 33.148  43.673 53.677 1.00 22.50  ? 78  GLN B OE1   1 
ATOM   2820  N  NE2   . GLN B 1 19  ? 32.590  42.576 51.834 1.00 22.50  ? 78  GLN B NE2   1 
ATOM   2821  H  H     . GLN B 1 19  ? 29.233  40.463 54.350 1.00 0.00   ? 78  GLN B H     1 
ATOM   2822  N  N     . ILE B 1 20  ? 28.623  41.964 57.118 1.00 10.49  ? 79  ILE B N     1 
ATOM   2823  C  CA    . ILE B 1 20  ? 27.932  42.496 58.281 1.00 10.49  ? 79  ILE B CA    1 
ATOM   2824  C  C     . ILE B 1 20  ? 27.782  41.435 59.360 1.00 10.49  ? 79  ILE B C     1 
ATOM   2825  O  O     . ILE B 1 20  ? 27.966  41.717 60.540 1.00 20.83  ? 79  ILE B O     1 
ATOM   2826  C  CB    . ILE B 1 20  ? 26.573  43.058 57.901 1.00 20.83  ? 79  ILE B CB    1 
ATOM   2827  C  CG1   . ILE B 1 20  ? 26.772  44.228 56.937 1.00 20.83  ? 79  ILE B CG1   1 
ATOM   2828  C  CG2   . ILE B 1 20  ? 25.837  43.525 59.134 1.00 20.83  ? 79  ILE B CG2   1 
ATOM   2829  C  CD1   . ILE B 1 20  ? 25.514  44.799 56.386 1.00 20.83  ? 79  ILE B CD1   1 
ATOM   2830  H  H     . ILE B 1 20  ? 28.132  41.878 56.282 1.00 0.00   ? 79  ILE B H     1 
ATOM   2831  N  N     . VAL B 1 21  ? 27.511  40.200 58.955 1.00 23.75  ? 80  VAL B N     1 
ATOM   2832  C  CA    . VAL B 1 21  ? 27.364  39.078 59.888 1.00 23.75  ? 80  VAL B CA    1 
ATOM   2833  C  C     . VAL B 1 21  ? 28.715  38.660 60.499 1.00 23.75  ? 80  VAL B C     1 
ATOM   2834  O  O     . VAL B 1 21  ? 28.786  38.246 61.658 1.00 23.88  ? 80  VAL B O     1 
ATOM   2835  C  CB    . VAL B 1 21  ? 26.672  37.862 59.195 1.00 23.88  ? 80  VAL B CB    1 
ATOM   2836  C  CG1   . VAL B 1 21  ? 26.657  36.686 60.085 1.00 23.88  ? 80  VAL B CG1   1 
ATOM   2837  C  CG2   . VAL B 1 21  ? 25.250  38.196 58.854 1.00 23.88  ? 80  VAL B CG2   1 
ATOM   2838  H  H     . VAL B 1 21  ? 27.348  40.046 58.000 1.00 0.00   ? 80  VAL B H     1 
ATOM   2839  N  N     . ALA B 1 22  ? 29.791  38.764 59.734 1.00 26.57  ? 81  ALA B N     1 
ATOM   2840  C  CA    . ALA B 1 22  ? 31.110  38.394 60.250 1.00 26.57  ? 81  ALA B CA    1 
ATOM   2841  C  C     . ALA B 1 22  ? 31.629  39.480 61.196 1.00 26.57  ? 81  ALA B C     1 
ATOM   2842  O  O     . ALA B 1 22  ? 32.340  39.200 62.176 1.00 33.02  ? 81  ALA B O     1 
ATOM   2843  C  CB    . ALA B 1 22  ? 32.084  38.180 59.100 1.00 33.02  ? 81  ALA B CB    1 
ATOM   2844  H  H     . ALA B 1 22  ? 29.707  39.065 58.801 1.00 0.00   ? 81  ALA B H     1 
ATOM   2845  N  N     . ALA B 1 23  ? 31.273  40.721 60.875 1.00 21.66  ? 82  ALA B N     1 
ATOM   2846  C  CA    . ALA B 1 23  ? 31.655  41.882 61.663 1.00 21.66  ? 82  ALA B CA    1 
ATOM   2847  C  C     . ALA B 1 23  ? 30.971  41.700 62.981 1.00 21.66  ? 82  ALA B C     1 
ATOM   2848  O  O     . ALA B 1 23  ? 31.620  41.753 64.020 1.00 53.17  ? 82  ALA B O     1 
ATOM   2849  C  CB    . ALA B 1 23  ? 31.173  43.159 61.000 1.00 53.17  ? 82  ALA B CB    1 
ATOM   2850  H  H     . ALA B 1 23  ? 30.748  40.861 60.060 1.00 0.00   ? 82  ALA B H     1 
ATOM   2851  N  N     . ILE B 1 24  ? 29.658  41.456 62.927 1.00 23.24  ? 83  ILE B N     1 
ATOM   2852  C  CA    . ILE B 1 24  ? 28.841  41.231 64.132 1.00 23.24  ? 83  ILE B CA    1 
ATOM   2853  C  C     . ILE B 1 24  ? 29.528  40.189 65.002 1.00 23.24  ? 83  ILE B C     1 
ATOM   2854  O  O     . ILE B 1 24  ? 29.739  40.393 66.193 1.00 29.79  ? 83  ILE B O     1 
ATOM   2855  C  CB    . ILE B 1 24  ? 27.414  40.716 63.793 1.00 29.79  ? 83  ILE B CB    1 
ATOM   2856  C  CG1   . ILE B 1 24  ? 26.607  41.797 63.093 1.00 29.79  ? 83  ILE B CG1   1 
ATOM   2857  C  CG2   . ILE B 1 24  ? 26.680  40.359 65.054 1.00 29.79  ? 83  ILE B CG2   1 
ATOM   2858  C  CD1   . ILE B 1 24  ? 25.284  41.330 62.628 1.00 29.79  ? 83  ILE B CD1   1 
ATOM   2859  H  H     . ILE B 1 24  ? 29.216  41.443 62.052 1.00 0.00   ? 83  ILE B H     1 
ATOM   2860  N  N     . LYS B 1 25  ? 29.918  39.086 64.389 1.00 26.35  ? 84  LYS B N     1 
ATOM   2861  C  CA    . LYS B 1 25  ? 30.598  38.040 65.125 1.00 26.35  ? 84  LYS B CA    1 
ATOM   2862  C  C     . LYS B 1 25  ? 31.918  38.520 65.777 1.00 26.35  ? 84  LYS B C     1 
ATOM   2863  O  O     . LYS B 1 25  ? 32.292  38.037 66.845 1.00 32.52  ? 84  LYS B O     1 
ATOM   2864  C  CB    . LYS B 1 25  ? 30.824  36.834 64.216 1.00 32.52  ? 84  LYS B CB    1 
ATOM   2865  C  CG    . LYS B 1 25  ? 31.033  35.536 64.971 1.00 32.52  ? 84  LYS B CG    1 
ATOM   2866  C  CD    . LYS B 1 25  ? 32.481  35.259 65.176 1.00 32.52  ? 84  LYS B CD    1 
ATOM   2867  C  CE    . LYS B 1 25  ? 32.677  33.829 65.566 1.00 32.52  ? 84  LYS B CE    1 
ATOM   2868  N  NZ    . LYS B 1 25  ? 32.104  33.528 66.889 1.00 32.52  ? 84  LYS B NZ    1 
ATOM   2869  H  H     . LYS B 1 25  ? 29.718  38.955 63.436 1.00 0.00   ? 84  LYS B H     1 
ATOM   2870  H  HZ1   . LYS B 1 25  ? 31.083  33.731 66.878 1.00 0.00   ? 84  LYS B HZ1   1 
ATOM   2871  H  HZ2   . LYS B 1 25  ? 32.259  32.521 67.099 1.00 0.00   ? 84  LYS B HZ2   1 
ATOM   2872  H  HZ3   . LYS B 1 25  ? 32.569  34.106 67.614 1.00 0.00   ? 84  LYS B HZ3   1 
ATOM   2873  N  N     . SER B 1 26  ? 32.636  39.455 65.159 1.00 34.16  ? 85  SER B N     1 
ATOM   2874  C  CA    . SER B 1 26  ? 33.868  39.939 65.780 1.00 34.16  ? 85  SER B CA    1 
ATOM   2875  C  C     . SER B 1 26  ? 33.586  40.600 67.132 1.00 34.16  ? 85  SER B C     1 
ATOM   2876  O  O     . SER B 1 26  ? 34.197  40.247 68.145 1.00 52.23  ? 85  SER B O     1 
ATOM   2877  C  CB    . SER B 1 26  ? 34.607  40.907 64.862 1.00 52.23  ? 85  SER B CB    1 
ATOM   2878  O  OG    . SER B 1 26  ? 35.288  40.199 63.845 1.00 52.23  ? 85  SER B OG    1 
ATOM   2879  H  H     . SER B 1 26  ? 32.350  39.819 64.296 1.00 0.00   ? 85  SER B H     1 
ATOM   2880  H  HG    . SER B 1 26  ? 34.635  39.708 63.332 1.00 30.00  ? 85  SER B HG    1 
ATOM   2881  N  N     . ARG B 1 27  ? 32.637  41.534 67.151 1.00 50.44  ? 86  ARG B N     1 
ATOM   2882  C  CA    . ARG B 1 27  ? 32.281  42.230 68.387 1.00 50.44  ? 86  ARG B CA    1 
ATOM   2883  C  C     . ARG B 1 27  ? 31.815  41.238 69.443 1.00 50.44  ? 86  ARG B C     1 
ATOM   2884  O  O     . ARG B 1 27  ? 32.379  41.184 70.538 1.00 35.27  ? 86  ARG B O     1 
ATOM   2885  C  CB    . ARG B 1 27  ? 31.189  43.260 68.138 1.00 35.27  ? 86  ARG B CB    1 
ATOM   2886  C  CG    . ARG B 1 27  ? 31.609  44.680 68.438 1.00 35.27  ? 86  ARG B CG    1 
ATOM   2887  C  CD    . ARG B 1 27  ? 31.938  44.884 69.887 1.00 35.27  ? 86  ARG B CD    1 
ATOM   2888  N  NE    . ARG B 1 27  ? 32.420  46.235 70.131 1.00 35.27  ? 86  ARG B NE    1 
ATOM   2889  C  CZ    . ARG B 1 27  ? 33.697  46.588 70.120 1.00 35.27  ? 86  ARG B CZ    1 
ATOM   2890  N  NH1   . ARG B 1 27  ? 34.638  45.692 69.882 1.00 35.27  ? 86  ARG B NH1   1 
ATOM   2891  N  NH2   . ARG B 1 27  ? 34.034  47.847 70.337 1.00 35.27  ? 86  ARG B NH2   1 
ATOM   2892  H  H     . ARG B 1 27  ? 32.157  41.730 66.317 1.00 0.00   ? 86  ARG B H     1 
ATOM   2893  H  HE    . ARG B 1 27  ? 31.769  46.923 70.314 1.00 0.00   ? 86  ARG B HE    1 
ATOM   2894  H  HH11  . ARG B 1 27  ? 34.391  44.738 69.708 1.00 0.00   ? 86  ARG B HH11  1 
ATOM   2895  H  HH12  . ARG B 1 27  ? 35.599  45.966 69.879 1.00 0.00   ? 86  ARG B HH12  1 
ATOM   2896  H  HH21  . ARG B 1 27  ? 33.330  48.537 70.509 1.00 0.00   ? 86  ARG B HH21  1 
ATOM   2897  H  HH22  . ARG B 1 27  ? 34.998  48.108 70.332 1.00 0.00   ? 86  ARG B HH22  1 
ATOM   2898  N  N     . ALA B 1 28  ? 30.791  40.457 69.101 1.00 33.08  ? 87  ALA B N     1 
ATOM   2899  C  CA    . ALA B 1 28  ? 30.240  39.445 69.983 1.00 33.08  ? 87  ALA B CA    1 
ATOM   2900  C  C     . ALA B 1 28  ? 31.374  38.708 70.698 1.00 33.08  ? 87  ALA B C     1 
ATOM   2901  O  O     . ALA B 1 28  ? 31.382  38.610 71.924 1.00 41.43  ? 87  ALA B O     1 
ATOM   2902  C  CB    . ALA B 1 28  ? 29.412  38.481 69.188 1.00 41.43  ? 87  ALA B CB    1 
ATOM   2903  H  H     . ALA B 1 28  ? 30.393  40.561 68.207 1.00 0.00   ? 87  ALA B H     1 
ATOM   2904  N  N     . ASP B 1 29  ? 32.377  38.275 69.946 1.00 44.05  ? 88  ASP B N     1 
ATOM   2905  C  CA    . ASP B 1 29  ? 33.514  37.571 70.535 1.00 44.05  ? 88  ASP B CA    1 
ATOM   2906  C  C     . ASP B 1 29  ? 34.366  38.406 71.499 1.00 44.05  ? 88  ASP B C     1 
ATOM   2907  O  O     . ASP B 1 29  ? 35.099  37.846 72.314 1.00 52.48  ? 88  ASP B O     1 
ATOM   2908  C  CB    . ASP B 1 29  ? 34.406  36.995 69.436 1.00 52.48  ? 88  ASP B CB    1 
ATOM   2909  C  CG    . ASP B 1 29  ? 33.707  35.948 68.601 1.00 52.48  ? 88  ASP B CG    1 
ATOM   2910  O  OD1   . ASP B 1 29  ? 32.465  35.818 68.698 1.00 52.48  ? 88  ASP B OD1   1 
ATOM   2911  O  OD2   . ASP B 1 29  ? 34.411  35.255 67.843 1.00 52.48  ? 88  ASP B OD2   1 
ATOM   2912  H  H     . ASP B 1 29  ? 32.363  38.419 68.975 1.00 0.00   ? 88  ASP B H     1 
ATOM   2913  N  N     . GLN B 1 30  ? 34.326  39.732 71.367 1.00 35.76  ? 89  GLN B N     1 
ATOM   2914  C  CA    . GLN B 1 30  ? 35.098  40.612 72.250 1.00 35.76  ? 89  GLN B CA    1 
ATOM   2915  C  C     . GLN B 1 30  ? 34.307  41.031 73.471 1.00 35.76  ? 89  GLN B C     1 
ATOM   2916  O  O     . GLN B 1 30  ? 34.874  41.334 74.525 1.00 74.67  ? 89  GLN B O     1 
ATOM   2917  C  CB    . GLN B 1 30  ? 35.557  41.853 71.512 1.00 74.67  ? 89  GLN B CB    1 
ATOM   2918  C  CG    . GLN B 1 30  ? 36.572  41.569 70.454 1.00 74.67  ? 89  GLN B CG    1 
ATOM   2919  C  CD    . GLN B 1 30  ? 37.085  42.836 69.817 1.00 74.67  ? 89  GLN B CD    1 
ATOM   2920  O  OE1   . GLN B 1 30  ? 36.453  43.894 69.907 1.00 74.67  ? 89  GLN B OE1   1 
ATOM   2921  N  NE2   . GLN B 1 30  ? 38.238  42.743 69.164 1.00 74.67  ? 89  GLN B NE2   1 
ATOM   2922  H  H     . GLN B 1 30  ? 33.829  40.096 70.614 1.00 0.00   ? 89  GLN B H     1 
ATOM   2923  N  N     . LEU B 1 31  ? 32.993  41.094 73.312 1.00 30.92  ? 90  LEU B N     1 
ATOM   2924  C  CA    . LEU B 1 31  ? 32.118  41.465 74.408 1.00 30.92  ? 90  LEU B CA    1 
ATOM   2925  C  C     . LEU B 1 31  ? 31.468  40.205 74.969 1.00 30.92  ? 90  LEU B C     1 
ATOM   2926  O  O     . LEU B 1 31  ? 30.333  40.239 75.453 1.00 48.09  ? 90  LEU B O     1 
ATOM   2927  C  CB    . LEU B 1 31  ? 31.051  42.448 73.928 1.00 48.09  ? 90  LEU B CB    1 
ATOM   2928  C  CG    . LEU B 1 31  ? 31.541  43.701 73.206 1.00 48.09  ? 90  LEU B CG    1 
ATOM   2929  C  CD1   . LEU B 1 31  ? 30.498  44.748 73.378 1.00 48.09  ? 90  LEU B CD1   1 
ATOM   2930  C  CD2   . LEU B 1 31  ? 32.840  44.211 73.778 1.00 48.09  ? 90  LEU B CD2   1 
ATOM   2931  H  H     . LEU B 1 31  ? 32.611  40.887 72.434 1.00 0.00   ? 90  LEU B H     1 
ATOM   2932  N  N     . GLY B 1 32  ? 32.182  39.089 74.866 1.00 32.49  ? 91  GLY B N     1 
ATOM   2933  C  CA    . GLY B 1 32  ? 31.689  37.810 75.352 1.00 32.49  ? 91  GLY B CA    1 
ATOM   2934  C  C     . GLY B 1 32  ? 30.277  37.396 74.947 1.00 32.49  ? 91  GLY B C     1 
ATOM   2935  O  O     . GLY B 1 32  ? 29.686  36.538 75.602 1.00 59.49  ? 91  GLY B O     1 
ATOM   2936  H  H     . GLY B 1 32  ? 33.070  39.121 74.463 1.00 0.00   ? 91  GLY B H     1 
ATOM   2937  N  N     . ALA B 1 33  ? 29.713  38.012 73.912 1.00 41.16  ? 92  ALA B N     1 
ATOM   2938  C  CA    . ALA B 1 33  ? 28.366  37.658 73.447 1.00 41.16  ? 92  ALA B CA    1 
ATOM   2939  C  C     . ALA B 1 33  ? 28.390  36.328 72.660 1.00 41.16  ? 92  ALA B C     1 
ATOM   2940  O  O     . ALA B 1 33  ? 29.391  35.601 72.673 1.00 59.84  ? 92  ALA B O     1 
ATOM   2941  C  CB    . ALA B 1 33  ? 27.805  38.781 72.579 1.00 59.84  ? 92  ALA B CB    1 
ATOM   2942  H  H     . ALA B 1 33  ? 30.222  38.695 73.438 1.00 0.00   ? 92  ALA B H     1 
ATOM   2943  N  N     . SER B 1 34  ? 27.264  35.976 72.052 1.00 24.30  ? 93  SER B N     1 
ATOM   2944  C  CA    . SER B 1 34  ? 27.144  34.770 71.237 1.00 24.30  ? 93  SER B CA    1 
ATOM   2945  C  C     . SER B 1 34  ? 26.189  35.158 70.124 1.00 24.30  ? 93  SER B C     1 
ATOM   2946  O  O     . SER B 1 34  ? 25.360  36.041 70.299 1.00 46.12  ? 93  SER B O     1 
ATOM   2947  C  CB    . SER B 1 34  ? 26.577  33.599 72.045 1.00 46.12  ? 93  SER B CB    1 
ATOM   2948  O  OG    . SER B 1 34  ? 27.491  33.164 73.037 1.00 46.12  ? 93  SER B OG    1 
ATOM   2949  H  H     . SER B 1 34  ? 26.448  36.521 72.143 1.00 0.00   ? 93  SER B H     1 
ATOM   2950  H  HG    . SER B 1 34  ? 28.363  33.189 72.622 1.00 30.00  ? 93  SER B HG    1 
ATOM   2951  N  N     . VAL B 1 35  ? 26.362  34.572 68.950 1.00 36.68  ? 94  VAL B N     1 
ATOM   2952  C  CA    . VAL B 1 35  ? 25.505  34.904 67.815 1.00 36.68  ? 94  VAL B CA    1 
ATOM   2953  C  C     . VAL B 1 35  ? 24.952  33.652 67.175 1.00 36.68  ? 94  VAL B C     1 
ATOM   2954  O  O     . VAL B 1 35  ? 25.615  32.607 67.139 1.00 12.50  ? 94  VAL B O     1 
ATOM   2955  C  CB    . VAL B 1 35  ? 26.246  35.763 66.753 1.00 12.50  ? 94  VAL B CB    1 
ATOM   2956  C  CG1   . VAL B 1 35  ? 25.273  36.270 65.682 1.00 12.50  ? 94  VAL B CG1   1 
ATOM   2957  C  CG2   . VAL B 1 35  ? 26.936  36.954 67.430 1.00 12.50  ? 94  VAL B CG2   1 
ATOM   2958  H  H     . VAL B 1 35  ? 27.059  33.899 68.823 1.00 0.00   ? 94  VAL B H     1 
ATOM   2959  N  N     . VAL B 1 36  ? 23.700  33.774 66.751 1.00 19.76  ? 95  VAL B N     1 
ATOM   2960  C  CA    . VAL B 1 36  ? 22.931  32.722 66.114 1.00 19.76  ? 95  VAL B CA    1 
ATOM   2961  C  C     . VAL B 1 36  ? 22.340  33.438 64.929 1.00 19.76  ? 95  VAL B C     1 
ATOM   2962  O  O     . VAL B 1 36  ? 21.715  34.495 65.075 1.00 42.80  ? 95  VAL B O     1 
ATOM   2963  C  CB    . VAL B 1 36  ? 21.805  32.222 67.045 1.00 42.80  ? 95  VAL B CB    1 
ATOM   2964  C  CG1   . VAL B 1 36  ? 20.540  31.918 66.262 1.00 42.80  ? 95  VAL B CG1   1 
ATOM   2965  C  CG2   . VAL B 1 36  ? 22.256  30.982 67.774 1.00 42.80  ? 95  VAL B CG2   1 
ATOM   2966  H  H     . VAL B 1 36  ? 23.238  34.635 66.849 1.00 0.00   ? 95  VAL B H     1 
ATOM   2967  N  N     . VAL B 1 37  ? 22.636  32.925 63.749 1.00 41.98  ? 96  VAL B N     1 
ATOM   2968  C  CA    . VAL B 1 37  ? 22.140  33.518 62.535 1.00 41.98  ? 96  VAL B CA    1 
ATOM   2969  C  C     . VAL B 1 37  ? 21.017  32.636 62.064 1.00 41.98  ? 96  VAL B C     1 
ATOM   2970  O  O     . VAL B 1 37  ? 21.061  31.416 62.246 1.00 12.74  ? 96  VAL B O     1 
ATOM   2971  C  CB    . VAL B 1 37  ? 23.235  33.597 61.468 1.00 12.74  ? 96  VAL B CB    1 
ATOM   2972  C  CG1   . VAL B 1 37  ? 22.741  34.385 60.276 1.00 12.74  ? 96  VAL B CG1   1 
ATOM   2973  C  CG2   . VAL B 1 37  ? 24.479  34.233 62.057 1.00 12.74  ? 96  VAL B CG2   1 
ATOM   2974  H  H     . VAL B 1 37  ? 23.178  32.109 63.704 1.00 0.00   ? 96  VAL B H     1 
ATOM   2975  N  N     . SER B 1 38  ? 20.019  33.281 61.471 1.00 11.55  ? 97  SER B N     1 
ATOM   2976  C  CA    . SER B 1 38  ? 18.804  32.678 60.935 1.00 11.55  ? 97  SER B CA    1 
ATOM   2977  C  C     . SER B 1 38  ? 18.624  33.404 59.623 1.00 11.55  ? 97  SER B C     1 
ATOM   2978  O  O     . SER B 1 38  ? 18.557  34.625 59.585 1.00 28.48  ? 97  SER B O     1 
ATOM   2979  C  CB    . SER B 1 38  ? 17.622  32.981 61.865 1.00 28.48  ? 97  SER B CB    1 
ATOM   2980  O  OG    . SER B 1 38  ? 16.420  32.381 61.434 1.00 28.48  ? 97  SER B OG    1 
ATOM   2981  H  H     . SER B 1 38  ? 20.079  34.254 61.385 1.00 0.00   ? 97  SER B H     1 
ATOM   2982  H  HG    . SER B 1 38  ? 16.457  31.428 61.570 1.00 30.00  ? 97  SER B HG    1 
ATOM   2983  N  N     . MET B 1 39  ? 18.581  32.654 58.541 1.00 15.82  ? 98  MET B N     1 
ATOM   2984  C  CA    . MET B 1 39  ? 18.443  33.239 57.215 1.00 15.82  ? 98  MET B CA    1 
ATOM   2985  C  C     . MET B 1 39  ? 16.986  33.458 56.757 1.00 15.82  ? 98  MET B C     1 
ATOM   2986  O  O     . MET B 1 39  ? 16.123  32.633 57.041 1.00 55.45  ? 98  MET B O     1 
ATOM   2987  C  CB    . MET B 1 39  ? 19.165  32.317 56.230 1.00 55.45  ? 98  MET B CB    1 
ATOM   2988  C  CG    . MET B 1 39  ? 20.408  31.668 56.843 1.00 55.45  ? 98  MET B CG    1 
ATOM   2989  S  SD    . MET B 1 39  ? 21.262  30.580 55.733 1.00 55.45  ? 98  MET B SD    1 
ATOM   2990  C  CE    . MET B 1 39  ? 21.550  31.761 54.329 1.00 55.45  ? 98  MET B CE    1 
ATOM   2991  H  H     . MET B 1 39  ? 18.596  31.683 58.649 1.00 0.00   ? 98  MET B H     1 
ATOM   2992  N  N     . VAL B 1 40  ? 16.714  34.545 56.045 1.00 23.92  ? 99  VAL B N     1 
ATOM   2993  C  CA    . VAL B 1 40  ? 15.357  34.788 55.558 1.00 23.92  ? 99  VAL B CA    1 
ATOM   2994  C  C     . VAL B 1 40  ? 15.268  34.258 54.113 1.00 23.92  ? 99  VAL B C     1 
ATOM   2995  O  O     . VAL B 1 40  ? 16.243  34.344 53.352 1.00 30.10  ? 99  VAL B O     1 
ATOM   2996  C  CB    . VAL B 1 40  ? 15.002  36.277 55.556 1.00 30.10  ? 99  VAL B CB    1 
ATOM   2997  C  CG1   . VAL B 1 40  ? 13.552  36.461 55.191 1.00 30.10  ? 99  VAL B CG1   1 
ATOM   2998  C  CG2   . VAL B 1 40  ? 15.334  36.914 56.878 1.00 30.10  ? 99  VAL B CG2   1 
ATOM   2999  H  H     . VAL B 1 40  ? 17.429  35.180 55.817 1.00 0.00   ? 99  VAL B H     1 
ATOM   3000  N  N     . GLU B 1 41  ? 14.089  33.780 53.710 1.00 50.87  ? 100 GLU B N     1 
ATOM   3001  C  CA    . GLU B 1 41  ? 13.888  33.208 52.372 1.00 50.87  ? 100 GLU B CA    1 
ATOM   3002  C  C     . GLU B 1 41  ? 13.525  34.224 51.278 1.00 50.87  ? 100 GLU B C     1 
ATOM   3003  O  O     . GLU B 1 41  ? 13.043  33.842 50.208 1.00 104.32 ? 100 GLU B O     1 
ATOM   3004  C  CB    . GLU B 1 41  ? 12.817  32.110 52.432 1.00 104.32 ? 100 GLU B CB    1 
ATOM   3005  C  CG    . GLU B 1 41  ? 13.025  31.062 53.530 1.00 104.32 ? 100 GLU B CG    1 
ATOM   3006  C  CD    . GLU B 1 41  ? 12.532  31.508 54.912 1.00 104.32 ? 100 GLU B CD    1 
ATOM   3007  O  OE1   . GLU B 1 41  ? 11.303  31.469 55.151 1.00 104.32 ? 100 GLU B OE1   1 
ATOM   3008  O  OE2   . GLU B 1 41  ? 13.368  31.877 55.771 1.00 104.32 ? 100 GLU B OE2   1 
ATOM   3009  H  H     . GLU B 1 41  ? 13.330  33.815 54.326 1.00 0.00   ? 100 GLU B H     1 
ATOM   3010  N  N     . ARG B 1 42  ? 13.807  35.501 51.536 1.00 86.20  ? 101 ARG B N     1 
ATOM   3011  C  CA    . ARG B 1 42  ? 13.511  36.611 50.615 1.00 86.20  ? 101 ARG B CA    1 
ATOM   3012  C  C     . ARG B 1 42  ? 12.077  36.678 50.097 1.00 86.20  ? 101 ARG B C     1 
ATOM   3013  O  O     . ARG B 1 42  ? 11.826  36.764 48.893 1.00 105.64 ? 101 ARG B O     1 
ATOM   3014  C  CB    . ARG B 1 42  ? 14.530  36.706 49.466 1.00 105.64 ? 101 ARG B CB    1 
ATOM   3015  C  CG    . ARG B 1 42  ? 15.778  37.488 49.863 1.00 105.64 ? 101 ARG B CG    1 
ATOM   3016  C  CD    . ARG B 1 42  ? 16.607  37.974 48.678 1.00 105.64 ? 101 ARG B CD    1 
ATOM   3017  N  NE    . ARG B 1 42  ? 17.673  38.873 49.134 1.00 105.64 ? 101 ARG B NE    1 
ATOM   3018  C  CZ    . ARG B 1 42  ? 17.565  40.202 49.219 1.00 105.64 ? 101 ARG B CZ    1 
ATOM   3019  N  NH1   . ARG B 1 42  ? 16.439  40.821 48.866 1.00 105.64 ? 101 ARG B NH1   1 
ATOM   3020  N  NH2   . ARG B 1 42  ? 18.566  40.918 49.716 1.00 105.64 ? 101 ARG B NH2   1 
ATOM   3021  H  H     . ARG B 1 42  ? 14.284  35.706 52.363 1.00 0.00   ? 101 ARG B H     1 
ATOM   3022  H  HE    . ARG B 1 42  ? 18.528  38.468 49.393 1.00 0.00   ? 101 ARG B HE    1 
ATOM   3023  H  HH11  . ARG B 1 42  ? 15.655  40.296 48.534 1.00 0.00   ? 101 ARG B HH11  1 
ATOM   3024  H  HH12  . ARG B 1 42  ? 16.380  41.816 48.935 1.00 0.00   ? 101 ARG B HH12  1 
ATOM   3025  H  HH21  . ARG B 1 42  ? 19.400  40.454 50.019 1.00 0.00   ? 101 ARG B HH21  1 
ATOM   3026  H  HH22  . ARG B 1 42  ? 18.496  41.913 49.775 1.00 0.00   ? 101 ARG B HH22  1 
ATOM   3027  N  N     . SER B 1 43  ? 11.145  36.732 51.037 1.00 77.26  ? 102 SER B N     1 
ATOM   3028  C  CA    . SER B 1 43  ? 9.728   36.794 50.713 1.00 77.26  ? 102 SER B CA    1 
ATOM   3029  C  C     . SER B 1 43  ? 9.041   37.859 51.581 1.00 77.26  ? 102 SER B C     1 
ATOM   3030  O  O     . SER B 1 43  ? 7.957   37.625 52.138 1.00 87.93  ? 102 SER B O     1 
ATOM   3031  C  CB    . SER B 1 43  ? 9.082   35.418 50.951 1.00 87.93  ? 102 SER B CB    1 
ATOM   3032  O  OG    . SER B 1 43  ? 10.014  34.360 50.759 1.00 87.93  ? 102 SER B OG    1 
ATOM   3033  H  H     . SER B 1 43  ? 11.424  36.707 51.970 1.00 0.00   ? 102 SER B H     1 
ATOM   3034  H  HG    . SER B 1 43  ? 10.425  34.402 49.885 1.00 30.00  ? 102 SER B HG    1 
ATOM   3035  N  N     . GLY B 1 44  ? 9.714   38.995 51.759 1.00 43.61  ? 103 GLY B N     1 
ATOM   3036  C  CA    . GLY B 1 44  ? 9.151   40.083 52.544 1.00 43.61  ? 103 GLY B CA    1 
ATOM   3037  C  C     . GLY B 1 44  ? 8.909   39.853 54.027 1.00 43.61  ? 103 GLY B C     1 
ATOM   3038  O  O     . GLY B 1 44  ? 9.593   39.041 54.665 1.00 70.72  ? 103 GLY B O     1 
ATOM   3039  H  H     . GLY B 1 44  ? 10.593  39.085 51.338 1.00 0.00   ? 103 GLY B H     1 
ATOM   3040  N  N     . VAL B 1 45  ? 7.894   40.548 54.553 1.00 52.98  ? 104 VAL B N     1 
ATOM   3041  C  CA    . VAL B 1 45  ? 7.507   40.500 55.975 1.00 52.98  ? 104 VAL B CA    1 
ATOM   3042  C  C     . VAL B 1 45  ? 7.358   39.151 56.600 1.00 52.98  ? 104 VAL B C     1 
ATOM   3043  O  O     . VAL B 1 45  ? 7.860   38.927 57.693 1.00 29.11  ? 104 VAL B O     1 
ATOM   3044  C  CB    . VAL B 1 45  ? 6.169   41.148 56.263 1.00 29.11  ? 104 VAL B CB    1 
ATOM   3045  C  CG1   . VAL B 1 45  ? 6.316   42.153 57.405 1.00 29.11  ? 104 VAL B CG1   1 
ATOM   3046  C  CG2   . VAL B 1 45  ? 5.577   41.717 55.027 1.00 29.11  ? 104 VAL B CG2   1 
ATOM   3047  H  H     . VAL B 1 45  ? 7.430   41.109 53.902 1.00 0.00   ? 104 VAL B H     1 
ATOM   3048  N  N     . GLU B 1 46  ? 6.545   38.311 55.971 1.00 34.19  ? 105 GLU B N     1 
ATOM   3049  C  CA    . GLU B 1 46  ? 6.299   36.974 56.481 1.00 34.19  ? 105 GLU B CA    1 
ATOM   3050  C  C     . GLU B 1 46  ? 7.581   36.167 56.588 1.00 34.19  ? 105 GLU B C     1 
ATOM   3051  O  O     . GLU B 1 46  ? 7.913   35.654 57.659 1.00 101.88 ? 105 GLU B O     1 
ATOM   3052  C  CB    . GLU B 1 46  ? 5.264   36.252 55.615 1.00 101.88 ? 105 GLU B CB    1 
ATOM   3053  C  CG    . GLU B 1 46  ? 3.843   36.840 55.702 1.00 101.88 ? 105 GLU B CG    1 
ATOM   3054  C  CD    . GLU B 1 46  ? 3.272   36.882 57.127 1.00 101.88 ? 105 GLU B CD    1 
ATOM   3055  O  OE1   . GLU B 1 46  ? 3.625   36.014 57.961 1.00 101.88 ? 105 GLU B OE1   1 
ATOM   3056  O  OE2   . GLU B 1 46  ? 2.458   37.791 57.410 1.00 101.88 ? 105 GLU B OE2   1 
ATOM   3057  H  H     . GLU B 1 46  ? 6.096   38.597 55.152 1.00 0.00   ? 105 GLU B H     1 
ATOM   3058  N  N     . ALA B 1 47  ? 8.330   36.122 55.493 1.00 31.17  ? 106 ALA B N     1 
ATOM   3059  C  CA    . ALA B 1 47  ? 9.583   35.383 55.462 1.00 31.17  ? 106 ALA B CA    1 
ATOM   3060  C  C     . ALA B 1 47  ? 10.444  35.892 56.570 1.00 31.17  ? 106 ALA B C     1 
ATOM   3061  O  O     . ALA B 1 47  ? 11.130  35.146 57.248 1.00 32.53  ? 106 ALA B O     1 
ATOM   3062  C  CB    . ALA B 1 47  ? 10.269  35.598 54.162 1.00 32.53  ? 106 ALA B CB    1 
ATOM   3063  H  H     . ALA B 1 47  ? 8.023   36.589 54.689 1.00 0.00   ? 106 ALA B H     1 
ATOM   3064  N  N     . CYS B 1 48  ? 10.391  37.195 56.734 1.00 30.45  ? 107 CYS B N     1 
ATOM   3065  C  CA    . CYS B 1 48  ? 11.146  37.889 57.746 1.00 30.45  ? 107 CYS B CA    1 
ATOM   3066  C  C     . CYS B 1 48  ? 10.660  37.520 59.160 1.00 30.45  ? 107 CYS B C     1 
ATOM   3067  O  O     . CYS B 1 48  ? 11.464  37.311 60.074 1.00 54.09  ? 107 CYS B O     1 
ATOM   3068  C  CB    . CYS B 1 48  ? 10.998  39.393 57.493 1.00 54.09  ? 107 CYS B CB    1 
ATOM   3069  S  SG    . CYS B 1 48  ? 12.254  40.448 58.238 1.00 54.09  ? 107 CYS B SG    1 
ATOM   3070  H  H     . CYS B 1 48  ? 9.824   37.725 56.141 1.00 0.00   ? 107 CYS B H     1 
ATOM   3071  N  N     . LYS B 1 49  ? 9.348   37.417 59.337 1.00 52.32  ? 108 LYS B N     1 
ATOM   3072  C  CA    . LYS B 1 49  ? 8.784   37.099 60.641 1.00 52.32  ? 108 LYS B CA    1 
ATOM   3073  C  C     . LYS B 1 49  ? 9.209   35.730 61.165 1.00 52.32  ? 108 LYS B C     1 
ATOM   3074  O  O     . LYS B 1 49  ? 9.732   35.629 62.273 1.00 53.68  ? 108 LYS B O     1 
ATOM   3075  C  CB    . LYS B 1 49  ? 7.260   37.257 60.615 1.00 53.68  ? 108 LYS B CB    1 
ATOM   3076  C  CG    . LYS B 1 49  ? 6.801   38.709 60.753 1.00 53.68  ? 108 LYS B CG    1 
ATOM   3077  C  CD    . LYS B 1 49  ? 5.333   38.870 60.454 1.00 53.68  ? 108 LYS B CD    1 
ATOM   3078  C  CE    . LYS B 1 49  ? 4.498   37.932 61.298 1.00 53.68  ? 108 LYS B CE    1 
ATOM   3079  N  NZ    . LYS B 1 49  ? 3.041   38.066 61.033 1.00 53.68  ? 108 LYS B NZ    1 
ATOM   3080  H  H     . LYS B 1 49  ? 8.743   37.539 58.584 1.00 0.00   ? 108 LYS B H     1 
ATOM   3081  H  HZ1   . LYS B 1 49  ? 2.847   37.853 60.034 1.00 0.00   ? 108 LYS B HZ1   1 
ATOM   3082  H  HZ2   . LYS B 1 49  ? 2.525   37.405 61.647 1.00 0.00   ? 108 LYS B HZ2   1 
ATOM   3083  H  HZ3   . LYS B 1 49  ? 2.749   39.042 61.249 1.00 0.00   ? 108 LYS B HZ3   1 
ATOM   3084  N  N     . ALA B 1 50  ? 9.010   34.688 60.361 1.00 18.16  ? 109 ALA B N     1 
ATOM   3085  C  CA    . ALA B 1 50  ? 9.396   33.314 60.722 1.00 18.16  ? 109 ALA B CA    1 
ATOM   3086  C  C     . ALA B 1 50  ? 10.809  33.223 61.274 1.00 18.16  ? 109 ALA B C     1 
ATOM   3087  O  O     . ALA B 1 50  ? 11.076  32.459 62.194 1.00 48.82  ? 109 ALA B O     1 
ATOM   3088  C  CB    . ALA B 1 50  ? 9.283   32.419 59.521 1.00 48.82  ? 109 ALA B CB    1 
ATOM   3089  H  H     . ALA B 1 50  ? 8.594   34.855 59.485 1.00 0.00   ? 109 ALA B H     1 
ATOM   3090  N  N     . ALA B 1 51  ? 11.710  34.006 60.693 1.00 30.47  ? 110 ALA B N     1 
ATOM   3091  C  CA    . ALA B 1 51  ? 13.102  34.040 61.114 1.00 30.47  ? 110 ALA B CA    1 
ATOM   3092  C  C     . ALA B 1 51  ? 13.091  34.522 62.540 1.00 30.47  ? 110 ALA B C     1 
ATOM   3093  O  O     . ALA B 1 51  ? 13.607  33.844 63.427 1.00 19.32  ? 110 ALA B O     1 
ATOM   3094  C  CB    . ALA B 1 51  ? 13.896  34.997 60.236 1.00 19.32  ? 110 ALA B CB    1 
ATOM   3095  H  H     . ALA B 1 51  ? 11.432  34.573 59.944 1.00 0.00   ? 110 ALA B H     1 
ATOM   3096  N  N     . VAL B 1 52  ? 12.429  35.658 62.765 1.00 36.44  ? 111 VAL B N     1 
ATOM   3097  C  CA    . VAL B 1 52  ? 12.342  36.237 64.099 1.00 36.44  ? 111 VAL B CA    1 
ATOM   3098  C  C     . VAL B 1 52  ? 11.775  35.141 64.990 1.00 36.44  ? 111 VAL B C     1 
ATOM   3099  O  O     . VAL B 1 52  ? 12.412  34.729 65.942 1.00 24.29  ? 111 VAL B O     1 
ATOM   3100  C  CB    . VAL B 1 52  ? 11.471  37.527 64.129 1.00 24.29  ? 111 VAL B CB    1 
ATOM   3101  C  CG1   . VAL B 1 52  ? 11.600  38.214 65.465 1.00 24.29  ? 111 VAL B CG1   1 
ATOM   3102  C  CG2   . VAL B 1 52  ? 11.932  38.495 63.074 1.00 24.29  ? 111 VAL B CG2   1 
ATOM   3103  H  H     . VAL B 1 52  ? 11.985  36.096 62.006 1.00 0.00   ? 111 VAL B H     1 
ATOM   3104  N  N     . HIS B 1 53  ? 10.647  34.571 64.593 1.00 14.79  ? 112 HIS B N     1 
ATOM   3105  C  CA    . HIS B 1 53  ? 10.034  33.489 65.342 1.00 14.79  ? 112 HIS B CA    1 
ATOM   3106  C  C     . HIS B 1 53  ? 11.043  32.386 65.659 1.00 14.79  ? 112 HIS B C     1 
ATOM   3107  O  O     . HIS B 1 53  ? 11.024  31.824 66.757 1.00 135.85 ? 112 HIS B O     1 
ATOM   3108  C  CB    . HIS B 1 53  ? 8.850   32.900 64.571 1.00 135.85 ? 112 HIS B CB    1 
ATOM   3109  C  CG    . HIS B 1 53  ? 8.452   31.536 65.043 1.00 135.85 ? 112 HIS B CG    1 
ATOM   3110  N  ND1   . HIS B 1 53  ? 8.910   30.379 64.446 1.00 135.85 ? 112 HIS B ND1   1 
ATOM   3111  C  CD2   . HIS B 1 53  ? 7.688   31.140 66.090 1.00 135.85 ? 112 HIS B CD2   1 
ATOM   3112  C  CE1   . HIS B 1 53  ? 8.449   29.331 65.106 1.00 135.85 ? 112 HIS B CE1   1 
ATOM   3113  N  NE2   . HIS B 1 53  ? 7.706   29.766 66.109 1.00 135.85 ? 112 HIS B NE2   1 
ATOM   3114  H  H     . HIS B 1 53  ? 10.220  34.902 63.797 1.00 0.00   ? 112 HIS B H     1 
ATOM   3115  H  HD1   . HIS B 1 53  ? 9.513   30.329 63.661 1.00 0.00   ? 112 HIS B HD1   1 
ATOM   3116  H  HE2   . HIS B 1 53  ? 7.252   29.215 66.789 1.00 0.00   ? 112 HIS B HE2   1 
ATOM   3117  N  N     . ASN B 1 54  ? 11.921  32.072 64.711 1.00 27.81  ? 113 ASN B N     1 
ATOM   3118  C  CA    . ASN B 1 54  ? 12.920  31.023 64.912 1.00 27.81  ? 113 ASN B CA    1 
ATOM   3119  C  C     . ASN B 1 54  ? 13.953  31.463 65.920 1.00 27.81  ? 113 ASN B C     1 
ATOM   3120  O  O     . ASN B 1 54  ? 14.452  30.667 66.705 1.00 80.10  ? 113 ASN B O     1 
ATOM   3121  C  CB    . ASN B 1 54  ? 13.612  30.676 63.596 1.00 80.10  ? 113 ASN B CB    1 
ATOM   3122  C  CG    . ASN B 1 54  ? 13.100  29.381 62.993 1.00 80.10  ? 113 ASN B CG    1 
ATOM   3123  O  OD1   . ASN B 1 54  ? 12.021  29.341 62.381 1.00 80.10  ? 113 ASN B OD1   1 
ATOM   3124  N  ND2   . ASN B 1 54  ? 13.863  28.303 63.176 1.00 80.10  ? 113 ASN B ND2   1 
ATOM   3125  H  H     . ASN B 1 54  ? 11.940  32.564 63.867 1.00 0.00   ? 113 ASN B H     1 
ATOM   3126  H  HD21  . ASN B 1 54  ? 13.548  27.461 62.788 1.00 0.00   ? 113 ASN B HD21  1 
ATOM   3127  H  HD22  . ASN B 1 54  ? 14.691  28.414 63.688 1.00 0.00   ? 113 ASN B HD22  1 
ATOM   3128  N  N     . LEU B 1 55  ? 14.254  32.750 65.901 1.00 21.79  ? 114 LEU B N     1 
ATOM   3129  C  CA    . LEU B 1 55  ? 15.227  33.318 66.800 1.00 21.79  ? 114 LEU B CA    1 
ATOM   3130  C  C     . LEU B 1 55  ? 14.727  33.408 68.230 1.00 21.79  ? 114 LEU B C     1 
ATOM   3131  O  O     . LEU B 1 55  ? 15.454  33.056 69.159 1.00 34.06  ? 114 LEU B O     1 
ATOM   3132  C  CB    . LEU B 1 55  ? 15.632  34.695 66.293 1.00 34.06  ? 114 LEU B CB    1 
ATOM   3133  C  CG    . LEU B 1 55  ? 16.397  34.618 64.974 1.00 34.06  ? 114 LEU B CG    1 
ATOM   3134  C  CD1   . LEU B 1 55  ? 16.453  35.978 64.322 1.00 34.06  ? 114 LEU B CD1   1 
ATOM   3135  C  CD2   . LEU B 1 55  ? 17.793  34.059 65.239 1.00 34.06  ? 114 LEU B CD2   1 
ATOM   3136  H  H     . LEU B 1 55  ? 13.803  33.328 65.253 1.00 0.00   ? 114 LEU B H     1 
ATOM   3137  N  N     . LEU B 1 56  ? 13.498  33.900 68.414 1.00 29.35  ? 115 LEU B N     1 
ATOM   3138  C  CA    . LEU B 1 56  ? 12.909  34.034 69.754 1.00 29.35  ? 115 LEU B CA    1 
ATOM   3139  C  C     . LEU B 1 56  ? 12.868  32.661 70.379 1.00 29.35  ? 115 LEU B C     1 
ATOM   3140  O  O     . LEU B 1 56  ? 13.376  32.454 71.487 1.00 29.13  ? 115 LEU B O     1 
ATOM   3141  C  CB    . LEU B 1 56  ? 11.523  34.641 69.687 1.00 29.13  ? 115 LEU B CB    1 
ATOM   3142  C  CG    . LEU B 1 56  ? 11.554  36.100 69.259 1.00 29.13  ? 115 LEU B CG    1 
ATOM   3143  C  CD1   . LEU B 1 56  ? 10.139  36.599 69.074 1.00 29.13  ? 115 LEU B CD1   1 
ATOM   3144  C  CD2   . LEU B 1 56  ? 12.300  36.931 70.280 1.00 29.13  ? 115 LEU B CD2   1 
ATOM   3145  H  H     . LEU B 1 56  ? 12.985  34.166 67.627 1.00 0.00   ? 115 LEU B H     1 
ATOM   3146  N  N     . ALA B 1 57  ? 12.412  31.698 69.587 1.00 21.66  ? 116 ALA B N     1 
ATOM   3147  C  CA    . ALA B 1 57  ? 12.350  30.320 70.018 1.00 21.66  ? 116 ALA B CA    1 
ATOM   3148  C  C     . ALA B 1 57  ? 13.771  29.806 70.253 1.00 21.66  ? 116 ALA B C     1 
ATOM   3149  O  O     . ALA B 1 57  ? 13.972  28.675 70.689 1.00 68.40  ? 116 ALA B O     1 
ATOM   3150  C  CB    . ALA B 1 57  ? 11.647  29.485 68.969 1.00 68.40  ? 116 ALA B CB    1 
ATOM   3151  H  H     . ALA B 1 57  ? 12.103  31.909 68.680 1.00 0.00   ? 116 ALA B H     1 
ATOM   3152  N  N     . GLN B 1 58  ? 14.761  30.648 69.971 1.00 55.56  ? 117 GLN B N     1 
ATOM   3153  C  CA    . GLN B 1 58  ? 16.164  30.278 70.145 1.00 55.56  ? 117 GLN B CA    1 
ATOM   3154  C  C     . GLN B 1 58  ? 16.751  30.849 71.442 1.00 55.56  ? 117 GLN B C     1 
ATOM   3155  O  O     . GLN B 1 58  ? 17.965  30.773 71.657 1.00 70.51  ? 117 GLN B O     1 
ATOM   3156  C  CB    . GLN B 1 58  ? 16.990  30.739 68.935 1.00 70.51  ? 117 GLN B CB    1 
ATOM   3157  C  CG    . GLN B 1 58  ? 18.030  29.749 68.444 1.00 70.51  ? 117 GLN B CG    1 
ATOM   3158  C  CD    . GLN B 1 58  ? 17.445  28.614 67.616 1.00 70.51  ? 117 GLN B CD    1 
ATOM   3159  O  OE1   . GLN B 1 58  ? 17.358  28.706 66.388 1.00 70.51  ? 117 GLN B OE1   1 
ATOM   3160  N  NE2   . GLN B 1 58  ? 17.068  27.525 68.281 1.00 70.51  ? 117 GLN B NE2   1 
ATOM   3161  H  H     . GLN B 1 58  ? 14.574  31.507 69.592 1.00 0.00   ? 117 GLN B H     1 
ATOM   3162  N  N     . ARG B 1 59  ? 15.892  31.389 72.307 1.00 37.88  ? 118 ARG B N     1 
ATOM   3163  C  CA    . ARG B 1 59  ? 16.336  31.950 73.580 1.00 37.88  ? 118 ARG B CA    1 
ATOM   3164  C  C     . ARG B 1 59  ? 17.199  33.162 73.272 1.00 37.88  ? 118 ARG B C     1 
ATOM   3165  O  O     . ARG B 1 59  ? 18.110  33.518 74.022 1.00 151.10 ? 118 ARG B O     1 
ATOM   3166  C  CB    . ARG B 1 59  ? 17.153  30.912 74.369 1.00 151.10 ? 118 ARG B CB    1 
ATOM   3167  C  CG    . ARG B 1 59  ? 17.518  31.314 75.797 1.00 151.10 ? 118 ARG B CG    1 
ATOM   3168  C  CD    . ARG B 1 59  ? 19.009  31.129 76.086 1.00 151.10 ? 118 ARG B CD    1 
ATOM   3169  N  NE    . ARG B 1 59  ? 19.811  32.290 75.697 1.00 151.10 ? 118 ARG B NE    1 
ATOM   3170  C  CZ    . ARG B 1 59  ? 20.732  32.859 76.472 1.00 151.10 ? 118 ARG B CZ    1 
ATOM   3171  N  NH1   . ARG B 1 59  ? 20.983  32.377 77.683 1.00 151.10 ? 118 ARG B NH1   1 
ATOM   3172  N  NH2   . ARG B 1 59  ? 21.381  33.936 76.054 1.00 151.10 ? 118 ARG B NH2   1 
ATOM   3173  H  H     . ARG B 1 59  ? 14.941  31.405 72.082 1.00 0.00   ? 118 ARG B H     1 
ATOM   3174  H  HE    . ARG B 1 59  ? 19.696  32.663 74.802 1.00 0.00   ? 118 ARG B HE    1 
ATOM   3175  H  HH11  . ARG B 1 59  ? 20.477  31.586 78.027 1.00 0.00   ? 118 ARG B HH11  1 
ATOM   3176  H  HH12  . ARG B 1 59  ? 21.679  32.810 78.255 1.00 0.00   ? 118 ARG B HH12  1 
ATOM   3177  H  HH21  . ARG B 1 59  ? 21.172  34.336 75.164 1.00 0.00   ? 118 ARG B HH21  1 
ATOM   3178  H  HH22  . ARG B 1 59  ? 22.075  34.357 76.638 1.00 0.00   ? 118 ARG B HH22  1 
ATOM   3179  N  N     . VAL B 1 60  ? 16.892  33.806 72.157 1.00 42.67  ? 119 VAL B N     1 
ATOM   3180  C  CA    . VAL B 1 60  ? 17.635  34.969 71.713 1.00 42.67  ? 119 VAL B CA    1 
ATOM   3181  C  C     . VAL B 1 60  ? 17.494  36.119 72.708 1.00 42.67  ? 119 VAL B C     1 
ATOM   3182  O  O     . VAL B 1 60  ? 16.386  36.499 73.048 1.00 38.76  ? 119 VAL B O     1 
ATOM   3183  C  CB    . VAL B 1 60  ? 17.155  35.336 70.291 1.00 38.76  ? 119 VAL B CB    1 
ATOM   3184  C  CG1   . VAL B 1 60  ? 16.957  36.808 70.117 1.00 38.76  ? 119 VAL B CG1   1 
ATOM   3185  C  CG2   . VAL B 1 60  ? 18.135  34.805 69.280 1.00 38.76  ? 119 VAL B CG2   1 
ATOM   3186  H  H     . VAL B 1 60  ? 16.129  33.504 71.627 1.00 0.00   ? 119 VAL B H     1 
ATOM   3187  N  N     . SER B 1 61  ? 18.611  36.614 73.233 1.00 30.19  ? 120 SER B N     1 
ATOM   3188  C  CA    . SER B 1 61  ? 18.594  37.733 74.184 1.00 30.19  ? 120 SER B CA    1 
ATOM   3189  C  C     . SER B 1 61  ? 18.560  39.102 73.485 1.00 30.19  ? 120 SER B C     1 
ATOM   3190  O  O     . SER B 1 61  ? 18.458  40.146 74.147 1.00 42.65  ? 120 SER B O     1 
ATOM   3191  C  CB    . SER B 1 61  ? 19.813  37.681 75.103 1.00 42.65  ? 120 SER B CB    1 
ATOM   3192  O  OG    . SER B 1 61  ? 19.958  36.393 75.696 1.00 42.65  ? 120 SER B OG    1 
ATOM   3193  H  H     . SER B 1 61  ? 19.469  36.201 73.013 1.00 0.00   ? 120 SER B H     1 
ATOM   3194  H  HG    . SER B 1 61  ? 19.083  36.065 75.941 1.00 30.00  ? 120 SER B HG    1 
ATOM   3195  N  N     . GLY B 1 62  ? 18.638  39.092 72.155 1.00 32.92  ? 121 GLY B N     1 
ATOM   3196  C  CA    . GLY B 1 62  ? 18.621  40.325 71.391 1.00 32.92  ? 121 GLY B CA    1 
ATOM   3197  C  C     . GLY B 1 62  ? 18.497  40.011 69.916 1.00 32.92  ? 121 GLY B C     1 
ATOM   3198  O  O     . GLY B 1 62  ? 18.904  38.923 69.478 1.00 30.65  ? 121 GLY B O     1 
ATOM   3199  H  H     . GLY B 1 62  ? 18.707  38.246 71.664 1.00 0.00   ? 121 GLY B H     1 
ATOM   3200  N  N     . LEU B 1 63  ? 17.949  40.949 69.145 1.00 57.55  ? 122 LEU B N     1 
ATOM   3201  C  CA    . LEU B 1 63  ? 17.753  40.747 67.715 1.00 57.55  ? 122 LEU B CA    1 
ATOM   3202  C  C     . LEU B 1 63  ? 18.280  41.879 66.846 1.00 57.55  ? 122 LEU B C     1 
ATOM   3203  O  O     . LEU B 1 63  ? 18.144  43.051 67.194 1.00 31.53  ? 122 LEU B O     1 
ATOM   3204  C  CB    . LEU B 1 63  ? 16.267  40.551 67.413 1.00 31.53  ? 122 LEU B CB    1 
ATOM   3205  C  CG    . LEU B 1 63  ? 15.613  39.256 67.898 1.00 31.53  ? 122 LEU B CG    1 
ATOM   3206  C  CD1   . LEU B 1 63  ? 14.120  39.349 67.750 1.00 31.53  ? 122 LEU B CD1   1 
ATOM   3207  C  CD2   . LEU B 1 63  ? 16.136  38.093 67.102 1.00 31.53  ? 122 LEU B CD2   1 
ATOM   3208  H  H     . LEU B 1 63  ? 17.661  41.811 69.527 1.00 0.00   ? 122 LEU B H     1 
ATOM   3209  N  N     . ILE B 1 64  ? 18.913  41.507 65.735 1.00 49.31  ? 123 ILE B N     1 
ATOM   3210  C  CA    . ILE B 1 64  ? 19.439  42.450 64.752 1.00 49.31  ? 123 ILE B CA    1 
ATOM   3211  C  C     . ILE B 1 64  ? 18.811  41.961 63.457 1.00 49.31  ? 123 ILE B C     1 
ATOM   3212  O  O     . ILE B 1 64  ? 19.021  40.815 63.057 1.00 17.10  ? 123 ILE B O     1 
ATOM   3213  C  CB    . ILE B 1 64  ? 20.995  42.389 64.599 1.00 17.10  ? 123 ILE B CB    1 
ATOM   3214  C  CG1   . ILE B 1 64  ? 21.706  42.831 65.888 1.00 17.10  ? 123 ILE B CG1   1 
ATOM   3215  C  CG2   . ILE B 1 64  ? 21.425  43.293 63.456 1.00 17.10  ? 123 ILE B CG2   1 
ATOM   3216  C  CD1   . ILE B 1 64  ? 23.141  42.496 65.925 1.00 17.10  ? 123 ILE B CD1   1 
ATOM   3217  H  H     . ILE B 1 64  ? 19.037  40.551 65.558 1.00 0.00   ? 123 ILE B H     1 
ATOM   3218  N  N     . ILE B 1 65  ? 17.986  42.793 62.836 1.00 24.90  ? 124 ILE B N     1 
ATOM   3219  C  CA    . ILE B 1 65  ? 17.342  42.389 61.610 1.00 24.90  ? 124 ILE B CA    1 
ATOM   3220  C  C     . ILE B 1 65  ? 18.022  42.980 60.394 1.00 24.90  ? 124 ILE B C     1 
ATOM   3221  O  O     . ILE B 1 65  ? 17.717  44.120 60.024 1.00 28.50  ? 124 ILE B O     1 
ATOM   3222  C  CB    . ILE B 1 65  ? 15.858  42.795 61.566 1.00 28.50  ? 124 ILE B CB    1 
ATOM   3223  C  CG1   . ILE B 1 65  ? 15.050  42.009 62.591 1.00 28.50  ? 124 ILE B CG1   1 
ATOM   3224  C  CG2   . ILE B 1 65  ? 15.269  42.452 60.230 1.00 28.50  ? 124 ILE B CG2   1 
ATOM   3225  C  CD1   . ILE B 1 65  ? 15.357  42.348 64.007 1.00 28.50  ? 124 ILE B CD1   1 
ATOM   3226  H  H     . ILE B 1 65  ? 17.814  43.682 63.191 1.00 0.00   ? 124 ILE B H     1 
ATOM   3227  N  N     . ASN B 1 66  ? 18.943  42.231 59.771 1.00 18.00  ? 125 ASN B N     1 
ATOM   3228  C  CA    . ASN B 1 66  ? 19.582  42.729 58.557 1.00 18.00  ? 125 ASN B CA    1 
ATOM   3229  C  C     . ASN B 1 66  ? 18.801  42.193 57.353 1.00 18.00  ? 125 ASN B C     1 
ATOM   3230  O  O     . ASN B 1 66  ? 19.227  41.278 56.660 1.00 34.88  ? 125 ASN B O     1 
ATOM   3231  C  CB    . ASN B 1 66  ? 21.058  42.344 58.482 1.00 34.88  ? 125 ASN B CB    1 
ATOM   3232  C  CG    . ASN B 1 66  ? 21.787  43.006 57.301 1.00 34.88  ? 125 ASN B CG    1 
ATOM   3233  O  OD1   . ASN B 1 66  ? 22.922  42.666 57.007 1.00 34.88  ? 125 ASN B OD1   1 
ATOM   3234  N  ND2   . ASN B 1 66  ? 21.145  43.955 56.647 1.00 34.88  ? 125 ASN B ND2   1 
ATOM   3235  H  H     . ASN B 1 66  ? 19.144  41.333 60.118 1.00 0.00   ? 125 ASN B H     1 
ATOM   3236  H  HD21  . ASN B 1 66  ? 21.674  44.308 55.900 1.00 0.00   ? 125 ASN B HD21  1 
ATOM   3237  H  HD22  . ASN B 1 66  ? 20.254  44.277 56.858 1.00 0.00   ? 125 ASN B HD22  1 
ATOM   3238  N  N     . TYR B 1 67  ? 17.662  42.814 57.090 1.00 11.63  ? 126 TYR B N     1 
ATOM   3239  C  CA    . TYR B 1 67  ? 16.800  42.418 55.996 1.00 11.63  ? 126 TYR B CA    1 
ATOM   3240  C  C     . TYR B 1 67  ? 16.007  43.639 55.576 1.00 11.63  ? 126 TYR B C     1 
ATOM   3241  O  O     . TYR B 1 67  ? 15.494  44.373 56.413 1.00 37.39  ? 126 TYR B O     1 
ATOM   3242  C  CB    . TYR B 1 67  ? 15.854  41.334 56.481 1.00 37.39  ? 126 TYR B CB    1 
ATOM   3243  C  CG    . TYR B 1 67  ? 15.030  40.723 55.398 1.00 37.39  ? 126 TYR B CG    1 
ATOM   3244  C  CD1   . TYR B 1 67  ? 15.545  39.712 54.597 1.00 37.39  ? 126 TYR B CD1   1 
ATOM   3245  C  CD2   . TYR B 1 67  ? 13.717  41.116 55.204 1.00 37.39  ? 126 TYR B CD2   1 
ATOM   3246  C  CE1   . TYR B 1 67  ? 14.770  39.103 53.638 1.00 37.39  ? 126 TYR B CE1   1 
ATOM   3247  C  CE2   . TYR B 1 67  ? 12.931  40.516 54.258 1.00 37.39  ? 126 TYR B CE2   1 
ATOM   3248  C  CZ    . TYR B 1 67  ? 13.456  39.502 53.476 1.00 37.39  ? 126 TYR B CZ    1 
ATOM   3249  O  OH    . TYR B 1 67  ? 12.629  38.847 52.585 1.00 37.39  ? 126 TYR B OH    1 
ATOM   3250  H  H     . TYR B 1 67  ? 17.353  43.557 57.651 1.00 0.00   ? 126 TYR B H     1 
ATOM   3251  H  HH    . TYR B 1 67  ? 11.774  39.263 52.726 1.00 0.00   ? 126 TYR B HH    1 
ATOM   3252  N  N     . PRO B 1 68  ? 15.930  43.899 54.266 1.00 45.72  ? 127 PRO B N     1 
ATOM   3253  C  CA    . PRO B 1 68  ? 15.194  45.052 53.738 1.00 45.72  ? 127 PRO B CA    1 
ATOM   3254  C  C     . PRO B 1 68  ? 13.717  44.975 54.084 1.00 45.72  ? 127 PRO B C     1 
ATOM   3255  O  O     . PRO B 1 68  ? 12.971  44.159 53.541 1.00 41.81  ? 127 PRO B O     1 
ATOM   3256  C  CB    . PRO B 1 68  ? 15.449  44.947 52.242 1.00 41.81  ? 127 PRO B CB    1 
ATOM   3257  C  CG    . PRO B 1 68  ? 15.610  43.468 52.034 1.00 41.81  ? 127 PRO B CG    1 
ATOM   3258  C  CD    . PRO B 1 68  ? 16.487  43.087 53.170 1.00 41.81  ? 127 PRO B CD    1 
ATOM   3259  N  N     . LEU B 1 69  ? 13.309  45.833 55.005 1.00 33.47  ? 128 LEU B N     1 
ATOM   3260  C  CA    . LEU B 1 69  ? 11.938  45.856 55.468 1.00 33.47  ? 128 LEU B CA    1 
ATOM   3261  C  C     . LEU B 1 69  ? 11.261  47.189 55.230 1.00 33.47  ? 128 LEU B C     1 
ATOM   3262  O  O     . LEU B 1 69  ? 11.666  48.239 55.762 1.00 20.77  ? 128 LEU B O     1 
ATOM   3263  C  CB    . LEU B 1 69  ? 11.896  45.494 56.953 1.00 20.77  ? 128 LEU B CB    1 
ATOM   3264  C  CG    . LEU B 1 69  ? 12.036  43.994 57.219 1.00 20.77  ? 128 LEU B CG    1 
ATOM   3265  C  CD1   . LEU B 1 69  ? 12.480  43.755 58.648 1.00 20.77  ? 128 LEU B CD1   1 
ATOM   3266  C  CD2   . LEU B 1 69  ? 10.731  43.266 56.894 1.00 20.77  ? 128 LEU B CD2   1 
ATOM   3267  H  H     . LEU B 1 69  ? 13.957  46.471 55.378 1.00 0.00   ? 128 LEU B H     1 
ATOM   3268  N  N     . ASP B 1 70  ? 10.240  47.145 54.390 1.00 30.79  ? 129 ASP B N     1 
ATOM   3269  C  CA    . ASP B 1 70  ? 9.471   48.336 54.084 1.00 30.79  ? 129 ASP B CA    1 
ATOM   3270  C  C     . ASP B 1 70  ? 8.766   48.784 55.368 1.00 30.79  ? 129 ASP B C     1 
ATOM   3271  O  O     . ASP B 1 70  ? 8.147   47.981 56.064 1.00 46.33  ? 129 ASP B O     1 
ATOM   3272  C  CB    . ASP B 1 70  ? 8.497   48.048 52.947 1.00 46.33  ? 129 ASP B CB    1 
ATOM   3273  C  CG    . ASP B 1 70  ? 9.210   47.658 51.656 1.00 46.33  ? 129 ASP B CG    1 
ATOM   3274  O  OD1   . ASP B 1 70  ? 10.354  47.139 51.697 1.00 46.33  ? 129 ASP B OD1   1 
ATOM   3275  O  OD2   . ASP B 1 70  ? 8.621   47.873 50.583 1.00 46.33  ? 129 ASP B OD2   1 
ATOM   3276  H  H     . ASP B 1 70  ? 10.020  46.290 53.968 1.00 0.00   ? 129 ASP B H     1 
ATOM   3277  N  N     . ASP B 1 71  ? 8.959   50.058 55.706 1.00 49.68  ? 130 ASP B N     1 
ATOM   3278  C  CA    . ASP B 1 71  ? 8.419   50.703 56.909 1.00 49.68  ? 130 ASP B CA    1 
ATOM   3279  C  C     . ASP B 1 71  ? 7.271   50.035 57.661 1.00 49.68  ? 130 ASP B C     1 
ATOM   3280  O  O     . ASP B 1 71  ? 7.398   49.785 58.854 1.00 74.56  ? 130 ASP B O     1 
ATOM   3281  C  CB    . ASP B 1 71  ? 8.141   52.188 56.636 1.00 74.56  ? 130 ASP B CB    1 
ATOM   3282  C  CG    . ASP B 1 71  ? 9.405   52.953 56.209 1.00 74.56  ? 130 ASP B CG    1 
ATOM   3283  O  OD1   . ASP B 1 71  ? 10.531  52.421 56.378 1.00 74.56  ? 130 ASP B OD1   1 
ATOM   3284  O  OD2   . ASP B 1 71  ? 9.275   54.088 55.701 1.00 74.56  ? 130 ASP B OD2   1 
ATOM   3285  H  H     . ASP B 1 71  ? 9.540   50.581 55.119 1.00 0.00   ? 130 ASP B H     1 
ATOM   3286  N  N     . GLN B 1 72  ? 6.168   49.717 56.992 1.00 70.33  ? 131 GLN B N     1 
ATOM   3287  C  CA    . GLN B 1 72  ? 5.063   49.050 57.687 1.00 70.33  ? 131 GLN B CA    1 
ATOM   3288  C  C     . GLN B 1 72  ? 5.546   47.712 58.288 1.00 70.33  ? 131 GLN B C     1 
ATOM   3289  O  O     . GLN B 1 72  ? 5.330   47.422 59.473 1.00 57.99  ? 131 GLN B O     1 
ATOM   3290  C  CB    . GLN B 1 72  ? 3.885   48.819 56.726 1.00 57.99  ? 131 GLN B CB    1 
ATOM   3291  C  CG    . GLN B 1 72  ? 3.107   50.090 56.349 1.00 57.99  ? 131 GLN B CG    1 
ATOM   3292  C  CD    . GLN B 1 72  ? 1.852   49.809 55.510 1.00 57.99  ? 131 GLN B CD    1 
ATOM   3293  O  OE1   . GLN B 1 72  ? 1.159   48.806 55.712 1.00 57.99  ? 131 GLN B OE1   1 
ATOM   3294  N  NE2   . GLN B 1 72  ? 1.552   50.706 54.573 1.00 57.99  ? 131 GLN B NE2   1 
ATOM   3295  H  H     . GLN B 1 72  ? 6.100   49.934 56.044 1.00 0.00   ? 131 GLN B H     1 
ATOM   3296  N  N     . ASP B 1 73  ? 6.271   46.956 57.463 1.00 37.46  ? 132 ASP B N     1 
ATOM   3297  C  CA    . ASP B 1 73  ? 6.832   45.651 57.797 1.00 37.46  ? 132 ASP B CA    1 
ATOM   3298  C  C     . ASP B 1 73  ? 7.939   45.731 58.830 1.00 37.46  ? 132 ASP B C     1 
ATOM   3299  O  O     . ASP B 1 73  ? 8.206   44.752 59.526 1.00 92.89  ? 132 ASP B O     1 
ATOM   3300  C  CB    . ASP B 1 73  ? 7.350   44.998 56.524 1.00 92.89  ? 132 ASP B CB    1 
ATOM   3301  C  CG    . ASP B 1 73  ? 6.279   44.908 55.447 1.00 92.89  ? 132 ASP B CG    1 
ATOM   3302  O  OD1   . ASP B 1 73  ? 5.079   44.897 55.811 1.00 92.89  ? 132 ASP B OD1   1 
ATOM   3303  O  OD2   . ASP B 1 73  ? 6.631   44.846 54.242 1.00 92.89  ? 132 ASP B OD2   1 
ATOM   3304  H  H     . ASP B 1 73  ? 6.442   47.299 56.565 1.00 0.00   ? 132 ASP B H     1 
ATOM   3305  N  N     . ALA B 1 74  ? 8.591   46.887 58.924 1.00 36.81  ? 133 ALA B N     1 
ATOM   3306  C  CA    . ALA B 1 74  ? 9.658   47.080 59.903 1.00 36.81  ? 133 ALA B CA    1 
ATOM   3307  C  C     . ALA B 1 74  ? 8.975   47.100 61.254 1.00 36.81  ? 133 ALA B C     1 
ATOM   3308  O  O     . ALA B 1 74  ? 9.268   46.288 62.118 1.00 28.28  ? 133 ALA B O     1 
ATOM   3309  C  CB    . ALA B 1 74  ? 10.400  48.393 59.651 1.00 28.28  ? 133 ALA B CB    1 
ATOM   3310  H  H     . ALA B 1 74  ? 8.342   47.628 58.331 1.00 0.00   ? 133 ALA B H     1 
ATOM   3311  N  N     . ILE B 1 75  ? 7.994   47.980 61.394 1.00 71.65  ? 134 ILE B N     1 
ATOM   3312  C  CA    . ILE B 1 75  ? 7.234   48.095 62.629 1.00 71.65  ? 134 ILE B CA    1 
ATOM   3313  C  C     . ILE B 1 75  ? 6.618   46.736 62.948 1.00 71.65  ? 134 ILE B C     1 
ATOM   3314  O  O     . ILE B 1 75  ? 6.625   46.303 64.099 1.00 82.19  ? 134 ILE B O     1 
ATOM   3315  C  CB    . ILE B 1 75  ? 6.121   49.141 62.487 1.00 82.19  ? 134 ILE B CB    1 
ATOM   3316  C  CG1   . ILE B 1 75  ? 6.730   50.506 62.163 1.00 82.19  ? 134 ILE B CG1   1 
ATOM   3317  C  CG2   . ILE B 1 75  ? 5.310   49.217 63.769 1.00 82.19  ? 134 ILE B CG2   1 
ATOM   3318  C  CD1   . ILE B 1 75  ? 5.722   51.517 61.692 1.00 82.19  ? 134 ILE B CD1   1 
ATOM   3319  H  H     . ILE B 1 75  ? 7.762   48.560 60.635 1.00 0.00   ? 134 ILE B H     1 
ATOM   3320  N  N     . ALA B 1 76  ? 6.102   46.066 61.918 1.00 60.65  ? 135 ALA B N     1 
ATOM   3321  C  CA    . ALA B 1 76  ? 5.503   44.737 62.068 1.00 60.65  ? 135 ALA B CA    1 
ATOM   3322  C  C     . ALA B 1 76  ? 6.501   43.733 62.639 1.00 60.65  ? 135 ALA B C     1 
ATOM   3323  O  O     . ALA B 1 76  ? 6.175   42.994 63.572 1.00 45.44  ? 135 ALA B O     1 
ATOM   3324  C  CB    . ALA B 1 76  ? 4.957   44.230 60.736 1.00 45.44  ? 135 ALA B CB    1 
ATOM   3325  H  H     . ALA B 1 76  ? 6.102   46.494 61.037 1.00 0.00   ? 135 ALA B H     1 
ATOM   3326  N  N     . VAL B 1 77  ? 7.712   43.688 62.095 1.00 57.15  ? 136 VAL B N     1 
ATOM   3327  C  CA    . VAL B 1 77  ? 8.690   42.753 62.626 1.00 57.15  ? 136 VAL B CA    1 
ATOM   3328  C  C     . VAL B 1 77  ? 9.041   43.204 64.037 1.00 57.15  ? 136 VAL B C     1 
ATOM   3329  O  O     . VAL B 1 77  ? 9.347   42.380 64.895 1.00 29.87  ? 136 VAL B O     1 
ATOM   3330  C  CB    . VAL B 1 77  ? 9.954   42.651 61.735 1.00 29.87  ? 136 VAL B CB    1 
ATOM   3331  C  CG1   . VAL B 1 77  ? 11.040  41.835 62.433 1.00 29.87  ? 136 VAL B CG1   1 
ATOM   3332  C  CG2   . VAL B 1 77  ? 9.596   41.998 60.429 1.00 29.87  ? 136 VAL B CG2   1 
ATOM   3333  H  H     . VAL B 1 77  ? 7.961   44.281 61.357 1.00 0.00   ? 136 VAL B H     1 
ATOM   3334  N  N     . GLU B 1 78  ? 8.950   44.508 64.290 1.00 26.28  ? 137 GLU B N     1 
ATOM   3335  C  CA    . GLU B 1 78  ? 9.254   45.025 65.619 1.00 26.28  ? 137 GLU B CA    1 
ATOM   3336  C  C     . GLU B 1 78  ? 8.270   44.373 66.595 1.00 26.28  ? 137 GLU B C     1 
ATOM   3337  O  O     . GLU B 1 78  ? 8.664   43.781 67.599 1.00 70.17  ? 137 GLU B O     1 
ATOM   3338  C  CB    . GLU B 1 78  ? 9.097   46.544 65.665 1.00 70.17  ? 137 GLU B CB    1 
ATOM   3339  C  CG    . GLU B 1 78  ? 8.992   47.103 67.086 1.00 70.17  ? 137 GLU B CG    1 
ATOM   3340  C  CD    . GLU B 1 78  ? 7.804   48.039 67.271 1.00 70.17  ? 137 GLU B CD    1 
ATOM   3341  O  OE1   . GLU B 1 78  ? 6.690   47.714 66.793 1.00 70.17  ? 137 GLU B OE1   1 
ATOM   3342  O  OE2   . GLU B 1 78  ? 7.987   49.103 67.902 1.00 70.17  ? 137 GLU B OE2   1 
ATOM   3343  H  H     . GLU B 1 78  ? 8.694   45.126 63.580 1.00 0.00   ? 137 GLU B H     1 
ATOM   3344  N  N     . ALA B 1 79  ? 6.989   44.460 66.250 1.00 69.34  ? 138 ALA B N     1 
ATOM   3345  C  CA    . ALA B 1 79  ? 5.902   43.905 67.048 1.00 69.34  ? 138 ALA B CA    1 
ATOM   3346  C  C     . ALA B 1 79  ? 6.130   42.422 67.329 1.00 69.34  ? 138 ALA B C     1 
ATOM   3347  O  O     . ALA B 1 79  ? 5.746   41.912 68.389 1.00 55.07  ? 138 ALA B O     1 
ATOM   3348  C  CB    . ALA B 1 79  ? 4.566   44.107 66.311 1.00 55.07  ? 138 ALA B CB    1 
ATOM   3349  H  H     . ALA B 1 79  ? 6.769   44.921 65.415 1.00 0.00   ? 138 ALA B H     1 
ATOM   3350  N  N     . ALA B 1 80  ? 6.759   41.744 66.369 1.00 59.41  ? 139 ALA B N     1 
ATOM   3351  C  CA    . ALA B 1 80  ? 7.052   40.312 66.459 1.00 59.41  ? 139 ALA B CA    1 
ATOM   3352  C  C     . ALA B 1 80  ? 8.159   40.031 67.450 1.00 59.41  ? 139 ALA B C     1 
ATOM   3353  O  O     . ALA B 1 80  ? 8.288   38.905 67.936 1.00 50.49  ? 139 ALA B O     1 
ATOM   3354  C  CB    . ALA B 1 80  ? 7.440   39.758 65.082 1.00 50.49  ? 139 ALA B CB    1 
ATOM   3355  H  H     . ALA B 1 80  ? 7.032   42.234 65.566 1.00 0.00   ? 139 ALA B H     1 
ATOM   3356  N  N     . CYS B 1 81  ? 8.981   41.042 67.715 1.00 33.34  ? 140 CYS B N     1 
ATOM   3357  C  CA    . CYS B 1 81  ? 10.092  40.892 68.655 1.00 33.34  ? 140 CYS B CA    1 
ATOM   3358  C  C     . CYS B 1 81  ? 9.580   40.891 70.097 1.00 33.34  ? 140 CYS B C     1 
ATOM   3359  O  O     . CYS B 1 81  ? 9.815   41.836 70.854 1.00 56.30  ? 140 CYS B O     1 
ATOM   3360  C  CB    . CYS B 1 81  ? 11.126  42.006 68.445 1.00 56.30  ? 140 CYS B CB    1 
ATOM   3361  S  SG    . CYS B 1 81  ? 11.922  41.978 66.819 1.00 56.30  ? 140 CYS B SG    1 
ATOM   3362  H  H     . CYS B 1 81  ? 8.856   41.903 67.268 1.00 0.00   ? 140 CYS B H     1 
ATOM   3363  N  N     . THR B 1 82  ? 8.890   39.819 70.477 1.00 70.80  ? 141 THR B N     1 
ATOM   3364  C  CA    . THR B 1 82  ? 8.330   39.712 71.817 1.00 70.80  ? 141 THR B CA    1 
ATOM   3365  C  C     . THR B 1 82  ? 9.390   39.879 72.911 1.00 70.80  ? 141 THR B C     1 
ATOM   3366  O  O     . THR B 1 82  ? 10.310  39.068 73.030 1.00 55.43  ? 141 THR B O     1 
ATOM   3367  C  CB    . THR B 1 82  ? 7.564   38.379 72.005 1.00 55.43  ? 141 THR B CB    1 
ATOM   3368  O  OG1   . THR B 1 82  ? 8.494   37.298 72.077 1.00 55.43  ? 141 THR B OG1   1 
ATOM   3369  C  CG2   . THR B 1 82  ? 6.613   38.133 70.827 1.00 55.43  ? 141 THR B CG2   1 
ATOM   3370  H  H     . THR B 1 82  ? 8.774   39.075 69.848 1.00 0.00   ? 141 THR B H     1 
ATOM   3371  H  HG1   . THR B 1 82  ? 9.164   37.381 72.779 1.00 30.00  ? 141 THR B HG1   1 
ATOM   3372  N  N     . ASN B 1 83  ? 9.253   40.973 73.665 1.00 77.49  ? 142 ASN B N     1 
ATOM   3373  C  CA    . ASN B 1 83  ? 10.129  41.365 74.784 1.00 77.49  ? 142 ASN B CA    1 
ATOM   3374  C  C     . ASN B 1 83  ? 11.658  41.306 74.625 1.00 77.49  ? 142 ASN B C     1 
ATOM   3375  O  O     . ASN B 1 83  ? 12.395  41.275 75.615 1.00 80.22  ? 142 ASN B O     1 
ATOM   3376  C  CB    . ASN B 1 83  ? 9.686   40.710 76.112 1.00 80.22  ? 142 ASN B CB    1 
ATOM   3377  C  CG    . ASN B 1 83  ? 9.631   39.188 76.049 1.00 80.22  ? 142 ASN B CG    1 
ATOM   3378  O  OD1   . ASN B 1 83  ? 10.653  38.503 76.140 1.00 80.22  ? 142 ASN B OD1   1 
ATOM   3379  N  ND2   . ASN B 1 83  ? 8.421   38.653 75.942 1.00 80.22  ? 142 ASN B ND2   1 
ATOM   3380  H  H     . ASN B 1 83  ? 8.527   41.575 73.414 1.00 0.00   ? 142 ASN B H     1 
ATOM   3381  H  HD21  . ASN B 1 83  ? 8.396   37.677 75.886 1.00 0.00   ? 142 ASN B HD21  1 
ATOM   3382  H  HD22  . ASN B 1 83  ? 7.625   39.215 75.927 1.00 0.00   ? 142 ASN B HD22  1 
ATOM   3383  N  N     . VAL B 1 84  ? 12.123  41.383 73.381 1.00 55.93  ? 143 VAL B N     1 
ATOM   3384  C  CA    . VAL B 1 84  ? 13.548  41.355 73.059 1.00 55.93  ? 143 VAL B CA    1 
ATOM   3385  C  C     . VAL B 1 84  ? 13.816  42.631 72.254 1.00 55.93  ? 143 VAL B C     1 
ATOM   3386  O  O     . VAL B 1 84  ? 12.996  43.020 71.409 1.00 40.76  ? 143 VAL B O     1 
ATOM   3387  C  CB    . VAL B 1 84  ? 13.892  40.087 72.225 1.00 40.76  ? 143 VAL B CB    1 
ATOM   3388  C  CG1   . VAL B 1 84  ? 15.262  40.198 71.613 1.00 40.76  ? 143 VAL B CG1   1 
ATOM   3389  C  CG2   . VAL B 1 84  ? 13.846  38.856 73.107 1.00 40.76  ? 143 VAL B CG2   1 
ATOM   3390  H  H     . VAL B 1 84  ? 11.498  41.485 72.633 1.00 0.00   ? 143 VAL B H     1 
ATOM   3391  N  N     . PRO B 1 85  ? 14.918  43.349 72.566 1.00 30.59  ? 144 PRO B N     1 
ATOM   3392  C  CA    . PRO B 1 85  ? 15.249  44.581 71.846 1.00 30.59  ? 144 PRO B CA    1 
ATOM   3393  C  C     . PRO B 1 85  ? 15.491  44.226 70.386 1.00 30.59  ? 144 PRO B C     1 
ATOM   3394  O  O     . PRO B 1 85  ? 16.156  43.231 70.097 1.00 43.74  ? 144 PRO B O     1 
ATOM   3395  C  CB    . PRO B 1 85  ? 16.550  45.019 72.504 1.00 43.74  ? 144 PRO B CB    1 
ATOM   3396  C  CG    . PRO B 1 85  ? 16.500  44.417 73.843 1.00 43.74  ? 144 PRO B CG    1 
ATOM   3397  C  CD    . PRO B 1 85  ? 15.953  43.056 73.569 1.00 43.74  ? 144 PRO B CD    1 
ATOM   3398  N  N     . ALA B 1 86  ? 14.931  45.011 69.475 1.00 41.23  ? 145 ALA B N     1 
ATOM   3399  C  CA    . ALA B 1 86  ? 15.094  44.763 68.054 1.00 41.23  ? 145 ALA B CA    1 
ATOM   3400  C  C     . ALA B 1 86  ? 15.870  45.897 67.423 1.00 41.23  ? 145 ALA B C     1 
ATOM   3401  O  O     . ALA B 1 86  ? 15.466  47.052 67.516 1.00 48.46  ? 145 ALA B O     1 
ATOM   3402  C  CB    . ALA B 1 86  ? 13.738  44.628 67.383 1.00 48.46  ? 145 ALA B CB    1 
ATOM   3403  H  H     . ALA B 1 86  ? 14.390  45.781 69.741 1.00 0.00   ? 145 ALA B H     1 
ATOM   3404  N  N     . LEU B 1 87  ? 16.987  45.565 66.790 1.00 30.21  ? 146 LEU B N     1 
ATOM   3405  C  CA    . LEU B 1 87  ? 17.820  46.547 66.110 1.00 30.21  ? 146 LEU B CA    1 
ATOM   3406  C  C     . LEU B 1 87  ? 17.821  46.195 64.625 1.00 30.21  ? 146 LEU B C     1 
ATOM   3407  O  O     . LEU B 1 87  ? 18.239  45.111 64.224 1.00 50.71  ? 146 LEU B O     1 
ATOM   3408  C  CB    . LEU B 1 87  ? 19.237  46.537 66.692 1.00 50.71  ? 146 LEU B CB    1 
ATOM   3409  C  CG    . LEU B 1 87  ? 20.356  47.341 66.033 1.00 50.71  ? 146 LEU B CG    1 
ATOM   3410  C  CD1   . LEU B 1 87  ? 19.913  48.748 65.779 1.00 50.71  ? 146 LEU B CD1   1 
ATOM   3411  C  CD2   . LEU B 1 87  ? 21.572  47.321 66.936 1.00 50.71  ? 146 LEU B CD2   1 
ATOM   3412  H  H     . LEU B 1 87  ? 17.262  44.631 66.764 1.00 0.00   ? 146 LEU B H     1 
ATOM   3413  N  N     . PHE B 1 88  ? 17.273  47.096 63.827 1.00 23.28  ? 147 PHE B N     1 
ATOM   3414  C  CA    . PHE B 1 88  ? 17.166  46.909 62.395 1.00 23.28  ? 147 PHE B CA    1 
ATOM   3415  C  C     . PHE B 1 88  ? 18.331  47.541 61.646 1.00 23.28  ? 147 PHE B C     1 
ATOM   3416  O  O     . PHE B 1 88  ? 18.898  48.542 62.082 1.00 30.26  ? 147 PHE B O     1 
ATOM   3417  C  CB    . PHE B 1 88  ? 15.831  47.442 61.902 1.00 30.26  ? 147 PHE B CB    1 
ATOM   3418  C  CG    . PHE B 1 88  ? 14.651  46.776 62.549 1.00 30.26  ? 147 PHE B CG    1 
ATOM   3419  C  CD1   . PHE B 1 88  ? 14.368  46.987 63.885 1.00 30.26  ? 147 PHE B CD1   1 
ATOM   3420  C  CD2   . PHE B 1 88  ? 13.814  45.936 61.817 1.00 30.26  ? 147 PHE B CD2   1 
ATOM   3421  C  CE1   . PHE B 1 88  ? 13.271  46.379 64.486 1.00 30.26  ? 147 PHE B CE1   1 
ATOM   3422  C  CE2   . PHE B 1 88  ? 12.708  45.318 62.415 1.00 30.26  ? 147 PHE B CE2   1 
ATOM   3423  C  CZ    . PHE B 1 88  ? 12.439  45.543 63.749 1.00 30.26  ? 147 PHE B CZ    1 
ATOM   3424  H  H     . PHE B 1 88  ? 16.952  47.928 64.221 1.00 0.00   ? 147 PHE B H     1 
ATOM   3425  N  N     . LEU B 1 89  ? 18.708  46.918 60.534 1.00 27.22  ? 148 LEU B N     1 
ATOM   3426  C  CA    . LEU B 1 89  ? 19.821  47.394 59.740 1.00 27.22  ? 148 LEU B CA    1 
ATOM   3427  C  C     . LEU B 1 89  ? 19.512  47.707 58.271 1.00 27.22  ? 148 LEU B C     1 
ATOM   3428  O  O     . LEU B 1 89  ? 20.278  48.421 57.636 1.00 19.87  ? 148 LEU B O     1 
ATOM   3429  C  CB    . LEU B 1 89  ? 20.998  46.410 59.853 1.00 19.87  ? 148 LEU B CB    1 
ATOM   3430  C  CG    . LEU B 1 89  ? 21.654  46.285 61.238 1.00 19.87  ? 148 LEU B CG    1 
ATOM   3431  C  CD1   . LEU B 1 89  ? 22.718  45.232 61.216 1.00 19.87  ? 148 LEU B CD1   1 
ATOM   3432  C  CD2   . LEU B 1 89  ? 22.293  47.585 61.668 1.00 19.87  ? 148 LEU B CD2   1 
ATOM   3433  H  H     . LEU B 1 89  ? 18.236  46.097 60.272 1.00 0.00   ? 148 LEU B H     1 
ATOM   3434  N  N     . ASP B 1 90  ? 18.406  47.213 57.723 1.00 21.00  ? 149 ASP B N     1 
ATOM   3435  C  CA    . ASP B 1 90  ? 18.106  47.501 56.312 1.00 21.00  ? 149 ASP B CA    1 
ATOM   3436  C  C     . ASP B 1 90  ? 16.727  48.142 56.168 1.00 21.00  ? 149 ASP B C     1 
ATOM   3437  O  O     . ASP B 1 90  ? 15.857  47.619 55.487 1.00 33.72  ? 149 ASP B O     1 
ATOM   3438  C  CB    . ASP B 1 90  ? 18.240  46.225 55.451 1.00 33.72  ? 149 ASP B CB    1 
ATOM   3439  C  CG    . ASP B 1 90  ? 18.201  46.503 53.934 1.00 33.72  ? 149 ASP B CG    1 
ATOM   3440  O  OD1   . ASP B 1 90  ? 17.642  47.535 53.520 1.00 33.72  ? 149 ASP B OD1   1 
ATOM   3441  O  OD2   . ASP B 1 90  ? 18.709  45.674 53.133 1.00 33.72  ? 149 ASP B OD2   1 
ATOM   3442  H  H     . ASP B 1 90  ? 17.771  46.697 58.261 1.00 0.00   ? 149 ASP B H     1 
ATOM   3443  N  N     . VAL B 1 91  ? 16.558  49.306 56.785 1.00 43.26  ? 150 VAL B N     1 
ATOM   3444  C  CA    . VAL B 1 91  ? 15.297  50.045 56.761 1.00 43.26  ? 150 VAL B CA    1 
ATOM   3445  C  C     . VAL B 1 91  ? 15.522  51.511 56.343 1.00 43.26  ? 150 VAL B C     1 
ATOM   3446  O  O     . VAL B 1 91  ? 16.609  51.874 55.898 1.00 32.96  ? 150 VAL B O     1 
ATOM   3447  C  CB    . VAL B 1 91  ? 14.600  50.014 58.167 1.00 32.96  ? 150 VAL B CB    1 
ATOM   3448  C  CG1   . VAL B 1 91  ? 14.183  48.605 58.529 1.00 32.96  ? 150 VAL B CG1   1 
ATOM   3449  C  CG2   . VAL B 1 91  ? 15.517  50.579 59.251 1.00 32.96  ? 150 VAL B CG2   1 
ATOM   3450  H  H     . VAL B 1 91  ? 17.322  49.718 57.233 1.00 0.00   ? 150 VAL B H     1 
ATOM   3451  N  N     . SER B 1 92  ? 14.486  52.337 56.491 1.00 44.91  ? 151 SER B N     1 
ATOM   3452  C  CA    . SER B 1 92  ? 14.535  53.759 56.166 1.00 44.91  ? 151 SER B CA    1 
ATOM   3453  C  C     . SER B 1 92  ? 14.918  54.577 57.371 1.00 44.91  ? 151 SER B C     1 
ATOM   3454  O  O     . SER B 1 92  ? 14.792  54.134 58.513 1.00 35.31  ? 151 SER B O     1 
ATOM   3455  C  CB    . SER B 1 92  ? 13.177  54.260 55.724 1.00 35.31  ? 151 SER B CB    1 
ATOM   3456  O  OG    . SER B 1 92  ? 13.171  55.672 55.671 1.00 35.31  ? 151 SER B OG    1 
ATOM   3457  H  H     . SER B 1 92  ? 13.651  51.998 56.873 1.00 0.00   ? 151 SER B H     1 
ATOM   3458  H  HG    . SER B 1 92  ? 12.304  55.944 55.331 1.00 30.00  ? 151 SER B HG    1 
ATOM   3459  N  N     . ASP B 1 93  ? 15.318  55.813 57.106 1.00 76.61  ? 152 ASP B N     1 
ATOM   3460  C  CA    . ASP B 1 93  ? 15.701  56.729 58.169 1.00 76.61  ? 152 ASP B CA    1 
ATOM   3461  C  C     . ASP B 1 93  ? 14.472  57.220 58.927 1.00 76.61  ? 152 ASP B C     1 
ATOM   3462  O  O     . ASP B 1 93  ? 14.572  57.665 60.071 1.00 73.07  ? 152 ASP B O     1 
ATOM   3463  C  CB    . ASP B 1 93  ? 16.527  57.922 57.629 1.00 73.07  ? 152 ASP B CB    1 
ATOM   3464  C  CG    . ASP B 1 93  ? 16.121  58.369 56.208 1.00 73.07  ? 152 ASP B CG    1 
ATOM   3465  O  OD1   . ASP B 1 93  ? 14.973  58.146 55.758 1.00 73.07  ? 152 ASP B OD1   1 
ATOM   3466  O  OD2   . ASP B 1 93  ? 16.984  58.969 55.535 1.00 73.07  ? 152 ASP B OD2   1 
ATOM   3467  H  H     . ASP B 1 93  ? 15.306  56.072 56.165 1.00 0.00   ? 152 ASP B H     1 
ATOM   3468  N  N     . GLN B 1 94  ? 13.303  57.061 58.314 1.00 65.69  ? 153 GLN B N     1 
ATOM   3469  C  CA    . GLN B 1 94  ? 12.072  57.523 58.921 1.00 65.69  ? 153 GLN B CA    1 
ATOM   3470  C  C     . GLN B 1 94  ? 11.041  56.446 59.243 1.00 65.69  ? 153 GLN B C     1 
ATOM   3471  O  O     . GLN B 1 94  ? 10.056  56.278 58.523 1.00 76.86  ? 153 GLN B O     1 
ATOM   3472  C  CB    . GLN B 1 94  ? 11.486  58.634 58.054 1.00 76.86  ? 153 GLN B CB    1 
ATOM   3473  C  CG    . GLN B 1 94  ? 12.377  59.877 58.057 1.00 76.86  ? 153 GLN B CG    1 
ATOM   3474  C  CD    . GLN B 1 94  ? 12.100  60.831 56.918 1.00 76.86  ? 153 GLN B CD    1 
ATOM   3475  O  OE1   . GLN B 1 94  ? 11.766  60.416 55.809 1.00 76.86  ? 153 GLN B OE1   1 
ATOM   3476  N  NE2   . GLN B 1 94  ? 12.267  62.120 57.179 1.00 76.86  ? 153 GLN B NE2   1 
ATOM   3477  H  H     . GLN B 1 94  ? 13.264  56.627 57.436 1.00 0.00   ? 153 GLN B H     1 
ATOM   3478  N  N     . THR B 1 95  ? 11.297  55.716 60.331 1.00 83.56  ? 154 THR B N     1 
ATOM   3479  C  CA    . THR B 1 95  ? 10.433  54.644 60.852 1.00 83.56  ? 154 THR B CA    1 
ATOM   3480  C  C     . THR B 1 95  ? 10.775  54.634 62.333 1.00 83.56  ? 154 THR B C     1 
ATOM   3481  O  O     . THR B 1 95  ? 11.938  54.475 62.683 1.00 59.60  ? 154 THR B O     1 
ATOM   3482  C  CB    . THR B 1 95  ? 10.823  53.235 60.330 1.00 59.60  ? 154 THR B CB    1 
ATOM   3483  O  OG1   . THR B 1 95  ? 10.782  53.199 58.901 1.00 59.60  ? 154 THR B OG1   1 
ATOM   3484  C  CG2   . THR B 1 95  ? 9.866   52.197 60.874 1.00 59.60  ? 154 THR B CG2   1 
ATOM   3485  H  H     . THR B 1 95  ? 12.129  55.882 60.828 1.00 0.00   ? 154 THR B H     1 
ATOM   3486  H  HG1   . THR B 1 95  ? 10.003  53.699 58.624 1.00 30.00  ? 154 THR B HG1   1 
ATOM   3487  N  N     . PRO B 1 96  ? 9.781   54.799 63.222 1.00 40.68  ? 155 PRO B N     1 
ATOM   3488  C  CA    . PRO B 1 96  ? 10.040  54.803 64.668 1.00 40.68  ? 155 PRO B CA    1 
ATOM   3489  C  C     . PRO B 1 96  ? 10.410  53.416 65.203 1.00 40.68  ? 155 PRO B C     1 
ATOM   3490  O  O     . PRO B 1 96  ? 9.558   52.689 65.705 1.00 68.24  ? 155 PRO B O     1 
ATOM   3491  C  CB    . PRO B 1 96  ? 8.714   55.289 65.233 1.00 68.24  ? 155 PRO B CB    1 
ATOM   3492  C  CG    . PRO B 1 96  ? 7.730   54.664 64.289 1.00 68.24  ? 155 PRO B CG    1 
ATOM   3493  C  CD    . PRO B 1 96  ? 8.340   54.938 62.944 1.00 68.24  ? 155 PRO B CD    1 
ATOM   3494  N  N     . ILE B 1 97  ? 11.676  53.043 65.059 1.00 42.91  ? 156 ILE B N     1 
ATOM   3495  C  CA    . ILE B 1 97  ? 12.189  51.750 65.512 1.00 42.91  ? 156 ILE B CA    1 
ATOM   3496  C  C     . ILE B 1 97  ? 13.679  51.956 65.812 1.00 42.91  ? 156 ILE B C     1 
ATOM   3497  O  O     . ILE B 1 97  ? 14.222  53.032 65.512 1.00 44.68  ? 156 ILE B O     1 
ATOM   3498  C  CB    . ILE B 1 97  ? 12.020  50.644 64.418 1.00 44.68  ? 156 ILE B CB    1 
ATOM   3499  C  CG1   . ILE B 1 97  ? 12.714  51.061 63.127 1.00 44.68  ? 156 ILE B CG1   1 
ATOM   3500  C  CG2   . ILE B 1 97  ? 10.560  50.402 64.109 1.00 44.68  ? 156 ILE B CG2   1 
ATOM   3501  C  CD1   . ILE B 1 97  ? 12.567  50.074 61.999 1.00 44.68  ? 156 ILE B CD1   1 
ATOM   3502  H  H     . ILE B 1 97  ? 12.326  53.650 64.636 1.00 0.00   ? 156 ILE B H     1 
ATOM   3503  N  N     . ASN B 1 98  ? 14.323  50.960 66.428 1.00 59.15  ? 157 ASN B N     1 
ATOM   3504  C  CA    . ASN B 1 98  ? 15.758  51.028 66.754 1.00 59.15  ? 157 ASN B CA    1 
ATOM   3505  C  C     . ASN B 1 98  ? 16.548  50.628 65.519 1.00 59.15  ? 157 ASN B C     1 
ATOM   3506  O  O     . ASN B 1 98  ? 16.756  49.446 65.275 1.00 52.74  ? 157 ASN B O     1 
ATOM   3507  C  CB    . ASN B 1 98  ? 16.105  50.069 67.892 1.00 52.74  ? 157 ASN B CB    1 
ATOM   3508  C  CG    . ASN B 1 98  ? 15.471  50.463 69.197 1.00 52.74  ? 157 ASN B CG    1 
ATOM   3509  O  OD1   . ASN B 1 98  ? 14.287  50.777 69.259 1.00 52.74  ? 157 ASN B OD1   1 
ATOM   3510  N  ND2   . ASN B 1 98  ? 16.262  50.473 70.253 1.00 52.74  ? 157 ASN B ND2   1 
ATOM   3511  H  H     . ASN B 1 98  ? 13.838  50.154 66.688 1.00 0.00   ? 157 ASN B H     1 
ATOM   3512  H  HD21  . ASN B 1 98  ? 15.851  50.709 71.103 1.00 0.00   ? 157 ASN B HD21  1 
ATOM   3513  H  HD22  . ASN B 1 98  ? 17.198  50.244 70.096 1.00 0.00   ? 157 ASN B HD22  1 
ATOM   3514  N  N     . SER B 1 99  ? 17.023  51.608 64.763 1.00 39.36  ? 158 SER B N     1 
ATOM   3515  C  CA    . SER B 1 99  ? 17.745  51.332 63.533 1.00 39.36  ? 158 SER B CA    1 
ATOM   3516  C  C     . SER B 1 99  ? 19.104  51.970 63.451 1.00 39.36  ? 158 SER B C     1 
ATOM   3517  O  O     . SER B 1 99  ? 19.282  53.102 63.856 1.00 39.83  ? 158 SER B O     1 
ATOM   3518  C  CB    . SER B 1 99  ? 16.933  51.841 62.349 1.00 39.83  ? 158 SER B CB    1 
ATOM   3519  O  OG    . SER B 1 99  ? 16.673  53.238 62.464 1.00 39.83  ? 158 SER B OG    1 
ATOM   3520  H  H     . SER B 1 99  ? 16.900  52.541 65.042 1.00 0.00   ? 158 SER B H     1 
ATOM   3521  H  HG    . SER B 1 99  ? 17.516  53.695 62.510 1.00 30.00  ? 158 SER B HG    1 
ATOM   3522  N  N     . ILE B 1 100 ? 20.059  51.260 62.882 1.00 20.38  ? 159 ILE B N     1 
ATOM   3523  C  CA    . ILE B 1 100 ? 21.374  51.820 62.706 1.00 20.38  ? 159 ILE B CA    1 
ATOM   3524  C  C     . ILE B 1 100 ? 21.564  51.720 61.208 1.00 20.38  ? 159 ILE B C     1 
ATOM   3525  O  O     . ILE B 1 100 ? 21.876  50.652 60.719 1.00 31.18  ? 159 ILE B O     1 
ATOM   3526  C  CB    . ILE B 1 100 ? 22.468  50.993 63.391 1.00 31.18  ? 159 ILE B CB    1 
ATOM   3527  C  CG1   . ILE B 1 100 ? 22.253  50.917 64.893 1.00 31.18  ? 159 ILE B CG1   1 
ATOM   3528  C  CG2   . ILE B 1 100 ? 23.811  51.642 63.171 1.00 31.18  ? 159 ILE B CG2   1 
ATOM   3529  C  CD1   . ILE B 1 100 ? 23.396  50.174 65.626 1.00 31.18  ? 159 ILE B CD1   1 
ATOM   3530  H  H     . ILE B 1 100 ? 19.901  50.336 62.575 1.00 0.00   ? 159 ILE B H     1 
ATOM   3531  N  N     . ILE B 1 101 ? 21.307  52.799 60.471 1.00 31.32  ? 160 ILE B N     1 
ATOM   3532  C  CA    . ILE B 1 101 ? 21.464  52.782 59.013 1.00 31.32  ? 160 ILE B CA    1 
ATOM   3533  C  C     . ILE B 1 101 ? 22.502  53.796 58.444 1.00 31.32  ? 160 ILE B C     1 
ATOM   3534  O  O     . ILE B 1 101 ? 22.862  54.768 59.098 1.00 24.19  ? 160 ILE B O     1 
ATOM   3535  C  CB    . ILE B 1 101 ? 20.094  52.924 58.276 1.00 24.19  ? 160 ILE B CB    1 
ATOM   3536  C  CG1   . ILE B 1 101 ? 19.706  54.378 58.099 1.00 24.19  ? 160 ILE B CG1   1 
ATOM   3537  C  CG2   . ILE B 1 101 ? 19.010  52.192 59.009 1.00 24.19  ? 160 ILE B CG2   1 
ATOM   3538  C  CD1   . ILE B 1 101 ? 19.207  54.664 56.691 1.00 24.19  ? 160 ILE B CD1   1 
ATOM   3539  H  H     . ILE B 1 101 ? 21.054  53.639 60.899 1.00 0.00   ? 160 ILE B H     1 
ATOM   3540  N  N     . PHE B 1 102 ? 23.017  53.524 57.246 1.00 27.31  ? 161 PHE B N     1 
ATOM   3541  C  CA    . PHE B 1 102 ? 24.008  54.396 56.612 1.00 27.31  ? 161 PHE B CA    1 
ATOM   3542  C  C     . PHE B 1 102 ? 23.295  55.557 55.951 1.00 27.31  ? 161 PHE B C     1 
ATOM   3543  O  O     . PHE B 1 102 ? 22.104  55.446 55.603 1.00 21.62  ? 161 PHE B O     1 
ATOM   3544  C  CB    . PHE B 1 102 ? 24.836  53.652 55.536 1.00 21.62  ? 161 PHE B CB    1 
ATOM   3545  C  CG    . PHE B 1 102 ? 25.936  52.790 56.087 1.00 21.62  ? 161 PHE B CG    1 
ATOM   3546  C  CD1   . PHE B 1 102 ? 27.130  53.352 56.491 1.00 21.62  ? 161 PHE B CD1   1 
ATOM   3547  C  CD2   . PHE B 1 102 ? 25.791  51.407 56.150 1.00 21.62  ? 161 PHE B CD2   1 
ATOM   3548  C  CE1   . PHE B 1 102 ? 28.176  52.553 56.946 1.00 21.62  ? 161 PHE B CE1   1 
ATOM   3549  C  CE2   . PHE B 1 102 ? 26.829  50.597 56.601 1.00 21.62  ? 161 PHE B CE2   1 
ATOM   3550  C  CZ    . PHE B 1 102 ? 28.025  51.169 56.998 1.00 21.62  ? 161 PHE B CZ    1 
ATOM   3551  H  H     . PHE B 1 102 ? 22.688  52.726 56.788 1.00 0.00   ? 161 PHE B H     1 
ATOM   3552  N  N     . SER B 1 103 ? 24.044  56.640 55.732 1.00 20.18  ? 162 SER B N     1 
ATOM   3553  C  CA    . SER B 1 103 ? 23.512  57.837 55.109 1.00 20.18  ? 162 SER B CA    1 
ATOM   3554  C  C     . SER B 1 103 ? 23.536  57.707 53.598 1.00 20.18  ? 162 SER B C     1 
ATOM   3555  O  O     . SER B 1 103 ? 24.580  57.816 52.956 1.00 79.30  ? 162 SER B O     1 
ATOM   3556  C  CB    . SER B 1 103 ? 24.306  59.065 55.538 1.00 79.30  ? 162 SER B CB    1 
ATOM   3557  O  OG    . SER B 1 103 ? 23.691  60.236 55.030 1.00 79.30  ? 162 SER B OG    1 
ATOM   3558  H  H     . SER B 1 103 ? 24.981  56.644 56.001 1.00 0.00   ? 162 SER B H     1 
ATOM   3559  H  HG    . SER B 1 103 ? 24.213  60.959 55.401 1.00 30.00  ? 162 SER B HG    1 
ATOM   3560  N  N     . HIS B 1 104 ? 22.362  57.504 53.028 1.00 37.49  ? 163 HIS B N     1 
ATOM   3561  C  CA    . HIS B 1 104 ? 22.238  57.361 51.596 1.00 37.49  ? 163 HIS B CA    1 
ATOM   3562  C  C     . HIS B 1 104 ? 22.259  58.731 50.919 1.00 37.49  ? 163 HIS B C     1 
ATOM   3563  O  O     . HIS B 1 104 ? 22.611  58.835 49.749 1.00 49.53  ? 163 HIS B O     1 
ATOM   3564  C  CB    . HIS B 1 104 ? 20.957  56.608 51.264 1.00 49.53  ? 163 HIS B CB    1 
ATOM   3565  C  CG    . HIS B 1 104 ? 19.720  57.273 51.773 1.00 49.53  ? 163 HIS B CG    1 
ATOM   3566  N  ND1   . HIS B 1 104 ? 18.894  58.025 50.965 1.00 49.53  ? 163 HIS B ND1   1 
ATOM   3567  C  CD2   . HIS B 1 104 ? 19.158  57.289 53.004 1.00 49.53  ? 163 HIS B CD2   1 
ATOM   3568  C  CE1   . HIS B 1 104 ? 17.876  58.473 51.675 1.00 49.53  ? 163 HIS B CE1   1 
ATOM   3569  N  NE2   . HIS B 1 104 ? 18.013  58.040 52.916 1.00 49.53  ? 163 HIS B NE2   1 
ATOM   3570  H  H     . HIS B 1 104 ? 21.604  57.440 53.639 1.00 0.00   ? 163 HIS B H     1 
ATOM   3571  H  HD1   . HIS B 1 104 ? 19.019  58.192 49.998 1.00 0.00   ? 163 HIS B HD1   1 
ATOM   3572  H  HE2   . HIS B 1 104 ? 17.375  58.207 53.642 1.00 0.00   ? 163 HIS B HE2   1 
ATOM   3573  N  N     . GLU B 1 105 ? 21.903  59.786 51.647 1.00 34.39  ? 164 GLU B N     1 
ATOM   3574  C  CA    . GLU B 1 105 ? 21.912  61.125 51.057 1.00 34.39  ? 164 GLU B CA    1 
ATOM   3575  C  C     . GLU B 1 105 ? 23.335  61.419 50.642 1.00 34.39  ? 164 GLU B C     1 
ATOM   3576  O  O     . GLU B 1 105 ? 23.588  61.908 49.547 1.00 48.38  ? 164 GLU B O     1 
ATOM   3577  C  CB    . GLU B 1 105 ? 21.454  62.190 52.067 1.00 48.38  ? 164 GLU B CB    1 
ATOM   3578  C  CG    . GLU B 1 105 ? 19.964  62.184 52.439 1.00 48.38  ? 164 GLU B CG    1 
ATOM   3579  C  CD    . GLU B 1 105 ? 19.022  62.649 51.309 1.00 48.38  ? 164 GLU B CD    1 
ATOM   3580  O  OE1   . GLU B 1 105 ? 19.494  62.994 50.196 1.00 48.38  ? 164 GLU B OE1   1 
ATOM   3581  O  OE2   . GLU B 1 105 ? 17.787  62.659 51.542 1.00 48.38  ? 164 GLU B OE2   1 
ATOM   3582  H  H     . GLU B 1 105 ? 21.675  59.689 52.591 1.00 0.00   ? 164 GLU B H     1 
ATOM   3583  N  N     . ASP B 1 106 ? 24.266  61.083 51.526 1.00 23.81  ? 165 ASP B N     1 
ATOM   3584  C  CA    . ASP B 1 106 ? 25.678  61.307 51.262 1.00 23.81  ? 165 ASP B CA    1 
ATOM   3585  C  C     . ASP B 1 106 ? 26.179  60.348 50.211 1.00 23.81  ? 165 ASP B C     1 
ATOM   3586  O  O     . ASP B 1 106 ? 26.898  60.745 49.304 1.00 63.68  ? 165 ASP B O     1 
ATOM   3587  C  CB    . ASP B 1 106 ? 26.493  61.135 52.537 1.00 63.68  ? 165 ASP B CB    1 
ATOM   3588  C  CG    . ASP B 1 106 ? 26.076  62.099 53.629 1.00 63.68  ? 165 ASP B CG    1 
ATOM   3589  O  OD1   . ASP B 1 106 ? 25.310  63.046 53.335 1.00 63.68  ? 165 ASP B OD1   1 
ATOM   3590  O  OD2   . ASP B 1 106 ? 26.512  61.897 54.785 1.00 63.68  ? 165 ASP B OD2   1 
ATOM   3591  H  H     . ASP B 1 106 ? 24.005  60.691 52.383 1.00 0.00   ? 165 ASP B H     1 
ATOM   3592  N  N     . GLY B 1 107 ? 25.799  59.085 50.323 1.00 26.82  ? 166 GLY B N     1 
ATOM   3593  C  CA    . GLY B 1 107 ? 26.235  58.114 49.337 1.00 26.82  ? 166 GLY B CA    1 
ATOM   3594  C  C     . GLY B 1 107 ? 25.832  58.500 47.919 1.00 26.82  ? 166 GLY B C     1 
ATOM   3595  O  O     . GLY B 1 107 ? 26.637  58.483 46.977 1.00 48.23  ? 166 GLY B O     1 
ATOM   3596  H  H     . GLY B 1 107 ? 25.250  58.792 51.078 1.00 0.00   ? 166 GLY B H     1 
ATOM   3597  N  N     . THR B 1 108 ? 24.579  58.879 47.769 1.00 19.07  ? 167 THR B N     1 
ATOM   3598  C  CA    . THR B 1 108 ? 24.072  59.253 46.476 1.00 19.07  ? 167 THR B CA    1 
ATOM   3599  C  C     . THR B 1 108 ? 24.700  60.573 45.984 1.00 19.07  ? 167 THR B C     1 
ATOM   3600  O  O     . THR B 1 108 ? 25.014  60.727 44.787 1.00 25.58  ? 167 THR B O     1 
ATOM   3601  C  CB    . THR B 1 108 ? 22.559  59.371 46.556 1.00 25.58  ? 167 THR B CB    1 
ATOM   3602  O  OG1   . THR B 1 108 ? 22.218  60.254 47.634 1.00 25.58  ? 167 THR B OG1   1 
ATOM   3603  C  CG2   . THR B 1 108 ? 21.942  58.007 46.816 1.00 25.58  ? 167 THR B CG2   1 
ATOM   3604  H  H     . THR B 1 108 ? 23.975  58.915 48.533 1.00 0.00   ? 167 THR B H     1 
ATOM   3605  H  HG1   . THR B 1 108 ? 22.428  61.169 47.420 1.00 30.00  ? 167 THR B HG1   1 
ATOM   3606  N  N     . ARG B 1 109 ? 24.909  61.511 46.912 1.00 34.33  ? 168 ARG B N     1 
ATOM   3607  C  CA    . ARG B 1 109 ? 25.489  62.812 46.590 1.00 34.33  ? 168 ARG B CA    1 
ATOM   3608  C  C     . ARG B 1 109 ? 26.951  62.762 46.157 1.00 34.33  ? 168 ARG B C     1 
ATOM   3609  O  O     . ARG B 1 109 ? 27.325  63.395 45.175 1.00 41.49  ? 168 ARG B O     1 
ATOM   3610  C  CB    . ARG B 1 109 ? 25.339  63.757 47.769 1.00 41.49  ? 168 ARG B CB    1 
ATOM   3611  C  CG    . ARG B 1 109 ? 26.160  65.008 47.634 1.00 41.49  ? 168 ARG B CG    1 
ATOM   3612  C  CD    . ARG B 1 109 ? 25.849  65.970 48.744 1.00 41.49  ? 168 ARG B CD    1 
ATOM   3613  N  NE    . ARG B 1 109 ? 26.138  65.429 50.067 1.00 41.49  ? 168 ARG B NE    1 
ATOM   3614  C  CZ    . ARG B 1 109 ? 27.363  65.289 50.561 1.00 41.49  ? 168 ARG B CZ    1 
ATOM   3615  N  NH1   . ARG B 1 109 ? 28.419  65.640 49.840 1.00 41.49  ? 168 ARG B NH1   1 
ATOM   3616  N  NH2   . ARG B 1 109 ? 27.530  64.837 51.793 1.00 41.49  ? 168 ARG B NH2   1 
ATOM   3617  H  H     . ARG B 1 109 ? 24.661  61.322 47.845 1.00 0.00   ? 168 ARG B H     1 
ATOM   3618  H  HE    . ARG B 1 109 ? 25.383  65.161 50.630 1.00 0.00   ? 168 ARG B HE    1 
ATOM   3619  H  HH11  . ARG B 1 109 ? 28.308  66.006 48.917 1.00 0.00   ? 168 ARG B HH11  1 
ATOM   3620  H  HH12  . ARG B 1 109 ? 29.337  65.527 50.221 1.00 0.00   ? 168 ARG B HH12  1 
ATOM   3621  H  HH21  . ARG B 1 109 ? 26.736  64.600 52.354 1.00 0.00   ? 168 ARG B HH21  1 
ATOM   3622  H  HH22  . ARG B 1 109 ? 28.453  64.734 52.163 1.00 0.00   ? 168 ARG B HH22  1 
ATOM   3623  N  N     . LEU B 1 110 ? 27.774  62.037 46.914 1.00 16.68  ? 169 LEU B N     1 
ATOM   3624  C  CA    . LEU B 1 110 ? 29.202  61.890 46.634 1.00 16.68  ? 169 LEU B CA    1 
ATOM   3625  C  C     . LEU B 1 110 ? 29.368  61.207 45.291 1.00 16.68  ? 169 LEU B C     1 
ATOM   3626  O  O     . LEU B 1 110 ? 30.288  61.490 44.535 1.00 24.31  ? 169 LEU B O     1 
ATOM   3627  C  CB    . LEU B 1 110 ? 29.843  61.031 47.705 1.00 24.31  ? 169 LEU B CB    1 
ATOM   3628  C  CG    . LEU B 1 110 ? 29.588  61.463 49.143 1.00 24.31  ? 169 LEU B CG    1 
ATOM   3629  C  CD1   . LEU B 1 110 ? 30.120  60.421 50.109 1.00 24.31  ? 169 LEU B CD1   1 
ATOM   3630  C  CD2   . LEU B 1 110 ? 30.220  62.795 49.419 1.00 24.31  ? 169 LEU B CD2   1 
ATOM   3631  H  H     . LEU B 1 110 ? 27.398  61.574 47.688 1.00 0.00   ? 169 LEU B H     1 
ATOM   3632  N  N     . GLY B 1 111 ? 28.470  60.284 45.005 1.00 21.51  ? 170 GLY B N     1 
ATOM   3633  C  CA    . GLY B 1 111 ? 28.529  59.595 43.736 1.00 21.51  ? 170 GLY B CA    1 
ATOM   3634  C  C     . GLY B 1 111 ? 28.186  60.549 42.615 1.00 21.51  ? 170 GLY B C     1 
ATOM   3635  O  O     . GLY B 1 111 ? 29.039  60.831 41.773 1.00 51.98  ? 170 GLY B O     1 
ATOM   3636  H  H     . GLY B 1 111 ? 27.782  60.050 45.663 1.00 0.00   ? 170 GLY B H     1 
ATOM   3637  N  N     . VAL B 1 112 ? 26.977  61.115 42.659 1.00 31.41  ? 171 VAL B N     1 
ATOM   3638  C  CA    . VAL B 1 112 ? 26.511  62.036 41.629 1.00 31.41  ? 171 VAL B CA    1 
ATOM   3639  C  C     . VAL B 1 112 ? 27.421  63.233 41.441 1.00 31.41  ? 171 VAL B C     1 
ATOM   3640  O  O     . VAL B 1 112 ? 27.758  63.571 40.305 1.00 47.81  ? 171 VAL B O     1 
ATOM   3641  C  CB    . VAL B 1 112 ? 25.073  62.528 41.894 1.00 47.81  ? 171 VAL B CB    1 
ATOM   3642  C  CG1   . VAL B 1 112 ? 24.713  63.652 40.925 1.00 47.81  ? 171 VAL B CG1   1 
ATOM   3643  C  CG2   . VAL B 1 112 ? 24.087  61.374 41.730 1.00 47.81  ? 171 VAL B CG2   1 
ATOM   3644  H  H     . VAL B 1 112 ? 26.385  60.919 43.412 1.00 0.00   ? 171 VAL B H     1 
ATOM   3645  N  N     . GLU B 1 113 ? 27.842  63.851 42.542 1.00 19.26  ? 172 GLU B N     1 
ATOM   3646  C  CA    . GLU B 1 113 ? 28.731  65.032 42.487 1.00 19.26  ? 172 GLU B CA    1 
ATOM   3647  C  C     . GLU B 1 113 ? 30.086  64.712 41.854 1.00 19.26  ? 172 GLU B C     1 
ATOM   3648  O  O     . GLU B 1 113 ? 30.649  65.517 41.112 1.00 48.40  ? 172 GLU B O     1 
ATOM   3649  C  CB    . GLU B 1 113 ? 28.918  65.647 43.874 1.00 48.40  ? 172 GLU B CB    1 
ATOM   3650  C  CG    . GLU B 1 113 ? 27.651  66.298 44.412 1.00 48.40  ? 172 GLU B CG    1 
ATOM   3651  C  CD    . GLU B 1 113 ? 27.858  67.054 45.707 1.00 48.40  ? 172 GLU B CD    1 
ATOM   3652  O  OE1   . GLU B 1 113 ? 28.804  66.725 46.460 1.00 48.40  ? 172 GLU B OE1   1 
ATOM   3653  O  OE2   . GLU B 1 113 ? 27.053  67.977 45.972 1.00 48.40  ? 172 GLU B OE2   1 
ATOM   3654  H  H     . GLU B 1 113 ? 27.549  63.500 43.395 1.00 0.00   ? 172 GLU B H     1 
ATOM   3655  N  N     . HIS B 1 114 ? 30.553  63.490 42.079 1.00 23.51  ? 173 HIS B N     1 
ATOM   3656  C  CA    . HIS B 1 114 ? 31.814  63.046 41.526 1.00 23.51  ? 173 HIS B CA    1 
ATOM   3657  C  C     . HIS B 1 114 ? 31.722  62.962 40.018 1.00 23.51  ? 173 HIS B C     1 
ATOM   3658  O  O     . HIS B 1 114 ? 32.508  63.579 39.308 1.00 31.91  ? 173 HIS B O     1 
ATOM   3659  C  CB    . HIS B 1 114 ? 32.184  61.675 42.081 1.00 31.91  ? 173 HIS B CB    1 
ATOM   3660  C  CG    . HIS B 1 114 ? 33.554  61.229 41.694 1.00 31.91  ? 173 HIS B CG    1 
ATOM   3661  N  ND1   . HIS B 1 114 ? 33.830  59.946 41.286 1.00 31.91  ? 173 HIS B ND1   1 
ATOM   3662  C  CD2   . HIS B 1 114 ? 34.731  61.895 41.669 1.00 31.91  ? 173 HIS B CD2   1 
ATOM   3663  C  CE1   . HIS B 1 114 ? 35.120  59.833 41.030 1.00 31.91  ? 173 HIS B CE1   1 
ATOM   3664  N  NE2   . HIS B 1 114 ? 35.690  61.003 41.253 1.00 31.91  ? 173 HIS B NE2   1 
ATOM   3665  H  H     . HIS B 1 114 ? 30.025  62.871 42.630 1.00 0.00   ? 173 HIS B H     1 
ATOM   3666  H  HD1   . HIS B 1 114 ? 33.184  59.208 41.214 1.00 0.00   ? 173 HIS B HD1   1 
ATOM   3667  H  HE2   . HIS B 1 114 ? 36.643  61.195 41.120 1.00 0.00   ? 173 HIS B HE2   1 
ATOM   3668  N  N     . LEU B 1 115 ? 30.749  62.197 39.541 1.00 18.58  ? 174 LEU B N     1 
ATOM   3669  C  CA    . LEU B 1 115 ? 30.534  61.999 38.127 1.00 18.58  ? 174 LEU B CA    1 
ATOM   3670  C  C     . LEU B 1 115 ? 30.242  63.300 37.414 1.00 18.58  ? 174 LEU B C     1 
ATOM   3671  O  O     . LEU B 1 115 ? 30.619  63.461 36.241 1.00 26.48  ? 174 LEU B O     1 
ATOM   3672  C  CB    . LEU B 1 115 ? 29.386  61.022 37.891 1.00 26.48  ? 174 LEU B CB    1 
ATOM   3673  C  CG    . LEU B 1 115 ? 29.655  59.572 38.269 1.00 26.48  ? 174 LEU B CG    1 
ATOM   3674  C  CD1   . LEU B 1 115 ? 28.444  58.712 37.945 1.00 26.48  ? 174 LEU B CD1   1 
ATOM   3675  C  CD2   . LEU B 1 115 ? 30.869  59.088 37.510 1.00 26.48  ? 174 LEU B CD2   1 
ATOM   3676  H  H     . LEU B 1 115 ? 30.122  61.774 40.170 1.00 0.00   ? 174 LEU B H     1 
ATOM   3677  N  N     . VAL B 1 116 ? 29.563  64.234 38.073 1.00 37.51  ? 175 VAL B N     1 
ATOM   3678  C  CA    . VAL B 1 116 ? 29.269  65.491 37.387 1.00 37.51  ? 175 VAL B CA    1 
ATOM   3679  C  C     . VAL B 1 116 ? 30.492  66.388 37.316 1.00 37.51  ? 175 VAL B C     1 
ATOM   3680  O  O     . VAL B 1 116 ? 30.662  67.127 36.358 1.00 41.42  ? 175 VAL B O     1 
ATOM   3681  C  CB    . VAL B 1 116 ? 28.088  66.243 37.997 1.00 41.42  ? 175 VAL B CB    1 
ATOM   3682  C  CG1   . VAL B 1 116 ? 26.908  65.322 38.119 1.00 41.42  ? 175 VAL B CG1   1 
ATOM   3683  C  CG2   . VAL B 1 116 ? 28.463  66.834 39.323 1.00 41.42  ? 175 VAL B CG2   1 
ATOM   3684  H  H     . VAL B 1 116 ? 29.227  64.080 38.980 1.00 0.00   ? 175 VAL B H     1 
ATOM   3685  N  N     . ALA B 1 117 ? 31.378  66.262 38.293 1.00 45.31  ? 176 ALA B N     1 
ATOM   3686  C  CA    . ALA B 1 117 ? 32.582  67.070 38.321 1.00 45.31  ? 176 ALA B CA    1 
ATOM   3687  C  C     . ALA B 1 117 ? 33.559  66.707 37.189 1.00 45.31  ? 176 ALA B C     1 
ATOM   3688  O  O     . ALA B 1 117 ? 34.255  67.576 36.646 1.00 55.12  ? 176 ALA B O     1 
ATOM   3689  C  CB    . ALA B 1 117 ? 33.251  66.939 39.660 1.00 55.12  ? 176 ALA B CB    1 
ATOM   3690  H  H     . ALA B 1 117 ? 31.219  65.631 39.026 1.00 0.00   ? 176 ALA B H     1 
ATOM   3691  N  N     . LEU B 1 118 ? 33.618  65.432 36.828 1.00 25.77  ? 177 LEU B N     1 
ATOM   3692  C  CA    . LEU B 1 118 ? 34.522  65.013 35.770 1.00 25.77  ? 177 LEU B CA    1 
ATOM   3693  C  C     . LEU B 1 118 ? 34.044  65.516 34.435 1.00 25.77  ? 177 LEU B C     1 
ATOM   3694  O  O     . LEU B 1 118 ? 34.778  65.471 33.454 1.00 39.56  ? 177 LEU B O     1 
ATOM   3695  C  CB    . LEU B 1 118 ? 34.583  63.506 35.677 1.00 39.56  ? 177 LEU B CB    1 
ATOM   3696  C  CG    . LEU B 1 118 ? 34.970  62.730 36.912 1.00 39.56  ? 177 LEU B CG    1 
ATOM   3697  C  CD1   . LEU B 1 118 ? 34.786  61.287 36.563 1.00 39.56  ? 177 LEU B CD1   1 
ATOM   3698  C  CD2   . LEU B 1 118 ? 36.393  63.034 37.339 1.00 39.56  ? 177 LEU B CD2   1 
ATOM   3699  H  H     . LEU B 1 118 ? 33.057  64.781 37.298 1.00 0.00   ? 177 LEU B H     1 
ATOM   3700  N  N     . GLY B 1 119 ? 32.780  65.911 34.382 1.00 31.85  ? 178 GLY B N     1 
ATOM   3701  C  CA    . GLY B 1 119 ? 32.206  66.396 33.139 1.00 31.85  ? 178 GLY B CA    1 
ATOM   3702  C  C     . GLY B 1 119 ? 31.239  65.426 32.481 1.00 31.85  ? 178 GLY B C     1 
ATOM   3703  O  O     . GLY B 1 119 ? 30.989  65.523 31.285 1.00 40.85  ? 178 GLY B O     1 
ATOM   3704  H  H     . GLY B 1 119 ? 32.210  65.914 35.177 1.00 0.00   ? 178 GLY B H     1 
ATOM   3705  N  N     . HIS B 1 120 ? 30.733  64.461 33.245 1.00 29.07  ? 179 HIS B N     1 
ATOM   3706  C  CA    . HIS B 1 120 ? 29.794  63.493 32.719 1.00 29.07  ? 179 HIS B CA    1 
ATOM   3707  C  C     . HIS B 1 120 ? 28.452  64.161 32.635 1.00 29.07  ? 179 HIS B C     1 
ATOM   3708  O  O     . HIS B 1 120 ? 28.081  64.951 33.506 1.00 27.90  ? 179 HIS B O     1 
ATOM   3709  C  CB    . HIS B 1 120 ? 29.718  62.278 33.619 1.00 27.90  ? 179 HIS B CB    1 
ATOM   3710  C  CG    . HIS B 1 120 ? 30.944  61.440 33.575 1.00 27.90  ? 179 HIS B CG    1 
ATOM   3711  N  ND1   . HIS B 1 120 ? 31.332  60.760 32.440 1.00 27.90  ? 179 HIS B ND1   1 
ATOM   3712  C  CD2   . HIS B 1 120 ? 31.894  61.198 34.505 1.00 27.90  ? 179 HIS B CD2   1 
ATOM   3713  C  CE1   . HIS B 1 120 ? 32.472  60.133 32.673 1.00 27.90  ? 179 HIS B CE1   1 
ATOM   3714  N  NE2   . HIS B 1 120 ? 32.835  60.382 33.919 1.00 27.90  ? 179 HIS B NE2   1 
ATOM   3715  H  H     . HIS B 1 120 ? 30.954  64.446 34.197 1.00 0.00   ? 179 HIS B H     1 
ATOM   3716  H  HD1   . HIS B 1 120 ? 30.839  60.759 31.592 1.00 0.00   ? 179 HIS B HD1   1 
ATOM   3717  H  HE2   . HIS B 1 120 ? 33.680  60.045 34.307 1.00 0.00   ? 179 HIS B HE2   1 
ATOM   3718  N  N     . GLN B 1 121 ? 27.744  63.847 31.563 1.00 29.15  ? 180 GLN B N     1 
ATOM   3719  C  CA    . GLN B 1 121 ? 26.438  64.408 31.287 1.00 29.15  ? 180 GLN B CA    1 
ATOM   3720  C  C     . GLN B 1 121 ? 25.476  63.244 31.079 1.00 29.15  ? 180 GLN B C     1 
ATOM   3721  O  O     . GLN B 1 121 ? 24.338  63.272 31.533 1.00 114.96 ? 180 GLN B O     1 
ATOM   3722  C  CB    . GLN B 1 121 ? 26.503  65.247 30.001 1.00 114.96 ? 180 GLN B CB    1 
ATOM   3723  C  CG    . GLN B 1 121 ? 27.858  65.949 29.714 1.00 114.96 ? 180 GLN B CG    1 
ATOM   3724  C  CD    . GLN B 1 121 ? 28.950  65.034 29.091 1.00 114.96 ? 180 GLN B CD    1 
ATOM   3725  O  OE1   . GLN B 1 121 ? 28.923  63.794 29.227 1.00 114.96 ? 180 GLN B OE1   1 
ATOM   3726  N  NE2   . GLN B 1 121 ? 29.921  65.657 28.423 1.00 114.96 ? 180 GLN B NE2   1 
ATOM   3727  H  H     . GLN B 1 121 ? 28.150  63.231 30.923 1.00 0.00   ? 180 GLN B H     1 
ATOM   3728  N  N     . GLN B 1 122 ? 25.947  62.227 30.362 1.00 31.46  ? 181 GLN B N     1 
ATOM   3729  C  CA    . GLN B 1 122 ? 25.160  61.036 30.068 1.00 31.46  ? 181 GLN B CA    1 
ATOM   3730  C  C     . GLN B 1 122 ? 25.454  59.983 31.108 1.00 31.46  ? 181 GLN B C     1 
ATOM   3731  O  O     . GLN B 1 122 ? 26.415  59.226 30.994 1.00 79.28  ? 181 GLN B O     1 
ATOM   3732  C  CB    . GLN B 1 122 ? 25.517  60.483 28.700 1.00 79.28  ? 181 GLN B CB    1 
ATOM   3733  C  CG    . GLN B 1 122 ? 25.314  61.424 27.548 1.00 79.28  ? 181 GLN B CG    1 
ATOM   3734  C  CD    . GLN B 1 122 ? 25.804  60.796 26.269 1.00 79.28  ? 181 GLN B CD    1 
ATOM   3735  O  OE1   . GLN B 1 122 ? 25.243  59.800 25.801 1.00 79.28  ? 181 GLN B OE1   1 
ATOM   3736  N  NE2   . GLN B 1 122 ? 26.893  61.330 25.725 1.00 79.28  ? 181 GLN B NE2   1 
ATOM   3737  H  H     . GLN B 1 122 ? 26.857  62.310 30.014 1.00 0.00   ? 181 GLN B H     1 
ATOM   3738  N  N     . ILE B 1 123 ? 24.625  59.946 32.131 1.00 54.76  ? 182 ILE B N     1 
ATOM   3739  C  CA    . ILE B 1 123 ? 24.814  59.003 33.209 1.00 54.76  ? 182 ILE B CA    1 
ATOM   3740  C  C     . ILE B 1 123 ? 23.622  58.050 33.256 1.00 54.76  ? 182 ILE B C     1 
ATOM   3741  O  O     . ILE B 1 123 ? 22.459  58.493 33.222 1.00 35.96  ? 182 ILE B O     1 
ATOM   3742  C  CB    . ILE B 1 123 ? 24.931  59.764 34.573 1.00 35.96  ? 182 ILE B CB    1 
ATOM   3743  C  CG1   . ILE B 1 123 ? 26.170  60.661 34.582 1.00 35.96  ? 182 ILE B CG1   1 
ATOM   3744  C  CG2   . ILE B 1 123 ? 24.988  58.794 35.731 1.00 35.96  ? 182 ILE B CG2   1 
ATOM   3745  C  CD1   . ILE B 1 123 ? 26.027  61.910 35.452 1.00 35.96  ? 182 ILE B CD1   1 
ATOM   3746  H  H     . ILE B 1 123 ? 23.866  60.568 32.181 1.00 0.00   ? 182 ILE B H     1 
ATOM   3747  N  N     . ALA B 1 124 ? 23.910  56.750 33.264 1.00 27.01  ? 183 ALA B N     1 
ATOM   3748  C  CA    . ALA B 1 124 ? 22.867  55.724 33.368 1.00 27.01  ? 183 ALA B CA    1 
ATOM   3749  C  C     . ALA B 1 124 ? 22.933  55.143 34.800 1.00 27.01  ? 183 ALA B C     1 
ATOM   3750  O  O     . ALA B 1 124 ? 24.001  55.151 35.444 1.00 36.54  ? 183 ALA B O     1 
ATOM   3751  C  CB    . ALA B 1 124 ? 23.077  54.627 32.324 1.00 36.54  ? 183 ALA B CB    1 
ATOM   3752  H  H     . ALA B 1 124 ? 24.847  56.456 33.250 1.00 0.00   ? 183 ALA B H     1 
ATOM   3753  N  N     . LEU B 1 125 ? 21.790  54.687 35.307 1.00 35.21  ? 184 LEU B N     1 
ATOM   3754  C  CA    . LEU B 1 125 ? 21.708  54.129 36.656 1.00 35.21  ? 184 LEU B CA    1 
ATOM   3755  C  C     . LEU B 1 125 ? 21.485  52.615 36.579 1.00 35.21  ? 184 LEU B C     1 
ATOM   3756  O  O     . LEU B 1 125 ? 20.961  52.112 35.584 1.00 24.88  ? 184 LEU B O     1 
ATOM   3757  C  CB    . LEU B 1 125 ? 20.538  54.774 37.414 1.00 24.88  ? 184 LEU B CB    1 
ATOM   3758  C  CG    . LEU B 1 125 ? 20.344  56.288 37.334 1.00 24.88  ? 184 LEU B CG    1 
ATOM   3759  C  CD1   . LEU B 1 125 ? 19.153  56.713 38.144 1.00 24.88  ? 184 LEU B CD1   1 
ATOM   3760  C  CD2   . LEU B 1 125 ? 21.579  56.999 37.828 1.00 24.88  ? 184 LEU B CD2   1 
ATOM   3761  H  H     . LEU B 1 125 ? 20.975  54.714 34.762 1.00 0.00   ? 184 LEU B H     1 
ATOM   3762  N  N     . LEU B 1 126 ? 21.912  51.896 37.610 1.00 16.03  ? 185 LEU B N     1 
ATOM   3763  C  CA    . LEU B 1 126 ? 21.723  50.450 37.704 1.00 16.03  ? 185 LEU B CA    1 
ATOM   3764  C  C     . LEU B 1 126 ? 21.303  50.188 39.158 1.00 16.03  ? 185 LEU B C     1 
ATOM   3765  O  O     . LEU B 1 126 ? 22.113  49.809 40.012 1.00 16.67  ? 185 LEU B O     1 
ATOM   3766  C  CB    . LEU B 1 126 ? 23.012  49.706 37.324 1.00 16.67  ? 185 LEU B CB    1 
ATOM   3767  C  CG    . LEU B 1 126 ? 23.055  48.179 37.422 1.00 16.67  ? 185 LEU B CG    1 
ATOM   3768  C  CD1   . LEU B 1 126 ? 21.865  47.537 36.759 1.00 16.67  ? 185 LEU B CD1   1 
ATOM   3769  C  CD2   . LEU B 1 126 ? 24.303  47.686 36.787 1.00 16.67  ? 185 LEU B CD2   1 
ATOM   3770  H  H     . LEU B 1 126 ? 22.397  52.350 38.333 1.00 0.00   ? 185 LEU B H     1 
ATOM   3771  N  N     . ALA B 1 127 ? 20.041  50.480 39.448 1.00 27.72  ? 186 ALA B N     1 
ATOM   3772  C  CA    . ALA B 1 127 ? 19.491  50.330 40.787 1.00 27.72  ? 186 ALA B CA    1 
ATOM   3773  C  C     . ALA B 1 127 ? 19.461  48.905 41.314 1.00 27.72  ? 186 ALA B C     1 
ATOM   3774  O  O     . ALA B 1 127 ? 19.619  47.943 40.561 1.00 46.27  ? 186 ALA B O     1 
ATOM   3775  C  CB    . ALA B 1 127 ? 18.096  50.912 40.832 1.00 46.27  ? 186 ALA B CB    1 
ATOM   3776  H  H     . ALA B 1 127 ? 19.456  50.772 38.719 1.00 0.00   ? 186 ALA B H     1 
ATOM   3777  N  N     . GLY B 1 128 ? 19.311  48.764 42.628 1.00 2.00   ? 187 GLY B N     1 
ATOM   3778  C  CA    . GLY B 1 128 ? 19.217  47.418 43.160 1.00 2.00   ? 187 GLY B CA    1 
ATOM   3779  C  C     . GLY B 1 128 ? 17.752  47.035 42.958 1.00 2.00   ? 187 GLY B C     1 
ATOM   3780  O  O     . GLY B 1 128 ? 16.982  47.822 42.382 1.00 12.51  ? 187 GLY B O     1 
ATOM   3781  H  H     . GLY B 1 128 ? 19.226  49.546 43.207 1.00 0.00   ? 187 GLY B H     1 
ATOM   3782  N  N     . PRO B 1 129 ? 17.313  45.871 43.462 1.00 21.77  ? 188 PRO B N     1 
ATOM   3783  C  CA    . PRO B 1 129 ? 15.914  45.471 43.291 1.00 21.77  ? 188 PRO B CA    1 
ATOM   3784  C  C     . PRO B 1 129 ? 14.981  46.434 44.013 1.00 21.77  ? 188 PRO B C     1 
ATOM   3785  O  O     . PRO B 1 129 ? 15.077  46.587 45.222 1.00 31.82  ? 188 PRO B O     1 
ATOM   3786  C  CB    . PRO B 1 129 ? 15.884  44.069 43.920 1.00 31.82  ? 188 PRO B CB    1 
ATOM   3787  C  CG    . PRO B 1 129 ? 16.933  44.156 44.980 1.00 31.82  ? 188 PRO B CG    1 
ATOM   3788  C  CD    . PRO B 1 129 ? 18.054  44.863 44.240 1.00 31.82  ? 188 PRO B CD    1 
ATOM   3789  N  N     . LEU B 1 130 ? 14.048  47.036 43.288 1.00 27.21  ? 189 LEU B N     1 
ATOM   3790  C  CA    . LEU B 1 130 ? 13.106  47.996 43.865 1.00 27.21  ? 189 LEU B CA    1 
ATOM   3791  C  C     . LEU B 1 130 ? 12.235  47.496 45.033 1.00 27.21  ? 189 LEU B C     1 
ATOM   3792  O  O     . LEU B 1 130 ? 11.506  48.262 45.654 1.00 42.37  ? 189 LEU B O     1 
ATOM   3793  C  CB    . LEU B 1 130 ? 12.237  48.591 42.749 1.00 42.37  ? 189 LEU B CB    1 
ATOM   3794  C  CG    . LEU B 1 130 ? 12.822  49.778 41.963 1.00 42.37  ? 189 LEU B CG    1 
ATOM   3795  C  CD1   . LEU B 1 130 ? 12.818  51.010 42.849 1.00 42.37  ? 189 LEU B CD1   1 
ATOM   3796  C  CD2   . LEU B 1 130 ? 14.228  49.511 41.458 1.00 42.37  ? 189 LEU B CD2   1 
ATOM   3797  H  H     . LEU B 1 130 ? 14.016  46.863 42.334 1.00 0.00   ? 189 LEU B H     1 
ATOM   3798  N  N     . SER B 1 131 ? 12.292  46.205 45.317 1.00 28.07  ? 190 SER B N     1 
ATOM   3799  C  CA    . SER B 1 131 ? 11.534  45.646 46.424 1.00 28.07  ? 190 SER B CA    1 
ATOM   3800  C  C     . SER B 1 131 ? 12.302  45.938 47.705 1.00 28.07  ? 190 SER B C     1 
ATOM   3801  O  O     . SER B 1 131 ? 11.828  45.660 48.807 1.00 58.32  ? 190 SER B O     1 
ATOM   3802  C  CB    . SER B 1 131 ? 11.389  44.133 46.243 1.00 58.32  ? 190 SER B CB    1 
ATOM   3803  O  OG    . SER B 1 131 ? 12.645  43.499 46.051 1.00 58.32  ? 190 SER B OG    1 
ATOM   3804  H  H     . SER B 1 131 ? 12.858  45.595 44.813 1.00 0.00   ? 190 SER B H     1 
ATOM   3805  H  HG    . SER B 1 131 ? 12.493  42.548 46.008 1.00 30.00  ? 190 SER B HG    1 
ATOM   3806  N  N     . SER B 1 132 ? 13.491  46.519 47.545 1.00 22.68  ? 191 SER B N     1 
ATOM   3807  C  CA    . SER B 1 132 ? 14.385  46.856 48.646 1.00 22.68  ? 191 SER B CA    1 
ATOM   3808  C  C     . SER B 1 132 ? 14.234  48.322 49.020 1.00 22.68  ? 191 SER B C     1 
ATOM   3809  O  O     . SER B 1 132 ? 14.145  49.187 48.163 1.00 27.37  ? 191 SER B O     1 
ATOM   3810  C  CB    . SER B 1 132 ? 15.836  46.552 48.228 1.00 27.37  ? 191 SER B CB    1 
ATOM   3811  O  OG    . SER B 1 132 ? 16.781  46.974 49.188 1.00 27.37  ? 191 SER B OG    1 
ATOM   3812  H  H     . SER B 1 132 ? 13.809  46.755 46.656 1.00 0.00   ? 191 SER B H     1 
ATOM   3813  H  HG    . SER B 1 132 ? 17.584  46.457 49.036 1.00 30.00  ? 191 SER B HG    1 
ATOM   3814  N  N     . VAL B 1 133 ? 14.246  48.593 50.315 1.00 35.86  ? 192 VAL B N     1 
ATOM   3815  C  CA    . VAL B 1 133 ? 14.125  49.951 50.811 1.00 35.86  ? 192 VAL B CA    1 
ATOM   3816  C  C     . VAL B 1 133 ? 15.380  50.700 50.411 1.00 35.86  ? 192 VAL B C     1 
ATOM   3817  O  O     . VAL B 1 133 ? 15.302  51.790 49.843 1.00 27.98  ? 192 VAL B O     1 
ATOM   3818  C  CB    . VAL B 1 133 ? 14.053  49.992 52.340 1.00 27.98  ? 192 VAL B CB    1 
ATOM   3819  C  CG1   . VAL B 1 133 ? 13.434  51.299 52.795 1.00 27.98  ? 192 VAL B CG1   1 
ATOM   3820  C  CG2   . VAL B 1 133 ? 13.311  48.800 52.870 1.00 27.98  ? 192 VAL B CG2   1 
ATOM   3821  H  H     . VAL B 1 133 ? 14.344  47.831 50.916 1.00 0.00   ? 192 VAL B H     1 
ATOM   3822  N  N     . SER B 1 134 ? 16.533  50.092 50.716 1.00 15.26  ? 193 SER B N     1 
ATOM   3823  C  CA    . SER B 1 134 ? 17.842  50.672 50.430 1.00 15.26  ? 193 SER B CA    1 
ATOM   3824  C  C     . SER B 1 134 ? 18.062  50.867 48.932 1.00 15.26  ? 193 SER B C     1 
ATOM   3825  O  O     . SER B 1 134 ? 18.518  51.931 48.511 1.00 33.96  ? 193 SER B O     1 
ATOM   3826  C  CB    . SER B 1 134 ? 18.901  49.821 51.063 1.00 33.96  ? 193 SER B CB    1 
ATOM   3827  O  OG    . SER B 1 134 ? 18.546  49.653 52.415 1.00 33.96  ? 193 SER B OG    1 
ATOM   3828  H  H     . SER B 1 134 ? 16.535  49.229 51.180 1.00 0.00   ? 193 SER B H     1 
ATOM   3829  H  HG    . SER B 1 134 ? 18.552  50.486 52.900 1.00 30.00  ? 193 SER B HG    1 
ATOM   3830  N  N     . ALA B 1 135 ? 17.634  49.897 48.124 1.00 14.49  ? 194 ALA B N     1 
ATOM   3831  C  CA    . ALA B 1 135 ? 17.756  50.025 46.677 1.00 14.49  ? 194 ALA B CA    1 
ATOM   3832  C  C     . ALA B 1 135 ? 16.951  51.252 46.300 1.00 14.49  ? 194 ALA B C     1 
ATOM   3833  O  O     . ALA B 1 135 ? 17.432  52.097 45.543 1.00 53.36  ? 194 ALA B O     1 
ATOM   3834  C  CB    . ALA B 1 135 ? 17.190  48.817 45.985 1.00 53.36  ? 194 ALA B CB    1 
ATOM   3835  H  H     . ALA B 1 135 ? 17.220  49.097 48.508 1.00 0.00   ? 194 ALA B H     1 
ATOM   3836  N  N     . ARG B 1 136 ? 15.761  51.391 46.894 1.00 17.01  ? 195 ARG B N     1 
ATOM   3837  C  CA    . ARG B 1 136 ? 14.872  52.536 46.616 1.00 17.01  ? 195 ARG B CA    1 
ATOM   3838  C  C     . ARG B 1 136 ? 15.339  53.886 47.157 1.00 17.01  ? 195 ARG B C     1 
ATOM   3839  O  O     . ARG B 1 136 ? 15.042  54.916 46.577 1.00 29.13  ? 195 ARG B O     1 
ATOM   3840  C  CB    . ARG B 1 136 ? 13.440  52.253 47.092 1.00 29.13  ? 195 ARG B CB    1 
ATOM   3841  C  CG    . ARG B 1 136 ? 12.730  51.151 46.297 1.00 29.13  ? 195 ARG B CG    1 
ATOM   3842  C  CD    . ARG B 1 136 ? 11.227  51.176 46.472 1.00 29.13  ? 195 ARG B CD    1 
ATOM   3843  N  NE    . ARG B 1 136 ? 10.816  51.211 47.876 1.00 29.13  ? 195 ARG B NE    1 
ATOM   3844  C  CZ    . ARG B 1 136 ? 10.864  50.178 48.710 1.00 29.13  ? 195 ARG B CZ    1 
ATOM   3845  N  NH1   . ARG B 1 136 ? 11.313  49.004 48.293 1.00 29.13  ? 195 ARG B NH1   1 
ATOM   3846  N  NH2   . ARG B 1 136 ? 10.482  50.325 49.971 1.00 29.13  ? 195 ARG B NH2   1 
ATOM   3847  H  H     . ARG B 1 136 ? 15.428  50.712 47.515 1.00 0.00   ? 195 ARG B H     1 
ATOM   3848  H  HE    . ARG B 1 136 ? 10.468  52.057 48.231 1.00 0.00   ? 195 ARG B HE    1 
ATOM   3849  H  HH11  . ARG B 1 136 ? 11.628  48.888 47.355 1.00 0.00   ? 195 ARG B HH11  1 
ATOM   3850  H  HH12  . ARG B 1 136 ? 11.343  48.229 48.926 1.00 0.00   ? 195 ARG B HH12  1 
ATOM   3851  H  HH21  . ARG B 1 136 ? 10.159  51.211 50.301 1.00 0.00   ? 195 ARG B HH21  1 
ATOM   3852  H  HH22  . ARG B 1 136 ? 10.516  49.541 50.593 1.00 0.00   ? 195 ARG B HH22  1 
ATOM   3853  N  N     . LEU B 1 137 ? 16.087  53.880 48.247 1.00 8.78   ? 196 LEU B N     1 
ATOM   3854  C  CA    . LEU B 1 137 ? 16.570  55.118 48.811 1.00 8.78   ? 196 LEU B CA    1 
ATOM   3855  C  C     . LEU B 1 137 ? 17.676  55.665 47.934 1.00 8.78   ? 196 LEU B C     1 
ATOM   3856  O  O     . LEU B 1 137 ? 17.651  56.835 47.580 1.00 22.33  ? 196 LEU B O     1 
ATOM   3857  C  CB    . LEU B 1 137 ? 17.091  54.907 50.240 1.00 22.33  ? 196 LEU B CB    1 
ATOM   3858  C  CG    . LEU B 1 137 ? 16.160  54.426 51.371 1.00 22.33  ? 196 LEU B CG    1 
ATOM   3859  C  CD1   . LEU B 1 137 ? 16.978  54.247 52.657 1.00 22.33  ? 196 LEU B CD1   1 
ATOM   3860  C  CD2   . LEU B 1 137 ? 15.005  55.398 51.622 1.00 22.33  ? 196 LEU B CD2   1 
ATOM   3861  H  H     . LEU B 1 137 ? 16.299  53.025 48.669 1.00 0.00   ? 196 LEU B H     1 
ATOM   3862  N  N     . ARG B 1 138 ? 18.671  54.820 47.642 1.00 30.83  ? 197 ARG B N     1 
ATOM   3863  C  CA    . ARG B 1 138 ? 19.821  55.171 46.796 1.00 30.83  ? 197 ARG B CA    1 
ATOM   3864  C  C     . ARG B 1 138 ? 19.353  55.600 45.407 1.00 30.83  ? 197 ARG B C     1 
ATOM   3865  O  O     . ARG B 1 138 ? 19.833  56.585 44.864 1.00 23.34  ? 197 ARG B O     1 
ATOM   3866  C  CB    . ARG B 1 138 ? 20.771  53.983 46.639 1.00 23.34  ? 197 ARG B CB    1 
ATOM   3867  C  CG    . ARG B 1 138 ? 21.268  53.432 47.933 1.00 23.34  ? 197 ARG B CG    1 
ATOM   3868  C  CD    . ARG B 1 138 ? 21.959  52.097 47.732 1.00 23.34  ? 197 ARG B CD    1 
ATOM   3869  N  NE    . ARG B 1 138 ? 22.363  51.500 49.011 1.00 23.34  ? 197 ARG B NE    1 
ATOM   3870  C  CZ    . ARG B 1 138 ? 23.028  50.357 49.136 1.00 23.34  ? 197 ARG B CZ    1 
ATOM   3871  N  NH1   . ARG B 1 138 ? 23.379  49.672 48.062 1.00 23.34  ? 197 ARG B NH1   1 
ATOM   3872  N  NH2   . ARG B 1 138 ? 23.313  49.888 50.338 1.00 23.34  ? 197 ARG B NH2   1 
ATOM   3873  H  H     . ARG B 1 138 ? 18.621  53.903 47.986 1.00 0.00   ? 197 ARG B H     1 
ATOM   3874  H  HE    . ARG B 1 138 ? 22.133  51.975 49.835 1.00 0.00   ? 197 ARG B HE    1 
ATOM   3875  H  HH11  . ARG B 1 138 ? 23.141  50.009 47.152 1.00 0.00   ? 197 ARG B HH11  1 
ATOM   3876  H  HH12  . ARG B 1 138 ? 23.876  48.809 48.162 1.00 0.00   ? 197 ARG B HH12  1 
ATOM   3877  H  HH21  . ARG B 1 138 ? 23.024  50.421 51.135 1.00 0.00   ? 197 ARG B HH21  1 
ATOM   3878  H  HH22  . ARG B 1 138 ? 23.815  49.051 50.493 1.00 0.00   ? 197 ARG B HH22  1 
ATOM   3879  N  N     . LEU B 1 139 ? 18.439  54.849 44.810 1.00 12.41  ? 198 LEU B N     1 
ATOM   3880  C  CA    . LEU B 1 139 ? 17.937  55.225 43.499 1.00 12.41  ? 198 LEU B CA    1 
ATOM   3881  C  C     . LEU B 1 139 ? 17.432  56.656 43.568 1.00 12.41  ? 198 LEU B C     1 
ATOM   3882  O  O     . LEU B 1 139 ? 17.788  57.487 42.728 1.00 47.63  ? 198 LEU B O     1 
ATOM   3883  C  CB    . LEU B 1 139 ? 16.790  54.318 43.078 1.00 47.63  ? 198 LEU B CB    1 
ATOM   3884  C  CG    . LEU B 1 139 ? 16.402  54.296 41.594 1.00 47.63  ? 198 LEU B CG    1 
ATOM   3885  C  CD1   . LEU B 1 139 ? 14.925  54.576 41.472 1.00 47.63  ? 198 LEU B CD1   1 
ATOM   3886  C  CD2   . LEU B 1 139 ? 17.232  55.260 40.747 1.00 47.63  ? 198 LEU B CD2   1 
ATOM   3887  H  H     . LEU B 1 139 ? 18.105  54.043 45.258 1.00 0.00   ? 198 LEU B H     1 
ATOM   3888  N  N     . ALA B 1 140 ? 16.607  56.939 44.571 1.00 39.12  ? 199 ALA B N     1 
ATOM   3889  C  CA    . ALA B 1 140 ? 16.031  58.261 44.779 1.00 39.12  ? 199 ALA B CA    1 
ATOM   3890  C  C     . ALA B 1 140 ? 17.094  59.345 44.863 1.00 39.12  ? 199 ALA B C     1 
ATOM   3891  O  O     . ALA B 1 140 ? 17.004  60.358 44.185 1.00 45.07  ? 199 ALA B O     1 
ATOM   3892  C  CB    . ALA B 1 140 ? 15.198  58.262 46.035 1.00 45.07  ? 199 ALA B CB    1 
ATOM   3893  H  H     . ALA B 1 140 ? 16.381  56.233 45.219 1.00 0.00   ? 199 ALA B H     1 
ATOM   3894  N  N     . GLY B 1 141 ? 18.096  59.131 45.701 1.00 28.40  ? 200 GLY B N     1 
ATOM   3895  C  CA    . GLY B 1 141 ? 19.163  60.103 45.843 1.00 28.40  ? 200 GLY B CA    1 
ATOM   3896  C  C     . GLY B 1 141 ? 19.799  60.465 44.515 1.00 28.40  ? 200 GLY B C     1 
ATOM   3897  O  O     . GLY B 1 141 ? 20.071  61.633 44.265 1.00 40.84  ? 200 GLY B O     1 
ATOM   3898  H  H     . GLY B 1 141 ? 18.116  58.309 46.236 1.00 0.00   ? 200 GLY B H     1 
ATOM   3899  N  N     . TRP B 1 142 ? 19.998  59.480 43.645 1.00 19.59  ? 201 TRP B N     1 
ATOM   3900  C  CA    . TRP B 1 142 ? 20.605  59.748 42.353 1.00 19.59  ? 201 TRP B CA    1 
ATOM   3901  C  C     . TRP B 1 142 ? 19.710  60.748 41.661 1.00 19.59  ? 201 TRP B C     1 
ATOM   3902  O  O     . TRP B 1 142 ? 20.162  61.736 41.092 1.00 25.71  ? 201 TRP B O     1 
ATOM   3903  C  CB    . TRP B 1 142 ? 20.733  58.478 41.504 1.00 25.71  ? 201 TRP B CB    1 
ATOM   3904  C  CG    . TRP B 1 142 ? 21.695  57.420 42.055 1.00 25.71  ? 201 TRP B CG    1 
ATOM   3905  C  CD1   . TRP B 1 142 ? 22.705  57.613 42.953 1.00 25.71  ? 201 TRP B CD1   1 
ATOM   3906  C  CD2   . TRP B 1 142 ? 21.672  56.008 41.780 1.00 25.71  ? 201 TRP B CD2   1 
ATOM   3907  N  NE1   . TRP B 1 142 ? 23.293  56.414 43.266 1.00 25.71  ? 201 TRP B NE1   1 
ATOM   3908  C  CE2   . TRP B 1 142 ? 22.681  55.414 42.562 1.00 25.71  ? 201 TRP B CE2   1 
ATOM   3909  C  CE3   . TRP B 1 142 ? 20.893  55.193 40.950 1.00 25.71  ? 201 TRP B CE3   1 
ATOM   3910  C  CZ2   . TRP B 1 142 ? 22.933  54.043 42.547 1.00 25.71  ? 201 TRP B CZ2   1 
ATOM   3911  C  CZ3   . TRP B 1 142 ? 21.143  53.828 40.933 1.00 25.71  ? 201 TRP B CZ3   1 
ATOM   3912  C  CH2   . TRP B 1 142 ? 22.158  53.267 41.732 1.00 25.71  ? 201 TRP B CH2   1 
ATOM   3913  H  H     . TRP B 1 142 ? 19.738  58.561 43.873 1.00 0.00   ? 201 TRP B H     1 
ATOM   3914  H  HE1   . TRP B 1 142 ? 24.037  56.286 43.891 1.00 0.00   ? 201 TRP B HE1   1 
ATOM   3915  N  N     . HIS B 1 143 ? 18.416  60.538 41.780 1.00 31.78  ? 202 HIS B N     1 
ATOM   3916  C  CA    . HIS B 1 143 ? 17.479  61.459 41.160 1.00 31.78  ? 202 HIS B CA    1 
ATOM   3917  C  C     . HIS B 1 143 ? 17.601  62.831 41.829 1.00 31.78  ? 202 HIS B C     1 
ATOM   3918  O  O     . HIS B 1 143 ? 18.035  63.792 41.186 1.00 42.24  ? 202 HIS B O     1 
ATOM   3919  C  CB    . HIS B 1 143 ? 16.044  60.897 41.209 1.00 42.24  ? 202 HIS B CB    1 
ATOM   3920  C  CG    . HIS B 1 143 ? 15.749  59.879 40.138 1.00 42.24  ? 202 HIS B CG    1 
ATOM   3921  N  ND1   . HIS B 1 143 ? 15.088  58.691 40.388 1.00 42.24  ? 202 HIS B ND1   1 
ATOM   3922  C  CD2   . HIS B 1 143 ? 16.012  59.881 38.808 1.00 42.24  ? 202 HIS B CD2   1 
ATOM   3923  C  CE1   . HIS B 1 143 ? 14.956  58.011 39.262 1.00 42.24  ? 202 HIS B CE1   1 
ATOM   3924  N  NE2   . HIS B 1 143 ? 15.509  58.711 38.289 1.00 42.24  ? 202 HIS B NE2   1 
ATOM   3925  H  H     . HIS B 1 143 ? 18.114  59.780 42.324 1.00 0.00   ? 202 HIS B H     1 
ATOM   3926  H  HD1   . HIS B 1 143 ? 14.769  58.377 41.263 1.00 0.00   ? 202 HIS B HD1   1 
ATOM   3927  H  HE2   . HIS B 1 143 ? 15.560  58.447 37.345 1.00 0.00   ? 202 HIS B HE2   1 
ATOM   3928  N  N     . LYS B 1 144 ? 17.354  62.883 43.140 1.00 21.57  ? 203 LYS B N     1 
ATOM   3929  C  CA    . LYS B 1 144 ? 17.395  64.129 43.925 1.00 21.57  ? 203 LYS B CA    1 
ATOM   3930  C  C     . LYS B 1 144 ? 18.592  64.965 43.623 1.00 21.57  ? 203 LYS B C     1 
ATOM   3931  O  O     . LYS B 1 144 ? 18.502  66.180 43.570 1.00 39.47  ? 203 LYS B O     1 
ATOM   3932  C  CB    . LYS B 1 144 ? 17.380  63.859 45.427 1.00 39.47  ? 203 LYS B CB    1 
ATOM   3933  C  CG    . LYS B 1 144 ? 17.719  65.073 46.261 1.00 39.47  ? 203 LYS B CG    1 
ATOM   3934  C  CD    . LYS B 1 144 ? 17.606  64.790 47.741 1.00 39.47  ? 203 LYS B CD    1 
ATOM   3935  C  CE    . LYS B 1 144 ? 17.906  66.041 48.531 1.00 39.47  ? 203 LYS B CE    1 
ATOM   3936  N  NZ    . LYS B 1 144 ? 17.598  65.904 49.976 1.00 39.47  ? 203 LYS B NZ    1 
ATOM   3937  H  H     . LYS B 1 144 ? 17.157  62.062 43.612 1.00 0.00   ? 203 LYS B H     1 
ATOM   3938  H  HZ1   . LYS B 1 144 ? 16.591  65.670 50.070 1.00 0.00   ? 203 LYS B HZ1   1 
ATOM   3939  H  HZ2   . LYS B 1 144 ? 18.178  65.145 50.387 1.00 0.00   ? 203 LYS B HZ2   1 
ATOM   3940  H  HZ3   . LYS B 1 144 ? 17.792  66.801 50.467 1.00 0.00   ? 203 LYS B HZ3   1 
ATOM   3941  N  N     . TYR B 1 145 ? 19.722  64.329 43.421 1.00 34.66  ? 204 TYR B N     1 
ATOM   3942  C  CA    . TYR B 1 145 ? 20.900  65.090 43.126 1.00 34.66  ? 204 TYR B CA    1 
ATOM   3943  C  C     . TYR B 1 145 ? 21.129  65.287 41.631 1.00 34.66  ? 204 TYR B C     1 
ATOM   3944  O  O     . TYR B 1 145 ? 21.554  66.383 41.210 1.00 29.83  ? 204 TYR B O     1 
ATOM   3945  C  CB    . TYR B 1 145 ? 22.085  64.473 43.840 1.00 29.83  ? 204 TYR B CB    1 
ATOM   3946  C  CG    . TYR B 1 145 ? 21.879  64.557 45.320 1.00 29.83  ? 204 TYR B CG    1 
ATOM   3947  C  CD1   . TYR B 1 145 ? 22.096  65.757 45.987 1.00 29.83  ? 204 TYR B CD1   1 
ATOM   3948  C  CD2   . TYR B 1 145 ? 21.404  63.462 46.053 1.00 29.83  ? 204 TYR B CD2   1 
ATOM   3949  C  CE1   . TYR B 1 145 ? 21.844  65.880 47.347 1.00 29.83  ? 204 TYR B CE1   1 
ATOM   3950  C  CE2   . TYR B 1 145 ? 21.148  63.564 47.421 1.00 29.83  ? 204 TYR B CE2   1 
ATOM   3951  C  CZ    . TYR B 1 145 ? 21.372  64.786 48.065 1.00 29.83  ? 204 TYR B CZ    1 
ATOM   3952  O  OH    . TYR B 1 145 ? 21.149  64.942 49.420 1.00 29.83  ? 204 TYR B OH    1 
ATOM   3953  H  H     . TYR B 1 145 ? 19.766  63.351 43.473 1.00 0.00   ? 204 TYR B H     1 
ATOM   3954  H  HH    . TYR B 1 145 ? 21.108  64.068 49.801 1.00 0.00   ? 204 TYR B HH    1 
ATOM   3955  N  N     . LEU B 1 146 ? 20.772  64.286 40.823 1.00 34.96  ? 205 LEU B N     1 
ATOM   3956  C  CA    . LEU B 1 146 ? 20.971  64.391 39.383 1.00 34.96  ? 205 LEU B CA    1 
ATOM   3957  C  C     . LEU B 1 146 ? 20.260  65.614 38.871 1.00 34.96  ? 205 LEU B C     1 
ATOM   3958  O  O     . LEU B 1 146 ? 20.834  66.418 38.137 1.00 28.78  ? 205 LEU B O     1 
ATOM   3959  C  CB    . LEU B 1 146 ? 20.477  63.155 38.627 1.00 28.78  ? 205 LEU B CB    1 
ATOM   3960  C  CG    . LEU B 1 146 ? 21.513  62.043 38.418 1.00 28.78  ? 205 LEU B CG    1 
ATOM   3961  C  CD1   . LEU B 1 146 ? 20.927  60.997 37.486 1.00 28.78  ? 205 LEU B CD1   1 
ATOM   3962  C  CD2   . LEU B 1 146 ? 22.833  62.608 37.848 1.00 28.78  ? 205 LEU B CD2   1 
ATOM   3963  H  H     . LEU B 1 146 ? 20.336  63.512 41.207 1.00 0.00   ? 205 LEU B H     1 
ATOM   3964  N  N     . THR B 1 147 ? 19.025  65.791 39.315 1.00 51.19  ? 206 THR B N     1 
ATOM   3965  C  CA    . THR B 1 147 ? 18.239  66.933 38.894 1.00 51.19  ? 206 THR B CA    1 
ATOM   3966  C  C     . THR B 1 147 ? 18.876  68.211 39.424 1.00 51.19  ? 206 THR B C     1 
ATOM   3967  O  O     . THR B 1 147 ? 18.924  69.216 38.724 1.00 55.45  ? 206 THR B O     1 
ATOM   3968  C  CB    . THR B 1 147 ? 16.798  66.806 39.384 1.00 55.45  ? 206 THR B CB    1 
ATOM   3969  O  OG1   . THR B 1 147 ? 16.816  66.358 40.743 1.00 55.45  ? 206 THR B OG1   1 
ATOM   3970  C  CG2   . THR B 1 147 ? 16.006  65.804 38.517 1.00 55.45  ? 206 THR B CG2   1 
ATOM   3971  H  H     . THR B 1 147 ? 18.648  65.143 39.935 1.00 0.00   ? 206 THR B H     1 
ATOM   3972  H  HG1   . THR B 1 147 ? 17.110  65.444 40.799 1.00 30.00  ? 206 THR B HG1   1 
ATOM   3973  N  N     . ARG B 1 148 ? 19.408  68.158 40.641 1.00 59.86  ? 207 ARG B N     1 
ATOM   3974  C  CA    . ARG B 1 148 ? 20.062  69.322 41.229 1.00 59.86  ? 207 ARG B CA    1 
ATOM   3975  C  C     . ARG B 1 148 ? 21.012  69.905 40.184 1.00 59.86  ? 207 ARG B C     1 
ATOM   3976  O  O     . ARG B 1 148 ? 20.869  71.050 39.767 1.00 52.85  ? 207 ARG B O     1 
ATOM   3977  C  CB    . ARG B 1 148 ? 20.887  68.928 42.464 1.00 52.85  ? 207 ARG B CB    1 
ATOM   3978  C  CG    . ARG B 1 148 ? 20.114  68.445 43.670 1.00 52.85  ? 207 ARG B CG    1 
ATOM   3979  C  CD    . ARG B 1 148 ? 19.313  69.550 44.304 1.00 52.85  ? 207 ARG B CD    1 
ATOM   3980  N  NE    . ARG B 1 148 ? 18.753  69.165 45.600 1.00 52.85  ? 207 ARG B NE    1 
ATOM   3981  C  CZ    . ARG B 1 148 ? 19.448  69.136 46.732 1.00 52.85  ? 207 ARG B CZ    1 
ATOM   3982  N  NH1   . ARG B 1 148 ? 20.733  69.466 46.737 1.00 52.85  ? 207 ARG B NH1   1 
ATOM   3983  N  NH2   . ARG B 1 148 ? 18.856  68.783 47.861 1.00 52.85  ? 207 ARG B NH2   1 
ATOM   3984  H  H     . ARG B 1 148 ? 19.337  67.329 41.155 1.00 0.00   ? 207 ARG B H     1 
ATOM   3985  H  HE    . ARG B 1 148 ? 17.810  68.903 45.637 1.00 0.00   ? 207 ARG B HE    1 
ATOM   3986  H  HH11  . ARG B 1 148 ? 21.188  69.740 45.890 1.00 0.00   ? 207 ARG B HH11  1 
ATOM   3987  H  HH12  . ARG B 1 148 ? 21.251  69.439 47.592 1.00 0.00   ? 207 ARG B HH12  1 
ATOM   3988  H  HH21  . ARG B 1 148 ? 17.887  68.541 47.865 1.00 0.00   ? 207 ARG B HH21  1 
ATOM   3989  H  HH22  . ARG B 1 148 ? 19.383  68.759 48.710 1.00 0.00   ? 207 ARG B HH22  1 
ATOM   3990  N  N     . ASN B 1 149 ? 21.909  69.059 39.687 1.00 35.93  ? 208 ASN B N     1 
ATOM   3991  C  CA    . ASN B 1 149 ? 22.909  69.459 38.700 1.00 35.93  ? 208 ASN B CA    1 
ATOM   3992  C  C     . ASN B 1 149 ? 22.335  69.339 37.294 1.00 35.93  ? 208 ASN B C     1 
ATOM   3993  O  O     . ASN B 1 149 ? 23.029  68.975 36.356 1.00 36.78  ? 208 ASN B O     1 
ATOM   3994  C  CB    . ASN B 1 149 ? 24.155  68.592 38.853 1.00 36.78  ? 208 ASN B CB    1 
ATOM   3995  C  CG    . ASN B 1 149 ? 24.605  68.466 40.303 1.00 36.78  ? 208 ASN B CG    1 
ATOM   3996  O  OD1   . ASN B 1 149 ? 25.676  68.945 40.674 1.00 36.78  ? 208 ASN B OD1   1 
ATOM   3997  N  ND2   . ASN B 1 149 ? 23.786  67.820 41.132 1.00 36.78  ? 208 ASN B ND2   1 
ATOM   3998  H  H     . ASN B 1 149 ? 21.834  68.122 39.955 1.00 0.00   ? 208 ASN B H     1 
ATOM   3999  H  HD21  . ASN B 1 149 ? 24.068  67.752 42.066 1.00 0.00   ? 208 ASN B HD21  1 
ATOM   4000  H  HD22  . ASN B 1 149 ? 22.964  67.451 40.777 1.00 0.00   ? 208 ASN B HD22  1 
ATOM   4001  N  N     . GLN B 1 150 ? 21.045  69.638 37.185 1.00 33.47  ? 209 GLN B N     1 
ATOM   4002  C  CA    . GLN B 1 150 ? 20.289  69.609 35.942 1.00 33.47  ? 209 GLN B CA    1 
ATOM   4003  C  C     . GLN B 1 150 ? 20.772  68.597 34.923 1.00 33.47  ? 209 GLN B C     1 
ATOM   4004  O  O     . GLN B 1 150 ? 21.137  68.941 33.790 1.00 60.10  ? 209 GLN B O     1 
ATOM   4005  C  CB    . GLN B 1 150 ? 20.204  71.006 35.317 1.00 60.10  ? 209 GLN B CB    1 
ATOM   4006  C  CG    . GLN B 1 150 ? 19.691  72.110 36.248 1.00 60.10  ? 209 GLN B CG    1 
ATOM   4007  C  CD    . GLN B 1 150 ? 20.785  72.725 37.130 1.00 60.10  ? 209 GLN B CD    1 
ATOM   4008  O  OE1   . GLN B 1 150 ? 21.988  72.562 36.882 1.00 60.10  ? 209 GLN B OE1   1 
ATOM   4009  N  NE2   . GLN B 1 150 ? 20.365  73.448 38.158 1.00 60.10  ? 209 GLN B NE2   1 
ATOM   4010  H  H     . GLN B 1 150 ? 20.560  69.930 37.976 1.00 0.00   ? 209 GLN B H     1 
ATOM   4011  N  N     . ILE B 1 151 ? 20.813  67.344 35.361 1.00 60.81  ? 210 ILE B N     1 
ATOM   4012  C  CA    . ILE B 1 151 ? 21.198  66.225 34.504 1.00 60.81  ? 210 ILE B CA    1 
ATOM   4013  C  C     . ILE B 1 151 ? 20.175  65.124 34.761 1.00 60.81  ? 210 ILE B C     1 
ATOM   4014  O  O     . ILE B 1 151 ? 19.673  64.978 35.881 1.00 43.56  ? 210 ILE B O     1 
ATOM   4015  C  CB    . ILE B 1 151 ? 22.612  65.670 34.813 1.00 43.56  ? 210 ILE B CB    1 
ATOM   4016  C  CG1   . ILE B 1 151 ? 23.693  66.677 34.427 1.00 43.56  ? 210 ILE B CG1   1 
ATOM   4017  C  CG2   . ILE B 1 151 ? 22.839  64.384 34.040 1.00 43.56  ? 210 ILE B CG2   1 
ATOM   4018  C  CD1   . ILE B 1 151 ? 25.085  66.231 34.811 1.00 43.56  ? 210 ILE B CD1   1 
ATOM   4019  H  H     . ILE B 1 151 ? 20.566  67.146 36.292 1.00 0.00   ? 210 ILE B H     1 
ATOM   4020  N  N     . GLN B 1 152 ? 19.839  64.381 33.714 1.00 53.43  ? 211 GLN B N     1 
ATOM   4021  C  CA    . GLN B 1 152 ? 18.878  63.285 33.813 1.00 53.43  ? 211 GLN B CA    1 
ATOM   4022  C  C     . GLN B 1 152 ? 19.431  62.022 33.162 1.00 53.43  ? 211 GLN B C     1 
ATOM   4023  O  O     . GLN B 1 152 ? 20.026  62.070 32.083 1.00 116.68 ? 211 GLN B O     1 
ATOM   4024  C  CB    . GLN B 1 152 ? 17.531  63.673 33.192 1.00 116.68 ? 211 GLN B CB    1 
ATOM   4025  C  CG    . GLN B 1 152 ? 16.587  64.370 34.164 1.00 116.68 ? 211 GLN B CG    1 
ATOM   4026  C  CD    . GLN B 1 152 ? 16.183  63.471 35.323 1.00 116.68 ? 211 GLN B CD    1 
ATOM   4027  O  OE1   . GLN B 1 152 ? 16.687  63.600 36.442 1.00 116.68 ? 211 GLN B OE1   1 
ATOM   4028  N  NE2   . GLN B 1 152 ? 15.277  62.542 35.054 1.00 116.68 ? 211 GLN B NE2   1 
ATOM   4029  H  H     . GLN B 1 152 ? 20.257  64.551 32.843 1.00 0.00   ? 211 GLN B H     1 
ATOM   4030  N  N     . PRO B 1 153 ? 19.266  60.878 33.833 1.00 27.51  ? 212 PRO B N     1 
ATOM   4031  C  CA    . PRO B 1 153 ? 19.759  59.611 33.305 1.00 27.51  ? 212 PRO B CA    1 
ATOM   4032  C  C     . PRO B 1 153 ? 19.199  59.333 31.936 1.00 27.51  ? 212 PRO B C     1 
ATOM   4033  O  O     . PRO B 1 153 ? 18.044  59.628 31.649 1.00 31.32  ? 212 PRO B O     1 
ATOM   4034  C  CB    . PRO B 1 153 ? 19.232  58.595 34.302 1.00 31.32  ? 212 PRO B CB    1 
ATOM   4035  C  CG    . PRO B 1 153 ? 17.968  59.241 34.812 1.00 31.32  ? 212 PRO B CG    1 
ATOM   4036  C  CD    . PRO B 1 153 ? 18.434  60.660 35.027 1.00 31.32  ? 212 PRO B CD    1 
ATOM   4037  N  N     . ILE B 1 154 ? 20.059  58.782 31.090 1.00 33.17  ? 213 ILE B N     1 
ATOM   4038  C  CA    . ILE B 1 154 ? 19.719  58.413 29.730 1.00 33.17  ? 213 ILE B CA    1 
ATOM   4039  C  C     . ILE B 1 154 ? 19.287  56.958 29.799 1.00 33.17  ? 213 ILE B C     1 
ATOM   4040  O  O     . ILE B 1 154 ? 18.978  56.330 28.800 1.00 37.96  ? 213 ILE B O     1 
ATOM   4041  C  CB    . ILE B 1 154 ? 20.942  58.556 28.798 1.00 37.96  ? 213 ILE B CB    1 
ATOM   4042  C  CG1   . ILE B 1 154 ? 21.861  57.355 28.905 1.00 37.96  ? 213 ILE B CG1   1 
ATOM   4043  C  CG2   . ILE B 1 154 ? 21.783  59.723 29.228 1.00 37.96  ? 213 ILE B CG2   1 
ATOM   4044  C  CD1   . ILE B 1 154 ? 22.829  57.277 27.729 1.00 37.96  ? 213 ILE B CD1   1 
ATOM   4045  H  H     . ILE B 1 154 ? 20.965  58.620 31.423 1.00 0.00   ? 213 ILE B H     1 
ATOM   4046  N  N     . ALA B 1 155 ? 19.307  56.414 31.003 1.00 43.65  ? 214 ALA B N     1 
ATOM   4047  C  CA    . ALA B 1 155 ? 18.920  55.045 31.225 1.00 43.65  ? 214 ALA B CA    1 
ATOM   4048  C  C     . ALA B 1 155 ? 18.763  54.850 32.709 1.00 43.65  ? 214 ALA B C     1 
ATOM   4049  O  O     . ALA B 1 155 ? 19.356  55.570 33.534 1.00 24.81  ? 214 ALA B O     1 
ATOM   4050  C  CB    . ALA B 1 155 ? 19.969  54.111 30.698 1.00 24.81  ? 214 ALA B CB    1 
ATOM   4051  H  H     . ALA B 1 155 ? 19.572  56.927 31.790 1.00 0.00   ? 214 ALA B H     1 
ATOM   4052  N  N     . GLU B 1 156 ? 17.944  53.872 33.039 1.00 31.30  ? 215 GLU B N     1 
ATOM   4053  C  CA    . GLU B 1 156 ? 17.681  53.518 34.410 1.00 31.30  ? 215 GLU B CA    1 
ATOM   4054  C  C     . GLU B 1 156 ? 17.286  52.073 34.251 1.00 31.30  ? 215 GLU B C     1 
ATOM   4055  O  O     . GLU B 1 156 ? 16.655  51.715 33.254 1.00 82.35  ? 215 GLU B O     1 
ATOM   4056  C  CB    . GLU B 1 156 ? 16.513  54.343 34.957 1.00 82.35  ? 215 GLU B CB    1 
ATOM   4057  C  CG    . GLU B 1 156 ? 16.377  54.324 36.477 1.00 82.35  ? 215 GLU B CG    1 
ATOM   4058  C  CD    . GLU B 1 156 ? 15.420  55.400 37.007 1.00 82.35  ? 215 GLU B CD    1 
ATOM   4059  O  OE1   . GLU B 1 156 ? 15.441  56.541 36.478 1.00 82.35  ? 215 GLU B OE1   1 
ATOM   4060  O  OE2   . GLU B 1 156 ? 14.657  55.104 37.960 1.00 82.35  ? 215 GLU B OE2   1 
ATOM   4061  H  H     . GLU B 1 156 ? 17.486  53.345 32.347 1.00 0.00   ? 215 GLU B H     1 
ATOM   4062  N  N     . ARG B 1 157 ? 17.796  51.232 35.141 1.00 46.51  ? 216 ARG B N     1 
ATOM   4063  C  CA    . ARG B 1 157 ? 17.490  49.809 35.135 1.00 46.51  ? 216 ARG B CA    1 
ATOM   4064  C  C     . ARG B 1 157 ? 17.804  49.252 36.495 1.00 46.51  ? 216 ARG B C     1 
ATOM   4065  O  O     . ARG B 1 157 ? 18.359  49.949 37.343 1.00 82.20  ? 216 ARG B O     1 
ATOM   4066  C  CB    . ARG B 1 157 ? 18.255  49.060 34.035 1.00 82.20  ? 216 ARG B CB    1 
ATOM   4067  C  CG    . ARG B 1 157 ? 19.726  49.398 33.908 1.00 82.20  ? 216 ARG B CG    1 
ATOM   4068  C  CD    . ARG B 1 157 ? 20.230  49.083 32.504 1.00 82.20  ? 216 ARG B CD    1 
ATOM   4069  N  NE    . ARG B 1 157 ? 19.584  49.913 31.483 1.00 82.20  ? 216 ARG B NE    1 
ATOM   4070  C  CZ    . ARG B 1 157 ? 18.593  49.505 30.693 1.00 82.20  ? 216 ARG B CZ    1 
ATOM   4071  N  NH1   . ARG B 1 157 ? 18.124  48.263 30.794 1.00 82.20  ? 216 ARG B NH1   1 
ATOM   4072  N  NH2   . ARG B 1 157 ? 18.056  50.347 29.813 1.00 82.20  ? 216 ARG B NH2   1 
ATOM   4073  H  H     . ARG B 1 157 ? 18.417  51.547 35.834 1.00 0.00   ? 216 ARG B H     1 
ATOM   4074  H  HE    . ARG B 1 157 ? 19.900  50.834 31.375 1.00 0.00   ? 216 ARG B HE    1 
ATOM   4075  H  HH11  . ARG B 1 157 ? 18.509  47.624 31.459 1.00 0.00   ? 216 ARG B HH11  1 
ATOM   4076  H  HH12  . ARG B 1 157 ? 17.380  47.970 30.194 1.00 0.00   ? 216 ARG B HH12  1 
ATOM   4077  H  HH21  . ARG B 1 157 ? 18.400  51.285 29.751 1.00 0.00   ? 216 ARG B HH21  1 
ATOM   4078  H  HH22  . ARG B 1 157 ? 17.312  50.047 29.219 1.00 0.00   ? 216 ARG B HH22  1 
ATOM   4079  N  N     . GLU B 1 158 ? 17.383  48.009 36.721 1.00 37.14  ? 217 GLU B N     1 
ATOM   4080  C  CA    . GLU B 1 158 ? 17.647  47.449 38.054 1.00 37.14  ? 217 GLU B CA    1 
ATOM   4081  C  C     . GLU B 1 158 ? 17.913  45.945 37.946 1.00 37.14  ? 217 GLU B C     1 
ATOM   4082  O  O     . GLU B 1 158 ? 17.318  45.213 37.175 1.00 89.26  ? 217 GLU B O     1 
ATOM   4083  C  CB    . GLU B 1 158 ? 16.443  47.682 38.967 1.00 89.26  ? 217 GLU B CB    1 
ATOM   4084  C  CG    . GLU B 1 158 ? 16.110  49.162 39.151 1.00 89.26  ? 217 GLU B CG    1 
ATOM   4085  C  CD    . GLU B 1 158 ? 14.902  49.394 40.060 1.00 89.26  ? 217 GLU B CD    1 
ATOM   4086  O  OE1   . GLU B 1 158 ? 14.283  48.388 40.579 1.00 89.26  ? 217 GLU B OE1   1 
ATOM   4087  O  OE2   . GLU B 1 158 ? 14.502  50.595 40.309 1.00 89.26  ? 217 GLU B OE2   1 
ATOM   4088  N  N     . GLY B 1 159 ? 18.894  45.561 38.780 1.00 25.61  ? 218 GLY B N     1 
ATOM   4089  C  CA    . GLY B 1 159 ? 19.328  44.187 38.896 1.00 25.61  ? 218 GLY B CA    1 
ATOM   4090  C  C     . GLY B 1 159 ? 18.956  43.642 40.246 1.00 25.61  ? 218 GLY B C     1 
ATOM   4091  O  O     . GLY B 1 159 ? 18.273  44.315 41.011 1.00 46.18  ? 218 GLY B O     1 
ATOM   4092  H  H     . GLY B 1 159 ? 19.303  46.244 39.356 1.00 0.00   ? 218 GLY B H     1 
ATOM   4093  N  N     . ASP B 1 160 ? 19.496  42.481 40.588 1.00 13.50  ? 219 ASP B N     1 
ATOM   4094  C  CA    . ASP B 1 160 ? 19.154  41.847 41.851 1.00 13.50  ? 219 ASP B CA    1 
ATOM   4095  C  C     . ASP B 1 160 ? 20.267  41.776 42.872 1.00 13.50  ? 219 ASP B C     1 
ATOM   4096  O  O     . ASP B 1 160 ? 20.194  40.954 43.776 1.00 48.18  ? 219 ASP B O     1 
ATOM   4097  C  CB    . ASP B 1 160 ? 18.633  40.445 41.580 1.00 48.18  ? 219 ASP B CB    1 
ATOM   4098  C  CG    . ASP B 1 160 ? 19.546  39.662 40.672 1.00 48.18  ? 219 ASP B CG    1 
ATOM   4099  O  OD1   . ASP B 1 160 ? 20.573  39.165 41.156 1.00 48.18  ? 219 ASP B OD1   1 
ATOM   4100  O  OD2   . ASP B 1 160 ? 19.252  39.549 39.464 1.00 48.18  ? 219 ASP B OD2   1 
ATOM   4101  H  H     . ASP B 1 160 ? 20.136  42.050 39.988 1.00 0.00   ? 219 ASP B H     1 
ATOM   4102  N  N     . TRP B 1 161 ? 21.268  42.646 42.741 1.00 13.67  ? 220 TRP B N     1 
ATOM   4103  C  CA    . TRP B 1 161 ? 22.437  42.698 43.640 1.00 13.67  ? 220 TRP B CA    1 
ATOM   4104  C  C     . TRP B 1 161 ? 23.526  41.690 43.265 1.00 13.67  ? 220 TRP B C     1 
ATOM   4105  O  O     . TRP B 1 161 ? 24.472  41.487 44.032 1.00 33.40  ? 220 TRP B O     1 
ATOM   4106  C  CB    . TRP B 1 161 ? 22.099  42.432 45.121 1.00 33.40  ? 220 TRP B CB    1 
ATOM   4107  C  CG    . TRP B 1 161 ? 21.129  43.329 45.859 1.00 33.40  ? 220 TRP B CG    1 
ATOM   4108  C  CD1   . TRP B 1 161 ? 20.094  42.903 46.629 1.00 33.40  ? 220 TRP B CD1   1 
ATOM   4109  C  CD2   . TRP B 1 161 ? 21.187  44.763 46.030 1.00 33.40  ? 220 TRP B CD2   1 
ATOM   4110  N  NE1   . TRP B 1 161 ? 19.515  43.960 47.278 1.00 33.40  ? 220 TRP B NE1   1 
ATOM   4111  C  CE2   . TRP B 1 161 ? 20.162  45.115 46.930 1.00 33.40  ? 220 TRP B CE2   1 
ATOM   4112  C  CE3   . TRP B 1 161 ? 22.008  45.778 45.520 1.00 33.40  ? 220 TRP B CE3   1 
ATOM   4113  C  CZ2   . TRP B 1 161 ? 19.932  46.441 47.335 1.00 33.40  ? 220 TRP B CZ2   1 
ATOM   4114  C  CZ3   . TRP B 1 161 ? 21.777  47.105 45.927 1.00 33.40  ? 220 TRP B CZ3   1 
ATOM   4115  C  CH2   . TRP B 1 161 ? 20.748  47.416 46.823 1.00 33.40  ? 220 TRP B CH2   1 
ATOM   4116  H  H     . TRP B 1 161 ? 21.204  43.310 42.027 1.00 0.00   ? 220 TRP B H     1 
ATOM   4117  H  HE1   . TRP B 1 161 ? 18.740  43.865 47.871 1.00 0.00   ? 220 TRP B HE1   1 
ATOM   4118  N  N     . SER B 1 162 ? 23.417  41.087 42.081 1.00 2.00   ? 221 SER B N     1 
ATOM   4119  C  CA    . SER B 1 162 ? 24.400  40.080 41.626 1.00 2.00   ? 221 SER B CA    1 
ATOM   4120  C  C     . SER B 1 162 ? 25.234  40.636 40.496 1.00 2.00   ? 221 SER B C     1 
ATOM   4121  O  O     . SER B 1 162 ? 24.789  41.547 39.781 1.00 40.78  ? 221 SER B O     1 
ATOM   4122  C  CB    . SER B 1 162 ? 23.699  38.830 41.113 1.00 40.78  ? 221 SER B CB    1 
ATOM   4123  O  OG    . SER B 1 162 ? 22.931  39.119 39.954 1.00 40.78  ? 221 SER B OG    1 
ATOM   4124  H  H     . SER B 1 162 ? 22.688  41.339 41.487 1.00 0.00   ? 221 SER B H     1 
ATOM   4125  H  HG    . SER B 1 162 ? 22.284  39.810 40.142 1.00 30.00  ? 221 SER B HG    1 
ATOM   4126  N  N     . ALA B 1 163 ? 26.426  40.063 40.315 1.00 10.01  ? 222 ALA B N     1 
ATOM   4127  C  CA    . ALA B 1 163 ? 27.341  40.484 39.262 1.00 10.01  ? 222 ALA B CA    1 
ATOM   4128  C  C     . ALA B 1 163 ? 26.796  40.032 37.920 1.00 10.01  ? 222 ALA B C     1 
ATOM   4129  O  O     . ALA B 1 163 ? 27.076  40.635 36.901 1.00 23.80  ? 222 ALA B O     1 
ATOM   4130  C  CB    . ALA B 1 163 ? 28.716  39.907 39.501 1.00 23.80  ? 222 ALA B CB    1 
ATOM   4131  H  H     . ALA B 1 163 ? 26.701  39.337 40.908 1.00 0.00   ? 222 ALA B H     1 
ATOM   4132  N  N     . MET B 1 164 ? 26.013  38.965 37.917 1.00 17.66  ? 223 MET B N     1 
ATOM   4133  C  CA    . MET B 1 164 ? 25.436  38.501 36.674 1.00 17.66  ? 223 MET B CA    1 
ATOM   4134  C  C     . MET B 1 164 ? 24.358  39.486 36.200 1.00 17.66  ? 223 MET B C     1 
ATOM   4135  O  O     . MET B 1 164 ? 24.347  39.839 35.021 1.00 37.17  ? 223 MET B O     1 
ATOM   4136  C  CB    . MET B 1 164 ? 24.877  37.101 36.811 1.00 37.17  ? 223 MET B CB    1 
ATOM   4137  C  CG    . MET B 1 164 ? 24.541  36.468 35.462 1.00 37.17  ? 223 MET B CG    1 
ATOM   4138  S  SD    . MET B 1 164 ? 25.895  36.372 34.227 1.00 37.17  ? 223 MET B SD    1 
ATOM   4139  C  CE    . MET B 1 164 ? 26.369  34.635 34.344 1.00 37.17  ? 223 MET B CE    1 
ATOM   4140  H  H     . MET B 1 164 ? 25.821  38.490 38.746 1.00 0.00   ? 223 MET B H     1 
ATOM   4141  N  N     . SER B 1 165 ? 23.501  39.968 37.121 1.00 2.00   ? 224 SER B N     1 
ATOM   4142  C  CA    . SER B 1 165 ? 22.424  40.928 36.808 1.00 2.00   ? 224 SER B CA    1 
ATOM   4143  C  C     . SER B 1 165 ? 23.002  42.274 36.412 1.00 2.00   ? 224 SER B C     1 
ATOM   4144  O  O     . SER B 1 165 ? 22.367  43.051 35.709 1.00 40.58  ? 224 SER B O     1 
ATOM   4145  C  CB    . SER B 1 165 ? 21.473  41.105 37.987 1.00 40.58  ? 224 SER B CB    1 
ATOM   4146  O  OG    . SER B 1 165 ? 22.156  41.467 39.178 1.00 40.58  ? 224 SER B OG    1 
ATOM   4147  H  H     . SER B 1 165 ? 23.560  39.654 38.049 1.00 0.00   ? 224 SER B H     1 
ATOM   4148  H  HG    . SER B 1 165 ? 22.818  42.162 39.020 1.00 30.00  ? 224 SER B HG    1 
ATOM   4149  N  N     . GLY B 1 166 ? 24.210  42.555 36.891 1.00 20.05  ? 225 GLY B N     1 
ATOM   4150  C  CA    . GLY B 1 166 ? 24.876  43.797 36.535 1.00 20.05  ? 225 GLY B CA    1 
ATOM   4151  C  C     . GLY B 1 166 ? 25.343  43.598 35.108 1.00 20.05  ? 225 GLY B C     1 
ATOM   4152  O  O     . GLY B 1 166 ? 25.164  44.461 34.252 1.00 31.92  ? 225 GLY B O     1 
ATOM   4153  H  H     . GLY B 1 166 ? 24.660  41.934 37.501 1.00 0.00   ? 225 GLY B H     1 
ATOM   4154  N  N     . PHE B 1 167 ? 25.927  42.435 34.846 1.00 31.33  ? 226 PHE B N     1 
ATOM   4155  C  CA    . PHE B 1 167 ? 26.384  42.098 33.515 1.00 31.33  ? 226 PHE B CA    1 
ATOM   4156  C  C     . PHE B 1 167 ? 25.194  42.131 32.548 1.00 31.33  ? 226 PHE B C     1 
ATOM   4157  O  O     . PHE B 1 167 ? 25.152  42.976 31.652 1.00 26.17  ? 226 PHE B O     1 
ATOM   4158  C  CB    . PHE B 1 167 ? 27.038  40.714 33.503 1.00 26.17  ? 226 PHE B CB    1 
ATOM   4159  C  CG    . PHE B 1 167 ? 27.419  40.242 32.129 1.00 26.17  ? 226 PHE B CG    1 
ATOM   4160  C  CD1   . PHE B 1 167 ? 28.366  40.928 31.380 1.00 26.17  ? 226 PHE B CD1   1 
ATOM   4161  C  CD2   . PHE B 1 167 ? 26.803  39.134 31.567 1.00 26.17  ? 226 PHE B CD2   1 
ATOM   4162  C  CE1   . PHE B 1 167 ? 28.687  40.518 30.096 1.00 26.17  ? 226 PHE B CE1   1 
ATOM   4163  C  CE2   . PHE B 1 167 ? 27.120  38.721 30.287 1.00 26.17  ? 226 PHE B CE2   1 
ATOM   4164  C  CZ    . PHE B 1 167 ? 28.061  39.415 29.554 1.00 26.17  ? 226 PHE B CZ    1 
ATOM   4165  H  H     . PHE B 1 167 ? 26.061  41.785 35.564 1.00 0.00   ? 226 PHE B H     1 
ATOM   4166  N  N     . GLN B 1 168 ? 24.227  41.231 32.745 1.00 15.78  ? 227 GLN B N     1 
ATOM   4167  C  CA    . GLN B 1 168 ? 23.029  41.160 31.900 1.00 15.78  ? 227 GLN B CA    1 
ATOM   4168  C  C     . GLN B 1 168 ? 22.355  42.528 31.621 1.00 15.78  ? 227 GLN B C     1 
ATOM   4169  O  O     . GLN B 1 168 ? 22.138  42.881 30.467 1.00 113.97 ? 227 GLN B O     1 
ATOM   4170  C  CB    . GLN B 1 168 ? 22.017  40.184 32.489 1.00 113.97 ? 227 GLN B CB    1 
ATOM   4171  C  CG    . GLN B 1 168 ? 22.480  38.747 32.489 1.00 113.97 ? 227 GLN B CG    1 
ATOM   4172  C  CD    . GLN B 1 168 ? 21.410  37.804 32.998 1.00 113.97 ? 227 GLN B CD    1 
ATOM   4173  O  OE1   . GLN B 1 168 ? 21.273  37.597 34.204 1.00 113.97 ? 227 GLN B OE1   1 
ATOM   4174  N  NE2   . GLN B 1 168 ? 20.638  37.230 32.081 1.00 113.97 ? 227 GLN B NE2   1 
ATOM   4175  H  H     . GLN B 1 168 ? 24.337  40.587 33.449 1.00 0.00   ? 227 GLN B H     1 
ATOM   4176  N  N     . GLN B 1 169 ? 22.070  43.290 32.679 1.00 24.83  ? 228 GLN B N     1 
ATOM   4177  C  CA    . GLN B 1 169 ? 21.438  44.592 32.573 1.00 24.83  ? 228 GLN B CA    1 
ATOM   4178  C  C     . GLN B 1 169 ? 22.282  45.645 31.884 1.00 24.83  ? 228 GLN B C     1 
ATOM   4179  O  O     . GLN B 1 169 ? 21.747  46.509 31.183 1.00 53.02  ? 228 GLN B O     1 
ATOM   4180  C  CB    . GLN B 1 169 ? 21.010  45.103 33.939 1.00 53.02  ? 228 GLN B CB    1 
ATOM   4181  C  CG    . GLN B 1 169 ? 19.664  44.593 34.368 1.00 53.02  ? 228 GLN B CG    1 
ATOM   4182  C  CD    . GLN B 1 169 ? 18.615  44.768 33.293 1.00 53.02  ? 228 GLN B CD    1 
ATOM   4183  O  OE1   . GLN B 1 169 ? 17.880  43.833 32.975 1.00 53.02  ? 228 GLN B OE1   1 
ATOM   4184  N  NE2   . GLN B 1 169 ? 18.558  45.956 32.702 1.00 53.02  ? 228 GLN B NE2   1 
ATOM   4185  H  H     . GLN B 1 169 ? 22.296  42.964 33.577 1.00 0.00   ? 228 GLN B H     1 
ATOM   4186  N  N     . THR B 1 170 ? 23.594  45.600 32.085 1.00 34.20  ? 229 THR B N     1 
ATOM   4187  C  CA    . THR B 1 170 ? 24.469  46.563 31.426 1.00 34.20  ? 229 THR B CA    1 
ATOM   4188  C  C     . THR B 1 170 ? 24.583  46.165 29.962 1.00 34.20  ? 229 THR B C     1 
ATOM   4189  O  O     . THR B 1 170 ? 24.399  46.981 29.073 1.00 29.84  ? 229 THR B O     1 
ATOM   4190  C  CB    . THR B 1 170 ? 25.849  46.579 32.061 1.00 29.84  ? 229 THR B CB    1 
ATOM   4191  O  OG1   . THR B 1 170 ? 25.722  46.950 33.445 1.00 29.84  ? 229 THR B OG1   1 
ATOM   4192  C  CG2   . THR B 1 170 ? 26.749  47.579 31.338 1.00 29.84  ? 229 THR B CG2   1 
ATOM   4193  H  H     . THR B 1 170 ? 23.994  44.918 32.665 1.00 0.00   ? 229 THR B H     1 
ATOM   4194  H  HG1   . THR B 1 170 ? 25.219  46.272 33.903 1.00 30.00  ? 229 THR B HG1   1 
ATOM   4195  N  N     . MET B 1 171 ? 24.822  44.881 29.729 1.00 20.21  ? 230 MET B N     1 
ATOM   4196  C  CA    . MET B 1 171 ? 24.948  44.309 28.393 1.00 20.21  ? 230 MET B CA    1 
ATOM   4197  C  C     . MET B 1 171 ? 23.685  44.645 27.609 1.00 20.21  ? 230 MET B C     1 
ATOM   4198  O  O     . MET B 1 171 ? 23.757  45.032 26.454 1.00 34.31  ? 230 MET B O     1 
ATOM   4199  C  CB    . MET B 1 171 ? 25.114  42.792 28.505 1.00 34.31  ? 230 MET B CB    1 
ATOM   4200  C  CG    . MET B 1 171 ? 25.725  42.113 27.303 1.00 34.31  ? 230 MET B CG    1 
ATOM   4201  S  SD    . MET B 1 171 ? 27.466  42.495 27.043 1.00 34.31  ? 230 MET B SD    1 
ATOM   4202  C  CE    . MET B 1 171 ? 27.354  44.046 26.247 1.00 34.31  ? 230 MET B CE    1 
ATOM   4203  H  H     . MET B 1 171 ? 24.901  44.305 30.499 1.00 0.00   ? 230 MET B H     1 
ATOM   4204  N  N     . GLN B 1 172 ? 22.542  44.575 28.277 1.00 18.81  ? 231 GLN B N     1 
ATOM   4205  C  CA    . GLN B 1 172 ? 21.252  44.884 27.657 1.00 18.81  ? 231 GLN B CA    1 
ATOM   4206  C  C     . GLN B 1 172 ? 21.106  46.360 27.290 1.00 18.81  ? 231 GLN B C     1 
ATOM   4207  O  O     . GLN B 1 172 ? 20.550  46.690 26.237 1.00 80.39  ? 231 GLN B O     1 
ATOM   4208  C  CB    . GLN B 1 172 ? 20.068  44.441 28.547 1.00 80.39  ? 231 GLN B CB    1 
ATOM   4209  C  CG    . GLN B 1 172 ? 19.795  42.906 28.586 1.00 80.39  ? 231 GLN B CG    1 
ATOM   4210  C  CD    . GLN B 1 172 ? 18.467  42.524 29.263 1.00 80.39  ? 231 GLN B CD    1 
ATOM   4211  O  OE1   . GLN B 1 172 ? 17.387  42.847 28.760 1.00 80.39  ? 231 GLN B OE1   1 
ATOM   4212  N  NE2   . GLN B 1 172 ? 18.550  41.818 30.387 1.00 80.39  ? 231 GLN B NE2   1 
ATOM   4213  H  H     . GLN B 1 172 ? 22.559  44.291 29.210 1.00 0.00   ? 231 GLN B H     1 
ATOM   4214  N  N     . MET B 1 173 ? 21.630  47.239 28.138 1.00 38.36  ? 232 MET B N     1 
ATOM   4215  C  CA    . MET B 1 173 ? 21.569  48.686 27.913 1.00 38.36  ? 232 MET B CA    1 
ATOM   4216  C  C     . MET B 1 173 ? 22.436  49.055 26.700 1.00 38.36  ? 232 MET B C     1 
ATOM   4217  O  O     . MET B 1 173 ? 22.016  49.821 25.832 1.00 33.83  ? 232 MET B O     1 
ATOM   4218  C  CB    . MET B 1 173 ? 22.027  49.412 29.195 1.00 33.83  ? 232 MET B CB    1 
ATOM   4219  C  CG    . MET B 1 173 ? 21.952  50.932 29.211 1.00 33.83  ? 232 MET B CG    1 
ATOM   4220  S  SD    . MET B 1 173 ? 23.541  51.604 29.799 1.00 33.83  ? 232 MET B SD    1 
ATOM   4221  C  CE    . MET B 1 173 ? 23.348  51.417 31.499 1.00 33.83  ? 232 MET B CE    1 
ATOM   4222  H  H     . MET B 1 173 ? 22.078  46.903 28.939 1.00 0.00   ? 232 MET B H     1 
ATOM   4223  N  N     . LEU B 1 174 ? 23.613  48.446 26.608 1.00 30.56  ? 233 LEU B N     1 
ATOM   4224  C  CA    . LEU B 1 174 ? 24.526  48.693 25.501 1.00 30.56  ? 233 LEU B CA    1 
ATOM   4225  C  C     . LEU B 1 174 ? 24.002  48.056 24.218 1.00 30.56  ? 233 LEU B C     1 
ATOM   4226  O  O     . LEU B 1 174 ? 23.977  48.708 23.181 1.00 28.98  ? 233 LEU B O     1 
ATOM   4227  C  CB    . LEU B 1 174 ? 25.924  48.178 25.841 1.00 28.98  ? 233 LEU B CB    1 
ATOM   4228  C  CG    . LEU B 1 174 ? 26.596  48.908 27.015 1.00 28.98  ? 233 LEU B CG    1 
ATOM   4229  C  CD1   . LEU B 1 174 ? 27.888  48.234 27.410 1.00 28.98  ? 233 LEU B CD1   1 
ATOM   4230  C  CD2   . LEU B 1 174 ? 26.856  50.352 26.664 1.00 28.98  ? 233 LEU B CD2   1 
ATOM   4231  H  H     . LEU B 1 174 ? 23.886  47.830 27.320 1.00 0.00   ? 233 LEU B H     1 
ATOM   4232  N  N     . ASN B 1 175 ? 23.488  46.827 24.305 1.00 26.08  ? 234 ASN B N     1 
ATOM   4233  C  CA    . ASN B 1 175 ? 22.940  46.096 23.144 1.00 26.08  ? 234 ASN B CA    1 
ATOM   4234  C  C     . ASN B 1 175 ? 21.810  46.828 22.457 1.00 26.08  ? 234 ASN B C     1 
ATOM   4235  O  O     . ASN B 1 175 ? 21.385  46.456 21.356 1.00 31.23  ? 234 ASN B O     1 
ATOM   4236  C  CB    . ASN B 1 175 ? 22.424  44.712 23.547 1.00 31.23  ? 234 ASN B CB    1 
ATOM   4237  C  CG    . ASN B 1 175 ? 23.487  43.624 23.466 1.00 31.23  ? 234 ASN B CG    1 
ATOM   4238  O  OD1   . ASN B 1 175 ? 23.249  42.489 23.882 1.00 31.23  ? 234 ASN B OD1   1 
ATOM   4239  N  ND2   . ASN B 1 175 ? 24.650  43.950 22.911 1.00 31.23  ? 234 ASN B ND2   1 
ATOM   4240  H  H     . ASN B 1 175 ? 23.462  46.407 25.188 1.00 0.00   ? 234 ASN B H     1 
ATOM   4241  H  HD21  . ASN B 1 175 ? 25.297  43.216 22.917 1.00 0.00   ? 234 ASN B HD21  1 
ATOM   4242  H  HD22  . ASN B 1 175 ? 24.842  44.833 22.543 1.00 0.00   ? 234 ASN B HD22  1 
ATOM   4243  N  N     . GLU B 1 176 ? 21.270  47.834 23.125 1.00 24.94  ? 235 GLU B N     1 
ATOM   4244  C  CA    . GLU B 1 176 ? 20.181  48.588 22.525 1.00 24.94  ? 235 GLU B CA    1 
ATOM   4245  C  C     . GLU B 1 176 ? 20.624  49.997 22.167 1.00 24.94  ? 235 GLU B C     1 
ATOM   4246  O  O     . GLU B 1 176 ? 19.813  50.899 22.026 1.00 50.06  ? 235 GLU B O     1 
ATOM   4247  C  CB    . GLU B 1 176 ? 18.959  48.586 23.452 1.00 50.06  ? 235 GLU B CB    1 
ATOM   4248  C  CG    . GLU B 1 176 ? 19.217  49.069 24.876 1.00 50.06  ? 235 GLU B CG    1 
ATOM   4249  C  CD    . GLU B 1 176 ? 18.061  48.768 25.821 1.00 50.06  ? 235 GLU B CD    1 
ATOM   4250  O  OE1   . GLU B 1 176 ? 17.452  47.687 25.698 1.00 50.06  ? 235 GLU B OE1   1 
ATOM   4251  O  OE2   . GLU B 1 176 ? 17.775  49.607 26.700 1.00 50.06  ? 235 GLU B OE2   1 
ATOM   4252  H  H     . GLU B 1 176 ? 21.575  48.077 24.021 1.00 0.00   ? 235 GLU B H     1 
ATOM   4253  N  N     . GLY B 1 177 ? 21.932  50.174 22.039 1.00 28.93  ? 236 GLY B N     1 
ATOM   4254  C  CA    . GLY B 1 177 ? 22.480  51.476 21.694 1.00 28.93  ? 236 GLY B CA    1 
ATOM   4255  C  C     . GLY B 1 177 ? 22.547  52.514 22.806 1.00 28.93  ? 236 GLY B C     1 
ATOM   4256  O  O     . GLY B 1 177 ? 23.022  53.638 22.600 1.00 50.12  ? 236 GLY B O     1 
ATOM   4257  H  H     . GLY B 1 177 ? 22.547  49.430 22.178 1.00 0.00   ? 236 GLY B H     1 
ATOM   4258  N  N     . ILE B 1 178 ? 22.048  52.164 23.983 1.00 48.53  ? 237 ILE B N     1 
ATOM   4259  C  CA    . ILE B 1 178 ? 22.105  53.094 25.092 1.00 48.53  ? 237 ILE B CA    1 
ATOM   4260  C  C     . ILE B 1 178 ? 23.543  53.015 25.613 1.00 48.53  ? 237 ILE B C     1 
ATOM   4261  O  O     . ILE B 1 178 ? 23.936  51.992 26.198 1.00 29.22  ? 237 ILE B O     1 
ATOM   4262  C  CB    . ILE B 1 178 ? 21.127  52.695 26.222 1.00 29.22  ? 237 ILE B CB    1 
ATOM   4263  C  CG1   . ILE B 1 178 ? 19.749  52.358 25.661 1.00 29.22  ? 237 ILE B CG1   1 
ATOM   4264  C  CG2   . ILE B 1 178 ? 20.991  53.839 27.206 1.00 29.22  ? 237 ILE B CG2   1 
ATOM   4265  C  CD1   . ILE B 1 178 ? 18.871  53.565 25.468 1.00 29.22  ? 237 ILE B CD1   1 
ATOM   4266  H  H     . ILE B 1 178 ? 21.673  51.273 24.134 1.00 0.00   ? 237 ILE B H     1 
ATOM   4267  N  N     . VAL B 1 179 ? 24.339  54.049 25.338 1.00 27.55  ? 238 VAL B N     1 
ATOM   4268  C  CA    . VAL B 1 179 ? 25.726  54.082 25.806 1.00 27.55  ? 238 VAL B CA    1 
ATOM   4269  C  C     . VAL B 1 179 ? 26.161  55.422 26.408 1.00 27.55  ? 238 VAL B C     1 
ATOM   4270  O  O     . VAL B 1 179 ? 26.622  56.322 25.709 1.00 30.55  ? 238 VAL B O     1 
ATOM   4271  C  CB    . VAL B 1 179 ? 26.723  53.586 24.710 1.00 30.55  ? 238 VAL B CB    1 
ATOM   4272  C  CG1   . VAL B 1 179 ? 26.240  53.965 23.318 1.00 30.55  ? 238 VAL B CG1   1 
ATOM   4273  C  CG2   . VAL B 1 179 ? 28.134  54.113 24.986 1.00 30.55  ? 238 VAL B CG2   1 
ATOM   4274  H  H     . VAL B 1 179 ? 24.005  54.794 24.792 1.00 0.00   ? 238 VAL B H     1 
ATOM   4275  N  N     . PRO B 1 180 ? 26.013  55.561 27.738 1.00 36.73  ? 239 PRO B N     1 
ATOM   4276  C  CA    . PRO B 1 180 ? 26.376  56.781 28.459 1.00 36.73  ? 239 PRO B CA    1 
ATOM   4277  C  C     . PRO B 1 180 ? 27.871  56.903 28.664 1.00 36.73  ? 239 PRO B C     1 
ATOM   4278  O  O     . PRO B 1 180 ? 28.642  55.981 28.348 1.00 39.07  ? 239 PRO B O     1 
ATOM   4279  C  CB    . PRO B 1 180 ? 25.672  56.593 29.803 1.00 39.07  ? 239 PRO B CB    1 
ATOM   4280  C  CG    . PRO B 1 180 ? 25.806  55.119 30.032 1.00 39.07  ? 239 PRO B CG    1 
ATOM   4281  C  CD    . PRO B 1 180 ? 25.457  54.552 28.665 1.00 39.07  ? 239 PRO B CD    1 
ATOM   4282  N  N     . THR B 1 181 ? 28.272  58.035 29.232 1.00 25.14  ? 240 THR B N     1 
ATOM   4283  C  CA    . THR B 1 181 ? 29.666  58.283 29.510 1.00 25.14  ? 240 THR B CA    1 
ATOM   4284  C  C     . THR B 1 181 ? 30.005  57.669 30.879 1.00 25.14  ? 240 THR B C     1 
ATOM   4285  O  O     . THR B 1 181 ? 31.166  57.317 31.148 1.00 49.00  ? 240 THR B O     1 
ATOM   4286  C  CB    . THR B 1 181 ? 29.982  59.804 29.483 1.00 49.00  ? 240 THR B CB    1 
ATOM   4287  O  OG1   . THR B 1 181 ? 29.266  60.483 30.523 1.00 49.00  ? 240 THR B OG1   1 
ATOM   4288  C  CG2   . THR B 1 181 ? 29.575  60.401 28.162 1.00 49.00  ? 240 THR B CG2   1 
ATOM   4289  H  H     . THR B 1 181 ? 27.594  58.691 29.475 1.00 0.00   ? 240 THR B H     1 
ATOM   4290  H  HG1   . THR B 1 181 ? 28.338  60.214 30.445 1.00 30.00  ? 240 THR B HG1   1 
ATOM   4291  N  N     . ALA B 1 182 ? 28.988  57.490 31.724 1.00 26.97  ? 241 ALA B N     1 
ATOM   4292  C  CA    . ALA B 1 182 ? 29.203  56.932 33.056 1.00 26.97  ? 241 ALA B CA    1 
ATOM   4293  C  C     . ALA B 1 182 ? 28.011  56.169 33.556 1.00 26.97  ? 241 ALA B C     1 
ATOM   4294  O  O     . ALA B 1 182 ? 26.899  56.302 33.029 1.00 22.25  ? 241 ALA B O     1 
ATOM   4295  C  CB    . ALA B 1 182 ? 29.535  58.025 34.051 1.00 22.25  ? 241 ALA B CB    1 
ATOM   4296  H  H     . ALA B 1 182 ? 28.057  57.698 31.474 1.00 0.00   ? 241 ALA B H     1 
ATOM   4297  N  N     . MET B 1 183 ? 28.250  55.426 34.634 1.00 2.00   ? 242 MET B N     1 
ATOM   4298  C  CA    . MET B 1 183 ? 27.234  54.609 35.301 1.00 2.00   ? 242 MET B CA    1 
ATOM   4299  C  C     . MET B 1 183 ? 27.305  54.751 36.834 1.00 2.00   ? 242 MET B C     1 
ATOM   4300  O  O     . MET B 1 183 ? 28.378  54.869 37.422 1.00 20.10  ? 242 MET B O     1 
ATOM   4301  C  CB    . MET B 1 183 ? 27.412  53.143 34.923 1.00 20.10  ? 242 MET B CB    1 
ATOM   4302  C  CG    . MET B 1 183 ? 26.679  52.736 33.692 1.00 20.10  ? 242 MET B CG    1 
ATOM   4303  S  SD    . MET B 1 183 ? 27.008  51.028 33.275 1.00 20.10  ? 242 MET B SD    1 
ATOM   4304  C  CE    . MET B 1 183 ? 25.668  50.147 34.131 1.00 20.10  ? 242 MET B CE    1 
ATOM   4305  H  H     . MET B 1 183 ? 29.142  55.425 35.033 1.00 0.00   ? 242 MET B H     1 
ATOM   4306  N  N     . LEU B 1 184 ? 26.146  54.745 37.465 1.00 19.37  ? 243 LEU B N     1 
ATOM   4307  C  CA    . LEU B 1 184 ? 26.056  54.796 38.916 1.00 19.37  ? 243 LEU B CA    1 
ATOM   4308  C  C     . LEU B 1 184 ? 25.450  53.455 39.238 1.00 19.37  ? 243 LEU B C     1 
ATOM   4309  O  O     . LEU B 1 184 ? 24.316  53.199 38.857 1.00 21.11  ? 243 LEU B O     1 
ATOM   4310  C  CB    . LEU B 1 184 ? 25.093  55.885 39.371 1.00 21.11  ? 243 LEU B CB    1 
ATOM   4311  C  CG    . LEU B 1 184 ? 25.609  57.310 39.424 1.00 21.11  ? 243 LEU B CG    1 
ATOM   4312  C  CD1   . LEU B 1 184 ? 24.429  58.242 39.642 1.00 21.11  ? 243 LEU B CD1   1 
ATOM   4313  C  CD2   . LEU B 1 184 ? 26.603  57.446 40.535 1.00 21.11  ? 243 LEU B CD2   1 
ATOM   4314  H  H     . LEU B 1 184 ? 25.322  54.690 36.935 1.00 0.00   ? 243 LEU B H     1 
ATOM   4315  N  N     . VAL B 1 185 ? 26.207  52.581 39.879 1.00 46.84  ? 244 VAL B N     1 
ATOM   4316  C  CA    . VAL B 1 185 ? 25.702  51.257 40.225 1.00 46.84  ? 244 VAL B CA    1 
ATOM   4317  C  C     . VAL B 1 185 ? 25.352  51.217 41.738 1.00 46.84  ? 244 VAL B C     1 
ATOM   4318  O  O     . VAL B 1 185 ? 26.018  51.878 42.566 1.00 23.50  ? 244 VAL B O     1 
ATOM   4319  C  CB    . VAL B 1 185 ? 26.721  50.176 39.789 1.00 23.50  ? 244 VAL B CB    1 
ATOM   4320  C  CG1   . VAL B 1 185 ? 26.167  48.802 39.967 1.00 23.50  ? 244 VAL B CG1   1 
ATOM   4321  C  CG2   . VAL B 1 185 ? 27.133  50.419 38.353 1.00 23.50  ? 244 VAL B CG2   1 
ATOM   4322  H  H     . VAL B 1 185 ? 27.098  52.837 40.183 1.00 0.00   ? 244 VAL B H     1 
ATOM   4323  N  N     . ALA B 1 186 ? 24.299  50.470 42.091 1.00 17.88  ? 245 ALA B N     1 
ATOM   4324  C  CA    . ALA B 1 186 ? 23.818  50.406 43.468 1.00 17.88  ? 245 ALA B CA    1 
ATOM   4325  C  C     . ALA B 1 186 ? 24.565  49.495 44.444 1.00 17.88  ? 245 ALA B C     1 
ATOM   4326  O  O     . ALA B 1 186 ? 24.160  49.316 45.589 1.00 16.84  ? 245 ALA B O     1 
ATOM   4327  C  CB    . ALA B 1 186 ? 22.343  50.112 43.455 1.00 16.84  ? 245 ALA B CB    1 
ATOM   4328  H  H     . ALA B 1 186 ? 23.824  49.957 41.400 1.00 0.00   ? 245 ALA B H     1 
ATOM   4329  N  N     . ASN B 1 187 ? 25.630  48.883 43.951 1.00 10.79  ? 246 ASN B N     1 
ATOM   4330  C  CA    . ASN B 1 187 ? 26.499  48.006 44.734 1.00 10.79  ? 246 ASN B CA    1 
ATOM   4331  C  C     . ASN B 1 187 ? 27.617  47.503 43.841 1.00 10.79  ? 246 ASN B C     1 
ATOM   4332  O  O     . ASN B 1 187 ? 27.542  47.551 42.609 1.00 14.04  ? 246 ASN B O     1 
ATOM   4333  C  CB    . ASN B 1 187 ? 25.769  46.861 45.430 1.00 14.04  ? 246 ASN B CB    1 
ATOM   4334  C  CG    . ASN B 1 187 ? 25.602  45.630 44.565 1.00 14.04  ? 246 ASN B CG    1 
ATOM   4335  O  OD1   . ASN B 1 187 ? 25.706  45.683 43.345 1.00 14.04  ? 246 ASN B OD1   1 
ATOM   4336  N  ND2   . ASN B 1 187 ? 25.302  44.508 45.204 1.00 14.04  ? 246 ASN B ND2   1 
ATOM   4337  H  H     . ASN B 1 187 ? 25.862  49.003 43.005 1.00 0.00   ? 246 ASN B H     1 
ATOM   4338  H  HD21  . ASN B 1 187 ? 25.189  43.659 44.718 1.00 0.00   ? 246 ASN B HD21  1 
ATOM   4339  H  HD22  . ASN B 1 187 ? 25.197  44.583 46.179 1.00 0.00   ? 246 ASN B HD22  1 
ATOM   4340  N  N     . ASP B 1 188 ? 28.696  47.102 44.476 1.00 22.96  ? 247 ASP B N     1 
ATOM   4341  C  CA    . ASP B 1 188 ? 29.867  46.657 43.773 1.00 22.96  ? 247 ASP B CA    1 
ATOM   4342  C  C     . ASP B 1 188 ? 29.767  45.311 43.080 1.00 22.96  ? 247 ASP B C     1 
ATOM   4343  O  O     . ASP B 1 188 ? 30.528  45.030 42.140 1.00 31.39  ? 247 ASP B O     1 
ATOM   4344  C  CB    . ASP B 1 188 ? 31.053  46.648 44.740 1.00 31.39  ? 247 ASP B CB    1 
ATOM   4345  C  CG    . ASP B 1 188 ? 31.282  47.992 45.400 1.00 31.39  ? 247 ASP B CG    1 
ATOM   4346  O  OD1   . ASP B 1 188 ? 30.888  49.041 44.845 1.00 31.39  ? 247 ASP B OD1   1 
ATOM   4347  O  OD2   . ASP B 1 188 ? 31.895  47.984 46.478 1.00 31.39  ? 247 ASP B OD2   1 
ATOM   4348  H  H     . ASP B 1 188 ? 28.688  47.134 45.456 1.00 0.00   ? 247 ASP B H     1 
ATOM   4349  N  N     . GLN B 1 189 ? 28.908  44.436 43.586 1.00 27.91  ? 248 GLN B N     1 
ATOM   4350  C  CA    . GLN B 1 189 ? 28.806  43.145 42.947 1.00 27.91  ? 248 GLN B CA    1 
ATOM   4351  C  C     . GLN B 1 189 ? 28.328  43.397 41.560 1.00 27.91  ? 248 GLN B C     1 
ATOM   4352  O  O     . GLN B 1 189 ? 28.958  42.923 40.638 1.00 2.00   ? 248 GLN B O     1 
ATOM   4353  C  CB    . GLN B 1 189 ? 27.885  42.198 43.679 1.00 2.00   ? 248 GLN B CB    1 
ATOM   4354  C  CG    . GLN B 1 189 ? 28.560  41.591 44.864 1.00 2.00   ? 248 GLN B CG    1 
ATOM   4355  C  CD    . GLN B 1 189 ? 27.782  40.447 45.426 1.00 2.00   ? 248 GLN B CD    1 
ATOM   4356  O  OE1   . GLN B 1 189 ? 27.424  40.439 46.614 1.00 2.00   ? 248 GLN B OE1   1 
ATOM   4357  N  NE2   . GLN B 1 189 ? 27.554  39.433 44.600 1.00 2.00   ? 248 GLN B NE2   1 
ATOM   4358  H  H     . GLN B 1 189 ? 28.348  44.646 44.359 1.00 0.00   ? 248 GLN B H     1 
ATOM   4359  N  N     . MET B 1 190 ? 27.329  44.270 41.415 1.00 2.00   ? 249 MET B N     1 
ATOM   4360  C  CA    . MET B 1 190 ? 26.766  44.613 40.110 1.00 2.00   ? 249 MET B CA    1 
ATOM   4361  C  C     . MET B 1 190 ? 27.778  45.458 39.355 1.00 2.00   ? 249 MET B C     1 
ATOM   4362  O  O     . MET B 1 190 ? 27.784  45.471 38.122 1.00 24.16  ? 249 MET B O     1 
ATOM   4363  C  CB    . MET B 1 190 ? 25.464  45.410 40.249 1.00 24.16  ? 249 MET B CB    1 
ATOM   4364  C  CG    . MET B 1 190 ? 24.373  44.732 41.010 1.00 24.16  ? 249 MET B CG    1 
ATOM   4365  S  SD    . MET B 1 190 ? 22.773  45.433 40.633 1.00 24.16  ? 249 MET B SD    1 
ATOM   4366  C  CE    . MET B 1 190 ? 22.647  46.703 41.825 1.00 24.16  ? 249 MET B CE    1 
ATOM   4367  H  H     . MET B 1 190 ? 26.947  44.714 42.198 1.00 0.00   ? 249 MET B H     1 
ATOM   4368  N  N     . ALA B 1 191 ? 28.594  46.222 40.078 1.00 28.14  ? 250 ALA B N     1 
ATOM   4369  C  CA    . ALA B 1 191 ? 29.590  47.047 39.410 1.00 28.14  ? 250 ALA B CA    1 
ATOM   4370  C  C     . ALA B 1 191 ? 30.493  46.123 38.600 1.00 28.14  ? 250 ALA B C     1 
ATOM   4371  O  O     . ALA B 1 191 ? 30.808  46.416 37.456 1.00 35.82  ? 250 ALA B O     1 
ATOM   4372  C  CB    . ALA B 1 191 ? 30.391  47.862 40.420 1.00 35.82  ? 250 ALA B CB    1 
ATOM   4373  H  H     . ALA B 1 191 ? 28.483  46.247 41.046 1.00 0.00   ? 250 ALA B H     1 
ATOM   4374  N  N     . LEU B 1 192 ? 30.825  44.967 39.168 1.00 19.16  ? 251 LEU B N     1 
ATOM   4375  C  CA    . LEU B 1 192 ? 31.683  43.982 38.519 1.00 19.16  ? 251 LEU B CA    1 
ATOM   4376  C  C     . LEU B 1 192 ? 31.150  43.530 37.161 1.00 19.16  ? 251 LEU B C     1 
ATOM   4377  O  O     . LEU B 1 192 ? 31.869  43.532 36.163 1.00 24.02  ? 251 LEU B O     1 
ATOM   4378  C  CB    . LEU B 1 192 ? 31.851  42.774 39.416 1.00 24.02  ? 251 LEU B CB    1 
ATOM   4379  C  CG    . LEU B 1 192 ? 32.816  41.713 38.912 1.00 24.02  ? 251 LEU B CG    1 
ATOM   4380  C  CD1   . LEU B 1 192 ? 34.191  42.340 38.639 1.00 24.02  ? 251 LEU B CD1   1 
ATOM   4381  C  CD2   . LEU B 1 192 ? 32.937  40.594 39.944 1.00 24.02  ? 251 LEU B CD2   1 
ATOM   4382  H  H     . LEU B 1 192 ? 30.483  44.769 40.066 1.00 0.00   ? 251 LEU B H     1 
ATOM   4383  N  N     . GLY B 1 193 ? 29.888  43.141 37.118 1.00 19.50  ? 252 GLY B N     1 
ATOM   4384  C  CA    . GLY B 1 193 ? 29.294  42.699 35.865 1.00 19.50  ? 252 GLY B CA    1 
ATOM   4385  C  C     . GLY B 1 193 ? 29.238  43.834 34.860 1.00 19.50  ? 252 GLY B C     1 
ATOM   4386  O  O     . GLY B 1 193 ? 29.511  43.623 33.680 1.00 47.36  ? 252 GLY B O     1 
ATOM   4387  H  H     . GLY B 1 193 ? 29.356  43.158 37.940 1.00 0.00   ? 252 GLY B H     1 
ATOM   4388  N  N     . ALA B 1 194 ? 28.894  45.038 35.326 1.00 28.87  ? 253 ALA B N     1 
ATOM   4389  C  CA    . ALA B 1 194 ? 28.824  46.224 34.478 1.00 28.87  ? 253 ALA B CA    1 
ATOM   4390  C  C     . ALA B 1 194 ? 30.166  46.437 33.811 1.00 28.87  ? 253 ALA B C     1 
ATOM   4391  O  O     . ALA B 1 194 ? 30.215  46.620 32.614 1.00 29.95  ? 253 ALA B O     1 
ATOM   4392  C  CB    . ALA B 1 194 ? 28.436  47.430 35.291 1.00 29.95  ? 253 ALA B CB    1 
ATOM   4393  H  H     . ALA B 1 194 ? 28.671  45.148 36.276 1.00 0.00   ? 253 ALA B H     1 
ATOM   4394  N  N     . MET B 1 195 ? 31.256  46.387 34.576 1.00 29.04  ? 254 MET B N     1 
ATOM   4395  C  CA    . MET B 1 195 ? 32.611  46.534 34.029 1.00 29.04  ? 254 MET B CA    1 
ATOM   4396  C  C     . MET B 1 195 ? 32.879  45.416 33.013 1.00 29.04  ? 254 MET B C     1 
ATOM   4397  O  O     . MET B 1 195 ? 33.479  45.634 31.954 1.00 25.10  ? 254 MET B O     1 
ATOM   4398  C  CB    . MET B 1 195 ? 33.653  46.431 35.141 1.00 25.10  ? 254 MET B CB    1 
ATOM   4399  C  CG    . MET B 1 195 ? 33.548  47.507 36.218 1.00 25.10  ? 254 MET B CG    1 
ATOM   4400  S  SD    . MET B 1 195 ? 34.944  47.479 37.376 1.00 25.10  ? 254 MET B SD    1 
ATOM   4401  C  CE    . MET B 1 195 ? 34.140  47.269 38.819 1.00 25.10  ? 254 MET B CE    1 
ATOM   4402  H  H     . MET B 1 195 ? 31.128  46.253 35.537 1.00 0.00   ? 254 MET B H     1 
ATOM   4403  N  N     . ARG B 1 196 ? 32.485  44.204 33.385 1.00 32.82  ? 255 ARG B N     1 
ATOM   4404  C  CA    . ARG B 1 196 ? 32.636  43.014 32.552 1.00 32.82  ? 255 ARG B CA    1 
ATOM   4405  C  C     . ARG B 1 196 ? 31.874  43.154 31.246 1.00 32.82  ? 255 ARG B C     1 
ATOM   4406  O  O     . ARG B 1 196 ? 32.333  42.702 30.213 1.00 43.81  ? 255 ARG B O     1 
ATOM   4407  C  CB    . ARG B 1 196 ? 32.115  41.781 33.322 1.00 43.81  ? 255 ARG B CB    1 
ATOM   4408  C  CG    . ARG B 1 196 ? 31.707  40.583 32.468 1.00 43.81  ? 255 ARG B CG    1 
ATOM   4409  C  CD    . ARG B 1 196 ? 32.873  40.010 31.692 1.00 43.81  ? 255 ARG B CD    1 
ATOM   4410  N  NE    . ARG B 1 196 ? 32.436  39.047 30.694 1.00 43.81  ? 255 ARG B NE    1 
ATOM   4411  C  CZ    . ARG B 1 196 ? 32.497  37.733 30.856 1.00 43.81  ? 255 ARG B CZ    1 
ATOM   4412  N  NH1   . ARG B 1 196 ? 32.982  37.228 31.973 1.00 43.81  ? 255 ARG B NH1   1 
ATOM   4413  N  NH2   . ARG B 1 196 ? 32.046  36.919 29.916 1.00 43.81  ? 255 ARG B NH2   1 
ATOM   4414  H  H     . ARG B 1 196 ? 32.082  44.092 34.271 1.00 0.00   ? 255 ARG B H     1 
ATOM   4415  H  HE    . ARG B 1 196 ? 32.073  39.388 29.850 1.00 0.00   ? 255 ARG B HE    1 
ATOM   4416  H  HH11  . ARG B 1 196 ? 33.307  37.817 32.713 1.00 0.00   ? 255 ARG B HH11  1 
ATOM   4417  H  HH12  . ARG B 1 196 ? 33.018  36.233 32.079 1.00 0.00   ? 255 ARG B HH12  1 
ATOM   4418  H  HH21  . ARG B 1 196 ? 31.655  37.302 29.078 1.00 0.00   ? 255 ARG B HH21  1 
ATOM   4419  H  HH22  . ARG B 1 196 ? 32.093  35.929 30.039 1.00 0.00   ? 255 ARG B HH22  1 
ATOM   4420  N  N     . ALA B 1 197 ? 30.723  43.810 31.308 1.00 19.30  ? 256 ALA B N     1 
ATOM   4421  C  CA    . ALA B 1 197 ? 29.848  43.995 30.149 1.00 19.30  ? 256 ALA B CA    1 
ATOM   4422  C  C     . ALA B 1 197 ? 30.402  45.018 29.210 1.00 19.30  ? 256 ALA B C     1 
ATOM   4423  O  O     . ALA B 1 197 ? 30.404  44.837 27.991 1.00 36.37  ? 256 ALA B O     1 
ATOM   4424  C  CB    . ALA B 1 197 ? 28.460  44.413 30.593 1.00 36.37  ? 256 ALA B CB    1 
ATOM   4425  H  H     . ALA B 1 197 ? 30.451  44.190 32.163 1.00 0.00   ? 256 ALA B H     1 
ATOM   4426  N  N     . ILE B 1 198 ? 30.843  46.116 29.802 1.00 45.18  ? 257 ILE B N     1 
ATOM   4427  C  CA    . ILE B 1 198 ? 31.418  47.241 29.086 1.00 45.18  ? 257 ILE B CA    1 
ATOM   4428  C  C     . ILE B 1 198 ? 32.631  46.718 28.309 1.00 45.18  ? 257 ILE B C     1 
ATOM   4429  O  O     . ILE B 1 198 ? 32.666  46.781 27.072 1.00 27.38  ? 257 ILE B O     1 
ATOM   4430  C  CB    . ILE B 1 198 ? 31.810  48.333 30.114 1.00 27.38  ? 257 ILE B CB    1 
ATOM   4431  C  CG1   . ILE B 1 198 ? 30.550  48.894 30.757 1.00 27.38  ? 257 ILE B CG1   1 
ATOM   4432  C  CG2   . ILE B 1 198 ? 32.609  49.439 29.483 1.00 27.38  ? 257 ILE B CG2   1 
ATOM   4433  C  CD1   . ILE B 1 198 ? 30.831  49.754 31.928 1.00 27.38  ? 257 ILE B CD1   1 
ATOM   4434  H  H     . ILE B 1 198 ? 30.785  46.169 30.780 1.00 0.00   ? 257 ILE B H     1 
ATOM   4435  N  N     . THR B 1 199 ? 33.585  46.137 29.028 1.00 31.15  ? 258 THR B N     1 
ATOM   4436  C  CA    . THR B 1 199 ? 34.775  45.600 28.403 1.00 31.15  ? 258 THR B CA    1 
ATOM   4437  C  C     . THR B 1 199 ? 34.333  44.663 27.295 1.00 31.15  ? 258 THR B C     1 
ATOM   4438  O  O     . THR B 1 199 ? 34.637  44.903 26.127 1.00 46.90  ? 258 THR B O     1 
ATOM   4439  C  CB    . THR B 1 199 ? 35.617  44.849 29.413 1.00 46.90  ? 258 THR B CB    1 
ATOM   4440  O  OG1   . THR B 1 199 ? 34.779  43.939 30.136 1.00 46.90  ? 258 THR B OG1   1 
ATOM   4441  C  CG2   . THR B 1 199 ? 36.244  45.829 30.384 1.00 46.90  ? 258 THR B CG2   1 
ATOM   4442  H  H     . THR B 1 199 ? 33.492  46.039 29.998 1.00 0.00   ? 258 THR B H     1 
ATOM   4443  H  HG1   . THR B 1 199 ? 34.609  44.280 31.027 1.00 30.00  ? 258 THR B HG1   1 
ATOM   4444  N  N     . GLU B 1 200 ? 33.519  43.676 27.664 1.00 25.90  ? 259 GLU B N     1 
ATOM   4445  C  CA    . GLU B 1 200 ? 32.946  42.679 26.744 1.00 25.90  ? 259 GLU B CA    1 
ATOM   4446  C  C     . GLU B 1 200 ? 32.435  43.276 25.424 1.00 25.90  ? 259 GLU B C     1 
ATOM   4447  O  O     . GLU B 1 200 ? 32.222  42.553 24.452 1.00 63.42  ? 259 GLU B O     1 
ATOM   4448  C  CB    . GLU B 1 200 ? 31.782  41.965 27.434 1.00 63.42  ? 259 GLU B CB    1 
ATOM   4449  C  CG    . GLU B 1 200 ? 31.224  40.770 26.690 1.00 63.42  ? 259 GLU B CG    1 
ATOM   4450  C  CD    . GLU B 1 200 ? 32.129  39.554 26.756 1.00 63.42  ? 259 GLU B CD    1 
ATOM   4451  O  OE1   . GLU B 1 200 ? 33.018  39.505 27.640 1.00 63.42  ? 259 GLU B OE1   1 
ATOM   4452  O  OE2   . GLU B 1 200 ? 31.943  38.637 25.923 1.00 63.42  ? 259 GLU B OE2   1 
ATOM   4453  H  H     . GLU B 1 200 ? 33.303  43.586 28.620 1.00 0.00   ? 259 GLU B H     1 
ATOM   4454  N  N     . SER B 1 201 ? 32.209  44.590 25.414 1.00 43.04  ? 260 SER B N     1 
ATOM   4455  C  CA    . SER B 1 201 ? 31.730  45.305 24.233 1.00 43.04  ? 260 SER B CA    1 
ATOM   4456  C  C     . SER B 1 201 ? 32.835  46.196 23.711 1.00 43.04  ? 260 SER B C     1 
ATOM   4457  O  O     . SER B 1 201 ? 32.569  47.306 23.241 1.00 31.77  ? 260 SER B O     1 
ATOM   4458  C  CB    . SER B 1 201 ? 30.550  46.188 24.600 1.00 31.77  ? 260 SER B CB    1 
ATOM   4459  O  OG    . SER B 1 201 ? 29.765  45.583 25.608 1.00 31.77  ? 260 SER B OG    1 
ATOM   4460  H  H     . SER B 1 201 ? 32.355  45.123 26.213 1.00 0.00   ? 260 SER B H     1 
ATOM   4461  H  HG    . SER B 1 201 ? 30.348  45.201 26.261 1.00 30.00  ? 260 SER B HG    1 
ATOM   4462  N  N     . GLY B 1 202 ? 34.073  45.720 23.815 1.00 22.31  ? 261 GLY B N     1 
ATOM   4463  C  CA    . GLY B 1 202 ? 35.199  46.502 23.350 1.00 22.31  ? 261 GLY B CA    1 
ATOM   4464  C  C     . GLY B 1 202 ? 35.059  47.942 23.817 1.00 22.31  ? 261 GLY B C     1 
ATOM   4465  O  O     . GLY B 1 202 ? 35.092  48.879 23.018 1.00 44.36  ? 261 GLY B O     1 
ATOM   4466  H  H     . GLY B 1 202 ? 34.215  44.848 24.229 1.00 0.00   ? 261 GLY B H     1 
ATOM   4467  N  N     . LEU B 1 203 ? 34.799  48.116 25.106 1.00 39.91  ? 262 LEU B N     1 
ATOM   4468  C  CA    . LEU B 1 203 ? 34.663  49.450 25.676 1.00 39.91  ? 262 LEU B CA    1 
ATOM   4469  C  C     . LEU B 1 203 ? 35.614  49.490 26.855 1.00 39.91  ? 262 LEU B C     1 
ATOM   4470  O  O     . LEU B 1 203 ? 35.859  48.462 27.491 1.00 40.87  ? 262 LEU B O     1 
ATOM   4471  C  CB    . LEU B 1 203 ? 33.219  49.706 26.105 1.00 40.87  ? 262 LEU B CB    1 
ATOM   4472  C  CG    . LEU B 1 203 ? 32.282  50.353 25.088 1.00 40.87  ? 262 LEU B CG    1 
ATOM   4473  C  CD1   . LEU B 1 203 ? 30.864  49.941 25.365 1.00 40.87  ? 262 LEU B CD1   1 
ATOM   4474  C  CD2   . LEU B 1 203 ? 32.414  51.854 25.171 1.00 40.87  ? 262 LEU B CD2   1 
ATOM   4475  H  H     . LEU B 1 203 ? 34.692  47.336 25.694 1.00 0.00   ? 262 LEU B H     1 
ATOM   4476  N  N     . ARG B 1 204 ? 36.170  50.660 27.135 1.00 22.57  ? 263 ARG B N     1 
ATOM   4477  C  CA    . ARG B 1 204 ? 37.135  50.794 28.219 1.00 22.57  ? 263 ARG B CA    1 
ATOM   4478  C  C     . ARG B 1 204 ? 36.541  51.415 29.487 1.00 22.57  ? 263 ARG B C     1 
ATOM   4479  O  O     . ARG B 1 204 ? 35.950  52.481 29.434 1.00 45.96  ? 263 ARG B O     1 
ATOM   4480  C  CB    . ARG B 1 204 ? 38.337  51.636 27.737 1.00 45.96  ? 263 ARG B CB    1 
ATOM   4481  C  CG    . ARG B 1 204 ? 39.183  51.031 26.577 1.00 45.96  ? 263 ARG B CG    1 
ATOM   4482  C  CD    . ARG B 1 204 ? 39.430  52.033 25.443 1.00 45.96  ? 263 ARG B CD    1 
ATOM   4483  N  NE    . ARG B 1 204 ? 40.324  53.144 25.788 1.00 45.96  ? 263 ARG B NE    1 
ATOM   4484  C  CZ    . ARG B 1 204 ? 40.075  54.431 25.524 1.00 45.96  ? 263 ARG B CZ    1 
ATOM   4485  N  NH1   . ARG B 1 204 ? 38.953  54.784 24.926 1.00 45.96  ? 263 ARG B NH1   1 
ATOM   4486  N  NH2   . ARG B 1 204 ? 40.977  55.371 25.791 1.00 45.96  ? 263 ARG B NH2   1 
ATOM   4487  H  H     . ARG B 1 204 ? 35.898  51.436 26.621 1.00 0.00   ? 263 ARG B H     1 
ATOM   4488  H  HE    . ARG B 1 204 ? 41.157  52.930 26.254 1.00 0.00   ? 263 ARG B HE    1 
ATOM   4489  H  HH11  . ARG B 1 204 ? 38.289  54.083 24.664 1.00 0.00   ? 263 ARG B HH11  1 
ATOM   4490  H  HH12  . ARG B 1 204 ? 38.765  55.745 24.733 1.00 0.00   ? 263 ARG B HH12  1 
ATOM   4491  H  HH21  . ARG B 1 204 ? 41.861  55.116 26.184 1.00 0.00   ? 263 ARG B HH21  1 
ATOM   4492  H  HH22  . ARG B 1 204 ? 40.776  56.328 25.587 1.00 0.00   ? 263 ARG B HH22  1 
ATOM   4493  N  N     . VAL B 1 205 ? 36.710  50.748 30.623 1.00 26.44  ? 264 VAL B N     1 
ATOM   4494  C  CA    . VAL B 1 205 ? 36.213  51.252 31.906 1.00 26.44  ? 264 VAL B CA    1 
ATOM   4495  C  C     . VAL B 1 205 ? 37.004  52.496 32.329 1.00 26.44  ? 264 VAL B C     1 
ATOM   4496  O  O     . VAL B 1 205 ? 38.229  52.519 32.254 1.00 24.85  ? 264 VAL B O     1 
ATOM   4497  C  CB    . VAL B 1 205 ? 36.349  50.173 33.024 1.00 24.85  ? 264 VAL B CB    1 
ATOM   4498  C  CG1   . VAL B 1 205 ? 35.993  50.756 34.369 1.00 24.85  ? 264 VAL B CG1   1 
ATOM   4499  C  CG2   . VAL B 1 205 ? 35.462  48.972 32.721 1.00 24.85  ? 264 VAL B CG2   1 
ATOM   4500  H  H     . VAL B 1 205 ? 37.197  49.902 30.603 1.00 0.00   ? 264 VAL B H     1 
ATOM   4501  N  N     . GLY B 1 206 ? 36.297  53.517 32.798 1.00 22.63  ? 265 GLY B N     1 
ATOM   4502  C  CA    . GLY B 1 206 ? 36.928  54.757 33.231 1.00 22.63  ? 265 GLY B CA    1 
ATOM   4503  C  C     . GLY B 1 206 ? 37.188  55.676 32.057 1.00 22.63  ? 265 GLY B C     1 
ATOM   4504  O  O     . GLY B 1 206 ? 36.694  56.805 32.006 1.00 46.54  ? 265 GLY B O     1 
ATOM   4505  H  H     . GLY B 1 206 ? 35.341  53.421 32.879 1.00 0.00   ? 265 GLY B H     1 
ATOM   4506  N  N     . ALA B 1 207 ? 37.959  55.153 31.107 1.00 56.04  ? 266 ALA B N     1 
ATOM   4507  C  CA    . ALA B 1 207 ? 38.333  55.850 29.885 1.00 56.04  ? 266 ALA B CA    1 
ATOM   4508  C  C     . ALA B 1 207 ? 37.076  56.146 29.065 1.00 56.04  ? 266 ALA B C     1 
ATOM   4509  O  O     . ALA B 1 207 ? 36.770  57.310 28.774 1.00 27.57  ? 266 ALA B O     1 
ATOM   4510  C  CB    . ALA B 1 207 ? 39.302  54.979 29.089 1.00 27.57  ? 266 ALA B CB    1 
ATOM   4511  H  H     . ALA B 1 207 ? 38.307  54.251 31.256 1.00 0.00   ? 266 ALA B H     1 
ATOM   4512  N  N     . ASP B 1 208 ? 36.377  55.073 28.686 1.00 40.83  ? 267 ASP B N     1 
ATOM   4513  C  CA    . ASP B 1 208 ? 35.137  55.144 27.918 1.00 40.83  ? 267 ASP B CA    1 
ATOM   4514  C  C     . ASP B 1 208 ? 33.914  55.234 28.850 1.00 40.83  ? 267 ASP B C     1 
ATOM   4515  O  O     . ASP B 1 208 ? 33.237  56.261 28.907 1.00 32.09  ? 267 ASP B O     1 
ATOM   4516  C  CB    . ASP B 1 208 ? 35.014  53.918 27.000 1.00 32.09  ? 267 ASP B CB    1 
ATOM   4517  C  CG    . ASP B 1 208 ? 35.998  53.944 25.816 1.00 32.09  ? 267 ASP B CG    1 
ATOM   4518  O  OD1   . ASP B 1 208 ? 36.448  55.038 25.423 1.00 32.09  ? 267 ASP B OD1   1 
ATOM   4519  O  OD2   . ASP B 1 208 ? 36.288  52.871 25.242 1.00 32.09  ? 267 ASP B OD2   1 
ATOM   4520  H  H     . ASP B 1 208 ? 36.706  54.198 28.953 1.00 0.00   ? 267 ASP B H     1 
ATOM   4521  N  N     . ILE B 1 209 ? 33.644  54.164 29.594 1.00 17.29  ? 268 ILE B N     1 
ATOM   4522  C  CA    . ILE B 1 209 ? 32.517  54.143 30.517 1.00 17.29  ? 268 ILE B CA    1 
ATOM   4523  C  C     . ILE B 1 209 ? 32.950  54.156 31.982 1.00 17.29  ? 268 ILE B C     1 
ATOM   4524  O  O     . ILE B 1 209 ? 33.635  53.251 32.435 1.00 25.21  ? 268 ILE B O     1 
ATOM   4525  C  CB    . ILE B 1 209 ? 31.637  52.920 30.265 1.00 25.21  ? 268 ILE B CB    1 
ATOM   4526  C  CG1   . ILE B 1 209 ? 31.248  52.877 28.784 1.00 25.21  ? 268 ILE B CG1   1 
ATOM   4527  C  CG2   . ILE B 1 209 ? 30.409  52.975 31.139 1.00 25.21  ? 268 ILE B CG2   1 
ATOM   4528  C  CD1   . ILE B 1 209 ? 30.144  51.918 28.452 1.00 25.21  ? 268 ILE B CD1   1 
ATOM   4529  H  H     . ILE B 1 209 ? 34.224  53.378 29.560 1.00 0.00   ? 268 ILE B H     1 
ATOM   4530  N  N     . SER B 1 210 ? 32.608  55.220 32.707 1.00 40.39  ? 269 SER B N     1 
ATOM   4531  C  CA    . SER B 1 210 ? 32.946  55.308 34.128 1.00 40.39  ? 269 SER B CA    1 
ATOM   4532  C  C     . SER B 1 210 ? 31.906  54.538 34.950 1.00 40.39  ? 269 SER B C     1 
ATOM   4533  O  O     . SER B 1 210 ? 30.727  54.490 34.601 1.00 17.79  ? 269 SER B O     1 
ATOM   4534  C  CB    . SER B 1 210 ? 33.006  56.771 34.595 1.00 17.79  ? 269 SER B CB    1 
ATOM   4535  O  OG    . SER B 1 210 ? 34.087  57.489 34.002 1.00 17.79  ? 269 SER B OG    1 
ATOM   4536  H  H     . SER B 1 210 ? 32.113  55.935 32.257 1.00 0.00   ? 269 SER B H     1 
ATOM   4537  H  HG    . SER B 1 210 ? 34.174  57.300 33.050 1.00 30.00  ? 269 SER B HG    1 
ATOM   4538  N  N     . VAL B 1 211 ? 32.346  53.942 36.051 1.00 17.26  ? 270 VAL B N     1 
ATOM   4539  C  CA    . VAL B 1 211 ? 31.472  53.167 36.925 1.00 17.26  ? 270 VAL B CA    1 
ATOM   4540  C  C     . VAL B 1 211 ? 31.739  53.561 38.352 1.00 17.26  ? 270 VAL B C     1 
ATOM   4541  O  O     . VAL B 1 211 ? 32.888  53.693 38.753 1.00 20.23  ? 270 VAL B O     1 
ATOM   4542  C  CB    . VAL B 1 211 ? 31.750  51.661 36.801 1.00 20.23  ? 270 VAL B CB    1 
ATOM   4543  C  CG1   . VAL B 1 211 ? 30.877  50.875 37.782 1.00 20.23  ? 270 VAL B CG1   1 
ATOM   4544  C  CG2   . VAL B 1 211 ? 31.514  51.208 35.366 1.00 20.23  ? 270 VAL B CG2   1 
ATOM   4545  H  H     . VAL B 1 211 ? 33.274  54.043 36.345 1.00 0.00   ? 270 VAL B H     1 
ATOM   4546  N  N     . VAL B 1 212 ? 30.677  53.745 39.117 1.00 20.58  ? 271 VAL B N     1 
ATOM   4547  C  CA    . VAL B 1 212 ? 30.787  54.103 40.518 1.00 20.58  ? 271 VAL B CA    1 
ATOM   4548  C  C     . VAL B 1 212 ? 29.914  53.095 41.290 1.00 20.58  ? 271 VAL B C     1 
ATOM   4549  O  O     . VAL B 1 212 ? 28.702  53.060 41.108 1.00 26.60  ? 271 VAL B O     1 
ATOM   4550  C  CB    . VAL B 1 212 ? 30.281  55.551 40.741 1.00 26.60  ? 271 VAL B CB    1 
ATOM   4551  C  CG1   . VAL B 1 212 ? 30.377  55.937 42.205 1.00 26.60  ? 271 VAL B CG1   1 
ATOM   4552  C  CG2   . VAL B 1 212 ? 31.078  56.518 39.880 1.00 26.60  ? 271 VAL B CG2   1 
ATOM   4553  H  H     . VAL B 1 212 ? 29.771  53.652 38.747 1.00 0.00   ? 271 VAL B H     1 
ATOM   4554  N  N     . GLY B 1 213 ? 30.518  52.232 42.096 1.00 13.78  ? 272 GLY B N     1 
ATOM   4555  C  CA    . GLY B 1 213 ? 29.720  51.268 42.832 1.00 13.78  ? 272 GLY B CA    1 
ATOM   4556  C  C     . GLY B 1 213 ? 29.293  51.769 44.196 1.00 13.78  ? 272 GLY B C     1 
ATOM   4557  O  O     . GLY B 1 213 ? 29.656  52.874 44.584 1.00 62.07  ? 272 GLY B O     1 
ATOM   4558  H  H     . GLY B 1 213 ? 31.488  52.296 42.223 1.00 0.00   ? 272 GLY B H     1 
ATOM   4559  N  N     . TYR B 1 214 ? 28.621  50.932 44.977 1.00 25.26  ? 273 TYR B N     1 
ATOM   4560  C  CA    . TYR B 1 214 ? 28.163  51.343 46.293 1.00 25.26  ? 273 TYR B CA    1 
ATOM   4561  C  C     . TYR B 1 214 ? 28.378  50.222 47.282 1.00 25.26  ? 273 TYR B C     1 
ATOM   4562  O  O     . TYR B 1 214 ? 27.937  49.121 47.015 1.00 22.84  ? 273 TYR B O     1 
ATOM   4563  C  CB    . TYR B 1 214 ? 26.682  51.649 46.215 1.00 22.84  ? 273 TYR B CB    1 
ATOM   4564  C  CG    . TYR B 1 214 ? 26.204  52.704 47.160 1.00 22.84  ? 273 TYR B CG    1 
ATOM   4565  C  CD1   . TYR B 1 214 ? 26.283  52.515 48.533 1.00 22.84  ? 273 TYR B CD1   1 
ATOM   4566  C  CD2   . TYR B 1 214 ? 25.590  53.862 46.688 1.00 22.84  ? 273 TYR B CD2   1 
ATOM   4567  C  CE1   . TYR B 1 214 ? 25.749  53.451 49.426 1.00 22.84  ? 273 TYR B CE1   1 
ATOM   4568  C  CE2   . TYR B 1 214 ? 25.053  54.801 47.563 1.00 22.84  ? 273 TYR B CE2   1 
ATOM   4569  C  CZ    . TYR B 1 214 ? 25.135  54.586 48.933 1.00 22.84  ? 273 TYR B CZ    1 
ATOM   4570  O  OH    . TYR B 1 214 ? 24.599  55.488 49.832 1.00 22.84  ? 273 TYR B OH    1 
ATOM   4571  H  H     . TYR B 1 214 ? 28.403  50.030 44.680 1.00 0.00   ? 273 TYR B H     1 
ATOM   4572  H  HH    . TYR B 1 214 ? 24.829  55.220 50.723 1.00 0.00   ? 273 TYR B HH    1 
ATOM   4573  N  N     . ASP B 1 215 ? 29.117  50.500 48.363 1.00 17.41  ? 274 ASP B N     1 
ATOM   4574  C  CA    . ASP B 1 215 ? 29.426  49.583 49.461 1.00 17.41  ? 274 ASP B CA    1 
ATOM   4575  C  C     . ASP B 1 215 ? 30.868  49.611 49.908 1.00 17.41  ? 274 ASP B C     1 
ATOM   4576  O  O     . ASP B 1 215 ? 31.190  49.976 51.032 1.00 21.33  ? 274 ASP B O     1 
ATOM   4577  C  CB    . ASP B 1 215 ? 29.134  48.127 49.110 1.00 21.33  ? 274 ASP B CB    1 
ATOM   4578  C  CG    . ASP B 1 215 ? 27.731  47.734 49.383 1.00 21.33  ? 274 ASP B CG    1 
ATOM   4579  O  OD1   . ASP B 1 215 ? 27.130  48.360 50.254 1.00 21.33  ? 274 ASP B OD1   1 
ATOM   4580  O  OD2   . ASP B 1 215 ? 27.226  46.809 48.724 1.00 21.33  ? 274 ASP B OD2   1 
ATOM   4581  H  H     . ASP B 1 215 ? 29.501  51.394 48.453 1.00 0.00   ? 274 ASP B H     1 
ATOM   4582  N  N     . ASP B 1 216 ? 31.694  49.085 49.012 1.00 24.78  ? 275 ASP B N     1 
ATOM   4583  C  CA    . ASP B 1 216 ? 33.134  48.844 49.136 1.00 24.78  ? 275 ASP B CA    1 
ATOM   4584  C  C     . ASP B 1 216 ? 33.392  47.492 49.802 1.00 24.78  ? 275 ASP B C     1 
ATOM   4585  O  O     . ASP B 1 216 ? 34.003  47.409 50.860 1.00 23.65  ? 275 ASP B O     1 
ATOM   4586  C  CB    . ASP B 1 216 ? 33.920  49.943 49.829 1.00 23.65  ? 275 ASP B CB    1 
ATOM   4587  C  CG    . ASP B 1 216 ? 35.408  49.850 49.529 1.00 23.65  ? 275 ASP B CG    1 
ATOM   4588  O  OD1   . ASP B 1 216 ? 35.767  49.384 48.430 1.00 23.65  ? 275 ASP B OD1   1 
ATOM   4589  O  OD2   . ASP B 1 216 ? 36.242  50.209 50.383 1.00 23.65  ? 275 ASP B OD2   1 
ATOM   4590  H  H     . ASP B 1 216 ? 31.284  48.866 48.161 1.00 0.00   ? 275 ASP B H     1 
ATOM   4591  N  N     . THR B 1 217 ? 32.884  46.422 49.191 1.00 5.76   ? 276 THR B N     1 
ATOM   4592  C  CA    . THR B 1 217 ? 33.116  45.107 49.729 1.00 5.76   ? 276 THR B CA    1 
ATOM   4593  C  C     . THR B 1 217 ? 34.600  44.679 49.582 1.00 5.76   ? 276 THR B C     1 
ATOM   4594  O  O     . THR B 1 217 ? 35.388  45.312 48.857 1.00 26.35  ? 276 THR B O     1 
ATOM   4595  C  CB    . THR B 1 217 ? 32.101  44.075 49.178 1.00 26.35  ? 276 THR B CB    1 
ATOM   4596  O  OG1   . THR B 1 217 ? 31.937  44.213 47.757 1.00 26.35  ? 276 THR B OG1   1 
ATOM   4597  C  CG2   . THR B 1 217 ? 30.756  44.275 49.872 1.00 26.35  ? 276 THR B CG2   1 
ATOM   4598  H  H     . THR B 1 217 ? 32.368  46.514 48.365 1.00 0.00   ? 276 THR B H     1 
ATOM   4599  H  HG1   . THR B 1 217 ? 32.762  44.305 47.264 1.00 30.00  ? 276 THR B HG1   1 
ATOM   4600  N  N     . GLU B 1 218 ? 35.015  43.655 50.322 1.00 18.02  ? 277 GLU B N     1 
ATOM   4601  C  CA    . GLU B 1 218 ? 36.410  43.228 50.267 1.00 18.02  ? 277 GLU B CA    1 
ATOM   4602  C  C     . GLU B 1 218 ? 37.092  43.204 48.889 1.00 18.02  ? 277 GLU B C     1 
ATOM   4603  O  O     . GLU B 1 218 ? 38.253  43.606 48.766 1.00 55.04  ? 277 GLU B O     1 
ATOM   4604  C  CB    . GLU B 1 218 ? 36.579  41.867 50.945 1.00 55.04  ? 277 GLU B CB    1 
ATOM   4605  C  CG    . GLU B 1 218 ? 36.572  41.907 52.472 1.00 55.04  ? 277 GLU B CG    1 
ATOM   4606  C  CD    . GLU B 1 218 ? 37.796  42.588 53.060 1.00 55.04  ? 277 GLU B CD    1 
ATOM   4607  O  OE1   . GLU B 1 218 ? 38.915  42.060 52.889 1.00 55.04  ? 277 GLU B OE1   1 
ATOM   4608  O  OE2   . GLU B 1 218 ? 37.639  43.645 53.706 1.00 55.04  ? 277 GLU B OE2   1 
ATOM   4609  H  H     . GLU B 1 218 ? 34.427  43.209 50.957 1.00 0.00   ? 277 GLU B H     1 
ATOM   4610  N  N     . ASP B 1 219 ? 36.366  42.779 47.853 1.00 9.39   ? 278 ASP B N     1 
ATOM   4611  C  CA    . ASP B 1 219 ? 36.967  42.643 46.523 1.00 9.39   ? 278 ASP B CA    1 
ATOM   4612  C  C     . ASP B 1 219 ? 37.155  43.869 45.676 1.00 9.39   ? 278 ASP B C     1 
ATOM   4613  O  O     . ASP B 1 219 ? 38.030  43.893 44.803 1.00 36.78  ? 278 ASP B O     1 
ATOM   4614  C  CB    . ASP B 1 219 ? 36.196  41.666 45.637 1.00 36.78  ? 278 ASP B CB    1 
ATOM   4615  C  CG    . ASP B 1 219 ? 35.835  40.390 46.322 1.00 36.78  ? 278 ASP B CG    1 
ATOM   4616  O  OD1   . ASP B 1 219 ? 36.704  39.677 46.861 1.00 36.78  ? 278 ASP B OD1   1 
ATOM   4617  O  OD2   . ASP B 1 219 ? 34.633  40.091 46.286 1.00 36.78  ? 278 ASP B OD2   1 
ATOM   4618  H  H     . ASP B 1 219 ? 35.420  42.599 47.970 1.00 0.00   ? 278 ASP B H     1 
ATOM   4619  N  N     . SER B 1 220 ? 36.294  44.859 45.854 1.00 2.00   ? 279 SER B N     1 
ATOM   4620  C  CA    . SER B 1 220 ? 36.365  46.034 45.014 1.00 2.00   ? 279 SER B CA    1 
ATOM   4621  C  C     . SER B 1 220 ? 37.801  46.536 44.803 1.00 2.00   ? 279 SER B C     1 
ATOM   4622  O  O     . SER B 1 220 ? 38.233  46.674 43.664 1.00 9.99   ? 279 SER B O     1 
ATOM   4623  C  CB    . SER B 1 220 ? 35.372  47.072 45.498 1.00 9.99   ? 279 SER B CB    1 
ATOM   4624  O  OG    . SER B 1 220 ? 34.063  46.538 45.317 1.00 9.99   ? 279 SER B OG    1 
ATOM   4625  H  H     . SER B 1 220 ? 35.645  44.799 46.579 1.00 0.00   ? 279 SER B H     1 
ATOM   4626  H  HG    . SER B 1 220 ? 33.856  46.427 44.383 1.00 30.00  ? 279 SER B HG    1 
ATOM   4627  N  N     . SER B 1 221 ? 38.577  46.692 45.874 1.00 14.28  ? 280 SER B N     1 
ATOM   4628  C  CA    . SER B 1 221 ? 39.952  47.144 45.722 1.00 14.28  ? 280 SER B CA    1 
ATOM   4629  C  C     . SER B 1 221 ? 40.485  45.920 45.025 1.00 14.28  ? 280 SER B C     1 
ATOM   4630  O  O     . SER B 1 221 ? 40.214  44.815 45.458 1.00 27.76  ? 280 SER B O     1 
ATOM   4631  C  CB    . SER B 1 221 ? 40.621  47.297 47.067 1.00 27.76  ? 280 SER B CB    1 
ATOM   4632  O  OG    . SER B 1 221 ? 41.118  46.060 47.494 1.00 27.76  ? 280 SER B OG    1 
ATOM   4633  H  H     . SER B 1 221 ? 38.196  46.436 46.747 1.00 0.00   ? 280 SER B H     1 
ATOM   4634  H  HG    . SER B 1 221 ? 40.419  45.382 47.650 1.00 30.00  ? 280 SER B HG    1 
ATOM   4635  N  N     . CYS B 1 222 ? 41.232  46.070 43.961 1.00 26.72  ? 281 CYS B N     1 
ATOM   4636  C  CA    . CYS B 1 222 ? 41.686  44.877 43.248 1.00 26.72  ? 281 CYS B CA    1 
ATOM   4637  C  C     . CYS B 1 222 ? 40.679  44.120 42.351 1.00 26.72  ? 281 CYS B C     1 
ATOM   4638  O  O     . CYS B 1 222 ? 40.762  42.902 42.166 1.00 33.11  ? 281 CYS B O     1 
ATOM   4639  C  CB    . CYS B 1 222 ? 42.583  43.937 44.091 1.00 33.11  ? 281 CYS B CB    1 
ATOM   4640  S  SG    . CYS B 1 222 ? 41.918  42.675 45.190 1.00 33.11  ? 281 CYS B SG    1 
ATOM   4641  H  H     . CYS B 1 222 ? 41.415  46.971 43.629 1.00 0.00   ? 281 CYS B H     1 
ATOM   4642  N  N     . TYR B 1 223 ? 39.783  44.918 41.761 1.00 26.22  ? 282 TYR B N     1 
ATOM   4643  C  CA    . TYR B 1 223 ? 38.813  44.501 40.747 1.00 26.22  ? 282 TYR B CA    1 
ATOM   4644  C  C     . TYR B 1 223 ? 39.593  45.038 39.521 1.00 26.22  ? 282 TYR B C     1 
ATOM   4645  O  O     . TYR B 1 223 ? 40.646  45.646 39.689 1.00 20.13  ? 282 TYR B O     1 
ATOM   4646  C  CB    . TYR B 1 223 ? 37.458  45.237 40.880 1.00 20.13  ? 282 TYR B CB    1 
ATOM   4647  C  CG    . TYR B 1 223 ? 36.300  44.441 41.540 1.00 20.13  ? 282 TYR B CG    1 
ATOM   4648  C  CD1   . TYR B 1 223 ? 36.512  43.170 42.056 1.00 20.13  ? 282 TYR B CD1   1 
ATOM   4649  C  CD2   . TYR B 1 223 ? 35.002  44.988 41.658 1.00 20.13  ? 282 TYR B CD2   1 
ATOM   4650  C  CE1   . TYR B 1 223 ? 35.466  42.453 42.668 1.00 20.13  ? 282 TYR B CE1   1 
ATOM   4651  C  CE2   . TYR B 1 223 ? 33.957  44.290 42.283 1.00 20.13  ? 282 TYR B CE2   1 
ATOM   4652  C  CZ    . TYR B 1 223 ? 34.190  43.011 42.784 1.00 20.13  ? 282 TYR B CZ    1 
ATOM   4653  O  OH    . TYR B 1 223 ? 33.196  42.234 43.400 1.00 20.13  ? 282 TYR B OH    1 
ATOM   4654  H  H     . TYR B 1 223 ? 39.787  45.848 42.057 1.00 0.00   ? 282 TYR B H     1 
ATOM   4655  H  HH    . TYR B 1 223 ? 32.335  42.633 43.238 1.00 0.00   ? 282 TYR B HH    1 
ATOM   4656  N  N     . ILE B 1 224 ? 39.066  44.926 38.308 1.00 27.53  ? 283 ILE B N     1 
ATOM   4657  C  CA    . ILE B 1 224 ? 39.838  45.356 37.152 1.00 27.53  ? 283 ILE B CA    1 
ATOM   4658  C  C     . ILE B 1 224 ? 39.167  46.241 36.091 1.00 27.53  ? 283 ILE B C     1 
ATOM   4659  O  O     . ILE B 1 224 ? 38.396  45.754 35.263 1.00 64.24  ? 283 ILE B O     1 
ATOM   4660  C  CB    . ILE B 1 224 ? 40.479  44.107 36.474 1.00 64.24  ? 283 ILE B CB    1 
ATOM   4661  C  CG1   . ILE B 1 224 ? 39.510  42.900 36.539 1.00 64.24  ? 283 ILE B CG1   1 
ATOM   4662  C  CG2   . ILE B 1 224 ? 41.853  43.794 37.105 1.00 64.24  ? 283 ILE B CG2   1 
ATOM   4663  C  CD1   . ILE B 1 224 ? 39.879  41.788 37.538 1.00 64.24  ? 283 ILE B CD1   1 
ATOM   4664  H  H     . ILE B 1 224 ? 38.165  44.583 38.142 1.00 0.00   ? 283 ILE B H     1 
ATOM   4665  N  N     . PRO B 1 225 ? 39.479  47.560 36.089 1.00 2.00   ? 284 PRO B N     1 
ATOM   4666  C  CA    . PRO B 1 225 ? 40.410  48.240 37.023 1.00 2.00   ? 284 PRO B CA    1 
ATOM   4667  C  C     . PRO B 1 225 ? 39.826  48.346 38.439 1.00 2.00   ? 284 PRO B C     1 
ATOM   4668  O  O     . PRO B 1 225 ? 38.748  47.799 38.706 1.00 20.87  ? 284 PRO B O     1 
ATOM   4669  C  CB    . PRO B 1 225 ? 40.614  49.616 36.372 1.00 20.87  ? 284 PRO B CB    1 
ATOM   4670  C  CG    . PRO B 1 225 ? 39.413  49.820 35.556 1.00 20.87  ? 284 PRO B CG    1 
ATOM   4671  C  CD    . PRO B 1 225 ? 39.133  48.462 34.972 1.00 20.87  ? 284 PRO B CD    1 
ATOM   4672  N  N     . PRO B 1 226 ? 40.586  48.894 39.398 1.00 11.71  ? 285 PRO B N     1 
ATOM   4673  C  CA    . PRO B 1 226 ? 39.985  48.978 40.729 1.00 11.71  ? 285 PRO B CA    1 
ATOM   4674  C  C     . PRO B 1 226 ? 38.767  49.876 40.722 1.00 11.71  ? 285 PRO B C     1 
ATOM   4675  O  O     . PRO B 1 226 ? 38.692  50.841 39.951 1.00 24.89  ? 285 PRO B O     1 
ATOM   4676  C  CB    . PRO B 1 226 ? 41.119  49.522 41.588 1.00 24.89  ? 285 PRO B CB    1 
ATOM   4677  C  CG    . PRO B 1 226 ? 42.055  50.152 40.611 1.00 24.89  ? 285 PRO B CG    1 
ATOM   4678  C  CD    . PRO B 1 226 ? 42.015  49.214 39.448 1.00 24.89  ? 285 PRO B CD    1 
ATOM   4679  N  N     . LEU B 1 227 ? 37.856  49.610 41.646 1.00 12.78  ? 286 LEU B N     1 
ATOM   4680  C  CA    . LEU B 1 227 ? 36.606  50.319 41.714 1.00 12.78  ? 286 LEU B CA    1 
ATOM   4681  C  C     . LEU B 1 227 ? 36.475  51.532 42.630 1.00 12.78  ? 286 LEU B C     1 
ATOM   4682  O  O     . LEU B 1 227 ? 36.715  51.425 43.826 1.00 20.18  ? 286 LEU B O     1 
ATOM   4683  C  CB    . LEU B 1 227 ? 35.548  49.288 42.083 1.00 20.18  ? 286 LEU B CB    1 
ATOM   4684  C  CG    . LEU B 1 227 ? 34.080  49.658 42.230 1.00 20.18  ? 286 LEU B CG    1 
ATOM   4685  C  CD1   . LEU B 1 227 ? 33.498  50.191 40.926 1.00 20.18  ? 286 LEU B CD1   1 
ATOM   4686  C  CD2   . LEU B 1 227 ? 33.355  48.405 42.670 1.00 20.18  ? 286 LEU B CD2   1 
ATOM   4687  H  H     . LEU B 1 227 ? 38.020  48.901 42.300 1.00 0.00   ? 286 LEU B H     1 
ATOM   4688  N  N     . THR B 1 228 ? 36.099  52.688 42.072 1.00 12.44  ? 287 THR B N     1 
ATOM   4689  C  CA    . THR B 1 228 ? 35.878  53.872 42.901 1.00 12.44  ? 287 THR B CA    1 
ATOM   4690  C  C     . THR B 1 228 ? 34.445  53.673 43.357 1.00 12.44  ? 287 THR B C     1 
ATOM   4691  O  O     . THR B 1 228 ? 33.536  53.516 42.562 1.00 30.32  ? 287 THR B O     1 
ATOM   4692  C  CB    . THR B 1 228 ? 36.168  55.223 42.188 1.00 30.32  ? 287 THR B CB    1 
ATOM   4693  O  OG1   . THR B 1 228 ? 35.013  56.064 42.187 1.00 30.32  ? 287 THR B OG1   1 
ATOM   4694  C  CG2   . THR B 1 228 ? 36.691  55.012 40.805 1.00 30.32  ? 287 THR B CG2   1 
ATOM   4695  H  H     . THR B 1 228 ? 35.938  52.732 41.114 1.00 0.00   ? 287 THR B H     1 
ATOM   4696  H  HG1   . THR B 1 228 ? 34.295  55.606 41.723 1.00 30.00  ? 287 THR B HG1   1 
ATOM   4697  N  N     . THR B 1 229 ? 34.256  53.681 44.662 1.00 31.08  ? 288 THR B N     1 
ATOM   4698  C  CA    . THR B 1 229 ? 32.982  53.325 45.241 1.00 31.08  ? 288 THR B CA    1 
ATOM   4699  C  C     . THR B 1 229 ? 32.661  54.076 46.532 1.00 31.08  ? 288 THR B C     1 
ATOM   4700  O  O     . THR B 1 229 ? 33.554  54.629 47.201 1.00 15.08  ? 288 THR B O     1 
ATOM   4701  C  CB    . THR B 1 229 ? 33.099  51.801 45.532 1.00 15.08  ? 288 THR B CB    1 
ATOM   4702  O  OG1   . THR B 1 229 ? 31.872  51.251 46.000 1.00 15.08  ? 288 THR B OG1   1 
ATOM   4703  C  CG2   . THR B 1 229 ? 34.196  51.552 46.523 1.00 15.08  ? 288 THR B CG2   1 
ATOM   4704  H  H     . THR B 1 229 ? 34.982  53.934 45.277 1.00 0.00   ? 288 THR B H     1 
ATOM   4705  H  HG1   . THR B 1 229 ? 31.144  51.644 45.514 1.00 30.00  ? 288 THR B HG1   1 
ATOM   4706  N  N     . ILE B 1 230 ? 31.372  54.086 46.873 1.00 31.74  ? 289 ILE B N     1 
ATOM   4707  C  CA    . ILE B 1 230 ? 30.867  54.722 48.087 1.00 31.74  ? 289 ILE B CA    1 
ATOM   4708  C  C     . ILE B 1 230 ? 31.131  53.774 49.235 1.00 31.74  ? 289 ILE B C     1 
ATOM   4709  O  O     . ILE B 1 230 ? 30.611  52.664 49.266 1.00 18.05  ? 289 ILE B O     1 
ATOM   4710  C  CB    . ILE B 1 230 ? 29.343  54.946 48.023 1.00 18.05  ? 289 ILE B CB    1 
ATOM   4711  C  CG1   . ILE B 1 230 ? 28.964  55.778 46.790 1.00 18.05  ? 289 ILE B CG1   1 
ATOM   4712  C  CG2   . ILE B 1 230 ? 28.869  55.639 49.271 1.00 18.05  ? 289 ILE B CG2   1 
ATOM   4713  C  CD1   . ILE B 1 230 ? 29.492  57.182 46.816 1.00 18.05  ? 289 ILE B CD1   1 
ATOM   4714  H  H     . ILE B 1 230 ? 30.731  53.645 46.273 1.00 0.00   ? 289 ILE B H     1 
ATOM   4715  N  N     . LYS B 1 231 ? 31.954  54.213 50.169 1.00 19.90  ? 290 LYS B N     1 
ATOM   4716  C  CA    . LYS B 1 231 ? 32.315  53.424 51.349 1.00 19.90  ? 290 LYS B CA    1 
ATOM   4717  C  C     . LYS B 1 231 ? 31.258  53.322 52.497 1.00 19.90  ? 290 LYS B C     1 
ATOM   4718  O  O     . LYS B 1 231 ? 30.844  54.327 53.087 1.00 33.05  ? 290 LYS B O     1 
ATOM   4719  C  CB    . LYS B 1 231 ? 33.635  53.959 51.903 1.00 33.05  ? 290 LYS B CB    1 
ATOM   4720  C  CG    . LYS B 1 231 ? 34.694  52.914 52.128 1.00 33.05  ? 290 LYS B CG    1 
ATOM   4721  C  CD    . LYS B 1 231 ? 34.469  52.095 53.387 1.00 33.05  ? 290 LYS B CD    1 
ATOM   4722  C  CE    . LYS B 1 231 ? 35.567  51.039 53.517 1.00 33.05  ? 290 LYS B CE    1 
ATOM   4723  N  NZ    . LYS B 1 231 ? 35.396  50.039 54.629 1.00 33.05  ? 290 LYS B NZ    1 
ATOM   4724  H  H     . LYS B 1 231 ? 32.352  55.086 50.038 1.00 0.00   ? 290 LYS B H     1 
ATOM   4725  H  HZ1   . LYS B 1 231 ? 34.499  49.529 54.499 1.00 0.00   ? 290 LYS B HZ1   1 
ATOM   4726  H  HZ2   . LYS B 1 231 ? 36.180  49.355 54.600 1.00 0.00   ? 290 LYS B HZ2   1 
ATOM   4727  H  HZ3   . LYS B 1 231 ? 35.389  50.522 55.548 1.00 0.00   ? 290 LYS B HZ3   1 
ATOM   4728  N  N     . GLN B 1 232 ? 30.841  52.096 52.801 1.00 13.46  ? 291 GLN B N     1 
ATOM   4729  C  CA    . GLN B 1 232 ? 29.907  51.804 53.873 1.00 13.46  ? 291 GLN B CA    1 
ATOM   4730  C  C     . GLN B 1 232 ? 30.702  50.846 54.732 1.00 13.46  ? 291 GLN B C     1 
ATOM   4731  O  O     . GLN B 1 232 ? 30.990  49.737 54.306 1.00 23.84  ? 291 GLN B O     1 
ATOM   4732  C  CB    . GLN B 1 232 ? 28.676  51.139 53.311 1.00 23.84  ? 291 GLN B CB    1 
ATOM   4733  C  CG    . GLN B 1 232 ? 28.011  52.035 52.326 1.00 23.84  ? 291 GLN B CG    1 
ATOM   4734  C  CD    . GLN B 1 232 ? 26.587  51.679 52.085 1.00 23.84  ? 291 GLN B CD    1 
ATOM   4735  O  OE1   . GLN B 1 232 ? 26.257  50.534 51.803 1.00 23.84  ? 291 GLN B OE1   1 
ATOM   4736  N  NE2   . GLN B 1 232 ? 25.716  52.666 52.199 1.00 23.84  ? 291 GLN B NE2   1 
ATOM   4737  H  H     . GLN B 1 232 ? 31.208  51.335 52.301 1.00 0.00   ? 291 GLN B H     1 
ATOM   4738  N  N     . ASP B 1 233 ? 31.138  51.319 55.897 1.00 18.27  ? 292 ASP B N     1 
ATOM   4739  C  CA    . ASP B 1 233 ? 31.974  50.537 56.799 1.00 18.27  ? 292 ASP B CA    1 
ATOM   4740  C  C     . ASP B 1 233 ? 31.200  49.468 57.550 1.00 18.27  ? 292 ASP B C     1 
ATOM   4741  O  O     . ASP B 1 233 ? 30.591  49.761 58.579 1.00 29.22  ? 292 ASP B O     1 
ATOM   4742  C  CB    . ASP B 1 233 ? 32.686  51.479 57.790 1.00 29.22  ? 292 ASP B CB    1 
ATOM   4743  C  CG    . ASP B 1 233 ? 33.728  50.767 58.662 1.00 29.22  ? 292 ASP B CG    1 
ATOM   4744  O  OD1   . ASP B 1 233 ? 33.994  49.580 58.444 1.00 29.22  ? 292 ASP B OD1   1 
ATOM   4745  O  OD2   . ASP B 1 233 ? 34.298  51.386 59.579 1.00 29.22  ? 292 ASP B OD2   1 
ATOM   4746  H  H     . ASP B 1 233 ? 30.869  52.218 56.168 1.00 0.00   ? 292 ASP B H     1 
ATOM   4747  N  N     . PHE B 1 234 ? 31.270  48.220 57.083 1.00 30.78  ? 293 PHE B N     1 
ATOM   4748  C  CA    . PHE B 1 234 ? 30.561  47.120 57.738 1.00 30.78  ? 293 PHE B CA    1 
ATOM   4749  C  C     . PHE B 1 234 ? 31.226  46.655 59.058 1.00 30.78  ? 293 PHE B C     1 
ATOM   4750  O  O     . PHE B 1 234 ? 30.538  46.068 59.923 1.00 2.00   ? 293 PHE B O     1 
ATOM   4751  C  CB    . PHE B 1 234 ? 30.326  45.958 56.766 1.00 2.00   ? 293 PHE B CB    1 
ATOM   4752  C  CG    . PHE B 1 234 ? 29.604  46.361 55.491 1.00 2.00   ? 293 PHE B CG    1 
ATOM   4753  C  CD1   . PHE B 1 234 ? 28.287  46.815 55.521 1.00 2.00   ? 293 PHE B CD1   1 
ATOM   4754  C  CD2   . PHE B 1 234 ? 30.222  46.251 54.247 1.00 2.00   ? 293 PHE B CD2   1 
ATOM   4755  C  CE1   . PHE B 1 234 ? 27.603  47.147 54.327 1.00 2.00   ? 293 PHE B CE1   1 
ATOM   4756  C  CE2   . PHE B 1 234 ? 29.542  46.584 53.049 1.00 2.00   ? 293 PHE B CE2   1 
ATOM   4757  C  CZ    . PHE B 1 234 ? 28.246  47.019 53.095 1.00 2.00   ? 293 PHE B CZ    1 
ATOM   4758  H  H     . PHE B 1 234 ? 31.742  48.037 56.238 1.00 0.00   ? 293 PHE B H     1 
ATOM   4759  N  N     . ARG B 1 235 ? 32.522  46.946 59.247 1.00 15.69  ? 294 ARG B N     1 
ATOM   4760  C  CA    . ARG B 1 235 ? 33.213  46.591 60.494 1.00 15.69  ? 294 ARG B CA    1 
ATOM   4761  C  C     . ARG B 1 235 ? 32.654  47.527 61.597 1.00 15.69  ? 294 ARG B C     1 
ATOM   4762  O  O     . ARG B 1 235 ? 32.656  47.183 62.776 1.00 87.64  ? 294 ARG B O     1 
ATOM   4763  C  CB    . ARG B 1 235 ? 34.729  46.791 60.353 1.00 87.64  ? 294 ARG B CB    1 
ATOM   4764  C  CG    . ARG B 1 235 ? 35.590  45.898 61.257 1.00 87.64  ? 294 ARG B CG    1 
ATOM   4765  C  CD    . ARG B 1 235 ? 36.640  46.668 62.097 1.00 87.64  ? 294 ARG B CD    1 
ATOM   4766  N  NE    . ARG B 1 235 ? 37.725  47.308 61.329 1.00 87.64  ? 294 ARG B NE    1 
ATOM   4767  C  CZ    . ARG B 1 235 ? 38.732  48.023 61.864 1.00 87.64  ? 294 ARG B CZ    1 
ATOM   4768  N  NH1   . ARG B 1 235 ? 38.831  48.211 63.187 1.00 87.64  ? 294 ARG B NH1   1 
ATOM   4769  N  NH2   . ARG B 1 235 ? 39.646  48.582 61.070 1.00 87.64  ? 294 ARG B NH2   1 
ATOM   4770  H  H     . ARG B 1 235 ? 33.007  47.403 58.531 1.00 0.00   ? 294 ARG B H     1 
ATOM   4771  H  HE    . ARG B 1 235 ? 37.713  47.212 60.354 1.00 0.00   ? 294 ARG B HE    1 
ATOM   4772  H  HH11  . ARG B 1 235 ? 38.154  47.815 63.806 1.00 0.00   ? 294 ARG B HH11  1 
ATOM   4773  H  HH12  . ARG B 1 235 ? 39.582  48.760 63.554 1.00 0.00   ? 294 ARG B HH12  1 
ATOM   4774  H  HH21  . ARG B 1 235 ? 39.598  48.472 60.077 1.00 0.00   ? 294 ARG B HH21  1 
ATOM   4775  H  HH22  . ARG B 1 235 ? 40.387  49.123 61.474 1.00 0.00   ? 294 ARG B HH22  1 
ATOM   4776  N  N     . LEU B 1 236 ? 32.171  48.706 61.191 1.00 24.52  ? 295 LEU B N     1 
ATOM   4777  C  CA    . LEU B 1 236 ? 31.594  49.708 62.091 1.00 24.52  ? 295 LEU B CA    1 
ATOM   4778  C  C     . LEU B 1 236 ? 30.188  49.262 62.399 1.00 24.52  ? 295 LEU B C     1 
ATOM   4779  O  O     . LEU B 1 236 ? 29.802  49.211 63.550 1.00 37.94  ? 295 LEU B O     1 
ATOM   4780  C  CB    . LEU B 1 236 ? 31.507  51.072 61.404 1.00 37.94  ? 295 LEU B CB    1 
ATOM   4781  C  CG    . LEU B 1 236 ? 31.677  52.401 62.173 1.00 37.94  ? 295 LEU B CG    1 
ATOM   4782  C  CD1   . LEU B 1 236 ? 30.919  53.522 61.457 1.00 37.94  ? 295 LEU B CD1   1 
ATOM   4783  C  CD2   . LEU B 1 236 ? 31.201  52.298 63.607 1.00 37.94  ? 295 LEU B CD2   1 
ATOM   4784  H  H     . LEU B 1 236 ? 32.191  48.919 60.240 1.00 0.00   ? 295 LEU B H     1 
ATOM   4785  N  N     . LEU B 1 237 ? 29.415  48.945 61.365 1.00 28.54  ? 296 LEU B N     1 
ATOM   4786  C  CA    . LEU B 1 237 ? 28.034  48.487 61.534 1.00 28.54  ? 296 LEU B CA    1 
ATOM   4787  C  C     . LEU B 1 237 ? 27.951  47.415 62.577 1.00 28.54  ? 296 LEU B C     1 
ATOM   4788  O  O     . LEU B 1 237 ? 27.207  47.528 63.534 1.00 19.54  ? 296 LEU B O     1 
ATOM   4789  C  CB    . LEU B 1 237 ? 27.487  47.901 60.248 1.00 19.54  ? 296 LEU B CB    1 
ATOM   4790  C  CG    . LEU B 1 237 ? 26.281  48.598 59.646 1.00 19.54  ? 296 LEU B CG    1 
ATOM   4791  C  CD1   . LEU B 1 237 ? 25.468  47.580 58.843 1.00 19.54  ? 296 LEU B CD1   1 
ATOM   4792  C  CD2   . LEU B 1 237 ? 25.424  49.208 60.752 1.00 19.54  ? 296 LEU B CD2   1 
ATOM   4793  H  H     . LEU B 1 237 ? 29.761  49.047 60.451 1.00 0.00   ? 296 LEU B H     1 
ATOM   4794  N  N     . GLY B 1 238 ? 28.723  46.362 62.385 1.00 18.09  ? 297 GLY B N     1 
ATOM   4795  C  CA    . GLY B 1 238 ? 28.716  45.269 63.334 1.00 18.09  ? 297 GLY B CA    1 
ATOM   4796  C  C     . GLY B 1 238 ? 28.984  45.684 64.770 1.00 18.09  ? 297 GLY B C     1 
ATOM   4797  O  O     . GLY B 1 238 ? 28.210  45.345 65.654 1.00 46.00  ? 297 GLY B O     1 
ATOM   4798  H  H     . GLY B 1 238 ? 29.303  46.306 61.595 1.00 0.00   ? 297 GLY B H     1 
ATOM   4799  N  N     . GLN B 1 239 ? 30.053  46.436 65.006 1.00 28.72  ? 298 GLN B N     1 
ATOM   4800  C  CA    . GLN B 1 239 ? 30.386  46.852 66.359 1.00 28.72  ? 298 GLN B CA    1 
ATOM   4801  C  C     . GLN B 1 239 ? 29.295  47.719 66.950 1.00 28.72  ? 298 GLN B C     1 
ATOM   4802  O  O     . GLN B 1 239 ? 28.977  47.575 68.127 1.00 85.16  ? 298 GLN B O     1 
ATOM   4803  C  CB    . GLN B 1 239 ? 31.766  47.554 66.430 1.00 85.16  ? 298 GLN B CB    1 
ATOM   4804  C  CG    . GLN B 1 239 ? 31.787  49.109 66.344 1.00 85.16  ? 298 GLN B CG    1 
ATOM   4805  C  CD    . GLN B 1 239 ? 32.000  49.816 67.698 1.00 85.16  ? 298 GLN B CD    1 
ATOM   4806  O  OE1   . GLN B 1 239 ? 33.110  49.852 68.234 1.00 85.16  ? 298 GLN B OE1   1 
ATOM   4807  N  NE2   . GLN B 1 239 ? 30.935  50.404 68.230 1.00 85.16  ? 298 GLN B NE2   1 
ATOM   4808  H  H     . GLN B 1 239 ? 30.631  46.728 64.265 1.00 0.00   ? 298 GLN B H     1 
ATOM   4809  N  N     . THR B 1 240 ? 28.688  48.585 66.138 1.00 32.24  ? 299 THR B N     1 
ATOM   4810  C  CA    . THR B 1 240 ? 27.639  49.456 66.653 1.00 32.24  ? 299 THR B CA    1 
ATOM   4811  C  C     . THR B 1 240 ? 26.433  48.637 67.082 1.00 32.24  ? 299 THR B C     1 
ATOM   4812  O  O     . THR B 1 240 ? 25.870  48.873 68.154 1.00 50.72  ? 299 THR B O     1 
ATOM   4813  C  CB    . THR B 1 240 ? 27.192  50.512 65.641 1.00 50.72  ? 299 THR B CB    1 
ATOM   4814  O  OG1   . THR B 1 240 ? 28.313  50.929 64.862 1.00 50.72  ? 299 THR B OG1   1 
ATOM   4815  C  CG2   . THR B 1 240 ? 26.629  51.729 66.370 1.00 50.72  ? 299 THR B CG2   1 
ATOM   4816  H  H     . THR B 1 240 ? 28.934  48.669 65.191 1.00 0.00   ? 299 THR B H     1 
ATOM   4817  H  HG1   . THR B 1 240 ? 28.034  51.581 64.214 1.00 30.00  ? 299 THR B HG1   1 
ATOM   4818  N  N     . SER B 1 241 ? 26.078  47.637 66.279 1.00 20.31  ? 300 SER B N     1 
ATOM   4819  C  CA    . SER B 1 241 ? 24.944  46.767 66.571 1.00 20.31  ? 300 SER B CA    1 
ATOM   4820  C  C     . SER B 1 241 ? 25.144  45.921 67.833 1.00 20.31  ? 300 SER B C     1 
ATOM   4821  O  O     . SER B 1 241 ? 24.313  45.939 68.717 1.00 22.69  ? 300 SER B O     1 
ATOM   4822  C  CB    . SER B 1 241 ? 24.671  45.882 65.371 1.00 22.69  ? 300 SER B CB    1 
ATOM   4823  O  OG    . SER B 1 241 ? 24.494  46.679 64.219 1.00 22.69  ? 300 SER B OG    1 
ATOM   4824  H  H     . SER B 1 241 ? 26.598  47.484 65.461 1.00 0.00   ? 300 SER B H     1 
ATOM   4825  H  HG    . SER B 1 241 ? 25.278  47.203 64.019 1.00 30.00  ? 300 SER B HG    1 
ATOM   4826  N  N     . VAL B 1 242 ? 26.256  45.210 67.936 1.00 9.60   ? 301 VAL B N     1 
ATOM   4827  C  CA    . VAL B 1 242 ? 26.505  44.398 69.113 1.00 9.60   ? 301 VAL B CA    1 
ATOM   4828  C  C     . VAL B 1 242 ? 26.566  45.276 70.348 1.00 9.60   ? 301 VAL B C     1 
ATOM   4829  O  O     . VAL B 1 242 ? 25.873  45.011 71.325 1.00 37.64  ? 301 VAL B O     1 
ATOM   4830  C  CB    . VAL B 1 242 ? 27.801  43.596 69.000 1.00 37.64  ? 301 VAL B CB    1 
ATOM   4831  C  CG1   . VAL B 1 242 ? 28.055  42.814 70.281 1.00 37.64  ? 301 VAL B CG1   1 
ATOM   4832  C  CG2   . VAL B 1 242 ? 27.717  42.643 67.825 1.00 37.64  ? 301 VAL B CG2   1 
ATOM   4833  H  H     . VAL B 1 242 ? 26.932  45.244 67.222 1.00 0.00   ? 301 VAL B H     1 
ATOM   4834  N  N     . ASP B 1 243 ? 27.379  46.332 70.298 1.00 33.20  ? 302 ASP B N     1 
ATOM   4835  C  CA    . ASP B 1 243 ? 27.536  47.255 71.421 1.00 33.20  ? 302 ASP B CA    1 
ATOM   4836  C  C     . ASP B 1 243 ? 26.198  47.811 71.862 1.00 33.20  ? 302 ASP B C     1 
ATOM   4837  O  O     . ASP B 1 243 ? 25.845  47.730 73.045 1.00 42.11  ? 302 ASP B O     1 
ATOM   4838  C  CB    . ASP B 1 243 ? 28.456  48.420 71.063 1.00 42.11  ? 302 ASP B CB    1 
ATOM   4839  C  CG    . ASP B 1 243 ? 29.934  48.057 71.123 1.00 42.11  ? 302 ASP B CG    1 
ATOM   4840  O  OD1   . ASP B 1 243 ? 30.345  47.271 72.003 1.00 42.11  ? 302 ASP B OD1   1 
ATOM   4841  O  OD2   . ASP B 1 243 ? 30.702  48.603 70.295 1.00 42.11  ? 302 ASP B OD2   1 
ATOM   4842  H  H     . ASP B 1 243 ? 27.902  46.495 69.488 1.00 0.00   ? 302 ASP B H     1 
ATOM   4843  N  N     . ARG B 1 244 ? 25.452  48.368 70.914 1.00 33.02  ? 303 ARG B N     1 
ATOM   4844  C  CA    . ARG B 1 244 ? 24.147  48.939 71.220 1.00 33.02  ? 303 ARG B CA    1 
ATOM   4845  C  C     . ARG B 1 244 ? 23.126  47.868 71.585 1.00 33.02  ? 303 ARG B C     1 
ATOM   4846  O  O     . ARG B 1 244 ? 22.238  48.115 72.398 1.00 34.43  ? 303 ARG B O     1 
ATOM   4847  C  CB    . ARG B 1 244 ? 23.612  49.769 70.052 1.00 34.43  ? 303 ARG B CB    1 
ATOM   4848  C  CG    . ARG B 1 244 ? 22.228  50.356 70.286 1.00 34.43  ? 303 ARG B CG    1 
ATOM   4849  C  CD    . ARG B 1 244 ? 21.731  51.071 69.035 1.00 34.43  ? 303 ARG B CD    1 
ATOM   4850  N  NE    . ARG B 1 244 ? 20.435  51.705 69.258 1.00 34.43  ? 303 ARG B NE    1 
ATOM   4851  C  CZ    . ARG B 1 244 ? 19.768  52.419 68.352 1.00 34.43  ? 303 ARG B CZ    1 
ATOM   4852  N  NH1   . ARG B 1 244 ? 20.255  52.604 67.133 1.00 34.43  ? 303 ARG B NH1   1 
ATOM   4853  N  NH2   . ARG B 1 244 ? 18.605  52.957 68.683 1.00 34.43  ? 303 ARG B NH2   1 
ATOM   4854  H  H     . ARG B 1 244 ? 25.767  48.387 69.987 1.00 0.00   ? 303 ARG B H     1 
ATOM   4855  H  HE    . ARG B 1 244 ? 20.004  51.595 70.120 1.00 0.00   ? 303 ARG B HE    1 
ATOM   4856  H  HH11  . ARG B 1 244 ? 21.138  52.208 66.879 1.00 0.00   ? 303 ARG B HH11  1 
ATOM   4857  H  HH12  . ARG B 1 244 ? 19.744  53.137 66.459 1.00 0.00   ? 303 ARG B HH12  1 
ATOM   4858  H  HH21  . ARG B 1 244 ? 18.284  52.812 69.618 1.00 0.00   ? 303 ARG B HH21  1 
ATOM   4859  H  HH22  . ARG B 1 244 ? 18.055  53.515 68.105 1.00 0.00   ? 303 ARG B HH22  1 
ATOM   4860  N  N     . LEU B 1 245 ? 23.230  46.686 70.996 1.00 37.43  ? 304 LEU B N     1 
ATOM   4861  C  CA    . LEU B 1 245 ? 22.267  45.647 71.316 1.00 37.43  ? 304 LEU B CA    1 
ATOM   4862  C  C     . LEU B 1 245 ? 22.501  45.276 72.775 1.00 37.43  ? 304 LEU B C     1 
ATOM   4863  O  O     . LEU B 1 245 ? 21.575  45.259 73.581 1.00 36.18  ? 304 LEU B O     1 
ATOM   4864  C  CB    . LEU B 1 245 ? 22.422  44.452 70.363 1.00 36.18  ? 304 LEU B CB    1 
ATOM   4865  C  CG    . LEU B 1 245 ? 21.321  43.400 70.164 1.00 36.18  ? 304 LEU B CG    1 
ATOM   4866  C  CD1   . LEU B 1 245 ? 21.674  42.180 70.965 1.00 36.18  ? 304 LEU B CD1   1 
ATOM   4867  C  CD2   . LEU B 1 245 ? 19.932  43.932 70.513 1.00 36.18  ? 304 LEU B CD2   1 
ATOM   4868  H  H     . LEU B 1 245 ? 23.965  46.511 70.390 1.00 0.00   ? 304 LEU B H     1 
ATOM   4869  N  N     . LEU B 1 246 ? 23.761  45.097 73.140 1.00 39.56  ? 305 LEU B N     1 
ATOM   4870  C  CA    . LEU B 1 246 ? 24.090  44.759 74.513 1.00 39.56  ? 305 LEU B CA    1 
ATOM   4871  C  C     . LEU B 1 246 ? 23.544  45.838 75.436 1.00 39.56  ? 305 LEU B C     1 
ATOM   4872  O  O     . LEU B 1 246 ? 22.752  45.542 76.322 1.00 53.57  ? 305 LEU B O     1 
ATOM   4873  C  CB    . LEU B 1 246 ? 25.597  44.616 74.702 1.00 53.57  ? 305 LEU B CB    1 
ATOM   4874  C  CG    . LEU B 1 246 ? 26.222  43.427 73.981 1.00 53.57  ? 305 LEU B CG    1 
ATOM   4875  C  CD1   . LEU B 1 246 ? 27.539  43.106 74.654 1.00 53.57  ? 305 LEU B CD1   1 
ATOM   4876  C  CD2   . LEU B 1 246 ? 25.303  42.215 74.029 1.00 53.57  ? 305 LEU B CD2   1 
ATOM   4877  H  H     . LEU B 1 246 ? 24.462  45.189 72.470 1.00 0.00   ? 305 LEU B H     1 
ATOM   4878  N  N     . GLN B 1 247 ? 23.942  47.087 75.190 1.00 48.18  ? 306 GLN B N     1 
ATOM   4879  C  CA    . GLN B 1 247 ? 23.487  48.233 75.978 1.00 48.18  ? 306 GLN B CA    1 
ATOM   4880  C  C     . GLN B 1 247 ? 21.966  48.265 76.034 1.00 48.18  ? 306 GLN B C     1 
ATOM   4881  O  O     . GLN B 1 247 ? 21.380  48.325 77.109 1.00 73.89  ? 306 GLN B O     1 
ATOM   4882  C  CB    . GLN B 1 247 ? 23.975  49.548 75.363 1.00 73.89  ? 306 GLN B CB    1 
ATOM   4883  C  CG    . GLN B 1 247 ? 25.490  49.701 75.249 1.00 73.89  ? 306 GLN B CG    1 
ATOM   4884  C  CD    . GLN B 1 247 ? 25.899  50.854 74.323 1.00 73.89  ? 306 GLN B CD    1 
ATOM   4885  O  OE1   . GLN B 1 247 ? 25.084  51.714 73.967 1.00 73.89  ? 306 GLN B OE1   1 
ATOM   4886  N  NE2   . GLN B 1 247 ? 27.161  50.861 73.918 1.00 73.89  ? 306 GLN B NE2   1 
ATOM   4887  H  H     . GLN B 1 247 ? 24.564  47.234 74.448 1.00 0.00   ? 306 GLN B H     1 
ATOM   4888  N  N     . LEU B 1 248 ? 21.334  48.197 74.873 1.00 44.78  ? 307 LEU B N     1 
ATOM   4889  C  CA    . LEU B 1 248 ? 19.883  48.221 74.769 1.00 44.78  ? 307 LEU B CA    1 
ATOM   4890  C  C     . LEU B 1 248 ? 19.247  47.138 75.645 1.00 44.78  ? 307 LEU B C     1 
ATOM   4891  O  O     . LEU B 1 248 ? 18.148  47.323 76.175 1.00 87.70  ? 307 LEU B O     1 
ATOM   4892  C  CB    . LEU B 1 248 ? 19.478  48.062 73.302 1.00 87.70  ? 307 LEU B CB    1 
ATOM   4893  C  CG    . LEU B 1 248 ? 18.016  48.156 72.863 1.00 87.70  ? 307 LEU B CG    1 
ATOM   4894  C  CD1   . LEU B 1 248 ? 17.318  49.337 73.523 1.00 87.70  ? 307 LEU B CD1   1 
ATOM   4895  C  CD2   . LEU B 1 248 ? 17.966  48.250 71.337 1.00 87.70  ? 307 LEU B CD2   1 
ATOM   4896  H  H     . LEU B 1 248 ? 21.875  48.128 74.087 1.00 0.00   ? 307 LEU B H     1 
ATOM   4897  N  N     . SER B 1 249 ? 19.930  46.008 75.798 1.00 50.16  ? 308 SER B N     1 
ATOM   4898  C  CA    . SER B 1 249 ? 19.415  44.936 76.654 1.00 50.16  ? 308 SER B CA    1 
ATOM   4899  C  C     . SER B 1 249 ? 19.989  45.135 78.069 1.00 50.16  ? 308 SER B C     1 
ATOM   4900  O  O     . SER B 1 249 ? 19.449  44.633 79.057 1.00 74.94  ? 308 SER B O     1 
ATOM   4901  C  CB    . SER B 1 249 ? 19.793  43.548 76.112 1.00 74.94  ? 308 SER B CB    1 
ATOM   4902  O  OG    . SER B 1 249 ? 21.145  43.228 76.402 1.00 74.94  ? 308 SER B OG    1 
ATOM   4903  H  H     . SER B 1 249 ? 20.773  45.866 75.319 1.00 0.00   ? 308 SER B H     1 
ATOM   4904  H  HG    . SER B 1 249 ? 21.707  43.890 75.991 1.00 30.00  ? 308 SER B HG    1 
ATOM   4905  N  N     . GLN B 1 250 ? 21.065  45.910 78.145 1.00 76.48  ? 309 GLN B N     1 
ATOM   4906  C  CA    . GLN B 1 250 ? 21.734  46.223 79.397 1.00 76.48  ? 309 GLN B CA    1 
ATOM   4907  C  C     . GLN B 1 250 ? 20.889  47.277 80.111 1.00 76.48  ? 309 GLN B C     1 
ATOM   4908  O  O     . GLN B 1 250 ? 21.195  47.667 81.239 1.00 90.25  ? 309 GLN B O     1 
ATOM   4909  C  CB    . GLN B 1 250 ? 23.140  46.758 79.100 1.00 90.25  ? 309 GLN B CB    1 
ATOM   4910  C  CG    . GLN B 1 250 ? 24.041  46.985 80.297 1.00 90.25  ? 309 GLN B CG    1 
ATOM   4911  C  CD    . GLN B 1 250 ? 25.409  47.522 79.897 1.00 90.25  ? 309 GLN B CD    1 
ATOM   4912  O  OE1   . GLN B 1 250 ? 25.527  48.617 79.340 1.00 90.25  ? 309 GLN B OE1   1 
ATOM   4913  N  NE2   . GLN B 1 250 ? 26.447  46.749 80.172 1.00 90.25  ? 309 GLN B NE2   1 
ATOM   4914  H  H     . GLN B 1 250 ? 21.402  46.312 77.332 1.00 0.00   ? 309 GLN B H     1 
ATOM   4915  N  N     . GLY B 1 251 ? 19.834  47.743 79.438 1.00 92.58  ? 310 GLY B N     1 
ATOM   4916  C  CA    . GLY B 1 251 ? 18.940  48.736 80.012 1.00 92.58  ? 310 GLY B CA    1 
ATOM   4917  C  C     . GLY B 1 251 ? 19.076  50.129 79.425 1.00 92.58  ? 310 GLY B C     1 
ATOM   4918  O  O     . GLY B 1 251 ? 18.131  50.918 79.460 1.00 92.33  ? 310 GLY B O     1 
ATOM   4919  H  H     . GLY B 1 251 ? 19.644  47.443 78.529 1.00 0.00   ? 310 GLY B H     1 
ATOM   4920  N  N     . GLN B 1 252 ? 20.252  50.416 78.875 1.00 52.30  ? 311 GLN B N     1 
ATOM   4921  C  CA    . GLN B 1 252 ? 20.573  51.709 78.269 1.00 52.30  ? 311 GLN B CA    1 
ATOM   4922  C  C     . GLN B 1 252 ? 19.513  52.295 77.344 1.00 52.30  ? 311 GLN B C     1 
ATOM   4923  O  O     . GLN B 1 252 ? 18.894  51.590 76.545 1.00 113.06 ? 311 GLN B O     1 
ATOM   4924  C  CB    . GLN B 1 252 ? 21.890  51.609 77.496 1.00 113.06 ? 311 GLN B CB    1 
ATOM   4925  C  CG    . GLN B 1 252 ? 23.087  51.343 78.367 1.00 113.06 ? 311 GLN B CG    1 
ATOM   4926  C  CD    . GLN B 1 252 ? 23.291  52.436 79.383 1.00 113.06 ? 311 GLN B CD    1 
ATOM   4927  O  OE1   . GLN B 1 252 ? 23.066  53.610 79.097 1.00 113.06 ? 311 GLN B OE1   1 
ATOM   4928  N  NE2   . GLN B 1 252 ? 23.717  52.062 80.578 1.00 113.06 ? 311 GLN B NE2   1 
ATOM   4929  H  H     . GLN B 1 252 ? 20.910  49.693 78.843 1.00 0.00   ? 311 GLN B H     1 
ATOM   4930  N  N     . ALA B 1 253 ? 19.370  53.609 77.411 1.00 70.68  ? 312 ALA B N     1 
ATOM   4931  C  CA    . ALA B 1 253 ? 18.411  54.306 76.582 1.00 70.68  ? 312 ALA B CA    1 
ATOM   4932  C  C     . ALA B 1 253 ? 19.084  54.701 75.277 1.00 70.68  ? 312 ALA B C     1 
ATOM   4933  O  O     . ALA B 1 253 ? 19.718  55.750 75.192 1.00 69.82  ? 312 ALA B O     1 
ATOM   4934  C  CB    . ALA B 1 253 ? 17.880  55.535 77.308 1.00 69.82  ? 312 ALA B CB    1 
ATOM   4935  H  H     . ALA B 1 253 ? 19.934  54.131 78.018 1.00 0.00   ? 312 ALA B H     1 
ATOM   4936  N  N     . VAL B 1 254 ? 18.993  53.823 74.284 1.00 64.61  ? 313 VAL B N     1 
ATOM   4937  C  CA    . VAL B 1 254 ? 19.573  54.070 72.966 1.00 64.61  ? 313 VAL B CA    1 
ATOM   4938  C  C     . VAL B 1 254 ? 18.472  54.502 71.972 1.00 64.61  ? 313 VAL B C     1 
ATOM   4939  O  O     . VAL B 1 254 ? 18.643  55.444 71.199 1.00 70.56  ? 313 VAL B O     1 
ATOM   4940  C  CB    . VAL B 1 254 ? 20.336  52.829 72.478 1.00 70.56  ? 313 VAL B CB    1 
ATOM   4941  C  CG1   . VAL B 1 254 ? 21.467  52.496 73.458 1.00 70.56  ? 313 VAL B CG1   1 
ATOM   4942  C  CG2   . VAL B 1 254 ? 19.401  51.658 72.354 1.00 70.56  ? 313 VAL B CG2   1 
ATOM   4943  H  H     . VAL B 1 254 ? 18.551  52.970 74.489 1.00 0.00   ? 313 VAL B H     1 
ATOM   4944  N  N     . LYS B 1 255 ? 17.342  53.808 72.016 1.00 51.45  ? 314 LYS B N     1 
ATOM   4945  C  CA    . LYS B 1 255 ? 16.170  54.116 71.203 1.00 51.45  ? 314 LYS B CA    1 
ATOM   4946  C  C     . LYS B 1 255 ? 16.165  54.127 69.670 1.00 51.45  ? 314 LYS B C     1 
ATOM   4947  O  O     . LYS B 1 255 ? 16.203  53.076 69.044 1.00 110.30 ? 314 LYS B O     1 
ATOM   4948  C  CB    . LYS B 1 255 ? 15.494  55.393 71.722 1.00 110.30 ? 314 LYS B CB    1 
ATOM   4949  C  CG    . LYS B 1 255 ? 14.803  55.255 73.077 1.00 110.30 ? 314 LYS B CG    1 
ATOM   4950  C  CD    . LYS B 1 255 ? 14.062  56.544 73.442 1.00 110.30 ? 314 LYS B CD    1 
ATOM   4951  C  CE    . LYS B 1 255 ? 13.296  56.423 74.760 1.00 110.30 ? 314 LYS B CE    1 
ATOM   4952  N  NZ    . LYS B 1 255 ? 12.109  55.521 74.674 1.00 110.30 ? 314 LYS B NZ    1 
ATOM   4953  H  H     . LYS B 1 255 ? 17.283  53.036 72.608 1.00 0.00   ? 314 LYS B H     1 
ATOM   4954  H  HZ1   . LYS B 1 255 ? 12.406  54.563 74.401 1.00 0.00   ? 314 LYS B HZ1   1 
ATOM   4955  H  HZ2   . LYS B 1 255 ? 11.631  55.486 75.597 1.00 0.00   ? 314 LYS B HZ2   1 
ATOM   4956  H  HZ3   . LYS B 1 255 ? 11.450  55.896 73.962 1.00 0.00   ? 314 LYS B HZ3   1 
ATOM   4957  N  N     . GLY B 1 256 ? 16.096  55.316 69.077 1.00 58.42  ? 315 GLY B N     1 
ATOM   4958  C  CA    . GLY B 1 256 ? 15.973  55.449 67.629 1.00 58.42  ? 315 GLY B CA    1 
ATOM   4959  C  C     . GLY B 1 256 ? 16.986  55.074 66.555 1.00 58.42  ? 315 GLY B C     1 
ATOM   4960  O  O     . GLY B 1 256 ? 17.703  54.079 66.640 1.00 48.54  ? 315 GLY B O     1 
ATOM   4961  H  H     . GLY B 1 256 ? 16.169  56.139 69.590 1.00 0.00   ? 315 GLY B H     1 
ATOM   4962  N  N     . ASN B 1 257 ? 16.939  55.868 65.480 1.00 58.23  ? 316 ASN B N     1 
ATOM   4963  C  CA    . ASN B 1 257 ? 17.779  55.743 64.280 1.00 58.23  ? 316 ASN B CA    1 
ATOM   4964  C  C     . ASN B 1 257 ? 19.205  56.198 64.512 1.00 58.23  ? 316 ASN B C     1 
ATOM   4965  O  O     . ASN B 1 257 ? 19.451  57.149 65.258 1.00 53.92  ? 316 ASN B O     1 
ATOM   4966  C  CB    . ASN B 1 257 ? 17.186  56.596 63.143 1.00 53.92  ? 316 ASN B CB    1 
ATOM   4967  C  CG    . ASN B 1 257 ? 17.829  56.326 61.783 1.00 53.92  ? 316 ASN B CG    1 
ATOM   4968  O  OD1   . ASN B 1 257 ? 19.050  56.295 61.635 1.00 53.92  ? 316 ASN B OD1   1 
ATOM   4969  N  ND2   . ASN B 1 257 ? 16.992  56.145 60.779 1.00 53.92  ? 316 ASN B ND2   1 
ATOM   4970  H  H     . ASN B 1 257 ? 16.296  56.599 65.501 1.00 0.00   ? 316 ASN B H     1 
ATOM   4971  H  HD21  . ASN B 1 257 ? 17.387  55.957 59.908 1.00 0.00   ? 316 ASN B HD21  1 
ATOM   4972  H  HD22  . ASN B 1 257 ? 16.026  56.200 60.958 1.00 0.00   ? 316 ASN B HD22  1 
ATOM   4973  N  N     . GLN B 1 258 ? 20.127  55.564 63.797 1.00 64.62  ? 317 GLN B N     1 
ATOM   4974  C  CA    . GLN B 1 258 ? 21.538  55.885 63.872 1.00 64.62  ? 317 GLN B CA    1 
ATOM   4975  C  C     . GLN B 1 258 ? 22.063  55.902 62.440 1.00 64.62  ? 317 GLN B C     1 
ATOM   4976  O  O     . GLN B 1 258 ? 22.130  54.868 61.788 1.00 78.25  ? 317 GLN B O     1 
ATOM   4977  C  CB    . GLN B 1 258 ? 22.278  54.848 64.717 1.00 78.25  ? 317 GLN B CB    1 
ATOM   4978  C  CG    . GLN B 1 258 ? 23.026  55.436 65.902 1.00 78.25  ? 317 GLN B CG    1 
ATOM   4979  C  CD    . GLN B 1 258 ? 22.716  54.722 67.211 1.00 78.25  ? 317 GLN B CD    1 
ATOM   4980  O  OE1   . GLN B 1 258 ? 23.476  53.856 67.655 1.00 78.25  ? 317 GLN B OE1   1 
ATOM   4981  N  NE2   . GLN B 1 258 ? 21.602  55.094 67.842 1.00 78.25  ? 317 GLN B NE2   1 
ATOM   4982  H  H     . GLN B 1 258 ? 19.850  54.884 63.149 1.00 0.00   ? 317 GLN B H     1 
ATOM   4983  N  N     . LEU B 1 259 ? 22.311  57.105 61.932 1.00 35.82  ? 318 LEU B N     1 
ATOM   4984  C  CA    . LEU B 1 259 ? 22.837  57.331 60.589 1.00 35.82  ? 318 LEU B CA    1 
ATOM   4985  C  C     . LEU B 1 259 ? 24.332  57.138 60.648 1.00 35.82  ? 318 LEU B C     1 
ATOM   4986  O  O     . LEU B 1 259 ? 25.004  57.762 61.474 1.00 30.62  ? 318 LEU B O     1 
ATOM   4987  C  CB    . LEU B 1 259 ? 22.573  58.766 60.162 1.00 30.62  ? 318 LEU B CB    1 
ATOM   4988  C  CG    . LEU B 1 259 ? 21.385  59.046 59.254 1.00 30.62  ? 318 LEU B CG    1 
ATOM   4989  C  CD1   . LEU B 1 259 ? 21.770  58.678 57.858 1.00 30.62  ? 318 LEU B CD1   1 
ATOM   4990  C  CD2   . LEU B 1 259 ? 20.131  58.271 59.686 1.00 30.62  ? 318 LEU B CD2   1 
ATOM   4991  H  H     . LEU B 1 259 ? 22.133  57.884 62.493 1.00 0.00   ? 318 LEU B H     1 
ATOM   4992  N  N     . LEU B 1 260 ? 24.849  56.243 59.811 1.00 24.20  ? 319 LEU B N     1 
ATOM   4993  C  CA    . LEU B 1 260 ? 26.284  55.995 59.749 1.00 24.20  ? 319 LEU B CA    1 
ATOM   4994  C  C     . LEU B 1 260 ? 26.795  56.756 58.520 1.00 24.20  ? 319 LEU B C     1 
ATOM   4995  O  O     . LEU B 1 260 ? 26.075  56.907 57.539 1.00 23.91  ? 319 LEU B O     1 
ATOM   4996  C  CB    . LEU B 1 260 ? 26.566  54.491 59.694 1.00 23.91  ? 319 LEU B CB    1 
ATOM   4997  C  CG    . LEU B 1 260 ? 26.216  53.840 61.039 1.00 23.91  ? 319 LEU B CG    1 
ATOM   4998  C  CD1   . LEU B 1 260 ? 26.431  52.364 61.012 1.00 23.91  ? 319 LEU B CD1   1 
ATOM   4999  C  CD2   . LEU B 1 260 ? 27.075  54.425 62.130 1.00 23.91  ? 319 LEU B CD2   1 
ATOM   5000  H  H     . LEU B 1 260 ? 24.279  55.795 59.176 1.00 0.00   ? 319 LEU B H     1 
ATOM   5001  N  N     . PRO B 1 261 ? 27.997  57.343 58.620 1.00 25.76  ? 320 PRO B N     1 
ATOM   5002  C  CA    . PRO B 1 261 ? 28.771  58.141 57.669 1.00 25.76  ? 320 PRO B CA    1 
ATOM   5003  C  C     . PRO B 1 261 ? 28.741  57.929 56.164 1.00 25.76  ? 320 PRO B C     1 
ATOM   5004  O  O     . PRO B 1 261 ? 28.022  58.662 55.472 1.00 66.72  ? 320 PRO B O     1 
ATOM   5005  C  CB    . PRO B 1 261 ? 30.179  58.046 58.227 1.00 66.72  ? 320 PRO B CB    1 
ATOM   5006  C  CG    . PRO B 1 261 ? 29.923  58.193 59.658 1.00 66.72  ? 320 PRO B CG    1 
ATOM   5007  C  CD    . PRO B 1 261 ? 28.717  57.285 59.904 1.00 66.72  ? 320 PRO B CD    1 
ATOM   5008  N  N     . VAL B 1 262 ? 29.560  57.017 55.643 1.00 30.08  ? 321 VAL B N     1 
ATOM   5009  C  CA    . VAL B 1 262 ? 29.630  56.815 54.185 1.00 30.08  ? 321 VAL B CA    1 
ATOM   5010  C  C     . VAL B 1 262 ? 30.543  57.876 53.515 1.00 30.08  ? 321 VAL B C     1 
ATOM   5011  O  O     . VAL B 1 262 ? 30.361  59.090 53.725 1.00 20.32  ? 321 VAL B O     1 
ATOM   5012  C  CB    . VAL B 1 262 ? 28.224  56.860 53.538 1.00 20.32  ? 321 VAL B CB    1 
ATOM   5013  C  CG1   . VAL B 1 262 ? 28.305  57.144 52.082 1.00 20.32  ? 321 VAL B CG1   1 
ATOM   5014  C  CG2   . VAL B 1 262 ? 27.527  55.569 53.778 1.00 20.32  ? 321 VAL B CG2   1 
ATOM   5015  H  H     . VAL B 1 262 ? 30.141  56.479 56.208 1.00 0.00   ? 321 VAL B H     1 
ATOM   5016  N  N     . SER B 1 263 ? 31.536  57.410 52.741 1.00 25.09  ? 322 SER B N     1 
ATOM   5017  C  CA    . SER B 1 263 ? 32.482  58.279 52.022 1.00 25.09  ? 322 SER B CA    1 
ATOM   5018  C  C     . SER B 1 263 ? 32.675  57.764 50.593 1.00 25.09  ? 322 SER B C     1 
ATOM   5019  O  O     . SER B 1 263 ? 32.006  56.827 50.180 1.00 36.93  ? 322 SER B O     1 
ATOM   5020  C  CB    . SER B 1 263 ? 33.828  58.298 52.734 1.00 36.93  ? 322 SER B CB    1 
ATOM   5021  O  OG    . SER B 1 263 ? 34.486  57.056 52.605 1.00 36.93  ? 322 SER B OG    1 
ATOM   5022  H  H     . SER B 1 263 ? 31.626  56.443 52.606 1.00 0.00   ? 322 SER B H     1 
ATOM   5023  H  HG    . SER B 1 263 ? 35.348  57.098 53.033 1.00 30.00  ? 322 SER B HG    1 
ATOM   5024  N  N     . LEU B 1 264 ? 33.565  58.393 49.833 1.00 37.34  ? 323 LEU B N     1 
ATOM   5025  C  CA    . LEU B 1 264 ? 33.842  57.974 48.457 1.00 37.34  ? 323 LEU B CA    1 
ATOM   5026  C  C     . LEU B 1 264 ? 35.304  57.531 48.305 1.00 37.34  ? 323 LEU B C     1 
ATOM   5027  O  O     . LEU B 1 264 ? 36.238  58.268 48.670 1.00 16.75  ? 323 LEU B O     1 
ATOM   5028  C  CB    . LEU B 1 264 ? 33.532  59.096 47.469 1.00 16.75  ? 323 LEU B CB    1 
ATOM   5029  C  CG    . LEU B 1 264 ? 33.653  58.731 45.992 1.00 16.75  ? 323 LEU B CG    1 
ATOM   5030  C  CD1   . LEU B 1 264 ? 32.688  57.644 45.646 1.00 16.75  ? 323 LEU B CD1   1 
ATOM   5031  C  CD2   . LEU B 1 264 ? 33.339  59.914 45.169 1.00 16.75  ? 323 LEU B CD2   1 
ATOM   5032  H  H     . LEU B 1 264 ? 34.085  59.144 50.180 1.00 0.00   ? 323 LEU B H     1 
ATOM   5033  N  N     . VAL B 1 265 ? 35.484  56.299 47.831 1.00 27.93  ? 324 VAL B N     1 
ATOM   5034  C  CA    . VAL B 1 265 ? 36.799  55.706 47.624 1.00 27.93  ? 324 VAL B CA    1 
ATOM   5035  C  C     . VAL B 1 265 ? 37.220  55.889 46.154 1.00 27.93  ? 324 VAL B C     1 
ATOM   5036  O  O     . VAL B 1 265 ? 36.709  55.212 45.267 1.00 22.35  ? 324 VAL B O     1 
ATOM   5037  C  CB    . VAL B 1 265 ? 36.786  54.195 47.943 1.00 22.35  ? 324 VAL B CB    1 
ATOM   5038  C  CG1   . VAL B 1 265 ? 38.192  53.676 48.051 1.00 22.35  ? 324 VAL B CG1   1 
ATOM   5039  C  CG2   . VAL B 1 265 ? 36.050  53.928 49.214 1.00 22.35  ? 324 VAL B CG2   1 
ATOM   5040  H  H     . VAL B 1 265 ? 34.699  55.811 47.629 1.00 0.00   ? 324 VAL B H     1 
ATOM   5041  N  N     . LYS B 1 266 ? 38.121  56.826 45.888 1.00 16.61  ? 325 LYS B N     1 
ATOM   5042  C  CA    . LYS B 1 266 ? 38.566  57.058 44.535 1.00 16.61  ? 325 LYS B CA    1 
ATOM   5043  C  C     . LYS B 1 266 ? 39.610  56.011 44.123 1.00 16.61  ? 325 LYS B C     1 
ATOM   5044  O  O     . LYS B 1 266 ? 40.628  55.840 44.805 1.00 52.90  ? 325 LYS B O     1 
ATOM   5045  C  CB    . LYS B 1 266 ? 39.124  58.463 44.413 1.00 52.90  ? 325 LYS B CB    1 
ATOM   5046  C  CG    . LYS B 1 266 ? 38.088  59.541 44.556 1.00 52.90  ? 325 LYS B CG    1 
ATOM   5047  C  CD    . LYS B 1 266 ? 38.746  60.874 44.334 1.00 52.90  ? 325 LYS B CD    1 
ATOM   5048  C  CE    . LYS B 1 266 ? 37.765  62.024 44.373 1.00 52.90  ? 325 LYS B CE    1 
ATOM   5049  N  NZ    . LYS B 1 266 ? 38.420  63.300 43.939 1.00 52.90  ? 325 LYS B NZ    1 
ATOM   5050  H  H     . LYS B 1 266 ? 38.487  57.360 46.622 1.00 0.00   ? 325 LYS B H     1 
ATOM   5051  H  HZ1   . LYS B 1 266 ? 39.227  63.522 44.555 1.00 0.00   ? 325 LYS B HZ1   1 
ATOM   5052  H  HZ2   . LYS B 1 266 ? 38.745  63.196 42.958 1.00 0.00   ? 325 LYS B HZ2   1 
ATOM   5053  H  HZ3   . LYS B 1 266 ? 37.723  64.070 43.993 1.00 0.00   ? 325 LYS B HZ3   1 
ATOM   5054  N  N     . ARG B 1 267 ? 39.306  55.261 43.057 1.00 30.56  ? 326 ARG B N     1 
ATOM   5055  C  CA    . ARG B 1 267 ? 40.195  54.231 42.521 1.00 30.56  ? 326 ARG B CA    1 
ATOM   5056  C  C     . ARG B 1 267 ? 40.278  54.391 41.005 1.00 30.56  ? 326 ARG B C     1 
ATOM   5057  O  O     . ARG B 1 267 ? 40.027  55.486 40.519 1.00 20.07  ? 326 ARG B O     1 
ATOM   5058  C  CB    . ARG B 1 267 ? 39.742  52.832 42.932 1.00 20.07  ? 326 ARG B CB    1 
ATOM   5059  C  CG    . ARG B 1 267 ? 39.930  52.547 44.407 1.00 20.07  ? 326 ARG B CG    1 
ATOM   5060  C  CD    . ARG B 1 267 ? 39.530  51.138 44.713 1.00 20.07  ? 326 ARG B CD    1 
ATOM   5061  N  NE    . ARG B 1 267 ? 39.494  50.840 46.144 1.00 20.07  ? 326 ARG B NE    1 
ATOM   5062  C  CZ    . ARG B 1 267 ? 38.401  50.452 46.816 1.00 20.07  ? 326 ARG B CZ    1 
ATOM   5063  N  NH1   . ARG B 1 267 ? 37.222  50.313 46.197 1.00 20.07  ? 326 ARG B NH1   1 
ATOM   5064  N  NH2   . ARG B 1 267 ? 38.497  50.138 48.115 1.00 20.07  ? 326 ARG B NH2   1 
ATOM   5065  H  H     . ARG B 1 267 ? 38.485  55.452 42.586 1.00 0.00   ? 326 ARG B H     1 
ATOM   5066  H  HE    . ARG B 1 267 ? 40.332  50.900 46.651 1.00 0.00   ? 326 ARG B HE    1 
ATOM   5067  H  HH11  . ARG B 1 267 ? 37.160  50.465 45.220 1.00 0.00   ? 326 ARG B HH11  1 
ATOM   5068  H  HH12  . ARG B 1 267 ? 36.408  50.012 46.697 1.00 0.00   ? 326 ARG B HH12  1 
ATOM   5069  H  HH21  . ARG B 1 267 ? 39.373  50.203 48.588 1.00 0.00   ? 326 ARG B HH21  1 
ATOM   5070  H  HH22  . ARG B 1 267 ? 37.689  49.850 48.633 1.00 0.00   ? 326 ARG B HH22  1 
ATOM   5071  N  N     . LYS B 1 268 ? 40.520  53.321 40.239 1.00 15.76  ? 327 LYS B N     1 
ATOM   5072  C  CA    . LYS B 1 268 ? 40.684  53.475 38.776 1.00 15.76  ? 327 LYS B CA    1 
ATOM   5073  C  C     . LYS B 1 268 ? 39.542  53.197 37.787 1.00 15.76  ? 327 LYS B C     1 
ATOM   5074  O  O     . LYS B 1 268 ? 39.799  52.824 36.642 1.00 78.31  ? 327 LYS B O     1 
ATOM   5075  C  CB    . LYS B 1 268 ? 41.953  52.753 38.304 1.00 78.31  ? 327 LYS B CB    1 
ATOM   5076  C  CG    . LYS B 1 268 ? 43.255  53.457 38.646 1.00 78.31  ? 327 LYS B CG    1 
ATOM   5077  C  CD    . LYS B 1 268 ? 43.607  53.305 40.098 1.00 78.31  ? 327 LYS B CD    1 
ATOM   5078  C  CE    . LYS B 1 268 ? 44.977  53.871 40.374 1.00 78.31  ? 327 LYS B CE    1 
ATOM   5079  N  NZ    . LYS B 1 268 ? 45.448  53.472 41.727 1.00 78.31  ? 327 LYS B NZ    1 
ATOM   5080  H  H     . LYS B 1 268 ? 40.546  52.420 40.611 1.00 0.00   ? 327 LYS B H     1 
ATOM   5081  H  HZ1   . LYS B 1 268 ? 44.786  53.831 42.444 1.00 0.00   ? 327 LYS B HZ1   1 
ATOM   5082  H  HZ2   . LYS B 1 268 ? 45.497  52.435 41.785 1.00 0.00   ? 327 LYS B HZ2   1 
ATOM   5083  H  HZ3   . LYS B 1 268 ? 46.391  53.876 41.888 1.00 0.00   ? 327 LYS B HZ3   1 
ATOM   5084  N  N     . THR B 1 269 ? 38.298  53.381 38.198 1.00 23.98  ? 328 THR B N     1 
ATOM   5085  C  CA    . THR B 1 269 ? 37.171  53.149 37.302 1.00 23.98  ? 328 THR B CA    1 
ATOM   5086  C  C     . THR B 1 269 ? 36.389  54.430 37.043 1.00 23.98  ? 328 THR B C     1 
ATOM   5087  O  O     . THR B 1 269 ? 35.179  54.401 36.859 1.00 26.30  ? 328 THR B O     1 
ATOM   5088  C  CB    . THR B 1 269 ? 36.215  52.072 37.857 1.00 26.30  ? 328 THR B CB    1 
ATOM   5089  O  OG1   . THR B 1 269 ? 36.051  52.237 39.272 1.00 26.30  ? 328 THR B OG1   1 
ATOM   5090  C  CG2   . THR B 1 269 ? 36.742  50.702 37.566 1.00 26.30  ? 328 THR B CG2   1 
ATOM   5091  H  H     . THR B 1 269 ? 38.099  53.619 39.120 1.00 0.00   ? 328 THR B H     1 
ATOM   5092  H  HG1   . THR B 1 269 ? 35.227  51.763 39.430 1.00 30.00  ? 328 THR B HG1   1 
ATOM   5093  N  N     . THR B 1 270 ? 37.090  55.556 36.993 1.00 28.02  ? 329 THR B N     1 
ATOM   5094  C  CA    . THR B 1 270 ? 36.449  56.848 36.762 1.00 28.02  ? 329 THR B CA    1 
ATOM   5095  C  C     . THR B 1 270 ? 37.445  57.877 36.206 1.00 28.02  ? 329 THR B C     1 
ATOM   5096  O  O     . THR B 1 270 ? 38.528  58.083 36.770 1.00 36.59  ? 329 THR B O     1 
ATOM   5097  C  CB    . THR B 1 270 ? 35.801  57.350 38.069 1.00 36.59  ? 329 THR B CB    1 
ATOM   5098  O  OG1   . THR B 1 270 ? 34.418  57.001 38.075 1.00 36.59  ? 329 THR B OG1   1 
ATOM   5099  C  CG2   . THR B 1 270 ? 35.942  58.818 38.236 1.00 36.59  ? 329 THR B CG2   1 
ATOM   5100  H  H     . THR B 1 270 ? 38.060  55.545 37.127 1.00 0.00   ? 329 THR B H     1 
ATOM   5101  H  HG1   . THR B 1 270 ? 34.332  56.037 38.003 1.00 30.00  ? 329 THR B HG1   1 
ATOM   5102  N  N     . LEU B 1 271 ? 37.085  58.479 35.071 1.00 34.41  ? 330 LEU B N     1 
ATOM   5103  C  CA    . LEU B 1 271 ? 37.894  59.498 34.401 1.00 34.41  ? 330 LEU B CA    1 
ATOM   5104  C  C     . LEU B 1 271 ? 36.939  60.479 33.786 1.00 34.41  ? 330 LEU B C     1 
ATOM   5105  O  O     . LEU B 1 271 ? 35.737  60.240 33.743 1.00 36.76  ? 330 LEU B O     1 
ATOM   5106  C  CB    . LEU B 1 271 ? 38.725  58.913 33.259 1.00 36.76  ? 330 LEU B CB    1 
ATOM   5107  C  CG    . LEU B 1 271 ? 40.150  58.413 33.484 1.00 36.76  ? 330 LEU B CG    1 
ATOM   5108  C  CD1   . LEU B 1 271 ? 40.839  59.305 34.513 1.00 36.76  ? 330 LEU B CD1   1 
ATOM   5109  C  CD2   . LEU B 1 271 ? 40.144  56.966 33.940 1.00 36.76  ? 330 LEU B CD2   1 
ATOM   5110  H  H     . LEU B 1 271 ? 36.227  58.259 34.641 1.00 0.00   ? 330 LEU B H     1 
ATOM   5111  N  N     . ALA B 1 272 ? 37.482  61.580 33.294 1.00 59.36  ? 331 ALA B N     1 
ATOM   5112  C  CA    . ALA B 1 272 ? 36.677  62.609 32.639 1.00 59.36  ? 331 ALA B CA    1 
ATOM   5113  C  C     . ALA B 1 272 ? 36.290  62.093 31.246 1.00 59.36  ? 331 ALA B C     1 
ATOM   5114  O  O     . ALA B 1 272 ? 36.985  61.239 30.683 1.00 64.70  ? 331 ALA B O     1 
ATOM   5115  C  CB    . ALA B 1 272 ? 37.472  63.922 32.539 1.00 64.70  ? 331 ALA B CB    1 
ATOM   5116  H  H     . ALA B 1 272 ? 38.452  61.666 33.330 1.00 0.00   ? 331 ALA B H     1 
ATOM   5117  N  N     . PRO B 1 273 ? 35.187  62.615 30.673 1.00 56.00  ? 332 PRO B N     1 
ATOM   5118  C  CA    . PRO B 1 273 ? 34.663  62.235 29.354 1.00 56.00  ? 332 PRO B CA    1 
ATOM   5119  C  C     . PRO B 1 273 ? 35.419  62.606 28.074 1.00 56.00  ? 332 PRO B C     1 
ATOM   5120  O  O     . PRO B 1 273 ? 35.763  61.709 27.303 1.00 44.64  ? 332 PRO B O     1 
ATOM   5121  C  CB    . PRO B 1 273 ? 33.264  62.864 29.337 1.00 44.64  ? 332 PRO B CB    1 
ATOM   5122  C  CG    . PRO B 1 273 ? 32.924  63.032 30.783 1.00 44.64  ? 332 PRO B CG    1 
ATOM   5123  C  CD    . PRO B 1 273 ? 34.234  63.503 31.355 1.00 44.64  ? 332 PRO B CD    1 
ATOM   5124  N  N     . ASN B 1 274 ? 35.657  63.905 27.843 1.00 86.10  ? 333 ASN B N     1 
ATOM   5125  C  CA    . ASN B 1 274 ? 36.296  64.391 26.599 1.00 86.10  ? 333 ASN B CA    1 
ATOM   5126  C  C     . ASN B 1 274 ? 36.737  63.368 25.561 1.00 86.10  ? 333 ASN B C     1 
ATOM   5127  O  O     . ASN B 1 274 ? 37.778  62.697 25.664 1.00 54.73  ? 333 ASN B O     1 
ATOM   5128  C  CB    . ASN B 1 274 ? 37.421  65.408 26.811 1.00 54.73  ? 333 ASN B CB    1 
ATOM   5129  C  CG    . ASN B 1 274 ? 38.002  65.910 25.472 1.00 54.73  ? 333 ASN B CG    1 
ATOM   5130  O  OD1   . ASN B 1 274 ? 38.873  65.271 24.900 1.00 54.73  ? 333 ASN B OD1   1 
ATOM   5131  N  ND2   . ASN B 1 274 ? 37.484  67.026 24.963 1.00 54.73  ? 333 ASN B ND2   1 
ATOM   5132  H  H     . ASN B 1 274 ? 35.409  64.541 28.541 1.00 0.00   ? 333 ASN B H     1 
ATOM   5133  H  HD21  . ASN B 1 274 ? 37.867  67.326 24.113 1.00 0.00   ? 333 ASN B HD21  1 
ATOM   5134  H  HD22  . ASN B 1 274 ? 36.766  67.483 25.443 1.00 0.00   ? 333 ASN B HD22  1 
ATOM   5135  N  N     . THR B 1 275 ? 35.922  63.294 24.532 1.00 75.90  ? 334 THR B N     1 
ATOM   5136  C  CA    . THR B 1 275 ? 36.146  62.386 23.450 1.00 75.90  ? 334 THR B CA    1 
ATOM   5137  C  C     . THR B 1 275 ? 37.126  63.012 22.460 1.00 75.90  ? 334 THR B C     1 
ATOM   5138  O  O     . THR B 1 275 ? 37.106  64.228 22.244 1.00 88.46  ? 334 THR B O     1 
ATOM   5139  C  CB    . THR B 1 275 ? 34.809  62.094 22.794 1.00 88.46  ? 334 THR B CB    1 
ATOM   5140  O  OG1   . THR B 1 275 ? 34.086  63.325 22.625 1.00 88.46  ? 334 THR B OG1   1 
ATOM   5141  C  CG2   . THR B 1 275 ? 33.989  61.149 23.667 1.00 88.46  ? 334 THR B CG2   1 
ATOM   5142  H  H     . THR B 1 275 ? 35.137  63.869 24.460 1.00 0.00   ? 334 THR B H     1 
ATOM   5143  H  HG1   . THR B 1 275 ? 34.592  63.930 22.068 1.00 30.00  ? 334 THR B HG1   1 
ATOM   5144  N  N     . GLN B 1 276 ? 38.017  62.182 21.920 1.00 54.30  ? 335 GLN B N     1 
ATOM   5145  C  CA    . GLN B 1 276 ? 39.021  62.589 20.939 1.00 54.30  ? 335 GLN B CA    1 
ATOM   5146  C  C     . GLN B 1 276 ? 38.824  61.638 19.776 1.00 54.30  ? 335 GLN B C     1 
ATOM   5147  O  O     . GLN B 1 276 ? 39.118  60.444 19.868 1.00 85.61  ? 335 GLN B O     1 
ATOM   5148  C  CB    . GLN B 1 276 ? 40.431  62.446 21.515 1.00 85.61  ? 335 GLN B CB    1 
ATOM   5149  C  CG    . GLN B 1 276 ? 40.789  63.483 22.575 1.00 85.61  ? 335 GLN B CG    1 
ATOM   5150  C  CD    . GLN B 1 276 ? 41.012  64.870 21.996 1.00 85.61  ? 335 GLN B CD    1 
ATOM   5151  O  OE1   . GLN B 1 276 ? 42.153  65.300 21.815 1.00 85.61  ? 335 GLN B OE1   1 
ATOM   5152  N  NE2   . GLN B 1 276 ? 39.926  65.579 21.712 1.00 85.61  ? 335 GLN B NE2   1 
ATOM   5153  H  H     . GLN B 1 276 ? 38.017  61.245 22.211 1.00 0.00   ? 335 GLN B H     1 
ATOM   5154  N  N     . THR B 1 277 ? 38.327  62.188 18.679 1.00 87.69  ? 336 THR B N     1 
ATOM   5155  C  CA    . THR B 1 277 ? 38.006  61.414 17.486 1.00 87.69  ? 336 THR B CA    1 
ATOM   5156  C  C     . THR B 1 277 ? 39.122  60.812 16.615 1.00 87.69  ? 336 THR B C     1 
ATOM   5157  O  O     . THR B 1 277 ? 38.898  59.773 15.979 1.00 80.84  ? 336 THR B O     1 
ATOM   5158  C  CB    . THR B 1 277 ? 37.035  62.215 16.581 1.00 80.84  ? 336 THR B CB    1 
ATOM   5159  O  OG1   . THR B 1 277 ? 36.364  61.326 15.674 1.00 80.84  ? 336 THR B OG1   1 
ATOM   5160  C  CG2   . THR B 1 277 ? 37.789  63.294 15.803 1.00 80.84  ? 336 THR B CG2   1 
ATOM   5161  H  H     . THR B 1 277 ? 38.148  63.148 18.663 1.00 0.00   ? 336 THR B H     1 
ATOM   5162  H  HG1   . THR B 1 277 ? 36.987  60.794 15.159 1.00 30.00  ? 336 THR B HG1   1 
ATOM   5163  N  N     . ALA B 1 278 ? 40.312  61.415 16.601 1.00 38.47  ? 337 ALA B N     1 
ATOM   5164  C  CA    . ALA B 1 278 ? 41.400  60.931 15.743 1.00 38.47  ? 337 ALA B CA    1 
ATOM   5165  C  C     . ALA B 1 278 ? 40.992  61.299 14.319 1.00 38.47  ? 337 ALA B C     1 
ATOM   5166  O  O     . ALA B 1 278 ? 39.859  61.731 14.079 1.00 48.38  ? 337 ALA B O     1 
ATOM   5167  C  CB    . ALA B 1 278 ? 41.607  59.414 15.874 1.00 48.38  ? 337 ALA B CB    1 
ATOM   5168  H  H     . ALA B 1 278 ? 40.449  62.206 17.150 1.00 0.00   ? 337 ALA B H     1 
ATOM   5169  N  N     . SER B 1 279 ? 41.909  61.178 13.375 1.00 96.25  ? 338 SER B N     1 
ATOM   5170  C  CA    . SER B 1 279 ? 41.583  61.553 12.005 1.00 96.25  ? 338 SER B CA    1 
ATOM   5171  C  C     . SER B 1 279 ? 41.009  60.416 11.161 1.00 96.25  ? 338 SER B C     1 
ATOM   5172  O  O     . SER B 1 279 ? 41.369  59.253 11.354 1.00 92.11  ? 338 SER B O     1 
ATOM   5173  C  CB    . SER B 1 279 ? 42.815  62.178 11.310 1.00 92.11  ? 338 SER B CB    1 
ATOM   5174  O  OG    . SER B 1 279 ? 43.925  61.290 11.236 1.00 92.11  ? 338 SER B OG    1 
ATOM   5175  H  H     . SER B 1 279 ? 42.795  60.817 13.570 1.00 0.00   ? 338 SER B H     1 
ATOM   5176  H  HG    . SER B 1 279 ? 44.712  61.801 11.004 1.00 30.00  ? 338 SER B HG    1 
ATOM   5177  N  N     . PRO B 1 280 ? 40.063  60.734 10.253 1.00 53.56  ? 339 PRO B N     1 
ATOM   5178  C  CA    . PRO B 1 280 ? 39.484  59.697 9.399  1.00 53.56  ? 339 PRO B CA    1 
ATOM   5179  C  C     . PRO B 1 280 ? 40.648  58.966 8.713  1.00 53.56  ? 339 PRO B C     1 
ATOM   5180  O  O     . PRO B 1 280 ? 40.595  57.755 8.485  1.00 56.82  ? 339 PRO B O     1 
ATOM   5181  C  CB    . PRO B 1 280 ? 38.648  60.514 8.422  1.00 56.82  ? 339 PRO B CB    1 
ATOM   5182  C  CG    . PRO B 1 280 ? 38.123  61.609 9.300  1.00 56.82  ? 339 PRO B CG    1 
ATOM   5183  C  CD    . PRO B 1 280 ? 39.362  62.020 10.061 1.00 56.82  ? 339 PRO B CD    1 
ATOM   5184  N  N     . ARG B 1 281 ? 41.715  59.715 8.435  1.00 57.88  ? 340 ARG B N     1 
ATOM   5185  C  CA    . ARG B 1 281 ? 42.931  59.173 7.828  1.00 57.88  ? 340 ARG B CA    1 
ATOM   5186  C  C     . ARG B 1 281 ? 43.547  58.189 8.813  1.00 57.88  ? 340 ARG B C     1 
ATOM   5187  O  O     . ARG B 1 281 ? 43.741  57.022 8.495  1.00 91.46  ? 340 ARG B O     1 
ATOM   5188  C  CB    . ARG B 1 281 ? 43.931  60.304 7.570  1.00 91.46  ? 340 ARG B CB    1 
ATOM   5189  C  CG    . ARG B 1 281 ? 43.989  60.819 6.135  1.00 91.46  ? 340 ARG B CG    1 
ATOM   5190  C  CD    . ARG B 1 281 ? 44.732  59.847 5.215  1.00 91.46  ? 340 ARG B CD    1 
ATOM   5191  N  NE    . ARG B 1 281 ? 46.008  59.422 5.790  1.00 91.46  ? 340 ARG B NE    1 
ATOM   5192  C  CZ    . ARG B 1 281 ? 47.018  58.909 5.094  1.00 91.46  ? 340 ARG B CZ    1 
ATOM   5193  N  NH1   . ARG B 1 281 ? 46.920  58.761 3.779  1.00 91.46  ? 340 ARG B NH1   1 
ATOM   5194  N  NH2   . ARG B 1 281 ? 48.116  58.503 5.722  1.00 91.46  ? 340 ARG B NH2   1 
ATOM   5195  H  H     . ARG B 1 281 ? 41.655  60.670 8.607  1.00 0.00   ? 340 ARG B H     1 
ATOM   5196  H  HE    . ARG B 1 281 ? 46.154  59.527 6.752  1.00 0.00   ? 340 ARG B HE    1 
ATOM   5197  H  HH11  . ARG B 1 281 ? 46.092  59.041 3.295  1.00 0.00   ? 340 ARG B HH11  1 
ATOM   5198  H  HH12  . ARG B 1 281 ? 47.685  58.370 3.267  1.00 0.00   ? 340 ARG B HH12  1 
ATOM   5199  H  HH21  . ARG B 1 281 ? 48.179  58.586 6.716  1.00 0.00   ? 340 ARG B HH21  1 
ATOM   5200  H  HH22  . ARG B 1 281 ? 48.874  58.109 5.202  1.00 0.00   ? 340 ARG B HH22  1 
ATOM   5201  N  N     . ALA B 1 282 ? 43.803  58.675 10.025 1.00 32.57  ? 341 ALA B N     1 
ATOM   5202  C  CA    . ALA B 1 282 ? 44.395  57.878 11.102 1.00 32.57  ? 341 ALA B CA    1 
ATOM   5203  C  C     . ALA B 1 282 ? 43.641  56.600 11.472 1.00 32.57  ? 341 ALA B C     1 
ATOM   5204  O  O     . ALA B 1 282 ? 44.247  55.529 11.550 1.00 43.42  ? 341 ALA B O     1 
ATOM   5205  C  CB    . ALA B 1 282 ? 44.582  58.733 12.340 1.00 43.42  ? 341 ALA B CB    1 
ATOM   5206  H  H     . ALA B 1 282 ? 43.587  59.604 10.233 1.00 0.00   ? 341 ALA B H     1 
ATOM   5207  N  N     . LEU B 1 283 ? 42.347  56.730 11.768 1.00 43.43  ? 342 LEU B N     1 
ATOM   5208  C  CA    . LEU B 1 283 ? 41.505  55.590 12.131 1.00 43.43  ? 342 LEU B CA    1 
ATOM   5209  C  C     . LEU B 1 283 ? 41.460  54.619 10.964 1.00 43.43  ? 342 LEU B C     1 
ATOM   5210  O  O     . LEU B 1 283 ? 41.639  53.410 11.132 1.00 37.15  ? 342 LEU B O     1 
ATOM   5211  C  CB    . LEU B 1 283 ? 40.070  56.044 12.452 1.00 37.15  ? 342 LEU B CB    1 
ATOM   5212  C  CG    . LEU B 1 283 ? 39.799  56.980 13.643 1.00 37.15  ? 342 LEU B CG    1 
ATOM   5213  C  CD1   . LEU B 1 283 ? 38.306  57.352 13.731 1.00 37.15  ? 342 LEU B CD1   1 
ATOM   5214  C  CD2   . LEU B 1 283 ? 40.270  56.313 14.923 1.00 37.15  ? 342 LEU B CD2   1 
ATOM   5215  H  H     . LEU B 1 283 ? 41.950  57.611 11.774 1.00 0.00   ? 342 LEU B H     1 
ATOM   5216  N  N     . ALA B 1 284 ? 41.232  55.157 9.773  1.00 23.95  ? 343 ALA B N     1 
ATOM   5217  C  CA    . ALA B 1 284 ? 41.159  54.334 8.583  1.00 23.95  ? 343 ALA B CA    1 
ATOM   5218  C  C     . ALA B 1 284 ? 42.360  53.416 8.536  1.00 23.95  ? 343 ALA B C     1 
ATOM   5219  O  O     . ALA B 1 284 ? 42.229  52.199 8.371  1.00 62.27  ? 343 ALA B O     1 
ATOM   5220  C  CB    . ALA B 1 284 ? 41.136  55.195 7.367  1.00 62.27  ? 343 ALA B CB    1 
ATOM   5221  H  H     . ALA B 1 284 ? 41.112  56.126 9.678  1.00 0.00   ? 343 ALA B H     1 
ATOM   5222  N  N     . ASP B 1 285 ? 43.531  54.006 8.730  1.00 47.16  ? 344 ASP B N     1 
ATOM   5223  C  CA    . ASP B 1 285 ? 44.770  53.256 8.704  1.00 47.16  ? 344 ASP B CA    1 
ATOM   5224  C  C     . ASP B 1 285 ? 44.746  52.150 9.740  1.00 47.16  ? 344 ASP B C     1 
ATOM   5225  O  O     . ASP B 1 285 ? 45.019  50.986 9.429  1.00 92.95  ? 344 ASP B O     1 
ATOM   5226  C  CB    . ASP B 1 285 ? 45.961  54.201 8.909  1.00 92.95  ? 344 ASP B CB    1 
ATOM   5227  C  CG    . ASP B 1 285 ? 46.235  55.086 7.679  1.00 92.95  ? 344 ASP B CG    1 
ATOM   5228  O  OD1   . ASP B 1 285 ? 45.272  55.516 6.998  1.00 92.95  ? 344 ASP B OD1   1 
ATOM   5229  O  OD2   . ASP B 1 285 ? 47.424  55.342 7.386  1.00 92.95  ? 344 ASP B OD2   1 
ATOM   5230  H  H     . ASP B 1 285 ? 43.558  54.977 8.873  1.00 0.00   ? 344 ASP B H     1 
ATOM   5231  N  N     . SER B 1 286 ? 44.321  52.497 10.947 1.00 48.63  ? 345 SER B N     1 
ATOM   5232  C  CA    . SER B 1 286 ? 44.248  51.527 12.030 1.00 48.63  ? 345 SER B CA    1 
ATOM   5233  C  C     . SER B 1 286 ? 43.390  50.340 11.590 1.00 48.63  ? 345 SER B C     1 
ATOM   5234  O  O     . SER B 1 286 ? 43.758  49.183 11.810 1.00 48.36  ? 345 SER B O     1 
ATOM   5235  C  CB    . SER B 1 286 ? 43.639  52.168 13.280 1.00 48.36  ? 345 SER B CB    1 
ATOM   5236  O  OG    . SER B 1 286 ? 43.983  53.543 13.393 1.00 48.36  ? 345 SER B OG    1 
ATOM   5237  H  H     . SER B 1 286 ? 44.038  53.421 11.134 1.00 0.00   ? 345 SER B H     1 
ATOM   5238  H  HG    . SER B 1 286 ? 44.921  53.684 13.229 1.00 30.00  ? 345 SER B HG    1 
ATOM   5239  N  N     . LEU B 1 287 ? 42.274  50.631 10.924 1.00 61.48  ? 346 LEU B N     1 
ATOM   5240  C  CA    . LEU B 1 287 ? 41.376  49.582 10.466 1.00 61.48  ? 346 LEU B CA    1 
ATOM   5241  C  C     . LEU B 1 287 ? 42.089  48.670 9.496  1.00 61.48  ? 346 LEU B C     1 
ATOM   5242  O  O     . LEU B 1 287 ? 42.076  47.445 9.673  1.00 42.00  ? 346 LEU B O     1 
ATOM   5243  C  CB    . LEU B 1 287 ? 40.126  50.165 9.801  1.00 42.00  ? 346 LEU B CB    1 
ATOM   5244  C  CG    . LEU B 1 287 ? 39.141  50.912 10.703 1.00 42.00  ? 346 LEU B CG    1 
ATOM   5245  C  CD1   . LEU B 1 287 ? 37.834  51.137 9.959  1.00 42.00  ? 346 LEU B CD1   1 
ATOM   5246  C  CD2   . LEU B 1 287 ? 38.872  50.098 11.948 1.00 42.00  ? 346 LEU B CD2   1 
ATOM   5247  H  H     . LEU B 1 287 ? 42.059  51.568 10.716 1.00 0.00   ? 346 LEU B H     1 
ATOM   5248  N  N     . MET B 1 288 ? 42.765  49.277 8.515  1.00 56.07  ? 347 MET B N     1 
ATOM   5249  C  CA    . MET B 1 288 ? 43.488  48.531 7.483  1.00 56.07  ? 347 MET B CA    1 
ATOM   5250  C  C     . MET B 1 288 ? 44.474  47.585 8.139  1.00 56.07  ? 347 MET B C     1 
ATOM   5251  O  O     . MET B 1 288 ? 44.659  46.449 7.686  1.00 51.96  ? 347 MET B O     1 
ATOM   5252  C  CB    . MET B 1 288 ? 44.174  49.482 6.495  1.00 51.96  ? 347 MET B CB    1 
ATOM   5253  C  CG    . MET B 1 288 ? 43.271  49.935 5.341  1.00 51.96  ? 347 MET B CG    1 
ATOM   5254  S  SD    . MET B 1 288 ? 42.830  48.555 4.228  1.00 51.96  ? 347 MET B SD    1 
ATOM   5255  C  CE    . MET B 1 288 ? 42.410  49.427 2.718  1.00 51.96  ? 347 MET B CE    1 
ATOM   5256  H  H     . MET B 1 288 ? 42.771  50.257 8.485  1.00 0.00   ? 347 MET B H     1 
ATOM   5257  N  N     . GLN B 1 289 ? 45.039  48.021 9.258  1.00 31.68  ? 348 GLN B N     1 
ATOM   5258  C  CA    . GLN B 1 289 ? 45.966  47.168 9.982  1.00 31.68  ? 348 GLN B CA    1 
ATOM   5259  C  C     . GLN B 1 289 ? 45.213  45.878 10.324 1.00 31.68  ? 348 GLN B C     1 
ATOM   5260  O  O     . GLN B 1 289 ? 45.565  44.779 9.883  1.00 90.66  ? 348 GLN B O     1 
ATOM   5261  C  CB    . GLN B 1 289 ? 46.401  47.823 11.302 1.00 90.66  ? 348 GLN B CB    1 
ATOM   5262  C  CG    . GLN B 1 289 ? 46.961  49.237 11.205 1.00 90.66  ? 348 GLN B CG    1 
ATOM   5263  C  CD    . GLN B 1 289 ? 47.203  49.870 12.578 1.00 90.66  ? 348 GLN B CD    1 
ATOM   5264  O  OE1   . GLN B 1 289 ? 48.183  50.589 12.778 1.00 90.66  ? 348 GLN B OE1   1 
ATOM   5265  N  NE2   . GLN B 1 289 ? 46.292  49.623 13.521 1.00 90.66  ? 348 GLN B NE2   1 
ATOM   5266  H  H     . GLN B 1 289 ? 44.834  48.930 9.565  1.00 0.00   ? 348 GLN B H     1 
ATOM   5267  N  N     . LEU B 1 290 ? 44.141  46.055 11.090 1.00 47.15  ? 349 LEU B N     1 
ATOM   5268  C  CA    . LEU B 1 290 ? 43.317  44.948 11.548 1.00 47.15  ? 349 LEU B CA    1 
ATOM   5269  C  C     . LEU B 1 290 ? 42.937  44.075 10.369 1.00 47.15  ? 349 LEU B C     1 
ATOM   5270  O  O     . LEU B 1 290 ? 43.013  42.852 10.455 1.00 32.20  ? 349 LEU B O     1 
ATOM   5271  C  CB    . LEU B 1 290 ? 42.073  45.479 12.276 1.00 32.20  ? 349 LEU B CB    1 
ATOM   5272  C  CG    . LEU B 1 290 ? 42.152  45.976 13.737 1.00 32.20  ? 349 LEU B CG    1 
ATOM   5273  C  CD1   . LEU B 1 290 ? 43.529  46.481 14.126 1.00 32.20  ? 349 LEU B CD1   1 
ATOM   5274  C  CD2   . LEU B 1 290 ? 41.119  47.052 13.975 1.00 32.20  ? 349 LEU B CD2   1 
ATOM   5275  H  H     . LEU B 1 290 ? 43.871  46.970 11.317 1.00 0.00   ? 349 LEU B H     1 
ATOM   5276  N  N     . ALA B 1 291 ? 42.619  44.711 9.244  1.00 23.66  ? 350 ALA B N     1 
ATOM   5277  C  CA    . ALA B 1 291 ? 42.239  43.981 8.037  1.00 23.66  ? 350 ALA B CA    1 
ATOM   5278  C  C     . ALA B 1 291 ? 43.298  42.950 7.679  1.00 23.66  ? 350 ALA B C     1 
ATOM   5279  O  O     . ALA B 1 291 ? 42.982  41.784 7.447  1.00 44.33  ? 350 ALA B O     1 
ATOM   5280  C  CB    . ALA B 1 291 ? 42.031  44.930 6.887  1.00 44.33  ? 350 ALA B CB    1 
ATOM   5281  H  H     . ALA B 1 291 ? 42.648  45.687 9.222  1.00 0.00   ? 350 ALA B H     1 
ATOM   5282  N  N     . ARG B 1 292 ? 44.561  43.368 7.691  1.00 36.01  ? 351 ARG B N     1 
ATOM   5283  C  CA    . ARG B 1 292 ? 45.661  42.448 7.361  1.00 36.01  ? 351 ARG B CA    1 
ATOM   5284  C  C     . ARG B 1 292 ? 45.755  41.393 8.434  1.00 36.01  ? 351 ARG B C     1 
ATOM   5285  O  O     . ARG B 1 292 ? 45.813  40.198 8.138  1.00 90.69  ? 351 ARG B O     1 
ATOM   5286  C  CB    . ARG B 1 292 ? 47.003  43.181 7.218  1.00 90.69  ? 351 ARG B CB    1 
ATOM   5287  C  CG    . ARG B 1 292 ? 47.125  44.093 5.984  1.00 90.69  ? 351 ARG B CG    1 
ATOM   5288  C  CD    . ARG B 1 292 ? 46.645  43.418 4.683  1.00 90.69  ? 351 ARG B CD    1 
ATOM   5289  N  NE    . ARG B 1 292 ? 47.431  43.822 3.507  1.00 90.69  ? 351 ARG B NE    1 
ATOM   5290  C  CZ    . ARG B 1 292 ? 47.367  45.014 2.904  1.00 90.69  ? 351 ARG B CZ    1 
ATOM   5291  N  NH1   . ARG B 1 292 ? 46.544  45.966 3.344  1.00 90.69  ? 351 ARG B NH1   1 
ATOM   5292  N  NH2   . ARG B 1 292 ? 48.157  45.267 1.865  1.00 90.69  ? 351 ARG B NH2   1 
ATOM   5293  H  H     . ARG B 1 292 ? 44.749  44.303 7.931  1.00 0.00   ? 351 ARG B H     1 
ATOM   5294  H  HE    . ARG B 1 292 ? 48.050  43.161 3.133  1.00 0.00   ? 351 ARG B HE    1 
ATOM   5295  H  HH11  . ARG B 1 292 ? 45.966  45.806 4.143  1.00 0.00   ? 351 ARG B HH11  1 
ATOM   5296  H  HH12  . ARG B 1 292 ? 46.513  46.850 2.878  1.00 0.00   ? 351 ARG B HH12  1 
ATOM   5297  H  HH21  . ARG B 1 292 ? 48.798  44.568 1.550  1.00 0.00   ? 351 ARG B HH21  1 
ATOM   5298  H  HH22  . ARG B 1 292 ? 48.118  46.155 1.407  1.00 0.00   ? 351 ARG B HH22  1 
ATOM   5299  N  N     . GLN B 1 293 ? 45.697  41.840 9.685  1.00 59.40  ? 352 GLN B N     1 
ATOM   5300  C  CA    . GLN B 1 293 ? 45.759  40.939 10.823 1.00 59.40  ? 352 GLN B CA    1 
ATOM   5301  C  C     . GLN B 1 293 ? 44.704  39.837 10.679 1.00 59.40  ? 352 GLN B C     1 
ATOM   5302  O  O     . GLN B 1 293 ? 44.992  38.664 10.935 1.00 66.89  ? 352 GLN B O     1 
ATOM   5303  C  CB    . GLN B 1 293 ? 45.545  41.704 12.138 1.00 66.89  ? 352 GLN B CB    1 
ATOM   5304  C  CG    . GLN B 1 293 ? 46.674  42.657 12.541 1.00 66.89  ? 352 GLN B CG    1 
ATOM   5305  C  CD    . GLN B 1 293 ? 46.602  43.081 14.010 1.00 66.89  ? 352 GLN B CD    1 
ATOM   5306  O  OE1   . GLN B 1 293 ? 46.535  44.267 14.330 1.00 66.89  ? 352 GLN B OE1   1 
ATOM   5307  N  NE2   . GLN B 1 293 ? 46.627  42.108 14.904 1.00 66.89  ? 352 GLN B NE2   1 
ATOM   5308  H  H     . GLN B 1 293 ? 45.589  42.804 9.822  1.00 0.00   ? 352 GLN B H     1 
ATOM   5309  N  N     . VAL B 1 294 ? 43.513  40.207 10.203 1.00 55.91  ? 353 VAL B N     1 
ATOM   5310  C  CA    . VAL B 1 294 ? 42.409  39.255 10.029 1.00 55.91  ? 353 VAL B CA    1 
ATOM   5311  C  C     . VAL B 1 294 ? 42.669  38.317 8.856  1.00 55.91  ? 353 VAL B C     1 
ATOM   5312  O  O     . VAL B 1 294 ? 42.423  37.113 8.960  1.00 37.09  ? 353 VAL B O     1 
ATOM   5313  C  CB    . VAL B 1 294 ? 41.055  39.960 9.770  1.00 37.09  ? 353 VAL B CB    1 
ATOM   5314  C  CG1   . VAL B 1 294 ? 39.938  38.966 9.813  1.00 37.09  ? 353 VAL B CG1   1 
ATOM   5315  C  CG2   . VAL B 1 294 ? 40.801  41.035 10.777 1.00 37.09  ? 353 VAL B CG2   1 
ATOM   5316  H  H     . VAL B 1 294 ? 43.379  41.132 9.925  1.00 0.00   ? 353 VAL B H     1 
ATOM   5317  N  N     . SER B 1 295 ? 43.155  38.879 7.745  1.00 75.04  ? 354 SER B N     1 
ATOM   5318  C  CA    . SER B 1 295 ? 43.443  38.115 6.528  1.00 75.04  ? 354 SER B CA    1 
ATOM   5319  C  C     . SER B 1 295 ? 44.545  37.086 6.736  1.00 75.04  ? 354 SER B C     1 
ATOM   5320  O  O     . SER B 1 295 ? 44.598  36.068 6.039  1.00 73.94  ? 354 SER B O     1 
ATOM   5321  C  CB    . SER B 1 295 ? 43.793  39.046 5.356  1.00 73.94  ? 354 SER B CB    1 
ATOM   5322  O  OG    . SER B 1 295 ? 44.836  39.954 5.680  1.00 73.94  ? 354 SER B OG    1 
ATOM   5323  H  H     . SER B 1 295 ? 43.340  39.845 7.723  1.00 0.00   ? 354 SER B H     1 
ATOM   5324  H  HG    . SER B 1 295 ? 45.609  39.501 6.032  1.00 30.00  ? 354 SER B HG    1 
ATOM   5325  N  N     . ARG B 1 296 ? 45.432  37.368 7.686  1.00 64.71  ? 355 ARG B N     1 
ATOM   5326  C  CA    . ARG B 1 296 ? 46.521  36.456 7.998  1.00 64.71  ? 355 ARG B CA    1 
ATOM   5327  C  C     . ARG B 1 296 ? 45.929  35.200 8.643  1.00 64.71  ? 355 ARG B C     1 
ATOM   5328  O  O     . ARG B 1 296 ? 46.378  34.085 8.358  1.00 94.73  ? 355 ARG B O     1 
ATOM   5329  C  CB    . ARG B 1 296 ? 47.530  37.108 8.963  1.00 94.73  ? 355 ARG B CB    1 
ATOM   5330  C  CG    . ARG B 1 296 ? 48.951  37.316 8.407  1.00 94.73  ? 355 ARG B CG    1 
ATOM   5331  C  CD    . ARG B 1 296 ? 49.197  38.758 7.928  1.00 94.73  ? 355 ARG B CD    1 
ATOM   5332  N  NE    . ARG B 1 296 ? 48.369  39.120 6.774  1.00 94.73  ? 355 ARG B NE    1 
ATOM   5333  C  CZ    . ARG B 1 296 ? 48.468  40.260 6.083  1.00 94.73  ? 355 ARG B CZ    1 
ATOM   5334  N  NH1   . ARG B 1 296 ? 49.371  41.185 6.409  1.00 94.73  ? 355 ARG B NH1   1 
ATOM   5335  N  NH2   . ARG B 1 296 ? 47.628  40.490 5.077  1.00 94.73  ? 355 ARG B NH2   1 
ATOM   5336  H  H     . ARG B 1 296 ? 45.351  38.212 8.180  1.00 0.00   ? 355 ARG B H     1 
ATOM   5337  H  HE    . ARG B 1 296 ? 47.693  38.479 6.476  1.00 0.00   ? 355 ARG B HE    1 
ATOM   5338  H  HH11  . ARG B 1 296 ? 49.983  41.040 7.187  1.00 0.00   ? 355 ARG B HH11  1 
ATOM   5339  H  HH12  . ARG B 1 296 ? 49.422  42.036 5.888  1.00 0.00   ? 355 ARG B HH12  1 
ATOM   5340  H  HH21  . ARG B 1 296 ? 46.931  39.811 4.846  1.00 0.00   ? 355 ARG B HH21  1 
ATOM   5341  H  HH22  . ARG B 1 296 ? 47.700  41.335 4.552  1.00 0.00   ? 355 ARG B HH22  1 
ATOM   5342  N  N     . LEU B 1 297 ? 44.918  35.374 9.494  1.00 70.91  ? 356 LEU B N     1 
ATOM   5343  C  CA    . LEU B 1 297 ? 44.302  34.235 10.170 1.00 70.91  ? 356 LEU B CA    1 
ATOM   5344  C  C     . LEU B 1 297 ? 43.319  33.469 9.294  1.00 70.91  ? 356 LEU B C     1 
ATOM   5345  O  O     . LEU B 1 297 ? 42.927  32.363 9.724  1.00 66.32  ? 356 LEU B O     1 
ATOM   5346  C  CB    . LEU B 1 297 ? 43.638  34.675 11.479 1.00 66.32  ? 356 LEU B CB    1 
ATOM   5347  C  CG    . LEU B 1 297 ? 42.528  35.730 11.494 1.00 66.32  ? 356 LEU B CG    1 
ATOM   5348  C  CD1   . LEU B 1 297 ? 41.237  35.172 10.934 1.00 66.32  ? 356 LEU B CD1   1 
ATOM   5349  C  CD2   . LEU B 1 297 ? 42.301  36.200 12.919 1.00 66.32  ? 356 LEU B CD2   1 
ATOM   5350  H  H     . LEU B 1 297 ? 44.560  36.271 9.654  1.00 0.00   ? 356 LEU B H     1 
ATOM   5351  N  N     . SER C 1 2   ? -25.821 39.160 27.906 1.00 104.95 ? 61  SER C N     1 
ATOM   5352  C  CA    . SER C 1 2   ? -26.685 38.281 28.744 1.00 104.95 ? 61  SER C CA    1 
ATOM   5353  C  C     . SER C 1 2   ? -25.856 37.500 29.769 1.00 104.95 ? 61  SER C C     1 
ATOM   5354  O  O     . SER C 1 2   ? -25.691 37.936 30.912 1.00 89.33  ? 61  SER C O     1 
ATOM   5355  C  CB    . SER C 1 2   ? -27.502 37.317 27.852 1.00 89.33  ? 61  SER C CB    1 
ATOM   5356  O  OG    . SER C 1 2   ? -26.690 36.624 26.907 1.00 89.33  ? 61  SER C OG    1 
ATOM   5357  H  HG    . SER C 1 2   ? -27.198 36.071 26.285 1.00 30.00  ? 61  SER C HG    1 
ATOM   5358  N  N     . LEU C 1 3   ? -25.294 36.382 29.324 1.00 65.59  ? 62  LEU C N     1 
ATOM   5359  C  CA    . LEU C 1 3   ? -24.485 35.499 30.155 1.00 65.59  ? 62  LEU C CA    1 
ATOM   5360  C  C     . LEU C 1 3   ? -23.122 36.122 30.422 1.00 65.59  ? 62  LEU C C     1 
ATOM   5361  O  O     . LEU C 1 3   ? -22.230 36.087 29.578 1.00 85.38  ? 62  LEU C O     1 
ATOM   5362  C  CB    . LEU C 1 3   ? -24.356 34.156 29.444 1.00 85.38  ? 62  LEU C CB    1 
ATOM   5363  C  CG    . LEU C 1 3   ? -25.754 33.743 28.962 1.00 85.38  ? 62  LEU C CG    1 
ATOM   5364  C  CD1   . LEU C 1 3   ? -25.728 33.153 27.559 1.00 85.38  ? 62  LEU C CD1   1 
ATOM   5365  C  CD2   . LEU C 1 3   ? -26.402 32.817 29.979 1.00 85.38  ? 62  LEU C CD2   1 
ATOM   5366  H  H     . LEU C 1 3   ? -25.396 36.127 28.382 1.00 0.00   ? 62  LEU C H     1 
ATOM   5367  N  N     . LEU C 1 4   ? -23.005 36.752 31.584 1.00 31.45  ? 63  LEU C N     1 
ATOM   5368  C  CA    . LEU C 1 4   ? -21.782 37.419 31.999 1.00 31.45  ? 63  LEU C CA    1 
ATOM   5369  C  C     . LEU C 1 4   ? -20.663 36.414 32.138 1.00 31.45  ? 63  LEU C C     1 
ATOM   5370  O  O     . LEU C 1 4   ? -20.759 35.455 32.911 1.00 29.84  ? 63  LEU C O     1 
ATOM   5371  C  CB    . LEU C 1 4   ? -21.976 38.150 33.321 1.00 29.84  ? 63  LEU C CB    1 
ATOM   5372  C  CG    . LEU C 1 4   ? -21.239 39.484 33.408 1.00 29.84  ? 63  LEU C CG    1 
ATOM   5373  C  CD1   . LEU C 1 4   ? -21.596 40.174 34.685 1.00 29.84  ? 63  LEU C CD1   1 
ATOM   5374  C  CD2   . LEU C 1 4   ? -19.746 39.304 33.320 1.00 29.84  ? 63  LEU C CD2   1 
ATOM   5375  H  H     . LEU C 1 4   ? -23.768 36.747 32.201 1.00 0.00   ? 63  LEU C H     1 
ATOM   5376  N  N     . ILE C 1 5   ? -19.589 36.675 31.403 1.00 30.37  ? 64  ILE C N     1 
ATOM   5377  C  CA    . ILE C 1 5   ? -18.403 35.841 31.377 1.00 30.37  ? 64  ILE C CA    1 
ATOM   5378  C  C     . ILE C 1 5   ? -17.307 36.613 32.099 1.00 30.37  ? 64  ILE C C     1 
ATOM   5379  O  O     . ILE C 1 5   ? -17.198 37.829 31.965 1.00 27.46  ? 64  ILE C O     1 
ATOM   5380  C  CB    . ILE C 1 5   ? -18.010 35.509 29.900 1.00 27.46  ? 64  ILE C CB    1 
ATOM   5381  C  CG1   . ILE C 1 5   ? -19.186 34.810 29.210 1.00 27.46  ? 64  ILE C CG1   1 
ATOM   5382  C  CG2   . ILE C 1 5   ? -16.775 34.608 29.845 1.00 27.46  ? 64  ILE C CG2   1 
ATOM   5383  C  CD1   . ILE C 1 5   ? -18.896 34.329 27.848 1.00 27.46  ? 64  ILE C CD1   1 
ATOM   5384  H  H     . ILE C 1 5   ? -19.566 37.492 30.881 1.00 0.00   ? 64  ILE C H     1 
ATOM   5385  N  N     . GLY C 1 6   ? -16.546 35.917 32.930 1.00 18.91  ? 65  GLY C N     1 
ATOM   5386  C  CA    . GLY C 1 6   ? -15.485 36.568 33.667 1.00 18.91  ? 65  GLY C CA    1 
ATOM   5387  C  C     . GLY C 1 6   ? -14.204 35.943 33.198 1.00 18.91  ? 65  GLY C C     1 
ATOM   5388  O  O     . GLY C 1 6   ? -14.081 34.719 33.237 1.00 39.52  ? 65  GLY C O     1 
ATOM   5389  H  H     . GLY C 1 6   ? -16.694 34.954 33.057 1.00 0.00   ? 65  GLY C H     1 
ATOM   5390  N  N     . VAL C 1 7   ? -13.260 36.770 32.744 1.00 33.91  ? 66  VAL C N     1 
ATOM   5391  C  CA    . VAL C 1 7   ? -11.991 36.286 32.226 1.00 33.91  ? 66  VAL C CA    1 
ATOM   5392  C  C     . VAL C 1 7   ? -10.774 36.692 33.065 1.00 33.91  ? 66  VAL C C     1 
ATOM   5393  O  O     . VAL C 1 7   ? -10.554 37.872 33.326 1.00 16.02  ? 66  VAL C O     1 
ATOM   5394  C  CB    . VAL C 1 7   ? -11.781 36.776 30.766 1.00 16.02  ? 66  VAL C CB    1 
ATOM   5395  C  CG1   . VAL C 1 7   ? -10.747 35.927 30.078 1.00 16.02  ? 66  VAL C CG1   1 
ATOM   5396  C  CG2   . VAL C 1 7   ? -13.061 36.722 29.996 1.00 16.02  ? 66  VAL C CG2   1 
ATOM   5397  H  H     . VAL C 1 7   ? -13.428 37.737 32.758 1.00 0.00   ? 66  VAL C H     1 
ATOM   5398  N  N     . ALA C 1 8   ? -10.023 35.716 33.551 1.00 22.07  ? 67  ALA C N     1 
ATOM   5399  C  CA    . ALA C 1 8   ? -8.824  36.036 34.296 1.00 22.07  ? 67  ALA C CA    1 
ATOM   5400  C  C     . ALA C 1 8   ? -7.790  35.871 33.211 1.00 22.07  ? 67  ALA C C     1 
ATOM   5401  O  O     . ALA C 1 8   ? -7.550  34.759 32.708 1.00 27.48  ? 67  ALA C O     1 
ATOM   5402  C  CB    . ALA C 1 8   ? -8.587  35.056 35.418 1.00 27.48  ? 67  ALA C CB    1 
ATOM   5403  H  H     . ALA C 1 8   ? -10.266 34.777 33.394 1.00 0.00   ? 67  ALA C H     1 
ATOM   5404  N  N     . THR C 1 9   ? -7.201  36.984 32.813 1.00 27.59  ? 68  THR C N     1 
ATOM   5405  C  CA    . THR C 1 9   ? -6.235  36.952 31.738 1.00 27.59  ? 68  THR C CA    1 
ATOM   5406  C  C     . THR C 1 9   ? -4.866  37.394 32.196 1.00 27.59  ? 68  THR C C     1 
ATOM   5407  O  O     . THR C 1 9   ? -4.743  38.218 33.106 1.00 28.04  ? 68  THR C O     1 
ATOM   5408  C  CB    . THR C 1 9   ? -6.734  37.827 30.595 1.00 28.04  ? 68  THR C CB    1 
ATOM   5409  O  OG1   . THR C 1 9   ? -5.836  37.729 29.493 1.00 28.04  ? 68  THR C OG1   1 
ATOM   5410  C  CG2   . THR C 1 9   ? -6.854  39.264 31.033 1.00 28.04  ? 68  THR C CG2   1 
ATOM   5411  H  H     . THR C 1 9   ? -7.400  37.834 33.263 1.00 0.00   ? 68  THR C H     1 
ATOM   5412  H  HG1   . THR C 1 9   ? -4.965  38.121 29.659 1.00 30.00  ? 68  THR C HG1   1 
ATOM   5413  N  N     . SER C 1 10  ? -3.839  36.773 31.635 1.00 12.29  ? 69  SER C N     1 
ATOM   5414  C  CA    . SER C 1 10  ? -2.463  37.113 31.974 1.00 12.29  ? 69  SER C CA    1 
ATOM   5415  C  C     . SER C 1 10  ? -2.134  38.365 31.177 1.00 12.29  ? 69  SER C C     1 
ATOM   5416  O  O     . SER C 1 10  ? -2.812  38.640 30.193 1.00 43.20  ? 69  SER C O     1 
ATOM   5417  C  CB    . SER C 1 10  ? -1.519  35.939 31.658 1.00 43.20  ? 69  SER C CB    1 
ATOM   5418  O  OG    . SER C 1 10  ? -1.713  35.382 30.366 1.00 43.20  ? 69  SER C OG    1 
ATOM   5419  H  H     . SER C 1 10  ? -4.053  36.087 30.973 1.00 0.00   ? 69  SER C H     1 
ATOM   5420  H  HG    . SER C 1 10  ? -2.649  35.228 30.185 1.00 30.00  ? 69  SER C HG    1 
ATOM   5421  N  N     . SER C 1 11  ? -1.150  39.140 31.621 1.00 39.84  ? 70  SER C N     1 
ATOM   5422  C  CA    . SER C 1 11  ? -0.766  40.384 30.948 1.00 39.84  ? 70  SER C CA    1 
ATOM   5423  C  C     . SER C 1 11  ? -1.207  40.528 29.504 1.00 39.84  ? 70  SER C C     1 
ATOM   5424  O  O     . SER C 1 11  ? -0.773  39.775 28.630 1.00 29.17  ? 70  SER C O     1 
ATOM   5425  C  CB    . SER C 1 11  ? 0.746   40.608 31.004 1.00 29.17  ? 70  SER C CB    1 
ATOM   5426  O  OG    . SER C 1 11  ? 1.113   41.803 30.319 1.00 29.17  ? 70  SER C OG    1 
ATOM   5427  H  H     . SER C 1 11  ? -0.654  38.874 32.419 1.00 0.00   ? 70  SER C H     1 
ATOM   5428  H  HG    . SER C 1 11  ? 2.076   41.881 30.377 1.00 30.00  ? 70  SER C HG    1 
ATOM   5429  N  N     . LEU C 1 12  ? -2.057  41.521 29.259 1.00 27.27  ? 71  LEU C N     1 
ATOM   5430  C  CA    . LEU C 1 12  ? -2.534  41.792 27.921 1.00 27.27  ? 71  LEU C CA    1 
ATOM   5431  C  C     . LEU C 1 12  ? -1.434  42.470 27.114 1.00 27.27  ? 71  LEU C C     1 
ATOM   5432  O  O     . LEU C 1 12  ? -1.616  42.778 25.945 1.00 25.62  ? 71  LEU C O     1 
ATOM   5433  C  CB    . LEU C 1 12  ? -3.786  42.659 27.973 1.00 25.62  ? 71  LEU C CB    1 
ATOM   5434  C  CG    . LEU C 1 12  ? -4.978  41.868 28.509 1.00 25.62  ? 71  LEU C CG    1 
ATOM   5435  C  CD1   . LEU C 1 12  ? -6.238  42.702 28.417 1.00 25.62  ? 71  LEU C CD1   1 
ATOM   5436  C  CD2   . LEU C 1 12  ? -5.132  40.554 27.748 1.00 25.62  ? 71  LEU C CD2   1 
ATOM   5437  H  H     . LEU C 1 12  ? -2.365  42.082 30.000 1.00 0.00   ? 71  LEU C H     1 
ATOM   5438  N  N     . ALA C 1 13  ? -0.296  42.712 27.752 1.00 19.04  ? 72  ALA C N     1 
ATOM   5439  C  CA    . ALA C 1 13  ? 0.836   43.342 27.103 1.00 19.04  ? 72  ALA C CA    1 
ATOM   5440  C  C     . ALA C 1 13  ? 1.360   42.416 25.997 1.00 19.04  ? 72  ALA C C     1 
ATOM   5441  O  O     . ALA C 1 13  ? 1.925   42.880 25.012 1.00 48.61  ? 72  ALA C O     1 
ATOM   5442  C  CB    . ALA C 1 13  ? 1.919   43.608 28.130 1.00 48.61  ? 72  ALA C CB    1 
ATOM   5443  H  H     . ALA C 1 13  ? -0.184  42.480 28.692 1.00 0.00   ? 72  ALA C H     1 
ATOM   5444  N  N     . LEU C 1 14  ? 1.183   41.112 26.187 1.00 24.78  ? 73  LEU C N     1 
ATOM   5445  C  CA    . LEU C 1 14  ? 1.607   40.096 25.236 1.00 24.78  ? 73  LEU C CA    1 
ATOM   5446  C  C     . LEU C 1 14  ? 0.498   40.024 24.214 1.00 24.78  ? 73  LEU C C     1 
ATOM   5447  O  O     . LEU C 1 14  ? -0.662  40.268 24.531 1.00 2.00   ? 73  LEU C O     1 
ATOM   5448  C  CB    . LEU C 1 14  ? 1.803   38.773 25.962 1.00 2.00   ? 73  LEU C CB    1 
ATOM   5449  C  CG    . LEU C 1 14  ? 2.930   38.961 26.994 1.00 2.00   ? 73  LEU C CG    1 
ATOM   5450  C  CD1   . LEU C 1 14  ? 2.907   37.910 28.097 1.00 2.00   ? 73  LEU C CD1   1 
ATOM   5451  C  CD2   . LEU C 1 14  ? 4.245   38.957 26.288 1.00 2.00   ? 73  LEU C CD2   1 
ATOM   5452  H  H     . LEU C 1 14  ? 0.704   40.806 26.985 1.00 0.00   ? 73  LEU C H     1 
ATOM   5453  N  N     . HIS C 1 15  ? 0.827   39.692 22.980 1.00 7.19   ? 74  HIS C N     1 
ATOM   5454  C  CA    . HIS C 1 15  ? -0.206  39.712 21.955 1.00 7.19   ? 74  HIS C CA    1 
ATOM   5455  C  C     . HIS C 1 15  ? -1.209  38.584 21.967 1.00 7.19   ? 74  HIS C C     1 
ATOM   5456  O  O     . HIS C 1 15  ? -2.385  38.803 21.655 1.00 23.41  ? 74  HIS C O     1 
ATOM   5457  C  CB    . HIS C 1 15  ? 0.431   39.863 20.566 1.00 23.41  ? 74  HIS C CB    1 
ATOM   5458  C  CG    . HIS C 1 15  ? 1.430   40.984 20.460 1.00 23.41  ? 74  HIS C CG    1 
ATOM   5459  N  ND1   . HIS C 1 15  ? 1.677   41.882 21.478 1.00 23.41  ? 74  HIS C ND1   1 
ATOM   5460  C  CD2   . HIS C 1 15  ? 2.259   41.338 19.448 1.00 23.41  ? 74  HIS C CD2   1 
ATOM   5461  C  CE1   . HIS C 1 15  ? 2.609   42.735 21.102 1.00 23.41  ? 74  HIS C CE1   1 
ATOM   5462  N  NE2   . HIS C 1 15  ? 2.979   42.426 19.874 1.00 23.41  ? 74  HIS C NE2   1 
ATOM   5463  H  H     . HIS C 1 15  ? 1.764   39.440 22.801 1.00 0.00   ? 74  HIS C H     1 
ATOM   5464  H  HD1   . HIS C 1 15  ? 1.278   41.899 22.384 1.00 0.00   ? 74  HIS C HD1   1 
ATOM   5465  H  HE2   . HIS C 1 15  ? 3.701   42.856 19.366 1.00 0.00   ? 74  HIS C HE2   1 
ATOM   5466  N  N     . ALA C 1 16  ? -0.761  37.366 22.285 1.00 17.18  ? 75  ALA C N     1 
ATOM   5467  C  CA    . ALA C 1 16  ? -1.683  36.215 22.307 1.00 17.18  ? 75  ALA C CA    1 
ATOM   5468  C  C     . ALA C 1 16  ? -2.877  36.431 23.239 1.00 17.18  ? 75  ALA C C     1 
ATOM   5469  O  O     . ALA C 1 16  ? -4.020  36.399 22.768 1.00 28.20  ? 75  ALA C O     1 
ATOM   5470  C  CB    . ALA C 1 16  ? -0.957  34.964 22.649 1.00 28.20  ? 75  ALA C CB    1 
ATOM   5471  H  H     . ALA C 1 16  ? 0.175   37.229 22.531 1.00 0.00   ? 75  ALA C H     1 
ATOM   5472  N  N     . PRO C 1 17  ? -2.634  36.756 24.548 1.00 19.64  ? 76  PRO C N     1 
ATOM   5473  C  CA    . PRO C 1 17  ? -3.738  36.986 25.497 1.00 19.64  ? 76  PRO C CA    1 
ATOM   5474  C  C     . PRO C 1 17  ? -4.730  38.021 24.933 1.00 19.64  ? 76  PRO C C     1 
ATOM   5475  O  O     . PRO C 1 17  ? -5.930  37.741 24.800 1.00 14.85  ? 76  PRO C O     1 
ATOM   5476  C  CB    . PRO C 1 17  ? -3.020  37.529 26.724 1.00 14.85  ? 76  PRO C CB    1 
ATOM   5477  C  CG    . PRO C 1 17  ? -1.708  36.920 26.653 1.00 14.85  ? 76  PRO C CG    1 
ATOM   5478  C  CD    . PRO C 1 17  ? -1.348  37.047 25.211 1.00 14.85  ? 76  PRO C CD    1 
ATOM   5479  N  N     . SER C 1 18  ? -4.219  39.188 24.546 1.00 15.02  ? 77  SER C N     1 
ATOM   5480  C  CA    . SER C 1 18  ? -5.048  40.245 23.960 1.00 15.02  ? 77  SER C CA    1 
ATOM   5481  C  C     . SER C 1 18  ? -5.864  39.729 22.764 1.00 15.02  ? 77  SER C C     1 
ATOM   5482  O  O     . SER C 1 18  ? -7.022  40.098 22.559 1.00 27.01  ? 77  SER C O     1 
ATOM   5483  C  CB    . SER C 1 18  ? -4.179  41.468 23.583 1.00 27.01  ? 77  SER C CB    1 
ATOM   5484  O  OG    . SER C 1 18  ? -2.845  41.128 23.190 1.00 27.01  ? 77  SER C OG    1 
ATOM   5485  H  H     . SER C 1 18  ? -3.263  39.375 24.634 1.00 0.00   ? 77  SER C H     1 
ATOM   5486  H  HG    . SER C 1 18  ? -2.287  41.259 23.973 1.00 30.00  ? 77  SER C HG    1 
ATOM   5487  N  N     . GLN C 1 19  ? -5.291  38.817 22.004 1.00 17.16  ? 78  GLN C N     1 
ATOM   5488  C  CA    . GLN C 1 19  ? -6.026  38.288 20.880 1.00 17.16  ? 78  GLN C CA    1 
ATOM   5489  C  C     . GLN C 1 19  ? -7.028  37.264 21.311 1.00 17.16  ? 78  GLN C C     1 
ATOM   5490  O  O     . GLN C 1 19  ? -8.064  37.083 20.652 1.00 19.28  ? 78  GLN C O     1 
ATOM   5491  C  CB    . GLN C 1 19  ? -5.096  37.703 19.865 1.00 19.28  ? 78  GLN C CB    1 
ATOM   5492  C  CG    . GLN C 1 19  ? -4.409  38.746 19.073 1.00 19.28  ? 78  GLN C CG    1 
ATOM   5493  C  CD    . GLN C 1 19  ? -3.722  38.143 17.930 1.00 19.28  ? 78  GLN C CD    1 
ATOM   5494  O  OE1   . GLN C 1 19  ? -4.363  37.528 17.084 1.00 19.28  ? 78  GLN C OE1   1 
ATOM   5495  N  NE2   . GLN C 1 19  ? -2.403  38.262 17.895 1.00 19.28  ? 78  GLN C NE2   1 
ATOM   5496  H  H     . GLN C 1 19  ? -4.375  38.518 22.177 1.00 0.00   ? 78  GLN C H     1 
ATOM   5497  N  N     . ILE C 1 20  ? -6.718  36.586 22.415 1.00 13.67  ? 79  ILE C N     1 
ATOM   5498  C  CA    . ILE C 1 20  ? -7.615  35.587 22.963 1.00 13.67  ? 79  ILE C CA    1 
ATOM   5499  C  C     . ILE C 1 20  ? -8.786  36.324 23.568 1.00 13.67  ? 79  ILE C C     1 
ATOM   5500  O  O     . ILE C 1 20  ? -9.915  36.161 23.104 1.00 19.21  ? 79  ILE C O     1 
ATOM   5501  C  CB    . ILE C 1 20  ? -6.926  34.717 24.006 1.00 19.21  ? 79  ILE C CB    1 
ATOM   5502  C  CG1   . ILE C 1 20  ? -5.892  33.844 23.308 1.00 19.21  ? 79  ILE C CG1   1 
ATOM   5503  C  CG2   . ILE C 1 20  ? -7.963  33.833 24.725 1.00 19.21  ? 79  ILE C CG2   1 
ATOM   5504  C  CD1   . ILE C 1 20  ? -4.973  33.135 24.241 1.00 19.21  ? 79  ILE C CD1   1 
ATOM   5505  H  H     . ILE C 1 20  ? -5.887  36.787 22.882 1.00 0.00   ? 79  ILE C H     1 
ATOM   5506  N  N     . VAL C 1 21  ? -8.524  37.170 24.561 1.00 30.47  ? 80  VAL C N     1 
ATOM   5507  C  CA    . VAL C 1 21  ? -9.592  37.965 25.191 1.00 30.47  ? 80  VAL C CA    1 
ATOM   5508  C  C     . VAL C 1 21  ? -10.500 38.586 24.107 1.00 30.47  ? 80  VAL C C     1 
ATOM   5509  O  O     . VAL C 1 21  ? -11.727 38.448 24.150 1.00 23.25  ? 80  VAL C O     1 
ATOM   5510  C  CB    . VAL C 1 21  ? -9.015  39.068 26.107 1.00 23.25  ? 80  VAL C CB    1 
ATOM   5511  C  CG1   . VAL C 1 21  ? -10.061 40.049 26.467 1.00 23.25  ? 80  VAL C CG1   1 
ATOM   5512  C  CG2   . VAL C 1 21  ? -8.487  38.459 27.369 1.00 23.25  ? 80  VAL C CG2   1 
ATOM   5513  H  H     . VAL C 1 21  ? -7.620  37.240 24.897 1.00 0.00   ? 80  VAL C H     1 
ATOM   5514  N  N     . ALA C 1 22  ? -9.896  39.178 23.087 1.00 13.78  ? 81  ALA C N     1 
ATOM   5515  C  CA    . ALA C 1 22  ? -10.662 39.777 22.012 1.00 13.78  ? 81  ALA C CA    1 
ATOM   5516  C  C     . ALA C 1 22  ? -11.601 38.798 21.299 1.00 13.78  ? 81  ALA C C     1 
ATOM   5517  O  O     . ALA C 1 22  ? -12.703 39.172 20.865 1.00 25.01  ? 81  ALA C O     1 
ATOM   5518  C  CB    . ALA C 1 22  ? -9.719  40.394 21.019 1.00 25.01  ? 81  ALA C CB    1 
ATOM   5519  H  H     . ALA C 1 22  ? -8.916  39.211 23.053 1.00 0.00   ? 81  ALA C H     1 
ATOM   5520  N  N     . ALA C 1 23  ? -11.156 37.560 21.138 1.00 23.27  ? 82  ALA C N     1 
ATOM   5521  C  CA    . ALA C 1 23  ? -11.956 36.551 20.455 1.00 23.27  ? 82  ALA C CA    1 
ATOM   5522  C  C     . ALA C 1 23  ? -13.121 36.194 21.322 1.00 23.27  ? 82  ALA C C     1 
ATOM   5523  O  O     . ALA C 1 23  ? -14.234 36.010 20.854 1.00 36.58  ? 82  ALA C O     1 
ATOM   5524  C  CB    . ALA C 1 23  ? -11.132 35.325 20.212 1.00 36.58  ? 82  ALA C CB    1 
ATOM   5525  H  H     . ALA C 1 23  ? -10.265 37.312 21.475 1.00 0.00   ? 82  ALA C H     1 
ATOM   5526  N  N     . ILE C 1 24  ? -12.829 36.091 22.610 1.00 24.90  ? 83  ILE C N     1 
ATOM   5527  C  CA    . ILE C 1 24  ? -13.810 35.747 23.631 1.00 24.90  ? 83  ILE C CA    1 
ATOM   5528  C  C     . ILE C 1 24  ? -14.927 36.767 23.585 1.00 24.90  ? 83  ILE C C     1 
ATOM   5529  O  O     . ILE C 1 24  ? -16.104 36.413 23.632 1.00 24.92  ? 83  ILE C O     1 
ATOM   5530  C  CB    . ILE C 1 24  ? -13.138 35.741 25.022 1.00 24.92  ? 83  ILE C CB    1 
ATOM   5531  C  CG1   . ILE C 1 24  ? -12.087 34.629 25.065 1.00 24.92  ? 83  ILE C CG1   1 
ATOM   5532  C  CG2   . ILE C 1 24  ? -14.163 35.599 26.109 1.00 24.92  ? 83  ILE C CG2   1 
ATOM   5533  C  CD1   . ILE C 1 24  ? -11.475 34.385 26.415 1.00 24.92  ? 83  ILE C CD1   1 
ATOM   5534  H  H     . ILE C 1 24  ? -11.899 36.274 22.885 1.00 0.00   ? 83  ILE C H     1 
ATOM   5535  N  N     . LYS C 1 25  ? -14.543 38.029 23.432 1.00 17.51  ? 84  LYS C N     1 
ATOM   5536  C  CA    . LYS C 1 25  ? -15.496 39.116 23.372 1.00 17.51  ? 84  LYS C CA    1 
ATOM   5537  C  C     . LYS C 1 25  ? -16.254 39.023 22.057 1.00 17.51  ? 84  LYS C C     1 
ATOM   5538  O  O     . LYS C 1 25  ? -17.468 39.249 22.011 1.00 46.76  ? 84  LYS C O     1 
ATOM   5539  C  CB    . LYS C 1 25  ? -14.765 40.455 23.501 1.00 46.76  ? 84  LYS C CB    1 
ATOM   5540  C  CG    . LYS C 1 25  ? -15.640 41.643 23.875 1.00 46.76  ? 84  LYS C CG    1 
ATOM   5541  C  CD    . LYS C 1 25  ? -16.261 42.272 22.653 1.00 46.76  ? 84  LYS C CD    1 
ATOM   5542  C  CE    . LYS C 1 25  ? -17.045 43.524 22.997 1.00 46.76  ? 84  LYS C CE    1 
ATOM   5543  N  NZ    . LYS C 1 25  ? -18.216 43.254 23.871 1.00 46.76  ? 84  LYS C NZ    1 
ATOM   5544  H  H     . LYS C 1 25  ? -13.586 38.234 23.374 1.00 0.00   ? 84  LYS C H     1 
ATOM   5545  H  HZ1   . LYS C 1 25  ? -18.863 42.597 23.394 1.00 0.00   ? 84  LYS C HZ1   1 
ATOM   5546  H  HZ2   . LYS C 1 25  ? -17.900 42.840 24.772 1.00 0.00   ? 84  LYS C HZ2   1 
ATOM   5547  H  HZ3   . LYS C 1 25  ? -18.711 44.148 24.061 1.00 0.00   ? 84  LYS C HZ3   1 
ATOM   5548  N  N     . SER C 1 26  ? -15.542 38.652 20.995 1.00 54.33  ? 85  SER C N     1 
ATOM   5549  C  CA    . SER C 1 26  ? -16.139 38.523 19.662 1.00 54.33  ? 85  SER C CA    1 
ATOM   5550  C  C     . SER C 1 26  ? -17.298 37.529 19.638 1.00 54.33  ? 85  SER C C     1 
ATOM   5551  O  O     . SER C 1 26  ? -18.393 37.859 19.171 1.00 46.23  ? 85  SER C O     1 
ATOM   5552  C  CB    . SER C 1 26  ? -15.068 38.105 18.644 1.00 46.23  ? 85  SER C CB    1 
ATOM   5553  O  OG    . SER C 1 26  ? -15.643 37.652 17.430 1.00 46.23  ? 85  SER C OG    1 
ATOM   5554  H  H     . SER C 1 26  ? -14.592 38.445 21.099 1.00 0.00   ? 85  SER C H     1 
ATOM   5555  H  HG    . SER C 1 26  ? -16.251 38.308 17.073 1.00 30.00  ? 85  SER C HG    1 
ATOM   5556  N  N     . ARG C 1 27  ? -17.045 36.319 20.140 1.00 43.89  ? 86  ARG C N     1 
ATOM   5557  C  CA    . ARG C 1 27  ? -18.045 35.254 20.181 1.00 43.89  ? 86  ARG C CA    1 
ATOM   5558  C  C     . ARG C 1 27  ? -19.155 35.569 21.171 1.00 43.89  ? 86  ARG C C     1 
ATOM   5559  O  O     . ARG C 1 27  ? -20.333 35.450 20.834 1.00 51.90  ? 86  ARG C O     1 
ATOM   5560  C  CB    . ARG C 1 27  ? -17.376 33.924 20.525 1.00 51.90  ? 86  ARG C CB    1 
ATOM   5561  C  CG    . ARG C 1 27  ? -18.326 32.779 20.703 1.00 51.90  ? 86  ARG C CG    1 
ATOM   5562  C  CD    . ARG C 1 27  ? -19.087 32.479 19.450 1.00 51.90  ? 86  ARG C CD    1 
ATOM   5563  N  NE    . ARG C 1 27  ? -20.147 31.517 19.731 1.00 51.90  ? 86  ARG C NE    1 
ATOM   5564  C  CZ    . ARG C 1 27  ? -20.877 30.904 18.807 1.00 51.90  ? 86  ARG C CZ    1 
ATOM   5565  N  NH1   . ARG C 1 27  ? -20.679 31.131 17.518 1.00 51.90  ? 86  ARG C NH1   1 
ATOM   5566  N  NH2   . ARG C 1 27  ? -21.829 30.073 19.177 1.00 51.90  ? 86  ARG C NH2   1 
ATOM   5567  H  H     . ARG C 1 27  ? -16.138 36.132 20.463 1.00 0.00   ? 86  ARG C H     1 
ATOM   5568  H  HE    . ARG C 1 27  ? -20.344 31.297 20.666 1.00 0.00   ? 86  ARG C HE    1 
ATOM   5569  H  HH11  . ARG C 1 27  ? -19.975 31.774 17.218 1.00 0.00   ? 86  ARG C HH11  1 
ATOM   5570  H  HH12  . ARG C 1 27  ? -21.242 30.659 16.838 1.00 0.00   ? 86  ARG C HH12  1 
ATOM   5571  H  HH21  . ARG C 1 27  ? -22.009 29.910 20.146 1.00 0.00   ? 86  ARG C HH21  1 
ATOM   5572  H  HH22  . ARG C 1 27  ? -22.383 29.613 18.483 1.00 0.00   ? 86  ARG C HH22  1 
ATOM   5573  N  N     . ALA C 1 28  ? -18.774 35.988 22.381 1.00 30.82  ? 87  ALA C N     1 
ATOM   5574  C  CA    . ALA C 1 28  ? -19.727 36.344 23.438 1.00 30.82  ? 87  ALA C CA    1 
ATOM   5575  C  C     . ALA C 1 28  ? -20.840 37.218 22.878 1.00 30.82  ? 87  ALA C C     1 
ATOM   5576  O  O     . ALA C 1 28  ? -22.028 36.977 23.095 1.00 33.33  ? 87  ALA C O     1 
ATOM   5577  C  CB    . ALA C 1 28  ? -19.011 37.087 24.554 1.00 33.33  ? 87  ALA C CB    1 
ATOM   5578  H  H     . ALA C 1 28  ? -17.813 36.063 22.583 1.00 0.00   ? 87  ALA C H     1 
ATOM   5579  N  N     . ASP C 1 29  ? -20.436 38.222 22.127 1.00 32.51  ? 88  ASP C N     1 
ATOM   5580  C  CA    . ASP C 1 29  ? -21.376 39.146 21.530 1.00 32.51  ? 88  ASP C CA    1 
ATOM   5581  C  C     . ASP C 1 29  ? -22.349 38.420 20.639 1.00 32.51  ? 88  ASP C C     1 
ATOM   5582  O  O     . ASP C 1 29  ? -23.481 38.870 20.460 1.00 51.38  ? 88  ASP C O     1 
ATOM   5583  C  CB    . ASP C 1 29  ? -20.634 40.220 20.744 1.00 51.38  ? 88  ASP C CB    1 
ATOM   5584  C  CG    . ASP C 1 29  ? -19.835 41.142 21.636 1.00 51.38  ? 88  ASP C CG    1 
ATOM   5585  O  OD1   . ASP C 1 29  ? -19.702 40.867 22.859 1.00 51.38  ? 88  ASP C OD1   1 
ATOM   5586  O  OD2   . ASP C 1 29  ? -19.343 42.155 21.109 1.00 51.38  ? 88  ASP C OD2   1 
ATOM   5587  H  H     . ASP C 1 29  ? -19.477 38.367 21.977 1.00 0.00   ? 88  ASP C H     1 
ATOM   5588  N  N     . GLN C 1 30  ? -21.905 37.320 20.045 1.00 34.59  ? 89  GLN C N     1 
ATOM   5589  C  CA    . GLN C 1 30  ? -22.798 36.548 19.187 1.00 34.59  ? 89  GLN C CA    1 
ATOM   5590  C  C     . GLN C 1 30  ? -23.906 35.885 20.035 1.00 34.59  ? 89  GLN C C     1 
ATOM   5591  O  O     . GLN C 1 30  ? -25.091 36.063 19.770 1.00 42.49  ? 89  GLN C O     1 
ATOM   5592  C  CB    . GLN C 1 30  ? -22.022 35.504 18.396 1.00 42.49  ? 89  GLN C CB    1 
ATOM   5593  C  CG    . GLN C 1 30  ? -21.002 36.107 17.500 1.00 42.49  ? 89  GLN C CG    1 
ATOM   5594  C  CD    . GLN C 1 30  ? -20.670 35.211 16.340 1.00 42.49  ? 89  GLN C CD    1 
ATOM   5595  O  OE1   . GLN C 1 30  ? -19.855 34.292 16.449 1.00 42.49  ? 89  GLN C OE1   1 
ATOM   5596  N  NE2   . GLN C 1 30  ? -21.305 35.468 15.214 1.00 42.49  ? 89  GLN C NE2   1 
ATOM   5597  H  H     . GLN C 1 30  ? -20.973 37.059 20.166 1.00 0.00   ? 89  GLN C H     1 
ATOM   5598  N  N     . LEU C 1 31  ? -23.521 35.194 21.098 1.00 42.61  ? 90  LEU C N     1 
ATOM   5599  C  CA    . LEU C 1 31  ? -24.494 34.542 21.962 1.00 42.61  ? 90  LEU C CA    1 
ATOM   5600  C  C     . LEU C 1 31  ? -25.191 35.579 22.853 1.00 42.61  ? 90  LEU C C     1 
ATOM   5601  O  O     . LEU C 1 31  ? -25.827 35.237 23.874 1.00 31.41  ? 90  LEU C O     1 
ATOM   5602  C  CB    . LEU C 1 31  ? -23.787 33.500 22.825 1.00 31.41  ? 90  LEU C CB    1 
ATOM   5603  C  CG    . LEU C 1 31  ? -22.783 32.595 22.097 1.00 31.41  ? 90  LEU C CG    1 
ATOM   5604  C  CD1   . LEU C 1 31  ? -22.606 31.322 22.912 1.00 31.41  ? 90  LEU C CD1   1 
ATOM   5605  C  CD2   . LEU C 1 31  ? -23.272 32.255 20.681 1.00 31.41  ? 90  LEU C CD2   1 
ATOM   5606  H  H     . LEU C 1 31  ? -22.562 35.163 21.302 1.00 0.00   ? 90  LEU C H     1 
ATOM   5607  N  N     . GLY C 1 32  ? -25.030 36.852 22.492 1.00 48.36  ? 91  GLY C N     1 
ATOM   5608  C  CA    . GLY C 1 32  ? -25.629 37.929 23.255 1.00 48.36  ? 91  GLY C CA    1 
ATOM   5609  C  C     . GLY C 1 32  ? -25.091 37.960 24.668 1.00 48.36  ? 91  GLY C C     1 
ATOM   5610  O  O     . GLY C 1 32  ? -25.625 38.668 25.530 1.00 47.71  ? 91  GLY C O     1 
ATOM   5611  H  H     . GLY C 1 32  ? -24.518 37.133 21.716 1.00 0.00   ? 91  GLY C H     1 
ATOM   5612  N  N     . ALA C 1 33  ? -24.013 37.218 24.904 1.00 18.40  ? 92  ALA C N     1 
ATOM   5613  C  CA    . ALA C 1 33  ? -23.418 37.146 26.226 1.00 18.40  ? 92  ALA C CA    1 
ATOM   5614  C  C     . ALA C 1 33  ? -22.607 38.373 26.524 1.00 18.40  ? 92  ALA C C     1 
ATOM   5615  O  O     . ALA C 1 33  ? -22.719 39.377 25.836 1.00 26.83  ? 92  ALA C O     1 
ATOM   5616  C  CB    . ALA C 1 33  ? -22.587 35.913 26.373 1.00 26.83  ? 92  ALA C CB    1 
ATOM   5617  H  H     . ALA C 1 33  ? -23.583 36.750 24.165 1.00 0.00   ? 92  ALA C H     1 
ATOM   5618  N  N     . SER C 1 34  ? -21.816 38.311 27.579 1.00 22.79  ? 93  SER C N     1 
ATOM   5619  C  CA    . SER C 1 34  ? -21.022 39.457 27.980 1.00 22.79  ? 93  SER C CA    1 
ATOM   5620  C  C     . SER C 1 34  ? -19.749 38.991 28.633 1.00 22.79  ? 93  SER C C     1 
ATOM   5621  O  O     . SER C 1 34  ? -19.677 37.873 29.120 1.00 40.22  ? 93  SER C O     1 
ATOM   5622  C  CB    . SER C 1 34  ? -21.821 40.322 28.951 1.00 40.22  ? 93  SER C CB    1 
ATOM   5623  O  OG    . SER C 1 34  ? -23.112 40.568 28.419 1.00 40.22  ? 93  SER C OG    1 
ATOM   5624  H  H     . SER C 1 34  ? -21.712 37.495 28.123 1.00 0.00   ? 93  SER C H     1 
ATOM   5625  H  HG    . SER C 1 34  ? -22.948 40.956 27.542 1.00 30.00  ? 93  SER C HG    1 
ATOM   5626  N  N     . VAL C 1 35  ? -18.744 39.856 28.600 1.00 55.60  ? 94  VAL C N     1 
ATOM   5627  C  CA    . VAL C 1 35  ? -17.438 39.563 29.163 1.00 55.60  ? 94  VAL C CA    1 
ATOM   5628  C  C     . VAL C 1 35  ? -16.988 40.737 30.019 1.00 55.60  ? 94  VAL C C     1 
ATOM   5629  O  O     . VAL C 1 35  ? -17.260 41.890 29.705 1.00 15.53  ? 94  VAL C O     1 
ATOM   5630  C  CB    . VAL C 1 35  ? -16.378 39.332 28.038 1.00 15.53  ? 94  VAL C CB    1 
ATOM   5631  C  CG1   . VAL C 1 35  ? -15.063 38.879 28.612 1.00 15.53  ? 94  VAL C CG1   1 
ATOM   5632  C  CG2   . VAL C 1 35  ? -16.872 38.301 27.059 1.00 15.53  ? 94  VAL C CG2   1 
ATOM   5633  H  H     . VAL C 1 35  ? -18.861 40.744 28.203 1.00 0.00   ? 94  VAL C H     1 
ATOM   5634  N  N     . VAL C 1 36  ? -16.385 40.418 31.150 1.00 18.30  ? 95  VAL C N     1 
ATOM   5635  C  CA    . VAL C 1 36  ? -15.842 41.399 32.047 1.00 18.30  ? 95  VAL C CA    1 
ATOM   5636  C  C     . VAL C 1 36  ? -14.443 40.810 32.236 1.00 18.30  ? 95  VAL C C     1 
ATOM   5637  O  O     . VAL C 1 36  ? -14.306 39.600 32.490 1.00 37.96  ? 95  VAL C O     1 
ATOM   5638  C  CB    . VAL C 1 36  ? -16.668 41.476 33.363 1.00 37.96  ? 95  VAL C CB    1 
ATOM   5639  C  CG1   . VAL C 1 36  ? -16.460 40.244 34.252 1.00 37.96  ? 95  VAL C CG1   1 
ATOM   5640  C  CG2   . VAL C 1 36  ? -16.359 42.775 34.089 1.00 37.96  ? 95  VAL C CG2   1 
ATOM   5641  H  H     . VAL C 1 36  ? -16.298 39.472 31.406 1.00 0.00   ? 95  VAL C H     1 
ATOM   5642  N  N     . VAL C 1 37  ? -13.407 41.622 31.989 1.00 28.99  ? 96  VAL C N     1 
ATOM   5643  C  CA    . VAL C 1 37  ? -12.023 41.160 32.089 1.00 28.99  ? 96  VAL C CA    1 
ATOM   5644  C  C     . VAL C 1 37  ? -11.286 41.621 33.339 1.00 28.99  ? 96  VAL C C     1 
ATOM   5645  O  O     . VAL C 1 37  ? -11.366 42.793 33.692 1.00 18.88  ? 96  VAL C O     1 
ATOM   5646  C  CB    . VAL C 1 37  ? -11.200 41.632 30.851 1.00 18.88  ? 96  VAL C CB    1 
ATOM   5647  C  CG1   . VAL C 1 37  ? -9.775  41.119 30.924 1.00 18.88  ? 96  VAL C CG1   1 
ATOM   5648  C  CG2   . VAL C 1 37  ? -11.851 41.181 29.558 1.00 18.88  ? 96  VAL C CG2   1 
ATOM   5649  H  H     . VAL C 1 37  ? -13.574 42.558 31.759 1.00 0.00   ? 96  VAL C H     1 
ATOM   5650  N  N     . SER C 1 38  ? -10.571 40.700 33.995 1.00 22.15  ? 97  SER C N     1 
ATOM   5651  C  CA    . SER C 1 38  ? -9.733  41.004 35.176 1.00 22.15  ? 97  SER C CA    1 
ATOM   5652  C  C     . SER C 1 38  ? -8.319  40.502 34.894 1.00 22.15  ? 97  SER C C     1 
ATOM   5653  O  O     . SER C 1 38  ? -8.129  39.364 34.483 1.00 31.13  ? 97  SER C O     1 
ATOM   5654  C  CB    . SER C 1 38  ? -10.265 40.357 36.456 1.00 31.13  ? 97  SER C CB    1 
ATOM   5655  O  OG    . SER C 1 38  ? -9.348  40.536 37.539 1.00 31.13  ? 97  SER C OG    1 
ATOM   5656  H  H     . SER C 1 38  ? -10.604 39.763 33.701 1.00 0.00   ? 97  SER C H     1 
ATOM   5657  H  HG    . SER C 1 38  ? -8.623  39.916 37.438 1.00 30.00  ? 97  SER C HG    1 
ATOM   5658  N  N     . MET C 1 39  ? -7.330  41.350 35.135 1.00 24.09  ? 98  MET C N     1 
ATOM   5659  C  CA    . MET C 1 39  ? -5.932  41.019 34.844 1.00 24.09  ? 98  MET C CA    1 
ATOM   5660  C  C     . MET C 1 39  ? -5.108  40.546 36.027 1.00 24.09  ? 98  MET C C     1 
ATOM   5661  O  O     . MET C 1 39  ? -4.778  41.322 36.914 1.00 49.26  ? 98  MET C O     1 
ATOM   5662  C  CB    . MET C 1 39  ? -5.249  42.212 34.183 1.00 49.26  ? 98  MET C CB    1 
ATOM   5663  C  CG    . MET C 1 39  ? -6.018  42.765 33.005 1.00 49.26  ? 98  MET C CG    1 
ATOM   5664  S  SD    . MET C 1 39  ? -5.509  44.424 32.590 1.00 49.26  ? 98  MET C SD    1 
ATOM   5665  C  CE    . MET C 1 39  ? -3.818  44.059 31.827 1.00 49.26  ? 98  MET C CE    1 
ATOM   5666  H  H     . MET C 1 39  ? -7.531  42.227 35.521 1.00 0.00   ? 98  MET C H     1 
ATOM   5667  N  N     . VAL C 1 40  ? -4.758  39.266 36.013 1.00 28.59  ? 99  VAL C N     1 
ATOM   5668  C  CA    . VAL C 1 40  ? -3.975  38.660 37.077 1.00 28.59  ? 99  VAL C CA    1 
ATOM   5669  C  C     . VAL C 1 40  ? -2.643  39.379 37.204 1.00 28.59  ? 99  VAL C C     1 
ATOM   5670  O  O     . VAL C 1 40  ? -1.943  39.603 36.219 1.00 33.00  ? 99  VAL C O     1 
ATOM   5671  C  CB    . VAL C 1 40  ? -3.731  37.169 36.801 1.00 33.00  ? 99  VAL C CB    1 
ATOM   5672  C  CG1   . VAL C 1 40  ? -2.892  36.570 37.875 1.00 33.00  ? 99  VAL C CG1   1 
ATOM   5673  C  CG2   . VAL C 1 40  ? -5.048  36.431 36.674 1.00 33.00  ? 99  VAL C CG2   1 
ATOM   5674  H  H     . VAL C 1 40  ? -5.004  38.744 35.221 1.00 0.00   ? 99  VAL C H     1 
ATOM   5675  N  N     . GLU C 1 41  ? -2.272  39.651 38.448 1.00 44.36  ? 100 GLU C N     1 
ATOM   5676  C  CA    . GLU C 1 41  ? -1.040  40.353 38.825 1.00 44.36  ? 100 GLU C CA    1 
ATOM   5677  C  C     . GLU C 1 41  ? 0.259   39.644 38.402 1.00 44.36  ? 100 GLU C C     1 
ATOM   5678  O  O     . GLU C 1 41  ? 1.343   40.075 38.778 1.00 75.07  ? 100 GLU C O     1 
ATOM   5679  C  CB    . GLU C 1 41  ? -1.035  40.575 40.349 1.00 75.07  ? 100 GLU C CB    1 
ATOM   5680  C  CG    . GLU C 1 41  ? -2.318  41.222 40.926 1.00 75.07  ? 100 GLU C CG    1 
ATOM   5681  C  CD    . GLU C 1 41  ? -3.585  40.347 40.798 1.00 75.07  ? 100 GLU C CD    1 
ATOM   5682  O  OE1   . GLU C 1 41  ? -3.583  39.183 41.255 1.00 75.07  ? 100 GLU C OE1   1 
ATOM   5683  O  OE2   . GLU C 1 41  ? -4.590  40.821 40.227 1.00 75.07  ? 100 GLU C OE2   1 
ATOM   5684  H  H     . GLU C 1 41  ? -2.866  39.280 39.113 1.00 0.00   ? 100 GLU C H     1 
ATOM   5685  N  N     . ARG C 1 42  ? 0.131   38.532 37.674 1.00 47.99  ? 101 ARG C N     1 
ATOM   5686  C  CA    . ARG C 1 42  ? 1.262   37.750 37.174 1.00 47.99  ? 101 ARG C CA    1 
ATOM   5687  C  C     . ARG C 1 42  ? 2.172   37.176 38.251 1.00 47.99  ? 101 ARG C C     1 
ATOM   5688  O  O     . ARG C 1 42  ? 3.394   37.333 38.191 1.00 110.89 ? 101 ARG C O     1 
ATOM   5689  C  CB    . ARG C 1 42  ? 2.088   38.573 36.176 1.00 110.89 ? 101 ARG C CB    1 
ATOM   5690  C  CG    . ARG C 1 42  ? 1.489   38.678 34.774 1.00 110.89 ? 101 ARG C CG    1 
ATOM   5691  C  CD    . ARG C 1 42  ? 1.578   37.348 34.018 1.00 110.89 ? 101 ARG C CD    1 
ATOM   5692  N  NE    . ARG C 1 42  ? 1.235   37.491 32.604 1.00 110.89 ? 101 ARG C NE    1 
ATOM   5693  C  CZ    . ARG C 1 42  ? 1.579   36.626 31.652 1.00 110.89 ? 101 ARG C CZ    1 
ATOM   5694  N  NH1   . ARG C 1 42  ? 2.279   35.537 31.945 1.00 110.89 ? 101 ARG C NH1   1 
ATOM   5695  N  NH2   . ARG C 1 42  ? 1.215   36.851 30.397 1.00 110.89 ? 101 ARG C NH2   1 
ATOM   5696  H  H     . ARG C 1 42  ? -0.755  38.217 37.448 1.00 0.00   ? 101 ARG C H     1 
ATOM   5697  H  HE    . ARG C 1 42  ? 0.719   38.275 32.331 1.00 0.00   ? 101 ARG C HE    1 
ATOM   5698  H  HH11  . ARG C 1 42  ? 2.561   35.347 32.885 1.00 0.00   ? 101 ARG C HH11  1 
ATOM   5699  H  HH12  . ARG C 1 42  ? 2.525   34.899 31.216 1.00 0.00   ? 101 ARG C HH12  1 
ATOM   5700  H  HH21  . ARG C 1 42  ? 0.692   37.671 30.166 1.00 0.00   ? 101 ARG C HH21  1 
ATOM   5701  H  HH22  . ARG C 1 42  ? 1.474   36.203 29.680 1.00 0.00   ? 101 ARG C HH22  1 
ATOM   5702  N  N     . SER C 1 43  ? 1.598   36.415 39.176 1.00 68.42  ? 102 SER C N     1 
ATOM   5703  C  CA    . SER C 1 43  ? 2.410   35.864 40.256 1.00 68.42  ? 102 SER C CA    1 
ATOM   5704  C  C     . SER C 1 43  ? 2.014   34.474 40.768 1.00 68.42  ? 102 SER C C     1 
ATOM   5705  O  O     . SER C 1 43  ? 2.280   34.143 41.930 1.00 106.55 ? 102 SER C O     1 
ATOM   5706  C  CB    . SER C 1 43  ? 2.424   36.849 41.430 1.00 106.55 ? 102 SER C CB    1 
ATOM   5707  O  OG    . SER C 1 43  ? 2.515   38.191 40.978 1.00 106.55 ? 102 SER C OG    1 
ATOM   5708  H  H     . SER C 1 43  ? 0.646   36.225 39.138 1.00 0.00   ? 102 SER C H     1 
ATOM   5709  H  HG    . SER C 1 43  ? 3.264   38.288 40.375 1.00 30.00  ? 102 SER C HG    1 
ATOM   5710  N  N     . GLY C 1 44  ? 1.385   33.658 39.921 1.00 47.40  ? 103 GLY C N     1 
ATOM   5711  C  CA    . GLY C 1 44  ? 0.998   32.323 40.359 1.00 47.40  ? 103 GLY C CA    1 
ATOM   5712  C  C     . GLY C 1 44  ? -0.395  32.228 40.961 1.00 47.40  ? 103 GLY C C     1 
ATOM   5713  O  O     . GLY C 1 44  ? -1.204  33.161 40.836 1.00 33.75  ? 103 GLY C O     1 
ATOM   5714  H  H     . GLY C 1 44  ? 1.184   33.943 39.004 1.00 0.00   ? 103 GLY C H     1 
ATOM   5715  N  N     . VAL C 1 45  ? -0.664  31.114 41.641 1.00 34.59  ? 104 VAL C N     1 
ATOM   5716  C  CA    . VAL C 1 45  ? -1.977  30.866 42.245 1.00 34.59  ? 104 VAL C CA    1 
ATOM   5717  C  C     . VAL C 1 45  ? -2.617  32.044 42.926 1.00 34.59  ? 104 VAL C C     1 
ATOM   5718  O  O     . VAL C 1 45  ? -3.642  32.519 42.478 1.00 41.71  ? 104 VAL C O     1 
ATOM   5719  C  CB    . VAL C 1 45  ? -1.987  29.735 43.295 1.00 41.71  ? 104 VAL C CB    1 
ATOM   5720  C  CG1   . VAL C 1 45  ? -2.824  28.593 42.801 1.00 41.71  ? 104 VAL C CG1   1 
ATOM   5721  C  CG2   . VAL C 1 45  ? -0.583  29.303 43.680 1.00 41.71  ? 104 VAL C CG2   1 
ATOM   5722  H  H     . VAL C 1 45  ? 0.065   30.467 41.708 1.00 0.00   ? 104 VAL C H     1 
ATOM   5723  N  N     . GLU C 1 46  ? -1.997  32.527 43.996 1.00 30.98  ? 105 GLU C N     1 
ATOM   5724  C  CA    . GLU C 1 46  ? -2.559  33.635 44.777 1.00 30.98  ? 105 GLU C CA    1 
ATOM   5725  C  C     . GLU C 1 46  ? -3.070  34.824 43.965 1.00 30.98  ? 105 GLU C C     1 
ATOM   5726  O  O     . GLU C 1 46  ? -4.190  35.298 44.191 1.00 39.64  ? 105 GLU C O     1 
ATOM   5727  C  CB    . GLU C 1 46  ? -1.565  34.067 45.861 1.00 39.64  ? 105 GLU C CB    1 
ATOM   5728  C  CG    . GLU C 1 46  ? -1.215  32.939 46.838 1.00 39.64  ? 105 GLU C CG    1 
ATOM   5729  C  CD    . GLU C 1 46  ? -2.454  32.310 47.476 1.00 39.64  ? 105 GLU C CD    1 
ATOM   5730  O  OE1   . GLU C 1 46  ? -3.422  33.057 47.758 1.00 39.64  ? 105 GLU C OE1   1 
ATOM   5731  O  OE2   . GLU C 1 46  ? -2.469  31.074 47.691 1.00 39.64  ? 105 GLU C OE2   1 
ATOM   5732  H  H     . GLU C 1 46  ? -1.135  32.145 44.255 1.00 0.00   ? 105 GLU C H     1 
ATOM   5733  N  N     . ALA C 1 47  ? -2.253  35.264 43.001 1.00 33.94  ? 106 ALA C N     1 
ATOM   5734  C  CA    . ALA C 1 47  ? -2.573  36.378 42.102 1.00 33.94  ? 106 ALA C CA    1 
ATOM   5735  C  C     . ALA C 1 47  ? -3.752  35.971 41.236 1.00 33.94  ? 106 ALA C C     1 
ATOM   5736  O  O     . ALA C 1 47  ? -4.727  36.714 41.072 1.00 12.75  ? 106 ALA C O     1 
ATOM   5737  C  CB    . ALA C 1 47  ? -1.381  36.688 41.226 1.00 12.75  ? 106 ALA C CB    1 
ATOM   5738  H  H     . ALA C 1 47  ? -1.405  34.790 42.881 1.00 0.00   ? 106 ALA C H     1 
ATOM   5739  N  N     . CYS C 1 48  ? -3.657  34.760 40.704 1.00 19.30  ? 107 CYS C N     1 
ATOM   5740  C  CA    . CYS C 1 48  ? -4.696  34.181 39.849 1.00 19.30  ? 107 CYS C CA    1 
ATOM   5741  C  C     . CYS C 1 48  ? -6.010  34.079 40.621 1.00 19.30  ? 107 CYS C C     1 
ATOM   5742  O  O     . CYS C 1 48  ? -7.051  34.569 40.176 1.00 46.67  ? 107 CYS C O     1 
ATOM   5743  C  CB    . CYS C 1 48  ? -4.242  32.796 39.375 1.00 46.67  ? 107 CYS C CB    1 
ATOM   5744  S  SG    . CYS C 1 48  ? -5.209  32.129 38.045 1.00 46.67  ? 107 CYS C SG    1 
ATOM   5745  H  H     . CYS C 1 48  ? -2.865  34.225 40.897 1.00 0.00   ? 107 CYS C H     1 
ATOM   5746  N  N     . LYS C 1 49  ? -5.893  33.578 41.852 1.00 58.84  ? 108 LYS C N     1 
ATOM   5747  C  CA    . LYS C 1 49  ? -6.997  33.350 42.795 1.00 58.84  ? 108 LYS C CA    1 
ATOM   5748  C  C     . LYS C 1 49  ? -7.736  34.603 43.244 1.00 58.84  ? 108 LYS C C     1 
ATOM   5749  O  O     . LYS C 1 49  ? -8.954  34.586 43.430 1.00 42.45  ? 108 LYS C O     1 
ATOM   5750  C  CB    . LYS C 1 49  ? -6.473  32.602 44.024 1.00 42.45  ? 108 LYS C CB    1 
ATOM   5751  C  CG    . LYS C 1 49  ? -6.343  31.101 43.824 1.00 42.45  ? 108 LYS C CG    1 
ATOM   5752  C  CD    . LYS C 1 49  ? -5.666  30.400 44.995 1.00 42.45  ? 108 LYS C CD    1 
ATOM   5753  C  CE    . LYS C 1 49  ? -6.379  30.628 46.315 1.00 42.45  ? 108 LYS C CE    1 
ATOM   5754  N  NZ    . LYS C 1 49  ? -5.975  31.905 46.967 1.00 42.45  ? 108 LYS C NZ    1 
ATOM   5755  H  H     . LYS C 1 49  ? -5.010  33.464 42.172 1.00 0.00   ? 108 LYS C H     1 
ATOM   5756  H  HZ1   . LYS C 1 49  ? -6.185  32.729 46.371 1.00 0.00   ? 108 LYS C HZ1   1 
ATOM   5757  H  HZ2   . LYS C 1 49  ? -6.500  31.994 47.861 1.00 0.00   ? 108 LYS C HZ2   1 
ATOM   5758  H  HZ3   . LYS C 1 49  ? -4.958  31.871 47.174 1.00 0.00   ? 108 LYS C HZ3   1 
ATOM   5759  N  N     . ALA C 1 50  ? -6.984  35.677 43.450 1.00 30.70  ? 109 ALA C N     1 
ATOM   5760  C  CA    . ALA C 1 50  ? -7.543  36.962 43.875 1.00 30.70  ? 109 ALA C CA    1 
ATOM   5761  C  C     . ALA C 1 50  ? -8.345  37.565 42.726 1.00 30.70  ? 109 ALA C C     1 
ATOM   5762  O  O     . ALA C 1 50  ? -9.401  38.170 42.943 1.00 58.23  ? 109 ALA C O     1 
ATOM   5763  C  CB    . ALA C 1 50  ? -6.418  37.911 44.311 1.00 58.23  ? 109 ALA C CB    1 
ATOM   5764  H  H     . ALA C 1 50  ? -6.011  35.605 43.341 1.00 0.00   ? 109 ALA C H     1 
ATOM   5765  N  N     . ALA C 1 51  ? -7.871  37.328 41.500 1.00 38.76  ? 110 ALA C N     1 
ATOM   5766  C  CA    . ALA C 1 51  ? -8.546  37.819 40.301 1.00 38.76  ? 110 ALA C CA    1 
ATOM   5767  C  C     . ALA C 1 51  ? -9.926  37.191 40.213 1.00 38.76  ? 110 ALA C C     1 
ATOM   5768  O  O     . ALA C 1 51  ? -10.930 37.888 40.093 1.00 33.04  ? 110 ALA C O     1 
ATOM   5769  C  CB    . ALA C 1 51  ? -7.730  37.471 39.064 1.00 33.04  ? 110 ALA C CB    1 
ATOM   5770  H  H     . ALA C 1 51  ? -7.035  36.822 41.405 1.00 0.00   ? 110 ALA C H     1 
ATOM   5771  N  N     . VAL C 1 52  ? -9.958  35.866 40.333 1.00 36.73  ? 111 VAL C N     1 
ATOM   5772  C  CA    . VAL C 1 52  ? -11.192 35.082 40.266 1.00 36.73  ? 111 VAL C CA    1 
ATOM   5773  C  C     . VAL C 1 52  ? -12.173 35.527 41.326 1.00 36.73  ? 111 VAL C C     1 
ATOM   5774  O  O     . VAL C 1 52  ? -13.362 35.665 41.068 1.00 31.22  ? 111 VAL C O     1 
ATOM   5775  C  CB    . VAL C 1 52  ? -10.922 33.593 40.479 1.00 31.22  ? 111 VAL C CB    1 
ATOM   5776  C  CG1   . VAL C 1 52  ? -12.157 32.817 40.198 1.00 31.22  ? 111 VAL C CG1   1 
ATOM   5777  C  CG2   . VAL C 1 52  ? -9.796  33.116 39.584 1.00 31.22  ? 111 VAL C CG2   1 
ATOM   5778  H  H     . VAL C 1 52  ? -9.099  35.409 40.466 1.00 0.00   ? 111 VAL C H     1 
ATOM   5779  N  N     . HIS C 1 53  ? -11.661 35.764 42.524 1.00 40.51  ? 112 HIS C N     1 
ATOM   5780  C  CA    . HIS C 1 53  ? -12.486 36.204 43.632 1.00 40.51  ? 112 HIS C CA    1 
ATOM   5781  C  C     . HIS C 1 53  ? -13.170 37.511 43.266 1.00 40.51  ? 112 HIS C C     1 
ATOM   5782  O  O     . HIS C 1 53  ? -14.335 37.728 43.611 1.00 120.92 ? 112 HIS C O     1 
ATOM   5783  C  CB    . HIS C 1 53  ? -11.632 36.397 44.881 1.00 120.92 ? 112 HIS C CB    1 
ATOM   5784  C  CG    . HIS C 1 53  ? -12.428 36.482 46.146 1.00 120.92 ? 112 HIS C CG    1 
ATOM   5785  N  ND1   . HIS C 1 53  ? -11.949 37.087 47.289 1.00 120.92 ? 112 HIS C ND1   1 
ATOM   5786  C  CD2   . HIS C 1 53  ? -13.665 36.022 46.454 1.00 120.92 ? 112 HIS C CD2   1 
ATOM   5787  C  CE1   . HIS C 1 53  ? -12.855 36.995 48.247 1.00 120.92 ? 112 HIS C CE1   1 
ATOM   5788  N  NE2   . HIS C 1 53  ? -13.905 36.353 47.766 1.00 120.92 ? 112 HIS C NE2   1 
ATOM   5789  H  H     . HIS C 1 53  ? -10.696 35.637 42.660 1.00 0.00   ? 112 HIS C H     1 
ATOM   5790  H  HD1   . HIS C 1 53  ? -11.077 37.539 47.369 1.00 0.00   ? 112 HIS C HD1   1 
ATOM   5791  H  HE2   . HIS C 1 53  ? -14.730 36.151 48.263 1.00 0.00   ? 112 HIS C HE2   1 
ATOM   5792  N  N     . ASN C 1 54  ? -12.438 38.376 42.567 1.00 45.47  ? 113 ASN C N     1 
ATOM   5793  C  CA    . ASN C 1 54  ? -12.964 39.666 42.128 1.00 45.47  ? 113 ASN C CA    1 
ATOM   5794  C  C     . ASN C 1 54  ? -14.082 39.451 41.114 1.00 45.47  ? 113 ASN C C     1 
ATOM   5795  O  O     . ASN C 1 54  ? -15.149 40.069 41.188 1.00 81.71  ? 113 ASN C O     1 
ATOM   5796  C  CB    . ASN C 1 54  ? -11.850 40.501 41.487 1.00 81.71  ? 113 ASN C CB    1 
ATOM   5797  C  CG    . ASN C 1 54  ? -10.782 40.918 42.482 1.00 81.71  ? 113 ASN C CG    1 
ATOM   5798  O  OD1   . ASN C 1 54  ? -10.619 40.298 43.539 1.00 81.71  ? 113 ASN C OD1   1 
ATOM   5799  N  ND2   . ASN C 1 54  ? -10.050 41.981 42.155 1.00 81.71  ? 113 ASN C ND2   1 
ATOM   5800  H  H     . ASN C 1 54  ? -11.497 38.175 42.362 1.00 0.00   ? 113 ASN C H     1 
ATOM   5801  H  HD21  . ASN C 1 54  ? -9.352  42.247 42.786 1.00 0.00   ? 113 ASN C HD21  1 
ATOM   5802  H  HD22  . ASN C 1 54  ? -10.243 42.419 41.302 1.00 0.00   ? 113 ASN C HD22  1 
ATOM   5803  N  N     . LEU C 1 55  ? -13.827 38.527 40.191 1.00 65.11  ? 114 LEU C N     1 
ATOM   5804  C  CA    . LEU C 1 55  ? -14.756 38.167 39.119 1.00 65.11  ? 114 LEU C CA    1 
ATOM   5805  C  C     . LEU C 1 55  ? -16.066 37.615 39.651 1.00 65.11  ? 114 LEU C C     1 
ATOM   5806  O  O     . LEU C 1 55  ? -17.123 37.899 39.102 1.00 29.49  ? 114 LEU C O     1 
ATOM   5807  C  CB    . LEU C 1 55  ? -14.096 37.139 38.196 1.00 29.49  ? 114 LEU C CB    1 
ATOM   5808  C  CG    . LEU C 1 55  ? -12.847 37.680 37.513 1.00 29.49  ? 114 LEU C CG    1 
ATOM   5809  C  CD1   . LEU C 1 55  ? -11.991 36.575 36.931 1.00 29.49  ? 114 LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C 1 55  ? -13.320 38.651 36.459 1.00 29.49  ? 114 LEU C CD2   1 
ATOM   5811  H  H     . LEU C 1 55  ? -12.951 38.086 40.232 1.00 0.00   ? 114 LEU C H     1 
ATOM   5812  N  N     . LEU C 1 56  ? -15.987 36.817 40.714 1.00 58.63  ? 115 LEU C N     1 
ATOM   5813  C  CA    . LEU C 1 56  ? -17.173 36.224 41.326 1.00 58.63  ? 115 LEU C CA    1 
ATOM   5814  C  C     . LEU C 1 56  ? -18.041 37.332 41.895 1.00 58.63  ? 115 LEU C C     1 
ATOM   5815  O  O     . LEU C 1 56  ? -19.230 37.440 41.581 1.00 51.91  ? 115 LEU C O     1 
ATOM   5816  C  CB    . LEU C 1 56  ? -16.761 35.257 42.429 1.00 51.91  ? 115 LEU C CB    1 
ATOM   5817  C  CG    . LEU C 1 56  ? -15.921 34.078 41.936 1.00 51.91  ? 115 LEU C CG    1 
ATOM   5818  C  CD1   . LEU C 1 56  ? -15.255 33.360 43.100 1.00 51.91  ? 115 LEU C CD1   1 
ATOM   5819  C  CD2   . LEU C 1 56  ? -16.800 33.135 41.122 1.00 51.91  ? 115 LEU C CD2   1 
ATOM   5820  H  H     . LEU C 1 56  ? -15.096 36.633 41.082 1.00 0.00   ? 115 LEU C H     1 
ATOM   5821  N  N     . ALA C 1 57  ? -17.410 38.226 42.643 1.00 39.45  ? 116 ALA C N     1 
ATOM   5822  C  CA    . ALA C 1 57  ? -18.123 39.337 43.247 1.00 39.45  ? 116 ALA C CA    1 
ATOM   5823  C  C     . ALA C 1 57  ? -18.820 40.171 42.181 1.00 39.45  ? 116 ALA C C     1 
ATOM   5824  O  O     . ALA C 1 57  ? -19.659 41.013 42.491 1.00 63.22  ? 116 ALA C O     1 
ATOM   5825  C  CB    . ALA C 1 57  ? -17.167 40.194 44.063 1.00 63.22  ? 116 ALA C CB    1 
ATOM   5826  H  H     . ALA C 1 57  ? -16.440 38.152 42.778 1.00 0.00   ? 116 ALA C H     1 
ATOM   5827  N  N     . GLN C 1 58  ? -18.494 39.908 40.922 1.00 58.18  ? 117 GLN C N     1 
ATOM   5828  C  CA    . GLN C 1 58  ? -19.076 40.640 39.806 1.00 58.18  ? 117 GLN C CA    1 
ATOM   5829  C  C     . GLN C 1 58  ? -20.435 40.149 39.303 1.00 58.18  ? 117 GLN C C     1 
ATOM   5830  O  O     . GLN C 1 58  ? -21.050 40.844 38.494 1.00 62.37  ? 117 GLN C O     1 
ATOM   5831  C  CB    . GLN C 1 58  ? -18.091 40.648 38.633 1.00 62.37  ? 117 GLN C CB    1 
ATOM   5832  C  CG    . GLN C 1 58  ? -17.587 42.014 38.231 1.00 62.37  ? 117 GLN C CG    1 
ATOM   5833  C  CD    . GLN C 1 58  ? -16.732 42.668 39.289 1.00 62.37  ? 117 GLN C CD    1 
ATOM   5834  O  OE1   . GLN C 1 58  ? -15.529 42.430 39.364 1.00 62.37  ? 117 GLN C OE1   1 
ATOM   5835  N  NE2   . GLN C 1 58  ? -17.348 43.507 40.110 1.00 62.37  ? 117 GLN C NE2   1 
ATOM   5836  H  H     . GLN C 1 58  ? -17.798 39.259 40.711 1.00 0.00   ? 117 GLN C H     1 
ATOM   5837  N  N     . ARG C 1 59  ? -20.899 38.987 39.787 1.00 35.87  ? 118 ARG C N     1 
ATOM   5838  C  CA    . ARG C 1 59  ? -22.175 38.360 39.357 1.00 35.87  ? 118 ARG C CA    1 
ATOM   5839  C  C     . ARG C 1 59  ? -21.901 37.473 38.123 1.00 35.87  ? 118 ARG C C     1 
ATOM   5840  O  O     . ARG C 1 59  ? -22.788 37.160 37.323 1.00 149.07 ? 118 ARG C O     1 
ATOM   5841  C  CB    . ARG C 1 59  ? -23.247 39.423 39.032 1.00 149.07 ? 118 ARG C CB    1 
ATOM   5842  C  CG    . ARG C 1 59  ? -24.619 38.895 38.610 1.00 149.07 ? 118 ARG C CG    1 
ATOM   5843  C  CD    . ARG C 1 59  ? -25.501 40.013 38.044 1.00 149.07 ? 118 ARG C CD    1 
ATOM   5844  N  NE    . ARG C 1 59  ? -25.053 40.478 36.730 1.00 149.07 ? 118 ARG C NE    1 
ATOM   5845  C  CZ    . ARG C 1 59  ? -25.072 41.750 36.332 1.00 149.07 ? 118 ARG C CZ    1 
ATOM   5846  N  NH1   . ARG C 1 59  ? -25.514 42.699 37.148 1.00 149.07 ? 118 ARG C NH1   1 
ATOM   5847  N  NH2   . ARG C 1 59  ? -24.660 42.074 35.111 1.00 149.07 ? 118 ARG C NH2   1 
ATOM   5848  H  H     . ARG C 1 59  ? -20.366 38.526 40.466 1.00 0.00   ? 118 ARG C H     1 
ATOM   5849  H  HE    . ARG C 1 59  ? -24.716 39.811 36.095 1.00 0.00   ? 118 ARG C HE    1 
ATOM   5850  H  HH11  . ARG C 1 59  ? -25.831 42.464 38.066 1.00 0.00   ? 118 ARG C HH11  1 
ATOM   5851  H  HH12  . ARG C 1 59  ? -25.527 43.650 36.842 1.00 0.00   ? 118 ARG C HH12  1 
ATOM   5852  H  HH21  . ARG C 1 59  ? -24.337 41.360 34.489 1.00 0.00   ? 118 ARG C HH21  1 
ATOM   5853  H  HH22  . ARG C 1 59  ? -24.679 43.027 34.811 1.00 0.00   ? 118 ARG C HH22  1 
ATOM   5854  N  N     . VAL C 1 60  ? -20.644 37.064 38.014 1.00 53.04  ? 119 VAL C N     1 
ATOM   5855  C  CA    . VAL C 1 60  ? -20.143 36.233 36.937 1.00 53.04  ? 119 VAL C CA    1 
ATOM   5856  C  C     . VAL C 1 60  ? -20.898 34.914 36.842 1.00 53.04  ? 119 VAL C C     1 
ATOM   5857  O  O     . VAL C 1 60  ? -21.072 34.208 37.839 1.00 44.42  ? 119 VAL C O     1 
ATOM   5858  C  CB    . VAL C 1 60  ? -18.613 36.013 37.135 1.00 44.42  ? 119 VAL C CB    1 
ATOM   5859  C  CG1   . VAL C 1 60  ? -18.212 34.561 36.952 1.00 44.42  ? 119 VAL C CG1   1 
ATOM   5860  C  CG2   . VAL C 1 60  ? -17.841 36.930 36.209 1.00 44.42  ? 119 VAL C CG2   1 
ATOM   5861  H  H     . VAL C 1 60  ? -20.015 37.316 38.715 1.00 0.00   ? 119 VAL C H     1 
ATOM   5862  N  N     . SER C 1 61  ? -21.388 34.618 35.643 1.00 26.46  ? 120 SER C N     1 
ATOM   5863  C  CA    . SER C 1 61  ? -22.116 33.388 35.391 1.00 26.46  ? 120 SER C CA    1 
ATOM   5864  C  C     . SER C 1 61  ? -21.153 32.199 35.288 1.00 26.46  ? 120 SER C C     1 
ATOM   5865  O  O     . SER C 1 61  ? -21.466 31.083 35.725 1.00 63.99  ? 120 SER C O     1 
ATOM   5866  C  CB    . SER C 1 61  ? -22.910 33.524 34.100 1.00 63.99  ? 120 SER C CB    1 
ATOM   5867  O  OG    . SER C 1 61  ? -23.758 34.654 34.158 1.00 63.99  ? 120 SER C OG    1 
ATOM   5868  H  H     . SER C 1 61  ? -21.273 35.231 34.887 1.00 0.00   ? 120 SER C H     1 
ATOM   5869  H  HG    . SER C 1 61  ? -24.207 34.649 35.012 1.00 30.00  ? 120 SER C HG    1 
ATOM   5870  N  N     . GLY C 1 62  ? -19.990 32.440 34.685 1.00 37.95  ? 121 GLY C N     1 
ATOM   5871  C  CA    . GLY C 1 62  ? -18.987 31.403 34.522 1.00 37.95  ? 121 GLY C CA    1 
ATOM   5872  C  C     . GLY C 1 62  ? -17.667 32.100 34.335 1.00 37.95  ? 121 GLY C C     1 
ATOM   5873  O  O     . GLY C 1 62  ? -17.651 33.309 34.136 1.00 32.39  ? 121 GLY C O     1 
ATOM   5874  H  H     . GLY C 1 62  ? -19.778 33.343 34.360 1.00 0.00   ? 121 GLY C H     1 
ATOM   5875  N  N     . LEU C 1 63  ? -16.576 31.350 34.318 1.00 32.52  ? 122 LEU C N     1 
ATOM   5876  C  CA    . LEU C 1 63  ? -15.249 31.926 34.175 1.00 32.52  ? 122 LEU C CA    1 
ATOM   5877  C  C     . LEU C 1 63  ? -14.365 31.244 33.150 1.00 32.52  ? 122 LEU C C     1 
ATOM   5878  O  O     . LEU C 1 63  ? -14.391 30.025 33.014 1.00 31.58  ? 122 LEU C O     1 
ATOM   5879  C  CB    . LEU C 1 63  ? -14.526 31.837 35.506 1.00 31.58  ? 122 LEU C CB    1 
ATOM   5880  C  CG    . LEU C 1 63  ? -15.142 32.617 36.655 1.00 31.58  ? 122 LEU C CG    1 
ATOM   5881  C  CD1   . LEU C 1 63  ? -14.969 31.814 37.936 1.00 31.58  ? 122 LEU C CD1   1 
ATOM   5882  C  CD2   . LEU C 1 63  ? -14.476 33.975 36.770 1.00 31.58  ? 122 LEU C CD2   1 
ATOM   5883  H  H     . LEU C 1 63  ? -16.650 30.378 34.362 1.00 0.00   ? 122 LEU C H     1 
ATOM   5884  N  N     . ILE C 1 64  ? -13.552 32.035 32.458 1.00 20.26  ? 123 ILE C N     1 
ATOM   5885  C  CA    . ILE C 1 64  ? -12.589 31.522 31.493 1.00 20.26  ? 123 ILE C CA    1 
ATOM   5886  C  C     . ILE C 1 64  ? -11.280 32.003 32.102 1.00 20.26  ? 123 ILE C C     1 
ATOM   5887  O  O     . ILE C 1 64  ? -11.092 33.208 32.293 1.00 21.46  ? 123 ILE C O     1 
ATOM   5888  C  CB    . ILE C 1 64  ? -12.785 32.134 30.085 1.00 21.46  ? 123 ILE C CB    1 
ATOM   5889  C  CG1   . ILE C 1 64  ? -14.087 31.634 29.465 1.00 21.46  ? 123 ILE C CG1   1 
ATOM   5890  C  CG2   . ILE C 1 64  ? -11.607 31.768 29.171 1.00 21.46  ? 123 ILE C CG2   1 
ATOM   5891  C  CD1   . ILE C 1 64  ? -14.296 32.165 28.086 1.00 21.46  ? 123 ILE C CD1   1 
ATOM   5892  H  H     . ILE C 1 64  ? -13.583 32.998 32.621 1.00 0.00   ? 123 ILE C H     1 
ATOM   5893  N  N     . ILE C 1 65  ? -10.376 31.077 32.399 1.00 13.86  ? 124 ILE C N     1 
ATOM   5894  C  CA    . ILE C 1 65  ? -9.128  31.421 33.051 1.00 13.86  ? 124 ILE C CA    1 
ATOM   5895  C  C     . ILE C 1 65  ? -7.869  31.257 32.197 1.00 13.86  ? 124 ILE C C     1 
ATOM   5896  O  O     . ILE C 1 65  ? -7.128  30.265 32.270 1.00 28.27  ? 124 ILE C O     1 
ATOM   5897  C  CB    . ILE C 1 65  ? -9.051  30.690 34.432 1.00 28.27  ? 124 ILE C CB    1 
ATOM   5898  C  CG1   . ILE C 1 65  ? -10.295 31.046 35.259 1.00 28.27  ? 124 ILE C CG1   1 
ATOM   5899  C  CG2   . ILE C 1 65  ? -7.817  31.114 35.233 1.00 28.27  ? 124 ILE C CG2   1 
ATOM   5900  C  CD1   . ILE C 1 65  ? -10.482 30.201 36.445 1.00 28.27  ? 124 ILE C CD1   1 
ATOM   5901  H  H     . ILE C 1 65  ? -10.550 30.151 32.167 1.00 0.00   ? 124 ILE C H     1 
ATOM   5902  N  N     . ASN C 1 66  ? -7.617  32.284 31.398 1.00 40.72  ? 125 ASN C N     1 
ATOM   5903  C  CA    . ASN C 1 66  ? -6.461  32.329 30.517 1.00 40.72  ? 125 ASN C CA    1 
ATOM   5904  C  C     . ASN C 1 66  ? -5.266  32.812 31.324 1.00 40.72  ? 125 ASN C C     1 
ATOM   5905  O  O     . ASN C 1 66  ? -4.954  33.989 31.348 1.00 36.08  ? 125 ASN C O     1 
ATOM   5906  C  CB    . ASN C 1 66  ? -6.745  33.278 29.357 1.00 36.08  ? 125 ASN C CB    1 
ATOM   5907  C  CG    . ASN C 1 66  ? -5.530  33.529 28.477 1.00 36.08  ? 125 ASN C CG    1 
ATOM   5908  O  OD1   . ASN C 1 66  ? -5.449  34.581 27.822 1.00 36.08  ? 125 ASN C OD1   1 
ATOM   5909  N  ND2   . ASN C 1 66  ? -4.590  32.585 28.444 1.00 36.08  ? 125 ASN C ND2   1 
ATOM   5910  H  H     . ASN C 1 66  ? -8.194  33.077 31.461 1.00 0.00   ? 125 ASN C H     1 
ATOM   5911  H  HD21  . ASN C 1 66  ? -3.832  32.795 27.857 1.00 0.00   ? 125 ASN C HD21  1 
ATOM   5912  H  HD22  . ASN C 1 66  ? -4.650  31.754 28.946 1.00 0.00   ? 125 ASN C HD22  1 
ATOM   5913  N  N     . TYR C 1 67  ? -4.645  31.898 32.049 1.00 31.03  ? 126 TYR C N     1 
ATOM   5914  C  CA    . TYR C 1 67  ? -3.485  32.227 32.857 1.00 31.03  ? 126 TYR C CA    1 
ATOM   5915  C  C     . TYR C 1 67  ? -2.725  30.914 33.097 1.00 31.03  ? 126 TYR C C     1 
ATOM   5916  O  O     . TYR C 1 67  ? -3.339  29.855 33.281 1.00 43.54  ? 126 TYR C O     1 
ATOM   5917  C  CB    . TYR C 1 67  ? -3.926  32.869 34.171 1.00 43.54  ? 126 TYR C CB    1 
ATOM   5918  C  CG    . TYR C 1 67  ? -2.777  33.428 34.948 1.00 43.54  ? 126 TYR C CG    1 
ATOM   5919  C  CD1   . TYR C 1 67  ? -2.178  34.617 34.565 1.00 43.54  ? 126 TYR C CD1   1 
ATOM   5920  C  CD2   . TYR C 1 67  ? -2.235  32.739 36.029 1.00 43.54  ? 126 TYR C CD2   1 
ATOM   5921  C  CE1   . TYR C 1 67  ? -1.067  35.105 35.229 1.00 43.54  ? 126 TYR C CE1   1 
ATOM   5922  C  CE2   . TYR C 1 67  ? -1.125  33.225 36.701 1.00 43.54  ? 126 TYR C CE2   1 
ATOM   5923  C  CZ    . TYR C 1 67  ? -0.549  34.408 36.293 1.00 43.54  ? 126 TYR C CZ    1 
ATOM   5924  O  OH    . TYR C 1 67  ? 0.530   34.929 36.966 1.00 43.54  ? 126 TYR C OH    1 
ATOM   5925  H  H     . TYR C 1 67  ? -4.987  30.979 32.106 1.00 0.00   ? 126 TYR C H     1 
ATOM   5926  H  HH    . TYR C 1 67  ? 1.024   35.462 36.333 1.00 0.00   ? 126 TYR C HH    1 
ATOM   5927  N  N     . PRO C 1 68  ? -1.385  30.956 33.042 1.00 19.77  ? 127 PRO C N     1 
ATOM   5928  C  CA    . PRO C 1 68  ? -0.495  29.810 33.236 1.00 19.77  ? 127 PRO C CA    1 
ATOM   5929  C  C     . PRO C 1 68  ? -0.514  29.200 34.631 1.00 19.77  ? 127 PRO C C     1 
ATOM   5930  O  O     . PRO C 1 68  ? 0.146   29.707 35.536 1.00 25.02  ? 127 PRO C O     1 
ATOM   5931  C  CB    . PRO C 1 68  ? 0.872   30.408 32.938 1.00 25.02  ? 127 PRO C CB    1 
ATOM   5932  C  CG    . PRO C 1 68  ? 0.718   31.800 33.464 1.00 25.02  ? 127 PRO C CG    1 
ATOM   5933  C  CD    . PRO C 1 68  ? -0.597  32.187 32.873 1.00 25.02  ? 127 PRO C CD    1 
ATOM   5934  N  N     . LEU C 1 69  ? -1.182  28.063 34.786 1.00 35.99  ? 128 LEU C N     1 
ATOM   5935  C  CA    . LEU C 1 69  ? -1.261  27.421 36.093 1.00 35.99  ? 128 LEU C CA    1 
ATOM   5936  C  C     . LEU C 1 69  ? -0.717  25.994 36.146 1.00 35.99  ? 128 LEU C C     1 
ATOM   5937  O  O     . LEU C 1 69  ? -1.108  25.132 35.347 1.00 28.52  ? 128 LEU C O     1 
ATOM   5938  C  CB    . LEU C 1 69  ? -2.703  27.453 36.598 1.00 28.52  ? 128 LEU C CB    1 
ATOM   5939  C  CG    . LEU C 1 69  ? -3.251  28.828 36.992 1.00 28.52  ? 128 LEU C CG    1 
ATOM   5940  C  CD1   . LEU C 1 69  ? -4.763  28.816 37.062 1.00 28.52  ? 128 LEU C CD1   1 
ATOM   5941  C  CD2   . LEU C 1 69  ? -2.632  29.265 38.310 1.00 28.52  ? 128 LEU C CD2   1 
ATOM   5942  H  H     . LEU C 1 69  ? -1.620  27.640 34.013 1.00 0.00   ? 128 LEU C H     1 
ATOM   5943  N  N     . ASP C 1 70  ? 0.240   25.769 37.047 1.00 22.64  ? 129 ASP C N     1 
ATOM   5944  C  CA    . ASP C 1 70  ? 0.819   24.446 37.234 1.00 22.64  ? 129 ASP C CA    1 
ATOM   5945  C  C     . ASP C 1 70  ? -0.353  23.608 37.734 1.00 22.64  ? 129 ASP C C     1 
ATOM   5946  O  O     . ASP C 1 70  ? -1.320  24.155 38.289 1.00 30.53  ? 129 ASP C O     1 
ATOM   5947  C  CB    . ASP C 1 70  ? 1.911   24.464 38.319 1.00 30.53  ? 129 ASP C CB    1 
ATOM   5948  C  CG    . ASP C 1 70  ? 3.275   24.998 37.831 1.00 30.53  ? 129 ASP C CG    1 
ATOM   5949  O  OD1   . ASP C 1 70  ? 3.474   25.281 36.635 1.00 30.53  ? 129 ASP C OD1   1 
ATOM   5950  O  OD2   . ASP C 1 70  ? 4.185   25.120 38.680 1.00 30.53  ? 129 ASP C OD2   1 
ATOM   5951  H  H     . ASP C 1 70  ? 0.570   26.509 37.589 1.00 0.00   ? 129 ASP C H     1 
ATOM   5952  N  N     . ASP C 1 71  ? -0.248  22.291 37.584 1.00 42.26  ? 130 ASP C N     1 
ATOM   5953  C  CA    . ASP C 1 71  ? -1.296  21.362 38.009 1.00 42.26  ? 130 ASP C CA    1 
ATOM   5954  C  C     . ASP C 1 71  ? -1.943  21.705 39.360 1.00 42.26  ? 130 ASP C C     1 
ATOM   5955  O  O     . ASP C 1 71  ? -3.113  22.086 39.429 1.00 93.20  ? 130 ASP C O     1 
ATOM   5956  C  CB    . ASP C 1 71  ? -0.720  19.947 38.067 1.00 93.20  ? 130 ASP C CB    1 
ATOM   5957  C  CG    . ASP C 1 71  ? -1.558  18.943 37.293 1.00 93.20  ? 130 ASP C CG    1 
ATOM   5958  O  OD1   . ASP C 1 71  ? -2.787  18.847 37.551 1.00 93.20  ? 130 ASP C OD1   1 
ATOM   5959  O  OD2   . ASP C 1 71  ? -0.982  18.247 36.422 1.00 93.20  ? 130 ASP C OD2   1 
ATOM   5960  H  H     . ASP C 1 71  ? 0.547   21.934 37.142 1.00 0.00   ? 130 ASP C H     1 
ATOM   5961  N  N     . GLN C 1 72  ? -1.142  21.581 40.418 1.00 50.86  ? 131 GLN C N     1 
ATOM   5962  C  CA    . GLN C 1 72  ? -1.540  21.842 41.805 1.00 50.86  ? 131 GLN C CA    1 
ATOM   5963  C  C     . GLN C 1 72  ? -2.319  23.136 41.940 1.00 50.86  ? 131 GLN C C     1 
ATOM   5964  O  O     . GLN C 1 72  ? -3.327  23.203 42.637 1.00 79.07  ? 131 GLN C O     1 
ATOM   5965  C  CB    . GLN C 1 72  ? -0.298  21.936 42.714 1.00 79.07  ? 131 GLN C CB    1 
ATOM   5966  C  CG    . GLN C 1 72  ? 1.010   21.292 42.180 1.00 79.07  ? 131 GLN C CG    1 
ATOM   5967  C  CD    . GLN C 1 72  ? 2.082   22.317 41.758 1.00 79.07  ? 131 GLN C CD    1 
ATOM   5968  O  OE1   . GLN C 1 72  ? 1.780   23.481 41.492 1.00 79.07  ? 131 GLN C OE1   1 
ATOM   5969  N  NE2   . GLN C 1 72  ? 3.332   21.872 41.681 1.00 79.07  ? 131 GLN C NE2   1 
ATOM   5970  H  H     . GLN C 1 72  ? -0.234  21.303 40.210 1.00 0.00   ? 131 GLN C H     1 
ATOM   5971  N  N     . ASP C 1 73  ? -1.813  24.166 41.279 1.00 39.43  ? 132 ASP C N     1 
ATOM   5972  C  CA    . ASP C 1 73  ? -2.400  25.495 41.297 1.00 39.43  ? 132 ASP C CA    1 
ATOM   5973  C  C     . ASP C 1 73  ? -3.624  25.568 40.418 1.00 39.43  ? 132 ASP C C     1 
ATOM   5974  O  O     . ASP C 1 73  ? -4.480  26.431 40.599 1.00 69.75  ? 132 ASP C O     1 
ATOM   5975  C  CB    . ASP C 1 73  ? -1.363  26.505 40.828 1.00 69.75  ? 132 ASP C CB    1 
ATOM   5976  C  CG    . ASP C 1 73  ? -0.047  26.372 41.579 1.00 69.75  ? 132 ASP C CG    1 
ATOM   5977  O  OD1   . ASP C 1 73  ? -0.068  26.362 42.826 1.00 69.75  ? 132 ASP C OD1   1 
ATOM   5978  O  OD2   . ASP C 1 73  ? 1.010   26.248 40.929 1.00 69.75  ? 132 ASP C OD2   1 
ATOM   5979  H  H     . ASP C 1 73  ? -1.001  24.028 40.752 1.00 0.00   ? 132 ASP C H     1 
ATOM   5980  N  N     . ALA C 1 74  ? -3.698  24.667 39.451 1.00 19.52  ? 133 ALA C N     1 
ATOM   5981  C  CA    . ALA C 1 74  ? -4.832  24.637 38.560 1.00 19.52  ? 133 ALA C CA    1 
ATOM   5982  C  C     . ALA C 1 74  ? -6.070  24.149 39.337 1.00 19.52  ? 133 ALA C C     1 
ATOM   5983  O  O     . ALA C 1 74  ? -7.136  24.799 39.323 1.00 41.78  ? 133 ALA C O     1 
ATOM   5984  C  CB    . ALA C 1 74  ? -4.535  23.730 37.375 1.00 41.78  ? 133 ALA C CB    1 
ATOM   5985  H  H     . ALA C 1 74  ? -2.980  24.019 39.329 1.00 0.00   ? 133 ALA C H     1 
ATOM   5986  N  N     . ILE C 1 75  ? -5.929  23.021 40.035 1.00 42.00  ? 134 ILE C N     1 
ATOM   5987  C  CA    . ILE C 1 75  ? -7.041  22.467 40.808 1.00 42.00  ? 134 ILE C CA    1 
ATOM   5988  C  C     . ILE C 1 75  ? -7.501  23.407 41.922 1.00 42.00  ? 134 ILE C C     1 
ATOM   5989  O  O     . ILE C 1 75  ? -8.691  23.472 42.230 1.00 68.77  ? 134 ILE C O     1 
ATOM   5990  C  CB    . ILE C 1 75  ? -6.713  21.068 41.382 1.00 68.77  ? 134 ILE C CB    1 
ATOM   5991  C  CG1   . ILE C 1 75  ? -5.291  21.030 41.940 1.00 68.77  ? 134 ILE C CG1   1 
ATOM   5992  C  CG2   . ILE C 1 75  ? -6.921  19.989 40.316 1.00 68.77  ? 134 ILE C CG2   1 
ATOM   5993  C  CD1   . ILE C 1 75  ? -4.782  19.609 42.242 1.00 68.77  ? 134 ILE C CD1   1 
ATOM   5994  H  H     . ILE C 1 75  ? -5.047  22.585 40.005 1.00 0.00   ? 134 ILE C H     1 
ATOM   5995  N  N     . ALA C 1 76  ? -6.564  24.189 42.459 1.00 43.25  ? 135 ALA C N     1 
ATOM   5996  C  CA    . ALA C 1 76  ? -6.832  25.148 43.530 1.00 43.25  ? 135 ALA C CA    1 
ATOM   5997  C  C     . ALA C 1 76  ? -7.745  26.267 43.057 1.00 43.25  ? 135 ALA C C     1 
ATOM   5998  O  O     . ALA C 1 76  ? -8.868  26.411 43.532 1.00 30.05  ? 135 ALA C O     1 
ATOM   5999  C  CB    . ALA C 1 76  ? -5.524  25.724 44.049 1.00 30.05  ? 135 ALA C CB    1 
ATOM   6000  H  H     . ALA C 1 76  ? -5.648  24.107 42.117 1.00 0.00   ? 135 ALA C H     1 
ATOM   6001  N  N     . VAL C 1 77  ? -7.251  27.064 42.120 1.00 26.31  ? 136 VAL C N     1 
ATOM   6002  C  CA    . VAL C 1 77  ? -8.014  28.164 41.565 1.00 26.31  ? 136 VAL C CA    1 
ATOM   6003  C  C     . VAL C 1 77  ? -9.383  27.599 41.187 1.00 26.31  ? 136 VAL C C     1 
ATOM   6004  O  O     . VAL C 1 77  ? -10.438 28.190 41.454 1.00 31.12  ? 136 VAL C O     1 
ATOM   6005  C  CB    . VAL C 1 77  ? -7.321  28.702 40.281 1.00 31.12  ? 136 VAL C CB    1 
ATOM   6006  C  CG1   . VAL C 1 77  ? -8.157  29.791 39.632 1.00 31.12  ? 136 VAL C CG1   1 
ATOM   6007  C  CG2   . VAL C 1 77  ? -5.921  29.210 40.593 1.00 31.12  ? 136 VAL C CG2   1 
ATOM   6008  H  H     . VAL C 1 77  ? -6.345  26.891 41.780 1.00 0.00   ? 136 VAL C H     1 
ATOM   6009  N  N     . GLU C 1 78  ? -9.365  26.400 40.632 1.00 27.77  ? 137 GLU C N     1 
ATOM   6010  C  CA    . GLU C 1 78  ? -10.599 25.778 40.205 1.00 27.77  ? 137 GLU C CA    1 
ATOM   6011  C  C     . GLU C 1 78  ? -11.513 25.583 41.393 1.00 27.77  ? 137 GLU C C     1 
ATOM   6012  O  O     . GLU C 1 78  ? -12.673 25.986 41.363 1.00 72.14  ? 137 GLU C O     1 
ATOM   6013  C  CB    . GLU C 1 78  ? -10.278 24.453 39.511 1.00 72.14  ? 137 GLU C CB    1 
ATOM   6014  C  CG    . GLU C 1 78  ? -11.451 23.784 38.843 1.00 72.14  ? 137 GLU C CG    1 
ATOM   6015  C  CD    . GLU C 1 78  ? -12.323 23.087 39.838 1.00 72.14  ? 137 GLU C CD    1 
ATOM   6016  O  OE1   . GLU C 1 78  ? -11.771 22.552 40.829 1.00 72.14  ? 137 GLU C OE1   1 
ATOM   6017  O  OE2   . GLU C 1 78  ? -13.555 23.095 39.645 1.00 72.14  ? 137 GLU C OE2   1 
ATOM   6018  H  H     . GLU C 1 78  ? -8.516  25.938 40.473 1.00 0.00   ? 137 GLU C H     1 
ATOM   6019  N  N     . ALA C 1 79  ? -10.969 24.986 42.445 1.00 79.52  ? 138 ALA C N     1 
ATOM   6020  C  CA    . ALA C 1 79  ? -11.712 24.722 43.673 1.00 79.52  ? 138 ALA C CA    1 
ATOM   6021  C  C     . ALA C 1 79  ? -12.213 26.028 44.288 1.00 79.52  ? 138 ALA C C     1 
ATOM   6022  O  O     . ALA C 1 79  ? -13.139 26.041 45.104 1.00 64.16  ? 138 ALA C O     1 
ATOM   6023  C  CB    . ALA C 1 79  ? -10.822 23.968 44.673 1.00 64.16  ? 138 ALA C CB    1 
ATOM   6024  H  H     . ALA C 1 79  ? -10.029 24.737 42.408 1.00 0.00   ? 138 ALA C H     1 
ATOM   6025  N  N     . ALA C 1 80  ? -11.591 27.129 43.899 1.00 67.13  ? 139 ALA C N     1 
ATOM   6026  C  CA    . ALA C 1 80  ? -11.981 28.426 44.411 1.00 67.13  ? 139 ALA C CA    1 
ATOM   6027  C  C     . ALA C 1 80  ? -13.241 28.948 43.716 1.00 67.13  ? 139 ALA C C     1 
ATOM   6028  O  O     . ALA C 1 80  ? -14.006 29.696 44.308 1.00 48.17  ? 139 ALA C O     1 
ATOM   6029  C  CB    . ALA C 1 80  ? -10.813 29.421 44.253 1.00 48.17  ? 139 ALA C CB    1 
ATOM   6030  H  H     . ALA C 1 80  ? -10.850 27.075 43.262 1.00 0.00   ? 139 ALA C H     1 
ATOM   6031  N  N     . CYS C 1 81  ? -13.476 28.507 42.482 1.00 61.45  ? 140 CYS C N     1 
ATOM   6032  C  CA    . CYS C 1 81  ? -14.625 28.953 41.676 1.00 61.45  ? 140 CYS C CA    1 
ATOM   6033  C  C     . CYS C 1 81  ? -15.980 28.408 42.140 1.00 61.45  ? 140 CYS C C     1 
ATOM   6034  O  O     . CYS C 1 81  ? -16.671 27.681 41.412 1.00 44.94  ? 140 CYS C O     1 
ATOM   6035  C  CB    . CYS C 1 81  ? -14.391 28.603 40.202 1.00 44.94  ? 140 CYS C CB    1 
ATOM   6036  S  SG    . CYS C 1 81  ? -12.757 29.073 39.599 1.00 44.94  ? 140 CYS C SG    1 
ATOM   6037  H  H     . CYS C 1 81  ? -12.853 27.857 42.088 1.00 0.00   ? 140 CYS C H     1 
ATOM   6038  N  N     . THR C 1 82  ? -16.366 28.836 43.336 1.00 45.55  ? 141 THR C N     1 
ATOM   6039  C  CA    . THR C 1 82  ? -17.604 28.440 43.997 1.00 45.55  ? 141 THR C CA    1 
ATOM   6040  C  C     . THR C 1 82  ? -18.720 28.004 43.063 1.00 45.55  ? 141 THR C C     1 
ATOM   6041  O  O     . THR C 1 82  ? -19.517 28.822 42.609 1.00 97.64  ? 141 THR C O     1 
ATOM   6042  C  CB    . THR C 1 82  ? -18.108 29.583 44.894 1.00 97.64  ? 141 THR C CB    1 
ATOM   6043  O  OG1   . THR C 1 82  ? -18.421 30.733 44.091 1.00 97.64  ? 141 THR C OG1   1 
ATOM   6044  C  CG2   . THR C 1 82  ? -17.031 29.957 45.917 1.00 97.64  ? 141 THR C CG2   1 
ATOM   6045  H  H     . THR C 1 82  ? -15.799 29.492 43.790 1.00 0.00   ? 141 THR C H     1 
ATOM   6046  H  HG1   . THR C 1 82  ? -19.159 30.488 43.511 1.00 30.00  ? 141 THR C HG1   1 
ATOM   6047  N  N     . ASN C 1 83  ? -18.746 26.712 42.755 1.00 55.19  ? 142 ASN C N     1 
ATOM   6048  C  CA    . ASN C 1 83  ? -19.758 26.105 41.871 1.00 55.19  ? 142 ASN C CA    1 
ATOM   6049  C  C     . ASN C 1 83  ? -19.996 26.829 40.550 1.00 55.19  ? 142 ASN C C     1 
ATOM   6050  O  O     . ASN C 1 83  ? -20.893 26.464 39.788 1.00 90.07  ? 142 ASN C O     1 
ATOM   6051  C  CB    . ASN C 1 83  ? -21.117 25.890 42.567 1.00 90.07  ? 142 ASN C CB    1 
ATOM   6052  C  CG    . ASN C 1 83  ? -21.111 26.263 44.028 1.00 90.07  ? 142 ASN C CG    1 
ATOM   6053  O  OD1   . ASN C 1 83  ? -21.107 27.441 44.381 1.00 90.07  ? 142 ASN C OD1   1 
ATOM   6054  N  ND2   . ASN C 1 83  ? -21.142 25.264 44.891 1.00 90.07  ? 142 ASN C ND2   1 
ATOM   6055  H  H     . ASN C 1 83  ? -18.004 26.188 43.091 1.00 0.00   ? 142 ASN C H     1 
ATOM   6056  H  HD21  . ASN C 1 83  ? -21.197 25.549 45.827 1.00 0.00   ? 142 ASN C HD21  1 
ATOM   6057  H  HD22  . ASN C 1 83  ? -21.149 24.338 44.599 1.00 0.00   ? 142 ASN C HD22  1 
ATOM   6058  N  N     . VAL C 1 84  ? -19.183 27.842 40.279 1.00 50.65  ? 143 VAL C N     1 
ATOM   6059  C  CA    . VAL C 1 84  ? -19.282 28.601 39.048 1.00 50.65  ? 143 VAL C CA    1 
ATOM   6060  C  C     . VAL C 1 84  ? -18.421 27.858 38.013 1.00 50.65  ? 143 VAL C C     1 
ATOM   6061  O  O     . VAL C 1 84  ? -17.273 27.505 38.299 1.00 40.96  ? 143 VAL C O     1 
ATOM   6062  C  CB    . VAL C 1 84  ? -18.782 30.040 39.260 1.00 40.96  ? 143 VAL C CB    1 
ATOM   6063  C  CG1   . VAL C 1 84  ? -18.816 30.796 37.968 1.00 40.96  ? 143 VAL C CG1   1 
ATOM   6064  C  CG2   . VAL C 1 84  ? -19.663 30.746 40.256 1.00 40.96  ? 143 VAL C CG2   1 
ATOM   6065  H  H     . VAL C 1 84  ? -18.436 28.061 40.855 1.00 0.00   ? 143 VAL C H     1 
ATOM   6066  N  N     . PRO C 1 85  ? -18.988 27.542 36.830 1.00 48.59  ? 144 PRO C N     1 
ATOM   6067  C  CA    . PRO C 1 85  ? -18.257 26.832 35.777 1.00 48.59  ? 144 PRO C CA    1 
ATOM   6068  C  C     . PRO C 1 85  ? -16.959 27.524 35.374 1.00 48.59  ? 144 PRO C C     1 
ATOM   6069  O  O     . PRO C 1 85  ? -16.975 28.628 34.845 1.00 37.45  ? 144 PRO C O     1 
ATOM   6070  C  CB    . PRO C 1 85  ? -19.272 26.791 34.627 1.00 37.45  ? 144 PRO C CB    1 
ATOM   6071  C  CG    . PRO C 1 85  ? -20.157 27.957 34.888 1.00 37.45  ? 144 PRO C CG    1 
ATOM   6072  C  CD    . PRO C 1 85  ? -20.348 27.861 36.371 1.00 37.45  ? 144 PRO C CD    1 
ATOM   6073  N  N     . ALA C 1 86  ? -15.838 26.880 35.674 1.00 40.57  ? 145 ALA C N     1 
ATOM   6074  C  CA    . ALA C 1 86  ? -14.524 27.414 35.355 1.00 40.57  ? 145 ALA C CA    1 
ATOM   6075  C  C     . ALA C 1 86  ? -13.867 26.586 34.247 1.00 40.57  ? 145 ALA C C     1 
ATOM   6076  O  O     . ALA C 1 86  ? -13.736 25.366 34.351 1.00 41.47  ? 145 ALA C O     1 
ATOM   6077  C  CB    . ALA C 1 86  ? -13.649 27.431 36.592 1.00 41.47  ? 145 ALA C CB    1 
ATOM   6078  H  H     . ALA C 1 86  ? -15.878 26.008 36.114 1.00 0.00   ? 145 ALA C H     1 
ATOM   6079  N  N     . LEU C 1 87  ? -13.459 27.280 33.193 1.00 43.53  ? 146 LEU C N     1 
ATOM   6080  C  CA    . LEU C 1 87  ? -12.816 26.685 32.037 1.00 43.53  ? 146 LEU C CA    1 
ATOM   6081  C  C     . LEU C 1 87  ? -11.405 27.285 31.998 1.00 43.53  ? 146 LEU C C     1 
ATOM   6082  O  O     . LEU C 1 87  ? -11.253 28.500 32.083 1.00 34.08  ? 146 LEU C O     1 
ATOM   6083  C  CB    . LEU C 1 87  ? -13.616 27.089 30.808 1.00 34.08  ? 146 LEU C CB    1 
ATOM   6084  C  CG    . LEU C 1 87  ? -13.430 26.400 29.470 1.00 34.08  ? 146 LEU C CG    1 
ATOM   6085  C  CD1   . LEU C 1 87  ? -13.731 24.903 29.558 1.00 34.08  ? 146 LEU C CD1   1 
ATOM   6086  C  CD2   . LEU C 1 87  ? -14.376 27.086 28.509 1.00 34.08  ? 146 LEU C CD2   1 
ATOM   6087  H  H     . LEU C 1 87  ? -13.599 28.251 33.180 1.00 0.00   ? 146 LEU C H     1 
ATOM   6088  N  N     . PHE C 1 88  ? -10.382 26.442 31.894 1.00 24.21  ? 147 PHE C N     1 
ATOM   6089  C  CA    . PHE C 1 88  ? -8.993  26.888 31.885 1.00 24.21  ? 147 PHE C CA    1 
ATOM   6090  C  C     . PHE C 1 88  ? -8.357  26.856 30.510 1.00 24.21  ? 147 PHE C C     1 
ATOM   6091  O  O     . PHE C 1 88  ? -8.359  25.820 29.853 1.00 33.67  ? 147 PHE C O     1 
ATOM   6092  C  CB    . PHE C 1 88  ? -8.166  26.030 32.828 1.00 33.67  ? 147 PHE C CB    1 
ATOM   6093  C  CG    . PHE C 1 88  ? -8.473  26.254 34.271 1.00 33.67  ? 147 PHE C CG    1 
ATOM   6094  C  CD1   . PHE C 1 88  ? -9.618  25.711 34.846 1.00 33.67  ? 147 PHE C CD1   1 
ATOM   6095  C  CD2   . PHE C 1 88  ? -7.599  26.986 35.072 1.00 33.67  ? 147 PHE C CD2   1 
ATOM   6096  C  CE1   . PHE C 1 88  ? -9.882  25.891 36.192 1.00 33.67  ? 147 PHE C CE1   1 
ATOM   6097  C  CE2   . PHE C 1 88  ? -7.853  27.176 36.428 1.00 33.67  ? 147 PHE C CE2   1 
ATOM   6098  C  CZ    . PHE C 1 88  ? -8.991  26.631 36.988 1.00 33.67  ? 147 PHE C CZ    1 
ATOM   6099  H  H     . PHE C 1 88  ? -10.567 25.487 31.809 1.00 0.00   ? 147 PHE C H     1 
ATOM   6100  N  N     . LEU C 1 89  ? -7.716  27.956 30.125 1.00 35.04  ? 148 LEU C N     1 
ATOM   6101  C  CA    . LEU C 1 89  ? -7.099  28.044 28.803 1.00 35.04  ? 148 LEU C CA    1 
ATOM   6102  C  C     . LEU C 1 89  ? -5.574  27.952 28.778 1.00 35.04  ? 148 LEU C C     1 
ATOM   6103  O  O     . LEU C 1 89  ? -5.000  27.963 27.701 1.00 24.73  ? 148 LEU C O     1 
ATOM   6104  C  CB    . LEU C 1 89  ? -7.534  29.329 28.054 1.00 24.73  ? 148 LEU C CB    1 
ATOM   6105  C  CG    . LEU C 1 89  ? -8.979  29.873 27.965 1.00 24.73  ? 148 LEU C CG    1 
ATOM   6106  C  CD1   . LEU C 1 89  ? -8.956  31.105 27.109 1.00 24.73  ? 148 LEU C CD1   1 
ATOM   6107  C  CD2   . LEU C 1 89  ? -9.992  28.884 27.407 1.00 24.73  ? 148 LEU C CD2   1 
ATOM   6108  H  H     . LEU C 1 89  ? -7.636  28.704 30.756 1.00 0.00   ? 148 LEU C H     1 
ATOM   6109  N  N     . ASP C 1 90  ? -4.914  27.882 29.935 1.00 12.41  ? 149 ASP C N     1 
ATOM   6110  C  CA    . ASP C 1 90  ? -3.449  27.813 29.957 1.00 12.41  ? 149 ASP C CA    1 
ATOM   6111  C  C     . ASP C 1 90  ? -2.954  26.827 31.004 1.00 12.41  ? 149 ASP C C     1 
ATOM   6112  O  O     . ASP C 1 90  ? -2.302  27.211 31.962 1.00 40.04  ? 149 ASP C O     1 
ATOM   6113  C  CB    . ASP C 1 90  ? -2.884  29.204 30.237 1.00 40.04  ? 149 ASP C CB    1 
ATOM   6114  C  CG    . ASP C 1 90  ? -1.429  29.356 29.824 1.00 40.04  ? 149 ASP C CG    1 
ATOM   6115  O  OD1   . ASP C 1 90  ? -0.677  28.355 29.857 1.00 40.04  ? 149 ASP C OD1   1 
ATOM   6116  O  OD2   . ASP C 1 90  ? -1.039  30.500 29.471 1.00 40.04  ? 149 ASP C OD2   1 
ATOM   6117  H  H     . ASP C 1 90  ? -5.394  27.863 30.789 1.00 0.00   ? 149 ASP C H     1 
ATOM   6118  N  N     . VAL C 1 91  ? -3.250  25.547 30.786 1.00 36.43  ? 150 VAL C N     1 
ATOM   6119  C  CA    . VAL C 1 91  ? -2.872  24.442 31.683 1.00 36.43  ? 150 VAL C CA    1 
ATOM   6120  C  C     . VAL C 1 91  ? -2.237  23.247 30.913 1.00 36.43  ? 150 VAL C C     1 
ATOM   6121  O  O     . VAL C 1 91  ? -1.609  23.424 29.872 1.00 20.70  ? 150 VAL C O     1 
ATOM   6122  C  CB    . VAL C 1 91  ? -4.116  23.931 32.474 1.00 20.70  ? 150 VAL C CB    1 
ATOM   6123  C  CG1   . VAL C 1 91  ? -4.686  25.023 33.356 1.00 20.70  ? 150 VAL C CG1   1 
ATOM   6124  C  CG2   . VAL C 1 91  ? -5.179  23.421 31.509 1.00 20.70  ? 150 VAL C CG2   1 
ATOM   6125  H  H     . VAL C 1 91  ? -3.705  25.334 29.948 1.00 0.00   ? 150 VAL C H     1 
ATOM   6126  N  N     . SER C 1 92  ? -2.388  22.035 31.445 1.00 36.82  ? 151 SER C N     1 
ATOM   6127  C  CA    . SER C 1 92  ? -1.857  20.823 30.817 1.00 36.82  ? 151 SER C CA    1 
ATOM   6128  C  C     . SER C 1 92  ? -3.028  19.939 30.498 1.00 36.82  ? 151 SER C C     1 
ATOM   6129  O  O     . SER C 1 92  ? -3.959  19.821 31.277 1.00 30.11  ? 151 SER C O     1 
ATOM   6130  C  CB    . SER C 1 92  ? -0.907  20.057 31.753 1.00 30.11  ? 151 SER C CB    1 
ATOM   6131  O  OG    . SER C 1 92  ? -0.570  18.777 31.223 1.00 30.11  ? 151 SER C OG    1 
ATOM   6132  H  H     . SER C 1 92  ? -2.881  21.903 32.278 1.00 0.00   ? 151 SER C H     1 
ATOM   6133  H  HG    . SER C 1 92  ? 0.152   18.414 31.751 1.00 30.00  ? 151 SER C HG    1 
ATOM   6134  N  N     . ASP C 1 93  ? -2.960  19.263 29.371 1.00 42.15  ? 152 ASP C N     1 
ATOM   6135  C  CA    . ASP C 1 93  ? -4.041  18.380 28.977 1.00 42.15  ? 152 ASP C CA    1 
ATOM   6136  C  C     . ASP C 1 93  ? -4.140  17.169 29.915 1.00 42.15  ? 152 ASP C C     1 
ATOM   6137  O  O     . ASP C 1 93  ? -4.846  16.198 29.637 1.00 42.92  ? 152 ASP C O     1 
ATOM   6138  C  CB    . ASP C 1 93  ? -3.880  17.970 27.501 1.00 42.92  ? 152 ASP C CB    1 
ATOM   6139  C  CG    . ASP C 1 93  ? -2.470  17.487 27.154 1.00 42.92  ? 152 ASP C CG    1 
ATOM   6140  O  OD1   . ASP C 1 93  ? -1.466  17.973 27.730 1.00 42.92  ? 152 ASP C OD1   1 
ATOM   6141  O  OD2   . ASP C 1 93  ? -2.372  16.616 26.267 1.00 42.92  ? 152 ASP C OD2   1 
ATOM   6142  H  H     . ASP C 1 93  ? -2.183  19.446 28.817 1.00 0.00   ? 152 ASP C H     1 
ATOM   6143  N  N     . GLN C 1 94  ? -3.444  17.256 31.043 1.00 24.19  ? 153 GLN C N     1 
ATOM   6144  C  CA    . GLN C 1 94  ? -3.407  16.199 32.042 1.00 24.19  ? 153 GLN C CA    1 
ATOM   6145  C  C     . GLN C 1 94  ? -4.079  16.646 33.324 1.00 24.19  ? 153 GLN C C     1 
ATOM   6146  O  O     . GLN C 1 94  ? -4.054  15.935 34.314 1.00 75.83  ? 153 GLN C O     1 
ATOM   6147  C  CB    . GLN C 1 94  ? -1.953  15.849 32.355 1.00 75.83  ? 153 GLN C CB    1 
ATOM   6148  C  CG    . GLN C 1 94  ? -1.130  15.460 31.142 1.00 75.83  ? 153 GLN C CG    1 
ATOM   6149  C  CD    . GLN C 1 94  ? -1.555  14.125 30.552 1.00 75.83  ? 153 GLN C CD    1 
ATOM   6150  O  OE1   . GLN C 1 94  ? -0.882  13.107 30.743 1.00 75.83  ? 153 GLN C OE1   1 
ATOM   6151  N  NE2   . GLN C 1 94  ? -2.669  14.120 29.832 1.00 75.83  ? 153 GLN C NE2   1 
ATOM   6152  H  H     . GLN C 1 94  ? -2.885  18.002 31.289 1.00 0.00   ? 153 GLN C H     1 
ATOM   6153  N  N     . THR C 1 95  ? -4.650  17.838 33.318 1.00 70.86  ? 154 THR C N     1 
ATOM   6154  C  CA    . THR C 1 95  ? -5.303  18.337 34.508 1.00 70.86  ? 154 THR C CA    1 
ATOM   6155  C  C     . THR C 1 95  ? -6.783  18.000 34.558 1.00 70.86  ? 154 THR C C     1 
ATOM   6156  O  O     . THR C 1 95  ? -7.507  18.154 33.562 1.00 54.66  ? 154 THR C O     1 
ATOM   6157  C  CB    . THR C 1 95  ? -5.095  19.840 34.670 1.00 54.66  ? 154 THR C CB    1 
ATOM   6158  O  OG1   . THR C 1 95  ? -3.700  20.092 34.860 1.00 54.66  ? 154 THR C OG1   1 
ATOM   6159  C  CG2   . THR C 1 95  ? -5.839  20.358 35.881 1.00 54.66  ? 154 THR C CG2   1 
ATOM   6160  H  H     . THR C 1 95  ? -4.661  18.405 32.517 1.00 0.00   ? 154 THR C H     1 
ATOM   6161  H  HG1   . THR C 1 95  ? -3.399  19.600 35.624 1.00 30.00  ? 154 THR C HG1   1 
ATOM   6162  N  N     . PRO C 1 96  ? -7.240  17.477 35.714 1.00 45.02  ? 155 PRO C N     1 
ATOM   6163  C  CA    . PRO C 1 96  ? -8.637  17.102 35.934 1.00 45.02  ? 155 PRO C CA    1 
ATOM   6164  C  C     . PRO C 1 96  ? -9.498  18.351 36.188 1.00 45.02  ? 155 PRO C C     1 
ATOM   6165  O  O     . PRO C 1 96  ? -9.876  18.641 37.327 1.00 48.50  ? 155 PRO C O     1 
ATOM   6166  C  CB    . PRO C 1 96  ? -8.540  16.194 37.158 1.00 48.50  ? 155 PRO C CB    1 
ATOM   6167  C  CG    . PRO C 1 96  ? -7.402  16.800 37.929 1.00 48.50  ? 155 PRO C CG    1 
ATOM   6168  C  CD    . PRO C 1 96  ? -6.393  17.062 36.854 1.00 48.50  ? 155 PRO C CD    1 
ATOM   6169  N  N     . ILE C 1 97  ? -9.775  19.096 35.117 1.00 28.64  ? 156 ILE C N     1 
ATOM   6170  C  CA    . ILE C 1 97  ? -10.574 20.337 35.168 1.00 28.64  ? 156 ILE C CA    1 
ATOM   6171  C  C     . ILE C 1 97  ? -11.079 20.584 33.752 1.00 28.64  ? 156 ILE C C     1 
ATOM   6172  O  O     . ILE C 1 97  ? -10.581 19.986 32.797 1.00 64.37  ? 156 ILE C O     1 
ATOM   6173  C  CB    . ILE C 1 97  ? -9.706  21.575 35.531 1.00 64.37  ? 156 ILE C CB    1 
ATOM   6174  C  CG1   . ILE C 1 97  ? -8.614  21.752 34.467 1.00 64.37  ? 156 ILE C CG1   1 
ATOM   6175  C  CG2   . ILE C 1 97  ? -9.102  21.444 36.930 1.00 64.37  ? 156 ILE C CG2   1 
ATOM   6176  C  CD1   . ILE C 1 97  ? -7.723  22.926 34.676 1.00 64.37  ? 156 ILE C CD1   1 
ATOM   6177  H  H     . ILE C 1 97  ? -9.445  18.827 34.228 1.00 0.00   ? 156 ILE C H     1 
ATOM   6178  N  N     . ASN C 1 98  ? -12.030 21.490 33.600 1.00 28.60  ? 157 ASN C N     1 
ATOM   6179  C  CA    . ASN C 1 98  ? -12.523 21.784 32.263 1.00 28.60  ? 157 ASN C CA    1 
ATOM   6180  C  C     . ASN C 1 98  ? -11.458 22.638 31.563 1.00 28.60  ? 157 ASN C C     1 
ATOM   6181  O  O     . ASN C 1 98  ? -11.067 23.688 32.080 1.00 55.40  ? 157 ASN C O     1 
ATOM   6182  C  CB    . ASN C 1 98  ? -13.840 22.569 32.316 1.00 55.40  ? 157 ASN C CB    1 
ATOM   6183  C  CG    . ASN C 1 98  ? -14.770 22.096 33.414 1.00 55.40  ? 157 ASN C CG    1 
ATOM   6184  O  OD1   . ASN C 1 98  ? -15.559 22.875 33.946 1.00 55.40  ? 157 ASN C OD1   1 
ATOM   6185  N  ND2   . ASN C 1 98  ? -14.674 20.825 33.772 1.00 55.40  ? 157 ASN C ND2   1 
ATOM   6186  H  H     . ASN C 1 98  ? -12.379 21.989 34.368 1.00 0.00   ? 157 ASN C H     1 
ATOM   6187  H  HD21  . ASN C 1 98  ? -15.281 20.535 34.476 1.00 0.00   ? 157 ASN C HD21  1 
ATOM   6188  H  HD22  . ASN C 1 98  ? -14.023 20.250 33.332 1.00 0.00   ? 157 ASN C HD22  1 
ATOM   6189  N  N     . SER C 1 99  ? -10.954 22.173 30.422 1.00 48.72  ? 158 SER C N     1 
ATOM   6190  C  CA    . SER C 1 99  ? -9.960  22.937 29.673 1.00 48.72  ? 158 SER C CA    1 
ATOM   6191  C  C     . SER C 1 99  ? -10.068 22.718 28.170 1.00 48.72  ? 158 SER C C     1 
ATOM   6192  O  O     . SER C 1 99  ? -10.694 21.767 27.709 1.00 28.90  ? 158 SER C O     1 
ATOM   6193  C  CB    . SER C 1 99  ? -8.517  22.647 30.149 1.00 28.90  ? 158 SER C CB    1 
ATOM   6194  O  OG    . SER C 1 99  ? -8.074  21.337 29.824 1.00 28.90  ? 158 SER C OG    1 
ATOM   6195  H  H     . SER C 1 99  ? -11.264 21.307 30.068 1.00 0.00   ? 158 SER C H     1 
ATOM   6196  H  HG    . SER C 1 99  ? -8.558  20.731 30.399 1.00 30.00  ? 158 SER C HG    1 
ATOM   6197  N  N     . ILE C 1 100 ? -9.538  23.675 27.417 1.00 33.65  ? 159 ILE C N     1 
ATOM   6198  C  CA    . ILE C 1 100 ? -9.496  23.617 25.968 1.00 33.65  ? 159 ILE C CA    1 
ATOM   6199  C  C     . ILE C 1 100 ? -8.114  24.160 25.775 1.00 33.65  ? 159 ILE C C     1 
ATOM   6200  O  O     . ILE C 1 100 ? -7.780  25.219 26.301 1.00 20.46  ? 159 ILE C O     1 
ATOM   6201  C  CB    . ILE C 1 100 ? -10.450 24.598 25.286 1.00 20.46  ? 159 ILE C CB    1 
ATOM   6202  C  CG1   . ILE C 1 100 ? -11.868 24.429 25.823 1.00 20.46  ? 159 ILE C CG1   1 
ATOM   6203  C  CG2   . ILE C 1 100 ? -10.438 24.344 23.811 1.00 20.46  ? 159 ILE C CG2   1 
ATOM   6204  C  CD1   . ILE C 1 100 ? -12.894 25.301 25.145 1.00 20.46  ? 159 ILE C CD1   1 
ATOM   6205  H  H     . ILE C 1 100 ? -9.121  24.462 27.834 1.00 0.00   ? 159 ILE C H     1 
ATOM   6206  N  N     . ILE C 1 101 ? -7.270  23.403 25.111 1.00 34.97  ? 160 ILE C N     1 
ATOM   6207  C  CA    . ILE C 1 101 ? -5.926  23.865 24.883 1.00 34.97  ? 160 ILE C CA    1 
ATOM   6208  C  C     . ILE C 1 101 ? -5.524  23.418 23.475 1.00 34.97  ? 160 ILE C C     1 
ATOM   6209  O  O     . ILE C 1 101 ? -6.233  22.627 22.853 1.00 28.49  ? 160 ILE C O     1 
ATOM   6210  C  CB    . ILE C 1 101 ? -4.942  23.330 25.978 1.00 28.49  ? 160 ILE C CB    1 
ATOM   6211  C  CG1   . ILE C 1 101 ? -4.654  21.848 25.786 1.00 28.49  ? 160 ILE C CG1   1 
ATOM   6212  C  CG2   . ILE C 1 101 ? -5.507  23.561 27.352 1.00 28.49  ? 160 ILE C CG2   1 
ATOM   6213  C  CD1   . ILE C 1 101 ? -3.315  21.410 26.390 1.00 28.49  ? 160 ILE C CD1   1 
ATOM   6214  H  H     . ILE C 1 101 ? -7.513  22.542 24.737 1.00 0.00   ? 160 ILE C H     1 
ATOM   6215  N  N     . PHE C 1 102 ? -4.446  23.987 22.943 1.00 29.51  ? 161 PHE C N     1 
ATOM   6216  C  CA    . PHE C 1 102 ? -3.966  23.631 21.610 1.00 29.51  ? 161 PHE C CA    1 
ATOM   6217  C  C     . PHE C 1 102 ? -3.010  22.424 21.699 1.00 29.51  ? 161 PHE C C     1 
ATOM   6218  O  O     . PHE C 1 102 ? -2.322  22.207 22.696 1.00 14.39  ? 161 PHE C O     1 
ATOM   6219  C  CB    . PHE C 1 102 ? -3.229  24.838 20.970 1.00 14.39  ? 161 PHE C CB    1 
ATOM   6220  C  CG    . PHE C 1 102 ? -4.118  26.044 20.707 1.00 14.39  ? 161 PHE C CG    1 
ATOM   6221  C  CD1   . PHE C 1 102 ? -4.826  26.145 19.533 1.00 14.39  ? 161 PHE C CD1   1 
ATOM   6222  C  CD2   . PHE C 1 102 ? -4.254  27.056 21.662 1.00 14.39  ? 161 PHE C CD2   1 
ATOM   6223  C  CE1   . PHE C 1 102 ? -5.657  27.223 19.322 1.00 14.39  ? 161 PHE C CE1   1 
ATOM   6224  C  CE2   . PHE C 1 102 ? -5.075  28.133 21.463 1.00 14.39  ? 161 PHE C CE2   1 
ATOM   6225  C  CZ    . PHE C 1 102 ? -5.785  28.224 20.298 1.00 14.39  ? 161 PHE C CZ    1 
ATOM   6226  H  H     . PHE C 1 102 ? -3.948  24.648 23.466 1.00 0.00   ? 161 PHE C H     1 
ATOM   6227  N  N     . SER C 1 103 ? -2.915  21.661 20.636 1.00 8.62   ? 162 SER C N     1 
ATOM   6228  C  CA    . SER C 1 103 ? -2.027  20.531 20.666 1.00 8.62   ? 162 SER C CA    1 
ATOM   6229  C  C     . SER C 1 103 ? -0.582  20.992 20.836 1.00 8.62   ? 162 SER C C     1 
ATOM   6230  O  O     . SER C 1 103 ? -0.022  21.648 19.957 1.00 49.56  ? 162 SER C O     1 
ATOM   6231  C  CB    . SER C 1 103 ? -2.171  19.757 19.359 1.00 49.56  ? 162 SER C CB    1 
ATOM   6232  O  OG    . SER C 1 103 ? -1.269  18.668 19.302 1.00 49.56  ? 162 SER C OG    1 
ATOM   6233  H  H     . SER C 1 103 ? -3.389  21.883 19.813 1.00 0.00   ? 162 SER C H     1 
ATOM   6234  H  HG    . SER C 1 103 ? -1.829  17.932 19.025 1.00 30.00  ? 162 SER C HG    1 
ATOM   6235  N  N     . HIS C 1 104 ? 0.048   20.624 21.938 1.00 20.77  ? 163 HIS C N     1 
ATOM   6236  C  CA    . HIS C 1 104 ? 1.448   20.999 22.139 1.00 20.77  ? 163 HIS C CA    1 
ATOM   6237  C  C     . HIS C 1 104 ? 2.382   19.960 21.541 1.00 20.77  ? 163 HIS C C     1 
ATOM   6238  O  O     . HIS C 1 104 ? 3.586   20.167 21.454 1.00 29.18  ? 163 HIS C O     1 
ATOM   6239  C  CB    . HIS C 1 104 ? 1.761   21.185 23.621 1.00 29.18  ? 163 HIS C CB    1 
ATOM   6240  C  CG    . HIS C 1 104 ? 1.367   20.021 24.473 1.00 29.18  ? 163 HIS C CG    1 
ATOM   6241  N  ND1   . HIS C 1 104 ? 2.289   19.161 25.028 1.00 29.18  ? 163 HIS C ND1   1 
ATOM   6242  C  CD2   . HIS C 1 104 ? 0.151   19.578 24.868 1.00 29.18  ? 163 HIS C CD2   1 
ATOM   6243  C  CE1   . HIS C 1 104 ? 1.659   18.238 25.729 1.00 29.18  ? 163 HIS C CE1   1 
ATOM   6244  N  NE2   . HIS C 1 104 ? 0.362   18.469 25.646 1.00 29.18  ? 163 HIS C NE2   1 
ATOM   6245  H  H     . HIS C 1 104 ? -0.498  20.156 22.596 1.00 0.00   ? 163 HIS C H     1 
ATOM   6246  H  HD1   . HIS C 1 104 ? 3.272   19.236 24.932 1.00 0.00   ? 163 HIS C HD1   1 
ATOM   6247  H  HE2   . HIS C 1 104 ? -0.326  17.899 26.045 1.00 0.00   ? 163 HIS C HE2   1 
ATOM   6248  N  N     . GLU C 1 105 ? 1.821   18.822 21.152 1.00 14.31  ? 164 GLU C N     1 
ATOM   6249  C  CA    . GLU C 1 105 ? 2.604   17.735 20.547 1.00 14.31  ? 164 GLU C CA    1 
ATOM   6250  C  C     . GLU C 1 105 ? 2.781   17.991 19.048 1.00 14.31  ? 164 GLU C C     1 
ATOM   6251  O  O     . GLU C 1 105 ? 3.884   17.904 18.504 1.00 67.74  ? 164 GLU C O     1 
ATOM   6252  C  CB    . GLU C 1 105 ? 1.902   16.396 20.789 1.00 67.74  ? 164 GLU C CB    1 
ATOM   6253  C  CG    . GLU C 1 105 ? 1.930   15.940 22.245 1.00 67.74  ? 164 GLU C CG    1 
ATOM   6254  C  CD    . GLU C 1 105 ? 3.226   15.225 22.598 1.00 67.74  ? 164 GLU C CD    1 
ATOM   6255  O  OE1   . GLU C 1 105 ? 3.564   14.261 21.880 1.00 67.74  ? 164 GLU C OE1   1 
ATOM   6256  O  OE2   . GLU C 1 105 ? 3.906   15.618 23.583 1.00 67.74  ? 164 GLU C OE2   1 
ATOM   6257  H  H     . GLU C 1 105 ? 0.860   18.714 21.246 1.00 0.00   ? 164 GLU C H     1 
ATOM   6258  N  N     . ASP C 1 106 ? 1.673   18.300 18.387 1.00 27.67  ? 165 ASP C N     1 
ATOM   6259  C  CA    . ASP C 1 106 ? 1.686   18.616 16.975 1.00 27.67  ? 165 ASP C CA    1 
ATOM   6260  C  C     . ASP C 1 106 ? 2.567   19.846 16.780 1.00 27.67  ? 165 ASP C C     1 
ATOM   6261  O  O     . ASP C 1 106 ? 3.581   19.763 16.089 1.00 41.94  ? 165 ASP C O     1 
ATOM   6262  C  CB    . ASP C 1 106 ? 0.257   18.833 16.510 1.00 41.94  ? 165 ASP C CB    1 
ATOM   6263  C  CG    . ASP C 1 106 ? -0.553  17.548 16.581 1.00 41.94  ? 165 ASP C CG    1 
ATOM   6264  O  OD1   . ASP C 1 106 ? 0.021   16.498 16.208 1.00 41.94  ? 165 ASP C OD1   1 
ATOM   6265  O  OD2   . ASP C 1 106 ? -1.723  17.557 17.027 1.00 41.94  ? 165 ASP C OD2   1 
ATOM   6266  H  H     . ASP C 1 106 ? 0.815   18.329 18.862 1.00 0.00   ? 165 ASP C H     1 
ATOM   6267  N  N     . GLY C 1 107 ? 2.253   20.938 17.481 1.00 17.27  ? 166 GLY C N     1 
ATOM   6268  C  CA    . GLY C 1 107 ? 3.053   22.148 17.395 1.00 17.27  ? 166 GLY C CA    1 
ATOM   6269  C  C     . GLY C 1 107 ? 4.551   21.913 17.479 1.00 17.27  ? 166 GLY C C     1 
ATOM   6270  O  O     . GLY C 1 107 ? 5.289   22.310 16.589 1.00 13.99  ? 166 GLY C O     1 
ATOM   6271  H  H     . GLY C 1 107 ? 1.479   20.946 18.082 1.00 0.00   ? 166 GLY C H     1 
ATOM   6272  N  N     . THR C 1 108 ? 5.011   21.270 18.546 1.00 25.83  ? 167 THR C N     1 
ATOM   6273  C  CA    . THR C 1 108 ? 6.432   20.985 18.706 1.00 25.83  ? 167 THR C CA    1 
ATOM   6274  C  C     . THR C 1 108 ? 6.931   19.992 17.628 1.00 25.83  ? 167 THR C C     1 
ATOM   6275  O  O     . THR C 1 108 ? 8.124   19.943 17.289 1.00 26.73  ? 167 THR C O     1 
ATOM   6276  C  CB    . THR C 1 108 ? 6.746   20.476 20.157 1.00 26.73  ? 167 THR C CB    1 
ATOM   6277  O  OG1   . THR C 1 108 ? 5.871   19.401 20.508 1.00 26.73  ? 167 THR C OG1   1 
ATOM   6278  C  CG2   . THR C 1 108 ? 6.542   21.576 21.184 1.00 26.73  ? 167 THR C CG2   1 
ATOM   6279  H  H     . THR C 1 108 ? 4.407   20.991 19.267 1.00 0.00   ? 167 THR C H     1 
ATOM   6280  H  HG1   . THR C 1 108 ? 5.905   18.664 19.889 1.00 30.00  ? 167 THR C HG1   1 
ATOM   6281  N  N     . ARG C 1 109 ? 6.009   19.236 17.044 1.00 22.11  ? 168 ARG C N     1 
ATOM   6282  C  CA    . ARG C 1 109 ? 6.378   18.268 16.021 1.00 22.11  ? 168 ARG C CA    1 
ATOM   6283  C  C     . ARG C 1 109 ? 6.547   18.934 14.660 1.00 22.11  ? 168 ARG C C     1 
ATOM   6284  O  O     . ARG C 1 109 ? 7.567   18.755 13.995 1.00 22.29  ? 168 ARG C O     1 
ATOM   6285  C  CB    . ARG C 1 109 ? 5.319   17.167 15.935 1.00 22.29  ? 168 ARG C CB    1 
ATOM   6286  C  CG    . ARG C 1 109 ? 5.705   16.014 15.023 1.00 22.29  ? 168 ARG C CG    1 
ATOM   6287  C  CD    . ARG C 1 109 ? 4.714   14.879 15.117 1.00 22.29  ? 168 ARG C CD    1 
ATOM   6288  N  NE    . ARG C 1 109 ? 3.371   15.292 14.726 1.00 22.29  ? 168 ARG C NE    1 
ATOM   6289  C  CZ    . ARG C 1 109 ? 3.042   15.761 13.523 1.00 22.29  ? 168 ARG C CZ    1 
ATOM   6290  N  NH1   . ARG C 1 109 ? 3.966   15.887 12.571 1.00 22.29  ? 168 ARG C NH1   1 
ATOM   6291  N  NH2   . ARG C 1 109 ? 1.776   16.092 13.271 1.00 22.29  ? 168 ARG C NH2   1 
ATOM   6292  H  H     . ARG C 1 109 ? 5.066   19.311 17.292 1.00 0.00   ? 168 ARG C H     1 
ATOM   6293  H  HE    . ARG C 1 109 ? 2.659   15.230 15.393 1.00 0.00   ? 168 ARG C HE    1 
ATOM   6294  H  HH11  . ARG C 1 109 ? 4.917   15.636 12.746 1.00 0.00   ? 168 ARG C HH11  1 
ATOM   6295  H  HH12  . ARG C 1 109 ? 3.709   16.242 11.672 1.00 0.00   ? 168 ARG C HH12  1 
ATOM   6296  H  HH21  . ARG C 1 109 ? 1.086   15.982 13.986 1.00 0.00   ? 168 ARG C HH21  1 
ATOM   6297  H  HH22  . ARG C 1 109 ? 1.518   16.437 12.370 1.00 0.00   ? 168 ARG C HH22  1 
ATOM   6298  N  N     . LEU C 1 110 ? 5.536   19.704 14.255 1.00 2.00   ? 169 LEU C N     1 
ATOM   6299  C  CA    . LEU C 1 110 ? 5.551   20.403 12.989 1.00 2.00   ? 169 LEU C CA    1 
ATOM   6300  C  C     . LEU C 1 110 ? 6.812   21.241 12.903 1.00 2.00   ? 169 LEU C C     1 
ATOM   6301  O  O     . LEU C 1 110 ? 7.457   21.264 11.862 1.00 21.65  ? 169 LEU C O     1 
ATOM   6302  C  CB    . LEU C 1 110 ? 4.289   21.236 12.833 1.00 21.65  ? 169 LEU C CB    1 
ATOM   6303  C  CG    . LEU C 1 110 ? 3.102   20.282 12.824 1.00 21.65  ? 169 LEU C CG    1 
ATOM   6304  C  CD1   . LEU C 1 110 ? 1.794   21.000 12.872 1.00 21.65  ? 169 LEU C CD1   1 
ATOM   6305  C  CD2   . LEU C 1 110 ? 3.187   19.449 11.569 1.00 21.65  ? 169 LEU C CD2   1 
ATOM   6306  H  H     . LEU C 1 110 ? 4.781   19.807 14.834 1.00 0.00   ? 169 LEU C H     1 
ATOM   6307  N  N     . GLY C 1 111 ? 7.214   21.854 14.003 1.00 12.32  ? 170 GLY C N     1 
ATOM   6308  C  CA    . GLY C 1 111 ? 8.428   22.656 13.999 1.00 12.32  ? 170 GLY C CA    1 
ATOM   6309  C  C     . GLY C 1 111 ? 9.695   21.853 13.751 1.00 12.32  ? 170 GLY C C     1 
ATOM   6310  O  O     . GLY C 1 111 ? 10.401  22.113 12.781 1.00 50.63  ? 170 GLY C O     1 
ATOM   6311  H  H     . GLY C 1 111 ? 6.667   21.751 14.810 1.00 0.00   ? 170 GLY C H     1 
ATOM   6312  N  N     . VAL C 1 112 ? 9.976   20.865 14.599 1.00 27.38  ? 171 VAL C N     1 
ATOM   6313  C  CA    . VAL C 1 112 ? 11.171  20.034 14.447 1.00 27.38  ? 171 VAL C CA    1 
ATOM   6314  C  C     . VAL C 1 112 ? 11.164  19.346 13.086 1.00 27.38  ? 171 VAL C C     1 
ATOM   6315  O  O     . VAL C 1 112 ? 12.070  19.538 12.278 1.00 28.77  ? 171 VAL C O     1 
ATOM   6316  C  CB    . VAL C 1 112 ? 11.286  18.919 15.552 1.00 28.77  ? 171 VAL C CB    1 
ATOM   6317  C  CG1   . VAL C 1 112 ? 12.520  18.066 15.305 1.00 28.77  ? 171 VAL C CG1   1 
ATOM   6318  C  CG2   . VAL C 1 112 ? 11.352  19.521 16.950 1.00 28.77  ? 171 VAL C CG2   1 
ATOM   6319  H  H     . VAL C 1 112 ? 9.356   20.672 15.336 1.00 0.00   ? 171 VAL C H     1 
ATOM   6320  N  N     . GLU C 1 113 ? 10.123  18.573 12.817 1.00 19.71  ? 172 GLU C N     1 
ATOM   6321  C  CA    . GLU C 1 113 ? 10.040  17.871 11.553 1.00 19.71  ? 172 GLU C CA    1 
ATOM   6322  C  C     . GLU C 1 113 ? 10.317  18.760 10.363 1.00 19.71  ? 172 GLU C C     1 
ATOM   6323  O  O     . GLU C 1 113 ? 11.027  18.369 9.444  1.00 43.89  ? 172 GLU C O     1 
ATOM   6324  C  CB    . GLU C 1 113 ? 8.712   17.135 11.413 1.00 43.89  ? 172 GLU C CB    1 
ATOM   6325  C  CG    . GLU C 1 113 ? 8.666   15.870 12.286 1.00 43.89  ? 172 GLU C CG    1 
ATOM   6326  C  CD    . GLU C 1 113 ? 7.442   14.990 12.042 1.00 43.89  ? 172 GLU C CD    1 
ATOM   6327  O  OE1   . GLU C 1 113 ? 6.462   15.458 11.393 1.00 43.89  ? 172 GLU C OE1   1 
ATOM   6328  O  OE2   . GLU C 1 113 ? 7.472   13.820 12.510 1.00 43.89  ? 172 GLU C OE2   1 
ATOM   6329  H  H     . GLU C 1 113 ? 9.405   18.494 13.475 1.00 0.00   ? 172 GLU C H     1 
ATOM   6330  N  N     . HIS C 1 114 ? 9.841   19.992 10.431 1.00 13.74  ? 173 HIS C N     1 
ATOM   6331  C  CA    . HIS C 1 114 ? 10.040  20.953 9.356  1.00 13.74  ? 173 HIS C CA    1 
ATOM   6332  C  C     . HIS C 1 114 ? 11.505  21.267 9.233  1.00 13.74  ? 173 HIS C C     1 
ATOM   6333  O  O     . HIS C 1 114 ? 12.088  21.134 8.163  1.00 25.35  ? 173 HIS C O     1 
ATOM   6334  C  CB    . HIS C 1 114 ? 9.278   22.241 9.652  1.00 25.35  ? 173 HIS C CB    1 
ATOM   6335  C  CG    . HIS C 1 114 ? 9.547   23.352 8.687  1.00 25.35  ? 173 HIS C CG    1 
ATOM   6336  N  ND1   . HIS C 1 114 ? 10.100  24.551 9.077  1.00 25.35  ? 173 HIS C ND1   1 
ATOM   6337  C  CD2   . HIS C 1 114 ? 9.246   23.490 7.375  1.00 25.35  ? 173 HIS C CD2   1 
ATOM   6338  C  CE1   . HIS C 1 114 ? 10.117  25.385 8.052  1.00 25.35  ? 173 HIS C CE1   1 
ATOM   6339  N  NE2   . HIS C 1 114 ? 9.605   24.766 7.006  1.00 25.35  ? 173 HIS C NE2   1 
ATOM   6340  H  H     . HIS C 1 114 ? 9.330   20.258 11.229 1.00 0.00   ? 173 HIS C H     1 
ATOM   6341  H  HD1   . HIS C 1 114 ? 10.428  24.769 9.977  1.00 0.00   ? 173 HIS C HD1   1 
ATOM   6342  H  HE2   . HIS C 1 114 ? 9.508   25.153 6.109  1.00 0.00   ? 173 HIS C HE2   1 
ATOM   6343  N  N     . LEU C 1 115 ? 12.113  21.676 10.335 1.00 24.32  ? 174 LEU C N     1 
ATOM   6344  C  CA    . LEU C 1 115 ? 13.522  22.024 10.306 1.00 24.32  ? 174 LEU C CA    1 
ATOM   6345  C  C     . LEU C 1 115 ? 14.373  20.826 9.922  1.00 24.32  ? 174 LEU C C     1 
ATOM   6346  O  O     . LEU C 1 115 ? 15.403  20.976 9.250  1.00 14.53  ? 174 LEU C O     1 
ATOM   6347  C  CB    . LEU C 1 115 ? 13.959  22.596 11.650 1.00 14.53  ? 174 LEU C CB    1 
ATOM   6348  C  CG    . LEU C 1 115 ? 13.290  23.914 12.033 1.00 14.53  ? 174 LEU C CG    1 
ATOM   6349  C  CD1   . LEU C 1 115 ? 13.794  24.308 13.399 1.00 14.53  ? 174 LEU C CD1   1 
ATOM   6350  C  CD2   . LEU C 1 115 ? 13.576  25.013 11.011 1.00 14.53  ? 174 LEU C CD2   1 
ATOM   6351  H  H     . LEU C 1 115 ? 11.622  21.700 11.188 1.00 0.00   ? 174 LEU C H     1 
ATOM   6352  N  N     . VAL C 1 116 ? 13.938  19.629 10.297 1.00 25.45  ? 175 VAL C N     1 
ATOM   6353  C  CA    . VAL C 1 116 ? 14.733  18.474 9.954  1.00 25.45  ? 175 VAL C CA    1 
ATOM   6354  C  C     . VAL C 1 116 ? 14.553  18.135 8.480  1.00 25.45  ? 175 VAL C C     1 
ATOM   6355  O  O     . VAL C 1 116 ? 15.530  17.989 7.750  1.00 35.75  ? 175 VAL C O     1 
ATOM   6356  C  CB    . VAL C 1 116 ? 14.467  17.259 10.859 1.00 35.75  ? 175 VAL C CB    1 
ATOM   6357  C  CG1   . VAL C 1 116 ? 14.681  17.629 12.301 1.00 35.75  ? 175 VAL C CG1   1 
ATOM   6358  C  CG2   . VAL C 1 116 ? 13.094  16.721 10.637 1.00 35.75  ? 175 VAL C CG2   1 
ATOM   6359  H  H     . VAL C 1 116 ? 13.099  19.528 10.778 1.00 0.00   ? 175 VAL C H     1 
ATOM   6360  N  N     . ALA C 1 117 ? 13.316  18.121 8.010  1.00 27.29  ? 176 ALA C N     1 
ATOM   6361  C  CA    . ALA C 1 117 ? 13.041  17.802 6.609  1.00 27.29  ? 176 ALA C CA    1 
ATOM   6362  C  C     . ALA C 1 117 ? 13.774  18.756 5.685  1.00 27.29  ? 176 ALA C C     1 
ATOM   6363  O  O     . ALA C 1 117 ? 13.906  18.510 4.486  1.00 62.09  ? 176 ALA C O     1 
ATOM   6364  C  CB    . ALA C 1 117 ? 11.548  17.861 6.346  1.00 62.09  ? 176 ALA C CB    1 
ATOM   6365  H  H     . ALA C 1 117 ? 12.587  18.363 8.599  1.00 0.00   ? 176 ALA C H     1 
ATOM   6366  N  N     . LEU C 1 118 ? 14.230  19.863 6.251  1.00 39.92  ? 177 LEU C N     1 
ATOM   6367  C  CA    . LEU C 1 118 ? 14.949  20.871 5.502  1.00 39.92  ? 177 LEU C CA    1 
ATOM   6368  C  C     . LEU C 1 118 ? 16.455  20.642 5.520  1.00 39.92  ? 177 LEU C C     1 
ATOM   6369  O  O     . LEU C 1 118 ? 17.173  21.186 4.684  1.00 35.46  ? 177 LEU C O     1 
ATOM   6370  C  CB    . LEU C 1 118 ? 14.599  22.239 6.060  1.00 35.46  ? 177 LEU C CB    1 
ATOM   6371  C  CG    . LEU C 1 118 ? 13.454  22.969 5.377  1.00 35.46  ? 177 LEU C CG    1 
ATOM   6372  C  CD1   . LEU C 1 118 ? 13.134  24.223 6.154  1.00 35.46  ? 177 LEU C CD1   1 
ATOM   6373  C  CD2   . LEU C 1 118 ? 13.861  23.306 3.943  1.00 35.46  ? 177 LEU C CD2   1 
ATOM   6374  H  H     . LEU C 1 118 ? 14.042  20.038 7.190  1.00 0.00   ? 177 LEU C H     1 
ATOM   6375  N  N     . GLY C 1 119 ? 16.931  19.890 6.517  1.00 31.69  ? 178 GLY C N     1 
ATOM   6376  C  CA    . GLY C 1 119 ? 18.352  19.569 6.635  1.00 31.69  ? 178 GLY C CA    1 
ATOM   6377  C  C     . GLY C 1 119 ? 19.119  20.257 7.750  1.00 31.69  ? 178 GLY C C     1 
ATOM   6378  O  O     . GLY C 1 119 ? 20.343  20.352 7.690  1.00 46.90  ? 178 GLY C O     1 
ATOM   6379  H  H     . GLY C 1 119 ? 16.313  19.552 7.185  1.00 0.00   ? 178 GLY C H     1 
ATOM   6380  N  N     . HIS C 1 120 ? 18.414  20.741 8.766  1.00 17.50  ? 179 HIS C N     1 
ATOM   6381  C  CA    . HIS C 1 120 ? 19.065  21.412 9.883  1.00 17.50  ? 179 HIS C CA    1 
ATOM   6382  C  C     . HIS C 1 120 ? 19.524  20.389 10.884 1.00 17.50  ? 179 HIS C C     1 
ATOM   6383  O  O     . HIS C 1 120 ? 18.769  19.504 11.264 1.00 20.98  ? 179 HIS C O     1 
ATOM   6384  C  CB    . HIS C 1 120 ? 18.117  22.407 10.537 1.00 20.98  ? 179 HIS C CB    1 
ATOM   6385  C  CG    . HIS C 1 120 ? 17.827  23.595 9.681  1.00 20.98  ? 179 HIS C CG    1 
ATOM   6386  N  ND1   . HIS C 1 120 ? 18.729  24.621 9.507  1.00 20.98  ? 179 HIS C ND1   1 
ATOM   6387  C  CD2   . HIS C 1 120 ? 16.751  23.909 8.925  1.00 20.98  ? 179 HIS C CD2   1 
ATOM   6388  C  CE1   . HIS C 1 120 ? 18.221  25.518 8.681  1.00 20.98  ? 179 HIS C CE1   1 
ATOM   6389  N  NE2   . HIS C 1 120 ? 17.023  25.107 8.315  1.00 20.98  ? 179 HIS C NE2   1 
ATOM   6390  H  H     . HIS C 1 120 ? 17.445  20.585 8.791  1.00 0.00   ? 179 HIS C H     1 
ATOM   6391  H  HD1   . HIS C 1 120 ? 19.603  24.704 9.959  1.00 0.00   ? 179 HIS C HD1   1 
ATOM   6392  H  HE2   . HIS C 1 120 ? 16.434  25.662 7.748  1.00 0.00   ? 179 HIS C HE2   1 
ATOM   6393  N  N     . GLN C 1 121 ? 20.746  20.556 11.359 1.00 18.17  ? 180 GLN C N     1 
ATOM   6394  C  CA    . GLN C 1 121 ? 21.356  19.619 12.296 1.00 18.17  ? 180 GLN C CA    1 
ATOM   6395  C  C     . GLN C 1 121 ? 21.628  20.343 13.608 1.00 18.17  ? 180 GLN C C     1 
ATOM   6396  O  O     . GLN C 1 121 ? 21.305  19.856 14.697 1.00 96.86  ? 180 GLN C O     1 
ATOM   6397  C  CB    . GLN C 1 121 ? 22.682  19.107 11.709 1.00 96.86  ? 180 GLN C CB    1 
ATOM   6398  C  CG    . GLN C 1 121 ? 22.870  19.310 10.175 1.00 96.86  ? 180 GLN C CG    1 
ATOM   6399  C  CD    . GLN C 1 121 ? 23.112  20.783 9.736  1.00 96.86  ? 180 GLN C CD    1 
ATOM   6400  O  OE1   . GLN C 1 121 ? 22.861  21.734 10.495 1.00 96.86  ? 180 GLN C OE1   1 
ATOM   6401  N  NE2   . GLN C 1 121 ? 23.591  20.960 8.502  1.00 96.86  ? 180 GLN C NE2   1 
ATOM   6402  H  H     . GLN C 1 121 ? 21.199  21.372 11.097 1.00 0.00   ? 180 GLN C H     1 
ATOM   6403  N  N     . GLN C 1 122 ? 22.252  21.510 13.485 1.00 54.28  ? 181 GLN C N     1 
ATOM   6404  C  CA    . GLN C 1 122 ? 22.569  22.343 14.632 1.00 54.28  ? 181 GLN C CA    1 
ATOM   6405  C  C     . GLN C 1 122 ? 21.375  23.277 14.850 1.00 54.28  ? 181 GLN C C     1 
ATOM   6406  O  O     . GLN C 1 122 ? 21.161  24.226 14.087 1.00 71.92  ? 181 GLN C O     1 
ATOM   6407  C  CB    . GLN C 1 122 ? 23.837  23.140 14.360 1.00 71.92  ? 181 GLN C CB    1 
ATOM   6408  C  CG    . GLN C 1 122 ? 24.980  22.307 13.822 1.00 71.92  ? 181 GLN C CG    1 
ATOM   6409  C  CD    . GLN C 1 122 ? 25.517  22.854 12.504 1.00 71.92  ? 181 GLN C CD    1 
ATOM   6410  O  OE1   . GLN C 1 122 ? 25.748  24.055 12.366 1.00 71.92  ? 181 GLN C OE1   1 
ATOM   6411  N  NE2   . GLN C 1 122 ? 25.720  21.974 11.530 1.00 71.92  ? 181 GLN C NE2   1 
ATOM   6412  H  H     . GLN C 1 122 ? 22.486  21.823 12.585 1.00 0.00   ? 181 GLN C H     1 
ATOM   6413  N  N     . ILE C 1 123 ? 20.590  22.966 15.879 1.00 52.49  ? 182 ILE C N     1 
ATOM   6414  C  CA    . ILE C 1 123 ? 19.388  23.710 16.236 1.00 52.49  ? 182 ILE C CA    1 
ATOM   6415  C  C     . ILE C 1 123 ? 19.461  24.181 17.680 1.00 52.49  ? 182 ILE C C     1 
ATOM   6416  O  O     . ILE C 1 123 ? 20.040  23.497 18.518 1.00 25.90  ? 182 ILE C O     1 
ATOM   6417  C  CB    . ILE C 1 123 ? 18.167  22.803 16.099 1.00 25.90  ? 182 ILE C CB    1 
ATOM   6418  C  CG1   . ILE C 1 123 ? 18.166  22.158 14.700 1.00 25.90  ? 182 ILE C CG1   1 
ATOM   6419  C  CG2   . ILE C 1 123 ? 16.885  23.580 16.401 1.00 25.90  ? 182 ILE C CG2   1 
ATOM   6420  C  CD1   . ILE C 1 123 ? 16.941  21.304 14.379 1.00 25.90  ? 182 ILE C CD1   1 
ATOM   6421  H  H     . ILE C 1 123 ? 20.813  22.192 16.438 1.00 0.00   ? 182 ILE C H     1 
ATOM   6422  N  N     . ALA C 1 124 ? 18.877  25.346 17.955 1.00 43.79  ? 183 ALA C N     1 
ATOM   6423  C  CA    . ALA C 1 124 ? 18.845  25.947 19.297 1.00 43.79  ? 183 ALA C CA    1 
ATOM   6424  C  C     . ALA C 1 124 ? 17.405  26.203 19.739 1.00 43.79  ? 183 ALA C C     1 
ATOM   6425  O  O     . ALA C 1 124 ? 16.536  26.513 18.905 1.00 27.89  ? 183 ALA C O     1 
ATOM   6426  C  CB    . ALA C 1 124 ? 19.637  27.253 19.321 1.00 27.89  ? 183 ALA C CB    1 
ATOM   6427  H  H     . ALA C 1 124 ? 18.426  25.845 17.237 1.00 0.00   ? 183 ALA C H     1 
ATOM   6428  N  N     . LEU C 1 125 ? 17.158  26.076 21.044 1.00 10.38  ? 184 LEU C N     1 
ATOM   6429  C  CA    . LEU C 1 125 ? 15.831  26.274 21.620 1.00 10.38  ? 184 LEU C CA    1 
ATOM   6430  C  C     . LEU C 1 125 ? 15.815  27.541 22.418 1.00 10.38  ? 184 LEU C C     1 
ATOM   6431  O  O     . LEU C 1 125 ? 16.768  27.860 23.096 1.00 22.25  ? 184 LEU C O     1 
ATOM   6432  C  CB    . LEU C 1 125 ? 15.457  25.117 22.542 1.00 22.25  ? 184 LEU C CB    1 
ATOM   6433  C  CG    . LEU C 1 125 ? 15.589  23.686 22.016 1.00 22.25  ? 184 LEU C CG    1 
ATOM   6434  C  CD1   . LEU C 1 125 ? 15.149  22.674 23.052 1.00 22.25  ? 184 LEU C CD1   1 
ATOM   6435  C  CD2   . LEU C 1 125 ? 14.758  23.540 20.777 1.00 22.25  ? 184 LEU C CD2   1 
ATOM   6436  H  H     . LEU C 1 125 ? 17.889  25.871 21.660 1.00 0.00   ? 184 LEU C H     1 
ATOM   6437  N  N     . LEU C 1 126 ? 14.744  28.301 22.270 1.00 10.60  ? 185 LEU C N     1 
ATOM   6438  C  CA    . LEU C 1 126 ? 14.553  29.540 23.006 1.00 10.60  ? 185 LEU C CA    1 
ATOM   6439  C  C     . LEU C 1 126 ? 13.157  29.409 23.572 1.00 10.60  ? 185 LEU C C     1 
ATOM   6440  O  O     . LEU C 1 126 ? 12.166  29.618 22.875 1.00 25.52  ? 185 LEU C O     1 
ATOM   6441  C  CB    . LEU C 1 126 ? 14.654  30.748 22.079 1.00 25.52  ? 185 LEU C CB    1 
ATOM   6442  C  CG    . LEU C 1 126 ? 14.481  32.119 22.737 1.00 25.52  ? 185 LEU C CG    1 
ATOM   6443  C  CD1   . LEU C 1 126 ? 15.611  32.363 23.716 1.00 25.52  ? 185 LEU C CD1   1 
ATOM   6444  C  CD2   . LEU C 1 126 ? 14.468  33.210 21.698 1.00 25.52  ? 185 LEU C CD2   1 
ATOM   6445  H  H     . LEU C 1 126 ? 14.048  28.033 21.626 1.00 0.00   ? 185 LEU C H     1 
ATOM   6446  N  N     . ALA C 1 127 ? 13.093  28.957 24.817 1.00 15.31  ? 186 ALA C N     1 
ATOM   6447  C  CA    . ALA C 1 127 ? 11.831  28.722 25.517 1.00 15.31  ? 186 ALA C CA    1 
ATOM   6448  C  C     . ALA C 1 127 ? 11.222  29.931 26.180 1.00 15.31  ? 186 ALA C C     1 
ATOM   6449  O  O     . ALA C 1 127 ? 11.901  30.933 26.401 1.00 30.35  ? 186 ALA C O     1 
ATOM   6450  C  CB    . ALA C 1 127 ? 12.017  27.625 26.554 1.00 30.35  ? 186 ALA C CB    1 
ATOM   6451  H  H     . ALA C 1 127 ? 13.919  28.774 25.287 1.00 0.00   ? 186 ALA C H     1 
ATOM   6452  N  N     . GLY C 1 128 ? 9.939   29.822 26.515 1.00 13.37  ? 187 GLY C N     1 
ATOM   6453  C  CA    . GLY C 1 128 ? 9.250   30.923 27.190 1.00 13.37  ? 187 GLY C CA    1 
ATOM   6454  C  C     . GLY C 1 128 ? 9.699   30.837 28.642 1.00 13.37  ? 187 GLY C C     1 
ATOM   6455  O  O     . GLY C 1 128 ? 10.554  29.979 28.958 1.00 42.82  ? 187 GLY C O     1 
ATOM   6456  H  H     . GLY C 1 128 ? 9.470   28.972 26.379 1.00 0.00   ? 187 GLY C H     1 
ATOM   6457  N  N     . PRO C 1 129 ? 9.183   31.685 29.554 1.00 2.00   ? 188 PRO C N     1 
ATOM   6458  C  CA    . PRO C 1 129 ? 9.666   31.537 30.924 1.00 2.00   ? 188 PRO C CA    1 
ATOM   6459  C  C     . PRO C 1 129 ? 9.316   30.128 31.437 1.00 2.00   ? 188 PRO C C     1 
ATOM   6460  O  O     . PRO C 1 129 ? 8.181   29.668 31.249 1.00 23.70  ? 188 PRO C O     1 
ATOM   6461  C  CB    . PRO C 1 129 ? 8.906   32.642 31.669 1.00 23.70  ? 188 PRO C CB    1 
ATOM   6462  C  CG    . PRO C 1 129 ? 7.674   32.804 30.905 1.00 23.70  ? 188 PRO C CG    1 
ATOM   6463  C  CD    . PRO C 1 129 ? 8.178   32.756 29.480 1.00 23.70  ? 188 PRO C CD    1 
ATOM   6464  N  N     . LEU C 1 130 ? 10.256  29.433 32.087 1.00 22.54  ? 189 LEU C N     1 
ATOM   6465  C  CA    . LEU C 1 130 ? 9.947   28.101 32.574 1.00 22.54  ? 189 LEU C CA    1 
ATOM   6466  C  C     . LEU C 1 130 ? 8.919   28.069 33.680 1.00 22.54  ? 189 LEU C C     1 
ATOM   6467  O  O     . LEU C 1 130 ? 8.615   27.008 34.216 1.00 25.94  ? 189 LEU C O     1 
ATOM   6468  C  CB    . LEU C 1 130 ? 11.193  27.349 32.987 1.00 25.94  ? 189 LEU C CB    1 
ATOM   6469  C  CG    . LEU C 1 130 ? 12.067  26.901 31.821 1.00 25.94  ? 189 LEU C CG    1 
ATOM   6470  C  CD1   . LEU C 1 130 ? 12.805  25.660 32.264 1.00 25.94  ? 189 LEU C CD1   1 
ATOM   6471  C  CD2   . LEU C 1 130 ? 11.252  26.623 30.554 1.00 25.94  ? 189 LEU C CD2   1 
ATOM   6472  H  H     . LEU C 1 130 ? 11.153  29.758 32.196 1.00 0.00   ? 189 LEU C H     1 
ATOM   6473  N  N     . SER C 1 131 ? 8.378   29.227 34.029 1.00 26.96  ? 190 SER C N     1 
ATOM   6474  C  CA    . SER C 1 131 ? 7.343   29.279 35.049 1.00 26.96  ? 190 SER C CA    1 
ATOM   6475  C  C     . SER C 1 131 ? 6.003   28.874 34.418 1.00 26.96  ? 190 SER C C     1 
ATOM   6476  O  O     . SER C 1 131 ? 5.094   28.318 35.077 1.00 26.44  ? 190 SER C O     1 
ATOM   6477  C  CB    . SER C 1 131 ? 7.261   30.700 35.644 1.00 26.44  ? 190 SER C CB    1 
ATOM   6478  O  OG    . SER C 1 131 ? 6.673   31.649 34.768 1.00 26.44  ? 190 SER C OG    1 
ATOM   6479  H  H     . SER C 1 131 ? 8.637   30.076 33.631 1.00 0.00   ? 190 SER C H     1 
ATOM   6480  H  HG    . SER C 1 131 ? 6.530   32.474 35.243 1.00 30.00  ? 190 SER C HG    1 
ATOM   6481  N  N     . SER C 1 132 ? 5.912   29.105 33.110 1.00 24.89  ? 191 SER C N     1 
ATOM   6482  C  CA    . SER C 1 132 ? 4.702   28.804 32.380 1.00 24.89  ? 191 SER C CA    1 
ATOM   6483  C  C     . SER C 1 132 ? 4.590   27.354 31.992 1.00 24.89  ? 191 SER C C     1 
ATOM   6484  O  O     . SER C 1 132 ? 5.556   26.741 31.549 1.00 24.32  ? 191 SER C O     1 
ATOM   6485  C  CB    . SER C 1 132 ? 4.597   29.680 31.150 1.00 24.32  ? 191 SER C CB    1 
ATOM   6486  O  OG    . SER C 1 132 ? 3.360   29.445 30.513 1.00 24.32  ? 191 SER C OG    1 
ATOM   6487  H  H     . SER C 1 132 ? 6.680   29.449 32.613 1.00 0.00   ? 191 SER C H     1 
ATOM   6488  H  HG    . SER C 1 132 ? 3.209   30.187 29.913 1.00 30.00  ? 191 SER C HG    1 
ATOM   6489  N  N     . VAL C 1 133 ? 3.381   26.832 32.150 1.00 32.91  ? 192 VAL C N     1 
ATOM   6490  C  CA    . VAL C 1 133 ? 3.063   25.452 31.824 1.00 32.91  ? 192 VAL C CA    1 
ATOM   6491  C  C     . VAL C 1 133 ? 3.404   25.246 30.363 1.00 32.91  ? 192 VAL C C     1 
ATOM   6492  O  O     . VAL C 1 133 ? 4.294   24.467 30.022 1.00 28.49  ? 192 VAL C O     1 
ATOM   6493  C  CB    . VAL C 1 133 ? 1.548   25.164 31.937 1.00 28.49  ? 192 VAL C CB    1 
ATOM   6494  C  CG1   . VAL C 1 133 ? 1.313   23.738 32.389 1.00 28.49  ? 192 VAL C CG1   1 
ATOM   6495  C  CG2   . VAL C 1 133 ? 0.833   26.199 32.807 1.00 28.49  ? 192 VAL C CG2   1 
ATOM   6496  H  H     . VAL C 1 133 ? 2.725   27.460 32.503 1.00 0.00   ? 192 VAL C H     1 
ATOM   6497  N  N     . SER C 1 134 ? 2.695   25.989 29.512 1.00 16.14  ? 193 SER C N     1 
ATOM   6498  C  CA    . SER C 1 134 ? 2.849   25.934 28.065 1.00 16.14  ? 193 SER C CA    1 
ATOM   6499  C  C     . SER C 1 134 ? 4.294   25.936 27.587 1.00 16.14  ? 193 SER C C     1 
ATOM   6500  O  O     . SER C 1 134 ? 4.710   25.053 26.844 1.00 22.83  ? 193 SER C O     1 
ATOM   6501  C  CB    . SER C 1 134 ? 2.047   27.074 27.455 1.00 22.83  ? 193 SER C CB    1 
ATOM   6502  O  OG    . SER C 1 134 ? 0.693   27.029 27.929 1.00 22.83  ? 193 SER C OG    1 
ATOM   6503  H  H     . SER C 1 134 ? 2.008   26.599 29.848 1.00 0.00   ? 193 SER C H     1 
ATOM   6504  H  HG    . SER C 1 134 ? 0.158   27.745 27.581 1.00 30.00  ? 193 SER C HG    1 
ATOM   6505  N  N     . ALA C 1 135 ? 5.074   26.873 28.093 1.00 11.80  ? 194 ALA C N     1 
ATOM   6506  C  CA    . ALA C 1 135 ? 6.473   26.984 27.734 1.00 11.80  ? 194 ALA C CA    1 
ATOM   6507  C  C     . ALA C 1 135 ? 7.175   25.661 27.929 1.00 11.80  ? 194 ALA C C     1 
ATOM   6508  O  O     . ALA C 1 135 ? 7.772   25.132 26.984 1.00 40.56  ? 194 ALA C O     1 
ATOM   6509  C  CB    . ALA C 1 135 ? 7.148   28.029 28.580 1.00 40.56  ? 194 ALA C CB    1 
ATOM   6510  H  H     . ALA C 1 135 ? 4.702   27.478 28.764 1.00 0.00   ? 194 ALA C H     1 
ATOM   6511  N  N     . ARG C 1 136 ? 7.121   25.142 29.159 1.00 22.57  ? 195 ARG C N     1 
ATOM   6512  C  CA    . ARG C 1 136 ? 7.751   23.862 29.531 1.00 22.57  ? 195 ARG C CA    1 
ATOM   6513  C  C     . ARG C 1 136 ? 7.221   22.702 28.672 1.00 22.57  ? 195 ARG C C     1 
ATOM   6514  O  O     . ARG C 1 136 ? 7.966   21.839 28.242 1.00 31.06  ? 195 ARG C O     1 
ATOM   6515  C  CB    . ARG C 1 136 ? 7.505   23.568 31.019 1.00 31.06  ? 195 ARG C CB    1 
ATOM   6516  C  CG    . ARG C 1 136 ? 7.686   24.772 31.986 1.00 31.06  ? 195 ARG C CG    1 
ATOM   6517  C  CD    . ARG C 1 136 ? 7.724   24.379 33.485 1.00 31.06  ? 195 ARG C CD    1 
ATOM   6518  N  NE    . ARG C 1 136 ? 6.920   23.186 33.733 1.00 31.06  ? 195 ARG C NE    1 
ATOM   6519  C  CZ    . ARG C 1 136 ? 5.707   23.171 34.278 1.00 31.06  ? 195 ARG C CZ    1 
ATOM   6520  N  NH1   . ARG C 1 136 ? 5.124   24.297 34.673 1.00 31.06  ? 195 ARG C NH1   1 
ATOM   6521  N  NH2   . ARG C 1 136 ? 5.048   22.016 34.342 1.00 31.06  ? 195 ARG C NH2   1 
ATOM   6522  H  H     . ARG C 1 136 ? 6.622   25.631 29.851 1.00 0.00   ? 195 ARG C H     1 
ATOM   6523  H  HE    . ARG C 1 136 ? 7.310   22.319 33.494 1.00 0.00   ? 195 ARG C HE    1 
ATOM   6524  H  HH11  . ARG C 1 136 ? 5.587   25.175 34.569 1.00 0.00   ? 195 ARG C HH11  1 
ATOM   6525  H  HH12  . ARG C 1 136 ? 4.209   24.255 35.075 1.00 0.00   ? 195 ARG C HH12  1 
ATOM   6526  H  HH21  . ARG C 1 136 ? 5.472   21.185 33.980 1.00 0.00   ? 195 ARG C HH21  1 
ATOM   6527  H  HH22  . ARG C 1 136 ? 4.134   21.972 34.744 1.00 0.00   ? 195 ARG C HH22  1 
ATOM   6528  N  N     . LEU C 1 137 ? 5.925   22.726 28.406 1.00 17.15  ? 196 LEU C N     1 
ATOM   6529  C  CA    . LEU C 1 137 ? 5.236   21.731 27.594 1.00 17.15  ? 196 LEU C CA    1 
ATOM   6530  C  C     . LEU C 1 137 ? 5.761   21.745 26.158 1.00 17.15  ? 196 LEU C C     1 
ATOM   6531  O  O     . LEU C 1 137 ? 5.747   20.699 25.485 1.00 21.49  ? 196 LEU C O     1 
ATOM   6532  C  CB    . LEU C 1 137 ? 3.728   22.020 27.581 1.00 21.49  ? 196 LEU C CB    1 
ATOM   6533  C  CG    . LEU C 1 137 ? 2.756   21.636 28.713 1.00 21.49  ? 196 LEU C CG    1 
ATOM   6534  C  CD1   . LEU C 1 137 ? 1.369   22.275 28.472 1.00 21.49  ? 196 LEU C CD1   1 
ATOM   6535  C  CD2   . LEU C 1 137 ? 2.614   20.115 28.781 1.00 21.49  ? 196 LEU C CD2   1 
ATOM   6536  H  H     . LEU C 1 137 ? 5.399   23.464 28.778 1.00 0.00   ? 196 LEU C H     1 
ATOM   6537  N  N     . ARG C 1 138 ? 6.150   22.941 25.680 1.00 15.81  ? 197 ARG C N     1 
ATOM   6538  C  CA    . ARG C 1 138 ? 6.720   23.156 24.323 1.00 15.81  ? 197 ARG C CA    1 
ATOM   6539  C  C     . ARG C 1 138 ? 8.201   22.786 24.330 1.00 15.81  ? 197 ARG C C     1 
ATOM   6540  O  O     . ARG C 1 138 ? 8.730   22.165 23.407 1.00 23.27  ? 197 ARG C O     1 
ATOM   6541  C  CB    . ARG C 1 138 ? 6.558   24.615 23.874 1.00 23.27  ? 197 ARG C CB    1 
ATOM   6542  C  CG    . ARG C 1 138 ? 5.115   25.010 23.652 1.00 23.27  ? 197 ARG C CG    1 
ATOM   6543  C  CD    . ARG C 1 138 ? 4.917   26.497 23.409 1.00 23.27  ? 197 ARG C CD    1 
ATOM   6544  N  NE    . ARG C 1 138 ? 3.489   26.829 23.485 1.00 23.27  ? 197 ARG C NE    1 
ATOM   6545  C  CZ    . ARG C 1 138 ? 2.988   28.061 23.413 1.00 23.27  ? 197 ARG C CZ    1 
ATOM   6546  N  NH1   . ARG C 1 138 ? 3.794   29.090 23.262 1.00 23.27  ? 197 ARG C NH1   1 
ATOM   6547  N  NH2   . ARG C 1 138 ? 1.679   28.268 23.482 1.00 23.27  ? 197 ARG C NH2   1 
ATOM   6548  H  H     . ARG C 1 138 ? 6.045   23.714 26.276 1.00 0.00   ? 197 ARG C H     1 
ATOM   6549  H  HE    . ARG C 1 138 ? 2.851   26.089 23.594 1.00 0.00   ? 197 ARG C HE    1 
ATOM   6550  H  HH11  . ARG C 1 138 ? 4.780   28.949 23.197 1.00 0.00   ? 197 ARG C HH11  1 
ATOM   6551  H  HH12  . ARG C 1 138 ? 3.416   30.013 23.211 1.00 0.00   ? 197 ARG C HH12  1 
ATOM   6552  H  HH21  . ARG C 1 138 ? 1.062   27.487 23.593 1.00 0.00   ? 197 ARG C HH21  1 
ATOM   6553  H  HH22  . ARG C 1 138 ? 1.301   29.193 23.434 1.00 0.00   ? 197 ARG C HH22  1 
ATOM   6554  N  N     . LEU C 1 139 ? 8.894   23.178 25.371 1.00 2.00   ? 198 LEU C N     1 
ATOM   6555  C  CA    . LEU C 1 139 ? 10.305  22.827 25.459 1.00 2.00   ? 198 LEU C CA    1 
ATOM   6556  C  C     . LEU C 1 139 ? 10.433  21.280 25.441 1.00 2.00   ? 198 LEU C C     1 
ATOM   6557  O  O     . LEU C 1 139 ? 11.418  20.716 24.922 1.00 24.12  ? 198 LEU C O     1 
ATOM   6558  C  CB    . LEU C 1 139 ? 10.902  23.403 26.757 1.00 24.12  ? 198 LEU C CB    1 
ATOM   6559  C  CG    . LEU C 1 139 ? 12.390  23.778 26.747 1.00 24.12  ? 198 LEU C CG    1 
ATOM   6560  C  CD1   . LEU C 1 139 ? 13.135  23.038 27.834 1.00 24.12  ? 198 LEU C CD1   1 
ATOM   6561  C  CD2   . LEU C 1 139 ? 12.999  23.534 25.356 1.00 24.12  ? 198 LEU C CD2   1 
ATOM   6562  H  H     . LEU C 1 139 ? 8.473   23.686 26.089 1.00 0.00   ? 198 LEU C H     1 
ATOM   6563  N  N     . ALA C 1 140 ? 9.439   20.618 26.045 1.00 29.77  ? 199 ALA C N     1 
ATOM   6564  C  CA    . ALA C 1 140 ? 9.389   19.161 26.124 1.00 29.77  ? 199 ALA C CA    1 
ATOM   6565  C  C     . ALA C 1 140 ? 9.196   18.607 24.706 1.00 29.77  ? 199 ALA C C     1 
ATOM   6566  O  O     . ALA C 1 140 ? 9.946   17.727 24.266 1.00 60.02  ? 199 ALA C O     1 
ATOM   6567  C  CB    . ALA C 1 140 ? 8.248   18.728 27.015 1.00 60.02  ? 199 ALA C CB    1 
ATOM   6568  H  H     . ALA C 1 140 ? 8.734   21.136 26.488 1.00 0.00   ? 199 ALA C H     1 
ATOM   6569  N  N     . GLY C 1 141 ? 8.182   19.116 24.007 1.00 40.65  ? 200 GLY C N     1 
ATOM   6570  C  CA    . GLY C 1 141 ? 7.919   18.689 22.643 1.00 40.65  ? 200 GLY C CA    1 
ATOM   6571  C  C     . GLY C 1 141 ? 9.191   18.762 21.827 1.00 40.65  ? 200 GLY C C     1 
ATOM   6572  O  O     . GLY C 1 141 ? 9.639   17.735 21.336 1.00 19.32  ? 200 GLY C O     1 
ATOM   6573  H  H     . GLY C 1 141 ? 7.585   19.772 24.421 1.00 0.00   ? 200 GLY C H     1 
ATOM   6574  N  N     . TRP C 1 142 ? 9.834   19.930 21.775 1.00 26.39  ? 201 TRP C N     1 
ATOM   6575  C  CA    . TRP C 1 142 ? 11.077  20.080 21.001 1.00 26.39  ? 201 TRP C CA    1 
ATOM   6576  C  C     . TRP C 1 142 ? 12.137  19.055 21.390 1.00 26.39  ? 201 TRP C C     1 
ATOM   6577  O  O     . TRP C 1 142 ? 13.042  18.772 20.605 1.00 16.96  ? 201 TRP C O     1 
ATOM   6578  C  CB    . TRP C 1 142 ? 11.689  21.467 21.131 1.00 16.96  ? 201 TRP C CB    1 
ATOM   6579  C  CG    . TRP C 1 142 ? 10.830  22.559 20.698 1.00 16.96  ? 201 TRP C CG    1 
ATOM   6580  C  CD1   . TRP C 1 142 ? 9.858   22.511 19.752 1.00 16.96  ? 201 TRP C CD1   1 
ATOM   6581  C  CD2   . TRP C 1 142 ? 10.793  23.873 21.247 1.00 16.96  ? 201 TRP C CD2   1 
ATOM   6582  N  NE1   . TRP C 1 142 ? 9.198   23.714 19.685 1.00 16.96  ? 201 TRP C NE1   1 
ATOM   6583  C  CE2   . TRP C 1 142 ? 9.753   24.568 20.601 1.00 16.96  ? 201 TRP C CE2   1 
ATOM   6584  C  CE3   . TRP C 1 142 ? 11.535  24.535 22.233 1.00 16.96  ? 201 TRP C CE3   1 
ATOM   6585  C  CZ2   . TRP C 1 142 ? 9.432   25.891 20.915 1.00 16.96  ? 201 TRP C CZ2   1 
ATOM   6586  C  CZ3   . TRP C 1 142 ? 11.213  25.848 22.540 1.00 16.96  ? 201 TRP C CZ3   1 
ATOM   6587  C  CH2   . TRP C 1 142 ? 10.171  26.509 21.885 1.00 16.96  ? 201 TRP C CH2   1 
ATOM   6588  H  H     . TRP C 1 142 ? 9.459   20.701 22.253 1.00 0.00   ? 201 TRP C H     1 
ATOM   6589  H  HE1   . TRP C 1 142 ? 8.456   23.935 19.081 1.00 0.00   ? 201 TRP C HE1   1 
ATOM   6590  N  N     . HIS C 1 143 ? 12.084  18.554 22.622 1.00 27.99  ? 202 HIS C N     1 
ATOM   6591  C  CA    . HIS C 1 143 ? 13.030  17.522 23.071 1.00 27.99  ? 202 HIS C CA    1 
ATOM   6592  C  C     . HIS C 1 143 ? 12.601  16.088 22.668 1.00 27.99  ? 202 HIS C C     1 
ATOM   6593  O  O     . HIS C 1 143 ? 13.440  15.254 22.328 1.00 25.43  ? 202 HIS C O     1 
ATOM   6594  C  CB    . HIS C 1 143 ? 13.238  17.610 24.578 1.00 25.43  ? 202 HIS C CB    1 
ATOM   6595  C  CG    . HIS C 1 143 ? 14.360  18.511 24.974 1.00 25.43  ? 202 HIS C CG    1 
ATOM   6596  N  ND1   . HIS C 1 143 ? 14.166  19.668 25.694 1.00 25.43  ? 202 HIS C ND1   1 
ATOM   6597  C  CD2   . HIS C 1 143 ? 15.694  18.408 24.779 1.00 25.43  ? 202 HIS C CD2   1 
ATOM   6598  C  CE1   . HIS C 1 143 ? 15.332  20.236 25.935 1.00 25.43  ? 202 HIS C CE1   1 
ATOM   6599  N  NE2   . HIS C 1 143 ? 16.276  19.492 25.389 1.00 25.43  ? 202 HIS C NE2   1 
ATOM   6600  H  H     . HIS C 1 143 ? 11.393  18.876 23.236 1.00 0.00   ? 202 HIS C H     1 
ATOM   6601  H  HD1   . HIS C 1 143 ? 13.293  20.052 25.954 1.00 0.00   ? 202 HIS C HD1   1 
ATOM   6602  H  HE2   . HIS C 1 143 ? 17.243  19.674 25.401 1.00 0.00   ? 202 HIS C HE2   1 
ATOM   6603  N  N     . LYS C 1 144 ? 11.301  15.811 22.718 1.00 23.65  ? 203 LYS C N     1 
ATOM   6604  C  CA    . LYS C 1 144 ? 10.773  14.507 22.338 1.00 23.65  ? 203 LYS C CA    1 
ATOM   6605  C  C     . LYS C 1 144 ? 10.992  14.260 20.855 1.00 23.65  ? 203 LYS C C     1 
ATOM   6606  O  O     . LYS C 1 144 ? 11.471  13.200 20.454 1.00 30.11  ? 203 LYS C O     1 
ATOM   6607  C  CB    . LYS C 1 144 ? 9.277   14.441 22.632 1.00 30.11  ? 203 LYS C CB    1 
ATOM   6608  C  CG    . LYS C 1 144 ? 8.610   13.146 22.184 1.00 30.11  ? 203 LYS C CG    1 
ATOM   6609  C  CD    . LYS C 1 144 ? 7.175   13.049 22.637 1.00 30.11  ? 203 LYS C CD    1 
ATOM   6610  C  CE    . LYS C 1 144 ? 6.625   11.788 22.097 1.00 30.11  ? 203 LYS C CE    1 
ATOM   6611  N  NZ    . LYS C 1 144 ? 5.219   11.604 22.472 1.00 30.11  ? 203 LYS C NZ    1 
ATOM   6612  H  H     . LYS C 1 144 ? 10.674  16.516 22.989 1.00 0.00   ? 203 LYS C H     1 
ATOM   6613  H  HZ1   . LYS C 1 144 ? 5.142   11.571 23.507 1.00 0.00   ? 203 LYS C HZ1   1 
ATOM   6614  H  HZ2   . LYS C 1 144 ? 4.634   12.369 22.086 1.00 0.00   ? 203 LYS C HZ2   1 
ATOM   6615  H  HZ3   . LYS C 1 144 ? 4.905   10.692 22.079 1.00 0.00   ? 203 LYS C HZ3   1 
ATOM   6616  N  N     . TYR C 1 145 ? 10.617  15.229 20.032 1.00 18.64  ? 204 TYR C N     1 
ATOM   6617  C  CA    . TYR C 1 145 ? 10.797  15.082 18.616 1.00 18.64  ? 204 TYR C CA    1 
ATOM   6618  C  C     . TYR C 1 145 ? 12.233  15.316 18.141 1.00 18.64  ? 204 TYR C C     1 
ATOM   6619  O  O     . TYR C 1 145 ? 12.683  14.657 17.212 1.00 19.01  ? 204 TYR C O     1 
ATOM   6620  C  CB    . TYR C 1 145 ? 9.796   15.935 17.887 1.00 19.01  ? 204 TYR C CB    1 
ATOM   6621  C  CG    . TYR C 1 145 ? 8.375   15.538 18.230 1.00 19.01  ? 204 TYR C CG    1 
ATOM   6622  C  CD1   . TYR C 1 145 ? 7.730   16.081 19.344 1.00 19.01  ? 204 TYR C CD1   1 
ATOM   6623  C  CD2   . TYR C 1 145 ? 7.686   14.558 17.492 1.00 19.01  ? 204 TYR C CD2   1 
ATOM   6624  C  CE1   . TYR C 1 145 ? 6.439   15.664 19.730 1.00 19.01  ? 204 TYR C CE1   1 
ATOM   6625  C  CE2   . TYR C 1 145 ? 6.389   14.136 17.886 1.00 19.01  ? 204 TYR C CE2   1 
ATOM   6626  C  CZ    . TYR C 1 145 ? 5.790   14.701 19.004 1.00 19.01  ? 204 TYR C CZ    1 
ATOM   6627  O  OH    . TYR C 1 145 ? 4.532   14.311 19.405 1.00 19.01  ? 204 TYR C OH    1 
ATOM   6628  H  H     . TYR C 1 145 ? 10.221  16.049 20.405 1.00 0.00   ? 204 TYR C H     1 
ATOM   6629  H  HH    . TYR C 1 145 ? 4.203   13.630 18.822 1.00 0.00   ? 204 TYR C HH    1 
ATOM   6630  N  N     . LEU C 1 146 ? 12.995  16.208 18.759 1.00 15.07  ? 205 LEU C N     1 
ATOM   6631  C  CA    . LEU C 1 146 ? 14.368  16.373 18.291 1.00 15.07  ? 205 LEU C CA    1 
ATOM   6632  C  C     . LEU C 1 146 ? 15.107  15.038 18.429 1.00 15.07  ? 205 LEU C C     1 
ATOM   6633  O  O     . LEU C 1 146 ? 15.548  14.467 17.430 1.00 33.25  ? 205 LEU C O     1 
ATOM   6634  C  CB    . LEU C 1 146 ? 15.103  17.483 19.040 1.00 33.25  ? 205 LEU C CB    1 
ATOM   6635  C  CG    . LEU C 1 146 ? 15.018  18.877 18.429 1.00 33.25  ? 205 LEU C CG    1 
ATOM   6636  C  CD1   . LEU C 1 146 ? 15.818  19.834 19.265 1.00 33.25  ? 205 LEU C CD1   1 
ATOM   6637  C  CD2   . LEU C 1 146 ? 15.557  18.865 17.032 1.00 33.25  ? 205 LEU C CD2   1 
ATOM   6638  H  H     . LEU C 1 146 ? 12.664  16.786 19.480 1.00 0.00   ? 205 LEU C H     1 
ATOM   6639  N  N     . THR C 1 147 ? 15.163  14.498 19.645 1.00 27.96  ? 206 THR C N     1 
ATOM   6640  C  CA    . THR C 1 147 ? 15.836  13.226 19.888 1.00 27.96  ? 206 THR C CA    1 
ATOM   6641  C  C     . THR C 1 147 ? 15.211  12.091 19.055 1.00 27.96  ? 206 THR C C     1 
ATOM   6642  O  O     . THR C 1 147 ? 15.908  11.164 18.631 1.00 42.70  ? 206 THR C O     1 
ATOM   6643  C  CB    . THR C 1 147 ? 15.868  12.873 21.390 1.00 42.70  ? 206 THR C CB    1 
ATOM   6644  O  OG1   . THR C 1 147 ? 14.540  12.604 21.852 1.00 42.70  ? 206 THR C OG1   1 
ATOM   6645  C  CG2   . THR C 1 147 ? 16.424  14.040 22.185 1.00 42.70  ? 206 THR C CG2   1 
ATOM   6646  H  H     . THR C 1 147 ? 14.779  14.982 20.405 1.00 0.00   ? 206 THR C H     1 
ATOM   6647  H  HG1   . THR C 1 147 ? 14.016  13.414 21.930 1.00 30.00  ? 206 THR C HG1   1 
ATOM   6648  N  N     . ARG C 1 148 ? 13.902  12.155 18.821 1.00 33.99  ? 207 ARG C N     1 
ATOM   6649  C  CA    . ARG C 1 148 ? 13.250  11.153 17.967 1.00 33.99  ? 207 ARG C CA    1 
ATOM   6650  C  C     . ARG C 1 148 ? 13.957  11.154 16.599 1.00 33.99  ? 207 ARG C C     1 
ATOM   6651  O  O     . ARG C 1 148 ? 14.280  10.109 16.046 1.00 35.57  ? 207 ARG C O     1 
ATOM   6652  C  CB    . ARG C 1 148 ? 11.773  11.468 17.778 1.00 35.57  ? 207 ARG C CB    1 
ATOM   6653  C  CG    . ARG C 1 148 ? 10.882  10.729 18.722 1.00 35.57  ? 207 ARG C CG    1 
ATOM   6654  C  CD    . ARG C 1 148 ? 9.488   10.610 18.140 1.00 35.57  ? 207 ARG C CD    1 
ATOM   6655  N  NE    . ARG C 1 148 ? 8.540   10.049 19.100 1.00 35.57  ? 207 ARG C NE    1 
ATOM   6656  C  CZ    . ARG C 1 148 ? 7.236   9.897  18.868 1.00 35.57  ? 207 ARG C CZ    1 
ATOM   6657  N  NH1   . ARG C 1 148 ? 6.710   10.267 17.697 1.00 35.57  ? 207 ARG C NH1   1 
ATOM   6658  N  NH2   . ARG C 1 148 ? 6.457   9.365  19.808 1.00 35.57  ? 207 ARG C NH2   1 
ATOM   6659  H  H     . ARG C 1 148 ? 13.373  12.851 19.268 1.00 0.00   ? 207 ARG C H     1 
ATOM   6660  H  HE    . ARG C 1 148 ? 8.887   9.758  19.970 1.00 0.00   ? 207 ARG C HE    1 
ATOM   6661  H  HH11  . ARG C 1 148 ? 7.285   10.674 16.987 1.00 0.00   ? 207 ARG C HH11  1 
ATOM   6662  H  HH12  . ARG C 1 148 ? 5.731   10.152 17.538 1.00 0.00   ? 207 ARG C HH12  1 
ATOM   6663  H  HH21  . ARG C 1 148 ? 6.852   9.078  20.681 1.00 0.00   ? 207 ARG C HH21  1 
ATOM   6664  H  HH22  . ARG C 1 148 ? 5.479   9.243  19.631 1.00 0.00   ? 207 ARG C HH22  1 
ATOM   6665  N  N     . ASN C 1 149 ? 14.240  12.346 16.084 1.00 27.16  ? 208 ASN C N     1 
ATOM   6666  C  CA    . ASN C 1 149 ? 14.932  12.500 14.812 1.00 27.16  ? 208 ASN C CA    1 
ATOM   6667  C  C     . ASN C 1 149 ? 16.412  12.541 15.172 1.00 27.16  ? 208 ASN C C     1 
ATOM   6668  O  O     . ASN C 1 149 ? 17.227  13.107 14.460 1.00 36.88  ? 208 ASN C O     1 
ATOM   6669  C  CB    . ASN C 1 149 ? 14.508  13.794 14.117 1.00 36.88  ? 208 ASN C CB    1 
ATOM   6670  C  CG    . ASN C 1 149 ? 13.004  13.851 13.837 1.00 36.88  ? 208 ASN C CG    1 
ATOM   6671  O  OD1   . ASN C 1 149 ? 12.585  14.022 12.691 1.00 36.88  ? 208 ASN C OD1   1 
ATOM   6672  N  ND2   . ASN C 1 149 ? 12.185  13.728 14.881 1.00 36.88  ? 208 ASN C ND2   1 
ATOM   6673  H  H     . ASN C 1 149 ? 14.023  13.160 16.585 1.00 0.00   ? 208 ASN C H     1 
ATOM   6674  H  HD21  . ASN C 1 149 ? 11.229  13.787 14.688 1.00 0.00   ? 208 ASN C HD21  1 
ATOM   6675  H  HD22  . ASN C 1 149 ? 12.560  13.596 15.762 1.00 0.00   ? 208 ASN C HD22  1 
ATOM   6676  N  N     . GLN C 1 150 ? 16.740  11.954 16.313 1.00 25.01  ? 209 GLN C N     1 
ATOM   6677  C  CA    . GLN C 1 150 ? 18.105  11.867 16.815 1.00 25.01  ? 209 GLN C CA    1 
ATOM   6678  C  C     . GLN C 1 150 ? 18.882  13.155 16.983 1.00 25.01  ? 209 GLN C C     1 
ATOM   6679  O  O     . GLN C 1 150 ? 20.109  13.130 17.155 1.00 78.13  ? 209 GLN C O     1 
ATOM   6680  C  CB    . GLN C 1 150 ? 18.905  10.859 15.991 1.00 78.13  ? 209 GLN C CB    1 
ATOM   6681  C  CG    . GLN C 1 150 ? 18.485  9.424  16.241 1.00 78.13  ? 209 GLN C CG    1 
ATOM   6682  C  CD    . GLN C 1 150 ? 18.715  8.541  15.047 1.00 78.13  ? 209 GLN C CD    1 
ATOM   6683  O  OE1   . GLN C 1 150 ? 19.765  7.910  14.918 1.00 78.13  ? 209 GLN C OE1   1 
ATOM   6684  N  NE2   . GLN C 1 150 ? 17.733  8.495  14.152 1.00 78.13  ? 209 GLN C NE2   1 
ATOM   6685  H  H     . GLN C 1 150 ? 16.077  11.488 16.830 1.00 0.00   ? 209 GLN C H     1 
ATOM   6686  N  N     . ILE C 1 151 ? 18.176  14.275 17.027 1.00 51.55  ? 210 ILE C N     1 
ATOM   6687  C  CA    . ILE C 1 151 ? 18.864  15.548 17.178 1.00 51.55  ? 210 ILE C CA    1 
ATOM   6688  C  C     . ILE C 1 151 ? 18.913  16.068 18.608 1.00 51.55  ? 210 ILE C C     1 
ATOM   6689  O  O     . ILE C 1 151 ? 17.951  15.921 19.385 1.00 31.17  ? 210 ILE C O     1 
ATOM   6690  C  CB    . ILE C 1 151 ? 18.322  16.661 16.212 1.00 31.17  ? 210 ILE C CB    1 
ATOM   6691  C  CG1   . ILE C 1 151 ? 18.407  16.193 14.760 1.00 31.17  ? 210 ILE C CG1   1 
ATOM   6692  C  CG2   . ILE C 1 151 ? 19.198  17.918 16.318 1.00 31.17  ? 210 ILE C CG2   1 
ATOM   6693  C  CD1   . ILE C 1 151 ? 18.141  17.268 13.760 1.00 31.17  ? 210 ILE C CD1   1 
ATOM   6694  H  H     . ILE C 1 151 ? 17.224  14.231 16.915 1.00 0.00   ? 210 ILE C H     1 
ATOM   6695  N  N     . GLN C 1 152 ? 20.065  16.648 18.945 1.00 28.81  ? 211 GLN C N     1 
ATOM   6696  C  CA    . GLN C 1 152 ? 20.294  17.229 20.255 1.00 28.81  ? 211 GLN C CA    1 
ATOM   6697  C  C     . GLN C 1 152 ? 20.532  18.727 20.113 1.00 28.81  ? 211 GLN C C     1 
ATOM   6698  O  O     . GLN C 1 152 ? 21.391  19.164 19.337 1.00 101.75 ? 211 GLN C O     1 
ATOM   6699  C  CB    . GLN C 1 152 ? 21.488  16.564 20.942 1.00 101.75 ? 211 GLN C CB    1 
ATOM   6700  C  CG    . GLN C 1 152 ? 21.243  15.115 21.333 1.00 101.75 ? 211 GLN C CG    1 
ATOM   6701  C  CD    . GLN C 1 152 ? 20.005  14.931 22.209 1.00 101.75 ? 211 GLN C CD    1 
ATOM   6702  O  OE1   . GLN C 1 152 ? 19.489  15.881 22.815 1.00 101.75 ? 211 GLN C OE1   1 
ATOM   6703  N  NE2   . GLN C 1 152 ? 19.520  13.697 22.272 1.00 101.75 ? 211 GLN C NE2   1 
ATOM   6704  H  H     . GLN C 1 152 ? 20.781  16.727 18.281 1.00 0.00   ? 211 GLN C H     1 
ATOM   6705  N  N     . PRO C 1 153 ? 19.718  19.536 20.810 1.00 30.45  ? 212 PRO C N     1 
ATOM   6706  C  CA    . PRO C 1 153 ? 19.860  20.984 20.747 1.00 30.45  ? 212 PRO C CA    1 
ATOM   6707  C  C     . PRO C 1 153 ? 21.224  21.416 21.250 1.00 30.45  ? 212 PRO C C     1 
ATOM   6708  O  O     . PRO C 1 153 ? 21.646  21.027 22.345 1.00 47.44  ? 212 PRO C O     1 
ATOM   6709  C  CB    . PRO C 1 153 ? 18.710  21.478 21.644 1.00 47.44  ? 212 PRO C CB    1 
ATOM   6710  C  CG    . PRO C 1 153 ? 18.445  20.340 22.573 1.00 47.44  ? 212 PRO C CG    1 
ATOM   6711  C  CD    . PRO C 1 153 ? 18.563  19.163 21.650 1.00 47.44  ? 212 PRO C CD    1 
ATOM   6712  N  N     . ILE C 1 154 ? 21.923  22.204 20.438 1.00 24.19  ? 213 ILE C N     1 
ATOM   6713  C  CA    . ILE C 1 154 ? 23.256  22.681 20.812 1.00 24.19  ? 213 ILE C CA    1 
ATOM   6714  C  C     . ILE C 1 154 ? 23.178  23.784 21.870 1.00 24.19  ? 213 ILE C C     1 
ATOM   6715  O  O     . ILE C 1 154 ? 24.120  24.003 22.633 1.00 38.80  ? 213 ILE C O     1 
ATOM   6716  C  CB    . ILE C 1 154 ? 24.072  23.164 19.568 1.00 38.80  ? 213 ILE C CB    1 
ATOM   6717  C  CG1   . ILE C 1 154 ? 23.331  24.255 18.811 1.00 38.80  ? 213 ILE C CG1   1 
ATOM   6718  C  CG2   . ILE C 1 154 ? 24.310  22.010 18.607 1.00 38.80  ? 213 ILE C CG2   1 
ATOM   6719  C  CD1   . ILE C 1 154 ? 24.129  24.820 17.674 1.00 38.80  ? 213 ILE C CD1   1 
ATOM   6720  H  H     . ILE C 1 154 ? 21.514  22.463 19.589 1.00 0.00   ? 213 ILE C H     1 
ATOM   6721  N  N     . ALA C 1 155 ? 22.032  24.449 21.936 1.00 17.96  ? 214 ALA C N     1 
ATOM   6722  C  CA    . ALA C 1 155 ? 21.827  25.521 22.885 1.00 17.96  ? 214 ALA C CA    1 
ATOM   6723  C  C     . ALA C 1 155 ? 20.351  25.578 23.183 1.00 17.96  ? 214 ALA C C     1 
ATOM   6724  O  O     . ALA C 1 155 ? 19.519  25.226 22.354 1.00 24.80  ? 214 ALA C O     1 
ATOM   6725  C  CB    . ALA C 1 155 ? 22.298  26.840 22.304 1.00 24.80  ? 214 ALA C CB    1 
ATOM   6726  H  H     . ALA C 1 155 ? 21.284  24.215 21.349 1.00 0.00   ? 214 ALA C H     1 
ATOM   6727  N  N     . GLU C 1 156 ? 20.041  26.040 24.382 1.00 31.19  ? 215 GLU C N     1 
ATOM   6728  C  CA    . GLU C 1 156 ? 18.676  26.152 24.857 1.00 31.19  ? 215 GLU C CA    1 
ATOM   6729  C  C     . GLU C 1 156 ? 18.758  27.303 25.829 1.00 31.19  ? 215 GLU C C     1 
ATOM   6730  O  O     . GLU C 1 156 ? 19.821  27.539 26.402 1.00 68.89  ? 215 GLU C O     1 
ATOM   6731  C  CB    . GLU C 1 156 ? 18.308  24.859 25.573 1.00 68.89  ? 215 GLU C CB    1 
ATOM   6732  C  CG    . GLU C 1 156 ? 17.000  24.844 26.312 1.00 68.89  ? 215 GLU C CG    1 
ATOM   6733  C  CD    . GLU C 1 156 ? 16.858  23.576 27.145 1.00 68.89  ? 215 GLU C CD    1 
ATOM   6734  O  OE1   . GLU C 1 156 ? 17.427  22.533 26.743 1.00 68.89  ? 215 GLU C OE1   1 
ATOM   6735  O  OE2   . GLU C 1 156 ? 16.196  23.623 28.209 1.00 68.89  ? 215 GLU C OE2   1 
ATOM   6736  H  H     . GLU C 1 156 ? 20.746  26.333 25.004 1.00 0.00   ? 215 GLU C H     1 
ATOM   6737  N  N     . ARG C 1 157 ? 17.675  28.064 25.954 1.00 26.80  ? 216 ARG C N     1 
ATOM   6738  C  CA    . ARG C 1 157 ? 17.622  29.214 26.858 1.00 26.80  ? 216 ARG C CA    1 
ATOM   6739  C  C     . ARG C 1 157 ? 16.225  29.799 26.879 1.00 26.80  ? 216 ARG C C     1 
ATOM   6740  O  O     . ARG C 1 157 ? 15.411  29.449 26.029 1.00 57.71  ? 216 ARG C O     1 
ATOM   6741  C  CB    . ARG C 1 157 ? 18.633  30.285 26.445 1.00 57.71  ? 216 ARG C CB    1 
ATOM   6742  C  CG    . ARG C 1 157 ? 18.551  30.729 25.016 1.00 57.71  ? 216 ARG C CG    1 
ATOM   6743  C  CD    . ARG C 1 157 ? 19.706  31.633 24.725 1.00 57.71  ? 216 ARG C CD    1 
ATOM   6744  N  NE    . ARG C 1 157 ? 20.973  30.973 25.032 1.00 57.71  ? 216 ARG C NE    1 
ATOM   6745  C  CZ    . ARG C 1 157 ? 21.907  31.472 25.839 1.00 57.71  ? 216 ARG C CZ    1 
ATOM   6746  N  NH1   . ARG C 1 157 ? 21.714  32.648 26.430 1.00 57.71  ? 216 ARG C NH1   1 
ATOM   6747  N  NH2   . ARG C 1 157 ? 23.043  30.803 26.034 1.00 57.71  ? 216 ARG C NH2   1 
ATOM   6748  H  H     . ARG C 1 157 ? 16.888  27.883 25.400 1.00 0.00   ? 216 ARG C H     1 
ATOM   6749  H  HE    . ARG C 1 157 ? 21.145  30.099 24.624 1.00 0.00   ? 216 ARG C HE    1 
ATOM   6750  H  HH11  . ARG C 1 157 ? 20.875  33.166 26.275 1.00 0.00   ? 216 ARG C HH11  1 
ATOM   6751  H  HH12  . ARG C 1 157 ? 22.419  33.012 27.039 1.00 0.00   ? 216 ARG C HH12  1 
ATOM   6752  H  HH21  . ARG C 1 157 ? 23.201  29.933 25.567 1.00 0.00   ? 216 ARG C HH21  1 
ATOM   6753  H  HH22  . ARG C 1 157 ? 23.736  31.172 26.651 1.00 0.00   ? 216 ARG C HH22  1 
ATOM   6754  N  N     . GLU C 1 158 ? 15.917  30.715 27.878 1.00 19.35  ? 217 GLU C N     1 
ATOM   6755  C  CA    . GLU C 1 158 ? 14.522  31.178 27.877 1.00 19.35  ? 217 GLU C CA    1 
ATOM   6756  C  C     . GLU C 1 158 ? 14.468  32.676 28.190 1.00 19.35  ? 217 GLU C C     1 
ATOM   6757  O  O     . GLU C 1 158 ? 15.179  33.317 28.918 1.00 57.68  ? 217 GLU C O     1 
ATOM   6758  C  CB    . GLU C 1 158 ? 13.718  30.416 28.931 1.00 57.68  ? 217 GLU C CB    1 
ATOM   6759  C  CG    . GLU C 1 158 ? 13.699  28.906 28.691 1.00 57.68  ? 217 GLU C CG    1 
ATOM   6760  C  CD    . GLU C 1 158 ? 12.898  28.144 29.747 1.00 57.68  ? 217 GLU C CD    1 
ATOM   6761  O  OE1   . GLU C 1 158 ? 12.329  28.785 30.711 1.00 57.68  ? 217 GLU C OE1   1 
ATOM   6762  O  OE2   . GLU C 1 158 ? 12.792  26.860 29.675 1.00 57.68  ? 217 GLU C OE2   1 
ATOM   6763  N  N     . GLY C 1 159 ? 13.417  33.264 27.496 1.00 16.04  ? 218 GLY C N     1 
ATOM   6764  C  CA    . GLY C 1 159 ? 13.073  34.658 27.643 1.00 16.04  ? 218 GLY C CA    1 
ATOM   6765  C  C     . GLY C 1 159 ? 11.789  34.723 28.428 1.00 16.04  ? 218 GLY C C     1 
ATOM   6766  O  O     . GLY C 1 159 ? 11.394  33.765 29.080 1.00 37.79  ? 218 GLY C O     1 
ATOM   6767  H  H     . GLY C 1 159 ? 12.881  32.693 26.902 1.00 0.00   ? 218 GLY C H     1 
ATOM   6768  N  N     . ASP C 1 160 ? 11.075  35.821 28.282 1.00 17.88  ? 219 ASP C N     1 
ATOM   6769  C  CA    . ASP C 1 160 ? 9.842   36.014 29.018 1.00 17.88  ? 219 ASP C CA    1 
ATOM   6770  C  C     . ASP C 1 160 ? 8.646   36.285 28.139 1.00 17.88  ? 219 ASP C C     1 
ATOM   6771  O  O     . ASP C 1 160 ? 7.732   36.981 28.589 1.00 21.74  ? 219 ASP C O     1 
ATOM   6772  C  CB    . ASP C 1 160 ? 9.996   37.175 30.000 1.00 21.74  ? 219 ASP C CB    1 
ATOM   6773  C  CG    . ASP C 1 160 ? 10.399  38.479 29.328 1.00 21.74  ? 219 ASP C CG    1 
ATOM   6774  O  OD1   . ASP C 1 160 ? 10.048  38.696 28.154 1.00 21.74  ? 219 ASP C OD1   1 
ATOM   6775  O  OD2   . ASP C 1 160 ? 11.071  39.305 29.975 1.00 21.74  ? 219 ASP C OD2   1 
ATOM   6776  H  H     . ASP C 1 160 ? 11.407  36.519 27.680 1.00 0.00   ? 219 ASP C H     1 
ATOM   6777  N  N     . TRP C 1 161 ? 8.691   35.803 26.889 1.00 14.26  ? 220 TRP C N     1 
ATOM   6778  C  CA    . TRP C 1 161 ? 7.595   35.986 25.908 1.00 14.26  ? 220 TRP C CA    1 
ATOM   6779  C  C     . TRP C 1 161 ? 7.651   37.308 25.104 1.00 14.26  ? 220 TRP C C     1 
ATOM   6780  O  O     . TRP C 1 161 ? 6.863   37.511 24.173 1.00 26.37  ? 220 TRP C O     1 
ATOM   6781  C  CB    . TRP C 1 161 ? 6.199   35.924 26.569 1.00 26.37  ? 220 TRP C CB    1 
ATOM   6782  C  CG    . TRP C 1 161 ? 5.746   34.636 27.201 1.00 26.37  ? 220 TRP C CG    1 
ATOM   6783  C  CD1   . TRP C 1 161 ? 5.164   34.507 28.415 1.00 26.37  ? 220 TRP C CD1   1 
ATOM   6784  C  CD2   . TRP C 1 161 ? 5.727   33.333 26.610 1.00 26.37  ? 220 TRP C CD2   1 
ATOM   6785  N  NE1   . TRP C 1 161 ? 4.770   33.218 28.619 1.00 26.37  ? 220 TRP C NE1   1 
ATOM   6786  C  CE2   . TRP C 1 161 ? 5.108   32.473 27.525 1.00 26.37  ? 220 TRP C CE2   1 
ATOM   6787  C  CE3   . TRP C 1 161 ? 6.168   32.813 25.396 1.00 26.37  ? 220 TRP C CE3   1 
ATOM   6788  C  CZ2   . TRP C 1 161 ? 4.922   31.124 27.269 1.00 26.37  ? 220 TRP C CZ2   1 
ATOM   6789  C  CZ3   . TRP C 1 161 ? 5.979   31.468 25.143 1.00 26.37  ? 220 TRP C CZ3   1 
ATOM   6790  C  CH2   . TRP C 1 161 ? 5.364   30.641 26.074 1.00 26.37  ? 220 TRP C CH2   1 
ATOM   6791  H  H     . TRP C 1 161 ? 9.474   35.293 26.602 1.00 0.00   ? 220 TRP C H     1 
ATOM   6792  H  HE1   . TRP C 1 161 ? 4.309   32.907 29.429 1.00 0.00   ? 220 TRP C HE1   1 
ATOM   6793  N  N     . SER C 1 162 ? 8.584   38.190 25.454 1.00 18.78  ? 221 SER C N     1 
ATOM   6794  C  CA    . SER C 1 162 ? 8.699   39.491 24.788 1.00 18.78  ? 221 SER C CA    1 
ATOM   6795  C  C     . SER C 1 162 ? 9.782   39.579 23.728 1.00 18.78  ? 221 SER C C     1 
ATOM   6796  O  O     . SER C 1 162 ? 10.821  38.913 23.833 1.00 19.22  ? 221 SER C O     1 
ATOM   6797  C  CB    . SER C 1 162 ? 8.968   40.585 25.819 1.00 19.22  ? 221 SER C CB    1 
ATOM   6798  O  OG    . SER C 1 162 ? 10.288  40.511 26.306 1.00 19.22  ? 221 SER C OG    1 
ATOM   6799  H  H     . SER C 1 162 ? 9.205   37.987 26.172 1.00 0.00   ? 221 SER C H     1 
ATOM   6800  H  HG    . SER C 1 162 ? 10.378  41.061 27.093 1.00 30.00  ? 221 SER C HG    1 
ATOM   6801  N  N     . ALA C 1 163 ? 9.558   40.466 22.755 1.00 2.00   ? 222 ALA C N     1 
ATOM   6802  C  CA    . ALA C 1 163 ? 10.513  40.703 21.675 1.00 2.00   ? 222 ALA C CA    1 
ATOM   6803  C  C     . ALA C 1 163 ? 11.910  40.943 22.241 1.00 2.00   ? 222 ALA C C     1 
ATOM   6804  O  O     . ALA C 1 163 ? 12.855  40.186 21.973 1.00 15.44  ? 222 ALA C O     1 
ATOM   6805  C  CB    . ALA C 1 163 ? 10.082  41.894 20.834 1.00 15.44  ? 222 ALA C CB    1 
ATOM   6806  H  H     . ALA C 1 163 ? 8.738   40.988 22.756 1.00 0.00   ? 222 ALA C H     1 
ATOM   6807  N  N     . MET C 1 164 ? 12.007  41.904 23.144 1.00 26.59  ? 223 MET C N     1 
ATOM   6808  C  CA    . MET C 1 164 ? 13.302  42.250 23.703 1.00 26.59  ? 223 MET C CA    1 
ATOM   6809  C  C     . MET C 1 164 ? 14.043  41.075 24.339 1.00 26.59  ? 223 MET C C     1 
ATOM   6810  O  O     . MET C 1 164 ? 15.275  41.105 24.459 1.00 27.09  ? 223 MET C O     1 
ATOM   6811  C  CB    . MET C 1 164 ? 13.150  43.395 24.680 1.00 27.09  ? 223 MET C CB    1 
ATOM   6812  C  CG    . MET C 1 164 ? 14.465  43.920 25.165 1.00 27.09  ? 223 MET C CG    1 
ATOM   6813  S  SD    . MET C 1 164 ? 15.446  44.725 23.910 1.00 27.09  ? 223 MET C SD    1 
ATOM   6814  C  CE    . MET C 1 164 ? 17.193  44.607 24.762 1.00 27.09  ? 223 MET C CE    1 
ATOM   6815  H  H     . MET C 1 164 ? 11.195  42.346 23.458 1.00 0.00   ? 223 MET C H     1 
ATOM   6816  N  N     . SER C 1 165 ? 13.292  40.012 24.633 1.00 21.20  ? 224 SER C N     1 
ATOM   6817  C  CA    . SER C 1 165 ? 13.802  38.809 25.263 1.00 21.20  ? 224 SER C CA    1 
ATOM   6818  C  C     . SER C 1 165 ? 14.450  37.914 24.235 1.00 21.20  ? 224 SER C C     1 
ATOM   6819  O  O     . SER C 1 165 ? 15.471  37.278 24.484 1.00 34.74  ? 224 SER C O     1 
ATOM   6820  C  CB    . SER C 1 165 ? 12.658  38.073 25.931 1.00 34.74  ? 224 SER C CB    1 
ATOM   6821  O  OG    . SER C 1 165 ? 13.066  37.573 27.177 1.00 34.74  ? 224 SER C OG    1 
ATOM   6822  H  H     . SER C 1 165 ? 12.340  40.024 24.414 1.00 0.00   ? 224 SER C H     1 
ATOM   6823  H  HG    . SER C 1 165 ? 13.464  38.330 27.630 1.00 30.00  ? 224 SER C HG    1 
ATOM   6824  N  N     . GLY C 1 166 ? 13.848  37.832 23.068 1.00 2.00   ? 225 GLY C N     1 
ATOM   6825  C  CA    . GLY C 1 166 ? 14.445  37.002 22.039 1.00 2.00   ? 225 GLY C CA    1 
ATOM   6826  C  C     . GLY C 1 166 ? 15.758  37.696 21.727 1.00 2.00   ? 225 GLY C C     1 
ATOM   6827  O  O     . GLY C 1 166 ? 16.798  37.044 21.613 1.00 30.39  ? 225 GLY C O     1 
ATOM   6828  H  H     . GLY C 1 166 ? 13.027  38.345 22.878 1.00 0.00   ? 225 GLY C H     1 
ATOM   6829  N  N     . PHE C 1 167 ? 15.715  39.033 21.625 1.00 2.00   ? 226 PHE C N     1 
ATOM   6830  C  CA    . PHE C 1 167 ? 16.908  39.826 21.345 1.00 2.00   ? 226 PHE C CA    1 
ATOM   6831  C  C     . PHE C 1 167 ? 17.944  39.637 22.445 1.00 2.00   ? 226 PHE C C     1 
ATOM   6832  O  O     . PHE C 1 167 ? 19.097  39.439 22.133 1.00 13.48  ? 226 PHE C O     1 
ATOM   6833  C  CB    . PHE C 1 167 ? 16.550  41.302 21.195 1.00 13.48  ? 226 PHE C CB    1 
ATOM   6834  C  CG    . PHE C 1 167 ? 17.734  42.200 20.896 1.00 13.48  ? 226 PHE C CG    1 
ATOM   6835  C  CD1   . PHE C 1 167 ? 18.521  42.708 21.908 1.00 13.48  ? 226 PHE C CD1   1 
ATOM   6836  C  CD2   . PHE C 1 167 ? 18.057  42.529 19.601 1.00 13.48  ? 226 PHE C CD2   1 
ATOM   6837  C  CE1   . PHE C 1 167 ? 19.605  43.520 21.620 1.00 13.48  ? 226 PHE C CE1   1 
ATOM   6838  C  CE2   . PHE C 1 167 ? 19.138  43.338 19.316 1.00 13.48  ? 226 PHE C CE2   1 
ATOM   6839  C  CZ    . PHE C 1 167 ? 19.911  43.831 20.316 1.00 13.48  ? 226 PHE C CZ    1 
ATOM   6840  H  H     . PHE C 1 167 ? 14.837  39.470 21.705 1.00 0.00   ? 226 PHE C H     1 
ATOM   6841  N  N     . GLN C 1 168 ? 17.560  39.695 23.722 1.00 21.60  ? 227 GLN C N     1 
ATOM   6842  C  CA    . GLN C 1 168 ? 18.532  39.541 24.814 1.00 21.60  ? 227 GLN C CA    1 
ATOM   6843  C  C     . GLN C 1 168 ? 19.246  38.166 24.745 1.00 21.60  ? 227 GLN C C     1 
ATOM   6844  O  O     . GLN C 1 168 ? 20.461  38.086 24.560 1.00 97.57  ? 227 GLN C O     1 
ATOM   6845  C  CB    . GLN C 1 168 ? 17.852  39.748 26.196 1.00 97.57  ? 227 GLN C CB    1 
ATOM   6846  C  CG    . GLN C 1 168 ? 16.828  38.642 26.617 1.00 97.57  ? 227 GLN C CG    1 
ATOM   6847  C  CD    . GLN C 1 168 ? 16.186  38.789 28.022 1.00 97.57  ? 227 GLN C CD    1 
ATOM   6848  O  OE1   . GLN C 1 168 ? 15.937  39.895 28.504 1.00 97.57  ? 227 GLN C OE1   1 
ATOM   6849  N  NE2   . GLN C 1 168 ? 15.877  37.653 28.650 1.00 97.57  ? 227 GLN C NE2   1 
ATOM   6850  H  H     . GLN C 1 168 ? 16.621  39.850 23.939 1.00 0.00   ? 227 GLN C H     1 
ATOM   6851  N  N     . GLN C 1 169 ? 18.448  37.103 24.789 1.00 13.52  ? 228 GLN C N     1 
ATOM   6852  C  CA    . GLN C 1 169 ? 18.903  35.730 24.765 1.00 13.52  ? 228 GLN C CA    1 
ATOM   6853  C  C     . GLN C 1 169 ? 19.698  35.352 23.556 1.00 13.52  ? 228 GLN C C     1 
ATOM   6854  O  O     . GLN C 1 169 ? 20.751  34.714 23.694 1.00 21.47  ? 228 GLN C O     1 
ATOM   6855  C  CB    . GLN C 1 169 ? 17.720  34.788 24.911 1.00 21.47  ? 228 GLN C CB    1 
ATOM   6856  C  CG    . GLN C 1 169 ? 17.157  34.827 26.291 1.00 21.47  ? 228 GLN C CG    1 
ATOM   6857  C  CD    . GLN C 1 169 ? 18.264  34.898 27.354 1.00 21.47  ? 228 GLN C CD    1 
ATOM   6858  O  OE1   . GLN C 1 169 ? 18.187  35.719 28.279 1.00 21.47  ? 228 GLN C OE1   1 
ATOM   6859  N  NE2   . GLN C 1 169 ? 19.315  34.067 27.203 1.00 21.47  ? 228 GLN C NE2   1 
ATOM   6860  H  H     . GLN C 1 169 ? 17.483  37.270 24.783 1.00 0.00   ? 228 GLN C H     1 
ATOM   6861  N  N     . THR C 1 170 ? 19.148  35.650 22.381 1.00 9.01   ? 229 THR C N     1 
ATOM   6862  C  CA    . THR C 1 170 ? 19.809  35.398 21.105 1.00 9.01   ? 229 THR C CA    1 
ATOM   6863  C  C     . THR C 1 170 ? 21.093  36.211 20.913 1.00 9.01   ? 229 THR C C     1 
ATOM   6864  O  O     . THR C 1 170 ? 21.948  35.805 20.145 1.00 17.32  ? 229 THR C O     1 
ATOM   6865  C  CB    . THR C 1 170 ? 18.901  35.713 19.945 1.00 17.32  ? 229 THR C CB    1 
ATOM   6866  O  OG1   . THR C 1 170 ? 17.636  35.075 20.152 1.00 17.32  ? 229 THR C OG1   1 
ATOM   6867  C  CG2   . THR C 1 170 ? 19.522  35.243 18.667 1.00 17.32  ? 229 THR C CG2   1 
ATOM   6868  H  H     . THR C 1 170 ? 18.255  36.045 22.351 1.00 0.00   ? 229 THR C H     1 
ATOM   6869  H  HG1   . THR C 1 170 ? 17.100  35.562 20.758 1.00 30.00  ? 229 THR C HG1   1 
ATOM   6870  N  N     . MET C 1 171 ? 21.220  37.372 21.552 1.00 15.70  ? 230 MET C N     1 
ATOM   6871  C  CA    . MET C 1 171 ? 22.447  38.136 21.418 1.00 15.70  ? 230 MET C CA    1 
ATOM   6872  C  C     . MET C 1 171 ? 23.489  37.440 22.275 1.00 15.70  ? 230 MET C C     1 
ATOM   6873  O  O     . MET C 1 171 ? 24.551  37.060 21.792 1.00 26.43  ? 230 MET C O     1 
ATOM   6874  C  CB    . MET C 1 171 ? 22.265  39.586 21.867 1.00 26.43  ? 230 MET C CB    1 
ATOM   6875  C  CG    . MET C 1 171 ? 21.634  40.520 20.819 1.00 26.43  ? 230 MET C CG    1 
ATOM   6876  S  SD    . MET C 1 171 ? 22.545  40.683 19.288 1.00 26.43  ? 230 MET C SD    1 
ATOM   6877  C  CE    . MET C 1 171 ? 23.868  41.605 19.819 1.00 26.43  ? 230 MET C CE    1 
ATOM   6878  H  H     . MET C 1 171 ? 20.484  37.724 22.100 1.00 0.00   ? 230 MET C H     1 
ATOM   6879  N  N     . GLN C 1 172 ? 23.129  37.171 23.525 1.00 29.01  ? 231 GLN C N     1 
ATOM   6880  C  CA    . GLN C 1 172 ? 24.024  36.503 24.465 1.00 29.01  ? 231 GLN C CA    1 
ATOM   6881  C  C     . GLN C 1 172 ? 24.561  35.185 23.898 1.00 29.01  ? 231 GLN C C     1 
ATOM   6882  O  O     . GLN C 1 172 ? 25.761  34.941 23.923 1.00 92.40  ? 231 GLN C O     1 
ATOM   6883  C  CB    . GLN C 1 172 ? 23.329  36.319 25.838 1.00 92.40  ? 231 GLN C CB    1 
ATOM   6884  C  CG    . GLN C 1 172 ? 23.220  37.647 26.686 1.00 92.40  ? 231 GLN C CG    1 
ATOM   6885  C  CD    . GLN C 1 172 ? 22.178  37.625 27.851 1.00 92.40  ? 231 GLN C CD    1 
ATOM   6886  O  OE1   . GLN C 1 172 ? 21.563  36.593 28.145 1.00 92.40  ? 231 GLN C OE1   1 
ATOM   6887  N  NE2   . GLN C 1 172 ? 21.981  38.786 28.499 1.00 92.40  ? 231 GLN C NE2   1 
ATOM   6888  H  H     . GLN C 1 172 ? 22.238  37.461 23.814 1.00 0.00   ? 231 GLN C H     1 
ATOM   6889  N  N     . MET C 1 173 ? 23.687  34.395 23.281 1.00 27.84  ? 232 MET C N     1 
ATOM   6890  C  CA    . MET C 1 173 ? 24.058  33.100 22.698 1.00 27.84  ? 232 MET C CA    1 
ATOM   6891  C  C     . MET C 1 173 ? 25.156  33.224 21.654 1.00 27.84  ? 232 MET C C     1 
ATOM   6892  O  O     . MET C 1 173 ? 26.228  32.617 21.762 1.00 35.32  ? 232 MET C O     1 
ATOM   6893  C  CB    . MET C 1 173 ? 22.829  32.462 22.038 1.00 35.32  ? 232 MET C CB    1 
ATOM   6894  C  CG    . MET C 1 173 ? 23.065  31.061 21.468 1.00 35.32  ? 232 MET C CG    1 
ATOM   6895  S  SD    . MET C 1 173 ? 21.984  30.634 20.082 1.00 35.32  ? 232 MET C SD    1 
ATOM   6896  C  CE    . MET C 1 173 ? 20.509  30.281 20.973 1.00 35.32  ? 232 MET C CE    1 
ATOM   6897  H  H     . MET C 1 173 ? 22.752  34.690 23.226 1.00 0.00   ? 232 MET C H     1 
ATOM   6898  N  N     . LEU C 1 174 ? 24.858  33.991 20.613 1.00 25.99  ? 233 LEU C N     1 
ATOM   6899  C  CA    . LEU C 1 174 ? 25.785  34.189 19.522 1.00 25.99  ? 233 LEU C CA    1 
ATOM   6900  C  C     . LEU C 1 174 ? 27.128  34.640 20.061 1.00 25.99  ? 233 LEU C C     1 
ATOM   6901  O  O     . LEU C 1 174 ? 28.151  34.130 19.638 1.00 21.58  ? 233 LEU C O     1 
ATOM   6902  C  CB    . LEU C 1 174 ? 25.201  35.169 18.495 1.00 21.58  ? 233 LEU C CB    1 
ATOM   6903  C  CG    . LEU C 1 174 ? 23.896  34.770 17.762 1.00 21.58  ? 233 LEU C CG    1 
ATOM   6904  C  CD1   . LEU C 1 174 ? 23.278  35.973 17.067 1.00 21.58  ? 233 LEU C CD1   1 
ATOM   6905  C  CD2   . LEU C 1 174 ? 24.127  33.645 16.752 1.00 21.58  ? 233 LEU C CD2   1 
ATOM   6906  H  H     . LEU C 1 174 ? 23.989  34.445 20.579 1.00 0.00   ? 233 LEU C H     1 
ATOM   6907  N  N     . ASN C 1 175 ? 27.128  35.511 21.067 1.00 31.81  ? 234 ASN C N     1 
ATOM   6908  C  CA    . ASN C 1 175 ? 28.385  35.990 21.665 1.00 31.81  ? 234 ASN C CA    1 
ATOM   6909  C  C     . ASN C 1 175 ? 29.192  34.810 22.178 1.00 31.81  ? 234 ASN C C     1 
ATOM   6910  O  O     . ASN C 1 175 ? 30.411  34.757 22.037 1.00 72.96  ? 234 ASN C O     1 
ATOM   6911  C  CB    . ASN C 1 175 ? 28.116  36.920 22.847 1.00 72.96  ? 234 ASN C CB    1 
ATOM   6912  C  CG    . ASN C 1 175 ? 27.254  38.098 22.481 1.00 72.96  ? 234 ASN C CG    1 
ATOM   6913  O  OD1   . ASN C 1 175 ? 26.819  38.850 23.351 1.00 72.96  ? 234 ASN C OD1   1 
ATOM   6914  N  ND2   . ASN C 1 175 ? 27.002  38.276 21.195 1.00 72.96  ? 234 ASN C ND2   1 
ATOM   6915  H  H     . ASN C 1 175 ? 26.265  35.824 21.420 1.00 0.00   ? 234 ASN C H     1 
ATOM   6916  H  HD21  . ASN C 1 175 ? 26.401  39.035 21.039 1.00 0.00   ? 234 ASN C HD21  1 
ATOM   6917  H  HD22  . ASN C 1 175 ? 27.344  37.719 20.473 1.00 0.00   ? 234 ASN C HD22  1 
ATOM   6918  N  N     . GLU C 1 176 ? 28.473  33.866 22.776 1.00 53.36  ? 235 GLU C N     1 
ATOM   6919  C  CA    . GLU C 1 176 ? 29.040  32.647 23.329 1.00 53.36  ? 235 GLU C CA    1 
ATOM   6920  C  C     . GLU C 1 176 ? 29.597  31.797 22.194 1.00 53.36  ? 235 GLU C C     1 
ATOM   6921  O  O     . GLU C 1 176 ? 30.093  30.688 22.413 1.00 82.79  ? 235 GLU C O     1 
ATOM   6922  C  CB    . GLU C 1 176 ? 27.965  31.846 24.087 1.00 82.79  ? 235 GLU C CB    1 
ATOM   6923  C  CG    . GLU C 1 176 ? 27.409  32.506 25.359 1.00 82.79  ? 235 GLU C CG    1 
ATOM   6924  C  CD    . GLU C 1 176 ? 26.296  31.691 26.019 1.00 82.79  ? 235 GLU C CD    1 
ATOM   6925  O  OE1   . GLU C 1 176 ? 26.413  30.446 26.100 1.00 82.79  ? 235 GLU C OE1   1 
ATOM   6926  O  OE2   . GLU C 1 176 ? 25.300  32.301 26.459 1.00 82.79  ? 235 GLU C OE2   1 
ATOM   6927  H  H     . GLU C 1 176 ? 27.501  33.981 22.855 1.00 0.00   ? 235 GLU C H     1 
ATOM   6928  N  N     . GLY C 1 177 ? 29.486  32.309 20.975 1.00 21.12  ? 236 GLY C N     1 
ATOM   6929  C  CA    . GLY C 1 177 ? 29.991  31.588 19.836 1.00 21.12  ? 236 GLY C CA    1 
ATOM   6930  C  C     . GLY C 1 177 ? 29.101  30.430 19.459 1.00 21.12  ? 236 GLY C C     1 
ATOM   6931  O  O     . GLY C 1 177 ? 29.536  29.550 18.707 1.00 44.53  ? 236 GLY C O     1 
ATOM   6932  H  H     . GLY C 1 177 ? 29.052  33.143 20.818 1.00 0.00   ? 236 GLY C H     1 
ATOM   6933  N  N     . ILE C 1 178 ? 27.873  30.406 19.984 1.00 24.51  ? 237 ILE C N     1 
ATOM   6934  C  CA    . ILE C 1 178 ? 26.937  29.349 19.642 1.00 24.51  ? 237 ILE C CA    1 
ATOM   6935  C  C     . ILE C 1 178 ? 26.086  29.939 18.542 1.00 24.51  ? 237 ILE C C     1 
ATOM   6936  O  O     . ILE C 1 178 ? 25.324  30.874 18.790 1.00 34.53  ? 237 ILE C O     1 
ATOM   6937  C  CB    . ILE C 1 178 ? 26.011  28.989 20.798 1.00 34.53  ? 237 ILE C CB    1 
ATOM   6938  C  CG1   . ILE C 1 178 ? 26.807  28.502 21.992 1.00 34.53  ? 237 ILE C CG1   1 
ATOM   6939  C  CG2   . ILE C 1 178 ? 25.062  27.893 20.363 1.00 34.53  ? 237 ILE C CG2   1 
ATOM   6940  C  CD1   . ILE C 1 178 ? 25.942  28.158 23.140 1.00 34.53  ? 237 ILE C CD1   1 
ATOM   6941  H  H     . ILE C 1 178 ? 27.573  31.124 20.579 1.00 0.00   ? 237 ILE C H     1 
ATOM   6942  N  N     . VAL C 1 179 ? 26.237  29.431 17.325 1.00 39.74  ? 238 VAL C N     1 
ATOM   6943  C  CA    . VAL C 1 179 ? 25.472  29.925 16.181 1.00 39.74  ? 238 VAL C CA    1 
ATOM   6944  C  C     . VAL C 1 179 ? 24.741  28.739 15.528 1.00 39.74  ? 238 VAL C C     1 
ATOM   6945  O  O     . VAL C 1 179 ? 25.302  27.992 14.729 1.00 29.97  ? 238 VAL C O     1 
ATOM   6946  C  CB    . VAL C 1 179 ? 26.416  30.688 15.189 1.00 29.97  ? 238 VAL C CB    1 
ATOM   6947  C  CG1   . VAL C 1 179 ? 27.672  29.906 14.983 1.00 29.97  ? 238 VAL C CG1   1 
ATOM   6948  C  CG2   . VAL C 1 179 ? 25.744  30.948 13.838 1.00 29.97  ? 238 VAL C CG2   1 
ATOM   6949  H  H     . VAL C 1 179 ? 26.884  28.706 17.199 1.00 0.00   ? 238 VAL C H     1 
ATOM   6950  N  N     . PRO C 1 180 ? 23.474  28.528 15.894 1.00 13.56  ? 239 PRO C N     1 
ATOM   6951  C  CA    . PRO C 1 180 ? 22.775  27.402 15.290 1.00 13.56  ? 239 PRO C CA    1 
ATOM   6952  C  C     . PRO C 1 180 ? 22.518  27.694 13.833 1.00 13.56  ? 239 PRO C C     1 
ATOM   6953  O  O     . PRO C 1 180 ? 22.726  28.813 13.393 1.00 23.69  ? 239 PRO C O     1 
ATOM   6954  C  CB    . PRO C 1 180 ? 21.468  27.407 16.062 1.00 23.69  ? 239 PRO C CB    1 
ATOM   6955  C  CG    . PRO C 1 180 ? 21.213  28.844 16.194 1.00 23.69  ? 239 PRO C CG    1 
ATOM   6956  C  CD    . PRO C 1 180 ? 22.538  29.337 16.689 1.00 23.69  ? 239 PRO C CD    1 
ATOM   6957  N  N     . THR C 1 181 ? 22.080  26.697 13.076 1.00 12.56  ? 240 THR C N     1 
ATOM   6958  C  CA    . THR C 1 181 ? 21.743  26.938 11.683 1.00 12.56  ? 240 THR C CA    1 
ATOM   6959  C  C     . THR C 1 181 ? 20.252  27.254 11.749 1.00 12.56  ? 240 THR C C     1 
ATOM   6960  O  O     . THR C 1 181 ? 19.668  27.777 10.782 1.00 24.77  ? 240 THR C O     1 
ATOM   6961  C  CB    . THR C 1 181 ? 21.932  25.677 10.750 1.00 24.77  ? 240 THR C CB    1 
ATOM   6962  O  OG1   . THR C 1 181 ? 21.085  24.603 11.170 1.00 24.77  ? 240 THR C OG1   1 
ATOM   6963  C  CG2   . THR C 1 181 ? 23.355  25.198 10.739 1.00 24.77  ? 240 THR C CG2   1 
ATOM   6964  H  H     . THR C 1 181 ? 22.005  25.801 13.453 1.00 0.00   ? 240 THR C H     1 
ATOM   6965  H  HG1   . THR C 1 181 ? 21.429  24.329 12.038 1.00 30.00  ? 240 THR C HG1   1 
ATOM   6966  N  N     . ALA C 1 182 ? 19.635  26.881 12.878 1.00 9.36   ? 241 ALA C N     1 
ATOM   6967  C  CA    . ALA C 1 182 ? 18.210  27.073 13.091 1.00 9.36   ? 241 ALA C CA    1 
ATOM   6968  C  C     . ALA C 1 182 ? 17.909  27.291 14.547 1.00 9.36   ? 241 ALA C C     1 
ATOM   6969  O  O     . ALA C 1 182 ? 18.661  26.838 15.407 1.00 25.24  ? 241 ALA C O     1 
ATOM   6970  C  CB    . ALA C 1 182 ? 17.428  25.859 12.602 1.00 25.24  ? 241 ALA C CB    1 
ATOM   6971  H  H     . ALA C 1 182 ? 20.112  26.489 13.636 1.00 0.00   ? 241 ALA C H     1 
ATOM   6972  N  N     . MET C 1 183 ? 16.766  27.932 14.799 1.00 16.50  ? 242 MET C N     1 
ATOM   6973  C  CA    . MET C 1 183 ? 16.263  28.239 16.126 1.00 16.50  ? 242 MET C CA    1 
ATOM   6974  C  C     . MET C 1 183 ? 14.779  27.970 16.134 1.00 16.50  ? 242 MET C C     1 
ATOM   6975  O  O     . MET C 1 183 ? 14.066  28.300 15.174 1.00 22.57  ? 242 MET C O     1 
ATOM   6976  C  CB    . MET C 1 183 ? 16.457  29.711 16.472 1.00 22.57  ? 242 MET C CB    1 
ATOM   6977  C  CG    . MET C 1 183 ? 17.877  30.177 16.577 1.00 22.57  ? 242 MET C CG    1 
ATOM   6978  S  SD    . MET C 1 183 ? 17.862  31.768 17.377 1.00 22.57  ? 242 MET C SD    1 
ATOM   6979  C  CE    . MET C 1 183 ? 18.048  31.340 19.019 1.00 22.57  ? 242 MET C CE    1 
ATOM   6980  H  H     . MET C 1 183 ? 16.208  28.234 14.057 1.00 0.00   ? 242 MET C H     1 
ATOM   6981  N  N     . LEU C 1 184 ? 14.331  27.321 17.205 1.00 28.46  ? 243 LEU C N     1 
ATOM   6982  C  CA    . LEU C 1 184 ? 12.925  27.001 17.429 1.00 28.46  ? 243 LEU C CA    1 
ATOM   6983  C  C     . LEU C 1 184 ? 12.573  27.932 18.585 1.00 28.46  ? 243 LEU C C     1 
ATOM   6984  O  O     . LEU C 1 184 ? 13.160  27.817 19.683 1.00 2.00   ? 243 LEU C O     1 
ATOM   6985  C  CB    . LEU C 1 184 ? 12.791  25.548 17.865 1.00 2.00   ? 243 LEU C CB    1 
ATOM   6986  C  CG    . LEU C 1 184 ? 12.807  24.444 16.799 1.00 2.00   ? 243 LEU C CG    1 
ATOM   6987  C  CD1   . LEU C 1 184 ? 13.114  23.103 17.453 1.00 2.00   ? 243 LEU C CD1   1 
ATOM   6988  C  CD2   . LEU C 1 184 ? 11.475  24.376 16.057 1.00 2.00   ? 243 LEU C CD2   1 
ATOM   6989  H  H     . LEU C 1 184 ? 14.959  27.036 17.908 1.00 0.00   ? 243 LEU C H     1 
ATOM   6990  N  N     . VAL C 1 185 ? 11.684  28.891 18.326 1.00 22.99  ? 244 VAL C N     1 
ATOM   6991  C  CA    . VAL C 1 185 ? 11.295  29.886 19.319 1.00 22.99  ? 244 VAL C CA    1 
ATOM   6992  C  C     . VAL C 1 185 ? 9.917   29.564 19.880 1.00 22.99  ? 244 VAL C C     1 
ATOM   6993  O  O     . VAL C 1 185 ? 9.095   28.948 19.209 1.00 13.25  ? 244 VAL C O     1 
ATOM   6994  C  CB    . VAL C 1 185 ? 11.379  31.298 18.705 1.00 13.25  ? 244 VAL C CB    1 
ATOM   6995  C  CG1   . VAL C 1 185 ? 11.073  32.366 19.722 1.00 13.25  ? 244 VAL C CG1   1 
ATOM   6996  C  CG2   . VAL C 1 185 ? 12.757  31.509 18.170 1.00 13.25  ? 244 VAL C CG2   1 
ATOM   6997  H  H     . VAL C 1 185 ? 11.199  28.930 17.470 1.00 0.00   ? 244 VAL C H     1 
ATOM   6998  N  N     . ALA C 1 186 ? 9.719   29.917 21.146 1.00 6.92   ? 245 ALA C N     1 
ATOM   6999  C  CA    . ALA C 1 186 ? 8.488   29.667 21.885 1.00 6.92   ? 245 ALA C CA    1 
ATOM   7000  C  C     . ALA C 1 186 ? 7.296   30.484 21.444 1.00 6.92   ? 245 ALA C C     1 
ATOM   7001  O  O     . ALA C 1 186 ? 6.169   30.059 21.662 1.00 31.46  ? 245 ALA C O     1 
ATOM   7002  C  CB    . ALA C 1 186 ? 8.731   29.869 23.356 1.00 31.46  ? 245 ALA C CB    1 
ATOM   7003  H  H     . ALA C 1 186 ? 10.467  30.366 21.600 1.00 0.00   ? 245 ALA C H     1 
ATOM   7004  N  N     . ASN C 1 187 ? 7.525   31.698 20.934 1.00 14.09  ? 246 ASN C N     1 
ATOM   7005  C  CA    . ASN C 1 187 ? 6.436   32.540 20.434 1.00 14.09  ? 246 ASN C CA    1 
ATOM   7006  C  C     . ASN C 1 187 ? 6.939   33.486 19.368 1.00 14.09  ? 246 ASN C C     1 
ATOM   7007  O  O     . ASN C 1 187 ? 8.148   33.586 19.161 1.00 11.24  ? 246 ASN C O     1 
ATOM   7008  C  CB    . ASN C 1 187 ? 5.683   33.299 21.548 1.00 11.24  ? 246 ASN C CB    1 
ATOM   7009  C  CG    . ASN C 1 187 ? 6.498   34.396 22.186 1.00 11.24  ? 246 ASN C CG    1 
ATOM   7010  O  OD1   . ASN C 1 187 ? 7.730   34.406 22.106 1.00 11.24  ? 246 ASN C OD1   1 
ATOM   7011  N  ND2   . ASN C 1 187 ? 5.822   35.303 22.872 1.00 11.24  ? 246 ASN C ND2   1 
ATOM   7012  H  H     . ASN C 1 187 ? 8.429   32.057 20.860 1.00 0.00   ? 246 ASN C H     1 
ATOM   7013  H  HD21  . ASN C 1 187 ? 6.283   36.051 23.284 1.00 0.00   ? 246 ASN C HD21  1 
ATOM   7014  H  HD22  . ASN C 1 187 ? 4.856   35.140 22.949 1.00 0.00   ? 246 ASN C HD22  1 
ATOM   7015  N  N     . ASP C 1 188 ? 6.013   34.135 18.655 1.00 15.65  ? 247 ASP C N     1 
ATOM   7016  C  CA    . ASP C 1 188 ? 6.358   35.064 17.575 1.00 15.65  ? 247 ASP C CA    1 
ATOM   7017  C  C     . ASP C 1 188 ? 7.130   36.276 18.016 1.00 15.65  ? 247 ASP C C     1 
ATOM   7018  O  O     . ASP C 1 188 ? 8.048   36.687 17.313 1.00 23.63  ? 247 ASP C O     1 
ATOM   7019  C  CB    . ASP C 1 188 ? 5.120   35.559 16.851 1.00 23.63  ? 247 ASP C CB    1 
ATOM   7020  C  CG    . ASP C 1 188 ? 4.401   34.474 16.116 1.00 23.63  ? 247 ASP C CG    1 
ATOM   7021  O  OD1   . ASP C 1 188 ? 4.950   33.355 15.998 1.00 23.63  ? 247 ASP C OD1   1 
ATOM   7022  O  OD2   . ASP C 1 188 ? 3.281   34.742 15.650 1.00 23.63  ? 247 ASP C OD2   1 
ATOM   7023  H  H     . ASP C 1 188 ? 5.062   33.981 18.876 1.00 0.00   ? 247 ASP C H     1 
ATOM   7024  N  N     . GLN C 1 189 ? 6.721   36.876 19.137 1.00 11.20  ? 248 GLN C N     1 
ATOM   7025  C  CA    . GLN C 1 189 ? 7.352   38.081 19.692 1.00 11.20  ? 248 GLN C CA    1 
ATOM   7026  C  C     . GLN C 1 189 ? 8.822   37.896 20.001 1.00 11.20  ? 248 GLN C C     1 
ATOM   7027  O  O     . GLN C 1 189 ? 9.659   38.705 19.607 1.00 33.85  ? 248 GLN C O     1 
ATOM   7028  C  CB    . GLN C 1 189 ? 6.613   38.560 20.939 1.00 33.85  ? 248 GLN C CB    1 
ATOM   7029  C  CG    . GLN C 1 189 ? 5.389   39.391 20.648 1.00 33.85  ? 248 GLN C CG    1 
ATOM   7030  C  CD    . GLN C 1 189 ? 4.762   39.953 21.904 1.00 33.85  ? 248 GLN C CD    1 
ATOM   7031  O  OE1   . GLN C 1 189 ? 3.626   39.627 22.233 1.00 33.85  ? 248 GLN C OE1   1 
ATOM   7032  N  NE2   . GLN C 1 189 ? 5.478   40.826 22.598 1.00 33.85  ? 248 GLN C NE2   1 
ATOM   7033  H  H     . GLN C 1 189 ? 5.953   36.487 19.601 1.00 0.00   ? 248 GLN C H     1 
ATOM   7034  N  N     . MET C 1 190 ? 9.152   36.849 20.727 1.00 9.42   ? 249 MET C N     1 
ATOM   7035  C  CA    . MET C 1 190 ? 10.552  36.590 21.027 1.00 9.42   ? 249 MET C CA    1 
ATOM   7036  C  C     . MET C 1 190 ? 11.250  36.290 19.705 1.00 9.42   ? 249 MET C C     1 
ATOM   7037  O  O     . MET C 1 190 ? 12.434  36.561 19.552 1.00 22.02  ? 249 MET C O     1 
ATOM   7038  C  CB    . MET C 1 190 ? 10.671  35.380 21.941 1.00 22.02  ? 249 MET C CB    1 
ATOM   7039  C  CG    . MET C 1 190 ? 10.227  35.625 23.368 1.00 22.02  ? 249 MET C CG    1 
ATOM   7040  S  SD    . MET C 1 190 ? 10.270  34.100 24.287 1.00 22.02  ? 249 MET C SD    1 
ATOM   7041  C  CE    . MET C 1 190 ? 11.932  33.877 24.387 1.00 22.02  ? 249 MET C CE    1 
ATOM   7042  H  H     . MET C 1 190 ? 8.475   36.219 21.068 1.00 0.00   ? 249 MET C H     1 
ATOM   7043  N  N     . ALA C 1 191 ? 10.507  35.699 18.764 1.00 14.80  ? 250 ALA C N     1 
ATOM   7044  C  CA    . ALA C 1 191 ? 11.048  35.379 17.437 1.00 14.80  ? 250 ALA C CA    1 
ATOM   7045  C  C     . ALA C 1 191 ? 11.467  36.652 16.697 1.00 14.80  ? 250 ALA C C     1 
ATOM   7046  O  O     . ALA C 1 191 ? 12.496  36.679 16.018 1.00 38.00  ? 250 ALA C O     1 
ATOM   7047  C  CB    . ALA C 1 191 ? 10.036  34.601 16.615 1.00 38.00  ? 250 ALA C CB    1 
ATOM   7048  H  H     . ALA C 1 191 ? 9.593   35.425 18.969 1.00 0.00   ? 250 ALA C H     1 
ATOM   7049  N  N     . LEU C 1 192 ? 10.647  37.697 16.829 1.00 11.86  ? 251 LEU C N     1 
ATOM   7050  C  CA    . LEU C 1 192 ? 10.919  39.002 16.237 1.00 11.86  ? 251 LEU C CA    1 
ATOM   7051  C  C     . LEU C 1 192 ? 12.223  39.474 16.871 1.00 11.86  ? 251 LEU C C     1 
ATOM   7052  O  O     . LEU C 1 192 ? 13.092  40.027 16.199 1.00 34.65  ? 251 LEU C O     1 
ATOM   7053  C  CB    . LEU C 1 192 ? 9.781   39.974 16.570 1.00 34.65  ? 251 LEU C CB    1 
ATOM   7054  C  CG    . LEU C 1 192 ? 9.923   41.407 16.050 1.00 34.65  ? 251 LEU C CG    1 
ATOM   7055  C  CD1   . LEU C 1 192 ? 10.034  41.391 14.536 1.00 34.65  ? 251 LEU C CD1   1 
ATOM   7056  C  CD2   . LEU C 1 192 ? 8.765   42.269 16.515 1.00 34.65  ? 251 LEU C CD2   1 
ATOM   7057  H  H     . LEU C 1 192 ? 9.830   37.577 17.360 1.00 0.00   ? 251 LEU C H     1 
ATOM   7058  N  N     . GLY C 1 193 ? 12.341  39.244 18.178 1.00 20.10  ? 252 GLY C N     1 
ATOM   7059  C  CA    . GLY C 1 193 ? 13.543  39.610 18.904 1.00 20.10  ? 252 GLY C CA    1 
ATOM   7060  C  C     . GLY C 1 193 ? 14.801  38.910 18.410 1.00 20.10  ? 252 GLY C C     1 
ATOM   7061  O  O     . GLY C 1 193 ? 15.829  39.574 18.285 1.00 31.19  ? 252 GLY C O     1 
ATOM   7062  H  H     . GLY C 1 193 ? 11.582  38.863 18.664 1.00 0.00   ? 252 GLY C H     1 
ATOM   7063  N  N     . ALA C 1 194 ? 14.717  37.601 18.122 1.00 23.10  ? 253 ALA C N     1 
ATOM   7064  C  CA    . ALA C 1 194 ? 15.844  36.774 17.614 1.00 23.10  ? 253 ALA C CA    1 
ATOM   7065  C  C     . ALA C 1 194 ? 16.288  37.175 16.195 1.00 23.10  ? 253 ALA C C     1 
ATOM   7066  O  O     . ALA C 1 194 ? 17.477  37.193 15.867 1.00 39.73  ? 253 ALA C O     1 
ATOM   7067  C  CB    . ALA C 1 194 ? 15.470  35.311 17.625 1.00 39.73  ? 253 ALA C CB    1 
ATOM   7068  H  H     . ALA C 1 194 ? 13.843  37.165 18.251 1.00 0.00   ? 253 ALA C H     1 
ATOM   7069  N  N     . MET C 1 195 ? 15.316  37.485 15.349 1.00 10.52  ? 254 MET C N     1 
ATOM   7070  C  CA    . MET C 1 195 ? 15.569  37.928 13.993 1.00 10.52  ? 254 MET C CA    1 
ATOM   7071  C  C     . MET C 1 195 ? 16.249  39.283 14.068 1.00 10.52  ? 254 MET C C     1 
ATOM   7072  O  O     . MET C 1 195 ? 16.977  39.678 13.167 1.00 24.69  ? 254 MET C O     1 
ATOM   7073  C  CB    . MET C 1 195 ? 14.245  38.054 13.264 1.00 24.69  ? 254 MET C CB    1 
ATOM   7074  C  CG    . MET C 1 195 ? 13.583  36.744 13.034 1.00 24.69  ? 254 MET C CG    1 
ATOM   7075  S  SD    . MET C 1 195 ? 11.977  36.991 12.411 1.00 24.69  ? 254 MET C SD    1 
ATOM   7076  C  CE    . MET C 1 195 ? 12.273  37.978 11.038 1.00 24.69  ? 254 MET C CE    1 
ATOM   7077  H  H     . MET C 1 195 ? 14.399  37.391 15.672 1.00 0.00   ? 254 MET C H     1 
ATOM   7078  N  N     . ARG C 1 196 ? 16.000  40.001 15.144 1.00 23.42  ? 255 ARG C N     1 
ATOM   7079  C  CA    . ARG C 1 196 ? 16.583  41.310 15.362 1.00 23.42  ? 255 ARG C CA    1 
ATOM   7080  C  C     . ARG C 1 196 ? 18.028  41.145 15.841 1.00 23.42  ? 255 ARG C C     1 
ATOM   7081  O  O     . ARG C 1 196 ? 18.910  41.937 15.498 1.00 32.93  ? 255 ARG C O     1 
ATOM   7082  C  CB    . ARG C 1 196 ? 15.733  42.044 16.402 1.00 32.93  ? 255 ARG C CB    1 
ATOM   7083  C  CG    . ARG C 1 196 ? 16.162  43.421 16.728 1.00 32.93  ? 255 ARG C CG    1 
ATOM   7084  C  CD    . ARG C 1 196 ? 16.155  44.298 15.514 1.00 32.93  ? 255 ARG C CD    1 
ATOM   7085  N  NE    . ARG C 1 196 ? 17.356  45.110 15.564 1.00 32.93  ? 255 ARG C NE    1 
ATOM   7086  C  CZ    . ARG C 1 196 ? 17.513  46.144 16.379 1.00 32.93  ? 255 ARG C CZ    1 
ATOM   7087  N  NH1   . ARG C 1 196 ? 16.520  46.514 17.180 1.00 32.93  ? 255 ARG C NH1   1 
ATOM   7088  N  NH2   . ARG C 1 196 ? 18.716  46.678 16.536 1.00 32.93  ? 255 ARG C NH2   1 
ATOM   7089  H  H     . ARG C 1 196 ? 15.346  39.673 15.798 1.00 0.00   ? 255 ARG C H     1 
ATOM   7090  H  HE    . ARG C 1 196 ? 18.100  44.858 14.980 1.00 0.00   ? 255 ARG C HE    1 
ATOM   7091  H  HH11  . ARG C 1 196 ? 15.638  46.048 17.208 1.00 0.00   ? 255 ARG C HH11  1 
ATOM   7092  H  HH12  . ARG C 1 196 ? 16.678  47.312 17.764 1.00 0.00   ? 255 ARG C HH12  1 
ATOM   7093  H  HH21  . ARG C 1 196 ? 19.488  46.263 16.047 1.00 0.00   ? 255 ARG C HH21  1 
ATOM   7094  H  HH22  . ARG C 1 196 ? 18.872  47.458 17.139 1.00 0.00   ? 255 ARG C HH22  1 
ATOM   7095  N  N     . ALA C 1 197 ? 18.281  40.094 16.611 1.00 27.78  ? 256 ALA C N     1 
ATOM   7096  C  CA    . ALA C 1 197 ? 19.621  39.838 17.140 1.00 27.78  ? 256 ALA C CA    1 
ATOM   7097  C  C     . ALA C 1 197 ? 20.570  39.167 16.146 1.00 27.78  ? 256 ALA C C     1 
ATOM   7098  O  O     . ALA C 1 197 ? 21.788  39.224 16.293 1.00 38.67  ? 256 ALA C O     1 
ATOM   7099  C  CB    . ALA C 1 197 ? 19.517  39.013 18.390 1.00 38.67  ? 256 ALA C CB    1 
ATOM   7100  H  H     . ALA C 1 197 ? 17.542  39.499 16.854 1.00 0.00   ? 256 ALA C H     1 
ATOM   7101  N  N     . ILE C 1 198 ? 19.998  38.477 15.173 1.00 13.41  ? 257 ILE C N     1 
ATOM   7102  C  CA    . ILE C 1 198 ? 20.756  37.796 14.147 1.00 13.41  ? 257 ILE C CA    1 
ATOM   7103  C  C     . ILE C 1 198 ? 21.272  38.846 13.170 1.00 13.41  ? 257 ILE C C     1 
ATOM   7104  O  O     . ILE C 1 198 ? 22.473  38.909 12.897 1.00 17.30  ? 257 ILE C O     1 
ATOM   7105  C  CB    . ILE C 1 198 ? 19.873  36.775 13.428 1.00 17.30  ? 257 ILE C CB    1 
ATOM   7106  C  CG1   . ILE C 1 198 ? 19.469  35.661 14.405 1.00 17.30  ? 257 ILE C CG1   1 
ATOM   7107  C  CG2   . ILE C 1 198 ? 20.597  36.222 12.252 1.00 17.30  ? 257 ILE C CG2   1 
ATOM   7108  C  CD1   . ILE C 1 198 ? 18.285  34.808 13.940 1.00 17.30  ? 257 ILE C CD1   1 
ATOM   7109  H  H     . ILE C 1 198 ? 19.020  38.408 15.168 1.00 0.00   ? 257 ILE C H     1 
ATOM   7110  N  N     . THR C 1 199 ? 20.389  39.686 12.648 1.00 11.88  ? 258 THR C N     1 
ATOM   7111  C  CA    . THR C 1 199 ? 20.842  40.723 11.733 1.00 11.88  ? 258 THR C CA    1 
ATOM   7112  C  C     . THR C 1 199 ? 21.832  41.620 12.468 1.00 11.88  ? 258 THR C C     1 
ATOM   7113  O  O     . THR C 1 199 ? 22.846  42.000 11.916 1.00 26.47  ? 258 THR C O     1 
ATOM   7114  C  CB    . THR C 1 199 ? 19.698  41.551 11.214 1.00 26.47  ? 258 THR C CB    1 
ATOM   7115  O  OG1   . THR C 1 199 ? 19.083  42.219 12.310 1.00 26.47  ? 258 THR C OG1   1 
ATOM   7116  C  CG2   . THR C 1 199 ? 18.677  40.665 10.550 1.00 26.47  ? 258 THR C CG2   1 
ATOM   7117  H  H     . THR C 1 199 ? 19.433  39.644 12.863 1.00 0.00   ? 258 THR C H     1 
ATOM   7118  H  HG1   . THR C 1 199 ? 18.249  42.620 12.045 1.00 30.00  ? 258 THR C HG1   1 
ATOM   7119  N  N     . GLU C 1 200 ? 21.552  41.916 13.730 1.00 23.00  ? 259 GLU C N     1 
ATOM   7120  C  CA    . GLU C 1 200 ? 22.441  42.725 14.555 1.00 23.00  ? 259 GLU C CA    1 
ATOM   7121  C  C     . GLU C 1 200 ? 23.834  42.103 14.524 1.00 23.00  ? 259 GLU C C     1 
ATOM   7122  O  O     . GLU C 1 200 ? 24.846  42.802 14.583 1.00 31.94  ? 259 GLU C O     1 
ATOM   7123  C  CB    . GLU C 1 200 ? 21.934  42.728 16.002 1.00 31.94  ? 259 GLU C CB    1 
ATOM   7124  C  CG    . GLU C 1 200 ? 21.336  44.031 16.466 1.00 31.94  ? 259 GLU C CG    1 
ATOM   7125  C  CD    . GLU C 1 200 ? 22.338  45.140 16.441 1.00 31.94  ? 259 GLU C CD    1 
ATOM   7126  O  OE1   . GLU C 1 200 ? 23.156  45.220 17.378 1.00 31.94  ? 259 GLU C OE1   1 
ATOM   7127  O  OE2   . GLU C 1 200 ? 22.326  45.912 15.462 1.00 31.94  ? 259 GLU C OE2   1 
ATOM   7128  H  H     . GLU C 1 200 ? 20.686  41.624 14.095 1.00 0.00   ? 259 GLU C H     1 
ATOM   7129  N  N     . SER C 1 201 ? 23.861  40.775 14.449 1.00 28.26  ? 260 SER C N     1 
ATOM   7130  C  CA    . SER C 1 201 ? 25.094  40.002 14.406 1.00 28.26  ? 260 SER C CA    1 
ATOM   7131  C  C     . SER C 1 201 ? 25.687  39.839 13.006 1.00 28.26  ? 260 SER C C     1 
ATOM   7132  O  O     . SER C 1 201 ? 26.645  39.108 12.815 1.00 32.93  ? 260 SER C O     1 
ATOM   7133  C  CB    . SER C 1 201 ? 24.862  38.640 15.044 1.00 32.93  ? 260 SER C CB    1 
ATOM   7134  O  OG    . SER C 1 201 ? 24.395  38.816 16.371 1.00 32.93  ? 260 SER C OG    1 
ATOM   7135  H  H     . SER C 1 201 ? 23.027  40.275 14.431 1.00 0.00   ? 260 SER C H     1 
ATOM   7136  H  HG    . SER C 1 201 ? 23.513  39.152 16.429 1.00 30.00  ? 260 SER C HG    1 
ATOM   7137  N  N     . GLY C 1 202 ? 25.118  40.512 12.025 1.00 27.34  ? 261 GLY C N     1 
ATOM   7138  C  CA    . GLY C 1 202 ? 25.659  40.411 10.688 1.00 27.34  ? 261 GLY C CA    1 
ATOM   7139  C  C     . GLY C 1 202 ? 25.354  39.107 10.000 1.00 27.34  ? 261 GLY C C     1 
ATOM   7140  O  O     . GLY C 1 202 ? 26.099  38.657 9.129  1.00 44.11  ? 261 GLY C O     1 
ATOM   7141  H  H     . GLY C 1 202 ? 24.367  41.096 12.203 1.00 0.00   ? 261 GLY C H     1 
ATOM   7142  N  N     . LEU C 1 203 ? 24.265  38.476 10.410 1.00 36.27  ? 262 LEU C N     1 
ATOM   7143  C  CA    . LEU C 1 203 ? 23.845  37.229 9.798  1.00 36.27  ? 262 LEU C CA    1 
ATOM   7144  C  C     . LEU C 1 203 ? 22.498  37.538 9.147  1.00 36.27  ? 262 LEU C C     1 
ATOM   7145  O  O     . LEU C 1 203 ? 21.900  38.581 9.419  1.00 20.34  ? 262 LEU C O     1 
ATOM   7146  C  CB    . LEU C 1 203 ? 23.713  36.123 10.855 1.00 20.34  ? 262 LEU C CB    1 
ATOM   7147  C  CG    . LEU C 1 203 ? 24.980  35.753 11.637 1.00 20.34  ? 262 LEU C CG    1 
ATOM   7148  C  CD1   . LEU C 1 203 ? 24.660  34.783 12.750 1.00 20.34  ? 262 LEU C CD1   1 
ATOM   7149  C  CD2   . LEU C 1 203 ? 25.988  35.136 10.722 1.00 20.34  ? 262 LEU C CD2   1 
ATOM   7150  H  H     . LEU C 1 203 ? 23.711  38.863 11.120 1.00 0.00   ? 262 LEU C H     1 
ATOM   7151  N  N     . ARG C 1 204 ? 22.052  36.669 8.248  1.00 16.87  ? 263 ARG C N     1 
ATOM   7152  C  CA    . ARG C 1 204 ? 20.778  36.848 7.584  1.00 16.87  ? 263 ARG C CA    1 
ATOM   7153  C  C     . ARG C 1 204 ? 19.824  35.819 8.165  1.00 16.87  ? 263 ARG C C     1 
ATOM   7154  O  O     . ARG C 1 204 ? 20.250  34.760 8.600  1.00 25.94  ? 263 ARG C O     1 
ATOM   7155  C  CB    . ARG C 1 204 ? 20.922  36.597 6.077  1.00 25.94  ? 263 ARG C CB    1 
ATOM   7156  C  CG    . ARG C 1 204 ? 21.738  37.640 5.314  1.00 25.94  ? 263 ARG C CG    1 
ATOM   7157  C  CD    . ARG C 1 204 ? 22.990  37.051 4.649  1.00 25.94  ? 263 ARG C CD    1 
ATOM   7158  N  NE    . ARG C 1 204 ? 22.710  36.350 3.390  1.00 25.94  ? 263 ARG C NE    1 
ATOM   7159  C  CZ    . ARG C 1 204 ? 23.438  35.344 2.907  1.00 25.94  ? 263 ARG C CZ    1 
ATOM   7160  N  NH1   . ARG C 1 204 ? 24.499  34.895 3.565  1.00 25.94  ? 263 ARG C NH1   1 
ATOM   7161  N  NH2   . ARG C 1 204 ? 23.097  34.778 1.762  1.00 25.94  ? 263 ARG C NH2   1 
ATOM   7162  H  H     . ARG C 1 204 ? 22.584  35.874 8.057  1.00 0.00   ? 263 ARG C H     1 
ATOM   7163  H  HE    . ARG C 1 204 ? 21.928  36.632 2.870  1.00 0.00   ? 263 ARG C HE    1 
ATOM   7164  H  HH11  . ARG C 1 204 ? 24.764  35.320 4.430  1.00 0.00   ? 263 ARG C HH11  1 
ATOM   7165  H  HH12  . ARG C 1 204 ? 25.042  34.144 3.189  1.00 0.00   ? 263 ARG C HH12  1 
ATOM   7166  H  HH21  . ARG C 1 204 ? 22.291  35.100 1.263  1.00 0.00   ? 263 ARG C HH21  1 
ATOM   7167  H  HH22  . ARG C 1 204 ? 23.642  34.022 1.400  1.00 0.00   ? 263 ARG C HH22  1 
ATOM   7168  N  N     . VAL C 1 205 ? 18.541  36.144 8.198  1.00 25.18  ? 264 VAL C N     1 
ATOM   7169  C  CA    . VAL C 1 205 ? 17.543  35.210 8.686  1.00 25.18  ? 264 VAL C CA    1 
ATOM   7170  C  C     . VAL C 1 205 ? 17.166  34.389 7.454  1.00 25.18  ? 264 VAL C C     1 
ATOM   7171  O  O     . VAL C 1 205 ? 17.152  34.911 6.327  1.00 33.01  ? 264 VAL C O     1 
ATOM   7172  C  CB    . VAL C 1 205 ? 16.306  35.918 9.248  1.00 33.01  ? 264 VAL C CB    1 
ATOM   7173  C  CG1   . VAL C 1 205 ? 15.391  34.913 9.875  1.00 33.01  ? 264 VAL C CG1   1 
ATOM   7174  C  CG2   . VAL C 1 205 ? 16.712  36.940 10.289 1.00 33.01  ? 264 VAL C CG2   1 
ATOM   7175  H  H     . VAL C 1 205 ? 18.255  37.019 7.868  1.00 0.00   ? 264 VAL C H     1 
ATOM   7176  N  N     . GLY C 1 206 ? 16.915  33.098 7.654  1.00 19.15  ? 265 GLY C N     1 
ATOM   7177  C  CA    . GLY C 1 206 ? 16.595  32.233 6.541  1.00 19.15  ? 265 GLY C CA    1 
ATOM   7178  C  C     . GLY C 1 206 ? 17.951  31.810 6.015  1.00 19.15  ? 265 GLY C C     1 
ATOM   7179  O  O     . GLY C 1 206 ? 18.469  30.761 6.391  1.00 34.08  ? 265 GLY C O     1 
ATOM   7180  H  H     . GLY C 1 206 ? 16.964  32.730 8.564  1.00 0.00   ? 265 GLY C H     1 
ATOM   7181  N  N     . ALA C 1 207 ? 18.574  32.704 5.254  1.00 28.32  ? 266 ALA C N     1 
ATOM   7182  C  CA    . ALA C 1 207 ? 19.883  32.471 4.657  1.00 28.32  ? 266 ALA C CA    1 
ATOM   7183  C  C     . ALA C 1 207 ? 21.007  31.988 5.585  1.00 28.32  ? 266 ALA C C     1 
ATOM   7184  O  O     . ALA C 1 207 ? 21.839  31.191 5.159  1.00 33.69  ? 266 ALA C O     1 
ATOM   7185  C  CB    . ALA C 1 207 ? 20.324  33.688 3.915  1.00 33.69  ? 266 ALA C CB    1 
ATOM   7186  H  H     . ALA C 1 207 ? 18.102  33.553 5.100  1.00 0.00   ? 266 ALA C H     1 
ATOM   7187  N  N     . ASP C 1 208 ? 21.096  32.506 6.810  1.00 19.15  ? 267 ASP C N     1 
ATOM   7188  C  CA    . ASP C 1 208 ? 22.144  32.048 7.735  1.00 19.15  ? 267 ASP C CA    1 
ATOM   7189  C  C     . ASP C 1 208 ? 21.569  31.269 8.908  1.00 19.15  ? 267 ASP C C     1 
ATOM   7190  O  O     . ASP C 1 208 ? 21.988  30.136 9.163  1.00 36.20  ? 267 ASP C O     1 
ATOM   7191  C  CB    . ASP C 1 208 ? 22.986  33.209 8.232  1.00 36.20  ? 267 ASP C CB    1 
ATOM   7192  C  CG    . ASP C 1 208 ? 23.897  33.750 7.165  1.00 36.20  ? 267 ASP C CG    1 
ATOM   7193  O  OD1   . ASP C 1 208 ? 23.435  34.588 6.373  1.00 36.20  ? 267 ASP C OD1   1 
ATOM   7194  O  OD2   . ASP C 1 208 ? 25.073  33.329 7.112  1.00 36.20  ? 267 ASP C OD2   1 
ATOM   7195  H  H     . ASP C 1 208 ? 20.440  33.158 7.125  1.00 0.00   ? 267 ASP C H     1 
ATOM   7196  N  N     . ILE C 1 209 ? 20.569  31.856 9.572  1.00 21.97  ? 268 ILE C N     1 
ATOM   7197  C  CA    . ILE C 1 209 ? 19.903  31.240 10.714 1.00 21.97  ? 268 ILE C CA    1 
ATOM   7198  C  C     . ILE C 1 209 ? 18.390  31.290 10.567 1.00 21.97  ? 268 ILE C C     1 
ATOM   7199  O  O     . ILE C 1 209 ? 17.806  32.364 10.426 1.00 13.13  ? 268 ILE C O     1 
ATOM   7200  C  CB    . ILE C 1 209 ? 20.319  31.873 12.034 1.00 13.13  ? 268 ILE C CB    1 
ATOM   7201  C  CG1   . ILE C 1 209 ? 21.820  31.707 12.237 1.00 13.13  ? 268 ILE C CG1   1 
ATOM   7202  C  CG2   . ILE C 1 209 ? 19.653  31.175 13.161 1.00 13.13  ? 268 ILE C CG2   1 
ATOM   7203  C  CD1   . ILE C 1 209 ? 22.283  32.238 13.544 1.00 13.13  ? 268 ILE C CD1   1 
ATOM   7204  H  H     . ILE C 1 209 ? 20.263  32.744 9.297  1.00 0.00   ? 268 ILE C H     1 
ATOM   7205  N  N     . SER C 1 210 ? 17.773  30.105 10.556 1.00 21.72  ? 269 SER C N     1 
ATOM   7206  C  CA    . SER C 1 210 ? 16.330  29.933 10.384 1.00 21.72  ? 269 SER C CA    1 
ATOM   7207  C  C     . SER C 1 210 ? 15.663  30.094 11.718 1.00 21.72  ? 269 SER C C     1 
ATOM   7208  O  O     . SER C 1 210 ? 16.228  29.715 12.731 1.00 32.21  ? 269 SER C O     1 
ATOM   7209  C  CB    . SER C 1 210 ? 16.025  28.534 9.833  1.00 32.21  ? 269 SER C CB    1 
ATOM   7210  O  OG    . SER C 1 210 ? 16.692  28.268 8.600  1.00 32.21  ? 269 SER C OG    1 
ATOM   7211  H  H     . SER C 1 210 ? 18.333  29.314 10.690 1.00 0.00   ? 269 SER C H     1 
ATOM   7212  H  HG    . SER C 1 210 ? 17.572  28.668 8.616  1.00 30.00  ? 269 SER C HG    1 
ATOM   7213  N  N     . VAL C 1 211 ? 14.469  30.672 11.709 1.00 16.76  ? 270 VAL C N     1 
ATOM   7214  C  CA    . VAL C 1 211 ? 13.699  30.898 12.916 1.00 16.76  ? 270 VAL C CA    1 
ATOM   7215  C  C     . VAL C 1 211 ? 12.256  30.472 12.703 1.00 16.76  ? 270 VAL C C     1 
ATOM   7216  O  O     . VAL C 1 211 ? 11.639  30.857 11.712 1.00 17.40  ? 270 VAL C O     1 
ATOM   7217  C  CB    . VAL C 1 211 ? 13.693  32.368 13.311 1.00 17.40  ? 270 VAL C CB    1 
ATOM   7218  C  CG1   . VAL C 1 211 ? 12.892  32.565 14.584 1.00 17.40  ? 270 VAL C CG1   1 
ATOM   7219  C  CG2   . VAL C 1 211 ? 15.100  32.848 13.516 1.00 17.40  ? 270 VAL C CG2   1 
ATOM   7220  H  H     . VAL C 1 211 ? 14.072  30.930 10.850 1.00 0.00   ? 270 VAL C H     1 
ATOM   7221  N  N     . VAL C 1 212 ? 11.761  29.617 13.601 1.00 18.32  ? 271 VAL C N     1 
ATOM   7222  C  CA    . VAL C 1 212 ? 10.377  29.129 13.605 1.00 18.32  ? 271 VAL C CA    1 
ATOM   7223  C  C     . VAL C 1 212 ? 9.722   29.763 14.842 1.00 18.32  ? 271 VAL C C     1 
ATOM   7224  O  O     . VAL C 1 212 ? 10.306  29.765 15.930 1.00 11.38  ? 271 VAL C O     1 
ATOM   7225  C  CB    . VAL C 1 212 ? 10.325  27.596 13.706 1.00 11.38  ? 271 VAL C CB    1 
ATOM   7226  C  CG1   . VAL C 1 212 ? 8.918   27.137 13.701 1.00 11.38  ? 271 VAL C CG1   1 
ATOM   7227  C  CG2   . VAL C 1 212 ? 11.065  26.986 12.542 1.00 11.38  ? 271 VAL C CG2   1 
ATOM   7228  H  H     . VAL C 1 212 ? 12.343  29.286 14.317 1.00 0.00   ? 271 VAL C H     1 
ATOM   7229  N  N     . GLY C 1 213 ? 8.562   30.390 14.665 1.00 12.47  ? 272 GLY C N     1 
ATOM   7230  C  CA    . GLY C 1 213 ? 7.914   31.033 15.794 1.00 12.47  ? 272 GLY C CA    1 
ATOM   7231  C  C     . GLY C 1 213 ? 6.988   30.060 16.456 1.00 12.47  ? 272 GLY C C     1 
ATOM   7232  O  O     . GLY C 1 213 ? 7.233   28.848 16.459 1.00 30.51  ? 272 GLY C O     1 
ATOM   7233  H  H     . GLY C 1 213 ? 8.143   30.389 13.785 1.00 0.00   ? 272 GLY C H     1 
ATOM   7234  N  N     . TYR C 1 214 ? 5.902   30.599 16.996 1.00 24.11  ? 273 TYR C N     1 
ATOM   7235  C  CA    . TYR C 1 214 ? 4.891   29.809 17.673 1.00 24.11  ? 273 TYR C CA    1 
ATOM   7236  C  C     . TYR C 1 214 ? 3.769   30.798 18.030 1.00 24.11  ? 273 TYR C C     1 
ATOM   7237  O  O     . TYR C 1 214 ? 4.063   31.845 18.615 1.00 13.79  ? 273 TYR C O     1 
ATOM   7238  C  CB    . TYR C 1 214 ? 5.510   29.168 18.929 1.00 13.79  ? 273 TYR C CB    1 
ATOM   7239  C  CG    . TYR C 1 214 ? 4.868   27.865 19.325 1.00 13.79  ? 273 TYR C CG    1 
ATOM   7240  C  CD1   . TYR C 1 214 ? 3.584   27.849 19.805 1.00 13.79  ? 273 TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C 1 214 ? 5.511   26.647 19.144 1.00 13.79  ? 273 TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C 1 214 ? 2.937   26.681 20.084 1.00 13.79  ? 273 TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C 1 214 ? 4.864   25.458 19.427 1.00 13.79  ? 273 TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C 1 214 ? 3.563   25.500 19.894 1.00 13.79  ? 273 TYR C CZ    1 
ATOM   7245  O  OH    . TYR C 1 214 ? 2.810   24.385 20.142 1.00 13.79  ? 273 TYR C OH    1 
ATOM   7246  H  H     . TYR C 1 214 ? 5.762   31.565 16.997 1.00 0.00   ? 273 TYR C H     1 
ATOM   7247  H  HH    . TYR C 1 214 ? 1.922   24.639 20.395 1.00 0.00   ? 273 TYR C HH    1 
ATOM   7248  N  N     . ASP C 1 215 ? 2.536   30.511 17.571 1.00 13.77  ? 274 ASP C N     1 
ATOM   7249  C  CA    . ASP C 1 215 ? 1.296   31.306 17.785 1.00 13.77  ? 274 ASP C CA    1 
ATOM   7250  C  C     . ASP C 1 215 ? 0.589   31.774 16.515 1.00 13.77  ? 274 ASP C C     1 
ATOM   7251  O  O     . ASP C 1 215 ? -0.558  31.435 16.242 1.00 29.70  ? 274 ASP C O     1 
ATOM   7252  C  CB    . ASP C 1 215 ? 1.526   32.588 18.600 1.00 29.70  ? 274 ASP C CB    1 
ATOM   7253  C  CG    . ASP C 1 215 ? 1.483   32.378 20.080 1.00 29.70  ? 274 ASP C CG    1 
ATOM   7254  O  OD1   . ASP C 1 215 ? 0.981   31.343 20.534 1.00 29.70  ? 274 ASP C OD1   1 
ATOM   7255  O  OD2   . ASP C 1 215 ? 1.959   33.272 20.795 1.00 29.70  ? 274 ASP C OD2   1 
ATOM   7256  H  H     . ASP C 1 215 ? 2.438   29.675 17.071 1.00 0.00   ? 274 ASP C H     1 
ATOM   7257  N  N     . ASP C 1 216 ? 1.284   32.650 15.806 1.00 11.68  ? 275 ASP C N     1 
ATOM   7258  C  CA    . ASP C 1 216 ? 0.819   33.314 14.599 1.00 11.68  ? 275 ASP C CA    1 
ATOM   7259  C  C     . ASP C 1 216 ? -0.056  34.482 15.000 1.00 11.68  ? 275 ASP C C     1 
ATOM   7260  O  O     . ASP C 1 216 ? -1.229  34.597 14.606 1.00 19.58  ? 275 ASP C O     1 
ATOM   7261  C  CB    . ASP C 1 216 ? 0.097   32.410 13.605 1.00 19.58  ? 275 ASP C CB    1 
ATOM   7262  C  CG    . ASP C 1 216 ? 0.005   33.038 12.213 1.00 19.58  ? 275 ASP C CG    1 
ATOM   7263  O  OD1   . ASP C 1 216 ? 1.010   33.659 11.801 1.00 19.58  ? 275 ASP C OD1   1 
ATOM   7264  O  OD2   . ASP C 1 216 ? -1.053  32.914 11.530 1.00 19.58  ? 275 ASP C OD2   1 
ATOM   7265  H  H     . ASP C 1 216 ? 2.183   32.864 16.119 1.00 0.00   ? 275 ASP C H     1 
ATOM   7266  N  N     . THR C 1 217 ? 0.527   35.347 15.822 1.00 14.13  ? 276 THR C N     1 
ATOM   7267  C  CA    . THR C 1 217 ? -0.157  36.540 16.250 1.00 14.13  ? 276 THR C CA    1 
ATOM   7268  C  C     . THR C 1 217 ? -0.165  37.462 15.044 1.00 14.13  ? 276 THR C C     1 
ATOM   7269  O  O     . THR C 1 217 ? 0.773   37.451 14.253 1.00 17.20  ? 276 THR C O     1 
ATOM   7270  C  CB    . THR C 1 217 ? 0.568   37.154 17.384 1.00 17.20  ? 276 THR C CB    1 
ATOM   7271  O  OG1   . THR C 1 217 ? 1.964   37.000 17.157 1.00 17.20  ? 276 THR C OG1   1 
ATOM   7272  C  CG2   . THR C 1 217 ? 0.210   36.447 18.640 1.00 17.20  ? 276 THR C CG2   1 
ATOM   7273  H  H     . THR C 1 217 ? 1.430   35.234 16.161 1.00 0.00   ? 276 THR C H     1 
ATOM   7274  H  HG1   . THR C 1 217 ? 2.263   37.401 16.327 1.00 30.00  ? 276 THR C HG1   1 
ATOM   7275  N  N     . GLU C 1 218 ? -1.251  38.193 14.862 1.00 30.90  ? 277 GLU C N     1 
ATOM   7276  C  CA    . GLU C 1 218 ? -1.432  39.106 13.741 1.00 30.90  ? 277 GLU C CA    1 
ATOM   7277  C  C     . GLU C 1 218 ? -0.254  39.651 12.936 1.00 30.90  ? 277 GLU C C     1 
ATOM   7278  O  O     . GLU C 1 218 ? -0.150  39.409 11.741 1.00 25.08  ? 277 GLU C O     1 
ATOM   7279  C  CB    . GLU C 1 218 ? -2.241  40.284 14.202 1.00 25.08  ? 277 GLU C CB    1 
ATOM   7280  C  CG    . GLU C 1 218 ? -3.293  40.643 13.241 1.00 25.08  ? 277 GLU C CG    1 
ATOM   7281  C  CD    . GLU C 1 218 ? -4.375  39.609 13.202 1.00 25.08  ? 277 GLU C CD    1 
ATOM   7282  O  OE1   . GLU C 1 218 ? -4.758  39.104 14.290 1.00 25.08  ? 277 GLU C OE1   1 
ATOM   7283  O  OE2   . GLU C 1 218 ? -4.829  39.304 12.070 1.00 25.08  ? 277 GLU C OE2   1 
ATOM   7284  H  H     . GLU C 1 218 ? -2.018  38.078 15.458 1.00 0.00   ? 277 GLU C H     1 
ATOM   7285  N  N     . ASP C 1 219 ? 0.592   40.430 13.604 1.00 15.76  ? 278 ASP C N     1 
ATOM   7286  C  CA    . ASP C 1 219 ? 1.754   41.111 13.014 1.00 15.76  ? 278 ASP C CA    1 
ATOM   7287  C  C     . ASP C 1 219 ? 2.696   40.242 12.204 1.00 15.76  ? 278 ASP C C     1 
ATOM   7288  O  O     . ASP C 1 219 ? 3.295   40.732 11.248 1.00 27.65  ? 278 ASP C O     1 
ATOM   7289  C  CB    . ASP C 1 219 ? 2.580   41.807 14.112 1.00 27.65  ? 278 ASP C CB    1 
ATOM   7290  C  CG    . ASP C 1 219 ? 1.878   43.027 14.742 1.00 27.65  ? 278 ASP C CG    1 
ATOM   7291  O  OD1   . ASP C 1 219 ? 0.666   43.229 14.527 1.00 27.65  ? 278 ASP C OD1   1 
ATOM   7292  O  OD2   . ASP C 1 219 ? 2.572   43.792 15.464 1.00 27.65  ? 278 ASP C OD2   1 
ATOM   7293  H  H     . ASP C 1 219 ? 0.430   40.518 14.557 1.00 0.00   ? 278 ASP C H     1 
ATOM   7294  N  N     . SER C 1 220 ? 2.793   38.955 12.559 1.00 9.91   ? 279 SER C N     1 
ATOM   7295  C  CA    . SER C 1 220 ? 3.711   37.996 11.931 1.00 9.91   ? 279 SER C CA    1 
ATOM   7296  C  C     . SER C 1 220 ? 3.709   37.742 10.432 1.00 9.91   ? 279 SER C C     1 
ATOM   7297  O  O     . SER C 1 220 ? 4.719   37.282 9.940  1.00 19.07  ? 279 SER C O     1 
ATOM   7298  C  CB    . SER C 1 220 ? 3.646   36.655 12.643 1.00 19.07  ? 279 SER C CB    1 
ATOM   7299  O  OG    . SER C 1 220 ? 3.882   36.791 14.031 1.00 19.07  ? 279 SER C OG    1 
ATOM   7300  H  H     . SER C 1 220 ? 2.223   38.604 13.272 1.00 0.00   ? 279 SER C H     1 
ATOM   7301  H  HG    . SER C 1 220 ? 4.640   37.380 14.106 1.00 30.00  ? 279 SER C HG    1 
ATOM   7302  N  N     . SER C 1 221 ? 2.592   37.951 9.721  1.00 10.00  ? 280 SER C N     1 
ATOM   7303  C  CA    . SER C 1 221 ? 2.547   37.747 8.264  1.00 10.00  ? 280 SER C CA    1 
ATOM   7304  C  C     . SER C 1 221 ? 3.603   38.741 7.794  1.00 10.00  ? 280 SER C C     1 
ATOM   7305  O  O     . SER C 1 221 ? 4.273   38.570 6.765  1.00 22.69  ? 280 SER C O     1 
ATOM   7306  C  CB    . SER C 1 221 ? 1.213   38.175 7.646  1.00 22.69  ? 280 SER C CB    1 
ATOM   7307  O  OG    . SER C 1 221 ? 0.156   38.287 8.572  1.00 22.69  ? 280 SER C OG    1 
ATOM   7308  H  H     . SER C 1 221 ? 1.796   38.253 10.208 1.00 0.00   ? 280 SER C H     1 
ATOM   7309  H  HG    . SER C 1 221 ? -0.070  37.427 8.955  1.00 30.00  ? 280 SER C HG    1 
ATOM   7310  N  N     . CYS C 1 222 ? 3.637   39.855 8.501  1.00 16.03  ? 281 CYS C N     1 
ATOM   7311  C  CA    . CYS C 1 222 ? 4.612   40.866 8.240  1.00 16.03  ? 281 CYS C CA    1 
ATOM   7312  C  C     . CYS C 1 222 ? 5.740   40.439 9.185  1.00 16.03  ? 281 CYS C C     1 
ATOM   7313  O  O     . CYS C 1 222 ? 5.577   39.424 9.850  1.00 38.62  ? 281 CYS C O     1 
ATOM   7314  C  CB    . CYS C 1 222 ? 4.114   42.213 8.645  1.00 38.62  ? 281 CYS C CB    1 
ATOM   7315  S  SG    . CYS C 1 222 ? 5.633   43.103 8.874  1.00 38.62  ? 281 CYS C SG    1 
ATOM   7316  H  H     . CYS C 1 222 ? 3.093   39.941 9.311  1.00 0.00   ? 281 CYS C H     1 
ATOM   7317  N  N     . TYR C 1 223 ? 6.828   41.197 9.291  1.00 13.69  ? 282 TYR C N     1 
ATOM   7318  C  CA    . TYR C 1 223 ? 8.006   40.891 10.114 1.00 13.69  ? 282 TYR C CA    1 
ATOM   7319  C  C     . TYR C 1 223 ? 8.973   40.765 8.959  1.00 13.69  ? 282 TYR C C     1 
ATOM   7320  O  O     . TYR C 1 223 ? 8.549   40.476 7.832  1.00 20.08  ? 282 TYR C O     1 
ATOM   7321  C  CB    . TYR C 1 223 ? 7.954   39.543 10.868 1.00 20.08  ? 282 TYR C CB    1 
ATOM   7322  C  CG    . TYR C 1 223 ? 7.371   39.619 12.262 1.00 20.08  ? 282 TYR C CG    1 
ATOM   7323  C  CD1   . TYR C 1 223 ? 6.418   40.585 12.577 1.00 20.08  ? 282 TYR C CD1   1 
ATOM   7324  C  CD2   . TYR C 1 223 ? 7.749   38.706 13.262 1.00 20.08  ? 282 TYR C CD2   1 
ATOM   7325  C  CE1   . TYR C 1 223 ? 5.843   40.637 13.843 1.00 20.08  ? 282 TYR C CE1   1 
ATOM   7326  C  CE2   . TYR C 1 223 ? 7.179   38.754 14.548 1.00 20.08  ? 282 TYR C CE2   1 
ATOM   7327  C  CZ    . TYR C 1 223 ? 6.215   39.723 14.831 1.00 20.08  ? 282 TYR C CZ    1 
ATOM   7328  O  OH    . TYR C 1 223 ? 5.550   39.785 16.056 1.00 20.08  ? 282 TYR C OH    1 
ATOM   7329  H  H     . TYR C 1 223 ? 7.022   41.926 8.689  1.00 0.00   ? 282 TYR C H     1 
ATOM   7330  H  HH    . TYR C 1 223 ? 5.881   39.088 16.629 1.00 0.00   ? 282 TYR C HH    1 
ATOM   7331  N  N     . ILE C 1 224 ? 10.257  40.995 9.185  1.00 22.24  ? 283 ILE C N     1 
ATOM   7332  C  CA    . ILE C 1 224 ? 11.151  40.916 8.051  1.00 22.24  ? 283 ILE C CA    1 
ATOM   7333  C  C     . ILE C 1 224 ? 12.323  40.030 8.271  1.00 22.24  ? 283 ILE C C     1 
ATOM   7334  O  O     . ILE C 1 224 ? 13.184  40.323 9.071  1.00 25.80  ? 283 ILE C O     1 
ATOM   7335  C  CB    . ILE C 1 224 ? 11.592  42.308 7.591  1.00 25.80  ? 283 ILE C CB    1 
ATOM   7336  C  CG1   . ILE C 1 224 ? 10.489  42.936 6.736  1.00 25.80  ? 283 ILE C CG1   1 
ATOM   7337  C  CG2   . ILE C 1 224 ? 12.909  42.233 6.836  1.00 25.80  ? 283 ILE C CG2   1 
ATOM   7338  C  CD1   . ILE C 1 224 ? 9.921   44.213 7.319  1.00 25.80  ? 283 ILE C CD1   1 
ATOM   7339  H  H     . ILE C 1 224 ? 10.631  41.188 10.065 1.00 0.00   ? 283 ILE C H     1 
ATOM   7340  N  N     . PRO C 1 225 ? 12.355  38.906 7.572  1.00 13.93  ? 284 PRO C N     1 
ATOM   7341  C  CA    . PRO C 1 225 ? 11.369  38.421 6.605  1.00 13.93  ? 284 PRO C CA    1 
ATOM   7342  C  C     . PRO C 1 225 ? 10.200  37.773 7.314  1.00 13.93  ? 284 PRO C C     1 
ATOM   7343  O  O     . PRO C 1 225 ? 10.299  37.465 8.501  1.00 16.72  ? 284 PRO C O     1 
ATOM   7344  C  CB    . PRO C 1 225 ? 12.154  37.378 5.840  1.00 16.72  ? 284 PRO C CB    1 
ATOM   7345  C  CG    . PRO C 1 225 ? 13.016  36.816 6.875  1.00 16.72  ? 284 PRO C CG    1 
ATOM   7346  C  CD    . PRO C 1 225 ? 13.542  38.040 7.568  1.00 16.72  ? 284 PRO C CD    1 
ATOM   7347  N  N     . PRO C 1 226 ? 9.103   37.507 6.588  1.00 12.87  ? 285 PRO C N     1 
ATOM   7348  C  CA    . PRO C 1 226 ? 7.883   36.887 7.111  1.00 12.87  ? 285 PRO C CA    1 
ATOM   7349  C  C     . PRO C 1 226 ? 8.183   35.647 7.962  1.00 12.87  ? 285 PRO C C     1 
ATOM   7350  O  O     . PRO C 1 226 ? 8.860   34.713 7.500  1.00 15.08  ? 285 PRO C O     1 
ATOM   7351  C  CB    . PRO C 1 226 ? 7.134   36.518 5.854  1.00 15.08  ? 285 PRO C CB    1 
ATOM   7352  C  CG    . PRO C 1 226 ? 7.586   37.541 4.883  1.00 15.08  ? 285 PRO C CG    1 
ATOM   7353  C  CD    . PRO C 1 226 ? 9.022   37.658 5.124  1.00 15.08  ? 285 PRO C CD    1 
ATOM   7354  N  N     . LEU C 1 227 ? 7.613   35.628 9.168  1.00 18.75  ? 286 LEU C N     1 
ATOM   7355  C  CA    . LEU C 1 227 ? 7.802   34.580 10.166 1.00 18.75  ? 286 LEU C CA    1 
ATOM   7356  C  C     . LEU C 1 227 ? 7.071   33.270 9.972  1.00 18.75  ? 286 LEU C C     1 
ATOM   7357  O  O     . LEU C 1 227 ? 5.839   33.252 10.042 1.00 12.54  ? 286 LEU C O     1 
ATOM   7358  C  CB    . LEU C 1 227 ? 7.382   35.119 11.530 1.00 12.54  ? 286 LEU C CB    1 
ATOM   7359  C  CG    . LEU C 1 227 ? 7.701   34.261 12.748 1.00 12.54  ? 286 LEU C CG    1 
ATOM   7360  C  CD1   . LEU C 1 227 ? 9.112   33.765 12.676 1.00 12.54  ? 286 LEU C CD1   1 
ATOM   7361  C  CD2   . LEU C 1 227 ? 7.509   35.070 13.991 1.00 12.54  ? 286 LEU C CD2   1 
ATOM   7362  H  H     . LEU C 1 227 ? 7.009   36.373 9.388  1.00 0.00   ? 286 LEU C H     1 
ATOM   7363  N  N     . THR C 1 228 ? 7.808   32.174 9.770  1.00 18.53  ? 287 THR C N     1 
ATOM   7364  C  CA    . THR C 1 228 ? 7.158   30.861 9.652  1.00 18.53  ? 287 THR C CA    1 
ATOM   7365  C  C     . THR C 1 228 ? 6.880   30.512 11.107 1.00 18.53  ? 287 THR C C     1 
ATOM   7366  O  O     . THR C 1 228 ? 7.760   30.633 11.966 1.00 25.13  ? 287 THR C O     1 
ATOM   7367  C  CB    . THR C 1 228 ? 8.053   29.790 8.972  1.00 25.13  ? 287 THR C CB    1 
ATOM   7368  O  OG1   . THR C 1 228 ? 7.560   28.469 9.268  1.00 25.13  ? 287 THR C OG1   1 
ATOM   7369  C  CG2   . THR C 1 228 ? 9.471   29.914 9.422  1.00 25.13  ? 287 THR C CG2   1 
ATOM   7370  H  H     . THR C 1 228 ? 8.785   32.267 9.729  1.00 0.00   ? 287 THR C H     1 
ATOM   7371  H  HG1   . THR C 1 228 ? 7.676   28.303 10.212 1.00 30.00  ? 287 THR C HG1   1 
ATOM   7372  N  N     . THR C 1 229 ? 5.667   30.073 11.395 1.00 25.28  ? 288 THR C N     1 
ATOM   7373  C  CA    . THR C 1 229 ? 5.305   29.825 12.772 1.00 25.28  ? 288 THR C CA    1 
ATOM   7374  C  C     . THR C 1 229 ? 4.262   28.728 12.908 1.00 25.28  ? 288 THR C C     1 
ATOM   7375  O  O     . THR C 1 229 ? 3.825   28.178 11.916 1.00 34.00  ? 288 THR C O     1 
ATOM   7376  C  CB    . THR C 1 229 ? 4.764   31.146 13.336 1.00 34.00  ? 288 THR C CB    1 
ATOM   7377  O  OG1   . THR C 1 229 ? 4.821   31.145 14.767 1.00 34.00  ? 288 THR C OG1   1 
ATOM   7378  C  CG2   . THR C 1 229 ? 3.350   31.384 12.868 1.00 34.00  ? 288 THR C CG2   1 
ATOM   7379  H  H     . THR C 1 229 ? 5.024   29.889 10.670 1.00 0.00   ? 288 THR C H     1 
ATOM   7380  H  HG1   . THR C 1 229 ? 5.683   31.524 14.930 1.00 30.00  ? 288 THR C HG1   1 
ATOM   7381  N  N     . ILE C 1 230 ? 3.887   28.408 14.142 1.00 16.19  ? 289 ILE C N     1 
ATOM   7382  C  CA    . ILE C 1 230 ? 2.887   27.389 14.431 1.00 16.19  ? 289 ILE C CA    1 
ATOM   7383  C  C     . ILE C 1 230 ? 1.618   28.148 14.765 1.00 16.19  ? 289 ILE C C     1 
ATOM   7384  O  O     . ILE C 1 230 ? 1.499   28.670 15.872 1.00 12.05  ? 289 ILE C O     1 
ATOM   7385  C  CB    . ILE C 1 230 ? 3.281   26.514 15.667 1.00 12.05  ? 289 ILE C CB    1 
ATOM   7386  C  CG1   . ILE C 1 230 ? 4.589   25.768 15.424 1.00 12.05  ? 289 ILE C CG1   1 
ATOM   7387  C  CG2   . ILE C 1 230 ? 2.258   25.442 15.908 1.00 12.05  ? 289 ILE C CG2   1 
ATOM   7388  C  CD1   . ILE C 1 230 ? 4.527   24.811 14.275 1.00 12.05  ? 289 ILE C CD1   1 
ATOM   7389  H  H     . ILE C 1 230 ? 4.294   28.884 14.897 1.00 0.00   ? 289 ILE C H     1 
ATOM   7390  N  N     . LYS C 1 231 ? 0.677   28.231 13.827 1.00 13.46  ? 290 LYS C N     1 
ATOM   7391  C  CA    . LYS C 1 231 ? -0.553  28.968 14.081 1.00 13.46  ? 290 LYS C CA    1 
ATOM   7392  C  C     . LYS C 1 231 ? -1.468  28.300 15.065 1.00 13.46  ? 290 LYS C C     1 
ATOM   7393  O  O     . LYS C 1 231 ? -1.799  27.123 14.922 1.00 14.24  ? 290 LYS C O     1 
ATOM   7394  C  CB    . LYS C 1 231 ? -1.359  29.209 12.818 1.00 14.24  ? 290 LYS C CB    1 
ATOM   7395  C  CG    . LYS C 1 231 ? -2.615  30.022 13.102 1.00 14.24  ? 290 LYS C CG    1 
ATOM   7396  C  CD    . LYS C 1 231 ? -3.425  30.228 11.866 1.00 14.24  ? 290 LYS C CD    1 
ATOM   7397  C  CE    . LYS C 1 231 ? -4.506  31.264 12.036 1.00 14.24  ? 290 LYS C CE    1 
ATOM   7398  N  NZ    . LYS C 1 231 ? -3.967  32.635 12.009 1.00 14.24  ? 290 LYS C NZ    1 
ATOM   7399  H  H     . LYS C 1 231 ? 0.822   27.755 12.985 1.00 0.00   ? 290 LYS C H     1 
ATOM   7400  H  HZ1   . LYS C 1 231 ? -3.480  32.783 11.103 1.00 0.00   ? 290 LYS C HZ1   1 
ATOM   7401  H  HZ2   . LYS C 1 231 ? -4.740  33.326 12.100 1.00 0.00   ? 290 LYS C HZ2   1 
ATOM   7402  H  HZ3   . LYS C 1 231 ? -3.295  32.764 12.793 1.00 0.00   ? 290 LYS C HZ3   1 
ATOM   7403  N  N     . GLN C 1 232 ? -1.961  29.105 15.999 1.00 18.85  ? 291 GLN C N     1 
ATOM   7404  C  CA    . GLN C 1 232 ? -2.898  28.680 17.024 1.00 18.85  ? 291 GLN C CA    1 
ATOM   7405  C  C     . GLN C 1 232 ? -4.056  29.636 16.762 1.00 18.85  ? 291 GLN C C     1 
ATOM   7406  O  O     . GLN C 1 232 ? -3.892  30.849 16.843 1.00 24.55  ? 291 GLN C O     1 
ATOM   7407  C  CB    . GLN C 1 232 ? -2.321  28.927 18.410 1.00 24.55  ? 291 GLN C CB    1 
ATOM   7408  C  CG    . GLN C 1 232 ? -1.004  28.246 18.669 1.00 24.55  ? 291 GLN C CG    1 
ATOM   7409  C  CD    . GLN C 1 232 ? -0.640  28.250 20.143 1.00 24.55  ? 291 GLN C CD    1 
ATOM   7410  O  OE1   . GLN C 1 232 ? -0.791  29.260 20.832 1.00 24.55  ? 291 GLN C OE1   1 
ATOM   7411  N  NE2   . GLN C 1 232 ? -0.200  27.103 20.644 1.00 24.55  ? 291 GLN C NE2   1 
ATOM   7412  H  H     . GLN C 1 232 ? -1.733  30.054 15.964 1.00 0.00   ? 291 GLN C H     1 
ATOM   7413  N  N     . ASP C 1 233 ? -5.209  29.104 16.382 1.00 2.00   ? 292 ASP C N     1 
ATOM   7414  C  CA    . ASP C 1 233 ? -6.343  29.952 16.080 1.00 2.00   ? 292 ASP C CA    1 
ATOM   7415  C  C     . ASP C 1 233 ? -6.954  30.380 17.404 1.00 2.00   ? 292 ASP C C     1 
ATOM   7416  O  O     . ASP C 1 233 ? -7.592  29.592 18.099 1.00 44.21  ? 292 ASP C O     1 
ATOM   7417  C  CB    . ASP C 1 233 ? -7.362  29.178 15.230 1.00 44.21  ? 292 ASP C CB    1 
ATOM   7418  C  CG    . ASP C 1 233 ? -8.414  30.082 14.592 1.00 44.21  ? 292 ASP C CG    1 
ATOM   7419  O  OD1   . ASP C 1 233 ? -8.169  31.297 14.495 1.00 44.21  ? 292 ASP C OD1   1 
ATOM   7420  O  OD2   . ASP C 1 233 ? -9.483  29.584 14.166 1.00 44.21  ? 292 ASP C OD2   1 
ATOM   7421  H  H     . ASP C 1 233 ? -5.307  28.130 16.340 1.00 0.00   ? 292 ASP C H     1 
ATOM   7422  N  N     . PHE C 1 234 ? -6.723  31.623 17.774 1.00 17.72  ? 293 PHE C N     1 
ATOM   7423  C  CA    . PHE C 1 234 ? -7.264  32.178 19.002 1.00 17.72  ? 293 PHE C CA    1 
ATOM   7424  C  C     . PHE C 1 234 ? -8.678  32.613 18.701 1.00 17.72  ? 293 PHE C C     1 
ATOM   7425  O  O     . PHE C 1 234 ? -9.396  33.081 19.592 1.00 2.00   ? 293 PHE C O     1 
ATOM   7426  C  CB    . PHE C 1 234 ? -6.399  33.326 19.496 1.00 2.00   ? 293 PHE C CB    1 
ATOM   7427  C  CG    . PHE C 1 234 ? -4.945  32.924 19.746 1.00 2.00   ? 293 PHE C CG    1 
ATOM   7428  C  CD1   . PHE C 1 234 ? -4.626  31.953 20.704 1.00 2.00   ? 293 PHE C CD1   1 
ATOM   7429  C  CD2   . PHE C 1 234 ? -3.921  33.511 19.031 1.00 2.00   ? 293 PHE C CD2   1 
ATOM   7430  C  CE1   . PHE C 1 234 ? -3.325  31.581 20.950 1.00 2.00   ? 293 PHE C CE1   1 
ATOM   7431  C  CE2   . PHE C 1 234 ? -2.587  33.146 19.269 1.00 2.00   ? 293 PHE C CE2   1 
ATOM   7432  C  CZ    . PHE C 1 234 ? -2.296  32.161 20.247 1.00 2.00   ? 293 PHE C CZ    1 
ATOM   7433  H  H     . PHE C 1 234 ? -6.133  32.166 17.206 1.00 0.00   ? 293 PHE C H     1 
ATOM   7434  N  N     . ARG C 1 235 ? -9.095  32.504 17.444 1.00 14.28  ? 294 ARG C N     1 
ATOM   7435  C  CA    . ARG C 1 235 ? -10.494 32.808 17.156 1.00 14.28  ? 294 ARG C CA    1 
ATOM   7436  C  C     . ARG C 1 235 ? -11.288 31.529 17.463 1.00 14.28  ? 294 ARG C C     1 
ATOM   7437  O  O     . ARG C 1 235 ? -12.449 31.581 17.862 1.00 84.09  ? 294 ARG C O     1 
ATOM   7438  C  CB    . ARG C 1 235 ? -10.712 33.254 15.716 1.00 84.09  ? 294 ARG C CB    1 
ATOM   7439  C  CG    . ARG C 1 235 ? -10.702 34.765 15.587 1.00 84.09  ? 294 ARG C CG    1 
ATOM   7440  C  CD    . ARG C 1 235 ? -11.615 35.260 14.476 1.00 84.09  ? 294 ARG C CD    1 
ATOM   7441  N  NE    . ARG C 1 235 ? -11.211 34.759 13.164 1.00 84.09  ? 294 ARG C NE    1 
ATOM   7442  C  CZ    . ARG C 1 235 ? -11.801 35.089 12.019 1.00 84.09  ? 294 ARG C CZ    1 
ATOM   7443  N  NH1   . ARG C 1 235 ? -12.833 35.930 12.010 1.00 84.09  ? 294 ARG C NH1   1 
ATOM   7444  N  NH2   . ARG C 1 235 ? -11.367 34.555 10.885 1.00 84.09  ? 294 ARG C NH2   1 
ATOM   7445  H  H     . ARG C 1 235 ? -8.474  32.280 16.728 1.00 0.00   ? 294 ARG C H     1 
ATOM   7446  H  HE    . ARG C 1 235 ? -10.449 34.146 13.113 1.00 0.00   ? 294 ARG C HE    1 
ATOM   7447  H  HH11  . ARG C 1 235 ? -13.172 36.308 12.874 1.00 0.00   ? 294 ARG C HH11  1 
ATOM   7448  H  HH12  . ARG C 1 235 ? -13.267 36.181 11.147 1.00 0.00   ? 294 ARG C HH12  1 
ATOM   7449  H  HH21  . ARG C 1 235 ? -10.612 33.899 10.893 1.00 0.00   ? 294 ARG C HH21  1 
ATOM   7450  H  HH22  . ARG C 1 235 ? -11.807 34.805 10.024 1.00 0.00   ? 294 ARG C HH22  1 
ATOM   7451  N  N     . LEU C 1 236 ? -10.622 30.388 17.303 1.00 22.42  ? 295 LEU C N     1 
ATOM   7452  C  CA    . LEU C 1 236 ? -11.210 29.086 17.570 1.00 22.42  ? 295 LEU C CA    1 
ATOM   7453  C  C     . LEU C 1 236 ? -11.309 28.939 19.068 1.00 22.42  ? 295 LEU C C     1 
ATOM   7454  O  O     . LEU C 1 236 ? -12.372 28.709 19.594 1.00 22.19  ? 295 LEU C O     1 
ATOM   7455  C  CB    . LEU C 1 236 ? -10.298 27.986 17.075 1.00 22.19  ? 295 LEU C CB    1 
ATOM   7456  C  CG    . LEU C 1 236 ? -10.911 26.720 16.510 1.00 22.19  ? 295 LEU C CG    1 
ATOM   7457  C  CD1   . LEU C 1 236 ? -10.021 25.571 16.877 1.00 22.19  ? 295 LEU C CD1   1 
ATOM   7458  C  CD2   . LEU C 1 236 ? -12.303 26.517 17.023 1.00 22.19  ? 295 LEU C CD2   1 
ATOM   7459  H  H     . LEU C 1 236 ? -9.696  30.418 17.002 1.00 0.00   ? 295 LEU C H     1 
ATOM   7460  N  N     . LEU C 1 237 ? -10.172 29.048 19.743 1.00 28.90  ? 296 LEU C N     1 
ATOM   7461  C  CA    . LEU C 1 237 ? -10.075 28.938 21.203 1.00 28.90  ? 296 LEU C CA    1 
ATOM   7462  C  C     . LEU C 1 237 ? -11.069 29.900 21.830 1.00 28.90  ? 296 LEU C C     1 
ATOM   7463  O  O     . LEU C 1 237 ? -11.593 29.651 22.913 1.00 39.54  ? 296 LEU C O     1 
ATOM   7464  C  CB    . LEU C 1 237 ? -8.649  29.291 21.624 1.00 39.54  ? 296 LEU C CB    1 
ATOM   7465  C  CG    . LEU C 1 237 ? -8.060  29.253 23.033 1.00 39.54  ? 296 LEU C CG    1 
ATOM   7466  C  CD1   . LEU C 1 237 ? -8.810  30.206 23.871 1.00 39.54  ? 296 LEU C CD1   1 
ATOM   7467  C  CD2   . LEU C 1 237 ? -8.046  27.870 23.649 1.00 39.54  ? 296 LEU C CD2   1 
ATOM   7468  H  H     . LEU C 1 237 ? -9.335  29.170 19.246 1.00 0.00   ? 296 LEU C H     1 
ATOM   7469  N  N     . GLY C 1 238 ? -11.298 31.021 21.156 1.00 17.51  ? 297 GLY C N     1 
ATOM   7470  C  CA    . GLY C 1 238 ? -12.245 31.998 21.640 1.00 17.51  ? 297 GLY C CA    1 
ATOM   7471  C  C     . GLY C 1 238 ? -13.657 31.481 21.602 1.00 17.51  ? 297 GLY C C     1 
ATOM   7472  O  O     . GLY C 1 238 ? -14.286 31.364 22.648 1.00 47.51  ? 297 GLY C O     1 
ATOM   7473  H  H     . GLY C 1 238 ? -10.813 31.213 20.332 1.00 0.00   ? 297 GLY C H     1 
ATOM   7474  N  N     . GLN C 1 239 ? -14.157 31.125 20.422 1.00 29.27  ? 298 GLN C N     1 
ATOM   7475  C  CA    . GLN C 1 239 ? -15.539 30.642 20.316 1.00 29.27  ? 298 GLN C CA    1 
ATOM   7476  C  C     . GLN C 1 239 ? -15.758 29.346 21.046 1.00 29.27  ? 298 GLN C C     1 
ATOM   7477  O  O     . GLN C 1 239 ? -16.657 29.241 21.863 1.00 33.71  ? 298 GLN C O     1 
ATOM   7478  C  CB    . GLN C 1 239 ? -16.013 30.518 18.858 1.00 33.71  ? 298 GLN C CB    1 
ATOM   7479  C  CG    . GLN C 1 239 ? -15.315 29.466 18.018 1.00 33.71  ? 298 GLN C CG    1 
ATOM   7480  C  CD    . GLN C 1 239 ? -16.109 28.187 17.866 1.00 33.71  ? 298 GLN C CD    1 
ATOM   7481  O  OE1   . GLN C 1 239 ? -17.088 27.962 18.567 1.00 33.71  ? 298 GLN C OE1   1 
ATOM   7482  N  NE2   . GLN C 1 239 ? -15.672 27.330 16.952 1.00 33.71  ? 298 GLN C NE2   1 
ATOM   7483  H  H     . GLN C 1 239 ? -13.587 31.178 19.625 1.00 0.00   ? 298 GLN C H     1 
ATOM   7484  N  N     . THR C 1 240 ? -14.892 28.378 20.797 1.00 38.71  ? 299 THR C N     1 
ATOM   7485  C  CA    . THR C 1 240 ? -15.013 27.094 21.441 1.00 38.71  ? 299 THR C CA    1 
ATOM   7486  C  C     . THR C 1 240 ? -15.180 27.297 22.934 1.00 38.71  ? 299 THR C C     1 
ATOM   7487  O  O     . THR C 1 240 ? -16.174 26.841 23.492 1.00 33.21  ? 299 THR C O     1 
ATOM   7488  C  CB    . THR C 1 240 ? -13.802 26.229 21.172 1.00 33.21  ? 299 THR C CB    1 
ATOM   7489  O  OG1   . THR C 1 240 ? -12.622 26.978 21.453 1.00 33.21  ? 299 THR C OG1   1 
ATOM   7490  C  CG2   . THR C 1 240 ? -13.770 25.806 19.739 1.00 33.21  ? 299 THR C CG2   1 
ATOM   7491  H  H     . THR C 1 240 ? -14.127 28.526 20.211 1.00 0.00   ? 299 THR C H     1 
ATOM   7492  H  HG1   . THR C 1 240 ? -11.859 26.428 21.260 1.00 30.00  ? 299 THR C HG1   1 
ATOM   7493  N  N     . SER C 1 241 ? -14.285 28.066 23.560 1.00 50.41  ? 300 SER C N     1 
ATOM   7494  C  CA    . SER C 1 241 ? -14.368 28.307 25.004 1.00 50.41  ? 300 SER C CA    1 
ATOM   7495  C  C     . SER C 1 241 ? -15.603 29.083 25.471 1.00 50.41  ? 300 SER C C     1 
ATOM   7496  O  O     . SER C 1 241 ? -16.126 28.813 26.540 1.00 29.10  ? 300 SER C O     1 
ATOM   7497  C  CB    . SER C 1 241 ? -13.100 28.977 25.528 1.00 29.10  ? 300 SER C CB    1 
ATOM   7498  O  OG    . SER C 1 241 ? -12.975 30.283 25.013 1.00 29.10  ? 300 SER C OG    1 
ATOM   7499  H  H     . SER C 1 241 ? -13.555 28.476 23.044 1.00 0.00   ? 300 SER C H     1 
ATOM   7500  H  HG    . SER C 1 241 ? -12.823 30.288 24.064 1.00 30.00  ? 300 SER C HG    1 
ATOM   7501  N  N     . VAL C 1 242 ? -16.071 30.050 24.696 1.00 23.93  ? 301 VAL C N     1 
ATOM   7502  C  CA    . VAL C 1 242 ? -17.250 30.793 25.110 1.00 23.93  ? 301 VAL C CA    1 
ATOM   7503  C  C     . VAL C 1 242 ? -18.400 29.813 25.091 1.00 23.93  ? 301 VAL C C     1 
ATOM   7504  O  O     . VAL C 1 242 ? -19.187 29.737 26.036 1.00 45.28  ? 301 VAL C O     1 
ATOM   7505  C  CB    . VAL C 1 242 ? -17.581 31.942 24.135 1.00 45.28  ? 301 VAL C CB    1 
ATOM   7506  C  CG1   . VAL C 1 242 ? -18.999 32.446 24.371 1.00 45.28  ? 301 VAL C CG1   1 
ATOM   7507  C  CG2   . VAL C 1 242 ? -16.594 33.072 24.302 1.00 45.28  ? 301 VAL C CG2   1 
ATOM   7508  H  H     . VAL C 1 242 ? -15.610 30.265 23.854 1.00 0.00   ? 301 VAL C H     1 
ATOM   7509  N  N     . ASP C 1 243 ? -18.493 29.073 23.994 1.00 30.60  ? 302 ASP C N     1 
ATOM   7510  C  CA    . ASP C 1 243 ? -19.543 28.097 23.802 1.00 30.60  ? 302 ASP C CA    1 
ATOM   7511  C  C     . ASP C 1 243 ? -19.520 27.063 24.881 1.00 30.60  ? 302 ASP C C     1 
ATOM   7512  O  O     . ASP C 1 243 ? -20.543 26.807 25.513 1.00 54.44  ? 302 ASP C O     1 
ATOM   7513  C  CB    . ASP C 1 243 ? -19.414 27.426 22.447 1.00 54.44  ? 302 ASP C CB    1 
ATOM   7514  C  CG    . ASP C 1 243 ? -19.987 28.265 21.342 1.00 54.44  ? 302 ASP C CG    1 
ATOM   7515  O  OD1   . ASP C 1 243 ? -20.798 29.165 21.641 1.00 54.44  ? 302 ASP C OD1   1 
ATOM   7516  O  OD2   . ASP C 1 243 ? -19.632 28.020 20.176 1.00 54.44  ? 302 ASP C OD2   1 
ATOM   7517  H  H     . ASP C 1 243 ? -17.822 29.200 23.297 1.00 0.00   ? 302 ASP C H     1 
ATOM   7518  N  N     . ARG C 1 244 ? -18.359 26.469 25.110 1.00 23.14  ? 303 ARG C N     1 
ATOM   7519  C  CA    . ARG C 1 244 ? -18.267 25.472 26.150 1.00 23.14  ? 303 ARG C CA    1 
ATOM   7520  C  C     . ARG C 1 244 ? -18.652 26.081 27.485 1.00 23.14  ? 303 ARG C C     1 
ATOM   7521  O  O     . ARG C 1 244 ? -19.553 25.572 28.140 1.00 41.70  ? 303 ARG C O     1 
ATOM   7522  C  CB    . ARG C 1 244 ? -16.888 24.855 26.242 1.00 41.70  ? 303 ARG C CB    1 
ATOM   7523  C  CG    . ARG C 1 244 ? -16.922 23.601 27.051 1.00 41.70  ? 303 ARG C CG    1 
ATOM   7524  C  CD    . ARG C 1 244 ? -15.557 23.019 27.238 1.00 41.70  ? 303 ARG C CD    1 
ATOM   7525  N  NE    . ARG C 1 244 ? -15.589 21.926 28.206 1.00 41.70  ? 303 ARG C NE    1 
ATOM   7526  C  CZ    . ARG C 1 244 ? -14.586 21.085 28.425 1.00 41.70  ? 303 ARG C CZ    1 
ATOM   7527  N  NH1   . ARG C 1 244 ? -13.451 21.205 27.748 1.00 41.70  ? 303 ARG C NH1   1 
ATOM   7528  N  NH2   . ARG C 1 244 ? -14.724 20.125 29.328 1.00 41.70  ? 303 ARG C NH2   1 
ATOM   7529  H  H     . ARG C 1 244 ? -17.590 26.712 24.576 1.00 0.00   ? 303 ARG C H     1 
ATOM   7530  H  HE    . ARG C 1 244 ? -16.379 21.838 28.756 1.00 0.00   ? 303 ARG C HE    1 
ATOM   7531  H  HH11  . ARG C 1 244 ? -13.331 21.933 27.071 1.00 0.00   ? 303 ARG C HH11  1 
ATOM   7532  H  HH12  . ARG C 1 244 ? -12.698 20.574 27.933 1.00 0.00   ? 303 ARG C HH12  1 
ATOM   7533  H  HH21  . ARG C 1 244 ? -15.583 20.049 29.833 1.00 0.00   ? 303 ARG C HH21  1 
ATOM   7534  H  HH22  . ARG C 1 244 ? -13.992 19.474 29.498 1.00 0.00   ? 303 ARG C HH22  1 
ATOM   7535  N  N     . LEU C 1 245 ? -18.038 27.199 27.865 1.00 31.73  ? 304 LEU C N     1 
ATOM   7536  C  CA    . LEU C 1 245 ? -18.362 27.837 29.134 1.00 31.73  ? 304 LEU C CA    1 
ATOM   7537  C  C     . LEU C 1 245 ? -19.879 28.021 29.236 1.00 31.73  ? 304 LEU C C     1 
ATOM   7538  O  O     . LEU C 1 245 ? -20.465 27.848 30.307 1.00 72.14  ? 304 LEU C O     1 
ATOM   7539  C  CB    . LEU C 1 245 ? -17.646 29.175 29.264 1.00 72.14  ? 304 LEU C CB    1 
ATOM   7540  C  CG    . LEU C 1 245 ? -17.479 29.748 30.676 1.00 72.14  ? 304 LEU C CG    1 
ATOM   7541  C  CD1   . LEU C 1 245 ? -18.697 30.531 31.114 1.00 72.14  ? 304 LEU C CD1   1 
ATOM   7542  C  CD2   . LEU C 1 245 ? -17.157 28.617 31.637 1.00 72.14  ? 304 LEU C CD2   1 
ATOM   7543  H  H     . LEU C 1 245 ? -17.379 27.606 27.268 1.00 0.00   ? 304 LEU C H     1 
ATOM   7544  N  N     . LEU C 1 246 ? -20.520 28.306 28.105 1.00 56.66  ? 305 LEU C N     1 
ATOM   7545  C  CA    . LEU C 1 246 ? -21.976 28.481 28.056 1.00 56.66  ? 305 LEU C CA    1 
ATOM   7546  C  C     . LEU C 1 246 ? -22.684 27.160 28.382 1.00 56.66  ? 305 LEU C C     1 
ATOM   7547  O  O     . LEU C 1 246 ? -23.595 27.143 29.209 1.00 77.69  ? 305 LEU C O     1 
ATOM   7548  C  CB    . LEU C 1 246 ? -22.397 28.958 26.664 1.00 77.69  ? 305 LEU C CB    1 
ATOM   7549  C  CG    . LEU C 1 246 ? -23.484 30.020 26.629 1.00 77.69  ? 305 LEU C CG    1 
ATOM   7550  C  CD1   . LEU C 1 246 ? -24.821 29.434 27.060 1.00 77.69  ? 305 LEU C CD1   1 
ATOM   7551  C  CD2   . LEU C 1 246 ? -23.041 31.168 27.532 1.00 77.69  ? 305 LEU C CD2   1 
ATOM   7552  H  H     . LEU C 1 246 ? -20.009 28.417 27.276 1.00 0.00   ? 305 LEU C H     1 
ATOM   7553  N  N     . GLN C 1 247 ? -22.260 26.066 27.735 1.00 62.82  ? 306 GLN C N     1 
ATOM   7554  C  CA    . GLN C 1 247 ? -22.832 24.723 27.952 1.00 62.82  ? 306 GLN C CA    1 
ATOM   7555  C  C     . GLN C 1 247 ? -22.644 24.346 29.410 1.00 62.82  ? 306 GLN C C     1 
ATOM   7556  O  O     . GLN C 1 247 ? -23.570 23.931 30.096 1.00 92.59  ? 306 GLN C O     1 
ATOM   7557  C  CB    . GLN C 1 247 ? -22.087 23.668 27.131 1.00 92.59  ? 306 GLN C CB    1 
ATOM   7558  C  CG    . GLN C 1 247 ? -22.091 23.848 25.639 1.00 92.59  ? 306 GLN C CG    1 
ATOM   7559  C  CD    . GLN C 1 247 ? -21.277 22.771 24.953 1.00 92.59  ? 306 GLN C CD    1 
ATOM   7560  O  OE1   . GLN C 1 247 ? -20.049 22.755 25.035 1.00 92.59  ? 306 GLN C OE1   1 
ATOM   7561  N  NE2   . GLN C 1 247 ? -21.957 21.858 24.281 1.00 92.59  ? 306 GLN C NE2   1 
ATOM   7562  H  H     . GLN C 1 247 ? -21.514 26.161 27.103 1.00 0.00   ? 306 GLN C H     1 
ATOM   7563  N  N     . LEU C 1 248 ? -21.397 24.455 29.835 1.00 28.57  ? 307 LEU C N     1 
ATOM   7564  C  CA    . LEU C 1 248 ? -20.952 24.165 31.187 1.00 28.57  ? 307 LEU C CA    1 
ATOM   7565  C  C     . LEU C 1 248 ? -21.838 24.943 32.139 1.00 28.57  ? 307 LEU C C     1 
ATOM   7566  O  O     . LEU C 1 248 ? -22.237 24.444 33.196 1.00 48.19  ? 307 LEU C O     1 
ATOM   7567  C  CB    . LEU C 1 248 ? -19.513 24.664 31.329 1.00 48.19  ? 307 LEU C CB    1 
ATOM   7568  C  CG    . LEU C 1 248 ? -18.574 24.062 32.358 1.00 48.19  ? 307 LEU C CG    1 
ATOM   7569  C  CD1   . LEU C 1 248 ? -18.223 22.654 31.942 1.00 48.19  ? 307 LEU C CD1   1 
ATOM   7570  C  CD2   . LEU C 1 248 ? -17.326 24.899 32.426 1.00 48.19  ? 307 LEU C CD2   1 
ATOM   7571  H  H     . LEU C 1 248 ? -20.728 24.722 29.185 1.00 0.00   ? 307 LEU C H     1 
ATOM   7572  N  N     . SER C 1 249 ? -22.123 26.182 31.746 1.00 34.66  ? 308 SER C N     1 
ATOM   7573  C  CA    . SER C 1 249 ? -22.950 27.071 32.528 1.00 34.66  ? 308 SER C CA    1 
ATOM   7574  C  C     . SER C 1 249 ? -24.338 26.497 32.547 1.00 34.66  ? 308 SER C C     1 
ATOM   7575  O  O     . SER C 1 249 ? -24.917 26.296 33.621 1.00 65.13  ? 308 SER C O     1 
ATOM   7576  C  CB    . SER C 1 249 ? -22.984 28.458 31.898 1.00 65.13  ? 308 SER C CB    1 
ATOM   7577  O  OG    . SER C 1 249 ? -23.878 29.316 32.587 1.00 65.13  ? 308 SER C OG    1 
ATOM   7578  H  H     . SER C 1 249 ? -21.764 26.511 30.898 1.00 0.00   ? 308 SER C H     1 
ATOM   7579  H  HG    . SER C 1 249 ? -23.606 29.364 33.512 1.00 30.00  ? 308 SER C HG    1 
ATOM   7580  N  N     . GLN C 1 250 ? -24.845 26.169 31.361 1.00 58.72  ? 309 GLN C N     1 
ATOM   7581  C  CA    . GLN C 1 250 ? -26.185 25.624 31.230 1.00 58.72  ? 309 GLN C CA    1 
ATOM   7582  C  C     . GLN C 1 250 ? -26.307 24.098 31.399 1.00 58.72  ? 309 GLN C C     1 
ATOM   7583  O  O     . GLN C 1 250 ? -26.950 23.408 30.598 1.00 125.85 ? 309 GLN C O     1 
ATOM   7584  C  CB    . GLN C 1 250 ? -26.854 26.134 29.948 1.00 125.85 ? 309 GLN C CB    1 
ATOM   7585  C  CG    . GLN C 1 250 ? -27.090 27.647 29.971 1.00 125.85 ? 309 GLN C CG    1 
ATOM   7586  C  CD    . GLN C 1 250 ? -28.112 28.109 28.949 1.00 125.85 ? 309 GLN C CD    1 
ATOM   7587  O  OE1   . GLN C 1 250 ? -27.871 28.064 27.743 1.00 125.85 ? 309 GLN C OE1   1 
ATOM   7588  N  NE2   . GLN C 1 250 ? -29.258 28.566 29.429 1.00 125.85 ? 309 GLN C NE2   1 
ATOM   7589  H  H     . GLN C 1 250 ? -24.306 26.242 30.563 1.00 0.00   ? 309 GLN C H     1 
ATOM   7590  N  N     . GLY C 1 251 ? -25.694 23.597 32.471 1.00 112.70 ? 310 GLY C N     1 
ATOM   7591  C  CA    . GLY C 1 251 ? -25.742 22.185 32.807 1.00 112.70 ? 310 GLY C CA    1 
ATOM   7592  C  C     . GLY C 1 251 ? -25.312 21.148 31.784 1.00 112.70 ? 310 GLY C C     1 
ATOM   7593  O  O     . GLY C 1 251 ? -25.390 19.950 32.075 1.00 91.24  ? 310 GLY C O     1 
ATOM   7594  H  H     . GLY C 1 251 ? -25.184 24.208 33.044 1.00 0.00   ? 310 GLY C H     1 
ATOM   7595  N  N     . GLN C 1 252 ? -24.868 21.571 30.602 1.00 102.26 ? 311 GLN C N     1 
ATOM   7596  C  CA    . GLN C 1 252 ? -24.437 20.623 29.575 1.00 102.26 ? 311 GLN C CA    1 
ATOM   7597  C  C     . GLN C 1 252 ? -23.069 20.079 29.950 1.00 102.26 ? 311 GLN C C     1 
ATOM   7598  O  O     . GLN C 1 252 ? -22.034 20.646 29.590 1.00 104.93 ? 311 GLN C O     1 
ATOM   7599  C  CB    . GLN C 1 252 ? -24.406 21.283 28.197 1.00 104.93 ? 311 GLN C CB    1 
ATOM   7600  C  CG    . GLN C 1 252 ? -24.203 20.306 27.056 1.00 104.93 ? 311 GLN C CG    1 
ATOM   7601  C  CD    . GLN C 1 252 ? -24.841 20.786 25.770 1.00 104.93 ? 311 GLN C CD    1 
ATOM   7602  O  OE1   . GLN C 1 252 ? -24.254 20.689 24.695 1.00 104.93 ? 311 GLN C OE1   1 
ATOM   7603  N  NE2   . GLN C 1 252 ? -26.058 21.301 25.873 1.00 104.93 ? 311 GLN C NE2   1 
ATOM   7604  H  H     . GLN C 1 252 ? -24.817 22.530 30.424 1.00 0.00   ? 311 GLN C H     1 
ATOM   7605  N  N     . ALA C 1 253 ? -23.090 19.005 30.731 1.00 88.31  ? 312 ALA C N     1 
ATOM   7606  C  CA    . ALA C 1 253 ? -21.882 18.357 31.212 1.00 88.31  ? 312 ALA C CA    1 
ATOM   7607  C  C     . ALA C 1 253 ? -20.979 17.971 30.054 1.00 88.31  ? 312 ALA C C     1 
ATOM   7608  O  O     . ALA C 1 253 ? -21.382 17.235 29.155 1.00 86.57  ? 312 ALA C O     1 
ATOM   7609  C  CB    . ALA C 1 253 ? -22.240 17.132 32.057 1.00 86.57  ? 312 ALA C CB    1 
ATOM   7610  H  H     . ALA C 1 253 ? -23.967 18.661 31.002 1.00 0.00   ? 312 ALA C H     1 
ATOM   7611  N  N     . VAL C 1 254 ? -19.775 18.531 30.071 1.00 75.42  ? 313 VAL C N     1 
ATOM   7612  C  CA    . VAL C 1 254 ? -18.751 18.298 29.053 1.00 75.42  ? 313 VAL C CA    1 
ATOM   7613  C  C     . VAL C 1 254 ? -17.489 17.876 29.785 1.00 75.42  ? 313 VAL C C     1 
ATOM   7614  O  O     . VAL C 1 254 ? -16.668 17.138 29.262 1.00 93.04  ? 313 VAL C O     1 
ATOM   7615  C  CB    . VAL C 1 254 ? -18.468 19.581 28.263 1.00 93.04  ? 313 VAL C CB    1 
ATOM   7616  C  CG1   . VAL C 1 254 ? -19.635 19.882 27.318 1.00 93.04  ? 313 VAL C CG1   1 
ATOM   7617  C  CG2   . VAL C 1 254 ? -18.268 20.744 29.230 1.00 93.04  ? 313 VAL C CG2   1 
ATOM   7618  H  H     . VAL C 1 254 ? -19.606 19.149 30.802 1.00 0.00   ? 313 VAL C H     1 
ATOM   7619  N  N     . LYS C 1 255 ? -17.316 18.444 30.970 1.00 77.55  ? 314 LYS C N     1 
ATOM   7620  C  CA    . LYS C 1 255 ? -16.222 18.136 31.879 1.00 77.55  ? 314 LYS C CA    1 
ATOM   7621  C  C     . LYS C 1 255 ? -14.737 18.284 31.500 1.00 77.55  ? 314 LYS C C     1 
ATOM   7622  O  O     . LYS C 1 255 ? -14.119 19.306 31.780 1.00 114.03 ? 314 LYS C O     1 
ATOM   7623  C  CB    . LYS C 1 255 ? -16.450 16.741 32.473 1.00 114.03 ? 314 LYS C CB    1 
ATOM   7624  C  CG    . LYS C 1 255 ? -17.886 16.459 32.877 1.00 114.03 ? 314 LYS C CG    1 
ATOM   7625  C  CD    . LYS C 1 255 ? -18.022 15.070 33.481 1.00 114.03 ? 314 LYS C CD    1 
ATOM   7626  C  CE    . LYS C 1 255 ? -19.481 14.656 33.606 1.00 114.03 ? 314 LYS C CE    1 
ATOM   7627  N  NZ    . LYS C 1 255 ? -20.322 15.662 34.325 1.00 114.03 ? 314 LYS C NZ    1 
ATOM   7628  H  H     . LYS C 1 255 ? -17.948 19.130 31.247 1.00 0.00   ? 314 LYS C H     1 
ATOM   7629  H  HZ1   . LYS C 1 255 ? -19.959 15.818 35.288 1.00 0.00   ? 314 LYS C HZ1   1 
ATOM   7630  H  HZ2   . LYS C 1 255 ? -20.317 16.563 33.805 1.00 0.00   ? 314 LYS C HZ2   1 
ATOM   7631  H  HZ3   . LYS C 1 255 ? -21.298 15.304 34.382 1.00 0.00   ? 314 LYS C HZ3   1 
ATOM   7632  N  N     . GLY C 1 256 ? -14.184 17.257 30.867 1.00 31.75  ? 315 GLY C N     1 
ATOM   7633  C  CA    . GLY C 1 256 ? -12.769 17.209 30.545 1.00 31.75  ? 315 GLY C CA    1 
ATOM   7634  C  C     . GLY C 1 256 ? -11.952 18.296 29.867 1.00 31.75  ? 315 GLY C C     1 
ATOM   7635  O  O     . GLY C 1 256 ? -12.247 19.490 29.917 1.00 31.87  ? 315 GLY C O     1 
ATOM   7636  H  H     . GLY C 1 256 ? -14.768 16.537 30.559 1.00 0.00   ? 315 GLY C H     1 
ATOM   7637  N  N     . ASN C 1 257 ? -10.847 17.824 29.296 1.00 53.64  ? 316 ASN C N     1 
ATOM   7638  C  CA    . ASN C 1 257 ? -9.865  18.618 28.563 1.00 53.64  ? 316 ASN C CA    1 
ATOM   7639  C  C     . ASN C 1 257 ? -10.134 18.429 27.080 1.00 53.64  ? 316 ASN C C     1 
ATOM   7640  O  O     . ASN C 1 257 ? -10.637 17.383 26.657 1.00 42.43  ? 316 ASN C O     1 
ATOM   7641  C  CB    . ASN C 1 257 ? -8.443  18.135 28.912 1.00 42.43  ? 316 ASN C CB    1 
ATOM   7642  C  CG    . ASN C 1 257 ? -7.434  18.382 27.803 1.00 42.43  ? 316 ASN C CG    1 
ATOM   7643  O  OD1   . ASN C 1 257 ? -7.141  19.512 27.442 1.00 42.43  ? 316 ASN C OD1   1 
ATOM   7644  N  ND2   . ASN C 1 257 ? -6.878  17.311 27.280 1.00 42.43  ? 316 ASN C ND2   1 
ATOM   7645  H  H     . ASN C 1 257 ? -10.695 16.863 29.336 1.00 0.00   ? 316 ASN C H     1 
ATOM   7646  H  HD21  . ASN C 1 257 ? -6.250  17.468 26.549 1.00 0.00   ? 316 ASN C HD21  1 
ATOM   7647  H  HD22  . ASN C 1 257 ? -7.108  16.426 27.629 1.00 0.00   ? 316 ASN C HD22  1 
ATOM   7648  N  N     . GLN C 1 258 ? -9.836  19.452 26.293 1.00 44.95  ? 317 GLN C N     1 
ATOM   7649  C  CA    . GLN C 1 258 ? -10.048 19.379 24.865 1.00 44.95  ? 317 GLN C CA    1 
ATOM   7650  C  C     . GLN C 1 258 ? -8.827  19.974 24.223 1.00 44.95  ? 317 GLN C C     1 
ATOM   7651  O  O     . GLN C 1 258 ? -8.263  20.930 24.737 1.00 44.00  ? 317 GLN C O     1 
ATOM   7652  C  CB    . GLN C 1 258 ? -11.318 20.122 24.492 1.00 44.00  ? 317 GLN C CB    1 
ATOM   7653  C  CG    . GLN C 1 258 ? -12.441 19.708 25.394 1.00 44.00  ? 317 GLN C CG    1 
ATOM   7654  C  CD    . GLN C 1 258 ? -13.795 20.142 24.928 1.00 44.00  ? 317 GLN C CD    1 
ATOM   7655  O  OE1   . GLN C 1 258 ? -14.253 21.247 25.230 1.00 44.00  ? 317 GLN C OE1   1 
ATOM   7656  N  NE2   . GLN C 1 258 ? -14.481 19.247 24.220 1.00 44.00  ? 317 GLN C NE2   1 
ATOM   7657  H  H     . GLN C 1 258 ? -9.456  20.283 26.667 1.00 0.00   ? 317 GLN C H     1 
ATOM   7658  N  N     . LEU C 1 259 ? -8.387  19.351 23.136 1.00 38.41  ? 318 LEU C N     1 
ATOM   7659  C  CA    . LEU C 1 259 ? -7.198  19.782 22.410 1.00 38.41  ? 318 LEU C CA    1 
ATOM   7660  C  C     . LEU C 1 259 ? -7.554  20.370 21.057 1.00 38.41  ? 318 LEU C C     1 
ATOM   7661  O  O     . LEU C 1 259 ? -8.276  19.744 20.274 1.00 34.44  ? 318 LEU C O     1 
ATOM   7662  C  CB    . LEU C 1 259 ? -6.246  18.605 22.208 1.00 34.44  ? 318 LEU C CB    1 
ATOM   7663  C  CG    . LEU C 1 259 ? -5.417  18.151 23.393 1.00 34.44  ? 318 LEU C CG    1 
ATOM   7664  C  CD1   . LEU C 1 259 ? -4.776  16.856 23.028 1.00 34.44  ? 318 LEU C CD1   1 
ATOM   7665  C  CD2   . LEU C 1 259 ? -4.368  19.181 23.749 1.00 34.44  ? 318 LEU C CD2   1 
ATOM   7666  H  H     . LEU C 1 259 ? -8.886  18.599 22.764 1.00 0.00   ? 318 LEU C H     1 
ATOM   7667  N  N     . LEU C 1 260 ? -6.955  21.517 20.755 1.00 34.59  ? 319 LEU C N     1 
ATOM   7668  C  CA    . LEU C 1 260 ? -7.203  22.221 19.518 1.00 34.59  ? 319 LEU C CA    1 
ATOM   7669  C  C     . LEU C 1 260 ? -6.127  21.936 18.486 1.00 34.59  ? 319 LEU C C     1 
ATOM   7670  O  O     . LEU C 1 260 ? -4.937  21.827 18.795 1.00 18.69  ? 319 LEU C O     1 
ATOM   7671  C  CB    . LEU C 1 260 ? -7.325  23.719 19.779 1.00 18.69  ? 319 LEU C CB    1 
ATOM   7672  C  CG    . LEU C 1 260 ? -8.504  24.126 20.659 1.00 18.69  ? 319 LEU C CG    1 
ATOM   7673  C  CD1   . LEU C 1 260 ? -8.445  25.597 20.958 1.00 18.69  ? 319 LEU C CD1   1 
ATOM   7674  C  CD2   . LEU C 1 260 ? -9.790  23.764 19.967 1.00 18.69  ? 319 LEU C CD2   1 
ATOM   7675  H  H     . LEU C 1 260 ? -6.244  21.831 21.319 1.00 0.00   ? 319 LEU C H     1 
ATOM   7676  N  N     . PRO C 1 261 ? -6.538  21.845 17.227 1.00 20.58  ? 320 PRO C N     1 
ATOM   7677  C  CA    . PRO C 1 261 ? -5.738  21.574 16.043 1.00 20.58  ? 320 PRO C CA    1 
ATOM   7678  C  C     . PRO C 1 261 ? -4.299  22.075 15.896 1.00 20.58  ? 320 PRO C C     1 
ATOM   7679  O  O     . PRO C 1 261 ? -3.394  21.243 15.776 1.00 80.95  ? 320 PRO C O     1 
ATOM   7680  C  CB    . PRO C 1 261 ? -6.643  22.068 14.932 1.00 80.95  ? 320 PRO C CB    1 
ATOM   7681  C  CG    . PRO C 1 261 ? -7.978  21.563 15.401 1.00 80.95  ? 320 PRO C CG    1 
ATOM   7682  C  CD    . PRO C 1 261 ? -7.967  21.951 16.866 1.00 80.95  ? 320 PRO C CD    1 
ATOM   7683  N  N     . VAL C 1 262 ? -4.069  23.394 15.880 1.00 21.50  ? 321 VAL C N     1 
ATOM   7684  C  CA    . VAL C 1 262 ? -2.700  23.914 15.637 1.00 21.50  ? 321 VAL C CA    1 
ATOM   7685  C  C     . VAL C 1 262 ? -2.215  23.571 14.185 1.00 21.50  ? 321 VAL C C     1 
ATOM   7686  O  O     . VAL C 1 262 ? -2.661  22.587 13.597 1.00 18.21  ? 321 VAL C O     1 
ATOM   7687  C  CB    . VAL C 1 262 ? -1.692  23.410 16.716 1.00 18.21  ? 321 VAL C CB    1 
ATOM   7688  C  CG1   . VAL C 1 262 ? -0.320  23.205 16.138 1.00 18.21  ? 321 VAL C CG1   1 
ATOM   7689  C  CG2   . VAL C 1 262 ? -1.616  24.394 17.851 1.00 18.21  ? 321 VAL C CG2   1 
ATOM   7690  H  H     . VAL C 1 262 ? -4.809  24.013 15.997 1.00 0.00   ? 321 VAL C H     1 
ATOM   7691  N  N     . SER C 1 263 ? -1.349  24.409 13.597 1.00 15.41  ? 322 SER C N     1 
ATOM   7692  C  CA    . SER C 1 263 ? -0.848  24.192 12.229 1.00 15.41  ? 322 SER C CA    1 
ATOM   7693  C  C     . SER C 1 263 ? 0.482   24.906 11.925 1.00 15.41  ? 322 SER C C     1 
ATOM   7694  O  O     . SER C 1 263 ? 0.876   25.786 12.676 1.00 36.00  ? 322 SER C O     1 
ATOM   7695  C  CB    . SER C 1 263 ? -1.911  24.642 11.237 1.00 36.00  ? 322 SER C CB    1 
ATOM   7696  O  OG    . SER C 1 263 ? -2.222  26.003 11.433 1.00 36.00  ? 322 SER C OG    1 
ATOM   7697  H  H     . SER C 1 263 ? -1.055  25.225 14.056 1.00 0.00   ? 322 SER C H     1 
ATOM   7698  H  HG    . SER C 1 263 ? -2.984  26.199 10.882 1.00 30.00  ? 322 SER C HG    1 
ATOM   7699  N  N     . LEU C 1 264 ? 1.181   24.505 10.857 1.00 12.34  ? 323 LEU C N     1 
ATOM   7700  C  CA    . LEU C 1 264 ? 2.459   25.121 10.463 1.00 12.34  ? 323 LEU C CA    1 
ATOM   7701  C  C     . LEU C 1 264 ? 2.297   25.999 9.235  1.00 12.34  ? 323 LEU C C     1 
ATOM   7702  O  O     . LEU C 1 264 ? 2.060   25.530 8.118  1.00 2.00   ? 323 LEU C O     1 
ATOM   7703  C  CB    . LEU C 1 264 ? 3.545   24.092 10.164 1.00 2.00   ? 323 LEU C CB    1 
ATOM   7704  C  CG    . LEU C 1 264 ? 4.746   24.601 9.360  1.00 2.00   ? 323 LEU C CG    1 
ATOM   7705  C  CD1   . LEU C 1 264 ? 5.929   24.808 10.227 1.00 2.00   ? 323 LEU C CD1   1 
ATOM   7706  C  CD2   . LEU C 1 264 ? 5.108   23.628 8.318  1.00 2.00   ? 323 LEU C CD2   1 
ATOM   7707  H  H     . LEU C 1 264 ? 0.806   23.783 10.312 1.00 0.00   ? 323 LEU C H     1 
ATOM   7708  N  N     . VAL C 1 265 ? 2.498   27.286 9.478  1.00 24.63  ? 324 VAL C N     1 
ATOM   7709  C  CA    . VAL C 1 265 ? 2.403   28.336 8.489  1.00 24.63  ? 324 VAL C CA    1 
ATOM   7710  C  C     . VAL C 1 265 ? 3.807   28.629 8.019  1.00 24.63  ? 324 VAL C C     1 
ATOM   7711  O  O     . VAL C 1 265 ? 4.619   29.201 8.754  1.00 2.00   ? 324 VAL C O     1 
ATOM   7712  C  CB    . VAL C 1 265 ? 1.802   29.567 9.129  1.00 2.00   ? 324 VAL C CB    1 
ATOM   7713  C  CG1   . VAL C 1 265 ? 2.035   30.772 8.264  1.00 2.00   ? 324 VAL C CG1   1 
ATOM   7714  C  CG2   . VAL C 1 265 ? 0.284   29.340 9.342  1.00 2.00   ? 324 VAL C CG2   1 
ATOM   7715  H  H     . VAL C 1 265 ? 2.748   27.519 10.396 1.00 0.00   ? 324 VAL C H     1 
ATOM   7716  N  N     . LYS C 1 266 ? 4.117   28.189 6.809  1.00 19.82  ? 325 LYS C N     1 
ATOM   7717  C  CA    . LYS C 1 266 ? 5.447   28.408 6.257  1.00 19.82  ? 325 LYS C CA    1 
ATOM   7718  C  C     . LYS C 1 266 ? 5.512   29.805 5.630  1.00 19.82  ? 325 LYS C C     1 
ATOM   7719  O  O     . LYS C 1 266 ? 4.543   30.257 5.013  1.00 21.71  ? 325 LYS C O     1 
ATOM   7720  C  CB    . LYS C 1 266 ? 5.782   27.352 5.200  1.00 21.71  ? 325 LYS C CB    1 
ATOM   7721  C  CG    . LYS C 1 266 ? 5.756   25.895 5.651  1.00 21.71  ? 325 LYS C CG    1 
ATOM   7722  C  CD    . LYS C 1 266 ? 5.884   25.025 4.416  1.00 21.71  ? 325 LYS C CD    1 
ATOM   7723  C  CE    . LYS C 1 266 ? 6.184   23.571 4.710  1.00 21.71  ? 325 LYS C CE    1 
ATOM   7724  N  NZ    . LYS C 1 266 ? 6.616   22.873 3.472  1.00 21.71  ? 325 LYS C NZ    1 
ATOM   7725  H  H     . LYS C 1 266 ? 3.426   27.758 6.272  1.00 0.00   ? 325 LYS C H     1 
ATOM   7726  H  HZ1   . LYS C 1 266 ? 5.860   22.979 2.762  1.00 0.00   ? 325 LYS C HZ1   1 
ATOM   7727  H  HZ2   . LYS C 1 266 ? 7.495   23.305 3.117  1.00 0.00   ? 325 LYS C HZ2   1 
ATOM   7728  H  HZ3   . LYS C 1 266 ? 6.774   21.859 3.650  1.00 0.00   ? 325 LYS C HZ3   1 
ATOM   7729  N  N     . ARG C 1 267 ? 6.628   30.503 5.873  1.00 19.76  ? 326 ARG C N     1 
ATOM   7730  C  CA    . ARG C 1 267 ? 6.877   31.831 5.334  1.00 19.76  ? 326 ARG C CA    1 
ATOM   7731  C  C     . ARG C 1 267 ? 8.338   32.008 4.940  1.00 19.76  ? 326 ARG C C     1 
ATOM   7732  O  O     . ARG C 1 267 ? 8.888   31.141 4.258  1.00 19.94  ? 326 ARG C O     1 
ATOM   7733  C  CB    . ARG C 1 267 ? 6.415   32.927 6.290  1.00 19.94  ? 326 ARG C CB    1 
ATOM   7734  C  CG    . ARG C 1 267 ? 4.900   32.926 6.511  1.00 19.94  ? 326 ARG C CG    1 
ATOM   7735  C  CD    . ARG C 1 267 ? 4.441   34.238 7.098  1.00 19.94  ? 326 ARG C CD    1 
ATOM   7736  N  NE    . ARG C 1 267 ? 3.036   34.204 7.450  1.00 19.94  ? 326 ARG C NE    1 
ATOM   7737  C  CZ    . ARG C 1 267 ? 2.587   34.110 8.687  1.00 19.94  ? 326 ARG C CZ    1 
ATOM   7738  N  NH1   . ARG C 1 267 ? 3.429   34.038 9.710  1.00 19.94  ? 326 ARG C NH1   1 
ATOM   7739  N  NH2   . ARG C 1 267 ? 1.287   34.127 8.891  1.00 19.94  ? 326 ARG C NH2   1 
ATOM   7740  H  H     . ARG C 1 267 ? 7.338   30.103 6.412  1.00 0.00   ? 326 ARG C H     1 
ATOM   7741  H  HE    . ARG C 1 267 ? 2.377   34.254 6.723  1.00 0.00   ? 326 ARG C HE    1 
ATOM   7742  H  HH11  . ARG C 1 267 ? 4.405   34.081 9.540  1.00 0.00   ? 326 ARG C HH11  1 
ATOM   7743  H  HH12  . ARG C 1 267 ? 3.067   33.973 10.640 1.00 0.00   ? 326 ARG C HH12  1 
ATOM   7744  H  HH21  . ARG C 1 267 ? 0.698   34.207 8.094  1.00 0.00   ? 326 ARG C HH21  1 
ATOM   7745  H  HH22  . ARG C 1 267 ? 0.895   34.060 9.807  1.00 0.00   ? 326 ARG C HH22  1 
ATOM   7746  N  N     . LYS C 1 268 ? 9.023   33.037 5.433  1.00 2.00   ? 327 LYS C N     1 
ATOM   7747  C  CA    . LYS C 1 268 ? 10.392  33.254 4.945  1.00 2.00   ? 327 LYS C CA    1 
ATOM   7748  C  C     . LYS C 1 268 ? 11.584  33.169 5.869  1.00 2.00   ? 327 LYS C C     1 
ATOM   7749  O  O     . LYS C 1 268 ? 12.713  33.400 5.444  1.00 28.10  ? 327 LYS C O     1 
ATOM   7750  C  CB    . LYS C 1 268 ? 10.450  34.589 4.201  1.00 28.10  ? 327 LYS C CB    1 
ATOM   7751  C  CG    . LYS C 1 268 ? 10.053  34.519 2.740  1.00 28.10  ? 327 LYS C CG    1 
ATOM   7752  C  CD    . LYS C 1 268 ? 8.586   34.210 2.554  1.00 28.10  ? 327 LYS C CD    1 
ATOM   7753  C  CE    . LYS C 1 268 ? 8.214   34.077 1.091  1.00 28.10  ? 327 LYS C CE    1 
ATOM   7754  N  NZ    . LYS C 1 268 ? 8.966   32.999 0.394  1.00 28.10  ? 327 LYS C NZ    1 
ATOM   7755  H  H     . LYS C 1 268 ? 8.629   33.653 6.074  1.00 0.00   ? 327 LYS C H     1 
ATOM   7756  H  HZ1   . LYS C 1 268 ? 9.988   33.164 0.487  1.00 0.00   ? 327 LYS C HZ1   1 
ATOM   7757  H  HZ2   . LYS C 1 268 ? 8.716   32.083 0.818  1.00 0.00   ? 327 LYS C HZ2   1 
ATOM   7758  H  HZ3   . LYS C 1 268 ? 8.704   33.001 -0.612 1.00 0.00   ? 327 LYS C HZ3   1 
ATOM   7759  N  N     . THR C 1 269 ? 11.364  32.892 7.140  1.00 17.54  ? 328 THR C N     1 
ATOM   7760  C  CA    . THR C 1 269 ? 12.497  32.826 8.038  1.00 17.54  ? 328 THR C CA    1 
ATOM   7761  C  C     . THR C 1 269 ? 13.139  31.457 8.027  1.00 17.54  ? 328 THR C C     1 
ATOM   7762  O  O     . THR C 1 269 ? 14.133  31.225 8.709  1.00 21.74  ? 328 THR C O     1 
ATOM   7763  C  CB    . THR C 1 269 ? 12.083  33.194 9.448  1.00 21.74  ? 328 THR C CB    1 
ATOM   7764  O  OG1   . THR C 1 269 ? 10.792  32.642 9.733  1.00 21.74  ? 328 THR C OG1   1 
ATOM   7765  C  CG2   . THR C 1 269 ? 12.020  34.689 9.586  1.00 21.74  ? 328 THR C CG2   1 
ATOM   7766  H  H     . THR C 1 269 ? 10.473  32.758 7.524  1.00 0.00   ? 328 THR C H     1 
ATOM   7767  H  HG1   . THR C 1 269 ? 10.746  32.566 10.698 1.00 30.00  ? 328 THR C HG1   1 
ATOM   7768  N  N     . THR C 1 270 ? 12.633  30.578 7.172  1.00 35.96  ? 329 THR C N     1 
ATOM   7769  C  CA    . THR C 1 270 ? 13.129  29.217 7.107  1.00 35.96  ? 329 THR C CA    1 
ATOM   7770  C  C     . THR C 1 270 ? 13.623  28.733 5.737  1.00 35.96  ? 329 THR C C     1 
ATOM   7771  O  O     . THR C 1 270 ? 12.875  28.696 4.760  1.00 40.48  ? 329 THR C O     1 
ATOM   7772  C  CB    . THR C 1 270 ? 12.048  28.276 7.595  1.00 40.48  ? 329 THR C CB    1 
ATOM   7773  O  OG1   . THR C 1 270 ? 12.609  26.974 7.771  1.00 40.48  ? 329 THR C OG1   1 
ATOM   7774  C  CG2   . THR C 1 270 ? 10.891  28.225 6.591  1.00 40.48  ? 329 THR C CG2   1 
ATOM   7775  H  H     . THR C 1 270 ? 11.935  30.841 6.543  1.00 0.00   ? 329 THR C H     1 
ATOM   7776  H  HG1   . THR C 1 270 ? 13.120  26.722 6.996  1.00 30.00  ? 329 THR C HG1   1 
ATOM   7777  N  N     . LEU C 1 271 ? 14.885  28.330 5.689  1.00 38.56  ? 330 LEU C N     1 
ATOM   7778  C  CA    . LEU C 1 271 ? 15.548  27.813 4.478  1.00 38.56  ? 330 LEU C CA    1 
ATOM   7779  C  C     . LEU C 1 271 ? 16.490  26.799 5.080  1.00 38.56  ? 330 LEU C C     1 
ATOM   7780  O  O     . LEU C 1 271 ? 16.774  26.898 6.280  1.00 57.10  ? 330 LEU C O     1 
ATOM   7781  C  CB    . LEU C 1 271 ? 16.381  28.899 3.820  1.00 57.10  ? 330 LEU C CB    1 
ATOM   7782  C  CG    . LEU C 1 271 ? 15.810  29.855 2.784  1.00 57.10  ? 330 LEU C CG    1 
ATOM   7783  C  CD1   . LEU C 1 271 ? 14.465  30.457 3.209  1.00 57.10  ? 330 LEU C CD1   1 
ATOM   7784  C  CD2   . LEU C 1 271 ? 16.875  30.940 2.592  1.00 57.10  ? 330 LEU C CD2   1 
ATOM   7785  H  H     . LEU C 1 271 ? 15.430  28.390 6.505  1.00 0.00   ? 330 LEU C H     1 
ATOM   7786  N  N     . ALA C 1 272 ? 17.106  25.912 4.314  1.00 32.99  ? 331 ALA C N     1 
ATOM   7787  C  CA    . ALA C 1 272 ? 17.885  24.969 5.086  1.00 32.99  ? 331 ALA C CA    1 
ATOM   7788  C  C     . ALA C 1 272 ? 19.003  24.117 4.619  1.00 32.99  ? 331 ALA C C     1 
ATOM   7789  O  O     . ALA C 1 272 ? 18.842  23.379 3.648  1.00 94.96  ? 331 ALA C O     1 
ATOM   7790  C  CB    . ALA C 1 272 ? 16.945  24.084 5.790  1.00 94.96  ? 331 ALA C CB    1 
ATOM   7791  H  H     . ALA C 1 272 ? 17.067  25.873 3.337  1.00 0.00   ? 331 ALA C H     1 
ATOM   7792  N  N     . PRO C 1 273 ? 20.199  24.276 5.235  1.00 33.69  ? 332 PRO C N     1 
ATOM   7793  C  CA    . PRO C 1 273 ? 20.798  25.103 6.284  1.00 33.69  ? 332 PRO C CA    1 
ATOM   7794  C  C     . PRO C 1 273 ? 22.086  25.652 5.640  1.00 33.69  ? 332 PRO C C     1 
ATOM   7795  O  O     . PRO C 1 273 ? 22.644  25.007 4.753  1.00 47.75  ? 332 PRO C O     1 
ATOM   7796  C  CB    . PRO C 1 273 ? 21.112  24.085 7.367  1.00 47.75  ? 332 PRO C CB    1 
ATOM   7797  C  CG    . PRO C 1 273 ? 21.631  22.996 6.612  1.00 47.75  ? 332 PRO C CG    1 
ATOM   7798  C  CD    . PRO C 1 273 ? 20.670  22.885 5.436  1.00 47.75  ? 332 PRO C CD    1 
ATOM   7799  N  N     . ASN C 1 274 ? 22.597  26.801 6.075  1.00 29.60  ? 333 ASN C N     1 
ATOM   7800  C  CA    . ASN C 1 274 ? 23.787  27.342 5.410  1.00 29.60  ? 333 ASN C CA    1 
ATOM   7801  C  C     . ASN C 1 274 ? 25.052  26.508 5.524  1.00 29.60  ? 333 ASN C C     1 
ATOM   7802  O  O     . ASN C 1 274 ? 25.537  26.220 6.626  1.00 52.33  ? 333 ASN C O     1 
ATOM   7803  C  CB    . ASN C 1 274 ? 24.060  28.780 5.836  1.00 52.33  ? 333 ASN C CB    1 
ATOM   7804  C  CG    . ASN C 1 274 ? 24.982  29.499 4.882  1.00 52.33  ? 333 ASN C CG    1 
ATOM   7805  O  OD1   . ASN C 1 274 ? 24.990  29.237 3.679  1.00 52.33  ? 333 ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C 1 274 ? 25.780  30.402 5.416  1.00 52.33  ? 333 ASN C ND2   1 
ATOM   7807  H  H     . ASN C 1 274 ? 22.195  27.296 6.818  1.00 0.00   ? 333 ASN C H     1 
ATOM   7808  H  HD21  . ASN C 1 274 ? 26.355  30.899 4.807  1.00 0.00   ? 333 ASN C HD21  1 
ATOM   7809  H  HD22  . ASN C 1 274 ? 25.746  30.528 6.385  1.00 0.00   ? 333 ASN C HD22  1 
ATOM   7810  N  N     . THR C 1 275 ? 25.595  26.151 4.365  1.00 50.70  ? 334 THR C N     1 
ATOM   7811  C  CA    . THR C 1 275 ? 26.803  25.341 4.269  1.00 50.70  ? 334 THR C CA    1 
ATOM   7812  C  C     . THR C 1 275 ? 28.069  26.143 4.501  1.00 50.70  ? 334 THR C C     1 
ATOM   7813  O  O     . THR C 1 275 ? 29.024  25.654 5.102  1.00 68.09  ? 334 THR C O     1 
ATOM   7814  C  CB    . THR C 1 275 ? 26.918  24.683 2.867  1.00 68.09  ? 334 THR C CB    1 
ATOM   7815  O  OG1   . THR C 1 275 ? 26.087  25.388 1.930  1.00 68.09  ? 334 THR C OG1   1 
ATOM   7816  C  CG2   . THR C 1 275 ? 26.527  23.206 2.919  1.00 68.09  ? 334 THR C CG2   1 
ATOM   7817  H  H     . THR C 1 275 ? 25.169  26.426 3.525  1.00 0.00   ? 334 THR C H     1 
ATOM   7818  H  HG1   . THR C 1 275 ? 26.099  24.939 1.079  1.00 30.00  ? 334 THR C HG1   1 
ATOM   7819  N  N     . GLN C 1 276 ? 28.069  27.380 4.021  1.00 38.55  ? 335 GLN C N     1 
ATOM   7820  C  CA    . GLN C 1 276 ? 29.236  28.236 4.125  1.00 38.55  ? 335 GLN C CA    1 
ATOM   7821  C  C     . GLN C 1 276 ? 29.146  29.306 5.202  1.00 38.55  ? 335 GLN C C     1 
ATOM   7822  O  O     . GLN C 1 276 ? 28.215  29.334 6.008  1.00 69.60  ? 335 GLN C O     1 
ATOM   7823  C  CB    . GLN C 1 276 ? 29.475  28.909 2.773  1.00 69.60  ? 335 GLN C CB    1 
ATOM   7824  C  CG    . GLN C 1 276 ? 29.685  27.948 1.607  1.00 69.60  ? 335 GLN C CG    1 
ATOM   7825  C  CD    . GLN C 1 276 ? 31.114  27.428 1.499  1.00 69.60  ? 335 GLN C CD    1 
ATOM   7826  O  OE1   . GLN C 1 276 ? 31.625  26.772 2.410  1.00 69.60  ? 335 GLN C OE1   1 
ATOM   7827  N  NE2   . GLN C 1 276 ? 31.760  27.711 0.374  1.00 69.60  ? 335 GLN C NE2   1 
ATOM   7828  H  H     . GLN C 1 276 ? 27.249  27.719 3.612  1.00 0.00   ? 335 GLN C H     1 
ATOM   7829  N  N     . THR C 1 277 ? 30.153  30.180 5.194  1.00 102.02 ? 336 THR C N     1 
ATOM   7830  C  CA    . THR C 1 277 ? 30.287  31.324 6.096  1.00 102.02 ? 336 THR C CA    1 
ATOM   7831  C  C     . THR C 1 277 ? 31.467  32.162 5.575  1.00 102.02 ? 336 THR C C     1 
ATOM   7832  O  O     . THR C 1 277 ? 32.411  31.616 4.982  1.00 84.13  ? 336 THR C O     1 
ATOM   7833  C  CB    . THR C 1 277 ? 30.570  30.904 7.561  1.00 84.13  ? 336 THR C CB    1 
ATOM   7834  O  OG1   . THR C 1 277 ? 30.194  31.977 8.434  1.00 84.13  ? 336 THR C OG1   1 
ATOM   7835  C  CG2   . THR C 1 277 ? 32.062  30.571 7.770  1.00 84.13  ? 336 THR C CG2   1 
ATOM   7836  H  H     . THR C 1 277 ? 30.909  30.060 4.577  1.00 0.00   ? 336 THR C H     1 
ATOM   7837  H  HG1   . THR C 1 277 ? 29.234  32.030 8.470  1.00 30.00  ? 336 THR C HG1   1 
ATOM   7838  N  N     . ALA C 1 278 ? 31.389  33.479 5.759  1.00 76.44  ? 337 ALA C N     1 
ATOM   7839  C  CA    . ALA C 1 278 ? 32.439  34.391 5.310  1.00 76.44  ? 337 ALA C CA    1 
ATOM   7840  C  C     . ALA C 1 278 ? 33.771  33.979 5.915  1.00 76.44  ? 337 ALA C C     1 
ATOM   7841  O  O     . ALA C 1 278 ? 33.845  33.607 7.091  1.00 56.05  ? 337 ALA C O     1 
ATOM   7842  C  CB    . ALA C 1 278 ? 32.105  35.833 5.708  1.00 56.05  ? 337 ALA C CB    1 
ATOM   7843  H  H     . ALA C 1 278 ? 30.628  33.833 6.254  1.00 0.00   ? 337 ALA C H     1 
ATOM   7844  N  N     . SER C 1 279 ? 34.811  34.023 5.089  1.00 52.96  ? 338 SER C N     1 
ATOM   7845  C  CA    . SER C 1 279 ? 36.165  33.664 5.499  1.00 52.96  ? 338 SER C CA    1 
ATOM   7846  C  C     . SER C 1 279 ? 36.905  34.910 5.936  1.00 52.96  ? 338 SER C C     1 
ATOM   7847  O  O     . SER C 1 279 ? 36.456  36.031 5.674  1.00 70.48  ? 338 SER C O     1 
ATOM   7848  C  CB    . SER C 1 279 ? 36.908  33.023 4.319  1.00 70.48  ? 338 SER C CB    1 
ATOM   7849  O  OG    . SER C 1 279 ? 36.944  33.881 3.183  1.00 70.48  ? 338 SER C OG    1 
ATOM   7850  H  H     . SER C 1 279 ? 34.678  34.289 4.158  1.00 0.00   ? 338 SER C H     1 
ATOM   7851  H  HG    . SER C 1 279 ? 37.154  33.334 2.411  1.00 30.00  ? 338 SER C HG    1 
ATOM   7852  N  N     . PRO C 1 280 ? 38.048  34.736 6.618  1.00 48.80  ? 339 PRO C N     1 
ATOM   7853  C  CA    . PRO C 1 280 ? 38.812  35.906 7.056  1.00 48.80  ? 339 PRO C CA    1 
ATOM   7854  C  C     . PRO C 1 280 ? 39.077  36.800 5.846  1.00 48.80  ? 339 PRO C C     1 
ATOM   7855  O  O     . PRO C 1 280 ? 38.988  38.030 5.935  1.00 35.28  ? 339 PRO C O     1 
ATOM   7856  C  CB    . PRO C 1 280 ? 40.081  35.282 7.613  1.00 35.28  ? 339 PRO C CB    1 
ATOM   7857  C  CG    . PRO C 1 280 ? 39.548  34.048 8.246  1.00 35.28  ? 339 PRO C CG    1 
ATOM   7858  C  CD    . PRO C 1 280 ? 38.621  33.505 7.184  1.00 35.28  ? 339 PRO C CD    1 
ATOM   7859  N  N     . ARG C 1 281 ? 39.290  36.169 4.693  1.00 57.90  ? 340 ARG C N     1 
ATOM   7860  C  CA    . ARG C 1 281 ? 39.525  36.900 3.449  1.00 57.90  ? 340 ARG C CA    1 
ATOM   7861  C  C     . ARG C 1 281 ? 38.353  37.834 3.155  1.00 57.90  ? 340 ARG C C     1 
ATOM   7862  O  O     . ARG C 1 281 ? 38.541  39.033 2.940  1.00 113.89 ? 340 ARG C O     1 
ATOM   7863  C  CB    . ARG C 1 281 ? 39.729  35.924 2.287  1.00 113.89 ? 340 ARG C CB    1 
ATOM   7864  C  CG    . ARG C 1 281 ? 41.004  35.104 2.396  1.00 113.89 ? 340 ARG C CG    1 
ATOM   7865  C  CD    . ARG C 1 281 ? 42.186  36.015 2.715  1.00 113.89 ? 340 ARG C CD    1 
ATOM   7866  N  NE    . ARG C 1 281 ? 43.478  35.359 2.536  1.00 113.89 ? 340 ARG C NE    1 
ATOM   7867  C  CZ    . ARG C 1 281 ? 44.051  35.146 1.353  1.00 113.89 ? 340 ARG C CZ    1 
ATOM   7868  N  NH1   . ARG C 1 281 ? 43.445  35.528 0.234  1.00 113.89 ? 340 ARG C NH1   1 
ATOM   7869  N  NH2   . ARG C 1 281 ? 45.253  34.587 1.290  1.00 113.89 ? 340 ARG C NH2   1 
ATOM   7870  H  H     . ARG C 1 281 ? 39.308  35.195 4.681  1.00 0.00   ? 340 ARG C H     1 
ATOM   7871  H  HE    . ARG C 1 281 ? 43.952  35.059 3.340  1.00 0.00   ? 340 ARG C HE    1 
ATOM   7872  H  HH11  . ARG C 1 281 ? 42.556  35.983 0.275  1.00 0.00   ? 340 ARG C HH11  1 
ATOM   7873  H  HH12  . ARG C 1 281 ? 43.882  35.371 -0.652 1.00 0.00   ? 340 ARG C HH12  1 
ATOM   7874  H  HH21  . ARG C 1 281 ? 45.723  34.331 2.135  1.00 0.00   ? 340 ARG C HH21  1 
ATOM   7875  H  HH22  . ARG C 1 281 ? 45.690  34.429 0.404  1.00 0.00   ? 340 ARG C HH22  1 
ATOM   7876  N  N     . ALA C 1 282 ? 37.143  37.287 3.224  1.00 35.83  ? 341 ALA C N     1 
ATOM   7877  C  CA    . ALA C 1 282 ? 35.932  38.055 2.968  1.00 35.83  ? 341 ALA C CA    1 
ATOM   7878  C  C     . ALA C 1 282 ? 35.753  39.200 3.958  1.00 35.83  ? 341 ALA C C     1 
ATOM   7879  O  O     . ALA C 1 282 ? 35.415  40.319 3.577  1.00 50.62  ? 341 ALA C O     1 
ATOM   7880  C  CB    . ALA C 1 282 ? 34.722  37.137 3.004  1.00 50.62  ? 341 ALA C CB    1 
ATOM   7881  H  H     . ALA C 1 282 ? 37.052  36.345 3.466  1.00 0.00   ? 341 ALA C H     1 
ATOM   7882  N  N     . LEU C 1 283 ? 36.011  38.932 5.228  1.00 36.61  ? 342 LEU C N     1 
ATOM   7883  C  CA    . LEU C 1 283 ? 35.835  39.956 6.252  1.00 36.61  ? 342 LEU C CA    1 
ATOM   7884  C  C     . LEU C 1 283 ? 36.876  41.054 6.089  1.00 36.61  ? 342 LEU C C     1 
ATOM   7885  O  O     . LEU C 1 283 ? 36.549  42.241 6.123  1.00 35.35  ? 342 LEU C O     1 
ATOM   7886  C  CB    . LEU C 1 283 ? 35.914  39.325 7.640  1.00 35.35  ? 342 LEU C CB    1 
ATOM   7887  C  CG    . LEU C 1 283 ? 34.993  38.117 7.846  1.00 35.35  ? 342 LEU C CG    1 
ATOM   7888  C  CD1   . LEU C 1 283 ? 35.302  37.457 9.177  1.00 35.35  ? 342 LEU C CD1   1 
ATOM   7889  C  CD2   . LEU C 1 283 ? 33.531  38.519 7.756  1.00 35.35  ? 342 LEU C CD2   1 
ATOM   7890  H  H     . LEU C 1 283 ? 36.326  38.035 5.470  1.00 0.00   ? 342 LEU C H     1 
ATOM   7891  N  N     . ALA C 1 284 ? 38.120  40.650 5.845  1.00 65.04  ? 343 ALA C N     1 
ATOM   7892  C  CA    . ALA C 1 284 ? 39.217  41.593 5.664  1.00 65.04  ? 343 ALA C CA    1 
ATOM   7893  C  C     . ALA C 1 284 ? 38.872  42.545 4.521  1.00 65.04  ? 343 ALA C C     1 
ATOM   7894  O  O     . ALA C 1 284 ? 39.022  43.763 4.666  1.00 37.00  ? 343 ALA C O     1 
ATOM   7895  C  CB    . ALA C 1 284 ? 40.520  40.845 5.373  1.00 37.00  ? 343 ALA C CB    1 
ATOM   7896  H  H     . ALA C 1 284 ? 38.302  39.700 5.774  1.00 0.00   ? 343 ALA C H     1 
ATOM   7897  N  N     . ASP C 1 285 ? 38.360  41.982 3.421  1.00 41.20  ? 344 ASP C N     1 
ATOM   7898  C  CA    . ASP C 1 285 ? 37.959  42.743 2.237  1.00 41.20  ? 344 ASP C CA    1 
ATOM   7899  C  C     . ASP C 1 285 ? 36.967  43.842 2.573  1.00 41.20  ? 344 ASP C C     1 
ATOM   7900  O  O     . ASP C 1 285 ? 37.211  45.022 2.306  1.00 101.21 ? 344 ASP C O     1 
ATOM   7901  C  CB    . ASP C 1 285 ? 37.316  41.821 1.196  1.00 101.21 ? 344 ASP C CB    1 
ATOM   7902  C  CG    . ASP C 1 285 ? 38.331  41.164 0.288  1.00 101.21 ? 344 ASP C CG    1 
ATOM   7903  O  OD1   . ASP C 1 285 ? 39.261  41.865 -0.174 1.00 101.21 ? 344 ASP C OD1   1 
ATOM   7904  O  OD2   . ASP C 1 285 ? 38.189  39.950 0.021  1.00 101.21 ? 344 ASP C OD2   1 
ATOM   7905  H  H     . ASP C 1 285 ? 38.269  41.003 3.409  1.00 0.00   ? 344 ASP C H     1 
ATOM   7906  N  N     . SER C 1 286 ? 35.828  43.441 3.129  1.00 41.77  ? 345 SER C N     1 
ATOM   7907  C  CA    . SER C 1 286 ? 34.803  44.390 3.516  1.00 41.77  ? 345 SER C CA    1 
ATOM   7908  C  C     . SER C 1 286 ? 35.492  45.419 4.388  1.00 41.77  ? 345 SER C C     1 
ATOM   7909  O  O     . SER C 1 286 ? 35.388  46.618 4.145  1.00 73.60  ? 345 SER C O     1 
ATOM   7910  C  CB    . SER C 1 286 ? 33.703  43.686 4.306  1.00 73.60  ? 345 SER C CB    1 
ATOM   7911  O  OG    . SER C 1 286 ? 33.185  42.574 3.591  1.00 73.60  ? 345 SER C OG    1 
ATOM   7912  H  H     . SER C 1 286 ? 35.672  42.486 3.286  1.00 0.00   ? 345 SER C H     1 
ATOM   7913  H  HG    . SER C 1 286 ? 33.837  41.870 3.496  1.00 30.00  ? 345 SER C HG    1 
ATOM   7914  N  N     . LEU C 1 287 ? 36.285  44.935 5.335  1.00 24.24  ? 346 LEU C N     1 
ATOM   7915  C  CA    . LEU C 1 287 ? 37.002  45.821 6.235  1.00 24.24  ? 346 LEU C CA    1 
ATOM   7916  C  C     . LEU C 1 287 ? 37.843  46.823 5.464  1.00 24.24  ? 346 LEU C C     1 
ATOM   7917  O  O     . LEU C 1 287 ? 37.933  47.995 5.842  1.00 51.00  ? 346 LEU C O     1 
ATOM   7918  C  CB    . LEU C 1 287 ? 37.877  45.021 7.204  1.00 51.00  ? 346 LEU C CB    1 
ATOM   7919  C  CG    . LEU C 1 287 ? 37.217  44.706 8.550  1.00 51.00  ? 346 LEU C CG    1 
ATOM   7920  C  CD1   . LEU C 1 287 ? 38.189  43.978 9.472  1.00 51.00  ? 346 LEU C CD1   1 
ATOM   7921  C  CD2   . LEU C 1 287 ? 36.754  46.014 9.178  1.00 51.00  ? 346 LEU C CD2   1 
ATOM   7922  H  H     . LEU C 1 287 ? 36.408  43.970 5.420  1.00 0.00   ? 346 LEU C H     1 
ATOM   7923  N  N     . MET C 1 288 ? 38.405  46.374 4.349  1.00 69.77  ? 347 MET C N     1 
ATOM   7924  C  CA    . MET C 1 288 ? 39.233  47.230 3.511  1.00 69.77  ? 347 MET C CA    1 
ATOM   7925  C  C     . MET C 1 288 ? 38.446  48.436 3.051  1.00 69.77  ? 347 MET C C     1 
ATOM   7926  O  O     . MET C 1 288 ? 38.849  49.578 3.293  1.00 48.73  ? 347 MET C O     1 
ATOM   7927  C  CB    . MET C 1 288 ? 39.731  46.467 2.289  1.00 48.73  ? 347 MET C CB    1 
ATOM   7928  C  CG    . MET C 1 288 ? 40.674  45.338 2.618  1.00 48.73  ? 347 MET C CG    1 
ATOM   7929  S  SD    . MET C 1 288 ? 42.258  45.931 3.206  1.00 48.73  ? 347 MET C SD    1 
ATOM   7930  C  CE    . MET C 1 288 ? 43.229  44.370 3.049  1.00 48.73  ? 347 MET C CE    1 
ATOM   7931  H  H     . MET C 1 288 ? 38.259  45.446 4.091  1.00 0.00   ? 347 MET C H     1 
ATOM   7932  N  N     . GLN C 1 289 ? 37.311  48.184 2.403  1.00 59.11  ? 348 GLN C N     1 
ATOM   7933  C  CA    . GLN C 1 289 ? 36.499  49.288 1.911  1.00 59.11  ? 348 GLN C CA    1 
ATOM   7934  C  C     . GLN C 1 289 ? 35.865  50.119 3.013  1.00 59.11  ? 348 GLN C C     1 
ATOM   7935  O  O     . GLN C 1 289 ? 35.701  51.333 2.859  1.00 119.27 ? 348 GLN C O     1 
ATOM   7936  C  CB    . GLN C 1 289 ? 35.485  48.852 0.843  1.00 119.27 ? 348 GLN C CB    1 
ATOM   7937  C  CG    . GLN C 1 289 ? 34.704  47.578 1.103  1.00 119.27 ? 348 GLN C CG    1 
ATOM   7938  C  CD    . GLN C 1 289 ? 33.920  47.126 -0.131 1.00 119.27 ? 348 GLN C CD    1 
ATOM   7939  O  OE1   . GLN C 1 289 ? 33.742  45.927 -0.365 1.00 119.27 ? 348 GLN C OE1   1 
ATOM   7940  N  NE2   . GLN C 1 289 ? 33.449  48.089 -0.927 1.00 119.27 ? 348 GLN C NE2   1 
ATOM   7941  H  H     . GLN C 1 289 ? 37.030  47.248 2.286  1.00 0.00   ? 348 GLN C H     1 
ATOM   7942  N  N     . LEU C 1 290 ? 35.556  49.485 4.139  1.00 49.74  ? 349 LEU C N     1 
ATOM   7943  C  CA    . LEU C 1 290 ? 34.997  50.224 5.254  1.00 49.74  ? 349 LEU C CA    1 
ATOM   7944  C  C     . LEU C 1 290 ? 36.112  51.151 5.722  1.00 49.74  ? 349 LEU C C     1 
ATOM   7945  O  O     . LEU C 1 290 ? 35.868  52.317 6.043  1.00 56.74  ? 349 LEU C O     1 
ATOM   7946  C  CB    . LEU C 1 290 ? 34.539  49.289 6.382  1.00 56.74  ? 349 LEU C CB    1 
ATOM   7947  C  CG    . LEU C 1 290 ? 33.099  48.785 6.289  1.00 56.74  ? 349 LEU C CG    1 
ATOM   7948  C  CD1   . LEU C 1 290 ? 32.175  49.967 6.079  1.00 56.74  ? 349 LEU C CD1   1 
ATOM   7949  C  CD2   . LEU C 1 290 ? 32.941  47.815 5.142  1.00 56.74  ? 349 LEU C CD2   1 
ATOM   7950  H  H     . LEU C 1 290 ? 35.710  48.521 4.212  1.00 0.00   ? 349 LEU C H     1 
ATOM   7951  N  N     . ALA C 1 291 ? 37.344  50.648 5.685  1.00 64.48  ? 350 ALA C N     1 
ATOM   7952  C  CA    . ALA C 1 291 ? 38.521  51.436 6.076  1.00 64.48  ? 350 ALA C CA    1 
ATOM   7953  C  C     . ALA C 1 291 ? 38.643  52.642 5.142  1.00 64.48  ? 350 ALA C C     1 
ATOM   7954  O  O     . ALA C 1 291 ? 38.721  53.795 5.580  1.00 32.72  ? 350 ALA C O     1 
ATOM   7955  C  CB    . ALA C 1 291 ? 39.791  50.576 5.985  1.00 32.72  ? 350 ALA C CB    1 
ATOM   7956  H  H     . ALA C 1 291 ? 37.473  49.729 5.387  1.00 0.00   ? 350 ALA C H     1 
ATOM   7957  N  N     . ARG C 1 292 ? 38.622  52.352 3.847  1.00 70.90  ? 351 ARG C N     1 
ATOM   7958  C  CA    . ARG C 1 292 ? 38.717  53.374 2.825  1.00 70.90  ? 351 ARG C CA    1 
ATOM   7959  C  C     . ARG C 1 292 ? 37.676  54.450 3.080  1.00 70.90  ? 351 ARG C C     1 
ATOM   7960  O  O     . ARG C 1 292 ? 38.007  55.634 3.204  1.00 105.82 ? 351 ARG C O     1 
ATOM   7961  C  CB    . ARG C 1 292 ? 38.523  52.750 1.436  1.00 105.82 ? 351 ARG C CB    1 
ATOM   7962  C  CG    . ARG C 1 292 ? 39.775  52.064 0.886  1.00 105.82 ? 351 ARG C CG    1 
ATOM   7963  C  CD    . ARG C 1 292 ? 40.811  53.109 0.487  1.00 105.82 ? 351 ARG C CD    1 
ATOM   7964  N  NE    . ARG C 1 292 ? 42.169  52.580 0.388  1.00 105.82 ? 351 ARG C NE    1 
ATOM   7965  C  CZ    . ARG C 1 292 ? 43.155  53.193 -0.263 1.00 105.82 ? 351 ARG C CZ    1 
ATOM   7966  N  NH1   . ARG C 1 292 ? 42.929  54.349 -0.881 1.00 105.82 ? 351 ARG C NH1   1 
ATOM   7967  N  NH2   . ARG C 1 292 ? 44.377  52.670 -0.270 1.00 105.82 ? 351 ARG C NH2   1 
ATOM   7968  H  H     . ARG C 1 292 ? 38.545  51.413 3.585  1.00 0.00   ? 351 ARG C H     1 
ATOM   7969  H  HE    . ARG C 1 292 ? 42.373  51.730 0.830  1.00 0.00   ? 351 ARG C HE    1 
ATOM   7970  H  HH11  . ARG C 1 292 ? 42.019  54.763 -0.867 1.00 0.00   ? 351 ARG C HH11  1 
ATOM   7971  H  HH12  . ARG C 1 292 ? 43.675  54.804 -1.368 1.00 0.00   ? 351 ARG C HH12  1 
ATOM   7972  H  HH21  . ARG C 1 292 ? 44.557  51.813 0.212  1.00 0.00   ? 351 ARG C HH21  1 
ATOM   7973  H  HH22  . ARG C 1 292 ? 45.117  53.133 -0.758 1.00 0.00   ? 351 ARG C HH22  1 
ATOM   7974  N  N     . GLN C 1 293 ? 36.427  54.022 3.236  1.00 57.40  ? 352 GLN C N     1 
ATOM   7975  C  CA    . GLN C 1 293 ? 35.330  54.952 3.472  1.00 57.40  ? 352 GLN C CA    1 
ATOM   7976  C  C     . GLN C 1 293 ? 35.560  55.807 4.712  1.00 57.40  ? 352 GLN C C     1 
ATOM   7977  O  O     . GLN C 1 293 ? 35.322  57.019 4.693  1.00 49.50  ? 352 GLN C O     1 
ATOM   7978  C  CB    . GLN C 1 293 ? 34.009  54.199 3.539  1.00 49.50  ? 352 GLN C CB    1 
ATOM   7979  C  CG    . GLN C 1 293 ? 33.746  53.420 2.275  1.00 49.50  ? 352 GLN C CG    1 
ATOM   7980  C  CD    . GLN C 1 293 ? 32.378  52.798 2.250  1.00 49.50  ? 352 GLN C CD    1 
ATOM   7981  O  OE1   . GLN C 1 293 ? 32.241  51.577 2.151  1.00 49.50  ? 352 GLN C OE1   1 
ATOM   7982  N  NE2   . GLN C 1 293 ? 31.345  53.635 2.339  1.00 49.50  ? 352 GLN C NE2   1 
ATOM   7983  H  H     . GLN C 1 293 ? 36.253  53.063 3.203  1.00 0.00   ? 352 GLN C H     1 
ATOM   7984  N  N     . VAL C 1 294 ? 36.069  55.187 5.769  1.00 49.88  ? 353 VAL C N     1 
ATOM   7985  C  CA    . VAL C 1 294 ? 36.354  55.913 6.998  1.00 49.88  ? 353 VAL C CA    1 
ATOM   7986  C  C     . VAL C 1 294 ? 37.418  56.969 6.705  1.00 49.88  ? 353 VAL C C     1 
ATOM   7987  O  O     . VAL C 1 294 ? 37.337  58.089 7.211  1.00 58.80  ? 353 VAL C O     1 
ATOM   7988  C  CB    . VAL C 1 294 ? 36.863  54.972 8.095  1.00 58.80  ? 353 VAL C CB    1 
ATOM   7989  C  CG1   . VAL C 1 294 ? 37.352  55.772 9.284  1.00 58.80  ? 353 VAL C CG1   1 
ATOM   7990  C  CG2   . VAL C 1 294 ? 35.760  54.026 8.521  1.00 58.80  ? 353 VAL C CG2   1 
ATOM   7991  H  H     . VAL C 1 294 ? 36.258  54.226 5.728  1.00 0.00   ? 353 VAL C H     1 
ATOM   7992  N  N     . SER C 1 295 ? 38.391  56.606 5.865  1.00 71.30  ? 354 SER C N     1 
ATOM   7993  C  CA    . SER C 1 295 ? 39.494  57.490 5.477  1.00 71.30  ? 354 SER C CA    1 
ATOM   7994  C  C     . SER C 1 295 ? 38.945  58.704 4.768  1.00 71.30  ? 354 SER C C     1 
ATOM   7995  O  O     . SER C 1 295 ? 39.258  59.842 5.120  1.00 80.66  ? 354 SER C O     1 
ATOM   7996  C  CB    . SER C 1 295 ? 40.461  56.763 4.532  1.00 80.66  ? 354 SER C CB    1 
ATOM   7997  O  OG    . SER C 1 295 ? 41.697  57.451 4.400  1.00 80.66  ? 354 SER C OG    1 
ATOM   7998  H  H     . SER C 1 295 ? 38.372  55.707 5.482  1.00 0.00   ? 354 SER C H     1 
ATOM   7999  H  HG    . SER C 1 295 ? 42.070  57.526 5.285  1.00 30.00  ? 354 SER C HG    1 
ATOM   8000  N  N     . ARG C 1 296 ? 38.120  58.448 3.763  1.00 45.09  ? 355 ARG C N     1 
ATOM   8001  C  CA    . ARG C 1 296 ? 37.519  59.521 2.985  1.00 45.09  ? 355 ARG C CA    1 
ATOM   8002  C  C     . ARG C 1 296 ? 36.924  60.643 3.866  1.00 45.09  ? 355 ARG C C     1 
ATOM   8003  O  O     . ARG C 1 296 ? 37.220  61.819 3.656  1.00 112.24 ? 355 ARG C O     1 
ATOM   8004  C  CB    . ARG C 1 296 ? 36.446  58.943 2.034  1.00 112.24 ? 355 ARG C CB    1 
ATOM   8005  C  CG    . ARG C 1 296 ? 36.959  57.833 1.084  1.00 112.24 ? 355 ARG C CG    1 
ATOM   8006  C  CD    . ARG C 1 296 ? 35.830  57.150 0.271  1.00 112.24 ? 355 ARG C CD    1 
ATOM   8007  N  NE    . ARG C 1 296 ? 36.283  55.930 -0.421 1.00 112.24 ? 355 ARG C NE    1 
ATOM   8008  C  CZ    . ARG C 1 296 ? 35.484  54.945 -0.848 1.00 112.24 ? 355 ARG C CZ    1 
ATOM   8009  N  NH1   . ARG C 1 296 ? 34.168  55.012 -0.670 1.00 112.24 ? 355 ARG C NH1   1 
ATOM   8010  N  NH2   . ARG C 1 296 ? 36.004  53.874 -1.441 1.00 112.24 ? 355 ARG C NH2   1 
ATOM   8011  H  H     . ARG C 1 296 ? 37.902  57.517 3.568  1.00 0.00   ? 355 ARG C H     1 
ATOM   8012  H  HE    . ARG C 1 296 ? 37.245  55.826 -0.578 1.00 0.00   ? 355 ARG C HE    1 
ATOM   8013  H  HH11  . ARG C 1 296 ? 33.768  55.807 -0.216 1.00 0.00   ? 355 ARG C HH11  1 
ATOM   8014  H  HH12  . ARG C 1 296 ? 33.583  54.270 -0.995 1.00 0.00   ? 355 ARG C HH12  1 
ATOM   8015  H  HH21  . ARG C 1 296 ? 36.994  53.804 -1.572 1.00 0.00   ? 355 ARG C HH21  1 
ATOM   8016  H  HH22  . ARG C 1 296 ? 35.409  53.138 -1.761 1.00 0.00   ? 355 ARG C HH22  1 
ATOM   8017  N  N     . LEU C 1 297 ? 36.139  60.249 4.875  1.00 92.00  ? 356 LEU C N     1 
ATOM   8018  C  CA    . LEU C 1 297 ? 35.438  61.155 5.809  1.00 92.00  ? 356 LEU C CA    1 
ATOM   8019  C  C     . LEU C 1 297 ? 36.254  62.357 6.279  1.00 92.00  ? 356 LEU C C     1 
ATOM   8020  O  O     . LEU C 1 297 ? 35.744  63.073 7.176  1.00 65.76  ? 356 LEU C O     1 
ATOM   8021  C  CB    . LEU C 1 297 ? 34.927  60.370 7.034  1.00 65.76  ? 356 LEU C CB    1 
ATOM   8022  C  CG    . LEU C 1 297 ? 34.104  59.108 6.771  1.00 65.76  ? 356 LEU C CG    1 
ATOM   8023  C  CD1   . LEU C 1 297 ? 33.805  58.389 8.065  1.00 65.76  ? 356 LEU C CD1   1 
ATOM   8024  C  CD2   . LEU C 1 297 ? 32.834  59.464 6.039  1.00 65.76  ? 356 LEU C CD2   1 
ATOM   8025  H  H     . LEU C 1 297 ? 36.056  59.283 5.010  1.00 0.00   ? 356 LEU C H     1 
ATOM   8026  N  N     . SER D 1 2   ? -9.132  47.576 46.371 1.00 89.10  ? 61  SER D N     1 
ATOM   8027  C  CA    . SER D 1 2   ? -10.146 48.242 47.232 1.00 89.10  ? 61  SER D CA    1 
ATOM   8028  C  C     . SER D 1 2   ? -11.269 48.783 46.347 1.00 89.10  ? 61  SER D C     1 
ATOM   8029  O  O     . SER D 1 2   ? -12.245 48.074 46.077 1.00 87.46  ? 61  SER D O     1 
ATOM   8030  C  CB    . SER D 1 2   ? -9.494  49.373 48.047 1.00 87.46  ? 61  SER D CB    1 
ATOM   8031  O  OG    . SER D 1 2   ? -8.802  50.288 47.212 1.00 87.46  ? 61  SER D OG    1 
ATOM   8032  H  HG    . SER D 1 2   ? -8.270  50.905 47.744 1.00 30.00  ? 61  SER D HG    1 
ATOM   8033  N  N     . LEU D 1 3   ? -11.106 50.016 45.869 1.00 71.04  ? 62  LEU D N     1 
ATOM   8034  C  CA    . LEU D 1 3   ? -12.091 50.653 45.001 1.00 71.04  ? 62  LEU D CA    1 
ATOM   8035  C  C     . LEU D 1 3   ? -12.104 49.943 43.654 1.00 71.04  ? 62  LEU D C     1 
ATOM   8036  O  O     . LEU D 1 3   ? -11.310 49.034 43.422 1.00 63.46  ? 62  LEU D O     1 
ATOM   8037  C  CB    . LEU D 1 3   ? -11.727 52.113 44.786 1.00 63.46  ? 62  LEU D CB    1 
ATOM   8038  C  CG    . LEU D 1 3   ? -10.367 52.268 44.117 1.00 63.46  ? 62  LEU D CG    1 
ATOM   8039  C  CD1   . LEU D 1 3   ? -10.482 53.201 42.924 1.00 63.46  ? 62  LEU D CD1   1 
ATOM   8040  C  CD2   . LEU D 1 3   ? -9.342  52.740 45.137 1.00 63.46  ? 62  LEU D CD2   1 
ATOM   8041  H  H     . LEU D 1 3   ? -10.305 50.534 46.073 1.00 0.00   ? 62  LEU D H     1 
ATOM   8042  N  N     . LEU D 1 4   ? -12.965 50.404 42.755 1.00 41.67  ? 63  LEU D N     1 
ATOM   8043  C  CA    . LEU D 1 4   ? -13.096 49.810 41.434 1.00 41.67  ? 63  LEU D CA    1 
ATOM   8044  C  C     . LEU D 1 4   ? -12.971 50.851 40.365 1.00 41.67  ? 63  LEU D C     1 
ATOM   8045  O  O     . LEU D 1 4   ? -13.717 51.830 40.368 1.00 36.01  ? 63  LEU D O     1 
ATOM   8046  C  CB    . LEU D 1 4   ? -14.459 49.140 41.256 1.00 36.01  ? 63  LEU D CB    1 
ATOM   8047  C  CG    . LEU D 1 4   ? -14.469 47.611 41.161 1.00 36.01  ? 63  LEU D CG    1 
ATOM   8048  C  CD1   . LEU D 1 4   ? -15.796 47.151 40.583 1.00 36.01  ? 63  LEU D CD1   1 
ATOM   8049  C  CD2   . LEU D 1 4   ? -13.307 47.128 40.298 1.00 36.01  ? 63  LEU D CD2   1 
ATOM   8050  H  H     . LEU D 1 4   ? -13.521 51.180 42.981 1.00 0.00   ? 63  LEU D H     1 
ATOM   8051  N  N     . ILE D 1 5   ? -12.070 50.592 39.420 1.00 27.06  ? 64  ILE D N     1 
ATOM   8052  C  CA    . ILE D 1 5   ? -11.824 51.465 38.287 1.00 27.06  ? 64  ILE D CA    1 
ATOM   8053  C  C     . ILE D 1 5   ? -12.300 50.673 37.085 1.00 27.06  ? 64  ILE D C     1 
ATOM   8054  O  O     . ILE D 1 5   ? -11.884 49.519 36.897 1.00 28.45  ? 64  ILE D O     1 
ATOM   8055  C  CB    . ILE D 1 5   ? -10.323 51.754 38.139 1.00 28.45  ? 64  ILE D CB    1 
ATOM   8056  C  CG1   . ILE D 1 5   ? -9.793  52.448 39.419 1.00 28.45  ? 64  ILE D CG1   1 
ATOM   8057  C  CG2   . ILE D 1 5   ? -10.083 52.597 36.888 1.00 28.45  ? 64  ILE D CG2   1 
ATOM   8058  C  CD1   . ILE D 1 5   ? -8.245  52.407 39.626 1.00 28.45  ? 64  ILE D CD1   1 
ATOM   8059  H  H     . ILE D 1 5   ? -11.553 49.763 39.457 1.00 0.00   ? 64  ILE D H     1 
ATOM   8060  N  N     . GLY D 1 6   ? -13.222 51.249 36.317 1.00 18.50  ? 65  GLY D N     1 
ATOM   8061  C  CA    . GLY D 1 6   ? -13.733 50.578 35.137 1.00 18.50  ? 65  GLY D CA    1 
ATOM   8062  C  C     . GLY D 1 6   ? -13.127 51.240 33.919 1.00 18.50  ? 65  GLY D C     1 
ATOM   8063  O  O     . GLY D 1 6   ? -13.183 52.463 33.800 1.00 35.09  ? 65  GLY D O     1 
ATOM   8064  H  H     . GLY D 1 6   ? -13.548 52.149 36.512 1.00 0.00   ? 65  GLY D H     1 
ATOM   8065  N  N     . VAL D 1 7   ? -12.525 50.450 33.030 1.00 19.24  ? 66  VAL D N     1 
ATOM   8066  C  CA    . VAL D 1 7   ? -11.898 50.966 31.814 1.00 19.24  ? 66  VAL D CA    1 
ATOM   8067  C  C     . VAL D 1 7   ? -12.690 50.483 30.593 1.00 19.24  ? 66  VAL D C     1 
ATOM   8068  O  O     . VAL D 1 7   ? -12.991 49.293 30.474 1.00 19.36  ? 66  VAL D O     1 
ATOM   8069  C  CB    . VAL D 1 7   ? -10.456 50.432 31.671 1.00 19.36  ? 66  VAL D CB    1 
ATOM   8070  C  CG1   . VAL D 1 7   ? -9.720  51.210 30.614 1.00 19.36  ? 66  VAL D CG1   1 
ATOM   8071  C  CG2   . VAL D 1 7   ? -9.711  50.468 32.979 1.00 19.36  ? 66  VAL D CG2   1 
ATOM   8072  H  H     . VAL D 1 7   ? -12.524 49.483 33.184 1.00 0.00   ? 66  VAL D H     1 
ATOM   8073  N  N     . ALA D 1 8   ? -13.085 51.396 29.720 1.00 25.00  ? 67  ALA D N     1 
ATOM   8074  C  CA    . ALA D 1 8   ? -13.812 51.031 28.497 1.00 25.00  ? 67  ALA D CA    1 
ATOM   8075  C  C     . ALA D 1 8   ? -12.716 51.268 27.468 1.00 25.00  ? 67  ALA D C     1 
ATOM   8076  O  O     . ALA D 1 8   ? -12.277 52.406 27.261 1.00 37.65  ? 67  ALA D O     1 
ATOM   8077  C  CB    . ALA D 1 8   ? -14.986 51.962 28.263 1.00 37.65  ? 67  ALA D CB    1 
ATOM   8078  H  H     . ALA D 1 8   ? -12.874 52.337 29.875 1.00 0.00   ? 67  ALA D H     1 
ATOM   8079  N  N     . THR D 1 9   ? -12.260 50.187 26.845 1.00 20.18  ? 68  THR D N     1 
ATOM   8080  C  CA    . THR D 1 9   ? -11.146 50.250 25.919 1.00 20.18  ? 68  THR D CA    1 
ATOM   8081  C  C     . THR D 1 9   ? -11.411 49.692 24.541 1.00 20.18  ? 68  THR D C     1 
ATOM   8082  O  O     . THR D 1 9   ? -12.208 48.768 24.359 1.00 33.99  ? 68  THR D O     1 
ATOM   8083  C  CB    . THR D 1 9   ? -9.940  49.502 26.517 1.00 33.99  ? 68  THR D CB    1 
ATOM   8084  O  OG1   . THR D 1 9   ? -8.745  49.821 25.799 1.00 33.99  ? 68  THR D OG1   1 
ATOM   8085  C  CG2   . THR D 1 9   ? -10.174 48.019 26.452 1.00 33.99  ? 68  THR D CG2   1 
ATOM   8086  H  H     . THR D 1 9   ? -12.675 49.313 27.008 1.00 0.00   ? 68  THR D H     1 
ATOM   8087  H  HG1   . THR D 1 9   ? -8.435  50.731 25.915 1.00 30.00  ? 68  THR D HG1   1 
ATOM   8088  N  N     . SER D 1 10  ? -10.657 50.245 23.590 1.00 52.78  ? 69  SER D N     1 
ATOM   8089  C  CA    . SER D 1 10  ? -10.693 49.883 22.181 1.00 52.78  ? 69  SER D CA    1 
ATOM   8090  C  C     . SER D 1 10  ? -10.293 48.417 22.085 1.00 52.78  ? 69  SER D C     1 
ATOM   8091  O  O     . SER D 1 10  ? -10.033 47.778 23.095 1.00 30.18  ? 69  SER D O     1 
ATOM   8092  C  CB    . SER D 1 10  ? -9.669  50.720 21.422 1.00 30.18  ? 69  SER D CB    1 
ATOM   8093  O  OG    . SER D 1 10  ? -9.757  52.081 21.765 1.00 30.18  ? 69  SER D OG    1 
ATOM   8094  H  H     . SER D 1 10  ? -10.003 50.903 23.894 1.00 0.00   ? 69  SER D H     1 
ATOM   8095  H  HG    . SER D 1 10  ? -9.672  52.216 22.720 1.00 30.00  ? 69  SER D HG    1 
ATOM   8096  N  N     . SER D 1 11  ? -10.199 47.887 20.876 1.00 26.97  ? 70  SER D N     1 
ATOM   8097  C  CA    . SER D 1 11  ? -9.812  46.497 20.732 1.00 26.97  ? 70  SER D CA    1 
ATOM   8098  C  C     . SER D 1 11  ? -8.440  46.310 21.318 1.00 26.97  ? 70  SER D C     1 
ATOM   8099  O  O     . SER D 1 11  ? -7.490  46.972 20.936 1.00 43.72  ? 70  SER D O     1 
ATOM   8100  C  CB    . SER D 1 11  ? -9.808  46.056 19.268 1.00 43.72  ? 70  SER D CB    1 
ATOM   8101  O  OG    . SER D 1 11  ? -9.331  44.723 19.145 1.00 43.72  ? 70  SER D OG    1 
ATOM   8102  H  H     . SER D 1 11  ? -10.378 48.422 20.078 1.00 0.00   ? 70  SER D H     1 
ATOM   8103  H  HG    . SER D 1 11  ? -9.331  44.500 18.205 1.00 30.00  ? 70  SER D HG    1 
ATOM   8104  N  N     . LEU D 1 12  ? -8.358  45.388 22.256 1.00 28.64  ? 71  LEU D N     1 
ATOM   8105  C  CA    . LEU D 1 12  ? -7.109  45.091 22.898 1.00 28.64  ? 71  LEU D CA    1 
ATOM   8106  C  C     . LEU D 1 12  ? -6.226  44.367 21.924 1.00 28.64  ? 71  LEU D C     1 
ATOM   8107  O  O     . LEU D 1 12  ? -5.106  44.007 22.271 1.00 40.25  ? 71  LEU D O     1 
ATOM   8108  C  CB    . LEU D 1 12  ? -7.328  44.232 24.135 1.00 40.25  ? 71  LEU D CB    1 
ATOM   8109  C  CG    . LEU D 1 12  ? -8.091  44.957 25.231 1.00 40.25  ? 71  LEU D CG    1 
ATOM   8110  C  CD1   . LEU D 1 12  ? -8.191  44.056 26.425 1.00 40.25  ? 71  LEU D CD1   1 
ATOM   8111  C  CD2   . LEU D 1 12  ? -7.389  46.239 25.589 1.00 40.25  ? 71  LEU D CD2   1 
ATOM   8112  H  H     . LEU D 1 12  ? -9.163  44.905 22.525 1.00 0.00   ? 71  LEU D H     1 
ATOM   8113  N  N     . ALA D 1 13  ? -6.743  44.106 20.722 1.00 24.62  ? 72  ALA D N     1 
ATOM   8114  C  CA    . ALA D 1 13  ? -5.965  43.426 19.672 1.00 24.62  ? 72  ALA D CA    1 
ATOM   8115  C  C     . ALA D 1 13  ? -4.812  44.326 19.168 1.00 24.62  ? 72  ALA D C     1 
ATOM   8116  O  O     . ALA D 1 13  ? -3.830  43.825 18.610 1.00 30.89  ? 72  ALA D O     1 
ATOM   8117  C  CB    . ALA D 1 13  ? -6.879  43.061 18.503 1.00 30.89  ? 72  ALA D CB    1 
ATOM   8118  H  H     . ALA D 1 13  ? -7.663  44.334 20.497 1.00 0.00   ? 72  ALA D H     1 
ATOM   8119  N  N     . LEU D 1 14  ? -4.960  45.646 19.363 1.00 2.00   ? 73  LEU D N     1 
ATOM   8120  C  CA    . LEU D 1 14  ? -4.005  46.675 18.923 1.00 2.00   ? 73  LEU D CA    1 
ATOM   8121  C  C     . LEU D 1 14  ? -3.141  46.989 20.105 1.00 2.00   ? 73  LEU D C     1 
ATOM   8122  O  O     . LEU D 1 14  ? -3.638  47.242 21.193 1.00 18.65  ? 73  LEU D O     1 
ATOM   8123  C  CB    . LEU D 1 14  ? -4.759  47.912 18.467 1.00 18.65  ? 73  LEU D CB    1 
ATOM   8124  C  CG    . LEU D 1 14  ? -5.634  47.804 17.210 1.00 18.65  ? 73  LEU D CG    1 
ATOM   8125  C  CD1   . LEU D 1 14  ? -6.596  48.957 17.145 1.00 18.65  ? 73  LEU D CD1   1 
ATOM   8126  C  CD2   . LEU D 1 14  ? -4.779  47.812 15.994 1.00 18.65  ? 73  LEU D CD2   1 
ATOM   8127  H  H     . LEU D 1 14  ? -5.757  45.961 19.846 1.00 0.00   ? 73  LEU D H     1 
ATOM   8128  N  N     . HIS D 1 15  ? -1.844  47.075 19.882 1.00 10.20  ? 74  HIS D N     1 
ATOM   8129  C  CA    . HIS D 1 15  ? -0.903  47.268 20.984 1.00 10.20  ? 74  HIS D CA    1 
ATOM   8130  C  C     . HIS D 1 15  ? -0.933  48.498 21.899 1.00 10.20  ? 74  HIS D C     1 
ATOM   8131  O  O     . HIS D 1 15  ? -0.589  48.368 23.076 1.00 30.64  ? 74  HIS D O     1 
ATOM   8132  C  CB    . HIS D 1 15  ? 0.509   46.927 20.511 1.00 30.64  ? 74  HIS D CB    1 
ATOM   8133  C  CG    . HIS D 1 15  ? 0.538   45.799 19.521 1.00 30.64  ? 74  HIS D CG    1 
ATOM   8134  N  ND1   . HIS D 1 15  ? -0.222  44.657 19.673 1.00 30.64  ? 74  HIS D ND1   1 
ATOM   8135  C  CD2   . HIS D 1 15  ? 1.127   45.695 18.307 1.00 30.64  ? 74  HIS D CD2   1 
ATOM   8136  C  CE1   . HIS D 1 15  ? -0.116  43.910 18.589 1.00 30.64  ? 74  HIS D CE1   1 
ATOM   8137  N  NE2   . HIS D 1 15  ? 0.697   44.519 17.745 1.00 30.64  ? 74  HIS D NE2   1 
ATOM   8138  H  H     . HIS D 1 15  ? -1.573  47.064 18.941 1.00 0.00   ? 74  HIS D H     1 
ATOM   8139  H  HD1   . HIS D 1 15  ? -0.838  44.447 20.421 1.00 0.00   ? 74  HIS D HD1   1 
ATOM   8140  H  HE2   . HIS D 1 15  ? 0.911   44.207 16.842 1.00 0.00   ? 74  HIS D HE2   1 
ATOM   8141  N  N     . ALA D 1 16  ? -1.279  49.687 21.408 1.00 24.08  ? 75  ALA D N     1 
ATOM   8142  C  CA    . ALA D 1 16  ? -1.342  50.825 22.338 1.00 24.08  ? 75  ALA D CA    1 
ATOM   8143  C  C     . ALA D 1 16  ? -2.471  50.549 23.364 1.00 24.08  ? 75  ALA D C     1 
ATOM   8144  O  O     . ALA D 1 16  ? -2.262  50.682 24.573 1.00 20.42  ? 75  ALA D O     1 
ATOM   8145  C  CB    . ALA D 1 16  ? -1.555  52.088 21.622 1.00 20.42  ? 75  ALA D CB    1 
ATOM   8146  H  H     . ALA D 1 16  ? -1.494  49.819 20.461 1.00 0.00   ? 75  ALA D H     1 
ATOM   8147  N  N     . PRO D 1 17  ? -3.673  50.131 22.903 1.00 9.04   ? 76  PRO D N     1 
ATOM   8148  C  CA    . PRO D 1 17  ? -4.758  49.836 23.848 1.00 9.04   ? 76  PRO D CA    1 
ATOM   8149  C  C     . PRO D 1 17  ? -4.303  48.905 25.010 1.00 9.04   ? 76  PRO D C     1 
ATOM   8150  O  O     . PRO D 1 17  ? -4.447  49.247 26.181 1.00 12.99  ? 76  PRO D O     1 
ATOM   8151  C  CB    . PRO D 1 17  ? -5.775  49.167 22.950 1.00 12.99  ? 76  PRO D CB    1 
ATOM   8152  C  CG    . PRO D 1 17  ? -5.650  49.958 21.711 1.00 12.99  ? 76  PRO D CG    1 
ATOM   8153  C  CD    . PRO D 1 17  ? -4.174  50.053 21.515 1.00 12.99  ? 76  PRO D CD    1 
ATOM   8154  N  N     . SER D 1 18  ? -3.696  47.767 24.680 1.00 8.40   ? 77  SER D N     1 
ATOM   8155  C  CA    . SER D 1 18  ? -3.197  46.808 25.679 1.00 8.40   ? 77  SER D CA    1 
ATOM   8156  C  C     . SER D 1 18  ? -2.116  47.324 26.597 1.00 8.40   ? 77  SER D C     1 
ATOM   8157  O  O     . SER D 1 18  ? -1.955  46.829 27.707 1.00 25.29  ? 77  SER D O     1 
ATOM   8158  C  CB    . SER D 1 18  ? -2.652  45.568 24.989 1.00 25.29  ? 77  SER D CB    1 
ATOM   8159  O  OG    . SER D 1 18  ? -3.687  44.880 24.306 1.00 25.29  ? 77  SER D OG    1 
ATOM   8160  H  H     . SER D 1 18  ? -3.597  47.521 23.738 1.00 0.00   ? 77  SER D H     1 
ATOM   8161  H  HG    . SER D 1 18  ? -3.348  44.084 23.881 1.00 30.00  ? 77  SER D HG    1 
ATOM   8162  N  N     . GLN D 1 19  ? -1.341  48.291 26.132 1.00 18.73  ? 78  GLN D N     1 
ATOM   8163  C  CA    . GLN D 1 19  ? -0.253  48.851 26.932 1.00 18.73  ? 78  GLN D CA    1 
ATOM   8164  C  C     . GLN D 1 19  ? -0.737  49.923 27.862 1.00 18.73  ? 78  GLN D C     1 
ATOM   8165  O  O     . GLN D 1 19  ? -0.146  50.144 28.921 1.00 20.95  ? 78  GLN D O     1 
ATOM   8166  C  CB    . GLN D 1 19  ? 0.867   49.393 26.044 1.00 20.95  ? 78  GLN D CB    1 
ATOM   8167  C  CG    . GLN D 1 19  ? 1.819   48.305 25.538 1.00 20.95  ? 78  GLN D CG    1 
ATOM   8168  C  CD    . GLN D 1 19  ? 2.959   48.866 24.724 1.00 20.95  ? 78  GLN D CD    1 
ATOM   8169  O  OE1   . GLN D 1 19  ? 3.794   49.610 25.236 1.00 20.95  ? 78  GLN D OE1   1 
ATOM   8170  N  NE2   . GLN D 1 19  ? 3.008   48.508 23.441 1.00 20.95  ? 78  GLN D NE2   1 
ATOM   8171  H  H     . GLN D 1 19  ? -1.483  48.618 25.220 1.00 0.00   ? 78  GLN D H     1 
ATOM   8172  N  N     . ILE D 1 20  ? -1.813  50.596 27.463 1.00 27.42  ? 79  ILE D N     1 
ATOM   8173  C  CA    . ILE D 1 20  ? -2.400  51.647 28.285 1.00 27.42  ? 79  ILE D CA    1 
ATOM   8174  C  C     . ILE D 1 20  ? -3.070  50.949 29.442 1.00 27.42  ? 79  ILE D C     1 
ATOM   8175  O  O     . ILE D 1 20  ? -2.741  51.180 30.597 1.00 21.52  ? 79  ILE D O     1 
ATOM   8176  C  CB    . ILE D 1 20  ? -3.400  52.483 27.490 1.00 21.52  ? 79  ILE D CB    1 
ATOM   8177  C  CG1   . ILE D 1 20  ? -2.665  53.232 26.378 1.00 21.52  ? 79  ILE D CG1   1 
ATOM   8178  C  CG2   . ILE D 1 20  ? -4.095  53.452 28.396 1.00 21.52  ? 79  ILE D CG2   1 
ATOM   8179  C  CD1   . ILE D 1 20  ? -3.506  54.231 25.655 1.00 21.52  ? 79  ILE D CD1   1 
ATOM   8180  H  H     . ILE D 1 20  ? -2.215  50.402 26.588 1.00 0.00   ? 79  ILE D H     1 
ATOM   8181  N  N     . VAL D 1 21  ? -3.958  50.026 29.105 1.00 30.54  ? 80  VAL D N     1 
ATOM   8182  C  CA    . VAL D 1 21  ? -4.676  49.200 30.086 1.00 30.54  ? 80  VAL D CA    1 
ATOM   8183  C  C     . VAL D 1 21  ? -3.700  48.524 31.076 1.00 30.54  ? 80  VAL D C     1 
ATOM   8184  O  O     . VAL D 1 21  ? -3.964  48.477 32.286 1.00 31.43  ? 80  VAL D O     1 
ATOM   8185  C  CB    . VAL D 1 21  ? -5.545  48.139 29.368 1.00 31.43  ? 80  VAL D CB    1 
ATOM   8186  C  CG1   . VAL D 1 21  ? -6.113  47.172 30.356 1.00 31.43  ? 80  VAL D CG1   1 
ATOM   8187  C  CG2   . VAL D 1 21  ? -6.666  48.826 28.608 1.00 31.43  ? 80  VAL D CG2   1 
ATOM   8188  H  H     . VAL D 1 21  ? -4.152  49.899 28.147 1.00 0.00   ? 80  VAL D H     1 
ATOM   8189  N  N     . ALA D 1 22  ? -2.583  48.003 30.581 1.00 13.31  ? 81  ALA D N     1 
ATOM   8190  C  CA    . ALA D 1 22  ? -1.599  47.376 31.469 1.00 13.31  ? 81  ALA D CA    1 
ATOM   8191  C  C     . ALA D 1 22  ? -0.992  48.415 32.424 1.00 13.31  ? 81  ALA D C     1 
ATOM   8192  O  O     . ALA D 1 22  ? -0.709  48.120 33.573 1.00 23.73  ? 81  ALA D O     1 
ATOM   8193  C  CB    . ALA D 1 22  ? -0.508  46.706 30.661 1.00 23.73  ? 81  ALA D CB    1 
ATOM   8194  H  H     . ALA D 1 22  ? -2.415  48.009 29.616 1.00 0.00   ? 81  ALA D H     1 
ATOM   8195  N  N     . ALA D 1 23  ? -0.799  49.634 31.931 1.00 26.63  ? 82  ALA D N     1 
ATOM   8196  C  CA    . ALA D 1 23  ? -0.228  50.725 32.720 1.00 26.63  ? 82  ALA D CA    1 
ATOM   8197  C  C     . ALA D 1 23  ? -1.246  51.163 33.765 1.00 26.63  ? 82  ALA D C     1 
ATOM   8198  O  O     . ALA D 1 23  ? -0.889  51.457 34.903 1.00 34.05  ? 82  ALA D O     1 
ATOM   8199  C  CB    . ALA D 1 23  ? 0.130   51.893 31.814 1.00 34.05  ? 82  ALA D CB    1 
ATOM   8200  H  H     . ALA D 1 23  ? -1.042  49.819 30.998 1.00 0.00   ? 82  ALA D H     1 
ATOM   8201  N  N     . ILE D 1 24  ? -2.511  51.202 33.360 1.00 12.39  ? 83  ILE D N     1 
ATOM   8202  C  CA    . ILE D 1 24  ? -3.636  51.555 34.224 1.00 12.39  ? 83  ILE D CA    1 
ATOM   8203  C  C     . ILE D 1 24  ? -3.659  50.564 35.371 1.00 12.39  ? 83  ILE D C     1 
ATOM   8204  O  O     . ILE D 1 24  ? -3.778  50.922 36.538 1.00 20.64  ? 83  ILE D O     1 
ATOM   8205  C  CB    . ILE D 1 24  ? -4.962  51.481 33.415 1.00 20.64  ? 83  ILE D CB    1 
ATOM   8206  C  CG1   . ILE D 1 24  ? -5.259  52.837 32.798 1.00 20.64  ? 83  ILE D CG1   1 
ATOM   8207  C  CG2   . ILE D 1 24  ? -6.107  50.952 34.249 1.00 20.64  ? 83  ILE D CG2   1 
ATOM   8208  C  CD1   . ILE D 1 24  ? -6.402  52.828 31.857 1.00 20.64  ? 83  ILE D CD1   1 
ATOM   8209  H  H     . ILE D 1 24  ? -2.687  50.986 32.428 1.00 0.00   ? 83  ILE D H     1 
ATOM   8210  N  N     . LYS D 1 25  ? -3.495  49.304 35.023 1.00 18.00  ? 84  LYS D N     1 
ATOM   8211  C  CA    . LYS D 1 25  ? -3.487  48.238 35.999 1.00 18.00  ? 84  LYS D CA    1 
ATOM   8212  C  C     . LYS D 1 25  ? -2.332  48.418 36.984 1.00 18.00  ? 84  LYS D C     1 
ATOM   8213  O  O     . LYS D 1 25  ? -2.507  48.244 38.174 1.00 41.12  ? 84  LYS D O     1 
ATOM   8214  C  CB    . LYS D 1 25  ? -3.361  46.902 35.252 1.00 41.12  ? 84  LYS D CB    1 
ATOM   8215  C  CG    . LYS D 1 25  ? -3.833  45.668 35.987 1.00 41.12  ? 84  LYS D CG    1 
ATOM   8216  C  CD    . LYS D 1 25  ? -2.888  45.228 37.087 1.00 41.12  ? 84  LYS D CD    1 
ATOM   8217  C  CE    . LYS D 1 25  ? -3.290  43.858 37.643 1.00 41.12  ? 84  LYS D CE    1 
ATOM   8218  N  NZ    . LYS D 1 25  ? -4.763  43.805 37.916 1.00 41.12  ? 84  LYS D NZ    1 
ATOM   8219  H  H     . LYS D 1 25  ? -3.400  49.080 34.075 1.00 0.00   ? 84  LYS D H     1 
ATOM   8220  H  HZ1   . LYS D 1 25  ? -5.011  44.545 38.603 1.00 0.00   ? 84  LYS D HZ1   1 
ATOM   8221  H  HZ2   . LYS D 1 25  ? -5.289  43.955 37.033 1.00 0.00   ? 84  LYS D HZ2   1 
ATOM   8222  H  HZ3   . LYS D 1 25  ? -5.009  42.875 38.310 1.00 0.00   ? 84  LYS D HZ3   1 
ATOM   8223  N  N     . SER D 1 26  ? -1.165  48.817 36.504 1.00 28.89  ? 85  SER D N     1 
ATOM   8224  C  CA    . SER D 1 26  ? -0.004  48.950 37.377 1.00 28.89  ? 85  SER D CA    1 
ATOM   8225  C  C     . SER D 1 26  ? -0.084  50.027 38.431 1.00 28.89  ? 85  SER D C     1 
ATOM   8226  O  O     . SER D 1 26  ? 0.369   49.827 39.547 1.00 37.28  ? 85  SER D O     1 
ATOM   8227  C  CB    . SER D 1 26  ? 1.273   49.126 36.571 1.00 37.28  ? 85  SER D CB    1 
ATOM   8228  O  OG    . SER D 1 26  ? 2.396   49.009 37.426 1.00 37.28  ? 85  SER D OG    1 
ATOM   8229  H  H     . SER D 1 26  ? -1.070  49.002 35.544 1.00 0.00   ? 85  SER D H     1 
ATOM   8230  H  HG    . SER D 1 26  ? 2.315   49.535 38.231 1.00 30.00  ? 85  SER D HG    1 
ATOM   8231  N  N     . ARG D 1 27  ? -0.597  51.192 38.060 1.00 41.58  ? 86  ARG D N     1 
ATOM   8232  C  CA    . ARG D 1 27  ? -0.725  52.302 38.991 1.00 41.58  ? 86  ARG D CA    1 
ATOM   8233  C  C     . ARG D 1 27  ? -1.775  51.919 40.019 1.00 41.58  ? 86  ARG D C     1 
ATOM   8234  O  O     . ARG D 1 27  ? -1.596  52.119 41.224 1.00 30.60  ? 86  ARG D O     1 
ATOM   8235  C  CB    . ARG D 1 27  ? -1.146  53.545 38.236 1.00 30.60  ? 86  ARG D CB    1 
ATOM   8236  C  CG    . ARG D 1 27  ? -1.857  54.574 39.064 1.00 30.60  ? 86  ARG D CG    1 
ATOM   8237  C  CD    . ARG D 1 27  ? -0.932  55.634 39.569 1.00 30.60  ? 86  ARG D CD    1 
ATOM   8238  N  NE    . ARG D 1 27  ? -0.161  55.201 40.718 1.00 30.60  ? 86  ARG D NE    1 
ATOM   8239  C  CZ    . ARG D 1 27  ? 0.566   56.021 41.462 1.00 30.60  ? 86  ARG D CZ    1 
ATOM   8240  N  NH1   . ARG D 1 27  ? 0.620   57.306 41.162 1.00 30.60  ? 86  ARG D NH1   1 
ATOM   8241  N  NH2   . ARG D 1 27  ? 1.196   55.572 42.537 1.00 30.60  ? 86  ARG D NH2   1 
ATOM   8242  H  H     . ARG D 1 27  ? -0.912  51.298 37.135 1.00 0.00   ? 86  ARG D H     1 
ATOM   8243  H  HE    . ARG D 1 27  ? -0.181  54.252 40.961 1.00 0.00   ? 86  ARG D HE    1 
ATOM   8244  H  HH11  . ARG D 1 27  ? 0.115   57.662 40.376 1.00 0.00   ? 86  ARG D HH11  1 
ATOM   8245  H  HH12  . ARG D 1 27  ? 1.171   57.928 41.718 1.00 0.00   ? 86  ARG D HH12  1 
ATOM   8246  H  HH21  . ARG D 1 27  ? 1.126   54.605 42.782 1.00 0.00   ? 86  ARG D HH21  1 
ATOM   8247  H  HH22  . ARG D 1 27  ? 1.749   56.193 43.091 1.00 0.00   ? 86  ARG D HH22  1 
ATOM   8248  N  N     . ALA D 1 28  ? -2.863  51.341 39.524 1.00 32.22  ? 87  ALA D N     1 
ATOM   8249  C  CA    . ALA D 1 28  ? -3.960  50.887 40.365 1.00 32.22  ? 87  ALA D CA    1 
ATOM   8250  C  C     . ALA D 1 28  ? -3.410  49.888 41.378 1.00 32.22  ? 87  ALA D C     1 
ATOM   8251  O  O     . ALA D 1 28  ? -3.697  49.985 42.567 1.00 33.43  ? 87  ALA D O     1 
ATOM   8252  C  CB    . ALA D 1 28  ? -5.027  50.245 39.506 1.00 33.43  ? 87  ALA D CB    1 
ATOM   8253  H  H     . ALA D 1 28  ? -2.948  51.223 38.554 1.00 0.00   ? 87  ALA D H     1 
ATOM   8254  N  N     . ASP D 1 29  ? -2.554  48.986 40.902 1.00 32.78  ? 88  ASP D N     1 
ATOM   8255  C  CA    . ASP D 1 29  ? -1.927  47.955 41.725 1.00 32.78  ? 88  ASP D CA    1 
ATOM   8256  C  C     . ASP D 1 29  ? -1.253  48.552 42.947 1.00 32.78  ? 88  ASP D C     1 
ATOM   8257  O  O     . ASP D 1 29  ? -1.457  48.084 44.071 1.00 62.62  ? 88  ASP D O     1 
ATOM   8258  C  CB    . ASP D 1 29  ? -0.867  47.188 40.915 1.00 62.62  ? 88  ASP D CB    1 
ATOM   8259  C  CG    . ASP D 1 29  ? -1.340  45.812 40.440 1.00 62.62  ? 88  ASP D CG    1 
ATOM   8260  O  OD1   . ASP D 1 29  ? -2.488  45.414 40.748 1.00 62.62  ? 88  ASP D OD1   1 
ATOM   8261  O  OD2   . ASP D 1 29  ? -0.537  45.123 39.761 1.00 62.62  ? 88  ASP D OD2   1 
ATOM   8262  H  H     . ASP D 1 29  ? -2.359  48.988 39.945 1.00 0.00   ? 88  ASP D H     1 
ATOM   8263  N  N     . GLN D 1 30  ? -0.456  49.590 42.721 1.00 51.62  ? 89  GLN D N     1 
ATOM   8264  C  CA    . GLN D 1 30  ? 0.283   50.233 43.805 1.00 51.62  ? 89  GLN D CA    1 
ATOM   8265  C  C     . GLN D 1 30  ? -0.531  51.045 44.812 1.00 51.62  ? 89  GLN D C     1 
ATOM   8266  O  O     . GLN D 1 30  ? -0.069  51.307 45.926 1.00 42.63  ? 89  GLN D O     1 
ATOM   8267  C  CB    . GLN D 1 30  ? 1.463   51.046 43.253 1.00 42.63  ? 89  GLN D CB    1 
ATOM   8268  C  CG    . GLN D 1 30  ? 1.192   51.878 42.026 1.00 42.63  ? 89  GLN D CG    1 
ATOM   8269  C  CD    . GLN D 1 30  ? 2.484   52.294 41.317 1.00 42.63  ? 89  GLN D CD    1 
ATOM   8270  O  OE1   . GLN D 1 30  ? 3.507   51.612 41.415 1.00 42.63  ? 89  GLN D OE1   1 
ATOM   8271  N  NE2   . GLN D 1 30  ? 2.435   53.408 40.584 1.00 42.63  ? 89  GLN D NE2   1 
ATOM   8272  H  H     . GLN D 1 30  ? -0.364  49.915 41.800 1.00 0.00   ? 89  GLN D H     1 
ATOM   8273  N  N     . LEU D 1 31  ? -1.749  51.403 44.415 1.00 34.81  ? 90  LEU D N     1 
ATOM   8274  C  CA    . LEU D 1 31  ? -2.651  52.166 45.258 1.00 34.81  ? 90  LEU D CA    1 
ATOM   8275  C  C     . LEU D 1 31  ? -3.793  51.280 45.745 1.00 34.81  ? 90  LEU D C     1 
ATOM   8276  O  O     . LEU D 1 31  ? -4.855  51.766 46.131 1.00 28.16  ? 90  LEU D O     1 
ATOM   8277  C  CB    . LEU D 1 31  ? -3.239  53.331 44.480 1.00 28.16  ? 90  LEU D CB    1 
ATOM   8278  C  CG    . LEU D 1 31  ? -2.313  54.177 43.633 1.00 28.16  ? 90  LEU D CG    1 
ATOM   8279  C  CD1   . LEU D 1 31  ? -3.153  55.222 42.917 1.00 28.16  ? 90  LEU D CD1   1 
ATOM   8280  C  CD2   . LEU D 1 31  ? -1.238  54.786 44.510 1.00 28.16  ? 90  LEU D CD2   1 
ATOM   8281  H  H     . LEU D 1 31  ? -2.044  51.156 43.512 1.00 0.00   ? 90  LEU D H     1 
ATOM   8282  N  N     . GLY D 1 32  ? -3.611  49.974 45.646 1.00 39.09  ? 91  GLY D N     1 
ATOM   8283  C  CA    . GLY D 1 32  ? -4.638  49.061 46.110 1.00 39.09  ? 91  GLY D CA    1 
ATOM   8284  C  C     . GLY D 1 32  ? -6.002  49.156 45.444 1.00 39.09  ? 91  GLY D C     1 
ATOM   8285  O  O     . GLY D 1 32  ? -6.986  48.639 45.995 1.00 51.51  ? 91  GLY D O     1 
ATOM   8286  H  H     . GLY D 1 32  ? -2.798  49.615 45.236 1.00 0.00   ? 91  GLY D H     1 
ATOM   8287  N  N     . ALA D 1 33  ? -6.099  49.843 44.306 1.00 40.84  ? 92  ALA D N     1 
ATOM   8288  C  CA    . ALA D 1 33  ? -7.378  49.924 43.606 1.00 40.84  ? 92  ALA D CA    1 
ATOM   8289  C  C     . ALA D 1 33  ? -7.570  48.625 42.829 1.00 40.84  ? 92  ALA D C     1 
ATOM   8290  O  O     . ALA D 1 33  ? -6.711  47.734 42.840 1.00 29.72  ? 92  ALA D O     1 
ATOM   8291  C  CB    . ALA D 1 33  ? -7.420  51.115 42.666 1.00 29.72  ? 92  ALA D CB    1 
ATOM   8292  H  H     . ALA D 1 33  ? -5.298  50.255 43.922 1.00 0.00   ? 92  ALA D H     1 
ATOM   8293  N  N     . SER D 1 34  ? -8.728  48.509 42.196 1.00 39.86  ? 93  SER D N     1 
ATOM   8294  C  CA    . SER D 1 34  ? -9.078  47.340 41.407 1.00 39.86  ? 93  SER D CA    1 
ATOM   8295  C  C     . SER D 1 34  ? -9.404  47.865 40.024 1.00 39.86  ? 93  SER D C     1 
ATOM   8296  O  O     . SER D 1 34  ? -9.869  49.004 39.866 1.00 54.43  ? 93  SER D O     1 
ATOM   8297  C  CB    . SER D 1 34  ? -10.314 46.622 41.979 1.00 54.43  ? 93  SER D CB    1 
ATOM   8298  O  OG    . SER D 1 34  ? -10.077 46.071 43.270 1.00 54.43  ? 93  SER D OG    1 
ATOM   8299  H  H     . SER D 1 34  ? -9.396  49.226 42.232 1.00 0.00   ? 93  SER D H     1 
ATOM   8300  H  HG    . SER D 1 34  ? -10.933 45.732 43.566 1.00 30.00  ? 93  SER D HG    1 
ATOM   8301  N  N     . VAL D 1 35  ? -9.118  47.046 39.023 1.00 46.78  ? 94  VAL D N     1 
ATOM   8302  C  CA    . VAL D 1 35  ? -9.370  47.425 37.658 1.00 46.78  ? 94  VAL D CA    1 
ATOM   8303  C  C     . VAL D 1 35  ? -10.198 46.322 37.061 1.00 46.78  ? 94  VAL D C     1 
ATOM   8304  O  O     . VAL D 1 35  ? -9.878  45.145 37.235 1.00 25.84  ? 94  VAL D O     1 
ATOM   8305  C  CB    . VAL D 1 35  ? -8.052  47.565 36.865 1.00 25.84  ? 94  VAL D CB    1 
ATOM   8306  C  CG1   . VAL D 1 35  ? -8.342  48.129 35.486 1.00 25.84  ? 94  VAL D CG1   1 
ATOM   8307  C  CG2   . VAL D 1 35  ? -7.080  48.475 37.598 1.00 25.84  ? 94  VAL D CG2   1 
ATOM   8308  H  H     . VAL D 1 35  ? -8.750  46.156 39.192 1.00 0.00   ? 94  VAL D H     1 
ATOM   8309  N  N     . VAL D 1 36  ? -11.289 46.709 36.410 1.00 25.75  ? 95  VAL D N     1 
ATOM   8310  C  CA    . VAL D 1 36  ? -12.180 45.765 35.754 1.00 25.75  ? 95  VAL D CA    1 
ATOM   8311  C  C     . VAL D 1 36  ? -12.369 46.379 34.377 1.00 25.75  ? 95  VAL D C     1 
ATOM   8312  O  O     . VAL D 1 36  ? -12.777 47.535 34.265 1.00 39.55  ? 95  VAL D O     1 
ATOM   8313  C  CB    . VAL D 1 36  ? -13.514 45.583 36.541 1.00 39.55  ? 95  VAL D CB    1 
ATOM   8314  C  CG1   . VAL D 1 36  ? -14.621 46.517 36.047 1.00 39.55  ? 95  VAL D CG1   1 
ATOM   8315  C  CG2   . VAL D 1 36  ? -13.942 44.129 36.503 1.00 39.55  ? 95  VAL D CG2   1 
ATOM   8316  H  H     . VAL D 1 36  ? -11.512 47.662 36.336 1.00 0.00   ? 95  VAL D H     1 
ATOM   8317  N  N     . VAL D 1 37  ? -11.954 45.649 33.342 1.00 29.16  ? 96  VAL D N     1 
ATOM   8318  C  CA    . VAL D 1 37  ? -12.010 46.147 31.972 1.00 29.16  ? 96  VAL D CA    1 
ATOM   8319  C  C     . VAL D 1 37  ? -13.141 45.563 31.186 1.00 29.16  ? 96  VAL D C     1 
ATOM   8320  O  O     . VAL D 1 37  ? -13.384 44.355 31.237 1.00 19.76  ? 96  VAL D O     1 
ATOM   8321  C  CB    . VAL D 1 37  ? -10.709 45.813 31.172 1.00 19.76  ? 96  VAL D CB    1 
ATOM   8322  C  CG1   . VAL D 1 37  ? -10.735 46.468 29.789 1.00 19.76  ? 96  VAL D CG1   1 
ATOM   8323  C  CG2   . VAL D 1 37  ? -9.472  46.229 31.951 1.00 19.76  ? 96  VAL D CG2   1 
ATOM   8324  H  H     . VAL D 1 37  ? -11.625 44.738 33.500 1.00 0.00   ? 96  VAL D H     1 
ATOM   8325  N  N     . SER D 1 38  ? -13.793 46.438 30.430 1.00 31.77  ? 97  SER D N     1 
ATOM   8326  C  CA    . SER D 1 38  ? -14.878 46.081 29.537 1.00 31.77  ? 97  SER D CA    1 
ATOM   8327  C  C     . SER D 1 38  ? -14.354 46.529 28.157 1.00 31.77  ? 97  SER D C     1 
ATOM   8328  O  O     . SER D 1 38  ? -13.571 47.490 28.070 1.00 39.11  ? 97  SER D O     1 
ATOM   8329  C  CB    . SER D 1 38  ? -16.156 46.830 29.913 1.00 39.11  ? 97  SER D CB    1 
ATOM   8330  O  OG    . SER D 1 38  ? -17.298 46.195 29.351 1.00 39.11  ? 97  SER D OG    1 
ATOM   8331  H  H     . SER D 1 38  ? -13.512 47.380 30.436 1.00 0.00   ? 97  SER D H     1 
ATOM   8332  H  HG    . SER D 1 38  ? -17.299 45.263 29.599 1.00 30.00  ? 97  SER D HG    1 
ATOM   8333  N  N     . MET D 1 39  ? -14.785 45.844 27.094 1.00 8.31   ? 98  MET D N     1 
ATOM   8334  C  CA    . MET D 1 39  ? -14.320 46.122 25.724 1.00 8.31   ? 98  MET D CA    1 
ATOM   8335  C  C     . MET D 1 39  ? -15.407 46.533 24.772 1.00 8.31   ? 98  MET D C     1 
ATOM   8336  O  O     . MET D 1 39  ? -16.468 45.925 24.746 1.00 50.74  ? 98  MET D O     1 
ATOM   8337  C  CB    . MET D 1 39  ? -13.594 44.902 25.201 1.00 50.74  ? 98  MET D CB    1 
ATOM   8338  C  CG    . MET D 1 39  ? -12.608 44.368 26.216 1.00 50.74  ? 98  MET D CG    1 
ATOM   8339  S  SD    . MET D 1 39  ? -12.153 42.711 25.846 1.00 50.74  ? 98  MET D SD    1 
ATOM   8340  C  CE    . MET D 1 39  ? -10.963 43.025 24.581 1.00 50.74  ? 98  MET D CE    1 
ATOM   8341  H  H     . MET D 1 39  ? -15.457 45.144 27.205 1.00 0.00   ? 98  MET D H     1 
ATOM   8342  N  N     . VAL D 1 40  ? -15.125 47.554 23.972 1.00 44.35  ? 99  VAL D N     1 
ATOM   8343  C  CA    . VAL D 1 40  ? -16.093 48.113 23.022 1.00 44.35  ? 99  VAL D CA    1 
ATOM   8344  C  C     . VAL D 1 40  ? -15.888 47.755 21.538 1.00 44.35  ? 99  VAL D C     1 
ATOM   8345  O  O     . VAL D 1 40  ? -14.767 47.739 21.023 1.00 53.78  ? 99  VAL D O     1 
ATOM   8346  C  CB    . VAL D 1 40  ? -16.130 49.645 23.143 1.00 53.78  ? 99  VAL D CB    1 
ATOM   8347  C  CG1   . VAL D 1 40  ? -17.225 50.204 22.288 1.00 53.78  ? 99  VAL D CG1   1 
ATOM   8348  C  CG2   . VAL D 1 40  ? -16.316 50.062 24.582 1.00 53.78  ? 99  VAL D CG2   1 
ATOM   8349  H  H     . VAL D 1 40  ? -14.212 47.925 23.981 1.00 0.00   ? 99  VAL D H     1 
ATOM   8350  N  N     . GLU D 1 41  ? -17.001 47.548 20.847 1.00 25.63  ? 100 GLU D N     1 
ATOM   8351  C  CA    . GLU D 1 41  ? -17.019 47.197 19.430 1.00 25.63  ? 100 GLU D CA    1 
ATOM   8352  C  C     . GLU D 1 41  ? -16.741 48.478 18.665 1.00 25.63  ? 100 GLU D C     1 
ATOM   8353  O  O     . GLU D 1 41  ? -17.326 49.516 18.973 1.00 90.46  ? 100 GLU D O     1 
ATOM   8354  C  CB    . GLU D 1 41  ? -18.406 46.670 19.055 1.00 90.46  ? 100 GLU D CB    1 
ATOM   8355  C  CG    . GLU D 1 41  ? -18.992 45.621 20.036 1.00 90.46  ? 100 GLU D CG    1 
ATOM   8356  C  CD    . GLU D 1 41  ? -19.534 46.204 21.360 1.00 90.46  ? 100 GLU D CD    1 
ATOM   8357  O  OE1   . GLU D 1 41  ? -20.700 46.663 21.378 1.00 90.46  ? 100 GLU D OE1   1 
ATOM   8358  O  OE2   . GLU D 1 41  ? -18.812 46.176 22.388 1.00 90.46  ? 100 GLU D OE2   1 
ATOM   8359  H  H     . GLU D 1 41  ? -17.840 47.719 21.309 1.00 0.00   ? 100 GLU D H     1 
ATOM   8360  N  N     . ARG D 1 42  ? -15.810 48.429 17.715 1.00 73.66  ? 101 ARG D N     1 
ATOM   8361  C  CA    . ARG D 1 42  ? -15.464 49.610 16.917 1.00 73.66  ? 101 ARG D CA    1 
ATOM   8362  C  C     . ARG D 1 42  ? -16.697 50.080 16.165 1.00 73.66  ? 101 ARG D C     1 
ATOM   8363  O  O     . ARG D 1 42  ? -16.866 49.780 14.987 1.00 97.65  ? 101 ARG D O     1 
ATOM   8364  C  CB    . ARG D 1 42  ? -14.320 49.308 15.939 1.00 97.65  ? 101 ARG D CB    1 
ATOM   8365  C  CG    . ARG D 1 42  ? -12.927 49.388 16.559 1.00 97.65  ? 101 ARG D CG    1 
ATOM   8366  C  CD    . ARG D 1 42  ? -12.513 50.839 16.877 1.00 97.65  ? 101 ARG D CD    1 
ATOM   8367  N  NE    . ARG D 1 42  ? -11.262 50.923 17.644 1.00 97.65  ? 101 ARG D NE    1 
ATOM   8368  C  CZ    . ARG D 1 42  ? -10.311 51.842 17.464 1.00 97.65  ? 101 ARG D CZ    1 
ATOM   8369  N  NH1   . ARG D 1 42  ? -10.432 52.786 16.534 1.00 97.65  ? 101 ARG D NH1   1 
ATOM   8370  N  NH2   . ARG D 1 42  ? -9.236  51.821 18.232 1.00 97.65  ? 101 ARG D NH2   1 
ATOM   8371  H  H     . ARG D 1 42  ? -15.370 47.579 17.527 1.00 0.00   ? 101 ARG D H     1 
ATOM   8372  H  HE    . ARG D 1 42  ? -11.120 50.251 18.341 1.00 0.00   ? 101 ARG D HE    1 
ATOM   8373  H  HH11  . ARG D 1 42  ? -11.248 52.821 15.955 1.00 0.00   ? 101 ARG D HH11  1 
ATOM   8374  H  HH12  . ARG D 1 42  ? -9.709  53.464 16.406 1.00 0.00   ? 101 ARG D HH12  1 
ATOM   8375  H  HH21  . ARG D 1 42  ? -9.131  51.123 18.938 1.00 0.00   ? 101 ARG D HH21  1 
ATOM   8376  H  HH22  . ARG D 1 42  ? -8.530  52.485 18.053 1.00 0.00   ? 101 ARG D HH22  1 
ATOM   8377  N  N     . SER D 1 43  ? -17.563 50.803 16.866 1.00 66.02  ? 102 SER D N     1 
ATOM   8378  C  CA    . SER D 1 43  ? -18.799 51.293 16.280 1.00 66.02  ? 102 SER D CA    1 
ATOM   8379  C  C     . SER D 1 43  ? -19.101 52.701 16.784 1.00 66.02  ? 102 SER D C     1 
ATOM   8380  O  O     . SER D 1 43  ? -19.755 53.494 16.102 1.00 61.16  ? 102 SER D O     1 
ATOM   8381  C  CB    . SER D 1 43  ? -19.953 50.349 16.648 1.00 61.16  ? 102 SER D CB    1 
ATOM   8382  O  OG    . SER D 1 43  ? -19.505 48.999 16.762 1.00 61.16  ? 102 SER D OG    1 
ATOM   8383  H  H     . SER D 1 43  ? -17.399 50.997 17.807 1.00 0.00   ? 102 SER D H     1 
ATOM   8384  H  HG    . SER D 1 43  ? -19.060 48.784 15.935 1.00 30.00  ? 102 SER D HG    1 
ATOM   8385  N  N     . GLY D 1 44  ? -18.628 53.015 17.984 1.00 44.87  ? 103 GLY D N     1 
ATOM   8386  C  CA    . GLY D 1 44  ? -18.881 54.334 18.522 1.00 44.87  ? 103 GLY D CA    1 
ATOM   8387  C  C     . GLY D 1 44  ? -19.968 54.384 19.579 1.00 44.87  ? 103 GLY D C     1 
ATOM   8388  O  O     . GLY D 1 44  ? -20.524 53.354 19.982 1.00 58.33  ? 103 GLY D O     1 
ATOM   8389  H  H     . GLY D 1 44  ? -18.109 52.373 18.508 1.00 0.00   ? 103 GLY D H     1 
ATOM   8390  N  N     . VAL D 1 45  ? -20.253 55.605 20.022 1.00 42.61  ? 104 VAL D N     1 
ATOM   8391  C  CA    . VAL D 1 45  ? -21.235 55.930 21.062 1.00 42.61  ? 104 VAL D CA    1 
ATOM   8392  C  C     . VAL D 1 45  ? -22.076 54.823 21.657 1.00 42.61  ? 104 VAL D C     1 
ATOM   8393  O  O     . VAL D 1 45  ? -21.978 54.574 22.842 1.00 62.31  ? 104 VAL D O     1 
ATOM   8394  C  CB    . VAL D 1 45  ? -22.195 57.041 20.630 1.00 62.31  ? 104 VAL D CB    1 
ATOM   8395  C  CG1   . VAL D 1 45  ? -22.251 58.132 21.704 1.00 62.31  ? 104 VAL D CG1   1 
ATOM   8396  C  CG2   . VAL D 1 45  ? -21.802 57.583 19.259 1.00 62.31  ? 104 VAL D CG2   1 
ATOM   8397  H  H     . VAL D 1 45  ? -19.733 56.337 19.629 1.00 0.00   ? 104 VAL D H     1 
ATOM   8398  N  N     . GLU D 1 46  ? -22.911 54.175 20.851 1.00 45.48  ? 105 GLU D N     1 
ATOM   8399  C  CA    . GLU D 1 46  ? -23.773 53.117 21.363 1.00 45.48  ? 105 GLU D CA    1 
ATOM   8400  C  C     . GLU D 1 46  ? -22.934 52.000 21.931 1.00 45.48  ? 105 GLU D C     1 
ATOM   8401  O  O     . GLU D 1 46  ? -23.122 51.593 23.077 1.00 95.60  ? 105 GLU D O     1 
ATOM   8402  C  CB    . GLU D 1 46  ? -24.696 52.576 20.268 1.00 95.60  ? 105 GLU D CB    1 
ATOM   8403  C  CG    . GLU D 1 46  ? -25.492 53.645 19.527 1.00 95.60  ? 105 GLU D CG    1 
ATOM   8404  C  CD    . GLU D 1 46  ? -26.149 54.661 20.456 1.00 95.60  ? 105 GLU D CD    1 
ATOM   8405  O  OE1   . GLU D 1 46  ? -26.555 54.292 21.585 1.00 95.60  ? 105 GLU D OE1   1 
ATOM   8406  O  OE2   . GLU D 1 46  ? -26.252 55.839 20.048 1.00 95.60  ? 105 GLU D OE2   1 
ATOM   8407  H  H     . GLU D 1 46  ? -22.936 54.399 19.900 1.00 0.00   ? 105 GLU D H     1 
ATOM   8408  N  N     . ALA D 1 47  ? -21.986 51.538 21.123 1.00 35.59  ? 106 ALA D N     1 
ATOM   8409  C  CA    . ALA D 1 47  ? -21.072 50.472 21.501 1.00 35.59  ? 106 ALA D CA    1 
ATOM   8410  C  C     . ALA D 1 47  ? -20.310 50.878 22.754 1.00 35.59  ? 106 ALA D C     1 
ATOM   8411  O  O     . ALA D 1 47  ? -20.095 50.062 23.648 1.00 53.67  ? 106 ALA D O     1 
ATOM   8412  C  CB    . ALA D 1 47  ? -20.105 50.208 20.363 1.00 53.67  ? 106 ALA D CB    1 
ATOM   8413  H  H     . ALA D 1 47  ? -21.881 51.938 20.237 1.00 0.00   ? 106 ALA D H     1 
ATOM   8414  N  N     . CYS D 1 48  ? -19.892 52.143 22.798 1.00 42.41  ? 107 CYS D N     1 
ATOM   8415  C  CA    . CYS D 1 48  ? -19.159 52.692 23.940 1.00 42.41  ? 107 CYS D CA    1 
ATOM   8416  C  C     . CYS D 1 48  ? -20.089 52.876 25.150 1.00 42.41  ? 107 CYS D C     1 
ATOM   8417  O  O     . CYS D 1 48  ? -19.700 52.610 26.294 1.00 51.76  ? 107 CYS D O     1 
ATOM   8418  C  CB    . CYS D 1 48  ? -18.506 54.021 23.567 1.00 51.76  ? 107 CYS D CB    1 
ATOM   8419  S  SG    . CYS D 1 48  ? -17.158 54.476 24.652 1.00 51.76  ? 107 CYS D SG    1 
ATOM   8420  H  H     . CYS D 1 48  ? -20.094 52.712 22.030 1.00 0.00   ? 107 CYS D H     1 
ATOM   8421  N  N     . LYS D 1 49  ? -21.339 53.258 24.879 1.00 40.84  ? 108 LYS D N     1 
ATOM   8422  C  CA    . LYS D 1 49  ? -22.357 53.468 25.911 1.00 40.84  ? 108 LYS D CA    1 
ATOM   8423  C  C     . LYS D 1 49  ? -22.626 52.157 26.621 1.00 40.84  ? 108 LYS D C     1 
ATOM   8424  O  O     . LYS D 1 49  ? -22.602 52.093 27.861 1.00 39.29  ? 108 LYS D O     1 
ATOM   8425  C  CB    . LYS D 1 49  ? -23.656 53.996 25.302 1.00 39.29  ? 108 LYS D CB    1 
ATOM   8426  C  CG    . LYS D 1 49  ? -23.661 55.499 25.144 1.00 39.29  ? 108 LYS D CG    1 
ATOM   8427  C  CD    . LYS D 1 49  ? -25.046 56.006 24.915 1.00 39.29  ? 108 LYS D CD    1 
ATOM   8428  C  CE    . LYS D 1 49  ? -25.004 57.480 24.655 1.00 39.29  ? 108 LYS D CE    1 
ATOM   8429  N  NZ    . LYS D 1 49  ? -26.328 57.946 24.134 1.00 39.29  ? 108 LYS D NZ    1 
ATOM   8430  H  H     . LYS D 1 49  ? -21.606 53.283 23.955 1.00 0.00   ? 108 LYS D H     1 
ATOM   8431  H  HZ1   . LYS D 1 49  ? -27.069 57.734 24.833 1.00 0.00   ? 108 LYS D HZ1   1 
ATOM   8432  H  HZ2   . LYS D 1 49  ? -26.303 58.970 23.951 1.00 0.00   ? 108 LYS D HZ2   1 
ATOM   8433  H  HZ3   . LYS D 1 49  ? -26.534 57.443 23.247 1.00 0.00   ? 108 LYS D HZ3   1 
ATOM   8434  N  N     . ALA D 1 50  ? -22.824 51.103 25.828 1.00 32.58  ? 109 ALA D N     1 
ATOM   8435  C  CA    . ALA D 1 50  ? -23.084 49.764 26.357 1.00 32.58  ? 109 ALA D CA    1 
ATOM   8436  C  C     . ALA D 1 50  ? -22.046 49.413 27.414 1.00 32.58  ? 109 ALA D C     1 
ATOM   8437  O  O     . ALA D 1 50  ? -22.383 49.107 28.561 1.00 50.26  ? 109 ALA D O     1 
ATOM   8438  C  CB    . ALA D 1 50  ? -23.058 48.747 25.232 1.00 50.26  ? 109 ALA D CB    1 
ATOM   8439  H  H     . ALA D 1 50  ? -22.801 51.230 24.862 1.00 0.00   ? 109 ALA D H     1 
ATOM   8440  N  N     . ALA D 1 51  ? -20.779 49.554 27.043 1.00 40.33  ? 110 ALA D N     1 
ATOM   8441  C  CA    . ALA D 1 51  ? -19.679 49.250 27.941 1.00 40.33  ? 110 ALA D CA    1 
ATOM   8442  C  C     . ALA D 1 51  ? -19.735 50.097 29.209 1.00 40.33  ? 110 ALA D C     1 
ATOM   8443  O  O     . ALA D 1 51  ? -19.507 49.593 30.308 1.00 26.07  ? 110 ALA D O     1 
ATOM   8444  C  CB    . ALA D 1 51  ? -18.363 49.453 27.232 1.00 26.07  ? 110 ALA D CB    1 
ATOM   8445  H  H     . ALA D 1 51  ? -20.581 49.871 26.136 1.00 0.00   ? 110 ALA D H     1 
ATOM   8446  N  N     . VAL D 1 52  ? -20.034 51.383 29.072 1.00 56.13  ? 111 VAL D N     1 
ATOM   8447  C  CA    . VAL D 1 52  ? -20.096 52.212 30.261 1.00 56.13  ? 111 VAL D CA    1 
ATOM   8448  C  C     . VAL D 1 52  ? -21.149 51.585 31.166 1.00 56.13  ? 111 VAL D C     1 
ATOM   8449  O  O     . VAL D 1 52  ? -20.883 51.290 32.332 1.00 40.28  ? 111 VAL D O     1 
ATOM   8450  C  CB    . VAL D 1 52  ? -20.453 53.686 29.960 1.00 40.28  ? 111 VAL D CB    1 
ATOM   8451  C  CG1   . VAL D 1 52  ? -20.207 54.519 31.186 1.00 40.28  ? 111 VAL D CG1   1 
ATOM   8452  C  CG2   . VAL D 1 52  ? -19.602 54.228 28.825 1.00 40.28  ? 111 VAL D CG2   1 
ATOM   8453  H  H     . VAL D 1 52  ? -20.189 51.762 28.181 1.00 0.00   ? 111 VAL D H     1 
ATOM   8454  N  N     . HIS D 1 53  ? -22.286 51.229 30.585 1.00 32.07  ? 112 HIS D N     1 
ATOM   8455  C  CA    . HIS D 1 53  ? -23.371 50.627 31.357 1.00 32.07  ? 112 HIS D CA    1 
ATOM   8456  C  C     . HIS D 1 53  ? -22.912 49.398 32.148 1.00 32.07  ? 112 HIS D C     1 
ATOM   8457  O  O     . HIS D 1 53  ? -23.059 49.341 33.370 1.00 126.27 ? 112 HIS D O     1 
ATOM   8458  C  CB    . HIS D 1 53  ? -24.535 50.253 30.429 1.00 126.27 ? 112 HIS D CB    1 
ATOM   8459  C  CG    . HIS D 1 53  ? -25.865 50.796 30.867 1.00 126.27 ? 112 HIS D CG    1 
ATOM   8460  N  ND1   . HIS D 1 53  ? -27.024 50.047 30.835 1.00 126.27 ? 112 HIS D ND1   1 
ATOM   8461  C  CD2   . HIS D 1 53  ? -26.222 52.019 31.333 1.00 126.27 ? 112 HIS D CD2   1 
ATOM   8462  C  CE1   . HIS D 1 53  ? -28.036 50.782 31.261 1.00 126.27 ? 112 HIS D CE1   1 
ATOM   8463  N  NE2   . HIS D 1 53  ? -27.575 51.983 31.569 1.00 126.27 ? 112 HIS D NE2   1 
ATOM   8464  H  H     . HIS D 1 53  ? -22.368 51.357 29.617 1.00 0.00   ? 112 HIS D H     1 
ATOM   8465  H  HD1   . HIS D 1 53  ? -27.079 49.103 30.558 1.00 0.00   ? 112 HIS D HD1   1 
ATOM   8466  H  HE2   . HIS D 1 53  ? -28.104 52.746 31.900 1.00 0.00   ? 112 HIS D HE2   1 
ATOM   8467  N  N     . ASN D 1 54  ? -22.338 48.436 31.437 1.00 48.36  ? 113 ASN D N     1 
ATOM   8468  C  CA    . ASN D 1 54  ? -21.839 47.196 32.028 1.00 48.36  ? 113 ASN D CA    1 
ATOM   8469  C  C     . ASN D 1 54  ? -20.925 47.413 33.216 1.00 48.36  ? 113 ASN D C     1 
ATOM   8470  O  O     . ASN D 1 54  ? -20.845 46.565 34.097 1.00 79.03  ? 113 ASN D O     1 
ATOM   8471  C  CB    . ASN D 1 54  ? -21.080 46.385 30.979 1.00 79.03  ? 113 ASN D CB    1 
ATOM   8472  C  CG    . ASN D 1 54  ? -21.945 46.001 29.813 1.00 79.03  ? 113 ASN D CG    1 
ATOM   8473  O  OD1   . ASN D 1 54  ? -23.076 46.480 29.676 1.00 79.03  ? 113 ASN D OD1   1 
ATOM   8474  N  ND2   . ASN D 1 54  ? -21.425 45.138 28.955 1.00 79.03  ? 113 ASN D ND2   1 
ATOM   8475  H  H     . ASN D 1 54  ? -22.263 48.544 30.462 1.00 0.00   ? 113 ASN D H     1 
ATOM   8476  H  HD21  . ASN D 1 54  ? -21.981 44.870 28.199 1.00 0.00   ? 113 ASN D HD21  1 
ATOM   8477  H  HD22  . ASN D 1 54  ? -20.514 44.824 29.126 1.00 0.00   ? 113 ASN D HD22  1 
ATOM   8478  N  N     . LEU D 1 55  ? -20.177 48.510 33.186 1.00 38.83  ? 114 LEU D N     1 
ATOM   8479  C  CA    . LEU D 1 55  ? -19.264 48.844 34.272 1.00 38.83  ? 114 LEU D CA    1 
ATOM   8480  C  C     . LEU D 1 55  ? -20.051 49.459 35.416 1.00 38.83  ? 114 LEU D C     1 
ATOM   8481  O  O     . LEU D 1 55  ? -19.835 49.124 36.576 1.00 36.43  ? 114 LEU D O     1 
ATOM   8482  C  CB    . LEU D 1 55  ? -18.179 49.813 33.789 1.00 36.43  ? 114 LEU D CB    1 
ATOM   8483  C  CG    . LEU D 1 55  ? -17.075 49.294 32.851 1.00 36.43  ? 114 LEU D CG    1 
ATOM   8484  C  CD1   . LEU D 1 55  ? -16.369 50.477 32.207 1.00 36.43  ? 114 LEU D CD1   1 
ATOM   8485  C  CD2   . LEU D 1 55  ? -16.082 48.411 33.590 1.00 36.43  ? 114 LEU D CD2   1 
ATOM   8486  H  H     . LEU D 1 55  ? -20.224 49.095 32.397 1.00 0.00   ? 114 LEU D H     1 
ATOM   8487  N  N     . LEU D 1 56  ? -20.986 50.339 35.079 1.00 64.60  ? 115 LEU D N     1 
ATOM   8488  C  CA    . LEU D 1 56  ? -21.818 50.989 36.084 1.00 64.60  ? 115 LEU D CA    1 
ATOM   8489  C  C     . LEU D 1 56  ? -22.537 49.910 36.896 1.00 64.60  ? 115 LEU D C     1 
ATOM   8490  O  O     . LEU D 1 56  ? -22.684 50.010 38.114 1.00 39.07  ? 115 LEU D O     1 
ATOM   8491  C  CB    . LEU D 1 56  ? -22.808 51.954 35.417 1.00 39.07  ? 115 LEU D CB    1 
ATOM   8492  C  CG    . LEU D 1 56  ? -22.136 53.185 34.788 1.00 39.07  ? 115 LEU D CG    1 
ATOM   8493  C  CD1   . LEU D 1 56  ? -23.150 54.060 34.071 1.00 39.07  ? 115 LEU D CD1   1 
ATOM   8494  C  CD2   . LEU D 1 56  ? -21.403 53.984 35.863 1.00 39.07  ? 115 LEU D CD2   1 
ATOM   8495  H  H     . LEU D 1 56  ? -21.117 50.553 34.131 1.00 0.00   ? 115 LEU D H     1 
ATOM   8496  N  N     . ALA D 1 57  ? -22.902 48.831 36.220 1.00 35.00  ? 116 ALA D N     1 
ATOM   8497  C  CA    . ALA D 1 57  ? -23.556 47.714 36.867 1.00 35.00  ? 116 ALA D CA    1 
ATOM   8498  C  C     . ALA D 1 57  ? -22.563 46.887 37.697 1.00 35.00  ? 116 ALA D C     1 
ATOM   8499  O  O     . ALA D 1 57  ? -22.808 45.711 37.947 1.00 80.66  ? 116 ALA D O     1 
ATOM   8500  C  CB    . ALA D 1 57  ? -24.231 46.833 35.822 1.00 80.66  ? 116 ALA D CB    1 
ATOM   8501  H  H     . ALA D 1 57  ? -22.736 48.796 35.255 1.00 0.00   ? 116 ALA D H     1 
ATOM   8502  N  N     . GLN D 1 58  ? -21.441 47.483 38.101 1.00 38.45  ? 117 GLN D N     1 
ATOM   8503  C  CA    . GLN D 1 58  ? -20.427 46.795 38.916 1.00 38.45  ? 117 GLN D CA    1 
ATOM   8504  C  C     . GLN D 1 58  ? -19.719 47.772 39.855 1.00 38.45  ? 117 GLN D C     1 
ATOM   8505  O  O     . GLN D 1 58  ? -18.507 47.685 40.050 1.00 75.44  ? 117 GLN D O     1 
ATOM   8506  C  CB    . GLN D 1 58  ? -19.383 46.111 38.035 1.00 75.44  ? 117 GLN D CB    1 
ATOM   8507  C  CG    . GLN D 1 58  ? -19.857 44.854 37.337 1.00 75.44  ? 117 GLN D CG    1 
ATOM   8508  C  CD    . GLN D 1 58  ? -18.899 44.415 36.252 1.00 75.44  ? 117 GLN D CD    1 
ATOM   8509  O  OE1   . GLN D 1 58  ? -17.686 44.419 36.449 1.00 75.44  ? 117 GLN D OE1   1 
ATOM   8510  N  NE2   . GLN D 1 58  ? -19.435 44.057 35.092 1.00 75.44  ? 117 GLN D NE2   1 
ATOM   8511  H  H     . GLN D 1 58  ? -21.227 48.404 37.861 1.00 0.00   ? 117 GLN D H     1 
ATOM   8512  N  N     . ARG D 1 59  ? -20.497 48.677 40.451 1.00 63.39  ? 118 ARG D N     1 
ATOM   8513  C  CA    . ARG D 1 59  ? -20.004 49.705 41.377 1.00 63.39  ? 118 ARG D CA    1 
ATOM   8514  C  C     . ARG D 1 59  ? -19.190 50.728 40.598 1.00 63.39  ? 118 ARG D C     1 
ATOM   8515  O  O     . ARG D 1 59  ? -19.667 51.830 40.327 1.00 126.57 ? 118 ARG D O     1 
ATOM   8516  C  CB    . ARG D 1 59  ? -19.153 49.088 42.505 1.00 126.57 ? 118 ARG D CB    1 
ATOM   8517  C  CG    . ARG D 1 59  ? -19.016 49.931 43.789 1.00 126.57 ? 118 ARG D CG    1 
ATOM   8518  C  CD    . ARG D 1 59  ? -18.313 51.270 43.576 1.00 126.57 ? 118 ARG D CD    1 
ATOM   8519  N  NE    . ARG D 1 59  ? -17.840 51.844 44.834 1.00 126.57 ? 118 ARG D NE    1 
ATOM   8520  C  CZ    . ARG D 1 59  ? -16.623 51.641 45.336 1.00 126.57 ? 118 ARG D CZ    1 
ATOM   8521  N  NH1   . ARG D 1 59  ? -15.748 50.885 44.688 1.00 126.57 ? 118 ARG D NH1   1 
ATOM   8522  N  NH2   . ARG D 1 59  ? -16.285 52.172 46.502 1.00 126.57 ? 118 ARG D NH2   1 
ATOM   8523  H  H     . ARG D 1 59  ? -21.451 48.684 40.232 1.00 0.00   ? 118 ARG D H     1 
ATOM   8524  H  HE    . ARG D 1 59  ? -18.452 52.417 45.341 1.00 0.00   ? 118 ARG D HE    1 
ATOM   8525  H  HH11  . ARG D 1 59  ? -15.992 50.460 43.817 1.00 0.00   ? 118 ARG D HH11  1 
ATOM   8526  H  HH12  . ARG D 1 59  ? -14.837 50.738 45.074 1.00 0.00   ? 118 ARG D HH12  1 
ATOM   8527  H  HH21  . ARG D 1 59  ? -16.946 52.726 47.008 1.00 0.00   ? 118 ARG D HH21  1 
ATOM   8528  H  HH22  . ARG D 1 59  ? -15.371 52.017 46.878 1.00 0.00   ? 118 ARG D HH22  1 
ATOM   8529  N  N     . VAL D 1 60  ? -17.965 50.338 40.247 1.00 70.53  ? 119 VAL D N     1 
ATOM   8530  C  CA    . VAL D 1 60  ? -17.035 51.170 39.498 1.00 70.53  ? 119 VAL D CA    1 
ATOM   8531  C  C     . VAL D 1 60  ? -16.943 52.590 40.059 1.00 70.53  ? 119 VAL D C     1 
ATOM   8532  O  O     . VAL D 1 60  ? -17.772 53.446 39.754 1.00 36.27  ? 119 VAL D O     1 
ATOM   8533  C  CB    . VAL D 1 60  ? -17.374 51.142 37.978 1.00 36.27  ? 119 VAL D CB    1 
ATOM   8534  C  CG1   . VAL D 1 60  ? -16.616 52.209 37.227 1.00 36.27  ? 119 VAL D CG1   1 
ATOM   8535  C  CG2   . VAL D 1 60  ? -17.015 49.782 37.409 1.00 36.27  ? 119 VAL D CG2   1 
ATOM   8536  H  H     . VAL D 1 60  ? -17.689 49.426 40.474 1.00 0.00   ? 119 VAL D H     1 
ATOM   8537  N  N     . SER D 1 61  ? -15.950 52.815 40.918 1.00 56.54  ? 120 SER D N     1 
ATOM   8538  C  CA    . SER D 1 61  ? -15.717 54.127 41.528 1.00 56.54  ? 120 SER D CA    1 
ATOM   8539  C  C     . SER D 1 61  ? -15.650 55.228 40.453 1.00 56.54  ? 120 SER D C     1 
ATOM   8540  O  O     . SER D 1 61  ? -16.041 56.377 40.692 1.00 52.71  ? 120 SER D O     1 
ATOM   8541  C  CB    . SER D 1 61  ? -14.396 54.123 42.318 1.00 52.71  ? 120 SER D CB    1 
ATOM   8542  O  OG    . SER D 1 61  ? -14.306 53.021 43.210 1.00 52.71  ? 120 SER D OG    1 
ATOM   8543  H  H     . SER D 1 61  ? -15.352 52.090 41.160 1.00 0.00   ? 120 SER D H     1 
ATOM   8544  H  HG    . SER D 1 61  ? -15.023 53.134 43.846 1.00 30.00  ? 120 SER D HG    1 
ATOM   8545  N  N     . GLY D 1 62  ? -15.125 54.866 39.285 1.00 54.38  ? 121 GLY D N     1 
ATOM   8546  C  CA    . GLY D 1 62  ? -14.997 55.798 38.188 1.00 54.38  ? 121 GLY D CA    1 
ATOM   8547  C  C     . GLY D 1 62  ? -14.597 55.056 36.928 1.00 54.38  ? 121 GLY D C     1 
ATOM   8548  O  O     . GLY D 1 62  ? -14.054 53.939 36.971 1.00 34.82  ? 121 GLY D O     1 
ATOM   8549  H  H     . GLY D 1 62  ? -14.818 53.945 39.150 1.00 0.00   ? 121 GLY D H     1 
ATOM   8550  N  N     . LEU D 1 63  ? -14.833 55.687 35.791 1.00 29.51  ? 122 LEU D N     1 
ATOM   8551  C  CA    . LEU D 1 63  ? -14.505 55.068 34.530 1.00 29.51  ? 122 LEU D CA    1 
ATOM   8552  C  C     . LEU D 1 63  ? -13.354 55.781 33.833 1.00 29.51  ? 122 LEU D C     1 
ATOM   8553  O  O     . LEU D 1 63  ? -13.129 56.970 34.060 1.00 28.53  ? 122 LEU D O     1 
ATOM   8554  C  CB    . LEU D 1 63  ? -15.743 55.081 33.628 1.00 28.53  ? 122 LEU D CB    1 
ATOM   8555  C  CG    . LEU D 1 63  ? -17.053 54.565 34.245 1.00 28.53  ? 122 LEU D CG    1 
ATOM   8556  C  CD1   . LEU D 1 63  ? -17.982 55.745 34.417 1.00 28.53  ? 122 LEU D CD1   1 
ATOM   8557  C  CD2   . LEU D 1 63  ? -17.722 53.505 33.372 1.00 28.53  ? 122 LEU D CD2   1 
ATOM   8558  H  H     . LEU D 1 63  ? -15.182 56.602 35.806 1.00 0.00   ? 122 LEU D H     1 
ATOM   8559  N  N     . ILE D 1 64  ? -12.552 55.011 33.099 1.00 9.14   ? 123 ILE D N     1 
ATOM   8560  C  CA    . ILE D 1 64  ? -11.468 55.536 32.259 1.00 9.14   ? 123 ILE D CA    1 
ATOM   8561  C  C     . ILE D 1 64  ? -11.971 55.042 30.906 1.00 9.14   ? 123 ILE D C     1 
ATOM   8562  O  O     . ILE D 1 64  ? -12.317 53.882 30.749 1.00 17.18  ? 123 ILE D O     1 
ATOM   8563  C  CB    . ILE D 1 64  ? -10.113 54.919 32.551 1.00 17.18  ? 123 ILE D CB    1 
ATOM   8564  C  CG1   . ILE D 1 64  ? -9.531  55.497 33.838 1.00 17.18  ? 123 ILE D CG1   1 
ATOM   8565  C  CG2   . ILE D 1 64  ? -9.192  55.226 31.430 1.00 17.18  ? 123 ILE D CG2   1 
ATOM   8566  C  CD1   . ILE D 1 64  ? -8.239  54.852 34.256 1.00 17.18  ? 123 ILE D CD1   1 
ATOM   8567  H  H     . ILE D 1 64  ? -12.697 54.048 33.077 1.00 0.00   ? 123 ILE D H     1 
ATOM   8568  N  N     . ILE D 1 65  ? -12.122 55.933 29.958 1.00 15.20  ? 124 ILE D N     1 
ATOM   8569  C  CA    . ILE D 1 65  ? -12.659 55.540 28.671 1.00 15.20  ? 124 ILE D CA    1 
ATOM   8570  C  C     . ILE D 1 65  ? -11.667 55.799 27.553 1.00 15.20  ? 124 ILE D C     1 
ATOM   8571  O  O     . ILE D 1 65  ? -11.574 56.901 27.010 1.00 26.77  ? 124 ILE D O     1 
ATOM   8572  C  CB    . ILE D 1 65  ? -13.974 56.267 28.412 1.00 26.77  ? 124 ILE D CB    1 
ATOM   8573  C  CG1   . ILE D 1 65  ? -15.037 55.733 29.371 1.00 26.77  ? 124 ILE D CG1   1 
ATOM   8574  C  CG2   . ILE D 1 65  ? -14.384 56.123 26.981 1.00 26.77  ? 124 ILE D CG2   1 
ATOM   8575  C  CD1   . ILE D 1 65  ? -16.267 56.596 29.455 1.00 26.77  ? 124 ILE D CD1   1 
ATOM   8576  H  H     . ILE D 1 65  ? -11.847 56.863 30.123 1.00 0.00   ? 124 ILE D H     1 
ATOM   8577  N  N     . ASN D 1 66  ? -10.897 54.775 27.240 1.00 24.35  ? 125 ASN D N     1 
ATOM   8578  C  CA    . ASN D 1 66  ? -9.895  54.830 26.194 1.00 24.35  ? 125 ASN D CA    1 
ATOM   8579  C  C     . ASN D 1 66  ? -10.559 54.297 24.908 1.00 24.35  ? 125 ASN D C     1 
ATOM   8580  O  O     . ASN D 1 66  ? -10.271 53.199 24.453 1.00 34.38  ? 125 ASN D O     1 
ATOM   8581  C  CB    . ASN D 1 66  ? -8.731  53.963 26.671 1.00 34.38  ? 125 ASN D CB    1 
ATOM   8582  C  CG    . ASN D 1 66  ? -7.682  53.757 25.642 1.00 34.38  ? 125 ASN D CG    1 
ATOM   8583  O  OD1   . ASN D 1 66  ? -7.162  52.670 25.537 1.00 34.38  ? 125 ASN D OD1   1 
ATOM   8584  N  ND2   . ASN D 1 66  ? -7.329  54.796 24.904 1.00 34.38  ? 125 ASN D ND2   1 
ATOM   8585  H  H     . ASN D 1 66  ? -11.047 53.936 27.726 1.00 0.00   ? 125 ASN D H     1 
ATOM   8586  H  HD21  . ASN D 1 66  ? -6.643  54.607 24.230 1.00 0.00   ? 125 ASN D HD21  1 
ATOM   8587  H  HD22  . ASN D 1 66  ? -7.728  55.676 25.032 1.00 0.00   ? 125 ASN D HD22  1 
ATOM   8588  N  N     . TYR D 1 67  ? -11.542 55.026 24.400 1.00 13.23  ? 126 TYR D N     1 
ATOM   8589  C  CA    . TYR D 1 67  ? -12.246 54.626 23.186 1.00 13.23  ? 126 TYR D CA    1 
ATOM   8590  C  C     . TYR D 1 67  ? -12.410 55.916 22.421 1.00 13.23  ? 126 TYR D C     1 
ATOM   8591  O  O     . TYR D 1 67  ? -12.829 56.932 22.978 1.00 32.85  ? 126 TYR D O     1 
ATOM   8592  C  CB    . TYR D 1 67  ? -13.612 54.020 23.485 1.00 32.85  ? 126 TYR D CB    1 
ATOM   8593  C  CG    . TYR D 1 67  ? -14.304 53.504 22.241 1.00 32.85  ? 126 TYR D CG    1 
ATOM   8594  C  CD1   . TYR D 1 67  ? -13.744 52.473 21.482 1.00 32.85  ? 126 TYR D CD1   1 
ATOM   8595  C  CD2   . TYR D 1 67  ? -15.501 54.066 21.799 1.00 32.85  ? 126 TYR D CD2   1 
ATOM   8596  C  CE1   . TYR D 1 67  ? -14.348 52.022 20.321 1.00 32.85  ? 126 TYR D CE1   1 
ATOM   8597  C  CE2   . TYR D 1 67  ? -16.125 53.620 20.634 1.00 32.85  ? 126 TYR D CE2   1 
ATOM   8598  C  CZ    . TYR D 1 67  ? -15.542 52.600 19.901 1.00 32.85  ? 126 TYR D CZ    1 
ATOM   8599  O  OH    . TYR D 1 67  ? -16.158 52.149 18.754 1.00 32.85  ? 126 TYR D OH    1 
ATOM   8600  H  H     . TYR D 1 67  ? -11.838 55.864 24.820 1.00 0.00   ? 126 TYR D H     1 
ATOM   8601  H  HH    . TYR D 1 67  ? -15.584 51.450 18.442 1.00 0.00   ? 126 TYR D HH    1 
ATOM   8602  N  N     . PRO D 1 68  ? -12.031 55.921 21.143 1.00 25.15  ? 127 PRO D N     1 
ATOM   8603  C  CA    . PRO D 1 68  ? -12.173 57.177 20.417 1.00 25.15  ? 127 PRO D CA    1 
ATOM   8604  C  C     . PRO D 1 68  ? -13.593 57.667 20.293 1.00 25.15  ? 127 PRO D C     1 
ATOM   8605  O  O     . PRO D 1 68  ? -14.466 56.938 19.818 1.00 38.87  ? 127 PRO D O     1 
ATOM   8606  C  CB    . PRO D 1 68  ? -11.537 56.855 19.062 1.00 38.87  ? 127 PRO D CB    1 
ATOM   8607  C  CG    . PRO D 1 68  ? -11.748 55.382 18.924 1.00 38.87  ? 127 PRO D CG    1 
ATOM   8608  C  CD    . PRO D 1 68  ? -11.432 54.882 20.291 1.00 38.87  ? 127 PRO D CD    1 
ATOM   8609  N  N     . LEU D 1 69  ? -13.821 58.904 20.725 1.00 25.73  ? 128 LEU D N     1 
ATOM   8610  C  CA    . LEU D 1 69  ? -15.150 59.490 20.629 1.00 25.73  ? 128 LEU D CA    1 
ATOM   8611  C  C     . LEU D 1 69  ? -15.096 60.892 20.058 1.00 25.73  ? 128 LEU D C     1 
ATOM   8612  O  O     . LEU D 1 69  ? -14.227 61.699 20.419 1.00 17.51  ? 128 LEU D O     1 
ATOM   8613  C  CB    . LEU D 1 69  ? -15.879 59.490 21.983 1.00 17.51  ? 128 LEU D CB    1 
ATOM   8614  C  CG    . LEU D 1 69  ? -16.207 58.113 22.563 1.00 17.51  ? 128 LEU D CG    1 
ATOM   8615  C  CD1   . LEU D 1 69  ? -16.376 58.218 24.041 1.00 17.51  ? 128 LEU D CD1   1 
ATOM   8616  C  CD2   . LEU D 1 69  ? -17.405 57.501 21.897 1.00 17.51  ? 128 LEU D CD2   1 
ATOM   8617  H  H     . LEU D 1 69  ? -13.092 59.430 21.123 1.00 0.00   ? 128 LEU D H     1 
ATOM   8618  N  N     . ASP D 1 70  ? -15.976 61.121 19.085 1.00 22.80  ? 129 ASP D N     1 
ATOM   8619  C  CA    . ASP D 1 70  ? -16.129 62.402 18.420 1.00 22.80  ? 129 ASP D CA    1 
ATOM   8620  C  C     . ASP D 1 70  ? -16.608 63.355 19.517 1.00 22.80  ? 129 ASP D C     1 
ATOM   8621  O  O     . ASP D 1 70  ? -17.303 62.926 20.438 1.00 39.30  ? 129 ASP D O     1 
ATOM   8622  C  CB    . ASP D 1 70  ? -17.179 62.274 17.307 1.00 39.30  ? 129 ASP D CB    1 
ATOM   8623  C  CG    . ASP D 1 70  ? -16.648 61.537 16.054 1.00 39.30  ? 129 ASP D CG    1 
ATOM   8624  O  OD1   . ASP D 1 70  ? -15.428 61.323 15.930 1.00 39.30  ? 129 ASP D OD1   1 
ATOM   8625  O  OD2   . ASP D 1 70  ? -17.451 61.201 15.161 1.00 39.30  ? 129 ASP D OD2   1 
ATOM   8626  H  H     . ASP D 1 70  ? -16.556 60.379 18.827 1.00 0.00   ? 129 ASP D H     1 
ATOM   8627  N  N     . ASP D 1 71  ? -16.261 64.634 19.430 1.00 50.87  ? 130 ASP D N     1 
ATOM   8628  C  CA    . ASP D 1 71  ? -16.635 65.600 20.471 1.00 50.87  ? 130 ASP D CA    1 
ATOM   8629  C  C     . ASP D 1 71  ? -18.086 65.555 20.952 1.00 50.87  ? 130 ASP D C     1 
ATOM   8630  O  O     . ASP D 1 71  ? -18.360 65.682 22.149 1.00 85.02  ? 130 ASP D O     1 
ATOM   8631  C  CB    . ASP D 1 71  ? -16.230 67.014 20.048 1.00 85.02  ? 130 ASP D CB    1 
ATOM   8632  C  CG    . ASP D 1 71  ? -14.732 67.128 19.748 1.00 85.02  ? 130 ASP D CG    1 
ATOM   8633  O  OD1   . ASP D 1 71  ? -13.961 66.193 20.082 1.00 85.02  ? 130 ASP D OD1   1 
ATOM   8634  O  OD2   . ASP D 1 71  ? -14.326 68.152 19.162 1.00 85.02  ? 130 ASP D OD2   1 
ATOM   8635  H  H     . ASP D 1 71  ? -15.711 64.928 18.677 1.00 0.00   ? 130 ASP D H     1 
ATOM   8636  N  N     . GLN D 1 72  ? -18.998 65.293 20.025 1.00 37.51  ? 131 GLN D N     1 
ATOM   8637  C  CA    . GLN D 1 72  ? -20.415 65.213 20.327 1.00 37.51  ? 131 GLN D CA    1 
ATOM   8638  C  C     . GLN D 1 72  ? -20.753 63.913 21.062 1.00 37.51  ? 131 GLN D C     1 
ATOM   8639  O  O     . GLN D 1 72  ? -21.461 63.918 22.071 1.00 119.92 ? 131 GLN D O     1 
ATOM   8640  C  CB    . GLN D 1 72  ? -21.202 65.333 19.027 1.00 119.92 ? 131 GLN D CB    1 
ATOM   8641  C  CG    . GLN D 1 72  ? -20.735 66.519 18.184 1.00 119.92 ? 131 GLN D CG    1 
ATOM   8642  C  CD    . GLN D 1 72  ? -21.573 66.751 16.936 1.00 119.92 ? 131 GLN D CD    1 
ATOM   8643  O  OE1   . GLN D 1 72  ? -22.774 66.460 16.913 1.00 119.92 ? 131 GLN D OE1   1 
ATOM   8644  N  NE2   . GLN D 1 72  ? -20.947 67.301 15.895 1.00 119.92 ? 131 GLN D NE2   1 
ATOM   8645  H  H     . GLN D 1 72  ? -18.691 65.142 19.113 1.00 0.00   ? 131 GLN D H     1 
ATOM   8646  N  N     . ASP D 1 73  ? -20.202 62.808 20.574 1.00 20.00  ? 132 ASP D N     1 
ATOM   8647  C  CA    . ASP D 1 73  ? -20.437 61.504 21.178 1.00 20.00  ? 132 ASP D CA    1 
ATOM   8648  C  C     . ASP D 1 73  ? -19.706 61.324 22.510 1.00 20.00  ? 132 ASP D C     1 
ATOM   8649  O  O     . ASP D 1 73  ? -20.017 60.410 23.274 1.00 38.66  ? 132 ASP D O     1 
ATOM   8650  C  CB    . ASP D 1 73  ? -20.020 60.400 20.219 1.00 38.66  ? 132 ASP D CB    1 
ATOM   8651  C  CG    . ASP D 1 73  ? -20.713 60.495 18.885 1.00 38.66  ? 132 ASP D CG    1 
ATOM   8652  O  OD1   . ASP D 1 73  ? -21.915 60.818 18.839 1.00 38.66  ? 132 ASP D OD1   1 
ATOM   8653  O  OD2   . ASP D 1 73  ? -20.054 60.219 17.868 1.00 38.66  ? 132 ASP D OD2   1 
ATOM   8654  H  H     . ASP D 1 73  ? -19.602 62.868 19.809 1.00 0.00   ? 132 ASP D H     1 
ATOM   8655  N  N     . ALA D 1 74  ? -18.729 62.185 22.775 1.00 41.85  ? 133 ALA D N     1 
ATOM   8656  C  CA    . ALA D 1 74  ? -17.960 62.127 24.015 1.00 41.85  ? 133 ALA D CA    1 
ATOM   8657  C  C     . ALA D 1 74  ? -18.819 62.678 25.150 1.00 41.85  ? 133 ALA D C     1 
ATOM   8658  O  O     . ALA D 1 74  ? -18.875 62.125 26.249 1.00 54.61  ? 133 ALA D O     1 
ATOM   8659  C  CB    . ALA D 1 74  ? -16.679 62.930 23.871 1.00 54.61  ? 133 ALA D CB    1 
ATOM   8660  H  H     . ALA D 1 74  ? -18.497 62.861 22.105 1.00 0.00   ? 133 ALA D H     1 
ATOM   8661  N  N     . ILE D 1 75  ? -19.481 63.789 24.860 1.00 37.58  ? 134 ILE D N     1 
ATOM   8662  C  CA    . ILE D 1 75  ? -20.384 64.451 25.784 1.00 37.58  ? 134 ILE D CA    1 
ATOM   8663  C  C     . ILE D 1 75  ? -21.472 63.426 26.090 1.00 37.58  ? 134 ILE D C     1 
ATOM   8664  O  O     . ILE D 1 75  ? -21.615 62.991 27.232 1.00 34.04  ? 134 ILE D O     1 
ATOM   8665  C  CB    . ILE D 1 75  ? -20.979 65.677 25.091 1.00 34.04  ? 134 ILE D CB    1 
ATOM   8666  C  CG1   . ILE D 1 75  ? -19.913 66.776 24.996 1.00 34.04  ? 134 ILE D CG1   1 
ATOM   8667  C  CG2   . ILE D 1 75  ? -22.270 66.097 25.752 1.00 34.04  ? 134 ILE D CG2   1 
ATOM   8668  C  CD1   . ILE D 1 75  ? -20.189 67.830 23.922 1.00 34.04  ? 134 ILE D CD1   1 
ATOM   8669  H  H     . ILE D 1 75  ? -19.343 64.188 23.976 1.00 0.00   ? 134 ILE D H     1 
ATOM   8670  N  N     . ALA D 1 76  ? -22.184 62.995 25.049 1.00 23.02  ? 135 ALA D N     1 
ATOM   8671  C  CA    . ALA D 1 76  ? -23.230 61.983 25.167 1.00 23.02  ? 135 ALA D CA    1 
ATOM   8672  C  C     . ALA D 1 76  ? -22.768 60.809 26.025 1.00 23.02  ? 135 ALA D C     1 
ATOM   8673  O  O     . ALA D 1 76  ? -23.513 60.355 26.892 1.00 76.93  ? 135 ALA D O     1 
ATOM   8674  C  CB    . ALA D 1 76  ? -23.643 61.490 23.790 1.00 76.93  ? 135 ALA D CB    1 
ATOM   8675  H  H     . ALA D 1 76  ? -22.006 63.390 24.167 1.00 0.00   ? 135 ALA D H     1 
ATOM   8676  N  N     . VAL D 1 77  ? -21.543 60.326 25.803 1.00 36.61  ? 136 VAL D N     1 
ATOM   8677  C  CA    . VAL D 1 77  ? -21.019 59.203 26.597 1.00 36.61  ? 136 VAL D CA    1 
ATOM   8678  C  C     . VAL D 1 77  ? -20.727 59.590 28.039 1.00 36.61  ? 136 VAL D C     1 
ATOM   8679  O  O     . VAL D 1 77  ? -20.929 58.778 28.939 1.00 46.25  ? 136 VAL D O     1 
ATOM   8680  C  CB    . VAL D 1 77  ? -19.738 58.575 26.017 1.00 46.25  ? 136 VAL D CB    1 
ATOM   8681  C  CG1   . VAL D 1 77  ? -19.150 57.571 27.027 1.00 46.25  ? 136 VAL D CG1   1 
ATOM   8682  C  CG2   . VAL D 1 77  ? -20.043 57.872 24.706 1.00 46.25  ? 136 VAL D CG2   1 
ATOM   8683  H  H     . VAL D 1 77  ? -20.986 60.692 25.088 1.00 0.00   ? 136 VAL D H     1 
ATOM   8684  N  N     . GLU D 1 78  ? -20.240 60.803 28.272 1.00 40.24  ? 137 GLU D N     1 
ATOM   8685  C  CA    . GLU D 1 78  ? -19.965 61.221 29.640 1.00 40.24  ? 137 GLU D CA    1 
ATOM   8686  C  C     . GLU D 1 78  ? -21.291 61.342 30.371 1.00 40.24  ? 137 GLU D C     1 
ATOM   8687  O  O     . GLU D 1 78  ? -21.408 60.972 31.539 1.00 74.37  ? 137 GLU D O     1 
ATOM   8688  C  CB    . GLU D 1 78  ? -19.255 62.561 29.678 1.00 74.37  ? 137 GLU D CB    1 
ATOM   8689  C  CG    . GLU D 1 78  ? -18.943 62.990 31.088 1.00 74.37  ? 137 GLU D CG    1 
ATOM   8690  C  CD    . GLU D 1 78  ? -18.583 64.445 31.195 1.00 74.37  ? 137 GLU D CD    1 
ATOM   8691  O  OE1   . GLU D 1 78  ? -19.112 65.246 30.388 1.00 74.37  ? 137 GLU D OE1   1 
ATOM   8692  O  OE2   . GLU D 1 78  ? -17.781 64.786 32.097 1.00 74.37  ? 137 GLU D OE2   1 
ATOM   8693  H  H     . GLU D 1 78  ? -20.070 61.412 27.527 1.00 0.00   ? 137 GLU D H     1 
ATOM   8694  N  N     . ALA D 1 79  ? -22.298 61.835 29.665 1.00 43.71  ? 138 ALA D N     1 
ATOM   8695  C  CA    . ALA D 1 79  ? -23.631 61.996 30.226 1.00 43.71  ? 138 ALA D CA    1 
ATOM   8696  C  C     . ALA D 1 79  ? -24.262 60.669 30.699 1.00 43.71  ? 138 ALA D C     1 
ATOM   8697  O  O     . ALA D 1 79  ? -25.189 60.663 31.515 1.00 52.92  ? 138 ALA D O     1 
ATOM   8698  C  CB    . ALA D 1 79  ? -24.529 62.673 29.210 1.00 52.92  ? 138 ALA D CB    1 
ATOM   8699  H  H     . ALA D 1 79  ? -22.138 62.093 28.742 1.00 0.00   ? 138 ALA D H     1 
ATOM   8700  N  N     . ALA D 1 80  ? -23.749 59.548 30.209 1.00 46.68  ? 139 ALA D N     1 
ATOM   8701  C  CA    . ALA D 1 80  ? -24.284 58.244 30.593 1.00 46.68  ? 139 ALA D CA    1 
ATOM   8702  C  C     . ALA D 1 80  ? -23.587 57.598 31.788 1.00 46.68  ? 139 ALA D C     1 
ATOM   8703  O  O     . ALA D 1 80  ? -24.004 56.543 32.270 1.00 59.49  ? 139 ALA D O     1 
ATOM   8704  C  CB    . ALA D 1 80  ? -24.262 57.294 29.399 1.00 59.49  ? 139 ALA D CB    1 
ATOM   8705  H  H     . ALA D 1 80  ? -23.014 59.589 29.559 1.00 0.00   ? 139 ALA D H     1 
ATOM   8706  N  N     . CYS D 1 81  ? -22.501 58.198 32.244 1.00 53.59  ? 140 CYS D N     1 
ATOM   8707  C  CA    . CYS D 1 81  ? -21.791 57.637 33.376 1.00 53.59  ? 140 CYS D CA    1 
ATOM   8708  C  C     . CYS D 1 81  ? -22.557 57.952 34.648 1.00 53.59  ? 140 CYS D C     1 
ATOM   8709  O  O     . CYS D 1 81  ? -22.286 57.370 35.701 1.00 57.72  ? 140 CYS D O     1 
ATOM   8710  C  CB    . CYS D 1 81  ? -20.381 58.187 33.418 1.00 57.72  ? 140 CYS D CB    1 
ATOM   8711  S  SG    . CYS D 1 81  ? -19.590 57.946 31.839 1.00 57.72  ? 140 CYS D SG    1 
ATOM   8712  H  H     . CYS D 1 81  ? -22.160 59.009 31.810 1.00 0.00   ? 140 CYS D H     1 
ATOM   8713  N  N     . THR D 1 82  ? -23.487 58.905 34.530 1.00 71.96  ? 141 THR D N     1 
ATOM   8714  C  CA    . THR D 1 82  ? -24.366 59.336 35.610 1.00 71.96  ? 141 THR D CA    1 
ATOM   8715  C  C     . THR D 1 82  ? -23.738 59.317 37.002 1.00 71.96  ? 141 THR D C     1 
ATOM   8716  O  O     . THR D 1 82  ? -23.618 58.258 37.613 1.00 57.69  ? 141 THR D O     1 
ATOM   8717  C  CB    . THR D 1 82  ? -25.628 58.474 35.615 1.00 57.69  ? 141 THR D CB    1 
ATOM   8718  O  OG1   . THR D 1 82  ? -25.261 57.091 35.704 1.00 57.69  ? 141 THR D OG1   1 
ATOM   8719  C  CG2   . THR D 1 82  ? -26.401 58.687 34.331 1.00 57.69  ? 141 THR D CG2   1 
ATOM   8720  H  H     . THR D 1 82  ? -23.601 59.332 33.661 1.00 0.00   ? 141 THR D H     1 
ATOM   8721  H  HG1   . THR D 1 82  ? -24.570 56.950 36.375 1.00 30.00  ? 141 THR D HG1   1 
ATOM   8722  N  N     . ASN D 1 83  ? -23.367 60.498 37.498 1.00 85.02  ? 142 ASN D N     1 
ATOM   8723  C  CA    . ASN D 1 83  ? -22.734 60.695 38.820 1.00 85.02  ? 142 ASN D CA    1 
ATOM   8724  C  C     . ASN D 1 83  ? -21.402 59.965 39.104 1.00 85.02  ? 142 ASN D C     1 
ATOM   8725  O  O     . ASN D 1 83  ? -20.807 60.130 40.178 1.00 88.56  ? 142 ASN D O     1 
ATOM   8726  C  CB    . ASN D 1 83  ? -23.742 60.526 39.986 1.00 88.56  ? 142 ASN D CB    1 
ATOM   8727  C  CG    . ASN D 1 83  ? -24.079 59.074 40.292 1.00 88.56  ? 142 ASN D CG    1 
ATOM   8728  O  OD1   . ASN D 1 83  ? -23.267 58.339 40.853 1.00 88.56  ? 142 ASN D OD1   1 
ATOM   8729  N  ND2   . ASN D 1 83  ? -25.299 58.668 39.955 1.00 88.56  ? 142 ASN D ND2   1 
ATOM   8730  H  H     . ASN D 1 83  ? -23.513 61.291 36.944 1.00 0.00   ? 142 ASN D H     1 
ATOM   8731  H  HD21  . ASN D 1 83  ? -25.463 57.722 40.140 1.00 0.00   ? 142 ASN D HD21  1 
ATOM   8732  H  HD22  . ASN D 1 83  ? -25.937 59.282 39.552 1.00 0.00   ? 142 ASN D HD22  1 
ATOM   8733  N  N     . VAL D 1 84  ? -20.934 59.184 38.132 1.00 40.27  ? 143 VAL D N     1 
ATOM   8734  C  CA    . VAL D 1 84  ? -19.662 58.472 38.231 1.00 40.27  ? 143 VAL D CA    1 
ATOM   8735  C  C     . VAL D 1 84  ? -18.635 59.275 37.421 1.00 40.27  ? 143 VAL D C     1 
ATOM   8736  O  O     . VAL D 1 84  ? -18.914 59.709 36.304 1.00 39.44  ? 143 VAL D O     1 
ATOM   8737  C  CB    . VAL D 1 84  ? -19.779 57.058 37.655 1.00 39.44  ? 143 VAL D CB    1 
ATOM   8738  C  CG1   . VAL D 1 84  ? -18.481 56.293 37.852 1.00 39.44  ? 143 VAL D CG1   1 
ATOM   8739  C  CG2   . VAL D 1 84  ? -20.922 56.337 38.329 1.00 39.44  ? 143 VAL D CG2   1 
ATOM   8740  H  H     . VAL D 1 84  ? -21.450 59.029 37.320 1.00 0.00   ? 143 VAL D H     1 
ATOM   8741  N  N     . PRO D 1 85  ? -17.458 59.541 38.004 1.00 31.55  ? 144 PRO D N     1 
ATOM   8742  C  CA    . PRO D 1 85  ? -16.416 60.299 37.316 1.00 31.55  ? 144 PRO D CA    1 
ATOM   8743  C  C     . PRO D 1 85  ? -15.735 59.547 36.166 1.00 31.55  ? 144 PRO D C     1 
ATOM   8744  O  O     . PRO D 1 85  ? -15.192 58.457 36.349 1.00 30.26  ? 144 PRO D O     1 
ATOM   8745  C  CB    . PRO D 1 85  ? -15.446 60.628 38.444 1.00 30.26  ? 144 PRO D CB    1 
ATOM   8746  C  CG    . PRO D 1 85  ? -15.569 59.460 39.341 1.00 30.26  ? 144 PRO D CG    1 
ATOM   8747  C  CD    . PRO D 1 85  ? -17.050 59.233 39.384 1.00 30.26  ? 144 PRO D CD    1 
ATOM   8748  N  N     . ALA D 1 86  ? -15.777 60.147 34.981 1.00 33.88  ? 145 ALA D N     1 
ATOM   8749  C  CA    . ALA D 1 86  ? -15.175 59.568 33.796 1.00 33.88  ? 145 ALA D CA    1 
ATOM   8750  C  C     . ALA D 1 86  ? -14.072 60.470 33.251 1.00 33.88  ? 145 ALA D C     1 
ATOM   8751  O  O     . ALA D 1 86  ? -14.225 61.692 33.189 1.00 33.08  ? 145 ALA D O     1 
ATOM   8752  C  CB    . ALA D 1 86  ? -16.213 59.334 32.751 1.00 33.08  ? 145 ALA D CB    1 
ATOM   8753  H  H     . ALA D 1 86  ? -16.199 61.025 34.883 1.00 0.00   ? 145 ALA D H     1 
ATOM   8754  N  N     . LEU D 1 87  ? -12.980 59.831 32.831 1.00 37.92  ? 146 LEU D N     1 
ATOM   8755  C  CA    . LEU D 1 87  ? -11.796 60.479 32.273 1.00 37.92  ? 146 LEU D CA    1 
ATOM   8756  C  C     . LEU D 1 87  ? -11.528 59.900 30.882 1.00 37.92  ? 146 LEU D C     1 
ATOM   8757  O  O     . LEU D 1 87  ? -11.127 58.752 30.762 1.00 27.36  ? 146 LEU D O     1 
ATOM   8758  C  CB    . LEU D 1 87  ? -10.618 60.159 33.169 1.00 27.36  ? 146 LEU D CB    1 
ATOM   8759  C  CG    . LEU D 1 87  ? -9.266  60.773 32.874 1.00 27.36  ? 146 LEU D CG    1 
ATOM   8760  C  CD1   . LEU D 1 87  ? -9.255  62.225 33.292 1.00 27.36  ? 146 LEU D CD1   1 
ATOM   8761  C  CD2   . LEU D 1 87  ? -8.238  60.011 33.675 1.00 27.36  ? 146 LEU D CD2   1 
ATOM   8762  H  H     . LEU D 1 87  ? -12.958 58.852 32.914 1.00 0.00   ? 146 LEU D H     1 
ATOM   8763  N  N     . PHE D 1 88  ? -11.733 60.690 29.835 1.00 22.72  ? 147 PHE D N     1 
ATOM   8764  C  CA    . PHE D 1 88  ? -11.535 60.218 28.469 1.00 22.72  ? 147 PHE D CA    1 
ATOM   8765  C  C     . PHE D 1 88  ? -10.080 60.319 28.026 1.00 22.72  ? 147 PHE D C     1 
ATOM   8766  O  O     . PHE D 1 88  ? -9.450  61.363 28.207 1.00 24.39  ? 147 PHE D O     1 
ATOM   8767  C  CB    . PHE D 1 88  ? -12.442 60.998 27.522 1.00 24.39  ? 147 PHE D CB    1 
ATOM   8768  C  CG    . PHE D 1 88  ? -13.909 60.821 27.804 1.00 24.39  ? 147 PHE D CG    1 
ATOM   8769  C  CD1   . PHE D 1 88  ? -14.500 61.417 28.905 1.00 24.39  ? 147 PHE D CD1   1 
ATOM   8770  C  CD2   . PHE D 1 88  ? -14.702 60.053 26.973 1.00 24.39  ? 147 PHE D CD2   1 
ATOM   8771  C  CE1   . PHE D 1 88  ? -15.863 61.251 29.175 1.00 24.39  ? 147 PHE D CE1   1 
ATOM   8772  C  CE2   . PHE D 1 88  ? -16.067 59.884 27.238 1.00 24.39  ? 147 PHE D CE2   1 
ATOM   8773  C  CZ    . PHE D 1 88  ? -16.639 60.485 28.339 1.00 24.39  ? 147 PHE D CZ    1 
ATOM   8774  H  H     . PHE D 1 88  ? -11.983 61.619 29.990 1.00 0.00   ? 147 PHE D H     1 
ATOM   8775  N  N     . LEU D 1 89  ? -9.543  59.233 27.460 1.00 27.34  ? 148 LEU D N     1 
ATOM   8776  C  CA    . LEU D 1 89  ? -8.146  59.198 26.988 1.00 27.34  ? 148 LEU D CA    1 
ATOM   8777  C  C     . LEU D 1 89  ? -7.994  59.253 25.479 1.00 27.34  ? 148 LEU D C     1 
ATOM   8778  O  O     . LEU D 1 89  ? -6.891  59.193 24.972 1.00 21.44  ? 148 LEU D O     1 
ATOM   8779  C  CB    . LEU D 1 89  ? -7.417  57.944 27.467 1.00 21.44  ? 148 LEU D CB    1 
ATOM   8780  C  CG    . LEU D 1 89  ? -7.337  57.703 28.959 1.00 21.44  ? 148 LEU D CG    1 
ATOM   8781  C  CD1   . LEU D 1 89  ? -6.562  56.438 29.197 1.00 21.44  ? 148 LEU D CD1   1 
ATOM   8782  C  CD2   . LEU D 1 89  ? -6.678  58.900 29.610 1.00 21.44  ? 148 LEU D CD2   1 
ATOM   8783  H  H     . LEU D 1 89  ? -10.109 58.437 27.367 1.00 0.00   ? 148 LEU D H     1 
ATOM   8784  N  N     . ASP D 1 90  ? -9.092  59.304 24.755 1.00 14.57  ? 149 ASP D N     1 
ATOM   8785  C  CA    . ASP D 1 90  ? -9.006  59.361 23.309 1.00 14.57  ? 149 ASP D CA    1 
ATOM   8786  C  C     . ASP D 1 90  ? -10.137 60.204 22.747 1.00 14.57  ? 149 ASP D C     1 
ATOM   8787  O  O     . ASP D 1 90  ? -11.179 59.702 22.313 1.00 34.75  ? 149 ASP D O     1 
ATOM   8788  C  CB    . ASP D 1 90  ? -8.981  57.941 22.710 1.00 34.75  ? 149 ASP D CB    1 
ATOM   8789  C  CG    . ASP D 1 90  ? -8.859  57.930 21.182 1.00 34.75  ? 149 ASP D CG    1 
ATOM   8790  O  OD1   . ASP D 1 90  ? -8.781  58.999 20.551 1.00 34.75  ? 149 ASP D OD1   1 
ATOM   8791  O  OD2   . ASP D 1 90  ? -8.850  56.829 20.604 1.00 34.75  ? 149 ASP D OD2   1 
ATOM   8792  H  H     . ASP D 1 90  ? -9.980  59.319 25.165 1.00 0.00   ? 149 ASP D H     1 
ATOM   8793  N  N     . VAL D 1 91  ? -9.901  61.505 22.779 1.00 16.66  ? 150 VAL D N     1 
ATOM   8794  C  CA    . VAL D 1 91  ? -10.839 62.498 22.300 1.00 16.66  ? 150 VAL D CA    1 
ATOM   8795  C  C     . VAL D 1 91  ? -9.994  63.699 21.871 1.00 16.66  ? 150 VAL D C     1 
ATOM   8796  O  O     . VAL D 1 91  ? -8.765  63.683 21.980 1.00 28.08  ? 150 VAL D O     1 
ATOM   8797  C  CB    . VAL D 1 91  ? -11.833 62.940 23.433 1.00 28.08  ? 150 VAL D CB    1 
ATOM   8798  C  CG1   . VAL D 1 91  ? -12.653 61.765 23.944 1.00 28.08  ? 150 VAL D CG1   1 
ATOM   8799  C  CG2   . VAL D 1 91  ? -11.084 63.569 24.590 1.00 28.08  ? 150 VAL D CG2   1 
ATOM   8800  H  H     . VAL D 1 91  ? -9.030  61.852 23.081 1.00 0.00   ? 150 VAL D H     1 
ATOM   8801  N  N     . SER D 1 92  ? -10.649 64.716 21.332 1.00 37.39  ? 151 SER D N     1 
ATOM   8802  C  CA    . SER D 1 92  ? -9.948  65.922 20.943 1.00 37.39  ? 151 SER D CA    1 
ATOM   8803  C  C     . SER D 1 92  ? -9.667  66.627 22.252 1.00 37.39  ? 151 SER D C     1 
ATOM   8804  O  O     . SER D 1 92  ? -10.351 66.404 23.254 1.00 25.37  ? 151 SER D O     1 
ATOM   8805  C  CB    . SER D 1 92  ? -10.841 66.812 20.071 1.00 25.37  ? 151 SER D CB    1 
ATOM   8806  O  OG    . SER D 1 92  ? -10.213 68.044 19.716 1.00 25.37  ? 151 SER D OG    1 
ATOM   8807  H  H     . SER D 1 92  ? -11.617 64.652 21.223 1.00 0.00   ? 151 SER D H     1 
ATOM   8808  H  HG    . SER D 1 92  ? -10.669 68.378 18.932 1.00 30.00  ? 151 SER D HG    1 
ATOM   8809  N  N     . ASP D 1 93  ? -8.649  67.471 22.253 1.00 68.99  ? 152 ASP D N     1 
ATOM   8810  C  CA    . ASP D 1 93  ? -8.312  68.225 23.451 1.00 68.99  ? 152 ASP D CA    1 
ATOM   8811  C  C     . ASP D 1 93  ? -9.325  69.360 23.654 1.00 68.99  ? 152 ASP D C     1 
ATOM   8812  O  O     . ASP D 1 93  ? -9.291  70.067 24.656 1.00 47.05  ? 152 ASP D O     1 
ATOM   8813  C  CB    . ASP D 1 93  ? -6.864  68.745 23.374 1.00 47.05  ? 152 ASP D CB    1 
ATOM   8814  C  CG    . ASP D 1 93  ? -6.546  69.470 22.066 1.00 47.05  ? 152 ASP D CG    1 
ATOM   8815  O  OD1   . ASP D 1 93  ? -7.015  69.078 20.975 1.00 47.05  ? 152 ASP D OD1   1 
ATOM   8816  O  OD2   . ASP D 1 93  ? -5.780  70.444 22.135 1.00 47.05  ? 152 ASP D OD2   1 
ATOM   8817  H  H     . ASP D 1 93  ? -8.146  67.515 21.424 1.00 0.00   ? 152 ASP D H     1 
ATOM   8818  N  N     . GLN D 1 94  ? -10.270 69.467 22.724 1.00 45.51  ? 153 GLN D N     1 
ATOM   8819  C  CA    . GLN D 1 94  ? -11.295 70.508 22.743 1.00 45.51  ? 153 GLN D CA    1 
ATOM   8820  C  C     . GLN D 1 94  ? -12.668 70.067 23.246 1.00 45.51  ? 153 GLN D C     1 
ATOM   8821  O  O     . GLN D 1 94  ? -13.603 70.857 23.209 1.00 65.51  ? 153 GLN D O     1 
ATOM   8822  C  CB    . GLN D 1 94  ? -11.483 71.084 21.327 1.00 65.51  ? 153 GLN D CB    1 
ATOM   8823  C  CG    . GLN D 1 94  ? -10.206 71.230 20.487 1.00 65.51  ? 153 GLN D CG    1 
ATOM   8824  C  CD    . GLN D 1 94  ? -9.357  72.419 20.879 1.00 65.51  ? 153 GLN D CD    1 
ATOM   8825  O  OE1   . GLN D 1 94  ? -9.640  73.550 20.491 1.00 65.51  ? 153 GLN D OE1   1 
ATOM   8826  N  NE2   . GLN D 1 94  ? -8.301  72.170 21.637 1.00 65.51  ? 153 GLN D NE2   1 
ATOM   8827  H  H     . GLN D 1 94  ? -10.307 68.845 21.975 1.00 0.00   ? 153 GLN D H     1 
ATOM   8828  N  N     . THR D 1 95  ? -12.828 68.814 23.652 1.00 54.17  ? 154 THR D N     1 
ATOM   8829  C  CA    . THR D 1 95  ? -14.142 68.384 24.114 1.00 54.17  ? 154 THR D CA    1 
ATOM   8830  C  C     . THR D 1 95  ? -14.303 68.728 25.577 1.00 54.17  ? 154 THR D C     1 
ATOM   8831  O  O     . THR D 1 95  ? -13.389 68.521 26.375 1.00 36.90  ? 154 THR D O     1 
ATOM   8832  C  CB    . THR D 1 95  ? -14.393 66.881 23.938 1.00 36.90  ? 154 THR D CB    1 
ATOM   8833  O  OG1   . THR D 1 95  ? -13.951 66.465 22.642 1.00 36.90  ? 154 THR D OG1   1 
ATOM   8834  C  CG2   . THR D 1 95  ? -15.882 66.594 24.032 1.00 36.90  ? 154 THR D CG2   1 
ATOM   8835  H  H     . THR D 1 95  ? -12.089 68.175 23.692 1.00 0.00   ? 154 THR D H     1 
ATOM   8836  H  HG1   . THR D 1 95  ? -14.123 65.521 22.557 1.00 30.00  ? 154 THR D HG1   1 
ATOM   8837  N  N     . PRO D 1 96  ? -15.462 69.305 25.941 1.00 61.32  ? 155 PRO D N     1 
ATOM   8838  C  CA    . PRO D 1 96  ? -15.774 69.698 27.319 1.00 61.32  ? 155 PRO D CA    1 
ATOM   8839  C  C     . PRO D 1 96  ? -16.006 68.483 28.213 1.00 61.32  ? 155 PRO D C     1 
ATOM   8840  O  O     . PRO D 1 96  ? -17.144 68.169 28.592 1.00 46.50  ? 155 PRO D O     1 
ATOM   8841  C  CB    . PRO D 1 96  ? -17.035 70.532 27.146 1.00 46.50  ? 155 PRO D CB    1 
ATOM   8842  C  CG    . PRO D 1 96  ? -17.687 69.916 25.908 1.00 46.50  ? 155 PRO D CG    1 
ATOM   8843  C  CD    . PRO D 1 96  ? -16.523 69.740 25.008 1.00 46.50  ? 155 PRO D CD    1 
ATOM   8844  N  N     . ILE D 1 97  ? -14.918 67.778 28.508 1.00 31.77  ? 156 ILE D N     1 
ATOM   8845  C  CA    . ILE D 1 97  ? -14.963 66.597 29.354 1.00 31.77  ? 156 ILE D CA    1 
ATOM   8846  C  C     . ILE D 1 97  ? -13.629 66.525 30.115 1.00 31.77  ? 156 ILE D C     1 
ATOM   8847  O  O     . ILE D 1 97  ? -12.756 67.379 29.938 1.00 32.09  ? 156 ILE D O     1 
ATOM   8848  C  CB    . ILE D 1 97  ? -15.199 65.315 28.507 1.00 32.09  ? 156 ILE D CB    1 
ATOM   8849  C  CG1   . ILE D 1 97  ? -14.159 65.218 27.396 1.00 32.09  ? 156 ILE D CG1   1 
ATOM   8850  C  CG2   . ILE D 1 97  ? -16.593 65.318 27.899 1.00 32.09  ? 156 ILE D CG2   1 
ATOM   8851  C  CD1   . ILE D 1 97  ? -14.468 64.167 26.383 1.00 32.09  ? 156 ILE D CD1   1 
ATOM   8852  H  H     . ILE D 1 97  ? -14.025 68.057 28.195 1.00 0.00   ? 156 ILE D H     1 
ATOM   8853  N  N     . ASN D 1 98  ? -13.499 65.544 30.997 1.00 32.33  ? 157 ASN D N     1 
ATOM   8854  C  CA    . ASN D 1 98  ? -12.276 65.374 31.764 1.00 32.33  ? 157 ASN D CA    1 
ATOM   8855  C  C     . ASN D 1 98  ? -11.418 64.474 30.888 1.00 32.33  ? 157 ASN D C     1 
ATOM   8856  O  O     . ASN D 1 98  ? -11.700 63.286 30.746 1.00 52.18  ? 157 ASN D O     1 
ATOM   8857  C  CB    . ASN D 1 98  ? -12.564 64.686 33.110 1.00 52.18  ? 157 ASN D CB    1 
ATOM   8858  C  CG    . ASN D 1 98  ? -13.784 65.261 33.824 1.00 52.18  ? 157 ASN D CG    1 
ATOM   8859  O  OD1   . ASN D 1 98  ? -14.779 64.570 34.045 1.00 52.18  ? 157 ASN D OD1   1 
ATOM   8860  N  ND2   . ASN D 1 98  ? -13.717 66.527 34.170 1.00 52.18  ? 157 ASN D ND2   1 
ATOM   8861  H  H     . ASN D 1 98  ? -14.229 64.903 31.124 1.00 0.00   ? 157 ASN D H     1 
ATOM   8862  H  HD21  . ASN D 1 98  ? -14.486 66.919 34.623 1.00 0.00   ? 157 ASN D HD21  1 
ATOM   8863  H  HD22  . ASN D 1 98  ? -12.901 66.995 33.931 1.00 0.00   ? 157 ASN D HD22  1 
ATOM   8864  N  N     . SER D 1 99  ? -10.392 65.042 30.269 1.00 43.28  ? 158 SER D N     1 
ATOM   8865  C  CA    . SER D 1 99  ? -9.530  64.273 29.389 1.00 43.28  ? 158 SER D CA    1 
ATOM   8866  C  C     . SER D 1 99  ? -8.041  64.356 29.673 1.00 43.28  ? 158 SER D C     1 
ATOM   8867  O  O     . SER D 1 99  ? -7.571  65.268 30.355 1.00 30.99  ? 158 SER D O     1 
ATOM   8868  C  CB    . SER D 1 99  ? -9.798  64.667 27.929 1.00 30.99  ? 158 SER D CB    1 
ATOM   8869  O  OG    . SER D 1 99  ? -10.249 66.012 27.803 1.00 30.99  ? 158 SER D OG    1 
ATOM   8870  H  H     . SER D 1 99  ? -10.203 65.999 30.374 1.00 0.00   ? 158 SER D H     1 
ATOM   8871  H  HG    . SER D 1 99  ? -10.330 66.217 26.866 1.00 30.00  ? 158 SER D HG    1 
ATOM   8872  N  N     . ILE D 1 100 ? -7.317  63.357 29.175 1.00 52.49  ? 159 ILE D N     1 
ATOM   8873  C  CA    . ILE D 1 100 ? -5.864  63.280 29.289 1.00 52.49  ? 159 ILE D CA    1 
ATOM   8874  C  C     . ILE D 1 100 ? -5.407  62.762 27.932 1.00 52.49  ? 159 ILE D C     1 
ATOM   8875  O  O     . ILE D 1 100 ? -5.559  61.589 27.631 1.00 27.46  ? 159 ILE D O     1 
ATOM   8876  C  CB    . ILE D 1 100 ? -5.382  62.276 30.380 1.00 27.46  ? 159 ILE D CB    1 
ATOM   8877  C  CG1   . ILE D 1 100 ? -5.886  62.686 31.760 1.00 27.46  ? 159 ILE D CG1   1 
ATOM   8878  C  CG2   . ILE D 1 100 ? -3.855  62.255 30.436 1.00 27.46  ? 159 ILE D CG2   1 
ATOM   8879  C  CD1   . ILE D 1 100 ? -5.354  61.832 32.866 1.00 27.46  ? 159 ILE D CD1   1 
ATOM   8880  H  H     . ILE D 1 100 ? -7.765  62.617 28.706 1.00 0.00   ? 159 ILE D H     1 
ATOM   8881  N  N     . ILE D 1 101 ? -4.945  63.648 27.068 1.00 21.48  ? 160 ILE D N     1 
ATOM   8882  C  CA    . ILE D 1 101 ? -4.479  63.223 25.768 1.00 21.48  ? 160 ILE D CA    1 
ATOM   8883  C  C     . ILE D 1 101 ? -3.084  63.782 25.458 1.00 21.48  ? 160 ILE D C     1 
ATOM   8884  O  O     . ILE D 1 101 ? -2.710  64.855 25.960 1.00 24.51  ? 160 ILE D O     1 
ATOM   8885  C  CB    . ILE D 1 101 ? -5.470  63.600 24.663 1.00 24.51  ? 160 ILE D CB    1 
ATOM   8886  C  CG1   . ILE D 1 101 ? -5.349  65.070 24.297 1.00 24.51  ? 160 ILE D CG1   1 
ATOM   8887  C  CG2   . ILE D 1 101 ? -6.880  63.276 25.095 1.00 24.51  ? 160 ILE D CG2   1 
ATOM   8888  C  CD1   . ILE D 1 101 ? -5.944  65.380 22.933 1.00 24.51  ? 160 ILE D CD1   1 
ATOM   8889  H  H     . ILE D 1 101 ? -4.884  64.602 27.294 1.00 0.00   ? 160 ILE D H     1 
ATOM   8890  N  N     . PHE D 1 102 ? -2.304  63.015 24.683 1.00 17.91  ? 161 PHE D N     1 
ATOM   8891  C  CA    . PHE D 1 102 ? -0.927  63.391 24.281 1.00 17.91  ? 161 PHE D CA    1 
ATOM   8892  C  C     . PHE D 1 102 ? -0.936  64.515 23.266 1.00 17.91  ? 161 PHE D C     1 
ATOM   8893  O  O     . PHE D 1 102 ? -1.865  64.644 22.471 1.00 13.94  ? 161 PHE D O     1 
ATOM   8894  C  CB    . PHE D 1 102 ? -0.165  62.214 23.646 1.00 13.94  ? 161 PHE D CB    1 
ATOM   8895  C  CG    . PHE D 1 102 ? 0.050   61.029 24.568 1.00 13.94  ? 161 PHE D CG    1 
ATOM   8896  C  CD1   . PHE D 1 102 ? 1.133   60.975 25.403 1.00 13.94  ? 161 PHE D CD1   1 
ATOM   8897  C  CD2   . PHE D 1 102 ? -0.822  59.940 24.535 1.00 13.94  ? 161 PHE D CD2   1 
ATOM   8898  C  CE1   . PHE D 1 102 ? 1.351   59.871 26.183 1.00 13.94  ? 161 PHE D CE1   1 
ATOM   8899  C  CE2   . PHE D 1 102 ? -0.602  58.828 25.322 1.00 13.94  ? 161 PHE D CE2   1 
ATOM   8900  C  CZ    . PHE D 1 102 ? 0.479   58.796 26.139 1.00 13.94  ? 161 PHE D CZ    1 
ATOM   8901  H  H     . PHE D 1 102 ? -2.676  62.176 24.351 1.00 0.00   ? 161 PHE D H     1 
ATOM   8902  N  N     . SER D 1 103 ? 0.129   65.293 23.235 1.00 23.65  ? 162 SER D N     1 
ATOM   8903  C  CA    . SER D 1 103 ? 0.167   66.381 22.295 1.00 23.65  ? 162 SER D CA    1 
ATOM   8904  C  C     . SER D 1 103 ? 0.299   65.942 20.842 1.00 23.65  ? 162 SER D C     1 
ATOM   8905  O  O     . SER D 1 103 ? 1.391   65.614 20.395 1.00 26.36  ? 162 SER D O     1 
ATOM   8906  C  CB    . SER D 1 103 ? 1.285   67.347 22.633 1.00 26.36  ? 162 SER D CB    1 
ATOM   8907  O  OG    . SER D 1 103 ? 1.168   68.464 21.779 1.00 26.36  ? 162 SER D OG    1 
ATOM   8908  H  H     . SER D 1 103 ? 0.878   65.128 23.847 1.00 0.00   ? 162 SER D H     1 
ATOM   8909  H  HG    . SER D 1 103 ? 1.692   69.162 22.194 1.00 30.00  ? 162 SER D HG    1 
ATOM   8910  N  N     . HIS D 1 104 ? -0.807  65.973 20.098 1.00 18.57  ? 163 HIS D N     1 
ATOM   8911  C  CA    . HIS D 1 104 ? -0.794  65.617 18.674 1.00 18.57  ? 163 HIS D CA    1 
ATOM   8912  C  C     . HIS D 1 104 ? -0.117  66.661 17.811 1.00 18.57  ? 163 HIS D C     1 
ATOM   8913  O  O     . HIS D 1 104 ? 0.228   66.375 16.683 1.00 31.50  ? 163 HIS D O     1 
ATOM   8914  C  CB    . HIS D 1 104 ? -2.211  65.404 18.136 1.00 31.50  ? 163 HIS D CB    1 
ATOM   8915  C  CG    . HIS D 1 104 ? -3.113  66.595 18.279 1.00 31.50  ? 163 HIS D CG    1 
ATOM   8916  N  ND1   . HIS D 1 104 ? -3.595  67.302 17.195 1.00 31.50  ? 163 HIS D ND1   1 
ATOM   8917  C  CD2   . HIS D 1 104 ? -3.667  67.168 19.375 1.00 31.50  ? 163 HIS D CD2   1 
ATOM   8918  C  CE1   . HIS D 1 104 ? -4.406  68.256 17.617 1.00 31.50  ? 163 HIS D CE1   1 
ATOM   8919  N  NE2   . HIS D 1 104 ? -4.466  68.196 18.935 1.00 31.50  ? 163 HIS D NE2   1 
ATOM   8920  H  H     . HIS D 1 104 ? -1.628  66.175 20.584 1.00 0.00   ? 163 HIS D H     1 
ATOM   8921  H  HD1   . HIS D 1 104 ? -3.408  67.120 16.240 1.00 0.00   ? 163 HIS D HD1   1 
ATOM   8922  H  HE2   . HIS D 1 104 ? -4.997  68.800 19.501 1.00 0.00   ? 163 HIS D HE2   1 
ATOM   8923  N  N     . GLU D 1 105 ? 0.013   67.884 18.324 1.00 33.72  ? 164 GLU D N     1 
ATOM   8924  C  CA    . GLU D 1 105 ? 0.639   69.004 17.607 1.00 33.72  ? 164 GLU D CA    1 
ATOM   8925  C  C     . GLU D 1 105 ? 2.155   68.870 17.554 1.00 33.72  ? 164 GLU D C     1 
ATOM   8926  O  O     . GLU D 1 105 ? 2.803   69.296 16.593 1.00 30.96  ? 164 GLU D O     1 
ATOM   8927  C  CB    . GLU D 1 105 ? 0.294   70.330 18.294 1.00 30.96  ? 164 GLU D CB    1 
ATOM   8928  C  CG    . GLU D 1 105 ? -1.109  70.831 18.066 1.00 30.96  ? 164 GLU D CG    1 
ATOM   8929  C  CD    . GLU D 1 105 ? -1.322  71.416 16.681 1.00 30.96  ? 164 GLU D CD    1 
ATOM   8930  O  OE1   . GLU D 1 105 ? -0.339  71.628 15.939 1.00 30.96  ? 164 GLU D OE1   1 
ATOM   8931  O  OE2   . GLU D 1 105 ? -2.491  71.688 16.334 1.00 30.96  ? 164 GLU D OE2   1 
ATOM   8932  H  H     . GLU D 1 105 ? -0.299  68.044 19.234 1.00 0.00   ? 164 GLU D H     1 
ATOM   8933  N  N     . ASP D 1 106 ? 2.721   68.335 18.631 1.00 18.26  ? 165 ASP D N     1 
ATOM   8934  C  CA    . ASP D 1 106 ? 4.156   68.135 18.727 1.00 18.26  ? 165 ASP D CA    1 
ATOM   8935  C  C     . ASP D 1 106 ? 4.509   66.829 18.081 1.00 18.26  ? 165 ASP D C     1 
ATOM   8936  O  O     . ASP D 1 106 ? 5.567   66.676 17.493 1.00 39.31  ? 165 ASP D O     1 
ATOM   8937  C  CB    . ASP D 1 106 ? 4.586   68.127 20.181 1.00 39.31  ? 165 ASP D CB    1 
ATOM   8938  C  CG    . ASP D 1 106 ? 4.418   69.479 20.839 1.00 39.31  ? 165 ASP D CG    1 
ATOM   8939  O  OD1   . ASP D 1 106 ? 4.789   70.503 20.215 1.00 39.31  ? 165 ASP D OD1   1 
ATOM   8940  O  OD2   . ASP D 1 106 ? 3.909   69.507 21.981 1.00 39.31  ? 165 ASP D OD2   1 
ATOM   8941  H  H     . ASP D 1 106 ? 2.155   68.075 19.383 1.00 0.00   ? 165 ASP D H     1 
ATOM   8942  N  N     . GLY D 1 107 ? 3.596   65.880 18.189 1.00 26.94  ? 166 GLY D N     1 
ATOM   8943  C  CA    . GLY D 1 107 ? 3.815   64.596 17.572 1.00 26.94  ? 166 GLY D CA    1 
ATOM   8944  C  C     . GLY D 1 107 ? 3.955   64.820 16.084 1.00 26.94  ? 166 GLY D C     1 
ATOM   8945  O  O     . GLY D 1 107 ? 4.999   64.585 15.529 1.00 14.51  ? 166 GLY D O     1 
ATOM   8946  H  H     . GLY D 1 107 ? 2.775   66.029 18.697 1.00 0.00   ? 166 GLY D H     1 
ATOM   8947  N  N     . THR D 1 108 ? 2.930   65.370 15.454 1.00 18.94  ? 167 THR D N     1 
ATOM   8948  C  CA    . THR D 1 108 ? 2.946   65.610 14.021 1.00 18.94  ? 167 THR D CA    1 
ATOM   8949  C  C     . THR D 1 108 ? 4.048   66.573 13.515 1.00 18.94  ? 167 THR D C     1 
ATOM   8950  O  O     . THR D 1 108 ? 4.636   66.373 12.439 1.00 28.33  ? 167 THR D O     1 
ATOM   8951  C  CB    . THR D 1 108 ? 1.569   66.046 13.582 1.00 28.33  ? 167 THR D CB    1 
ATOM   8952  O  OG1   . THR D 1 108 ? 1.132   67.118 14.419 1.00 28.33  ? 167 THR D OG1   1 
ATOM   8953  C  CG2   . THR D 1 108 ? 0.604   64.898 13.748 1.00 28.33  ? 167 THR D CG2   1 
ATOM   8954  H  H     . THR D 1 108 ? 2.127   65.667 15.939 1.00 0.00   ? 167 THR D H     1 
ATOM   8955  H  HG1   . THR D 1 108 ? 0.314   67.511 14.111 1.00 30.00  ? 167 THR D HG1   1 
ATOM   8956  N  N     . ARG D 1 109 ? 4.373   67.578 14.318 1.00 2.00   ? 168 ARG D N     1 
ATOM   8957  C  CA    . ARG D 1 109 ? 5.396   68.546 13.947 1.00 2.00   ? 168 ARG D CA    1 
ATOM   8958  C  C     . ARG D 1 109 ? 6.765   67.850 13.961 1.00 2.00   ? 168 ARG D C     1 
ATOM   8959  O  O     . ARG D 1 109 ? 7.533   67.924 12.995 1.00 26.48  ? 168 ARG D O     1 
ATOM   8960  C  CB    . ARG D 1 109 ? 5.387   69.709 14.931 1.00 26.48  ? 168 ARG D CB    1 
ATOM   8961  C  CG    . ARG D 1 109 ? 6.538   70.651 14.728 1.00 26.48  ? 168 ARG D CG    1 
ATOM   8962  C  CD    . ARG D 1 109 ? 6.454   71.810 15.642 1.00 26.48  ? 168 ARG D CD    1 
ATOM   8963  N  NE    . ARG D 1 109 ? 6.446   71.368 17.021 1.00 26.48  ? 168 ARG D NE    1 
ATOM   8964  C  CZ    . ARG D 1 109 ? 7.524   70.944 17.660 1.00 26.48  ? 168 ARG D CZ    1 
ATOM   8965  N  NH1   . ARG D 1 109 ? 8.678   70.904 17.029 1.00 26.48  ? 168 ARG D NH1   1 
ATOM   8966  N  NH2   . ARG D 1 109 ? 7.460   70.601 18.936 1.00 26.48  ? 168 ARG D NH2   1 
ATOM   8967  H  H     . ARG D 1 109 ? 3.892   67.703 15.164 1.00 0.00   ? 168 ARG D H     1 
ATOM   8968  H  HE    . ARG D 1 109 ? 5.595   71.372 17.508 1.00 0.00   ? 168 ARG D HE    1 
ATOM   8969  H  HH11  . ARG D 1 109 ? 8.745   71.196 16.074 1.00 0.00   ? 168 ARG D HH11  1 
ATOM   8970  H  HH12  . ARG D 1 109 ? 9.495   70.590 17.509 1.00 0.00   ? 168 ARG D HH12  1 
ATOM   8971  H  HH21  . ARG D 1 109 ? 6.595   70.654 19.431 1.00 0.00   ? 168 ARG D HH21  1 
ATOM   8972  H  HH22  . ARG D 1 109 ? 8.288   70.284 19.398 1.00 0.00   ? 168 ARG D HH22  1 
ATOM   8973  N  N     . LEU D 1 110 ? 7.059   67.161 15.061 1.00 8.54   ? 169 LEU D N     1 
ATOM   8974  C  CA    . LEU D 1 110 ? 8.323   66.455 15.211 1.00 8.54   ? 169 LEU D CA    1 
ATOM   8975  C  C     . LEU D 1 110 ? 8.497   65.478 14.070 1.00 8.54   ? 169 LEU D C     1 
ATOM   8976  O  O     . LEU D 1 110 ? 9.605   65.261 13.625 1.00 16.57  ? 169 LEU D O     1 
ATOM   8977  C  CB    . LEU D 1 110 ? 8.371   65.728 16.548 1.00 16.57  ? 169 LEU D CB    1 
ATOM   8978  C  CG    . LEU D 1 110 ? 8.382   66.604 17.792 1.00 16.57  ? 169 LEU D CG    1 
ATOM   8979  C  CD1   . LEU D 1 110 ? 8.055   65.797 18.992 1.00 16.57  ? 169 LEU D CD1   1 
ATOM   8980  C  CD2   . LEU D 1 110 ? 9.716   67.239 17.977 1.00 16.57  ? 169 LEU D CD2   1 
ATOM   8981  H  H     . LEU D 1 110 ? 6.401   67.117 15.784 1.00 0.00   ? 169 LEU D H     1 
ATOM   8982  N  N     . GLY D 1 111 ? 7.396   64.938 13.553 1.00 21.63  ? 170 GLY D N     1 
ATOM   8983  C  CA    . GLY D 1 111 ? 7.457   63.982 12.453 1.00 21.63  ? 170 GLY D CA    1 
ATOM   8984  C  C     . GLY D 1 111 ? 7.898   64.651 11.169 1.00 21.63  ? 170 GLY D C     1 
ATOM   8985  O  O     . GLY D 1 111 ? 8.946   64.306 10.590 1.00 28.71  ? 170 GLY D O     1 
ATOM   8986  H  H     . GLY D 1 111 ? 6.536   65.164 13.956 1.00 0.00   ? 170 GLY D H     1 
ATOM   8987  N  N     . VAL D 1 112 ? 7.126   65.658 10.766 1.00 32.02  ? 171 VAL D N     1 
ATOM   8988  C  CA    . VAL D 1 112 ? 7.383   66.445 9.566  1.00 32.02  ? 171 VAL D CA    1 
ATOM   8989  C  C     . VAL D 1 112 ? 8.733   67.155 9.627  1.00 32.02  ? 171 VAL D C     1 
ATOM   8990  O  O     . VAL D 1 112 ? 9.510   67.101 8.698  1.00 17.48  ? 171 VAL D O     1 
ATOM   8991  C  CB    . VAL D 1 112 ? 6.314   67.518 9.384  1.00 17.48  ? 171 VAL D CB    1 
ATOM   8992  C  CG1   . VAL D 1 112 ? 6.521   68.231 8.098  1.00 17.48  ? 171 VAL D CG1   1 
ATOM   8993  C  CG2   . VAL D 1 112 ? 4.930   66.909 9.469  1.00 17.48  ? 171 VAL D CG2   1 
ATOM   8994  H  H     . VAL D 1 112 ? 6.352   65.892 11.326 1.00 0.00   ? 171 VAL D H     1 
ATOM   8995  N  N     . GLU D 1 113 ? 9.022   67.845 10.708 1.00 12.17  ? 172 GLU D N     1 
ATOM   8996  C  CA    . GLU D 1 113 ? 10.301  68.529 10.791 1.00 12.17  ? 172 GLU D CA    1 
ATOM   8997  C  C     . GLU D 1 113 ? 11.490  67.577 10.691 1.00 12.17  ? 172 GLU D C     1 
ATOM   8998  O  O     . GLU D 1 113 ? 12.540  67.937 10.163 1.00 46.94  ? 172 GLU D O     1 
ATOM   8999  C  CB    . GLU D 1 113 ? 10.388  69.373 12.060 1.00 46.94  ? 172 GLU D CB    1 
ATOM   9000  C  CG    . GLU D 1 113 ? 9.487   70.601 12.000 1.00 46.94  ? 172 GLU D CG    1 
ATOM   9001  C  CD    . GLU D 1 113 ? 9.463   71.411 13.285 1.00 46.94  ? 172 GLU D CD    1 
ATOM   9002  O  OE1   . GLU D 1 113 ? 10.197  71.066 14.254 1.00 46.94  ? 172 GLU D OE1   1 
ATOM   9003  O  OE2   . GLU D 1 113 ? 8.694   72.402 13.310 1.00 46.94  ? 172 GLU D OE2   1 
ATOM   9004  H  H     . GLU D 1 113 ? 8.373   67.901 11.424 1.00 0.00   ? 172 GLU D H     1 
ATOM   9005  N  N     . HIS D 1 114 ? 11.350  66.371 11.219 1.00 31.93  ? 173 HIS D N     1 
ATOM   9006  C  CA    . HIS D 1 114 ? 12.442  65.428 11.125 1.00 31.93  ? 173 HIS D CA    1 
ATOM   9007  C  C     . HIS D 1 114 ? 12.604  65.069 9.665  1.00 31.93  ? 173 HIS D C     1 
ATOM   9008  O  O     . HIS D 1 114 ? 13.706  65.162 9.134  1.00 16.51  ? 173 HIS D O     1 
ATOM   9009  C  CB    . HIS D 1 114 ? 12.132  64.174 11.911 1.00 16.51  ? 173 HIS D CB    1 
ATOM   9010  C  CG    . HIS D 1 114 ? 13.181  63.113 11.803 1.00 16.51  ? 173 HIS D CG    1 
ATOM   9011  N  ND1   . HIS D 1 114 ? 13.051  62.021 10.970 1.00 16.51  ? 173 HIS D ND1   1 
ATOM   9012  C  CD2   . HIS D 1 114 ? 14.333  62.927 12.484 1.00 16.51  ? 173 HIS D CD2   1 
ATOM   9013  C  CE1   . HIS D 1 114 ? 14.070  61.202 11.151 1.00 16.51  ? 173 HIS D CE1   1 
ATOM   9014  N  NE2   . HIS D 1 114 ? 14.864  61.727 12.063 1.00 16.51  ? 173 HIS D NE2   1 
ATOM   9015  H  H     . HIS D 1 114 ? 10.520  66.114 11.676 1.00 0.00   ? 173 HIS D H     1 
ATOM   9016  H  HD1   . HIS D 1 114 ? 12.320  61.859 10.333 1.00 0.00   ? 173 HIS D HD1   1 
ATOM   9017  H  HE2   . HIS D 1 114 ? 15.704  61.338 12.387 1.00 0.00   ? 173 HIS D HE2   1 
ATOM   9018  N  N     . LEU D 1 115 ? 11.520  64.668 9.004  1.00 29.43  ? 174 LEU D N     1 
ATOM   9019  C  CA    . LEU D 1 115 ? 11.623  64.303 7.602  1.00 29.43  ? 174 LEU D CA    1 
ATOM   9020  C  C     . LEU D 1 115 ? 12.150  65.423 6.742  1.00 29.43  ? 174 LEU D C     1 
ATOM   9021  O  O     . LEU D 1 115 ? 13.222  65.265 6.180  1.00 16.22  ? 174 LEU D O     1 
ATOM   9022  C  CB    . LEU D 1 115 ? 10.314  63.775 7.044  1.00 16.22  ? 174 LEU D CB    1 
ATOM   9023  C  CG    . LEU D 1 115 ? 9.965   62.371 7.520  1.00 16.22  ? 174 LEU D CG    1 
ATOM   9024  C  CD1   . LEU D 1 115 ? 8.802   61.876 6.741  1.00 16.22  ? 174 LEU D CD1   1 
ATOM   9025  C  CD2   . LEU D 1 115 ? 11.141  61.429 7.359  1.00 16.22  ? 174 LEU D CD2   1 
ATOM   9026  H  H     . LEU D 1 115 ? 10.641  64.656 9.445  1.00 0.00   ? 174 LEU D H     1 
ATOM   9027  N  N     . VAL D 1 116 ? 11.461  66.566 6.687  1.00 18.11  ? 175 VAL D N     1 
ATOM   9028  C  CA    . VAL D 1 116 ? 11.913  67.713 5.863  1.00 18.11  ? 175 VAL D CA    1 
ATOM   9029  C  C     . VAL D 1 116 ? 13.364  68.162 6.070  1.00 18.11  ? 175 VAL D C     1 
ATOM   9030  O  O     . VAL D 1 116 ? 14.063  68.448 5.117  1.00 30.81  ? 175 VAL D O     1 
ATOM   9031  C  CB    . VAL D 1 116 ? 11.000  68.976 5.997  1.00 30.81  ? 175 VAL D CB    1 
ATOM   9032  C  CG1   . VAL D 1 116 ? 9.555   68.625 5.784  1.00 30.81  ? 175 VAL D CG1   1 
ATOM   9033  C  CG2   . VAL D 1 116 ? 11.199  69.638 7.328  1.00 30.81  ? 175 VAL D CG2   1 
ATOM   9034  H  H     . VAL D 1 116 ? 10.635  66.647 7.205  1.00 0.00   ? 175 VAL D H     1 
ATOM   9035  N  N     . ALA D 1 117 ? 13.805  68.219 7.314  1.00 6.83   ? 176 ALA D N     1 
ATOM   9036  C  CA    . ALA D 1 117 ? 15.153  68.621 7.653  1.00 6.83   ? 176 ALA D CA    1 
ATOM   9037  C  C     . ALA D 1 117 ? 16.191  67.645 7.141  1.00 6.83   ? 176 ALA D C     1 
ATOM   9038  O  O     . ALA D 1 117 ? 17.382  67.979 7.087  1.00 61.34  ? 176 ALA D O     1 
ATOM   9039  C  CB    . ALA D 1 117 ? 15.285  68.785 9.140  1.00 61.34  ? 176 ALA D CB    1 
ATOM   9040  H  H     . ALA D 1 117 ? 13.212  67.984 8.063  1.00 0.00   ? 176 ALA D H     1 
ATOM   9041  N  N     . LEU D 1 118 ? 15.776  66.412 6.850  1.00 30.43  ? 177 LEU D N     1 
ATOM   9042  C  CA    . LEU D 1 118 ? 16.689  65.403 6.286  1.00 30.43  ? 177 LEU D CA    1 
ATOM   9043  C  C     . LEU D 1 118 ? 16.721  65.601 4.759  1.00 30.43  ? 177 LEU D C     1 
ATOM   9044  O  O     . LEU D 1 118 ? 17.494  64.974 4.034  1.00 17.11  ? 177 LEU D O     1 
ATOM   9045  C  CB    . LEU D 1 118 ? 16.184  63.992 6.591  1.00 17.11  ? 177 LEU D CB    1 
ATOM   9046  C  CG    . LEU D 1 118 ? 16.573  63.299 7.889  1.00 17.11  ? 177 LEU D CG    1 
ATOM   9047  C  CD1   . LEU D 1 118 ? 15.836  62.003 7.998  1.00 17.11  ? 177 LEU D CD1   1 
ATOM   9048  C  CD2   . LEU D 1 118 ? 18.040  63.042 7.904  1.00 17.11  ? 177 LEU D CD2   1 
ATOM   9049  H  H     . LEU D 1 118 ? 14.847  66.162 7.052  1.00 0.00   ? 177 LEU D H     1 
ATOM   9050  N  N     . GLY D 1 119 ? 15.797  66.427 4.292  1.00 6.41   ? 178 GLY D N     1 
ATOM   9051  C  CA    . GLY D 1 119 ? 15.673  66.742 2.890  1.00 6.41   ? 178 GLY D CA    1 
ATOM   9052  C  C     . GLY D 1 119 ? 14.523  66.123 2.118  1.00 6.41   ? 178 GLY D C     1 
ATOM   9053  O  O     . GLY D 1 119 ? 14.509  66.230 0.882  1.00 28.49  ? 178 GLY D O     1 
ATOM   9054  H  H     . GLY D 1 119 ? 15.185  66.853 4.919  1.00 0.00   ? 178 GLY D H     1 
ATOM   9055  N  N     . HIS D 1 120 ? 13.541  65.515 2.783  1.00 18.53  ? 179 HIS D N     1 
ATOM   9056  C  CA    . HIS D 1 120 ? 12.456  64.884 2.043  1.00 18.53  ? 179 HIS D CA    1 
ATOM   9057  C  C     . HIS D 1 120 ? 11.401  65.779 1.445  1.00 18.53  ? 179 HIS D C     1 
ATOM   9058  O  O     . HIS D 1 120 ? 10.703  66.528 2.127  1.00 14.22  ? 179 HIS D O     1 
ATOM   9059  C  CB    . HIS D 1 120 ? 11.821  63.759 2.831  1.00 14.22  ? 179 HIS D CB    1 
ATOM   9060  C  CG    . HIS D 1 120 ? 12.757  62.621 3.103  1.00 14.22  ? 179 HIS D CG    1 
ATOM   9061  N  ND1   . HIS D 1 120 ? 12.901  61.549 2.247  1.00 14.22  ? 179 HIS D ND1   1 
ATOM   9062  C  CD2   . HIS D 1 120 ? 13.591  62.381 4.144  1.00 14.22  ? 179 HIS D CD2   1 
ATOM   9063  C  CE1   . HIS D 1 120 ? 13.780  60.699 2.752  1.00 14.22  ? 179 HIS D CE1   1 
ATOM   9064  N  NE2   . HIS D 1 120 ? 14.212  61.180 3.902  1.00 14.22  ? 179 HIS D NE2   1 
ATOM   9065  H  H     . HIS D 1 120 ? 13.537  65.556 3.761  1.00 0.00   ? 179 HIS D H     1 
ATOM   9066  H  HD1   . HIS D 1 120 ? 12.420  61.403 1.406  1.00 0.00   ? 179 HIS D HD1   1 
ATOM   9067  H  HE2   . HIS D 1 120 ? 14.802  60.687 4.511  1.00 0.00   ? 179 HIS D HE2   1 
ATOM   9068  N  N     . GLN D 1 121 ? 11.260  65.619 0.141  1.00 16.57  ? 180 GLN D N     1 
ATOM   9069  C  CA    . GLN D 1 121 ? 10.323  66.366 -0.678 1.00 16.57  ? 180 GLN D CA    1 
ATOM   9070  C  C     . GLN D 1 121 ? 9.061   65.537 -0.890 1.00 16.57  ? 180 GLN D C     1 
ATOM   9071  O  O     . GLN D 1 121 ? 7.964   65.957 -0.538 1.00 111.71 ? 180 GLN D O     1 
ATOM   9072  C  CB    . GLN D 1 121 ? 10.973  66.678 -2.035 1.00 111.71 ? 180 GLN D CB    1 
ATOM   9073  C  CG    . GLN D 1 121 ? 12.473  66.285 -2.185 1.00 111.71 ? 180 GLN D CG    1 
ATOM   9074  C  CD    . GLN D 1 121 ? 12.725  64.771 -2.345 1.00 111.71 ? 180 GLN D CD    1 
ATOM   9075  O  OE1   . GLN D 1 121 ? 11.992  63.937 -1.799 1.00 111.71 ? 180 GLN D OE1   1 
ATOM   9076  N  NE2   . GLN D 1 121 ? 13.772  64.421 -3.092 1.00 111.71 ? 180 GLN D NE2   1 
ATOM   9077  H  H     . GLN D 1 121 ? 11.812  64.919 -0.233 1.00 0.00   ? 180 GLN D H     1 
ATOM   9078  N  N     . GLN D 1 122 ? 9.231   64.349 -1.456 1.00 18.22  ? 181 GLN D N     1 
ATOM   9079  C  CA    . GLN D 1 122 ? 8.129   63.444 -1.735 1.00 18.22  ? 181 GLN D CA    1 
ATOM   9080  C  C     . GLN D 1 122 ? 7.783   62.618 -0.508 1.00 18.22  ? 181 GLN D C     1 
ATOM   9081  O  O     . GLN D 1 122 ? 8.419   61.595 -0.247 1.00 88.25  ? 181 GLN D O     1 
ATOM   9082  C  CB    . GLN D 1 122 ? 8.528   62.503 -2.851 1.00 88.25  ? 181 GLN D CB    1 
ATOM   9083  C  CG    . GLN D 1 122 ? 9.140   63.169 -4.052 1.00 88.25  ? 181 GLN D CG    1 
ATOM   9084  C  CD    . GLN D 1 122 ? 9.855   62.159 -4.923 1.00 88.25  ? 181 GLN D CD    1 
ATOM   9085  O  OE1   . GLN D 1 122 ? 9.222   61.378 -5.641 1.00 88.25  ? 181 GLN D OE1   1 
ATOM   9086  N  NE2   . GLN D 1 122 ? 11.181  62.132 -4.830 1.00 88.25  ? 181 GLN D NE2   1 
ATOM   9087  H  H     . GLN D 1 122 ? 10.142  64.076 -1.666 1.00 0.00   ? 181 GLN D H     1 
ATOM   9088  N  N     . ILE D 1 123 ? 6.762   63.059 0.223  1.00 31.69  ? 182 ILE D N     1 
ATOM   9089  C  CA    . ILE D 1 123 ? 6.301   62.415 1.456  1.00 31.69  ? 182 ILE D CA    1 
ATOM   9090  C  C     . ILE D 1 123 ? 4.848   61.946 1.395  1.00 31.69  ? 182 ILE D C     1 
ATOM   9091  O  O     . ILE D 1 123 ? 3.941   62.720 1.062  1.00 15.86  ? 182 ILE D O     1 
ATOM   9092  C  CB    . ILE D 1 123 ? 6.420   63.376 2.646  1.00 15.86  ? 182 ILE D CB    1 
ATOM   9093  C  CG1   . ILE D 1 123 ? 7.885   63.763 2.861  1.00 15.86  ? 182 ILE D CG1   1 
ATOM   9094  C  CG2   . ILE D 1 123 ? 5.777   62.765 3.875  1.00 15.86  ? 182 ILE D CG2   1 
ATOM   9095  C  CD1   . ILE D 1 123 ? 8.113   64.893 3.829  1.00 15.86  ? 182 ILE D CD1   1 
ATOM   9096  H  H     . ILE D 1 123 ? 6.318   63.885 -0.060 1.00 0.00   ? 182 ILE D H     1 
ATOM   9097  N  N     . ALA D 1 124 ? 4.620   60.686 1.754  1.00 13.90  ? 183 ALA D N     1 
ATOM   9098  C  CA    . ALA D 1 124 ? 3.270   60.133 1.752  1.00 13.90  ? 183 ALA D CA    1 
ATOM   9099  C  C     . ALA D 1 124 ? 2.780   59.970 3.193  1.00 13.90  ? 183 ALA D C     1 
ATOM   9100  O  O     . ALA D 1 124 ? 3.565   59.670 4.084  1.00 17.75  ? 183 ALA D O     1 
ATOM   9101  C  CB    . ALA D 1 124 ? 3.281   58.814 1.064  1.00 17.75  ? 183 ALA D CB    1 
ATOM   9102  H  H     . ALA D 1 124 ? 5.354   60.113 2.073  1.00 0.00   ? 183 ALA D H     1 
ATOM   9103  N  N     . LEU D 1 125 ? 1.490   60.158 3.419  1.00 10.88  ? 184 LEU D N     1 
ATOM   9104  C  CA    . LEU D 1 125 ? 0.921   60.007 4.747  1.00 10.88  ? 184 LEU D CA    1 
ATOM   9105  C  C     . LEU D 1 125 ? 0.078   58.738 4.784  1.00 10.88  ? 184 LEU D C     1 
ATOM   9106  O  O     . LEU D 1 125 ? -0.650  58.447 3.838  1.00 19.53  ? 184 LEU D O     1 
ATOM   9107  C  CB    . LEU D 1 125 ? 0.026   61.198 5.093  1.00 19.53  ? 184 LEU D CB    1 
ATOM   9108  C  CG    . LEU D 1 125 ? 0.567   62.599 4.821  1.00 19.53  ? 184 LEU D CG    1 
ATOM   9109  C  CD1   . LEU D 1 125 ? -0.488  63.618 5.175  1.00 19.53  ? 184 LEU D CD1   1 
ATOM   9110  C  CD2   . LEU D 1 125 ? 1.836   62.844 5.593  1.00 19.53  ? 184 LEU D CD2   1 
ATOM   9111  H  H     . LEU D 1 125 ? 0.883   60.394 2.687  1.00 0.00   ? 184 LEU D H     1 
ATOM   9112  N  N     . LEU D 1 126 ? 0.158   58.004 5.886  1.00 15.10  ? 185 LEU D N     1 
ATOM   9113  C  CA    . LEU D 1 126 ? -0.614  56.779 6.069  1.00 15.10  ? 185 LEU D CA    1 
ATOM   9114  C  C     . LEU D 1 126 ? -1.331  56.982 7.395  1.00 15.10  ? 185 LEU D C     1 
ATOM   9115  O  O     . LEU D 1 126 ? -0.722  56.859 8.467  1.00 18.08  ? 185 LEU D O     1 
ATOM   9116  C  CB    . LEU D 1 126 ? 0.340   55.594 6.150  1.00 18.08  ? 185 LEU D CB    1 
ATOM   9117  C  CG    . LEU D 1 126 ? -0.116  54.141 6.254  1.00 18.08  ? 185 LEU D CG    1 
ATOM   9118  C  CD1   . LEU D 1 126 ? -1.281  53.854 5.362  1.00 18.08  ? 185 LEU D CD1   1 
ATOM   9119  C  CD2   . LEU D 1 126 ? 1.086   53.253 5.910  1.00 18.08  ? 185 LEU D CD2   1 
ATOM   9120  H  H     . LEU D 1 126 ? 0.760   58.282 6.606  1.00 0.00   ? 185 LEU D H     1 
ATOM   9121  N  N     . ALA D 1 127 ? -2.594  57.387 7.318  1.00 19.36  ? 186 ALA D N     1 
ATOM   9122  C  CA    . ALA D 1 127 ? -3.399  57.668 8.493  1.00 19.36  ? 186 ALA D CA    1 
ATOM   9123  C  C     . ALA D 1 127 ? -4.274  56.499 8.964  1.00 19.36  ? 186 ALA D C     1 
ATOM   9124  O  O     . ALA D 1 127 ? -4.612  55.593 8.187  1.00 18.41  ? 186 ALA D O     1 
ATOM   9125  C  CB    . ALA D 1 127 ? -4.249  58.911 8.241  1.00 18.41  ? 186 ALA D CB    1 
ATOM   9126  H  H     . ALA D 1 127 ? -2.999  57.519 6.455  1.00 0.00   ? 186 ALA D H     1 
ATOM   9127  N  N     . GLY D 1 128 ? -4.604  56.524 10.262 1.00 9.57   ? 187 GLY D N     1 
ATOM   9128  C  CA    . GLY D 1 128 ? -5.414  55.488 10.868 1.00 9.57   ? 187 GLY D CA    1 
ATOM   9129  C  C     . GLY D 1 128 ? -6.822  55.698 10.420 1.00 9.57   ? 187 GLY D C     1 
ATOM   9130  O  O     . GLY D 1 128 ? -7.054  56.542 9.546  1.00 21.99  ? 187 GLY D O     1 
ATOM   9131  H  H     . GLY D 1 128 ? -4.323  57.286 10.808 1.00 0.00   ? 187 GLY D H     1 
ATOM   9132  N  N     . PRO D 1 129 ? -7.788  54.930 10.946 1.00 28.56  ? 188 PRO D N     1 
ATOM   9133  C  CA    . PRO D 1 129 ? -9.166  55.140 10.512 1.00 28.56  ? 188 PRO D CA    1 
ATOM   9134  C  C     . PRO D 1 129 ? -9.646  56.540 10.869 1.00 28.56  ? 188 PRO D C     1 
ATOM   9135  O  O     . PRO D 1 129 ? -9.663  56.933 12.038 1.00 19.53  ? 188 PRO D O     1 
ATOM   9136  C  CB    . PRO D 1 129 ? -9.942  54.058 11.269 1.00 19.53  ? 188 PRO D CB    1 
ATOM   9137  C  CG    . PRO D 1 129 ? -9.134  53.825 12.454 1.00 19.53  ? 188 PRO D CG    1 
ATOM   9138  C  CD    . PRO D 1 129 ? -7.725  53.836 11.917 1.00 19.53  ? 188 PRO D CD    1 
ATOM   9139  N  N     . LEU D 1 130 ? -9.989  57.305 9.841  1.00 27.73  ? 189 LEU D N     1 
ATOM   9140  C  CA    . LEU D 1 130 ? -10.496 58.646 10.006 1.00 27.73  ? 189 LEU D CA    1 
ATOM   9141  C  C     . LEU D 1 130 ? -11.801 58.640 10.793 1.00 27.73  ? 189 LEU D C     1 
ATOM   9142  O  O     . LEU D 1 130 ? -12.497 59.643 10.862 1.00 27.38  ? 189 LEU D O     1 
ATOM   9143  C  CB    . LEU D 1 130 ? -10.656 59.327 8.640  1.00 27.38  ? 189 LEU D CB    1 
ATOM   9144  C  CG    . LEU D 1 130 ? -9.313  59.615 7.968  1.00 27.38  ? 189 LEU D CG    1 
ATOM   9145  C  CD1   . LEU D 1 130 ? -9.573  60.355 6.686  1.00 27.38  ? 189 LEU D CD1   1 
ATOM   9146  C  CD2   . LEU D 1 130 ? -8.382  60.427 8.869  1.00 27.38  ? 189 LEU D CD2   1 
ATOM   9147  H  H     . LEU D 1 130 ? -9.830  57.007 8.940  1.00 0.00   ? 189 LEU D H     1 
ATOM   9148  N  N     . SER D 1 131 ? -12.183 57.471 11.287 1.00 19.69  ? 190 SER D N     1 
ATOM   9149  C  CA    . SER D 1 131 ? -13.352 57.359 12.133 1.00 19.69  ? 190 SER D CA    1 
ATOM   9150  C  C     . SER D 1 131 ? -12.844 57.577 13.583 1.00 19.69  ? 190 SER D C     1 
ATOM   9151  O  O     . SER D 1 131 ? -13.626 57.703 14.522 1.00 34.18  ? 190 SER D O     1 
ATOM   9152  C  CB    . SER D 1 131 ? -14.019 55.994 11.959 1.00 34.18  ? 190 SER D CB    1 
ATOM   9153  O  OG    . SER D 1 131 ? -13.143 54.948 12.330 1.00 34.18  ? 190 SER D OG    1 
ATOM   9154  H  H     . SER D 1 131 ? -11.778 56.617 11.088 1.00 0.00   ? 190 SER D H     1 
ATOM   9155  H  HG    . SER D 1 131 ? -13.635 54.121 12.302 1.00 30.00  ? 190 SER D HG    1 
ATOM   9156  N  N     . SER D 1 132 ? -11.527 57.698 13.742 1.00 31.79  ? 191 SER D N     1 
ATOM   9157  C  CA    . SER D 1 132 ? -10.925 57.941 15.048 1.00 31.79  ? 191 SER D CA    1 
ATOM   9158  C  C     . SER D 1 132 ? -10.474 59.382 15.108 1.00 31.79  ? 191 SER D C     1 
ATOM   9159  O  O     . SER D 1 132 ? -9.803  59.876 14.209 1.00 33.10  ? 191 SER D O     1 
ATOM   9160  C  CB    . SER D 1 132 ? -9.722  57.033 15.306 1.00 33.10  ? 191 SER D CB    1 
ATOM   9161  O  OG    . SER D 1 132 ? -9.112  57.314 16.560 1.00 33.10  ? 191 SER D OG    1 
ATOM   9162  H  H     . SER D 1 132 ? -10.946 57.719 12.977 1.00 0.00   ? 191 SER D H     1 
ATOM   9163  H  HG    . SER D 1 132 ? -8.515  56.582 16.766 1.00 30.00  ? 191 SER D HG    1 
ATOM   9164  N  N     . VAL D 1 133 ? -10.858 60.051 16.180 1.00 21.58  ? 192 VAL D N     1 
ATOM   9165  C  CA    . VAL D 1 133 ? -10.497 61.425 16.404 1.00 21.58  ? 192 VAL D CA    1 
ATOM   9166  C  C     . VAL D 1 133 ? -8.992  61.544 16.334 1.00 21.58  ? 192 VAL D C     1 
ATOM   9167  O  O     . VAL D 1 133 ? -8.480  62.351 15.571 1.00 36.19  ? 192 VAL D O     1 
ATOM   9168  C  CB    . VAL D 1 133 ? -10.944 61.874 17.780 1.00 36.19  ? 192 VAL D CB    1 
ATOM   9169  C  CG1   . VAL D 1 133 ? -10.881 63.390 17.876 1.00 36.19  ? 192 VAL D CG1   1 
ATOM   9170  C  CG2   . VAL D 1 133 ? -12.339 61.342 18.070 1.00 36.19  ? 192 VAL D CG2   1 
ATOM   9171  H  H     . VAL D 1 133 ? -11.402 59.552 16.818 1.00 0.00   ? 192 VAL D H     1 
ATOM   9172  N  N     . SER D 1 134 ? -8.284  60.707 17.099 1.00 2.00   ? 193 SER D N     1 
ATOM   9173  C  CA    . SER D 1 134 ? -6.822  60.727 17.117 1.00 2.00   ? 193 SER D CA    1 
ATOM   9174  C  C     . SER D 1 134 ? -6.238  60.630 15.713 1.00 2.00   ? 193 SER D C     1 
ATOM   9175  O  O     . SER D 1 134 ? -5.360  61.391 15.334 1.00 19.43  ? 193 SER D O     1 
ATOM   9176  C  CB    . SER D 1 134 ? -6.316  59.617 18.004 1.00 19.43  ? 193 SER D CB    1 
ATOM   9177  O  OG    . SER D 1 134 ? -6.752  59.871 19.337 1.00 19.43  ? 193 SER D OG    1 
ATOM   9178  H  H     . SER D 1 134 ? -8.735  60.051 17.666 1.00 0.00   ? 193 SER D H     1 
ATOM   9179  H  HG    . SER D 1 134 ? -6.424  60.720 19.652 1.00 30.00  ? 193 SER D HG    1 
ATOM   9180  N  N     . ALA D 1 135 ? -6.786  59.733 14.921 1.00 15.19  ? 194 ALA D N     1 
ATOM   9181  C  CA    . ALA D 1 135 ? -6.360  59.564 13.546 1.00 15.19  ? 194 ALA D CA    1 
ATOM   9182  C  C     . ALA D 1 135 ? -6.514  60.917 12.906 1.00 15.19  ? 194 ALA D C     1 
ATOM   9183  O  O     . ALA D 1 135 ? -5.543  61.476 12.400 1.00 60.47  ? 194 ALA D O     1 
ATOM   9184  C  CB    . ALA D 1 135 ? -7.257  58.561 12.827 1.00 60.47  ? 194 ALA D CB    1 
ATOM   9185  H  H     . ALA D 1 135 ? -7.524  59.189 15.256 1.00 0.00   ? 194 ALA D H     1 
ATOM   9186  N  N     . ARG D 1 136 ? -7.720  61.469 12.976 1.00 22.18  ? 195 ARG D N     1 
ATOM   9187  C  CA    . ARG D 1 136 ? -7.979  62.768 12.377 1.00 22.18  ? 195 ARG D CA    1 
ATOM   9188  C  C     . ARG D 1 136 ? -7.037  63.860 12.878 1.00 22.18  ? 195 ARG D C     1 
ATOM   9189  O  O     . ARG D 1 136 ? -6.474  64.606 12.080 1.00 27.33  ? 195 ARG D O     1 
ATOM   9190  C  CB    . ARG D 1 136 ? -9.436  63.161 12.563 1.00 27.33  ? 195 ARG D CB    1 
ATOM   9191  C  CG    . ARG D 1 136 ? -10.383 62.199 11.861 1.00 27.33  ? 195 ARG D CG    1 
ATOM   9192  C  CD    . ARG D 1 136 ? -11.750 62.810 11.563 1.00 27.33  ? 195 ARG D CD    1 
ATOM   9193  N  NE    . ARG D 1 136 ? -12.429 63.255 12.781 1.00 27.33  ? 195 ARG D NE    1 
ATOM   9194  C  CZ    . ARG D 1 136 ? -12.985 62.446 13.683 1.00 27.33  ? 195 ARG D CZ    1 
ATOM   9195  N  NH1   . ARG D 1 136 ? -12.967 61.124 13.523 1.00 27.33  ? 195 ARG D NH1   1 
ATOM   9196  N  NH2   . ARG D 1 136 ? -13.527 62.972 14.775 1.00 27.33  ? 195 ARG D NH2   1 
ATOM   9197  H  H     . ARG D 1 136 ? -8.439  60.999 13.443 1.00 0.00   ? 195 ARG D H     1 
ATOM   9198  H  HE    . ARG D 1 136 ? -12.496 64.219 12.945 1.00 0.00   ? 195 ARG D HE    1 
ATOM   9199  H  HH11  . ARG D 1 136 ? -12.535 60.720 12.717 1.00 0.00   ? 195 ARG D HH11  1 
ATOM   9200  H  HH12  . ARG D 1 136 ? -13.394 60.531 14.206 1.00 0.00   ? 195 ARG D HH12  1 
ATOM   9201  H  HH21  . ARG D 1 136 ? -13.516 63.960 14.923 1.00 0.00   ? 195 ARG D HH21  1 
ATOM   9202  H  HH22  . ARG D 1 136 ? -13.932 62.372 15.462 1.00 0.00   ? 195 ARG D HH22  1 
ATOM   9203  N  N     . LEU D 1 137 ? -6.741  63.835 14.174 1.00 14.94  ? 196 LEU D N     1 
ATOM   9204  C  CA    . LEU D 1 137 ? -5.888  64.824 14.792 1.00 14.94  ? 196 LEU D CA    1 
ATOM   9205  C  C     . LEU D 1 137 ? -4.476  64.803 14.236 1.00 14.94  ? 196 LEU D C     1 
ATOM   9206  O  O     . LEU D 1 137 ? -3.932  65.863 13.873 1.00 21.41  ? 196 LEU D O     1 
ATOM   9207  C  CB    . LEU D 1 137 ? -5.914  64.663 16.316 1.00 21.41  ? 196 LEU D CB    1 
ATOM   9208  C  CG    . LEU D 1 137 ? -7.196  65.186 16.987 1.00 21.41  ? 196 LEU D CG    1 
ATOM   9209  C  CD1   . LEU D 1 137 ? -7.164  65.015 18.474 1.00 21.41  ? 196 LEU D CD1   1 
ATOM   9210  C  CD2   . LEU D 1 137 ? -7.348  66.629 16.691 1.00 21.41  ? 196 LEU D CD2   1 
ATOM   9211  H  H     . LEU D 1 137 ? -7.086  63.100 14.705 1.00 0.00   ? 196 LEU D H     1 
ATOM   9212  N  N     . ARG D 1 138 ? -3.861  63.618 14.221 1.00 11.04  ? 197 ARG D N     1 
ATOM   9213  C  CA    . ARG D 1 138 ? -2.513  63.418 13.673 1.00 11.04  ? 197 ARG D CA    1 
ATOM   9214  C  C     . ARG D 1 138 ? -2.516  63.707 12.146 1.00 11.04  ? 197 ARG D C     1 
ATOM   9215  O  O     . ARG D 1 138 ? -1.622  64.351 11.614 1.00 19.29  ? 197 ARG D O     1 
ATOM   9216  C  CB    . ARG D 1 138 ? -2.075  61.989 13.951 1.00 19.29  ? 197 ARG D CB    1 
ATOM   9217  C  CG    . ARG D 1 138 ? -2.199  61.579 15.409 1.00 19.29  ? 197 ARG D CG    1 
ATOM   9218  C  CD    . ARG D 1 138 ? -1.890  60.105 15.608 1.00 19.29  ? 197 ARG D CD    1 
ATOM   9219  N  NE    . ARG D 1 138 ? -2.085  59.698 17.005 1.00 19.29  ? 197 ARG D NE    1 
ATOM   9220  C  CZ    . ARG D 1 138 ? -1.920  58.464 17.480 1.00 19.29  ? 197 ARG D CZ    1 
ATOM   9221  N  NH1   . ARG D 1 138 ? -1.548  57.483 16.678 1.00 19.29  ? 197 ARG D NH1   1 
ATOM   9222  N  NH2   . ARG D 1 138 ? -2.139  58.213 18.760 1.00 19.29  ? 197 ARG D NH2   1 
ATOM   9223  H  H     . ARG D 1 138 ? -4.351  62.842 14.567 1.00 0.00   ? 197 ARG D H     1 
ATOM   9224  H  HE    . ARG D 1 138 ? -2.359  60.395 17.633 1.00 0.00   ? 197 ARG D HE    1 
ATOM   9225  H  HH11  . ARG D 1 138 ? -1.392  57.662 15.706 1.00 0.00   ? 197 ARG D HH11  1 
ATOM   9226  H  HH12  . ARG D 1 138 ? -1.422  56.560 17.042 1.00 0.00   ? 197 ARG D HH12  1 
ATOM   9227  H  HH21  . ARG D 1 138 ? -2.442  58.951 19.364 1.00 0.00   ? 197 ARG D HH21  1 
ATOM   9228  H  HH22  . ARG D 1 138 ? -2.013  57.301 19.130 1.00 0.00   ? 197 ARG D HH22  1 
ATOM   9229  N  N     . LEU D 1 139 ? -3.555  63.285 11.448 1.00 2.00   ? 198 LEU D N     1 
ATOM   9230  C  CA    . LEU D 1 139 ? -3.644  63.531 10.000 1.00 2.00   ? 198 LEU D CA    1 
ATOM   9231  C  C     . LEU D 1 139 ? -3.667  65.014 9.687  1.00 2.00   ? 198 LEU D C     1 
ATOM   9232  O  O     . LEU D 1 139 ? -2.871  65.496 8.861  1.00 24.34  ? 198 LEU D O     1 
ATOM   9233  C  CB    . LEU D 1 139 ? -4.896  62.889 9.391  1.00 24.34  ? 198 LEU D CB    1 
ATOM   9234  C  CG    . LEU D 1 139 ? -5.010  62.833 7.860  1.00 24.34  ? 198 LEU D CG    1 
ATOM   9235  C  CD1   . LEU D 1 139 ? -5.946  63.879 7.329  1.00 24.34  ? 198 LEU D CD1   1 
ATOM   9236  C  CD2   . LEU D 1 139 ? -3.651  62.933 7.234  1.00 24.34  ? 198 LEU D CD2   1 
ATOM   9237  H  H     . LEU D 1 139 ? -4.270  62.794 11.905 1.00 0.00   ? 198 LEU D H     1 
ATOM   9238  N  N     . ALA D 1 140 ? -4.592  65.730 10.330 1.00 33.40  ? 199 ALA D N     1 
ATOM   9239  C  CA    . ALA D 1 140 ? -4.749  67.167 10.137 1.00 33.40  ? 199 ALA D CA    1 
ATOM   9240  C  C     . ALA D 1 140 ? -3.490  67.890 10.562 1.00 33.40  ? 199 ALA D C     1 
ATOM   9241  O  O     . ALA D 1 140 ? -3.167  68.955 10.054 1.00 44.80  ? 199 ALA D O     1 
ATOM   9242  C  CB    . ALA D 1 140 ? -5.932  67.673 10.925 1.00 44.80  ? 199 ALA D CB    1 
ATOM   9243  H  H     . ALA D 1 140 ? -5.159  65.267 10.973 1.00 0.00   ? 199 ALA D H     1 
ATOM   9244  N  N     . GLY D 1 141 ? -2.753  67.278 11.469 1.00 16.54  ? 200 GLY D N     1 
ATOM   9245  C  CA    . GLY D 1 141 ? -1.528  67.869 11.962 1.00 16.54  ? 200 GLY D CA    1 
ATOM   9246  C  C     . GLY D 1 141 ? -0.383  67.735 10.988 1.00 16.54  ? 200 GLY D C     1 
ATOM   9247  O  O     . GLY D 1 141 ? 0.426   68.662 10.875 1.00 44.94  ? 200 GLY D O     1 
ATOM   9248  H  H     . GLY D 1 141 ? -3.055  66.420 11.844 1.00 0.00   ? 200 GLY D H     1 
ATOM   9249  N  N     . TRP D 1 142 ? -0.270  66.607 10.291 1.00 31.05  ? 201 TRP D N     1 
ATOM   9250  C  CA    . TRP D 1 142 ? 0.837   66.494 9.341  1.00 31.05  ? 201 TRP D CA    1 
ATOM   9251  C  C     . TRP D 1 142 ? 0.595   67.532 8.280  1.00 31.05  ? 201 TRP D C     1 
ATOM   9252  O  O     . TRP D 1 142 ? 1.518   68.109 7.790  1.00 2.00   ? 201 TRP D O     1 
ATOM   9253  C  CB    . TRP D 1 142 ? 0.979   65.098 8.713  1.00 2.00   ? 201 TRP D CB    1 
ATOM   9254  C  CG    . TRP D 1 142 ? 1.344   64.006 9.681  1.00 2.00   ? 201 TRP D CG    1 
ATOM   9255  C  CD1   . TRP D 1 142 ? 2.256   64.071 10.678 1.00 2.00   ? 201 TRP D CD1   1 
ATOM   9256  C  CD2   . TRP D 1 142 ? 0.815   62.678 9.712  1.00 2.00   ? 201 TRP D CD2   1 
ATOM   9257  N  NE1   . TRP D 1 142 ? 2.341   62.864 11.336 1.00 2.00   ? 201 TRP D NE1   1 
ATOM   9258  C  CE2   . TRP D 1 142 ? 1.458   61.992 10.765 1.00 2.00   ? 201 TRP D CE2   1 
ATOM   9259  C  CE3   . TRP D 1 142 ? -0.142  62.001 8.952  1.00 2.00   ? 201 TRP D CE3   1 
ATOM   9260  C  CZ2   . TRP D 1 142 ? 1.175   60.640 11.067 1.00 2.00   ? 201 TRP D CZ2   1 
ATOM   9261  C  CZ3   . TRP D 1 142 ? -0.428  60.662 9.254  1.00 2.00   ? 201 TRP D CZ3   1 
ATOM   9262  C  CH2   . TRP D 1 142 ? 0.232   59.995 10.305 1.00 2.00   ? 201 TRP D CH2   1 
ATOM   9263  H  H     . TRP D 1 142 ? -0.909  65.873 10.438 1.00 0.00   ? 201 TRP D H     1 
ATOM   9264  H  HE1   . TRP D 1 142 ? 2.917   62.675 12.114 1.00 0.00   ? 201 TRP D HE1   1 
ATOM   9265  N  N     . HIS D 1 143 ? -0.663  67.796 7.961  1.00 22.78  ? 202 HIS D N     1 
ATOM   9266  C  CA    . HIS D 1 143 ? -1.026  68.815 6.971  1.00 22.78  ? 202 HIS D CA    1 
ATOM   9267  C  C     . HIS D 1 143 ? -0.593  70.203 7.401  1.00 22.78  ? 202 HIS D C     1 
ATOM   9268  O  O     . HIS D 1 143 ? 0.000   70.932 6.623  1.00 37.46  ? 202 HIS D O     1 
ATOM   9269  C  CB    . HIS D 1 143 ? -2.524  68.855 6.769  1.00 37.46  ? 202 HIS D CB    1 
ATOM   9270  C  CG    . HIS D 1 143 ? -3.034  67.770 5.891  1.00 37.46  ? 202 HIS D CG    1 
ATOM   9271  N  ND1   . HIS D 1 143 ? -4.040  66.911 6.276  1.00 37.46  ? 202 HIS D ND1   1 
ATOM   9272  C  CD2   . HIS D 1 143 ? -2.674  67.399 4.639  1.00 37.46  ? 202 HIS D CD2   1 
ATOM   9273  C  CE1   . HIS D 1 143 ? -4.278  66.057 5.296  1.00 37.46  ? 202 HIS D CE1   1 
ATOM   9274  N  NE2   . HIS D 1 143 ? -3.461  66.331 4.292  1.00 37.46  ? 202 HIS D NE2   1 
ATOM   9275  H  H     . HIS D 1 143 ? -1.347  67.251 8.406  1.00 0.00   ? 202 HIS D H     1 
ATOM   9276  H  HD1   . HIS D 1 143 ? -4.503  66.913 7.141  1.00 0.00   ? 202 HIS D HD1   1 
ATOM   9277  H  HE2   . HIS D 1 143 ? -3.409  65.842 3.448  1.00 0.00   ? 202 HIS D HE2   1 
ATOM   9278  N  N     . LYS D 1 144 ? -0.902  70.572 8.640  1.00 16.52  ? 203 LYS D N     1 
ATOM   9279  C  CA    . LYS D 1 144 ? -0.540  71.885 9.156  1.00 16.52  ? 203 LYS D CA    1 
ATOM   9280  C  C     . LYS D 1 144 ? 0.957   72.058 8.980  1.00 16.52  ? 203 LYS D C     1 
ATOM   9281  O  O     . LYS D 1 144 ? 1.402   72.928 8.254  1.00 33.22  ? 203 LYS D O     1 
ATOM   9282  C  CB    . LYS D 1 144 ? -0.919  71.991 10.636 1.00 33.22  ? 203 LYS D CB    1 
ATOM   9283  C  CG    . LYS D 1 144 ? -0.825  73.392 11.259 1.00 33.22  ? 203 LYS D CG    1 
ATOM   9284  C  CD    . LYS D 1 144 ? -0.586  73.317 12.781 1.00 33.22  ? 203 LYS D CD    1 
ATOM   9285  C  CE    . LYS D 1 144 ? -0.856  74.623 13.516 1.00 33.22  ? 203 LYS D CE    1 
ATOM   9286  N  NZ    . LYS D 1 144 ? -2.294  74.821 13.917 1.00 33.22  ? 203 LYS D NZ    1 
ATOM   9287  H  H     . LYS D 1 144 ? -1.371  69.934 9.224  1.00 0.00   ? 203 LYS D H     1 
ATOM   9288  H  HZ1   . LYS D 1 144 ? -2.885  74.810 13.062 1.00 0.00   ? 203 LYS D HZ1   1 
ATOM   9289  H  HZ2   . LYS D 1 144 ? -2.582  74.051 14.556 1.00 0.00   ? 203 LYS D HZ2   1 
ATOM   9290  H  HZ3   . LYS D 1 144 ? -2.401  75.735 14.407 1.00 0.00   ? 203 LYS D HZ3   1 
ATOM   9291  N  N     . TYR D 1 145 ? 1.740   71.159 9.551  1.00 24.11  ? 204 TYR D N     1 
ATOM   9292  C  CA    . TYR D 1 145 ? 3.183   71.285 9.462  1.00 24.11  ? 204 TYR D CA    1 
ATOM   9293  C  C     . TYR D 1 145 ? 3.824   70.984 8.118  1.00 24.11  ? 204 TYR D C     1 
ATOM   9294  O  O     . TYR D 1 145 ? 4.944   71.421 7.860  1.00 23.13  ? 204 TYR D O     1 
ATOM   9295  C  CB    . TYR D 1 145 ? 3.838   70.510 10.582 1.00 23.13  ? 204 TYR D CB    1 
ATOM   9296  C  CG    . TYR D 1 145 ? 3.390   71.029 11.915 1.00 23.13  ? 204 TYR D CG    1 
ATOM   9297  C  CD1   . TYR D 1 145 ? 4.051   72.089 12.530 1.00 23.13  ? 204 TYR D CD1   1 
ATOM   9298  C  CD2   . TYR D 1 145 ? 2.262   70.511 12.534 1.00 23.13  ? 204 TYR D CD2   1 
ATOM   9299  C  CE1   . TYR D 1 145 ? 3.591   72.615 13.707 1.00 23.13  ? 204 TYR D CE1   1 
ATOM   9300  C  CE2   . TYR D 1 145 ? 1.801   71.032 13.719 1.00 23.13  ? 204 TYR D CE2   1 
ATOM   9301  C  CZ    . TYR D 1 145 ? 2.467   72.082 14.298 1.00 23.13  ? 204 TYR D CZ    1 
ATOM   9302  O  OH    . TYR D 1 145 ? 1.992   72.612 15.478 1.00 23.13  ? 204 TYR D OH    1 
ATOM   9303  H  H     . TYR D 1 145 ? 1.338   70.389 10.012 1.00 0.00   ? 204 TYR D H     1 
ATOM   9304  H  HH    . TYR D 1 145 ? 2.553   73.334 15.769 1.00 0.00   ? 204 TYR D HH    1 
ATOM   9305  N  N     . LEU D 1 146 ? 3.159   70.221 7.264  1.00 18.60  ? 205 LEU D N     1 
ATOM   9306  C  CA    . LEU D 1 146 ? 3.738   69.951 5.971  1.00 18.60  ? 205 LEU D CA    1 
ATOM   9307  C  C     . LEU D 1 146 ? 3.543   71.258 5.219  1.00 18.60  ? 205 LEU D C     1 
ATOM   9308  O  O     . LEU D 1 146 ? 4.511   71.905 4.833  1.00 24.64  ? 205 LEU D O     1 
ATOM   9309  C  CB    . LEU D 1 146 ? 3.029   68.784 5.272  1.00 24.64  ? 205 LEU D CB    1 
ATOM   9310  C  CG    . LEU D 1 146 ? 3.643   67.388 5.463  1.00 24.64  ? 205 LEU D CG    1 
ATOM   9311  C  CD1   . LEU D 1 146 ? 2.818   66.325 4.761  1.00 24.64  ? 205 LEU D CD1   1 
ATOM   9312  C  CD2   . LEU D 1 146 ? 5.063   67.371 4.931  1.00 24.64  ? 205 LEU D CD2   1 
ATOM   9313  H  H     . LEU D 1 146 ? 2.294   69.837 7.500  1.00 0.00   ? 205 LEU D H     1 
ATOM   9314  N  N     . THR D 1 147 ? 2.296   71.712 5.149  1.00 20.39  ? 206 THR D N     1 
ATOM   9315  C  CA    . THR D 1 147 ? 1.959   72.937 4.454  1.00 20.39  ? 206 THR D CA    1 
ATOM   9316  C  C     . THR D 1 147 ? 2.880   74.097 4.814  1.00 20.39  ? 206 THR D C     1 
ATOM   9317  O  O     . THR D 1 147 ? 3.415   74.765 3.930  1.00 68.27  ? 206 THR D O     1 
ATOM   9318  C  CB    . THR D 1 147 ? 0.492   73.367 4.690  1.00 68.27  ? 206 THR D CB    1 
ATOM   9319  O  OG1   . THR D 1 147 ? 0.268   73.535 6.086  1.00 68.27  ? 206 THR D OG1   1 
ATOM   9320  C  CG2   . THR D 1 147 ? -0.485  72.334 4.158  1.00 68.27  ? 206 THR D CG2   1 
ATOM   9321  H  H     . THR D 1 147 ? 1.573   71.213 5.575  1.00 0.00   ? 206 THR D H     1 
ATOM   9322  H  HG1   . THR D 1 147 ? 0.453   72.721 6.557  1.00 30.00  ? 206 THR D HG1   1 
ATOM   9323  N  N     . ARG D 1 148 ? 3.141   74.299 6.095  1.00 19.55  ? 207 ARG D N     1 
ATOM   9324  C  CA    . ARG D 1 148 ? 3.998   75.409 6.468  1.00 19.55  ? 207 ARG D CA    1 
ATOM   9325  C  C     . ARG D 1 148 ? 5.499   75.201 6.199  1.00 19.55  ? 207 ARG D C     1 
ATOM   9326  O  O     . ARG D 1 148 ? 6.349   76.017 6.568  1.00 32.09  ? 207 ARG D O     1 
ATOM   9327  C  CB    . ARG D 1 148 ? 3.704   75.852 7.900  1.00 32.09  ? 207 ARG D CB    1 
ATOM   9328  C  CG    . ARG D 1 148 ? 3.836   74.818 8.962  1.00 32.09  ? 207 ARG D CG    1 
ATOM   9329  C  CD    . ARG D 1 148 ? 4.105   75.514 10.292 1.00 32.09  ? 207 ARG D CD    1 
ATOM   9330  N  NE    . ARG D 1 148 ? 2.923   76.143 10.894 1.00 32.09  ? 207 ARG D NE    1 
ATOM   9331  C  CZ    . ARG D 1 148 ? 2.843   76.477 12.182 1.00 32.09  ? 207 ARG D CZ    1 
ATOM   9332  N  NH1   . ARG D 1 148 ? 3.888   76.268 12.986 1.00 32.09  ? 207 ARG D NH1   1 
ATOM   9333  N  NH2   . ARG D 1 148 ? 1.682   76.863 12.702 1.00 32.09  ? 207 ARG D NH2   1 
ATOM   9334  H  H     . ARG D 1 148 ? 2.716   73.726 6.768  1.00 0.00   ? 207 ARG D H     1 
ATOM   9335  H  HE    . ARG D 1 148 ? 2.151   76.336 10.322 1.00 0.00   ? 207 ARG D HE    1 
ATOM   9336  H  HH11  . ARG D 1 148 ? 4.732   75.861 12.635 1.00 0.00   ? 207 ARG D HH11  1 
ATOM   9337  H  HH12  . ARG D 1 148 ? 3.827   76.523 13.951 1.00 0.00   ? 207 ARG D HH12  1 
ATOM   9338  H  HH21  . ARG D 1 148 ? 0.867   76.896 12.124 1.00 0.00   ? 207 ARG D HH21  1 
ATOM   9339  H  HH22  . ARG D 1 148 ? 1.621   77.113 13.668 1.00 0.00   ? 207 ARG D HH22  1 
ATOM   9340  N  N     . ASN D 1 149 ? 5.836   74.083 5.582  1.00 2.00   ? 208 ASN D N     1 
ATOM   9341  C  CA    . ASN D 1 149 ? 7.235   73.821 5.225  1.00 2.00   ? 208 ASN D CA    1 
ATOM   9342  C  C     . ASN D 1 149 ? 7.175   73.729 3.722  1.00 2.00   ? 208 ASN D C     1 
ATOM   9343  O  O     . ASN D 1 149 ? 8.049   73.138 3.081  1.00 33.14  ? 208 ASN D O     1 
ATOM   9344  C  CB    . ASN D 1 149 ? 7.726   72.501 5.788  1.00 33.14  ? 208 ASN D CB    1 
ATOM   9345  C  CG    . ASN D 1 149 ? 8.287   72.641 7.173  1.00 33.14  ? 208 ASN D CG    1 
ATOM   9346  O  OD1   . ASN D 1 149 ? 9.510   72.835 7.344  1.00 33.14  ? 208 ASN D OD1   1 
ATOM   9347  N  ND2   . ASN D 1 149 ? 7.418   72.520 8.187  1.00 33.14  ? 208 ASN D ND2   1 
ATOM   9348  H  H     . ASN D 1 149 ? 5.139   73.451 5.385  1.00 0.00   ? 208 ASN D H     1 
ATOM   9349  H  HD21  . ASN D 1 149 ? 7.774   72.602 9.092  1.00 0.00   ? 208 ASN D HD21  1 
ATOM   9350  H  HD22  . ASN D 1 149 ? 6.484   72.359 7.971  1.00 0.00   ? 208 ASN D HD22  1 
ATOM   9351  N  N     . GLN D 1 150 ? 6.100   74.289 3.180  1.00 32.87  ? 209 GLN D N     1 
ATOM   9352  C  CA    . GLN D 1 150 ? 5.859   74.322 1.756  1.00 32.87  ? 209 GLN D CA    1 
ATOM   9353  C  C     . GLN D 1 150 ? 5.819   72.940 1.106  1.00 32.87  ? 209 GLN D C     1 
ATOM   9354  O  O     . GLN D 1 150 ? 6.050   72.799 -0.105 1.00 42.98  ? 209 GLN D O     1 
ATOM   9355  C  CB    . GLN D 1 150 ? 6.861   75.258 1.067  1.00 42.98  ? 209 GLN D CB    1 
ATOM   9356  C  CG    . GLN D 1 150 ? 6.433   76.733 1.013  1.00 42.98  ? 209 GLN D CG    1 
ATOM   9357  C  CD    . GLN D 1 150 ? 6.244   77.376 2.380  1.00 42.98  ? 209 GLN D CD    1 
ATOM   9358  O  OE1   . GLN D 1 150 ? 7.197   77.565 3.134  1.00 42.98  ? 209 GLN D OE1   1 
ATOM   9359  N  NE2   . GLN D 1 150 ? 5.007   77.739 2.693  1.00 42.98  ? 209 GLN D NE2   1 
ATOM   9360  H  H     . GLN D 1 150 ? 5.420   74.713 3.737  1.00 0.00   ? 209 GLN D H     1 
ATOM   9361  N  N     . ILE D 1 151 ? 5.456   71.923 1.892  1.00 39.75  ? 210 ILE D N     1 
ATOM   9362  C  CA    . ILE D 1 151 ? 5.368   70.576 1.328  1.00 39.75  ? 210 ILE D CA    1 
ATOM   9363  C  C     . ILE D 1 151 ? 3.932   70.094 1.197  1.00 39.75  ? 210 ILE D C     1 
ATOM   9364  O  O     . ILE D 1 151 ? 3.066   70.384 2.042  1.00 25.76  ? 210 ILE D O     1 
ATOM   9365  C  CB    . ILE D 1 151 ? 6.239   69.518 2.094  1.00 25.76  ? 210 ILE D CB    1 
ATOM   9366  C  CG1   . ILE D 1 151 ? 7.720   69.858 1.920  1.00 25.76  ? 210 ILE D CG1   1 
ATOM   9367  C  CG2   . ILE D 1 151 ? 5.988   68.095 1.521  1.00 25.76  ? 210 ILE D CG2   1 
ATOM   9368  C  CD1   . ILE D 1 151 ? 8.692   68.959 2.659  1.00 25.76  ? 210 ILE D CD1   1 
ATOM   9369  H  H     . ILE D 1 151 ? 5.232   72.069 2.833  1.00 0.00   ? 210 ILE D H     1 
ATOM   9370  N  N     . GLN D 1 152 ? 3.702   69.372 0.110  1.00 19.41  ? 211 GLN D N     1 
ATOM   9371  C  CA    . GLN D 1 152 ? 2.411   68.786 -0.215 1.00 19.41  ? 211 GLN D CA    1 
ATOM   9372  C  C     . GLN D 1 152 ? 2.700   67.288 -0.367 1.00 19.41  ? 211 GLN D C     1 
ATOM   9373  O  O     . GLN D 1 152 ? 3.637   66.897 -1.066 1.00 75.71  ? 211 GLN D O     1 
ATOM   9374  C  CB    . GLN D 1 152 ? 1.919   69.359 -1.543 1.00 75.71  ? 211 GLN D CB    1 
ATOM   9375  C  CG    . GLN D 1 152 ? 1.963   70.886 -1.631 1.00 75.71  ? 211 GLN D CG    1 
ATOM   9376  C  CD    . GLN D 1 152 ? 0.696   71.548 -1.123 1.00 75.71  ? 211 GLN D CD    1 
ATOM   9377  O  OE1   . GLN D 1 152 ? -0.268  71.725 -1.872 1.00 75.71  ? 211 GLN D OE1   1 
ATOM   9378  N  NE2   . GLN D 1 152 ? 0.694   71.929 0.146  1.00 75.71  ? 211 GLN D NE2   1 
ATOM   9379  H  H     . GLN D 1 152 ? 4.448   69.180 -0.500 1.00 0.00   ? 211 GLN D H     1 
ATOM   9380  N  N     . PRO D 1 153 ? 1.903   66.436 0.291  1.00 44.73  ? 212 PRO D N     1 
ATOM   9381  C  CA    . PRO D 1 153 ? 2.093   64.985 0.223  1.00 44.73  ? 212 PRO D CA    1 
ATOM   9382  C  C     . PRO D 1 153 ? 1.689   64.407 -1.134 1.00 44.73  ? 212 PRO D C     1 
ATOM   9383  O  O     . PRO D 1 153 ? 0.580   64.646 -1.621 1.00 45.17  ? 212 PRO D O     1 
ATOM   9384  C  CB    . PRO D 1 153 ? 1.177   64.462 1.337  1.00 45.17  ? 212 PRO D CB    1 
ATOM   9385  C  CG    . PRO D 1 153 ? 0.798   65.686 2.141  1.00 45.17  ? 212 PRO D CG    1 
ATOM   9386  C  CD    . PRO D 1 153 ? 0.733   66.763 1.118  1.00 45.17  ? 212 PRO D CD    1 
ATOM   9387  N  N     . ILE D 1 154 ? 2.575   63.617 -1.727 1.00 55.98  ? 213 ILE D N     1 
ATOM   9388  C  CA    . ILE D 1 154 ? 2.287   63.018 -3.022 1.00 55.98  ? 213 ILE D CA    1 
ATOM   9389  C  C     . ILE D 1 154 ? 1.169   61.993 -2.913 1.00 55.98  ? 213 ILE D C     1 
ATOM   9390  O  O     . ILE D 1 154 ? 0.482   61.699 -3.914 1.00 27.49  ? 213 ILE D O     1 
ATOM   9391  C  CB    . ILE D 1 154 ? 3.527   62.335 -3.639 1.00 27.49  ? 213 ILE D CB    1 
ATOM   9392  C  CG1   . ILE D 1 154 ? 3.994   61.166 -2.785 1.00 27.49  ? 213 ILE D CG1   1 
ATOM   9393  C  CG2   . ILE D 1 154 ? 4.622   63.341 -3.842 1.00 27.49  ? 213 ILE D CG2   1 
ATOM   9394  C  CD1   . ILE D 1 154 ? 5.116   60.425 -3.421 1.00 27.49  ? 213 ILE D CD1   1 
ATOM   9395  H  H     . ILE D 1 154 ? 3.423   63.453 -1.267 1.00 0.00   ? 213 ILE D H     1 
ATOM   9396  N  N     . ALA D 1 155 ? 0.997   61.469 -1.694 1.00 23.64  ? 214 ALA D N     1 
ATOM   9397  C  CA    . ALA D 1 155 ? -0.001  60.456 -1.385 1.00 23.64  ? 214 ALA D CA    1 
ATOM   9398  C  C     . ALA D 1 155 ? -0.480  60.558 0.056  1.00 23.64  ? 214 ALA D C     1 
ATOM   9399  O  O     . ALA D 1 155 ? 0.288   60.880 0.957  1.00 27.08  ? 214 ALA D O     1 
ATOM   9400  C  CB    . ALA D 1 155 ? 0.568   59.101 -1.625 1.00 27.08  ? 214 ALA D CB    1 
ATOM   9401  H  H     . ALA D 1 155 ? 1.542   61.790 -0.946 1.00 0.00   ? 214 ALA D H     1 
ATOM   9402  N  N     . GLU D 1 156 ? -1.767  60.301 0.251  1.00 14.24  ? 215 GLU D N     1 
ATOM   9403  C  CA    . GLU D 1 156 ? -2.378  60.333 1.564  1.00 14.24  ? 215 GLU D CA    1 
ATOM   9404  C  C     . GLU D 1 156 ? -3.274  59.097 1.563  1.00 14.24  ? 215 GLU D C     1 
ATOM   9405  O  O     . GLU D 1 156 ? -4.141  58.973 0.705  1.00 42.53  ? 215 GLU D O     1 
ATOM   9406  C  CB    . GLU D 1 156 ? -3.201  61.601 1.722  1.00 42.53  ? 215 GLU D CB    1 
ATOM   9407  C  CG    . GLU D 1 156 ? -3.826  61.748 3.074  1.00 42.53  ? 215 GLU D CG    1 
ATOM   9408  C  CD    . GLU D 1 156 ? -5.083  62.562 3.009  1.00 42.53  ? 215 GLU D CD    1 
ATOM   9409  O  OE1   . GLU D 1 156 ? -5.032  63.674 2.458  1.00 42.53  ? 215 GLU D OE1   1 
ATOM   9410  O  OE2   . GLU D 1 156 ? -6.129  62.076 3.480  1.00 42.53  ? 215 GLU D OE2   1 
ATOM   9411  H  H     . GLU D 1 156 ? -2.350  60.073 -0.500 1.00 0.00   ? 215 GLU D H     1 
ATOM   9412  N  N     . ARG D 1 157 ? -3.008  58.155 2.465  1.00 34.65  ? 216 ARG D N     1 
ATOM   9413  C  CA    . ARG D 1 157 ? -3.766  56.911 2.525  1.00 34.65  ? 216 ARG D CA    1 
ATOM   9414  C  C     . ARG D 1 157 ? -4.203  56.586 3.924  1.00 34.65  ? 216 ARG D C     1 
ATOM   9415  O  O     . ARG D 1 157 ? -3.634  57.109 4.871  1.00 39.57  ? 216 ARG D O     1 
ATOM   9416  C  CB    . ARG D 1 157 ? -2.911  55.758 2.001  1.00 39.57  ? 216 ARG D CB    1 
ATOM   9417  C  CG    . ARG D 1 157 ? -2.681  55.820 0.511  1.00 39.57  ? 216 ARG D CG    1 
ATOM   9418  C  CD    . ARG D 1 157 ? -2.316  54.481 -0.050 1.00 39.57  ? 216 ARG D CD    1 
ATOM   9419  N  NE    . ARG D 1 157 ? -2.724  54.392 -1.440 1.00 39.57  ? 216 ARG D NE    1 
ATOM   9420  C  CZ    . ARG D 1 157 ? -3.717  53.629 -1.870 1.00 39.57  ? 216 ARG D CZ    1 
ATOM   9421  N  NH1   . ARG D 1 157 ? -4.402  52.883 -1.020 1.00 39.57  ? 216 ARG D NH1   1 
ATOM   9422  N  NH2   . ARG D 1 157 ? -4.040  53.624 -3.151 1.00 39.57  ? 216 ARG D NH2   1 
ATOM   9423  H  H     . ARG D 1 157 ? -2.321  58.297 3.140  1.00 0.00   ? 216 ARG D H     1 
ATOM   9424  H  HE    . ARG D 1 157 ? -2.231  54.914 -2.107 1.00 0.00   ? 216 ARG D HE    1 
ATOM   9425  H  HH11  . ARG D 1 157 ? -4.172  52.895 -0.048 1.00 0.00   ? 216 ARG D HH11  1 
ATOM   9426  H  HH12  . ARG D 1 157 ? -5.154  52.313 -1.349 1.00 0.00   ? 216 ARG D HH12  1 
ATOM   9427  H  HH21  . ARG D 1 157 ? -3.533  54.194 -3.798 1.00 0.00   ? 216 ARG D HH21  1 
ATOM   9428  H  HH22  . ARG D 1 157 ? -4.792  53.051 -3.478 1.00 0.00   ? 216 ARG D HH22  1 
ATOM   9429  N  N     . GLU D 1 158 ? -5.237  55.711 4.072  1.00 28.14  ? 217 GLU D N     1 
ATOM   9430  C  CA    . GLU D 1 158 ? -5.634  55.428 5.459  1.00 28.14  ? 217 GLU D CA    1 
ATOM   9431  C  C     . GLU D 1 158 ? -5.968  53.942 5.615  1.00 28.14  ? 217 GLU D C     1 
ATOM   9432  O  O     . GLU D 1 158 ? -6.680  53.307 4.876  1.00 50.57  ? 217 GLU D O     1 
ATOM   9433  C  CB    . GLU D 1 158 ? -6.860  56.261 5.832  1.00 50.57  ? 217 GLU D CB    1 
ATOM   9434  C  CG    . GLU D 1 158 ? -6.615  57.766 5.724  1.00 50.57  ? 217 GLU D CG    1 
ATOM   9435  C  CD    . GLU D 1 158 ? -7.844  58.599 6.093  1.00 50.57  ? 217 GLU D CD    1 
ATOM   9436  O  OE1   . GLU D 1 158 ? -8.937  58.012 6.448  1.00 50.57  ? 217 GLU D OE1   1 
ATOM   9437  O  OE2   . GLU D 1 158 ? -7.788  59.887 6.050  1.00 50.57  ? 217 GLU D OE2   1 
ATOM   9438  N  N     . GLY D 1 159 ? -5.409  53.403 6.725  1.00 17.06  ? 218 GLY D N     1 
ATOM   9439  C  CA    . GLY D 1 159 ? -5.662  52.026 7.079  1.00 17.06  ? 218 GLY D CA    1 
ATOM   9440  C  C     . GLY D 1 159 ? -6.636  51.868 8.225  1.00 17.06  ? 218 GLY D C     1 
ATOM   9441  O  O     . GLY D 1 159 ? -7.681  52.516 8.252  1.00 57.58  ? 218 GLY D O     1 
ATOM   9442  H  H     . GLY D 1 159 ? -4.825  53.962 7.279  1.00 0.00   ? 218 GLY D H     1 
ATOM   9443  N  N     . ASP D 1 160 ? -6.302  50.990 9.170  1.00 12.77  ? 219 ASP D N     1 
ATOM   9444  C  CA    . ASP D 1 160 ? -7.174  50.750 10.312 1.00 12.77  ? 219 ASP D CA    1 
ATOM   9445  C  C     . ASP D 1 160 ? -6.463  50.366 11.610 1.00 12.77  ? 219 ASP D C     1 
ATOM   9446  O  O     . ASP D 1 160 ? -7.050  49.706 12.467 1.00 27.38  ? 219 ASP D O     1 
ATOM   9447  C  CB    . ASP D 1 160 ? -8.232  49.711 9.953  1.00 27.38  ? 219 ASP D CB    1 
ATOM   9448  C  CG    . ASP D 1 160 ? -7.643  48.350 9.650  1.00 27.38  ? 219 ASP D CG    1 
ATOM   9449  O  OD1   . ASP D 1 160 ? -6.409  48.192 9.752  1.00 27.38  ? 219 ASP D OD1   1 
ATOM   9450  O  OD2   . ASP D 1 160 ? -8.420  47.424 9.318  1.00 27.38  ? 219 ASP D OD2   1 
ATOM   9451  H  H     . ASP D 1 160 ? -5.459  50.494 9.081  1.00 0.00   ? 219 ASP D H     1 
ATOM   9452  N  N     . TRP D 1 161 ? -5.201  50.790 11.723 1.00 18.81  ? 220 TRP D N     1 
ATOM   9453  C  CA    . TRP D 1 161 ? -4.315  50.588 12.893 1.00 18.81  ? 220 TRP D CA    1 
ATOM   9454  C  C     . TRP D 1 161 ? -3.499  49.312 12.894 1.00 18.81  ? 220 TRP D C     1 
ATOM   9455  O  O     . TRP D 1 161 ? -2.582  49.155 13.694 1.00 40.63  ? 220 TRP D O     1 
ATOM   9456  C  CB    . TRP D 1 161 ? -5.078  50.693 14.223 1.00 40.63  ? 220 TRP D CB    1 
ATOM   9457  C  CG    . TRP D 1 161 ? -5.731  52.019 14.508 1.00 40.63  ? 220 TRP D CG    1 
ATOM   9458  C  CD1   . TRP D 1 161 ? -7.029  52.218 14.849 1.00 40.63  ? 220 TRP D CD1   1 
ATOM   9459  C  CD2   . TRP D 1 161 ? -5.108  53.314 14.526 1.00 40.63  ? 220 TRP D CD2   1 
ATOM   9460  N  NE1   . TRP D 1 161 ? -7.259  53.546 15.083 1.00 40.63  ? 220 TRP D NE1   1 
ATOM   9461  C  CE2   . TRP D 1 161 ? -6.097  54.243 14.893 1.00 40.63  ? 220 TRP D CE2   1 
ATOM   9462  C  CE3   . TRP D 1 161 ? -3.813  53.776 14.272 1.00 40.63  ? 220 TRP D CE3   1 
ATOM   9463  C  CZ2   . TRP D 1 161 ? -5.836  55.608 15.014 1.00 40.63  ? 220 TRP D CZ2   1 
ATOM   9464  C  CZ3   . TRP D 1 161 ? -3.556  55.132 14.391 1.00 40.63  ? 220 TRP D CZ3   1 
ATOM   9465  C  CH2   . TRP D 1 161 ? -4.563  56.031 14.760 1.00 40.63  ? 220 TRP D CH2   1 
ATOM   9466  H  H     . TRP D 1 161 ? -4.826  51.281 10.968 1.00 0.00   ? 220 TRP D H     1 
ATOM   9467  H  HE1   . TRP D 1 161 ? -8.135  53.901 15.355 1.00 0.00   ? 220 TRP D HE1   1 
ATOM   9468  N  N     . SER D 1 162 ? -3.800  48.429 11.954 1.00 2.00   ? 221 SER D N     1 
ATOM   9469  C  CA    . SER D 1 162 ? -3.119  47.156 11.893 1.00 2.00   ? 221 SER D CA    1 
ATOM   9470  C  C     . SER D 1 162 ? -1.980  47.128 10.906 1.00 2.00   ? 221 SER D C     1 
ATOM   9471  O  O     . SER D 1 162 ? -1.927  47.923 9.961  1.00 22.24  ? 221 SER D O     1 
ATOM   9472  C  CB    . SER D 1 162 ? -4.118  46.059 11.541 1.00 22.24  ? 221 SER D CB    1 
ATOM   9473  O  OG    . SER D 1 162 ? -4.793  46.352 10.330 1.00 22.24  ? 221 SER D OG    1 
ATOM   9474  H  H     . SER D 1 162 ? -4.494  48.618 11.300 1.00 0.00   ? 221 SER D H     1 
ATOM   9475  H  HG    . SER D 1 162 ? -5.629  45.862 10.316 1.00 30.00  ? 221 SER D HG    1 
ATOM   9476  N  N     . ALA D 1 163 ? -1.112  46.134 11.100 1.00 20.92  ? 222 ALA D N     1 
ATOM   9477  C  CA    . ALA D 1 163 ? 0.063   45.919 10.267 1.00 20.92  ? 222 ALA D CA    1 
ATOM   9478  C  C     . ALA D 1 163 ? -0.332  45.470 8.861  1.00 20.92  ? 222 ALA D C     1 
ATOM   9479  O  O     . ALA D 1 163 ? 0.334   45.806 7.891  1.00 9.75   ? 222 ALA D O     1 
ATOM   9480  C  CB    . ALA D 1 163 ? 0.967   44.915 10.911 1.00 9.75   ? 222 ALA D CB    1 
ATOM   9481  H  H     . ALA D 1 163 ? -1.252  45.520 11.847 1.00 0.00   ? 222 ALA D H     1 
ATOM   9482  N  N     . MET D 1 164 ? -1.422  44.721 8.743  1.00 2.00   ? 223 MET D N     1 
ATOM   9483  C  CA    . MET D 1 164 ? -1.813  44.285 7.429  1.00 2.00   ? 223 MET D CA    1 
ATOM   9484  C  C     . MET D 1 164 ? -2.211  45.508 6.644  1.00 2.00   ? 223 MET D C     1 
ATOM   9485  O  O     . MET D 1 164 ? -1.691  45.709 5.562  1.00 27.12  ? 223 MET D O     1 
ATOM   9486  C  CB    . MET D 1 164 ? -2.914  43.238 7.482  1.00 27.12  ? 223 MET D CB    1 
ATOM   9487  C  CG    . MET D 1 164 ? -3.150  42.500 6.167  1.00 27.12  ? 223 MET D CG    1 
ATOM   9488  S  SD    . MET D 1 164 ? -1.729  41.591 5.487  1.00 27.12  ? 223 MET D SD    1 
ATOM   9489  C  CE    . MET D 1 164 ? -1.707  40.152 6.581  1.00 27.12  ? 223 MET D CE    1 
ATOM   9490  H  H     . MET D 1 164 ? -1.954  44.460 9.517  1.00 0.00   ? 223 MET D H     1 
ATOM   9491  N  N     . SER D 1 165 ? -2.992  46.410 7.237  1.00 30.52  ? 224 SER D N     1 
ATOM   9492  C  CA    . SER D 1 165 ? -3.422  47.624 6.517  1.00 30.52  ? 224 SER D CA    1 
ATOM   9493  C  C     . SER D 1 165 ? -2.255  48.483 6.034  1.00 30.52  ? 224 SER D C     1 
ATOM   9494  O  O     . SER D 1 165 ? -2.297  49.063 4.942  1.00 21.63  ? 224 SER D O     1 
ATOM   9495  C  CB    . SER D 1 165 ? -4.355  48.476 7.364  1.00 21.63  ? 224 SER D CB    1 
ATOM   9496  O  OG    . SER D 1 165 ? -3.626  49.150 8.360  1.00 21.63  ? 224 SER D OG    1 
ATOM   9497  H  H     . SER D 1 165 ? -3.299  46.270 8.149  1.00 0.00   ? 224 SER D H     1 
ATOM   9498  H  HG    . SER D 1 165 ? -3.261  48.504 8.961  1.00 30.00  ? 224 SER D HG    1 
ATOM   9499  N  N     . GLY D 1 166 ? -1.219  48.566 6.849  1.00 9.29   ? 225 GLY D N     1 
ATOM   9500  C  CA    . GLY D 1 166 ? -0.058  49.332 6.453  1.00 9.29   ? 225 GLY D CA    1 
ATOM   9501  C  C     . GLY D 1 166 ? 0.487   48.666 5.208  1.00 9.29   ? 225 GLY D C     1 
ATOM   9502  O  O     . GLY D 1 166 ? 0.793   49.324 4.222  1.00 34.29  ? 225 GLY D O     1 
ATOM   9503  H  H     . GLY D 1 166 ? -1.259  48.129 7.721  1.00 0.00   ? 225 GLY D H     1 
ATOM   9504  N  N     . PHE D 1 167 ? 0.578   47.345 5.245  1.00 18.43  ? 226 PHE D N     1 
ATOM   9505  C  CA    . PHE D 1 167 ? 1.049   46.583 4.106  1.00 18.43  ? 226 PHE D CA    1 
ATOM   9506  C  C     . PHE D 1 167 ? 0.114   46.786 2.904  1.00 18.43  ? 226 PHE D C     1 
ATOM   9507  O  O     . PHE D 1 167 ? 0.516   47.385 1.933  1.00 6.75   ? 226 PHE D O     1 
ATOM   9508  C  CB    . PHE D 1 167 ? 1.168   45.092 4.454  1.00 6.75   ? 226 PHE D CB    1 
ATOM   9509  C  CG    . PHE D 1 167 ? 1.651   44.235 3.304  1.00 6.75   ? 226 PHE D CG    1 
ATOM   9510  C  CD1   . PHE D 1 167 ? 3.009   44.064 3.068  1.00 6.75   ? 226 PHE D CD1   1 
ATOM   9511  C  CD2   . PHE D 1 167 ? 0.759   43.628 2.442  1.00 6.75   ? 226 PHE D CD2   1 
ATOM   9512  C  CE1   . PHE D 1 167 ? 3.457   43.294 1.989  1.00 6.75   ? 226 PHE D CE1   1 
ATOM   9513  C  CE2   . PHE D 1 167 ? 1.207   42.869 1.371  1.00 6.75   ? 226 PHE D CE2   1 
ATOM   9514  C  CZ    . PHE D 1 167 ? 2.569   42.707 1.149  1.00 6.75   ? 226 PHE D CZ    1 
ATOM   9515  H  H     . PHE D 1 167 ? 0.313   46.880 6.071  1.00 0.00   ? 226 PHE D H     1 
ATOM   9516  N  N     . GLN D 1 168 ? -1.132  46.331 2.949  1.00 12.48  ? 227 GLN D N     1 
ATOM   9517  C  CA    . GLN D 1 168 ? -2.008  46.496 1.790  1.00 12.48  ? 227 GLN D CA    1 
ATOM   9518  C  C     . GLN D 1 168 ? -2.120  47.935 1.230  1.00 12.48  ? 227 GLN D C     1 
ATOM   9519  O  O     . GLN D 1 168 ? -2.366  48.106 0.042  1.00 53.97  ? 227 GLN D O     1 
ATOM   9520  C  CB    . GLN D 1 168 ? -3.394  45.909 2.059  1.00 53.97  ? 227 GLN D CB    1 
ATOM   9521  C  CG    . GLN D 1 168 ? -4.312  46.837 2.805  1.00 53.97  ? 227 GLN D CG    1 
ATOM   9522  C  CD    . GLN D 1 168 ? -5.654  46.194 3.157  1.00 53.97  ? 227 GLN D CD    1 
ATOM   9523  O  OE1   . GLN D 1 168 ? -5.847  45.687 4.272  1.00 53.97  ? 227 GLN D OE1   1 
ATOM   9524  N  NE2   . GLN D 1 168 ? -6.597  46.236 2.217  1.00 53.97  ? 227 GLN D NE2   1 
ATOM   9525  H  H     . GLN D 1 168 ? -1.473  45.887 3.747  1.00 0.00   ? 227 GLN D H     1 
ATOM   9526  N  N     . GLN D 1 169 ? -1.976  48.959 2.066  1.00 30.36  ? 228 GLN D N     1 
ATOM   9527  C  CA    . GLN D 1 169 ? -2.062  50.346 1.584  1.00 30.36  ? 228 GLN D CA    1 
ATOM   9528  C  C     . GLN D 1 169 ? -0.805  50.748 0.838  1.00 30.36  ? 228 GLN D C     1 
ATOM   9529  O  O     . GLN D 1 169 ? -0.872  51.232 -0.288 1.00 30.27  ? 228 GLN D O     1 
ATOM   9530  C  CB    . GLN D 1 169 ? -2.290  51.327 2.736  1.00 30.27  ? 228 GLN D CB    1 
ATOM   9531  C  CG    . GLN D 1 169 ? -3.654  51.238 3.382  1.00 30.27  ? 228 GLN D CG    1 
ATOM   9532  C  CD    . GLN D 1 169 ? -4.764  51.513 2.411  1.00 30.27  ? 228 GLN D CD    1 
ATOM   9533  O  OE1   . GLN D 1 169 ? -5.496  50.613 2.024  1.00 30.27  ? 228 GLN D OE1   1 
ATOM   9534  N  NE2   . GLN D 1 169 ? -4.892  52.758 1.998  1.00 30.27  ? 228 GLN D NE2   1 
ATOM   9535  H  H     . GLN D 1 169 ? -1.815  48.793 3.020  1.00 0.00   ? 228 GLN D H     1 
ATOM   9536  N  N     . THR D 1 170 ? 0.340   50.585 1.496  1.00 17.96  ? 229 THR D N     1 
ATOM   9537  C  CA    . THR D 1 170 ? 1.642   50.888 0.899  1.00 17.96  ? 229 THR D CA    1 
ATOM   9538  C  C     . THR D 1 170 ? 1.758   50.139 -0.438 1.00 17.96  ? 229 THR D C     1 
ATOM   9539  O  O     . THR D 1 170 ? 1.914   50.746 -1.487 1.00 2.00   ? 229 THR D O     1 
ATOM   9540  C  CB    . THR D 1 170 ? 2.774   50.470 1.849  1.00 2.00   ? 229 THR D CB    1 
ATOM   9541  O  OG1   . THR D 1 170 ? 2.531   51.059 3.129  1.00 2.00   ? 229 THR D OG1   1 
ATOM   9542  C  CG2   . THR D 1 170 ? 4.101   50.959 1.369  1.00 2.00   ? 229 THR D CG2   1 
ATOM   9543  H  H     . THR D 1 170 ? 0.330   50.226 2.404  1.00 0.00   ? 229 THR D H     1 
ATOM   9544  H  HG1   . THR D 1 170 ? 1.780   50.685 3.579  1.00 30.00  ? 229 THR D HG1   1 
ATOM   9545  N  N     . MET D 1 171 ? 1.560   48.829 -0.407 1.00 16.00  ? 230 MET D N     1 
ATOM   9546  C  CA    . MET D 1 171 ? 1.635   47.999 -1.595 1.00 16.00  ? 230 MET D CA    1 
ATOM   9547  C  C     . MET D 1 171 ? 0.847   48.619 -2.750 1.00 16.00  ? 230 MET D C     1 
ATOM   9548  O  O     . MET D 1 171 ? 1.445   48.974 -3.766 1.00 19.52  ? 230 MET D O     1 
ATOM   9549  C  CB    . MET D 1 171 ? 1.147   46.583 -1.272 1.00 19.52  ? 230 MET D CB    1 
ATOM   9550  C  CG    . MET D 1 171 ? 1.846   45.485 -2.049 1.00 19.52  ? 230 MET D CG    1 
ATOM   9551  S  SD    . MET D 1 171 ? 3.615   45.372 -1.752 1.00 19.52  ? 230 MET D SD    1 
ATOM   9552  C  CE    . MET D 1 171 ? 4.256   45.915 -3.293 1.00 19.52  ? 230 MET D CE    1 
ATOM   9553  H  H     . MET D 1 171 ? 1.360   48.410 0.452  1.00 0.00   ? 230 MET D H     1 
ATOM   9554  N  N     . GLN D 1 172 ? -0.456  48.862 -2.566 1.00 17.28  ? 231 GLN D N     1 
ATOM   9555  C  CA    . GLN D 1 172 ? -1.291  49.427 -3.651 1.00 17.28  ? 231 GLN D CA    1 
ATOM   9556  C  C     . GLN D 1 172 ? -0.980  50.870 -4.022 1.00 17.28  ? 231 GLN D C     1 
ATOM   9557  O  O     . GLN D 1 172 ? -1.360  51.355 -5.072 1.00 39.39  ? 231 GLN D O     1 
ATOM   9558  C  CB    . GLN D 1 172 ? -2.787  49.208 -3.407 1.00 39.39  ? 231 GLN D CB    1 
ATOM   9559  C  CG    . GLN D 1 172 ? -3.334  49.770 -2.123 1.00 39.39  ? 231 GLN D CG    1 
ATOM   9560  C  CD    . GLN D 1 172 ? -4.779  49.342 -1.877 1.00 39.39  ? 231 GLN D CD    1 
ATOM   9561  O  OE1   . GLN D 1 172 ? -5.602  49.345 -2.787 1.00 39.39  ? 231 GLN D OE1   1 
ATOM   9562  N  NE2   . GLN D 1 172 ? -5.085  48.958 -0.644 1.00 39.39  ? 231 GLN D NE2   1 
ATOM   9563  H  H     . GLN D 1 172 ? -0.887  48.673 -1.709 1.00 0.00   ? 231 GLN D H     1 
ATOM   9564  N  N     . MET D 1 173 ? -0.219  51.517 -3.160 1.00 9.40   ? 232 MET D N     1 
ATOM   9565  C  CA    . MET D 1 173 ? 0.209   52.876 -3.358 1.00 9.40   ? 232 MET D CA    1 
ATOM   9566  C  C     . MET D 1 173 ? 1.343   52.767 -4.359 1.00 9.40   ? 232 MET D C     1 
ATOM   9567  O  O     . MET D 1 173 ? 1.297   53.363 -5.422 1.00 24.76  ? 232 MET D O     1 
ATOM   9568  C  CB    . MET D 1 173 ? 0.714   53.434 -2.012 1.00 24.76  ? 232 MET D CB    1 
ATOM   9569  C  CG    . MET D 1 173 ? 1.140   54.902 -1.989 1.00 24.76  ? 232 MET D CG    1 
ATOM   9570  S  SD    . MET D 1 173 ? 2.577   55.096 -0.914 1.00 24.76  ? 232 MET D SD    1 
ATOM   9571  C  CE    . MET D 1 173 ? 2.789   56.686 -1.051 1.00 24.76  ? 232 MET D CE    1 
ATOM   9572  H  H     . MET D 1 173 ? 0.044   51.076 -2.327 1.00 0.00   ? 232 MET D H     1 
ATOM   9573  N  N     . LEU D 1 174 ? 2.331   51.940 -4.034 1.00 21.46  ? 233 LEU D N     1 
ATOM   9574  C  CA    . LEU D 1 174 ? 3.505   51.756 -4.883 1.00 21.46  ? 233 LEU D CA    1 
ATOM   9575  C  C     . LEU D 1 174 ? 3.122   51.188 -6.231 1.00 21.46  ? 233 LEU D C     1 
ATOM   9576  O  O     . LEU D 1 174 ? 3.606   51.601 -7.257 1.00 18.02  ? 233 LEU D O     1 
ATOM   9577  C  CB    . LEU D 1 174 ? 4.516   50.824 -4.214 1.00 18.02  ? 233 LEU D CB    1 
ATOM   9578  C  CG    . LEU D 1 174 ? 5.097   51.104 -2.827 1.00 18.02  ? 233 LEU D CG    1 
ATOM   9579  C  CD1   . LEU D 1 174 ? 6.161   50.088 -2.573 1.00 18.02  ? 233 LEU D CD1   1 
ATOM   9580  C  CD2   . LEU D 1 174 ? 5.694   52.479 -2.741 1.00 18.02  ? 233 LEU D CD2   1 
ATOM   9581  H  H     . LEU D 1 174 ? 2.273   51.457 -3.187 1.00 0.00   ? 233 LEU D H     1 
ATOM   9582  N  N     . ASN D 1 175 ? 2.225   50.231 -6.204 1.00 13.24  ? 234 ASN D N     1 
ATOM   9583  C  CA    . ASN D 1 175 ? 1.746   49.587 -7.405 1.00 13.24  ? 234 ASN D CA    1 
ATOM   9584  C  C     . ASN D 1 175 ? 0.869   50.534 -8.224 1.00 13.24  ? 234 ASN D C     1 
ATOM   9585  O  O     . ASN D 1 175 ? 0.306   50.129 -9.241 1.00 47.64  ? 234 ASN D O     1 
ATOM   9586  C  CB    . ASN D 1 175 ? 0.954   48.319 -7.042 1.00 47.64  ? 234 ASN D CB    1 
ATOM   9587  C  CG    . ASN D 1 175 ? 1.834   47.194 -6.496 1.00 47.64  ? 234 ASN D CG    1 
ATOM   9588  O  OD1   . ASN D 1 175 ? 1.328   46.179 -6.027 1.00 47.64  ? 234 ASN D OD1   1 
ATOM   9589  N  ND2   . ASN D 1 175 ? 3.148   47.358 -6.578 1.00 47.64  ? 234 ASN D ND2   1 
ATOM   9590  H  H     . ASN D 1 175 ? 1.857   49.960 -5.335 1.00 0.00   ? 234 ASN D H     1 
ATOM   9591  H  HD21  . ASN D 1 175 ? 3.667   46.617 -6.208 1.00 0.00   ? 234 ASN D HD21  1 
ATOM   9592  H  HD22  . ASN D 1 175 ? 3.564   48.148 -6.970 1.00 0.00   ? 234 ASN D HD22  1 
ATOM   9593  N  N     . GLU D 1 176 ? 0.679   51.760 -7.727 1.00 19.51  ? 235 GLU D N     1 
ATOM   9594  C  CA    . GLU D 1 176 ? -0.118  52.786 -8.427 1.00 19.51  ? 235 GLU D CA    1 
ATOM   9595  C  C     . GLU D 1 176 ? 0.841   53.779 -9.044 1.00 19.51  ? 235 GLU D C     1 
ATOM   9596  O  O     . GLU D 1 176 ? 0.418   54.751 -9.647 1.00 23.65  ? 235 GLU D O     1 
ATOM   9597  C  CB    . GLU D 1 176 ? -1.063  53.527 -7.474 1.00 23.65  ? 235 GLU D CB    1 
ATOM   9598  C  CG    . GLU D 1 176 ? -2.478  52.977 -7.469 1.00 23.65  ? 235 GLU D CG    1 
ATOM   9599  C  CD    . GLU D 1 176 ? -3.309  53.443 -6.287 1.00 23.65  ? 235 GLU D CD    1 
ATOM   9600  O  OE1   . GLU D 1 176 ? -2.992  54.509 -5.714 1.00 23.65  ? 235 GLU D OE1   1 
ATOM   9601  O  OE2   . GLU D 1 176 ? -4.285  52.740 -5.935 1.00 23.65  ? 235 GLU D OE2   1 
ATOM   9602  H  H     . GLU D 1 176 ? 1.028   52.015 -6.851 1.00 0.00   ? 235 GLU D H     1 
ATOM   9603  N  N     . GLY D 1 177 ? 2.132   53.539 -8.833 1.00 8.96   ? 236 GLY D N     1 
ATOM   9604  C  CA    . GLY D 1 177 ? 3.164   54.385 -9.384 1.00 8.96   ? 236 GLY D CA    1 
ATOM   9605  C  C     . GLY D 1 177 ? 3.609   55.462 -8.429 1.00 8.96   ? 236 GLY D C     1 
ATOM   9606  O  O     . GLY D 1 177 ? 4.542   56.209 -8.734 1.00 40.14  ? 236 GLY D O     1 
ATOM   9607  H  H     . GLY D 1 177 ? 2.415   52.760 -8.309 1.00 0.00   ? 236 GLY D H     1 
ATOM   9608  N  N     . ILE D 1 178 ? 2.936   55.574 -7.287 1.00 23.97  ? 237 ILE D N     1 
ATOM   9609  C  CA    . ILE D 1 178 ? 3.299   56.587 -6.308 1.00 23.97  ? 237 ILE D CA    1 
ATOM   9610  C  C     . ILE D 1 178 ? 4.318   56.036 -5.321 1.00 23.97  ? 237 ILE D C     1 
ATOM   9611  O  O     . ILE D 1 178 ? 3.996   55.253 -4.433 1.00 33.57  ? 237 ILE D O     1 
ATOM   9612  C  CB    . ILE D 1 178 ? 2.086   57.097 -5.557 1.00 33.57  ? 237 ILE D CB    1 
ATOM   9613  C  CG1   . ILE D 1 178 ? 1.091   57.694 -6.536 1.00 33.57  ? 237 ILE D CG1   1 
ATOM   9614  C  CG2   . ILE D 1 178 ? 2.511   58.158 -4.560 1.00 33.57  ? 237 ILE D CG2   1 
ATOM   9615  C  CD1   . ILE D 1 178 ? -0.183  58.079 -5.886 1.00 33.57  ? 237 ILE D CD1   1 
ATOM   9616  H  H     . ILE D 1 178 ? 2.205   54.960 -7.068 1.00 0.00   ? 237 ILE D H     1 
ATOM   9617  N  N     . VAL D 1 179 ? 5.555   56.467 -5.473 1.00 20.77  ? 238 VAL D N     1 
ATOM   9618  C  CA    . VAL D 1 179 ? 6.616   55.998 -4.623 1.00 20.77  ? 238 VAL D CA    1 
ATOM   9619  C  C     . VAL D 1 179 ? 7.268   57.211 -3.980 1.00 20.77  ? 238 VAL D C     1 
ATOM   9620  O  O     . VAL D 1 179 ? 7.941   58.013 -4.637 1.00 32.17  ? 238 VAL D O     1 
ATOM   9621  C  CB    . VAL D 1 179 ? 7.628   55.083 -5.418 1.00 32.17  ? 238 VAL D CB    1 
ATOM   9622  C  CG1   . VAL D 1 179 ? 7.454   55.243 -6.906 1.00 32.17  ? 238 VAL D CG1   1 
ATOM   9623  C  CG2   . VAL D 1 179 ? 9.065   55.386 -5.044 1.00 32.17  ? 238 VAL D CG2   1 
ATOM   9624  H  H     . VAL D 1 179 ? 5.783   57.139 -6.153 1.00 0.00   ? 238 VAL D H     1 
ATOM   9625  N  N     . PRO D 1 180 ? 7.062   57.367 -2.674 1.00 15.40  ? 239 PRO D N     1 
ATOM   9626  C  CA    . PRO D 1 180 ? 7.607   58.479 -1.917 1.00 15.40  ? 239 PRO D CA    1 
ATOM   9627  C  C     . PRO D 1 180 ? 9.012   58.170 -1.487 1.00 15.40  ? 239 PRO D C     1 
ATOM   9628  O  O     . PRO D 1 180 ? 9.494   57.061 -1.728 1.00 33.31  ? 239 PRO D O     1 
ATOM   9629  C  CB    . PRO D 1 180 ? 6.688   58.499 -0.714 1.00 33.31  ? 239 PRO D CB    1 
ATOM   9630  C  CG    . PRO D 1 180 ? 6.540   57.056 -0.435 1.00 33.31  ? 239 PRO D CG    1 
ATOM   9631  C  CD    . PRO D 1 180 ? 6.333   56.445 -1.793 1.00 33.31  ? 239 PRO D CD    1 
ATOM   9632  N  N     . THR D 1 181 ? 9.672   59.149 -0.863 1.00 30.81  ? 240 THR D N     1 
ATOM   9633  C  CA    . THR D 1 181 ? 11.018  58.933 -0.340 1.00 30.81  ? 240 THR D CA    1 
ATOM   9634  C  C     . THR D 1 181 ? 10.934  58.817 1.199  1.00 30.81  ? 240 THR D C     1 
ATOM   9635  O  O     . THR D 1 181 ? 11.894  58.441 1.865  1.00 28.92  ? 240 THR D O     1 
ATOM   9636  C  CB    . THR D 1 181 ? 12.021  60.046 -0.743 1.00 28.92  ? 240 THR D CB    1 
ATOM   9637  O  OG1   . THR D 1 181 ? 11.575  61.310 -0.247 1.00 28.92  ? 240 THR D OG1   1 
ATOM   9638  C  CG2   . THR D 1 181 ? 12.192  60.107 -2.241 1.00 28.92  ? 240 THR D CG2   1 
ATOM   9639  H  H     . THR D 1 181 ? 9.260   60.024 -0.759 1.00 0.00   ? 240 THR D H     1 
ATOM   9640  H  HG1   . THR D 1 181 ? 10.785  61.561 -0.749 1.00 30.00  ? 240 THR D HG1   1 
ATOM   9641  N  N     . ALA D 1 182 ? 9.774   59.130 1.762  1.00 10.40  ? 241 ALA D N     1 
ATOM   9642  C  CA    . ALA D 1 182 ? 9.565   59.038 3.196  1.00 10.40  ? 241 ALA D CA    1 
ATOM   9643  C  C     . ALA D 1 182 ? 8.077   58.822 3.454  1.00 10.40  ? 241 ALA D C     1 
ATOM   9644  O  O     . ALA D 1 182 ? 7.224   59.147 2.620  1.00 18.42  ? 241 ALA D O     1 
ATOM   9645  C  CB    . ALA D 1 182 ? 10.033  60.296 3.864  1.00 18.42  ? 241 ALA D CB    1 
ATOM   9646  H  H     . ALA D 1 182 ? 8.996   59.399 1.221  1.00 0.00   ? 241 ALA D H     1 
ATOM   9647  N  N     . MET D 1 183 ? 7.754   58.227 4.584  1.00 9.61   ? 242 MET D N     1 
ATOM   9648  C  CA    . MET D 1 183 ? 6.348   58.003 4.928  1.00 9.61   ? 242 MET D CA    1 
ATOM   9649  C  C     . MET D 1 183 ? 6.160   58.343 6.362  1.00 9.61   ? 242 MET D C     1 
ATOM   9650  O  O     . MET D 1 183 ? 7.059   58.140 7.189  1.00 20.62  ? 242 MET D O     1 
ATOM   9651  C  CB    . MET D 1 183 ? 5.901   56.553 4.720  1.00 20.62  ? 242 MET D CB    1 
ATOM   9652  C  CG    . MET D 1 183 ? 5.701   56.147 3.277  1.00 20.62  ? 242 MET D CG    1 
ATOM   9653  S  SD    . MET D 1 183 ? 4.760   54.643 3.110  1.00 20.62  ? 242 MET D SD    1 
ATOM   9654  C  CE    . MET D 1 183 ? 6.075   53.595 2.916  1.00 20.62  ? 242 MET D CE    1 
ATOM   9655  H  H     . MET D 1 183 ? 8.435   57.960 5.231  1.00 0.00   ? 242 MET D H     1 
ATOM   9656  N  N     . LEU D 1 184 ? 5.008   58.940 6.621  1.00 18.19  ? 243 LEU D N     1 
ATOM   9657  C  CA    . LEU D 1 184 ? 4.593   59.341 7.945  1.00 18.19  ? 243 LEU D CA    1 
ATOM   9658  C  C     . LEU D 1 184 ? 3.410   58.441 8.232  1.00 18.19  ? 243 LEU D C     1 
ATOM   9659  O  O     . LEU D 1 184 ? 2.391   58.507 7.528  1.00 2.00   ? 243 LEU D O     1 
ATOM   9660  C  CB    . LEU D 1 184 ? 4.179   60.800 7.934  1.00 2.00   ? 243 LEU D CB    1 
ATOM   9661  C  CG    . LEU D 1 184 ? 5.348   61.772 8.137  1.00 2.00   ? 243 LEU D CG    1 
ATOM   9662  C  CD1   . LEU D 1 184 ? 4.904   63.200 7.820  1.00 2.00   ? 243 LEU D CD1   1 
ATOM   9663  C  CD2   . LEU D 1 184 ? 5.816   61.667 9.584  1.00 2.00   ? 243 LEU D CD2   1 
ATOM   9664  H  H     . LEU D 1 184 ? 4.376   59.121 5.878  1.00 0.00   ? 243 LEU D H     1 
ATOM   9665  N  N     . VAL D 1 185 ? 3.544   57.600 9.249  1.00 19.78  ? 244 VAL D N     1 
ATOM   9666  C  CA    . VAL D 1 185 ? 2.514   56.644 9.571  1.00 19.78  ? 244 VAL D CA    1 
ATOM   9667  C  C     . VAL D 1 185 ? 1.830   56.919 10.909 1.00 19.78  ? 244 VAL D C     1 
ATOM   9668  O  O     . VAL D 1 185 ? 2.482   57.318 11.883 1.00 22.25  ? 244 VAL D O     1 
ATOM   9669  C  CB    . VAL D 1 185 ? 3.123   55.245 9.536  1.00 22.25  ? 244 VAL D CB    1 
ATOM   9670  C  CG1   . VAL D 1 185 ? 2.046   54.189 9.573  1.00 22.25  ? 244 VAL D CG1   1 
ATOM   9671  C  CG2   . VAL D 1 185 ? 4.013   55.105 8.296  1.00 22.25  ? 244 VAL D CG2   1 
ATOM   9672  H  H     . VAL D 1 185 ? 4.337   57.656 9.813  1.00 0.00   ? 244 VAL D H     1 
ATOM   9673  N  N     . ALA D 1 186 ? 0.512   56.713 10.929 1.00 15.40  ? 245 ALA D N     1 
ATOM   9674  C  CA    . ALA D 1 186 ? -0.346  56.926 12.095 1.00 15.40  ? 245 ALA D CA    1 
ATOM   9675  C  C     . ALA D 1 186 ? -0.029  56.103 13.355 1.00 15.40  ? 245 ALA D C     1 
ATOM   9676  O  O     . ALA D 1 186 ? -0.446  56.479 14.463 1.00 11.21  ? 245 ALA D O     1 
ATOM   9677  C  CB    . ALA D 1 186 ? -1.821  56.754 11.710 1.00 11.21  ? 245 ALA D CB    1 
ATOM   9678  H  H     . ALA D 1 186 ? 0.102   56.413 10.094 1.00 0.00   ? 245 ALA D H     1 
ATOM   9679  N  N     . ASN D 1 187 ? 0.647   54.966 13.196 1.00 9.00   ? 246 ASN D N     1 
ATOM   9680  C  CA    . ASN D 1 187 ? 1.019   54.154 14.346 1.00 9.00   ? 246 ASN D CA    1 
ATOM   9681  C  C     . ASN D 1 187 ? 2.126   53.173 13.976 1.00 9.00   ? 246 ASN D C     1 
ATOM   9682  O  O     . ASN D 1 187 ? 2.402   52.943 12.794 1.00 27.06  ? 246 ASN D O     1 
ATOM   9683  C  CB    . ASN D 1 187 ? -0.196  53.447 14.968 1.00 27.06  ? 246 ASN D CB    1 
ATOM   9684  C  CG    . ASN D 1 187 ? -0.571  52.151 14.268 1.00 27.06  ? 246 ASN D CG    1 
ATOM   9685  O  OD1   . ASN D 1 187 ? -0.296  51.955 13.087 1.00 27.06  ? 246 ASN D OD1   1 
ATOM   9686  N  ND2   . ASN D 1 187 ? -1.217  51.264 14.994 1.00 27.06  ? 246 ASN D ND2   1 
ATOM   9687  H  H     . ASN D 1 187 ? 0.910   54.658 12.304 1.00 0.00   ? 246 ASN D H     1 
ATOM   9688  H  HD21  . ASN D 1 187 ? -1.470  50.403 14.598 1.00 0.00   ? 246 ASN D HD21  1 
ATOM   9689  H  HD22  . ASN D 1 187 ? -1.428  51.505 15.924 1.00 0.00   ? 246 ASN D HD22  1 
ATOM   9690  N  N     . ASP D 1 188 ? 2.788   52.641 15.001 1.00 21.01  ? 247 ASP D N     1 
ATOM   9691  C  CA    . ASP D 1 188 ? 3.875   51.695 14.824 1.00 21.01  ? 247 ASP D CA    1 
ATOM   9692  C  C     . ASP D 1 188 ? 3.530   50.398 14.130 1.00 21.01  ? 247 ASP D C     1 
ATOM   9693  O  O     . ASP D 1 188 ? 4.381   49.796 13.466 1.00 18.60  ? 247 ASP D O     1 
ATOM   9694  C  CB    . ASP D 1 188 ? 4.517   51.399 16.152 1.00 18.60  ? 247 ASP D CB    1 
ATOM   9695  C  CG    . ASP D 1 188 ? 5.393   52.518 16.613 1.00 18.60  ? 247 ASP D CG    1 
ATOM   9696  O  OD1   . ASP D 1 188 ? 5.367   53.591 15.982 1.00 18.60  ? 247 ASP D OD1   1 
ATOM   9697  O  OD2   . ASP D 1 188 ? 6.108   52.361 17.607 1.00 18.60  ? 247 ASP D OD2   1 
ATOM   9698  H  H     . ASP D 1 188 ? 2.548   52.938 15.908 1.00 0.00   ? 247 ASP D H     1 
ATOM   9699  N  N     . GLN D 1 189 ? 2.300   49.938 14.288 1.00 26.57  ? 248 GLN D N     1 
ATOM   9700  C  CA    . GLN D 1 189 ? 1.913   48.704 13.637 1.00 26.57  ? 248 GLN D CA    1 
ATOM   9701  C  C     . GLN D 1 189 ? 1.820   48.917 12.156 1.00 26.57  ? 248 GLN D C     1 
ATOM   9702  O  O     . GLN D 1 189 ? 2.365   48.135 11.393 1.00 26.37  ? 248 GLN D O     1 
ATOM   9703  C  CB    . GLN D 1 189 ? 0.615   48.155 14.198 1.00 26.37  ? 248 GLN D CB    1 
ATOM   9704  C  CG    . GLN D 1 189 ? 0.842   47.452 15.474 1.00 26.37  ? 248 GLN D CG    1 
ATOM   9705  C  CD    . GLN D 1 189 ? -0.388  46.825 15.973 1.00 26.37  ? 248 GLN D CD    1 
ATOM   9706  O  OE1   . GLN D 1 189 ? -1.029  47.352 16.871 1.00 26.37  ? 248 GLN D OE1   1 
ATOM   9707  N  NE2   . GLN D 1 189 ? -0.723  45.661 15.439 1.00 26.37  ? 248 GLN D NE2   1 
ATOM   9708  H  H     . GLN D 1 189 ? 1.657   50.419 14.839 1.00 0.00   ? 248 GLN D H     1 
ATOM   9709  N  N     . MET D 1 190 ? 1.153   49.979 11.741 1.00 27.82  ? 249 MET D N     1 
ATOM   9710  C  CA    . MET D 1 190 ? 1.052   50.266 10.323 1.00 27.82  ? 249 MET D CA    1 
ATOM   9711  C  C     . MET D 1 190 ? 2.443   50.594 9.767  1.00 27.82  ? 249 MET D C     1 
ATOM   9712  O  O     . MET D 1 190 ? 2.694   50.410 8.584  1.00 2.00   ? 249 MET D O     1 
ATOM   9713  C  CB    . MET D 1 190 ? 0.127   51.452 10.090 1.00 2.00   ? 249 MET D CB    1 
ATOM   9714  C  CG    . MET D 1 190 ? -1.291  51.197 10.469 1.00 2.00   ? 249 MET D CG    1 
ATOM   9715  S  SD    . MET D 1 190 ? -2.200  52.612 9.990  1.00 2.00   ? 249 MET D SD    1 
ATOM   9716  C  CE    . MET D 1 190 ? -2.976  51.889 8.602  1.00 2.00   ? 249 MET D CE    1 
ATOM   9717  H  H     . MET D 1 190 ? 0.711   50.578 12.366 1.00 0.00   ? 249 MET D H     1 
ATOM   9718  N  N     . ALA D 1 191 ? 3.325   51.129 10.610 1.00 8.80   ? 250 ALA D N     1 
ATOM   9719  C  CA    . ALA D 1 191 ? 4.676   51.445 10.177 1.00 8.80   ? 250 ALA D CA    1 
ATOM   9720  C  C     . ALA D 1 191 ? 5.288   50.117 9.764  1.00 8.80   ? 250 ALA D C     1 
ATOM   9721  O  O     . ALA D 1 191 ? 5.861   50.020 8.685  1.00 37.39  ? 250 ALA D O     1 
ATOM   9722  C  CB    . ALA D 1 191 ? 5.474   52.087 11.304 1.00 37.39  ? 250 ALA D CB    1 
ATOM   9723  H  H     . ALA D 1 191 ? 3.045   51.336 11.527 1.00 0.00   ? 250 ALA D H     1 
ATOM   9724  N  N     . LEU D 1 192 ? 5.140   49.083 10.594 1.00 18.14  ? 251 LEU D N     1 
ATOM   9725  C  CA    . LEU D 1 192 ? 5.665   47.752 10.281 1.00 18.14  ? 251 LEU D CA    1 
ATOM   9726  C  C     . LEU D 1 192 ? 5.098   47.220 8.961  1.00 18.14  ? 251 LEU D C     1 
ATOM   9727  O  O     . LEU D 1 192 ? 5.822   46.700 8.125  1.00 12.53  ? 251 LEU D O     1 
ATOM   9728  C  CB    . LEU D 1 192 ? 5.296   46.762 11.399 1.00 12.53  ? 251 LEU D CB    1 
ATOM   9729  C  CG    . LEU D 1 192 ? 5.483   45.264 11.109 1.00 12.53  ? 251 LEU D CG    1 
ATOM   9730  C  CD1   . LEU D 1 192 ? 6.942   44.956 11.002 1.00 12.53  ? 251 LEU D CD1   1 
ATOM   9731  C  CD2   . LEU D 1 192 ? 4.860   44.408 12.162 1.00 12.53  ? 251 LEU D CD2   1 
ATOM   9732  H  H     . LEU D 1 192 ? 4.669   49.210 11.453 1.00 0.00   ? 251 LEU D H     1 
ATOM   9733  N  N     . GLY D 1 193 ? 3.787   47.329 8.769  1.00 2.00   ? 252 GLY D N     1 
ATOM   9734  C  CA    . GLY D 1 193 ? 3.201   46.794 7.553  1.00 2.00   ? 252 GLY D CA    1 
ATOM   9735  C  C     . GLY D 1 193 ? 3.778   47.505 6.348  1.00 2.00   ? 252 GLY D C     1 
ATOM   9736  O  O     . GLY D 1 193 ? 3.904   46.908 5.279  1.00 29.76  ? 252 GLY D O     1 
ATOM   9737  H  H     . GLY D 1 193 ? 3.224   47.740 9.457  1.00 0.00   ? 252 GLY D H     1 
ATOM   9738  N  N     . ALA D 1 194 ? 4.077   48.793 6.531  1.00 27.92  ? 253 ALA D N     1 
ATOM   9739  C  CA    . ALA D 1 194 ? 4.648   49.656 5.499  1.00 27.92  ? 253 ALA D CA    1 
ATOM   9740  C  C     . ALA D 1 194 ? 6.083   49.253 5.171  1.00 27.92  ? 253 ALA D C     1 
ATOM   9741  O  O     . ALA D 1 194 ? 6.427   49.151 4.004  1.00 16.78  ? 253 ALA D O     1 
ATOM   9742  C  CB    . ALA D 1 194 ? 4.598   51.088 5.940  1.00 16.78  ? 253 ALA D CB    1 
ATOM   9743  H  H     . ALA D 1 194 ? 3.878   49.182 7.408  1.00 0.00   ? 253 ALA D H     1 
ATOM   9744  N  N     . MET D 1 195 ? 6.910   49.008 6.190  1.00 10.58  ? 254 MET D N     1 
ATOM   9745  C  CA    . MET D 1 195 ? 8.297   48.613 5.990  1.00 10.58  ? 254 MET D CA    1 
ATOM   9746  C  C     . MET D 1 195 ? 8.279   47.315 5.214  1.00 10.58  ? 254 MET D C     1 
ATOM   9747  O  O     . MET D 1 195 ? 9.036   47.115 4.244  1.00 2.00   ? 254 MET D O     1 
ATOM   9748  C  CB    . MET D 1 195 ? 8.962   48.340 7.310  1.00 2.00   ? 254 MET D CB    1 
ATOM   9749  C  CG    . MET D 1 195 ? 8.798   49.408 8.329  1.00 2.00   ? 254 MET D CG    1 
ATOM   9750  S  SD    . MET D 1 195 ? 10.104  49.231 9.529  1.00 2.00   ? 254 MET D SD    1 
ATOM   9751  C  CE    . MET D 1 195 ? 9.224   48.491 10.791 1.00 2.00   ? 254 MET D CE    1 
ATOM   9752  H  H     . MET D 1 195 ? 6.545   49.111 7.098  1.00 0.00   ? 254 MET D H     1 
ATOM   9753  N  N     . ARG D 1 196 ? 7.414   46.424 5.682  1.00 22.50  ? 255 ARG D N     1 
ATOM   9754  C  CA    . ARG D 1 196 ? 7.175   45.123 5.092  1.00 22.50  ? 255 ARG D CA    1 
ATOM   9755  C  C     . ARG D 1 196 ? 6.941   45.253 3.586  1.00 22.50  ? 255 ARG D C     1 
ATOM   9756  O  O     . ARG D 1 196 ? 7.548   44.521 2.799  1.00 29.17  ? 255 ARG D O     1 
ATOM   9757  C  CB    . ARG D 1 196 ? 5.942   44.536 5.766  1.00 29.17  ? 255 ARG D CB    1 
ATOM   9758  C  CG    . ARG D 1 196 ? 5.320   43.416 5.051  1.00 29.17  ? 255 ARG D CG    1 
ATOM   9759  C  CD    . ARG D 1 196 ? 6.103   42.171 5.214  1.00 29.17  ? 255 ARG D CD    1 
ATOM   9760  N  NE    . ARG D 1 196 ? 5.469   41.101 4.466  1.00 29.17  ? 255 ARG D NE    1 
ATOM   9761  C  CZ    . ARG D 1 196 ? 6.101   40.346 3.590  1.00 29.17  ? 255 ARG D CZ    1 
ATOM   9762  N  NH1   . ARG D 1 196 ? 7.394   40.541 3.370  1.00 29.17  ? 255 ARG D NH1   1 
ATOM   9763  N  NH2   . ARG D 1 196 ? 5.423   39.460 2.883  1.00 29.17  ? 255 ARG D NH2   1 
ATOM   9764  H  H     . ARG D 1 196 ? 6.899   46.665 6.480  1.00 0.00   ? 255 ARG D H     1 
ATOM   9765  H  HE    . ARG D 1 196 ? 4.516   40.927 4.621  1.00 0.00   ? 255 ARG D HE    1 
ATOM   9766  H  HH11  . ARG D 1 196 ? 7.882   41.257 3.870  1.00 0.00   ? 255 ARG D HH11  1 
ATOM   9767  H  HH12  . ARG D 1 196 ? 7.891   39.965 2.721  1.00 0.00   ? 255 ARG D HH12  1 
ATOM   9768  H  HH21  . ARG D 1 196 ? 4.434   39.366 3.010  1.00 0.00   ? 255 ARG D HH21  1 
ATOM   9769  H  HH22  . ARG D 1 196 ? 5.905   38.876 2.225  1.00 0.00   ? 255 ARG D HH22  1 
ATOM   9770  N  N     . ALA D 1 197 ? 6.052   46.164 3.177  1.00 22.50  ? 256 ALA D N     1 
ATOM   9771  C  CA    . ALA D 1 197 ? 5.747   46.361 1.748  1.00 22.50  ? 256 ALA D CA    1 
ATOM   9772  C  C     . ALA D 1 197 ? 6.914   46.943 0.943  1.00 22.50  ? 256 ALA D C     1 
ATOM   9773  O  O     . ALA D 1 197 ? 7.228   46.458 -0.146 1.00 7.17   ? 256 ALA D O     1 
ATOM   9774  C  CB    . ALA D 1 197 ? 4.505   47.185 1.576  1.00 7.17   ? 256 ALA D CB    1 
ATOM   9775  H  H     . ALA D 1 197 ? 5.560   46.687 3.849  1.00 0.00   ? 256 ALA D H     1 
ATOM   9776  N  N     . ILE D 1 198 ? 7.568   47.962 1.480  1.00 25.18  ? 257 ILE D N     1 
ATOM   9777  C  CA    . ILE D 1 198 ? 8.723   48.584 0.806  1.00 25.18  ? 257 ILE D CA    1 
ATOM   9778  C  C     . ILE D 1 198 ? 9.615   47.422 0.384  1.00 25.18  ? 257 ILE D C     1 
ATOM   9779  O  O     . ILE D 1 198 ? 9.635   47.055 -0.791 1.00 17.73  ? 257 ILE D O     1 
ATOM   9780  C  CB    . ILE D 1 198 ? 9.501   49.497 1.761  1.00 17.73  ? 257 ILE D CB    1 
ATOM   9781  C  CG1   . ILE D 1 198 ? 8.582   50.597 2.280  1.00 17.73  ? 257 ILE D CG1   1 
ATOM   9782  C  CG2   . ILE D 1 198 ? 10.664  50.099 1.071  1.00 17.73  ? 257 ILE D CG2   1 
ATOM   9783  C  CD1   . ILE D 1 198 ? 8.961   51.111 3.674  1.00 17.73  ? 257 ILE D CD1   1 
ATOM   9784  H  H     . ILE D 1 198 ? 7.278   48.289 2.358  1.00 0.00   ? 257 ILE D H     1 
ATOM   9785  N  N     . THR D 1 199 ? 10.216  46.768 1.376  1.00 16.99  ? 258 THR D N     1 
ATOM   9786  C  CA    . THR D 1 199 ? 11.081  45.609 1.186  1.00 16.99  ? 258 THR D CA    1 
ATOM   9787  C  C     . THR D 1 199 ? 10.410  44.546 0.301  1.00 16.99  ? 258 THR D C     1 
ATOM   9788  O  O     . THR D 1 199 ? 11.087  43.747 -0.345 1.00 25.72  ? 258 THR D O     1 
ATOM   9789  C  CB    . THR D 1 199 ? 11.365  44.944 2.527  1.00 25.72  ? 258 THR D CB    1 
ATOM   9790  O  OG1   . THR D 1 199 ? 10.141  44.441 3.055  1.00 25.72  ? 258 THR D OG1   1 
ATOM   9791  C  CG2   . THR D 1 199 ? 11.924  45.939 3.522  1.00 25.72  ? 258 THR D CG2   1 
ATOM   9792  H  H     . THR D 1 199 ? 10.069  47.039 2.307  1.00 0.00   ? 258 THR D H     1 
ATOM   9793  H  HG1   . THR D 1 199 ? 9.678   43.798 2.509  1.00 30.00  ? 258 THR D HG1   1 
ATOM   9794  N  N     . GLU D 1 200 ? 9.082   44.486 0.319  1.00 21.33  ? 259 GLU D N     1 
ATOM   9795  C  CA    . GLU D 1 200 ? 8.371   43.516 -0.506 1.00 21.33  ? 259 GLU D CA    1 
ATOM   9796  C  C     . GLU D 1 200 ? 8.524   43.879 -1.970 1.00 21.33  ? 259 GLU D C     1 
ATOM   9797  O  O     . GLU D 1 200 ? 8.499   43.014 -2.828 1.00 43.74  ? 259 GLU D O     1 
ATOM   9798  C  CB    . GLU D 1 200 ? 6.897   43.481 -0.146 1.00 43.74  ? 259 GLU D CB    1 
ATOM   9799  C  CG    . GLU D 1 200 ? 6.473   42.151 0.392  1.00 43.74  ? 259 GLU D CG    1 
ATOM   9800  C  CD    . GLU D 1 200 ? 6.726   41.015 -0.590 1.00 43.74  ? 259 GLU D CD    1 
ATOM   9801  O  OE1   . GLU D 1 200 ? 6.018   40.963 -1.615 1.00 43.74  ? 259 GLU D OE1   1 
ATOM   9802  O  OE2   . GLU D 1 200 ? 7.614   40.160 -0.336 1.00 43.74  ? 259 GLU D OE2   1 
ATOM   9803  H  H     . GLU D 1 200 ? 8.591   45.090 0.916  1.00 0.00   ? 259 GLU D H     1 
ATOM   9804  N  N     . SER D 1 201 ? 8.626   45.180 -2.236 1.00 15.64  ? 260 SER D N     1 
ATOM   9805  C  CA    . SER D 1 201 ? 8.781   45.718 -3.572 1.00 15.64  ? 260 SER D CA    1 
ATOM   9806  C  C     . SER D 1 201 ? 10.235  45.830 -4.000 1.00 15.64  ? 260 SER D C     1 
ATOM   9807  O  O     . SER D 1 201 ? 10.528  46.348 -5.064 1.00 45.10  ? 260 SER D O     1 
ATOM   9808  C  CB    . SER D 1 201 ? 8.127   47.083 -3.641 1.00 45.10  ? 260 SER D CB    1 
ATOM   9809  O  OG    . SER D 1 201 ? 6.766   46.988 -3.277 1.00 45.10  ? 260 SER D OG    1 
ATOM   9810  H  H     . SER D 1 201 ? 8.539   45.804 -1.499 1.00 0.00   ? 260 SER D H     1 
ATOM   9811  H  HG    . SER D 1 201 ? 6.736   46.779 -2.331 1.00 30.00  ? 260 SER D HG    1 
ATOM   9812  N  N     . GLY D 1 202 ? 11.154  45.344 -3.187 1.00 14.20  ? 261 GLY D N     1 
ATOM   9813  C  CA    . GLY D 1 202 ? 12.547  45.415 -3.560 1.00 14.20  ? 261 GLY D CA    1 
ATOM   9814  C  C     . GLY D 1 202 ? 13.278  46.653 -3.094 1.00 14.20  ? 261 GLY D C     1 
ATOM   9815  O  O     . GLY D 1 202 ? 14.464  46.833 -3.391 1.00 73.76  ? 261 GLY D O     1 
ATOM   9816  H  H     . GLY D 1 202 ? 10.904  44.904 -2.349 1.00 0.00   ? 261 GLY D H     1 
ATOM   9817  N  N     . LEU D 1 203 ? 12.597  47.520 -2.369 1.00 23.14  ? 262 LEU D N     1 
ATOM   9818  C  CA    . LEU D 1 203 ? 13.243  48.730 -1.881 1.00 23.14  ? 262 LEU D CA    1 
ATOM   9819  C  C     . LEU D 1 203 ? 13.769  48.565 -0.460 1.00 23.14  ? 262 LEU D C     1 
ATOM   9820  O  O     . LEU D 1 203 ? 13.324  47.676 0.263  1.00 21.63  ? 262 LEU D O     1 
ATOM   9821  C  CB    . LEU D 1 203 ? 12.258  49.887 -1.928 1.00 21.63  ? 262 LEU D CB    1 
ATOM   9822  C  CG    . LEU D 1 203 ? 11.802  50.210 -3.335 1.00 21.63  ? 262 LEU D CG    1 
ATOM   9823  C  CD1   . LEU D 1 203 ? 10.638  51.165 -3.288 1.00 21.63  ? 262 LEU D CD1   1 
ATOM   9824  C  CD2   . LEU D 1 203 ? 12.953  50.795 -4.068 1.00 21.63  ? 262 LEU D CD2   1 
ATOM   9825  H  H     . LEU D 1 203 ? 11.660  47.333 -2.152 1.00 0.00   ? 262 LEU D H     1 
ATOM   9826  N  N     . ARG D 1 204 ? 14.723  49.412 -0.078 1.00 30.33  ? 263 ARG D N     1 
ATOM   9827  C  CA    . ARG D 1 204 ? 15.304  49.424 1.268  1.00 30.33  ? 263 ARG D CA    1 
ATOM   9828  C  C     . ARG D 1 204 ? 14.569  50.440 2.178  1.00 30.33  ? 263 ARG D C     1 
ATOM   9829  O  O     . ARG D 1 204 ? 14.185  51.541 1.750  1.00 31.23  ? 263 ARG D O     1 
ATOM   9830  C  CB    . ARG D 1 204 ? 16.804  49.783 1.222  1.00 31.23  ? 263 ARG D CB    1 
ATOM   9831  C  CG    . ARG D 1 204 ? 17.705  48.689 0.660  1.00 31.23  ? 263 ARG D CG    1 
ATOM   9832  C  CD    . ARG D 1 204 ? 18.464  49.150 -0.563 1.00 31.23  ? 263 ARG D CD    1 
ATOM   9833  N  NE    . ARG D 1 204 ? 19.570  50.050 -0.242 1.00 31.23  ? 263 ARG D NE    1 
ATOM   9834  C  CZ    . ARG D 1 204 ? 19.886  51.131 -0.954 1.00 31.23  ? 263 ARG D CZ    1 
ATOM   9835  N  NH1   . ARG D 1 204 ? 19.162  51.454 -2.015 1.00 31.23  ? 263 ARG D NH1   1 
ATOM   9836  N  NH2   . ARG D 1 204 ? 20.962  51.854 -0.648 1.00 31.23  ? 263 ARG D NH2   1 
ATOM   9837  H  H     . ARG D 1 204 ? 14.981  50.062 -0.733 1.00 0.00   ? 263 ARG D H     1 
ATOM   9838  H  HE    . ARG D 1 204 ? 20.119  49.841 0.541  1.00 0.00   ? 263 ARG D HE    1 
ATOM   9839  H  HH11  . ARG D 1 204 ? 18.372  50.904 -2.287 1.00 0.00   ? 263 ARG D HH11  1 
ATOM   9840  H  HH12  . ARG D 1 204 ? 19.411  52.263 -2.545 1.00 0.00   ? 263 ARG D HH12  1 
ATOM   9841  H  HH21  . ARG D 1 204 ? 21.531  51.578 0.128  1.00 0.00   ? 263 ARG D HH21  1 
ATOM   9842  H  HH22  . ARG D 1 204 ? 21.207  52.658 -1.188 1.00 0.00   ? 263 ARG D HH22  1 
ATOM   9843  N  N     . VAL D 1 205 ? 14.360  50.068 3.431  1.00 12.58  ? 264 VAL D N     1 
ATOM   9844  C  CA    . VAL D 1 205 ? 13.710  50.979 4.338  1.00 12.58  ? 264 VAL D CA    1 
ATOM   9845  C  C     . VAL D 1 205 ? 14.844  51.901 4.692  1.00 12.58  ? 264 VAL D C     1 
ATOM   9846  O  O     . VAL D 1 205 ? 15.996  51.475 4.753  1.00 20.58  ? 264 VAL D O     1 
ATOM   9847  C  CB    . VAL D 1 205 ? 13.187  50.248 5.613  1.00 20.58  ? 264 VAL D CB    1 
ATOM   9848  C  CG1   . VAL D 1 205 ? 12.395  51.197 6.490  1.00 20.58  ? 264 VAL D CG1   1 
ATOM   9849  C  CG2   . VAL D 1 205 ? 12.309  49.070 5.229  1.00 20.58  ? 264 VAL D CG2   1 
ATOM   9850  H  H     . VAL D 1 205 ? 14.650  49.197 3.754  1.00 0.00   ? 264 VAL D H     1 
ATOM   9851  N  N     . GLY D 1 206 ? 14.549  53.179 4.850  1.00 20.47  ? 265 GLY D N     1 
ATOM   9852  C  CA    . GLY D 1 206 ? 15.600  54.103 5.223  1.00 20.47  ? 265 GLY D CA    1 
ATOM   9853  C  C     . GLY D 1 206 ? 16.322  54.642 4.013  1.00 20.47  ? 265 GLY D C     1 
ATOM   9854  O  O     . GLY D 1 206 ? 16.122  55.799 3.653  1.00 45.86  ? 265 GLY D O     1 
ATOM   9855  H  H     . GLY D 1 206 ? 13.642  53.509 4.675  1.00 0.00   ? 265 GLY D H     1 
ATOM   9856  N  N     . ALA D 1 207 ? 17.109  53.793 3.359  1.00 33.31  ? 266 ALA D N     1 
ATOM   9857  C  CA    . ALA D 1 207 ? 17.881  54.188 2.174  1.00 33.31  ? 266 ALA D CA    1 
ATOM   9858  C  C     . ALA D 1 207 ? 17.042  54.617 1.001  1.00 33.31  ? 266 ALA D C     1 
ATOM   9859  O  O     . ALA D 1 207 ? 17.419  55.548 0.290  1.00 26.04  ? 266 ALA D O     1 
ATOM   9860  C  CB    . ALA D 1 207 ? 18.798  53.065 1.734  1.00 26.04  ? 266 ALA D CB    1 
ATOM   9861  H  H     . ALA D 1 207 ? 17.164  52.874 3.704  1.00 0.00   ? 266 ALA D H     1 
ATOM   9862  N  N     . ASP D 1 208 ? 15.960  53.871 0.773  1.00 14.45  ? 267 ASP D N     1 
ATOM   9863  C  CA    . ASP D 1 208 ? 15.031  54.112 -0.319 1.00 14.45  ? 267 ASP D CA    1 
ATOM   9864  C  C     . ASP D 1 208 ? 13.742  54.816 0.135  1.00 14.45  ? 267 ASP D C     1 
ATOM   9865  O  O     . ASP D 1 208 ? 13.553  56.000 -0.183 1.00 40.07  ? 267 ASP D O     1 
ATOM   9866  C  CB    . ASP D 1 208 ? 14.781  52.815 -1.084 1.00 40.07  ? 267 ASP D CB    1 
ATOM   9867  C  CG    . ASP D 1 208 ? 16.071  52.257 -1.726 1.00 40.07  ? 267 ASP D CG    1 
ATOM   9868  O  OD1   . ASP D 1 208 ? 16.810  53.024 -2.383 1.00 40.07  ? 267 ASP D OD1   1 
ATOM   9869  O  OD2   . ASP D 1 208 ? 16.353  51.050 -1.585 1.00 40.07  ? 267 ASP D OD2   1 
ATOM   9870  H  H     . ASP D 1 208 ? 15.745  53.146 1.392  1.00 0.00   ? 267 ASP D H     1 
ATOM   9871  N  N     . ILE D 1 209 ? 12.838  54.127 0.838  1.00 13.46  ? 268 ILE D N     1 
ATOM   9872  C  CA    . ILE D 1 209 ? 11.651  54.812 1.360  1.00 13.46  ? 268 ILE D CA    1 
ATOM   9873  C  C     . ILE D 1 209 ? 11.831  54.902 2.883  1.00 13.46  ? 268 ILE D C     1 
ATOM   9874  O  O     . ILE D 1 209 ? 12.050  53.872 3.531  1.00 11.57  ? 268 ILE D O     1 
ATOM   9875  C  CB    . ILE D 1 209 ? 10.355  54.080 1.072  1.00 11.57  ? 268 ILE D CB    1 
ATOM   9876  C  CG1   . ILE D 1 209 ? 10.145  53.895 -0.433 1.00 11.57  ? 268 ILE D CG1   1 
ATOM   9877  C  CG2   . ILE D 1 209 ? 9.236   54.898 1.580  1.00 11.57  ? 268 ILE D CG2   1 
ATOM   9878  C  CD1   . ILE D 1 209 ? 8.748   53.435 -0.829 1.00 11.57  ? 268 ILE D CD1   1 
ATOM   9879  H  H     . ILE D 1 209 ? 12.979  53.178 1.044  1.00 0.00   ? 268 ILE D H     1 
ATOM   9880  N  N     . SER D 1 210 ? 11.894  56.123 3.434  1.00 25.82  ? 269 SER D N     1 
ATOM   9881  C  CA    . SER D 1 210 ? 12.042  56.324 4.892  1.00 25.82  ? 269 SER D CA    1 
ATOM   9882  C  C     . SER D 1 210 ? 10.657  56.231 5.523  1.00 25.82  ? 269 SER D C     1 
ATOM   9883  O  O     . SER D 1 210 ? 9.655   56.580 4.897  1.00 29.92  ? 269 SER D O     1 
ATOM   9884  C  CB    . SER D 1 210 ? 12.681  57.673 5.222  1.00 29.92  ? 269 SER D CB    1 
ATOM   9885  O  OG    . SER D 1 210 ? 14.077  57.668 4.962  1.00 29.92  ? 269 SER D OG    1 
ATOM   9886  H  H     . SER D 1 210 ? 11.831  56.892 2.851  1.00 0.00   ? 269 SER D H     1 
ATOM   9887  H  HG    . SER D 1 210 ? 14.295  57.274 4.103  1.00 30.00  ? 269 SER D HG    1 
ATOM   9888  N  N     . VAL D 1 211 ? 10.604  55.783 6.768  1.00 14.62  ? 270 VAL D N     1 
ATOM   9889  C  CA    . VAL D 1 211 ? 9.345   55.582 7.452  1.00 14.62  ? 270 VAL D CA    1 
ATOM   9890  C  C     . VAL D 1 211 ? 9.356   56.190 8.850  1.00 14.62  ? 270 VAL D C     1 
ATOM   9891  O  O     . VAL D 1 211 ? 10.355  56.090 9.544  1.00 9.03   ? 270 VAL D O     1 
ATOM   9892  C  CB    . VAL D 1 211 ? 9.096   54.046 7.587  1.00 9.03   ? 270 VAL D CB    1 
ATOM   9893  C  CG1   . VAL D 1 211 ? 7.741   53.756 8.261  1.00 9.03   ? 270 VAL D CG1   1 
ATOM   9894  C  CG2   . VAL D 1 211 ? 9.169   53.388 6.215  1.00 9.03   ? 270 VAL D CG2   1 
ATOM   9895  H  H     . VAL D 1 211 ? 11.438  55.597 7.253  1.00 0.00   ? 270 VAL D H     1 
ATOM   9896  N  N     . VAL D 1 212 ? 8.271   56.866 9.244  1.00 14.60  ? 271 VAL D N     1 
ATOM   9897  C  CA    . VAL D 1 212 ? 8.146   57.416 10.608 1.00 14.60  ? 271 VAL D CA    1 
ATOM   9898  C  C     . VAL D 1 212 ? 6.864   56.864 11.253 1.00 14.60  ? 271 VAL D C     1 
ATOM   9899  O  O     . VAL D 1 212 ? 5.783   56.961 10.655 1.00 20.85  ? 271 VAL D O     1 
ATOM   9900  C  CB    . VAL D 1 212 ? 8.140   58.953 10.636 1.00 20.85  ? 271 VAL D CB    1 
ATOM   9901  C  CG1   . VAL D 1 212 ? 7.618   59.470 11.975 1.00 20.85  ? 271 VAL D CG1   1 
ATOM   9902  C  CG2   . VAL D 1 212 ? 9.555   59.449 10.459 1.00 20.85  ? 271 VAL D CG2   1 
ATOM   9903  H  H     . VAL D 1 212 ? 7.518   57.011 8.642  1.00 0.00   ? 271 VAL D H     1 
ATOM   9904  N  N     . GLY D 1 213 ? 7.004   56.194 12.407 1.00 9.87   ? 272 GLY D N     1 
ATOM   9905  C  CA    . GLY D 1 213 ? 5.837   55.650 13.095 1.00 9.87   ? 272 GLY D CA    1 
ATOM   9906  C  C     . GLY D 1 213 ? 5.213   56.622 14.086 1.00 9.87   ? 272 GLY D C     1 
ATOM   9907  O  O     . GLY D 1 213 ? 5.469   57.817 14.036 1.00 38.72  ? 272 GLY D O     1 
ATOM   9908  H  H     . GLY D 1 213 ? 7.892   56.072 12.808 1.00 0.00   ? 272 GLY D H     1 
ATOM   9909  N  N     . TYR D 1 214 ? 4.410   56.096 15.006 1.00 25.24  ? 273 TYR D N     1 
ATOM   9910  C  CA    . TYR D 1 214 ? 3.726   56.880 16.041 1.00 25.24  ? 273 TYR D CA    1 
ATOM   9911  C  C     . TYR D 1 214 ? 3.350   55.904 17.142 1.00 25.24  ? 273 TYR D C     1 
ATOM   9912  O  O     . TYR D 1 214 ? 2.800   54.851 16.828 1.00 17.45  ? 273 TYR D O     1 
ATOM   9913  C  CB    . TYR D 1 214 ? 2.443   57.505 15.488 1.00 17.45  ? 273 TYR D CB    1 
ATOM   9914  C  CG    . TYR D 1 214 ? 2.148   58.892 16.044 1.00 17.45  ? 273 TYR D CG    1 
ATOM   9915  C  CD1   . TYR D 1 214 ? 1.723   59.065 17.361 1.00 17.45  ? 273 TYR D CD1   1 
ATOM   9916  C  CD2   . TYR D 1 214 ? 2.295   60.038 15.245 1.00 17.45  ? 273 TYR D CD2   1 
ATOM   9917  C  CE1   . TYR D 1 214 ? 1.457   60.326 17.864 1.00 17.45  ? 273 TYR D CE1   1 
ATOM   9918  C  CE2   . TYR D 1 214 ? 2.010   61.301 15.748 1.00 17.45  ? 273 TYR D CE2   1 
ATOM   9919  C  CZ    . TYR D 1 214 ? 1.596   61.434 17.054 1.00 17.45  ? 273 TYR D CZ    1 
ATOM   9920  O  OH    . TYR D 1 214 ? 1.292   62.675 17.555 1.00 17.45  ? 273 TYR D OH    1 
ATOM   9921  H  H     . TYR D 1 214 ? 4.237   55.136 14.967 1.00 0.00   ? 273 TYR D H     1 
ATOM   9922  H  HH    . TYR D 1 214 ? 1.382   63.309 16.841 1.00 0.00   ? 273 TYR D HH    1 
ATOM   9923  N  N     . ASP D 1 215 ? 3.688   56.252 18.395 1.00 19.31  ? 274 ASP D N     1 
ATOM   9924  C  CA    . ASP D 1 215 ? 3.448   55.484 19.637 1.00 19.31  ? 274 ASP D CA    1 
ATOM   9925  C  C     . ASP D 1 215 ? 4.702   55.020 20.384 1.00 19.31  ? 274 ASP D C     1 
ATOM   9926  O  O     . ASP D 1 215 ? 4.905   55.326 21.548 1.00 15.15  ? 274 ASP D O     1 
ATOM   9927  C  CB    . ASP D 1 215 ? 2.600   54.235 19.402 1.00 15.15  ? 274 ASP D CB    1 
ATOM   9928  C  CG    . ASP D 1 215 ? 1.149   54.535 19.274 1.00 15.15  ? 274 ASP D CG    1 
ATOM   9929  O  OD1   . ASP D 1 215 ? 0.730   55.559 19.836 1.00 15.15  ? 274 ASP D OD1   1 
ATOM   9930  O  OD2   . ASP D 1 215 ? 0.420   53.761 18.620 1.00 15.15  ? 274 ASP D OD2   1 
ATOM   9931  H  H     . ASP D 1 215 ? 4.119   57.121 18.485 1.00 0.00   ? 274 ASP D H     1 
ATOM   9932  N  N     . ASP D 1 216 ? 5.546   54.295 19.673 1.00 10.47  ? 275 ASP D N     1 
ATOM   9933  C  CA    . ASP D 1 216 ? 6.752   53.659 20.201 1.00 10.47  ? 275 ASP D CA    1 
ATOM   9934  C  C     . ASP D 1 216 ? 6.278   52.537 21.096 1.00 10.47  ? 275 ASP D C     1 
ATOM   9935  O  O     . ASP D 1 216 ? 6.776   52.352 22.200 1.00 24.26  ? 275 ASP D O     1 
ATOM   9936  C  CB    . ASP D 1 216 ? 7.739   54.578 20.942 1.00 24.26  ? 275 ASP D CB    1 
ATOM   9937  C  CG    . ASP D 1 216 ? 9.008   53.829 21.384 1.00 24.26  ? 275 ASP D CG    1 
ATOM   9938  O  OD1   . ASP D 1 216 ? 9.318   52.788 20.780 1.00 24.26  ? 275 ASP D OD1   1 
ATOM   9939  O  OD2   . ASP D 1 216 ? 9.685   54.218 22.356 1.00 24.26  ? 275 ASP D OD2   1 
ATOM   9940  H  H     . ASP D 1 216 ? 5.319   54.174 18.735 1.00 0.00   ? 275 ASP D H     1 
ATOM   9941  N  N     . THR D 1 217 ? 5.266   51.818 20.623 1.00 2.00   ? 276 THR D N     1 
ATOM   9942  C  CA    . THR D 1 217 ? 4.763   50.690 21.354 1.00 2.00   ? 276 THR D CA    1 
ATOM   9943  C  C     . THR D 1 217 ? 5.937   49.729 21.462 1.00 2.00   ? 276 THR D C     1 
ATOM   9944  O  O     . THR D 1 217 ? 6.898   49.807 20.681 1.00 16.20  ? 276 THR D O     1 
ATOM   9945  C  CB    . THR D 1 217 ? 3.622   50.032 20.628 1.00 16.20  ? 276 THR D CB    1 
ATOM   9946  O  OG1   . THR D 1 217 ? 3.860   50.090 19.225 1.00 16.20  ? 276 THR D OG1   1 
ATOM   9947  C  CG2   . THR D 1 217 ? 2.320   50.738 20.928 1.00 16.20  ? 276 THR D CG2   1 
ATOM   9948  H  H     . THR D 1 217 ? 4.871   52.002 19.748 1.00 0.00   ? 276 THR D H     1 
ATOM   9949  H  HG1   . THR D 1 217 ? 3.167   49.691 18.693 1.00 30.00  ? 276 THR D HG1   1 
ATOM   9950  N  N     . GLU D 1 218 ? 5.916   48.923 22.510 1.00 20.97  ? 277 GLU D N     1 
ATOM   9951  C  CA    . GLU D 1 218 ? 6.948   47.943 22.814 1.00 20.97  ? 277 GLU D CA    1 
ATOM   9952  C  C     . GLU D 1 218 ? 7.885   47.514 21.688 1.00 20.97  ? 277 GLU D C     1 
ATOM   9953  O  O     . GLU D 1 218 ? 8.948   48.072 21.517 1.00 35.63  ? 277 GLU D O     1 
ATOM   9954  C  CB    . GLU D 1 218 ? 6.275   46.715 23.417 1.00 35.63  ? 277 GLU D CB    1 
ATOM   9955  C  CG    . GLU D 1 218 ? 6.901   46.207 24.678 1.00 35.63  ? 277 GLU D CG    1 
ATOM   9956  C  CD    . GLU D 1 218 ? 6.851   47.204 25.820 1.00 35.63  ? 277 GLU D CD    1 
ATOM   9957  O  OE1   . GLU D 1 218 ? 5.734   47.522 26.318 1.00 35.63  ? 277 GLU D OE1   1 
ATOM   9958  O  OE2   . GLU D 1 218 ? 7.948   47.632 26.248 1.00 35.63  ? 277 GLU D OE2   1 
ATOM   9959  H  H     . GLU D 1 218 ? 5.218   49.036 23.182 1.00 0.00   ? 277 GLU D H     1 
ATOM   9960  N  N     . ASP D 1 219 ? 7.418   46.578 20.873 1.00 19.16  ? 278 ASP D N     1 
ATOM   9961  C  CA    . ASP D 1 219 ? 8.162   45.964 19.765 1.00 19.16  ? 278 ASP D CA    1 
ATOM   9962  C  C     . ASP D 1 219 ? 8.728   46.790 18.614 1.00 19.16  ? 278 ASP D C     1 
ATOM   9963  O  O     . ASP D 1 219 ? 9.267   46.192 17.698 1.00 42.56  ? 278 ASP D O     1 
ATOM   9964  C  CB    . ASP D 1 219 ? 7.292   44.893 19.107 1.00 42.56  ? 278 ASP D CB    1 
ATOM   9965  C  CG    . ASP D 1 219 ? 6.757   43.863 20.078 1.00 42.56  ? 278 ASP D CG    1 
ATOM   9966  O  OD1   . ASP D 1 219 ? 7.254   43.752 21.220 1.00 42.56  ? 278 ASP D OD1   1 
ATOM   9967  O  OD2   . ASP D 1 219 ? 5.833   43.137 19.668 1.00 42.56  ? 278 ASP D OD2   1 
ATOM   9968  H  H     . ASP D 1 219 ? 6.495   46.307 20.998 1.00 0.00   ? 278 ASP D H     1 
ATOM   9969  N  N     . SER D 1 220 ? 8.582   48.119 18.614 1.00 14.98  ? 279 SER D N     1 
ATOM   9970  C  CA    . SER D 1 220 ? 9.069   48.958 17.515 1.00 14.98  ? 279 SER D CA    1 
ATOM   9971  C  C     . SER D 1 220 ? 10.565  48.914 17.315 1.00 14.98  ? 279 SER D C     1 
ATOM   9972  O  O     . SER D 1 220 ? 11.075  48.947 16.190 1.00 17.25  ? 279 SER D O     1 
ATOM   9973  C  CB    . SER D 1 220 ? 8.574   50.357 17.690 1.00 17.25  ? 279 SER D CB    1 
ATOM   9974  O  OG    . SER D 1 220 ? 7.180   50.266 17.697 1.00 17.25  ? 279 SER D OG    1 
ATOM   9975  H  H     . SER D 1 220 ? 8.145   48.535 19.384 1.00 0.00   ? 279 SER D H     1 
ATOM   9976  H  HG    . SER D 1 220 ? 6.914   49.830 18.511 1.00 30.00  ? 279 SER D HG    1 
ATOM   9977  N  N     . SER D 1 221 ? 11.311  48.799 18.398 1.00 7.48   ? 280 SER D N     1 
ATOM   9978  C  CA    . SER D 1 221 ? 12.725  48.631 18.203 1.00 7.48   ? 280 SER D CA    1 
ATOM   9979  C  C     . SER D 1 221 ? 12.626  47.169 17.802 1.00 7.48   ? 280 SER D C     1 
ATOM   9980  O  O     . SER D 1 221 ? 11.549  46.704 17.503 1.00 22.86  ? 280 SER D O     1 
ATOM   9981  C  CB    . SER D 1 221 ? 13.465  48.838 19.519 1.00 22.86  ? 280 SER D CB    1 
ATOM   9982  O  OG    . SER D 1 221 ? 12.772  48.254 20.605 1.00 22.86  ? 280 SER D OG    1 
ATOM   9983  H  H     . SER D 1 221 ? 10.891  48.761 19.297 1.00 0.00   ? 280 SER D H     1 
ATOM   9984  H  HG    . SER D 1 221 ? 11.981  48.711 20.942 1.00 30.00  ? 280 SER D HG    1 
ATOM   9985  N  N     . CYS D 1 222 ? 13.665  46.371 17.805 1.00 2.00   ? 281 CYS D N     1 
ATOM   9986  C  CA    . CYS D 1 222 ? 13.378  44.973 17.380 1.00 2.00   ? 281 CYS D CA    1 
ATOM   9987  C  C     . CYS D 1 222 ? 12.796  44.844 15.976 1.00 2.00   ? 281 CYS D C     1 
ATOM   9988  O  O     . CYS D 1 222 ? 12.809  43.745 15.446 1.00 25.45  ? 281 CYS D O     1 
ATOM   9989  C  CB    . CYS D 1 222 ? 12.411  44.251 18.294 1.00 25.45  ? 281 CYS D CB    1 
ATOM   9990  S  SG    . CYS D 1 222 ? 13.069  44.054 19.909 1.00 25.45  ? 281 CYS D SG    1 
ATOM   9991  H  H     . CYS D 1 222 ? 14.557  46.765 17.884 1.00 0.00   ? 281 CYS D H     1 
ATOM   9992  N  N     . TYR D 1 223 ? 12.362  45.934 15.362 1.00 7.23   ? 282 TYR D N     1 
ATOM   9993  C  CA    . TYR D 1 223 ? 11.825  45.881 14.012 1.00 7.23   ? 282 TYR D CA    1 
ATOM   9994  C  C     . TYR D 1 223 ? 13.084  46.003 13.181 1.00 7.23   ? 282 TYR D C     1 
ATOM   9995  O  O     . TYR D 1 223 ? 14.087  46.563 13.661 1.00 10.75  ? 282 TYR D O     1 
ATOM   9996  C  CB    . TYR D 1 223 ? 10.946  47.088 13.717 1.00 10.75  ? 282 TYR D CB    1 
ATOM   9997  C  CG    . TYR D 1 223 ? 9.494   46.949 14.082 1.00 10.75  ? 282 TYR D CG    1 
ATOM   9998  C  CD1   . TYR D 1 223 ? 9.033   45.857 14.812 1.00 10.75  ? 282 TYR D CD1   1 
ATOM   9999  C  CD2   . TYR D 1 223 ? 8.587   47.952 13.748 1.00 10.75  ? 282 TYR D CD2   1 
ATOM   10000 C  CE1   . TYR D 1 223 ? 7.691   45.774 15.218 1.00 10.75  ? 282 TYR D CE1   1 
ATOM   10001 C  CE2   . TYR D 1 223 ? 7.246   47.894 14.135 1.00 10.75  ? 282 TYR D CE2   1 
ATOM   10002 C  CZ    . TYR D 1 223 ? 6.796   46.815 14.879 1.00 10.75  ? 282 TYR D CZ    1 
ATOM   10003 O  OH    . TYR D 1 223 ? 5.478   46.860 15.333 1.00 10.75  ? 282 TYR D OH    1 
ATOM   10004 H  H     . TYR D 1 223 ? 12.654  46.831 15.630 1.00 0.00   ? 282 TYR D H     1 
ATOM   10005 H  HH    . TYR D 1 223 ? 5.213   46.011 15.665 1.00 0.00   ? 282 TYR D HH    1 
ATOM   10006 N  N     . ILE D 1 224 ? 13.056  45.482 11.959 1.00 19.86  ? 283 ILE D N     1 
ATOM   10007 C  CA    . ILE D 1 224 ? 14.217  45.549 11.078 1.00 19.86  ? 283 ILE D CA    1 
ATOM   10008 C  C     . ILE D 1 224 ? 13.863  46.371 9.864  1.00 19.86  ? 283 ILE D C     1 
ATOM   10009 O  O     . ILE D 1 224 ? 13.065  45.952 9.031  1.00 43.43  ? 283 ILE D O     1 
ATOM   10010 C  CB    . ILE D 1 224 ? 14.710  44.145 10.626 1.00 43.43  ? 283 ILE D CB    1 
ATOM   10011 C  CG1   . ILE D 1 224 ? 15.134  43.303 11.831 1.00 43.43  ? 283 ILE D CG1   1 
ATOM   10012 C  CG2   . ILE D 1 224 ? 15.903  44.275 9.678  1.00 43.43  ? 283 ILE D CG2   1 
ATOM   10013 C  CD1   . ILE D 1 224 ? 15.449  41.863 11.493 1.00 43.43  ? 283 ILE D CD1   1 
ATOM   10014 H  H     . ILE D 1 224 ? 12.210  45.088 11.658 1.00 0.00   ? 283 ILE D H     1 
ATOM   10015 N  N     . PRO D 1 225 ? 14.424  47.584 9.771  1.00 20.71  ? 284 PRO D N     1 
ATOM   10016 C  CA    . PRO D 1 225 ? 15.335  48.119 10.781 1.00 20.71  ? 284 PRO D CA    1 
ATOM   10017 C  C     . PRO D 1 225 ? 14.545  48.717 11.921 1.00 20.71  ? 284 PRO D C     1 
ATOM   10018 O  O     . PRO D 1 225 ? 13.334  48.863 11.817 1.00 23.12  ? 284 PRO D O     1 
ATOM   10019 C  CB    . PRO D 1 225 ? 16.110  49.178 9.995  1.00 23.12  ? 284 PRO D CB    1 
ATOM   10020 C  CG    . PRO D 1 225 ? 15.131  49.655 9.027  1.00 23.12  ? 284 PRO D CG    1 
ATOM   10021 C  CD    . PRO D 1 225 ? 14.496  48.390 8.541  1.00 23.12  ? 284 PRO D CD    1 
ATOM   10022 N  N     . PRO D 1 226 ? 15.202  49.001 13.048 1.00 12.40  ? 285 PRO D N     1 
ATOM   10023 C  CA    . PRO D 1 226 ? 14.519  49.587 14.202 1.00 12.40  ? 285 PRO D CA    1 
ATOM   10024 C  C     . PRO D 1 226 ? 13.715  50.826 13.783 1.00 12.40  ? 285 PRO D C     1 
ATOM   10025 O  O     . PRO D 1 226 ? 14.267  51.752 13.194 1.00 15.52  ? 285 PRO D O     1 
ATOM   10026 C  CB    . PRO D 1 226 ? 15.681  50.003 15.101 1.00 15.52  ? 285 PRO D CB    1 
ATOM   10027 C  CG    . PRO D 1 226 ? 16.745  49.086 14.740 1.00 15.52  ? 285 PRO D CG    1 
ATOM   10028 C  CD    . PRO D 1 226 ? 16.654  48.977 13.264 1.00 15.52  ? 285 PRO D CD    1 
ATOM   10029 N  N     . LEU D 1 227 ? 12.436  50.858 14.126 1.00 13.81  ? 286 LEU D N     1 
ATOM   10030 C  CA    . LEU D 1 227 ? 11.556  51.954 13.778 1.00 13.81  ? 286 LEU D CA    1 
ATOM   10031 C  C     . LEU D 1 227 ? 11.849  53.276 14.471 1.00 13.81  ? 286 LEU D C     1 
ATOM   10032 O  O     . LEU D 1 227 ? 12.005  53.300 15.691 1.00 9.88   ? 286 LEU D O     1 
ATOM   10033 C  CB    . LEU D 1 227 ? 10.103  51.565 14.094 1.00 9.88   ? 286 LEU D CB    1 
ATOM   10034 C  CG    . LEU D 1 227 ? 9.046   52.547 13.590 1.00 9.88   ? 286 LEU D CG    1 
ATOM   10035 C  CD1   . LEU D 1 227 ? 9.175   52.761 12.105 1.00 9.88   ? 286 LEU D CD1   1 
ATOM   10036 C  CD2   . LEU D 1 227 ? 7.685   52.054 13.929 1.00 9.88   ? 286 LEU D CD2   1 
ATOM   10037 H  H     . LEU D 1 227 ? 12.060  50.104 14.632 1.00 0.00   ? 286 LEU D H     1 
ATOM   10038 N  N     . THR D 1 228 ? 11.947  54.354 13.680 1.00 9.75   ? 287 THR D N     1 
ATOM   10039 C  CA    . THR D 1 228 ? 12.135  55.711 14.185 1.00 9.75   ? 287 THR D CA    1 
ATOM   10040 C  C     . THR D 1 228 ? 10.665  56.017 14.416 1.00 9.75   ? 287 THR D C     1 
ATOM   10041 O  O     . THR D 1 228 ? 9.810   55.624 13.604 1.00 16.24  ? 287 THR D O     1 
ATOM   10042 C  CB    . THR D 1 228 ? 12.728  56.684 13.119 1.00 16.24  ? 287 THR D CB    1 
ATOM   10043 O  OG1   . THR D 1 228 ? 14.150  56.571 13.114 1.00 16.24  ? 287 THR D OG1   1 
ATOM   10044 C  CG2   . THR D 1 228 ? 12.409  58.129 13.444 1.00 16.24  ? 287 THR D CG2   1 
ATOM   10045 H  H     . THR D 1 228 ? 11.812  54.243 12.714 1.00 0.00   ? 287 THR D H     1 
ATOM   10046 H  HG1   . THR D 1 228 ? 14.300  55.647 12.890 1.00 30.00  ? 287 THR D HG1   1 
ATOM   10047 N  N     . THR D 1 229 ? 10.355  56.771 15.465 1.00 2.00   ? 288 THR D N     1 
ATOM   10048 C  CA    . THR D 1 229 ? 8.953   57.001 15.787 1.00 2.00   ? 288 THR D CA    1 
ATOM   10049 C  C     . THR D 1 229 ? 8.705   58.080 16.805 1.00 2.00   ? 288 THR D C     1 
ATOM   10050 O  O     . THR D 1 229 ? 9.629   58.548 17.471 1.00 18.40  ? 288 THR D O     1 
ATOM   10051 C  CB    . THR D 1 229 ? 8.366   55.687 16.330 1.00 18.40  ? 288 THR D CB    1 
ATOM   10052 O  OG1   . THR D 1 229 ? 6.962   55.818 16.475 1.00 18.40  ? 288 THR D OG1   1 
ATOM   10053 C  CG2   . THR D 1 229 ? 8.996   55.302 17.654 1.00 18.40  ? 288 THR D CG2   1 
ATOM   10054 H  H     . THR D 1 229 ? 11.044  57.152 16.041 1.00 0.00   ? 288 THR D H     1 
ATOM   10055 H  HG1   . THR D 1 229 ? 6.660   54.998 16.868 1.00 30.00  ? 288 THR D HG1   1 
ATOM   10056 N  N     . ILE D 1 230 ? 7.444   58.482 16.906 1.00 16.34  ? 289 ILE D N     1 
ATOM   10057 C  CA    . ILE D 1 230 ? 7.009   59.476 17.871 1.00 16.34  ? 289 ILE D CA    1 
ATOM   10058 C  C     . ILE D 1 230 ? 6.555   58.716 19.144 1.00 16.34  ? 289 ILE D C     1 
ATOM   10059 O  O     . ILE D 1 230 ? 5.512   58.074 19.163 1.00 10.96  ? 289 ILE D O     1 
ATOM   10060 C  CB    . ILE D 1 230 ? 5.839   60.279 17.292 1.00 10.96  ? 289 ILE D CB    1 
ATOM   10061 C  CG1   . ILE D 1 230 ? 6.282   61.027 16.034 1.00 10.96  ? 289 ILE D CG1   1 
ATOM   10062 C  CG2   . ILE D 1 230 ? 5.225   61.172 18.350 1.00 10.96  ? 289 ILE D CG2   1 
ATOM   10063 C  CD1   . ILE D 1 230 ? 7.298   62.098 16.265 1.00 10.96  ? 289 ILE D CD1   1 
ATOM   10064 H  H     . ILE D 1 230 ? 6.772   58.076 16.317 1.00 0.00   ? 289 ILE D H     1 
ATOM   10065 N  N     . LYS D 1 231 ? 7.367   58.749 20.186 1.00 17.04  ? 290 LYS D N     1 
ATOM   10066 C  CA    . LYS D 1 231 ? 7.042   58.050 21.428 1.00 17.04  ? 290 LYS D CA    1 
ATOM   10067 C  C     . LYS D 1 231 ? 6.008   58.690 22.338 1.00 17.04  ? 290 LYS D C     1 
ATOM   10068 O  O     . LYS D 1 231 ? 6.235   59.787 22.873 1.00 18.60  ? 290 LYS D O     1 
ATOM   10069 C  CB    . LYS D 1 231 ? 8.294   57.831 22.256 1.00 18.60  ? 290 LYS D CB    1 
ATOM   10070 C  CG    . LYS D 1 231 ? 7.997   57.215 23.597 1.00 18.60  ? 290 LYS D CG    1 
ATOM   10071 C  CD    . LYS D 1 231 ? 9.284   56.981 24.337 1.00 18.60  ? 290 LYS D CD    1 
ATOM   10072 C  CE    . LYS D 1 231 ? 9.043   56.373 25.686 1.00 18.60  ? 290 LYS D CE    1 
ATOM   10073 N  NZ    . LYS D 1 231 ? 8.451   55.023 25.517 1.00 18.60  ? 290 LYS D NZ    1 
ATOM   10074 H  H     . LYS D 1 231 ? 8.224   59.192 20.108 1.00 0.00   ? 290 LYS D H     1 
ATOM   10075 H  HZ1   . LYS D 1 231 ? 9.105   54.429 24.969 1.00 0.00   ? 290 LYS D HZ1   1 
ATOM   10076 H  HZ2   . LYS D 1 231 ? 8.277   54.595 26.448 1.00 0.00   ? 290 LYS D HZ2   1 
ATOM   10077 H  HZ3   . LYS D 1 231 ? 7.547   55.105 25.007 1.00 0.00   ? 290 LYS D HZ3   1 
ATOM   10078 N  N     . GLN D 1 232 ? 4.965   57.926 22.654 1.00 16.45  ? 291 GLN D N     1 
ATOM   10079 C  CA    . GLN D 1 232 ? 3.902   58.395 23.520 1.00 16.45  ? 291 GLN D CA    1 
ATOM   10080 C  C     . GLN D 1 232 ? 3.865   57.555 24.773 1.00 16.45  ? 291 GLN D C     1 
ATOM   10081 O  O     . GLN D 1 232 ? 3.156   56.557 24.839 1.00 25.50  ? 291 GLN D O     1 
ATOM   10082 C  CB    . GLN D 1 232 ? 2.551   58.307 22.825 1.00 25.50  ? 291 GLN D CB    1 
ATOM   10083 C  CG    . GLN D 1 232 ? 2.482   59.023 21.518 1.00 25.50  ? 291 GLN D CG    1 
ATOM   10084 C  CD    . GLN D 1 232 ? 1.072   59.177 21.050 1.00 25.50  ? 291 GLN D CD    1 
ATOM   10085 O  OE1   . GLN D 1 232 ? 0.321   58.202 20.948 1.00 25.50  ? 291 GLN D OE1   1 
ATOM   10086 N  NE2   . GLN D 1 232 ? 0.686   60.418 20.777 1.00 25.50  ? 291 GLN D NE2   1 
ATOM   10087 H  H     . GLN D 1 232 ? 4.912   57.007 22.331 1.00 0.00   ? 291 GLN D H     1 
ATOM   10088 N  N     . ASP D 1 233 ? 4.582   57.997 25.796 1.00 24.03  ? 292 ASP D N     1 
ATOM   10089 C  CA    . ASP D 1 233 ? 4.663   57.293 27.075 1.00 24.03  ? 292 ASP D CA    1 
ATOM   10090 C  C     . ASP D 1 233 ? 3.301   56.874 27.646 1.00 24.03  ? 292 ASP D C     1 
ATOM   10091 O  O     . ASP D 1 233 ? 2.616   57.668 28.303 1.00 22.45  ? 292 ASP D O     1 
ATOM   10092 C  CB    . ASP D 1 233 ? 5.393   58.176 28.080 1.00 22.45  ? 292 ASP D CB    1 
ATOM   10093 C  CG    . ASP D 1 233 ? 5.958   57.403 29.249 1.00 22.45  ? 292 ASP D CG    1 
ATOM   10094 O  OD1   . ASP D 1 233 ? 5.324   56.426 29.686 1.00 22.45  ? 292 ASP D OD1   1 
ATOM   10095 O  OD2   . ASP D 1 233 ? 7.033   57.799 29.751 1.00 22.45  ? 292 ASP D OD2   1 
ATOM   10096 H  H     . ASP D 1 233 ? 5.035   58.853 25.676 1.00 0.00   ? 292 ASP D H     1 
ATOM   10097 N  N     . PHE D 1 234 ? 2.913   55.623 27.394 1.00 19.67  ? 293 PHE D N     1 
ATOM   10098 C  CA    . PHE D 1 234 ? 1.653   55.107 27.910 1.00 19.67  ? 293 PHE D CA    1 
ATOM   10099 C  C     . PHE D 1 234 ? 1.835   54.705 29.372 1.00 19.67  ? 293 PHE D C     1 
ATOM   10100 O  O     . PHE D 1 234 ? 0.864   54.383 30.039 1.00 2.00   ? 293 PHE D O     1 
ATOM   10101 C  CB    . PHE D 1 234 ? 1.136   53.911 27.104 1.00 2.00   ? 293 PHE D CB    1 
ATOM   10102 C  CG    . PHE D 1 234 ? 1.048   54.143 25.614 1.00 2.00   ? 293 PHE D CG    1 
ATOM   10103 C  CD1   . PHE D 1 234 ? 0.358   55.206 25.094 1.00 2.00   ? 293 PHE D CD1   1 
ATOM   10104 C  CD2   . PHE D 1 234 ? 1.618   53.234 24.733 1.00 2.00   ? 293 PHE D CD2   1 
ATOM   10105 C  CE1   . PHE D 1 234 ? 0.227   55.350 23.722 1.00 2.00   ? 293 PHE D CE1   1 
ATOM   10106 C  CE2   . PHE D 1 234 ? 1.495   53.373 23.388 1.00 2.00   ? 293 PHE D CE2   1 
ATOM   10107 C  CZ    . PHE D 1 234 ? 0.801   54.425 22.880 1.00 2.00   ? 293 PHE D CZ    1 
ATOM   10108 H  H     . PHE D 1 234 ? 3.455   55.051 26.817 1.00 0.00   ? 293 PHE D H     1 
ATOM   10109 N  N     . ARG D 1 235 ? 3.065   54.650 29.869 1.00 21.90  ? 294 ARG D N     1 
ATOM   10110 C  CA    . ARG D 1 235 ? 3.253   54.343 31.282 1.00 21.90  ? 294 ARG D CA    1 
ATOM   10111 C  C     . ARG D 1 235 ? 2.746   55.588 32.012 1.00 21.90  ? 294 ARG D C     1 
ATOM   10112 O  O     . ARG D 1 235 ? 2.030   55.495 33.007 1.00 62.61  ? 294 ARG D O     1 
ATOM   10113 C  CB    . ARG D 1 235 ? 4.715   54.112 31.624 1.00 62.61  ? 294 ARG D CB    1 
ATOM   10114 C  CG    . ARG D 1 235 ? 5.240   52.796 31.125 1.00 62.61  ? 294 ARG D CG    1 
ATOM   10115 C  CD    . ARG D 1 235 ? 6.427   52.317 31.943 1.00 62.61  ? 294 ARG D CD    1 
ATOM   10116 N  NE    . ARG D 1 235 ? 7.614   53.140 31.746 1.00 62.61  ? 294 ARG D NE    1 
ATOM   10117 C  CZ    . ARG D 1 235 ? 8.537   53.341 32.680 1.00 62.61  ? 294 ARG D CZ    1 
ATOM   10118 N  NH1   . ARG D 1 235 ? 8.401   52.780 33.878 1.00 62.61  ? 294 ARG D NH1   1 
ATOM   10119 N  NH2   . ARG D 1 235 ? 9.608   54.083 32.409 1.00 62.61  ? 294 ARG D NH2   1 
ATOM   10120 H  H     . ARG D 1 235 ? 3.825   54.784 29.281 1.00 0.00   ? 294 ARG D H     1 
ATOM   10121 H  HE    . ARG D 1 235 ? 7.744   53.572 30.877 1.00 0.00   ? 294 ARG D HE    1 
ATOM   10122 H  HH11  . ARG D 1 235 ? 7.600   52.215 34.074 1.00 0.00   ? 294 ARG D HH11  1 
ATOM   10123 H  HH12  . ARG D 1 235 ? 9.087   52.924 34.592 1.00 0.00   ? 294 ARG D HH12  1 
ATOM   10124 H  HH21  . ARG D 1 235 ? 9.722   54.501 31.509 1.00 0.00   ? 294 ARG D HH21  1 
ATOM   10125 H  HH22  . ARG D 1 235 ? 10.297  54.231 33.121 1.00 0.00   ? 294 ARG D HH22  1 
ATOM   10126 N  N     . LEU D 1 236 ? 3.061   56.750 31.445 1.00 29.06  ? 295 LEU D N     1 
ATOM   10127 C  CA    . LEU D 1 236 ? 2.641   58.031 31.983 1.00 29.06  ? 295 LEU D CA    1 
ATOM   10128 C  C     . LEU D 1 236 ? 1.129   58.057 31.902 1.00 29.06  ? 295 LEU D C     1 
ATOM   10129 O  O     . LEU D 1 236 ? 0.445   58.256 32.890 1.00 19.47  ? 295 LEU D O     1 
ATOM   10130 C  CB    . LEU D 1 236 ? 3.165   59.161 31.108 1.00 19.47  ? 295 LEU D CB    1 
ATOM   10131 C  CG    . LEU D 1 236 ? 3.820   60.393 31.708 1.00 19.47  ? 295 LEU D CG    1 
ATOM   10132 C  CD1   . LEU D 1 236 ? 3.580   61.545 30.802 1.00 19.47  ? 295 LEU D CD1   1 
ATOM   10133 C  CD2   . LEU D 1 236 ? 3.264   60.695 33.071 1.00 19.47  ? 295 LEU D CD2   1 
ATOM   10134 H  H     . LEU D 1 236 ? 3.562   56.756 30.614 1.00 0.00   ? 295 LEU D H     1 
ATOM   10135 N  N     . LEU D 1 237 ? 0.601   57.843 30.711 1.00 24.75  ? 296 LEU D N     1 
ATOM   10136 C  CA    . LEU D 1 237 ? -0.838  57.872 30.537 1.00 24.75  ? 296 LEU D CA    1 
ATOM   10137 C  C     . LEU D 1 237 ? -1.521  57.001 31.562 1.00 24.75  ? 296 LEU D C     1 
ATOM   10138 O  O     . LEU D 1 237 ? -2.657  57.245 31.924 1.00 25.89  ? 296 LEU D O     1 
ATOM   10139 C  CB    . LEU D 1 237 ? -1.204  57.346 29.176 1.00 25.89  ? 296 LEU D CB    1 
ATOM   10140 C  CG    . LEU D 1 237 ? -2.338  58.067 28.494 1.00 25.89  ? 296 LEU D CG    1 
ATOM   10141 C  CD1   . LEU D 1 237 ? -3.107  57.050 27.669 1.00 25.89  ? 296 LEU D CD1   1 
ATOM   10142 C  CD2   . LEU D 1 237 ? -3.225  58.716 29.514 1.00 25.89  ? 296 LEU D CD2   1 
ATOM   10143 H  H     . LEU D 1 237 ? 1.173   57.692 29.931 1.00 0.00   ? 296 LEU D H     1 
ATOM   10144 N  N     . GLY D 1 238 ? -0.834  55.960 32.002 1.00 21.14  ? 297 GLY D N     1 
ATOM   10145 C  CA    . GLY D 1 238 ? -1.426  55.073 32.984 1.00 21.14  ? 297 GLY D CA    1 
ATOM   10146 C  C     . GLY D 1 238 ? -1.544  55.693 34.357 1.00 21.14  ? 297 GLY D C     1 
ATOM   10147 O  O     . GLY D 1 238 ? -2.665  55.847 34.854 1.00 23.32  ? 297 GLY D O     1 
ATOM   10148 H  H     . GLY D 1 238 ? 0.060   55.763 31.661 1.00 0.00   ? 297 GLY D H     1 
ATOM   10149 N  N     . GLN D 1 239 ? -0.409  56.035 34.976 1.00 23.83  ? 298 GLN D N     1 
ATOM   10150 C  CA    . GLN D 1 239 ? -0.447  56.636 36.308 1.00 23.83  ? 298 GLN D CA    1 
ATOM   10151 C  C     . GLN D 1 239 ? -1.251  57.947 36.322 1.00 23.83  ? 298 GLN D C     1 
ATOM   10152 O  O     . GLN D 1 239 ? -2.207  58.078 37.093 1.00 46.01  ? 298 GLN D O     1 
ATOM   10153 C  CB    . GLN D 1 239 ? 0.953   56.763 36.947 1.00 46.01  ? 298 GLN D CB    1 
ATOM   10154 C  CG    . GLN D 1 239 ? 1.948   57.744 36.334 1.00 46.01  ? 298 GLN D CG    1 
ATOM   10155 C  CD    . GLN D 1 239 ? 1.746   59.184 36.786 1.00 46.01  ? 298 GLN D CD    1 
ATOM   10156 O  OE1   . GLN D 1 239 ? 0.796   59.489 37.501 1.00 46.01  ? 298 GLN D OE1   1 
ATOM   10157 N  NE2   . GLN D 1 239 ? 2.634   60.081 36.354 1.00 46.01  ? 298 GLN D NE2   1 
ATOM   10158 H  H     . GLN D 1 239 ? 0.444   55.882 34.515 1.00 0.00   ? 298 GLN D H     1 
ATOM   10159 N  N     . THR D 1 240 ? -0.977  58.841 35.374 1.00 43.58  ? 299 THR D N     1 
ATOM   10160 C  CA    . THR D 1 240 ? -1.714  60.094 35.301 1.00 43.58  ? 299 THR D CA    1 
ATOM   10161 C  C     . THR D 1 240 ? -3.207  59.828 35.225 1.00 43.58  ? 299 THR D C     1 
ATOM   10162 O  O     . THR D 1 240 ? -3.996  60.543 35.810 1.00 29.95  ? 299 THR D O     1 
ATOM   10163 C  CB    . THR D 1 240 ? -1.327  60.921 34.075 1.00 29.95  ? 299 THR D CB    1 
ATOM   10164 O  OG1   . THR D 1 240 ? -1.490  60.130 32.900 1.00 29.95  ? 299 THR D OG1   1 
ATOM   10165 C  CG2   . THR D 1 240 ? 0.096   61.352 34.167 1.00 29.95  ? 299 THR D CG2   1 
ATOM   10166 H  H     . THR D 1 240 ? -0.311  58.646 34.685 1.00 0.00   ? 299 THR D H     1 
ATOM   10167 H  HG1   . THR D 1 240 ? -1.233  60.637 32.126 1.00 30.00  ? 299 THR D HG1   1 
ATOM   10168 N  N     . SER D 1 241 ? -3.600  58.786 34.515 1.00 17.73  ? 300 SER D N     1 
ATOM   10169 C  CA    . SER D 1 241 ? -5.011  58.491 34.394 1.00 17.73  ? 300 SER D CA    1 
ATOM   10170 C  C     . SER D 1 241 ? -5.596  58.036 35.695 1.00 17.73  ? 300 SER D C     1 
ATOM   10171 O  O     . SER D 1 241 ? -6.630  58.536 36.090 1.00 26.92  ? 300 SER D O     1 
ATOM   10172 C  CB    . SER D 1 241 ? -5.285  57.413 33.343 1.00 26.92  ? 300 SER D CB    1 
ATOM   10173 O  OG    . SER D 1 241 ? -5.544  57.984 32.079 1.00 26.92  ? 300 SER D OG    1 
ATOM   10174 H  H     . SER D 1 241 ? -2.945  58.228 34.049 1.00 0.00   ? 300 SER D H     1 
ATOM   10175 H  HG    . SER D 1 241 ? -4.683  58.318 31.795 1.00 30.00  ? 300 SER D HG    1 
ATOM   10176 N  N     . VAL D 1 242 ? -4.953  57.074 36.351 1.00 31.89  ? 301 VAL D N     1 
ATOM   10177 C  CA    . VAL D 1 242 ? -5.482  56.527 37.599 1.00 31.89  ? 301 VAL D CA    1 
ATOM   10178 C  C     . VAL D 1 242 ? -5.546  57.540 38.729 1.00 31.89  ? 301 VAL D C     1 
ATOM   10179 O  O     . VAL D 1 242 ? -6.586  57.702 39.360 1.00 36.55  ? 301 VAL D O     1 
ATOM   10180 C  CB    . VAL D 1 242 ? -4.698  55.305 38.052 1.00 36.55  ? 301 VAL D CB    1 
ATOM   10181 C  CG1   . VAL D 1 242 ? -5.229  54.818 39.367 1.00 36.55  ? 301 VAL D CG1   1 
ATOM   10182 C  CG2   . VAL D 1 242 ? -4.803  54.208 37.027 1.00 36.55  ? 301 VAL D CG2   1 
ATOM   10183 H  H     . VAL D 1 242 ? -4.102  56.741 35.983 1.00 0.00   ? 301 VAL D H     1 
ATOM   10184 N  N     . ASP D 1 243 ? -4.443  58.237 38.962 1.00 26.66  ? 302 ASP D N     1 
ATOM   10185 C  CA    . ASP D 1 243 ? -4.390  59.243 39.995 1.00 26.66  ? 302 ASP D CA    1 
ATOM   10186 C  C     . ASP D 1 243 ? -5.527  60.239 39.885 1.00 26.66  ? 302 ASP D C     1 
ATOM   10187 O  O     . ASP D 1 243 ? -6.326  60.387 40.806 1.00 32.68  ? 302 ASP D O     1 
ATOM   10188 C  CB    . ASP D 1 243 ? -3.069  59.981 39.916 1.00 32.68  ? 302 ASP D CB    1 
ATOM   10189 C  CG    . ASP D 1 243 ? -1.930  59.173 40.459 1.00 32.68  ? 302 ASP D CG    1 
ATOM   10190 O  OD1   . ASP D 1 243 ? -2.162  58.018 40.859 1.00 32.68  ? 302 ASP D OD1   1 
ATOM   10191 O  OD2   . ASP D 1 243 ? -0.801  59.705 40.499 1.00 32.68  ? 302 ASP D OD2   1 
ATOM   10192 H  H     . ASP D 1 243 ? -3.641  58.069 38.422 1.00 0.00   ? 302 ASP D H     1 
ATOM   10193 N  N     . ARG D 1 244 ? -5.602  60.910 38.744 1.00 22.57  ? 303 ARG D N     1 
ATOM   10194 C  CA    . ARG D 1 244 ? -6.644  61.905 38.508 1.00 22.57  ? 303 ARG D CA    1 
ATOM   10195 C  C     . ARG D 1 244 ? -8.037  61.311 38.623 1.00 22.57  ? 303 ARG D C     1 
ATOM   10196 O  O     . ARG D 1 244 ? -8.930  61.952 39.183 1.00 32.90  ? 303 ARG D O     1 
ATOM   10197 C  CB    . ARG D 1 244 ? -6.471  62.608 37.161 1.00 32.90  ? 303 ARG D CB    1 
ATOM   10198 C  CG    . ARG D 1 244 ? -7.504  63.699 36.921 1.00 32.90  ? 303 ARG D CG    1 
ATOM   10199 C  CD    . ARG D 1 244 ? -7.212  64.523 35.675 1.00 32.90  ? 303 ARG D CD    1 
ATOM   10200 N  NE    . ARG D 1 244 ? -8.312  65.436 35.370 1.00 32.90  ? 303 ARG D NE    1 
ATOM   10201 C  CZ    . ARG D 1 244 ? -8.706  65.785 34.146 1.00 32.90  ? 303 ARG D CZ    1 
ATOM   10202 N  NH1   . ARG D 1 244 ? -8.104  65.314 33.063 1.00 32.90  ? 303 ARG D NH1   1 
ATOM   10203 N  NH2   . ARG D 1 244 ? -9.714  66.625 34.010 1.00 32.90  ? 303 ARG D NH2   1 
ATOM   10204 H  H     . ARG D 1 244 ? -4.952  60.733 38.030 1.00 0.00   ? 303 ARG D H     1 
ATOM   10205 H  HE    . ARG D 1 244 ? -8.799  65.828 36.126 1.00 0.00   ? 303 ARG D HE    1 
ATOM   10206 H  HH11  . ARG D 1 244 ? -7.332  64.685 33.145 1.00 0.00   ? 303 ARG D HH11  1 
ATOM   10207 H  HH12  . ARG D 1 244 ? -8.423  65.597 32.158 1.00 0.00   ? 303 ARG D HH12  1 
ATOM   10208 H  HH21  . ARG D 1 244 ? -10.144 66.984 34.838 1.00 0.00   ? 303 ARG D HH21  1 
ATOM   10209 H  HH22  . ARG D 1 244 ? -10.091 66.865 33.130 1.00 0.00   ? 303 ARG D HH22  1 
ATOM   10210 N  N     . LEU D 1 245 ? -8.212  60.067 38.184 1.00 39.11  ? 304 LEU D N     1 
ATOM   10211 C  CA    . LEU D 1 245 ? -9.518  59.419 38.262 1.00 39.11  ? 304 LEU D CA    1 
ATOM   10212 C  C     . LEU D 1 245 ? -9.967  59.383 39.712 1.00 39.11  ? 304 LEU D C     1 
ATOM   10213 O  O     . LEU D 1 245 ? -11.119 59.674 40.022 1.00 37.23  ? 304 LEU D O     1 
ATOM   10214 C  CB    . LEU D 1 245 ? -9.453  57.999 37.696 1.00 37.23  ? 304 LEU D CB    1 
ATOM   10215 C  CG    . LEU D 1 245 ? -10.758 57.300 37.305 1.00 37.23  ? 304 LEU D CG    1 
ATOM   10216 C  CD1   . LEU D 1 245 ? -11.131 56.227 38.320 1.00 37.23  ? 304 LEU D CD1   1 
ATOM   10217 C  CD2   . LEU D 1 245 ? -11.859 58.341 37.119 1.00 37.23  ? 304 LEU D CD2   1 
ATOM   10218 H  H     . LEU D 1 245 ? -7.458  59.579 37.781 1.00 0.00   ? 304 LEU D H     1 
ATOM   10219 N  N     . LEU D 1 246 ? -9.045  59.050 40.603 1.00 28.49  ? 305 LEU D N     1 
ATOM   10220 C  CA    . LEU D 1 246 ? -9.365  59.005 42.010 1.00 28.49  ? 305 LEU D CA    1 
ATOM   10221 C  C     . LEU D 1 246 ? -9.651  60.426 42.506 1.00 28.49  ? 305 LEU D C     1 
ATOM   10222 O  O     . LEU D 1 246 ? -10.627 60.644 43.226 1.00 37.46  ? 305 LEU D O     1 
ATOM   10223 C  CB    . LEU D 1 246 ? -8.207  58.402 42.789 1.00 37.46  ? 305 LEU D CB    1 
ATOM   10224 C  CG    . LEU D 1 246 ? -7.790  57.011 42.338 1.00 37.46  ? 305 LEU D CG    1 
ATOM   10225 C  CD1   . LEU D 1 246 ? -6.541  56.628 43.073 1.00 37.46  ? 305 LEU D CD1   1 
ATOM   10226 C  CD2   . LEU D 1 246 ? -8.891  55.995 42.581 1.00 37.46  ? 305 LEU D CD2   1 
ATOM   10227 H  H     . LEU D 1 246 ? -8.133  58.838 40.305 1.00 0.00   ? 305 LEU D H     1 
ATOM   10228 N  N     . GLN D 1 247 ? -8.808  61.393 42.127 1.00 16.06  ? 306 GLN D N     1 
ATOM   10229 C  CA    . GLN D 1 247 ? -9.001  62.781 42.540 1.00 16.06  ? 306 GLN D CA    1 
ATOM   10230 C  C     . GLN D 1 247 ? -10.435 63.137 42.220 1.00 16.06  ? 306 GLN D C     1 
ATOM   10231 O  O     . GLN D 1 247 ? -11.136 63.729 43.035 1.00 75.69  ? 306 GLN D O     1 
ATOM   10232 C  CB    . GLN D 1 247 ? -8.065  63.703 41.774 1.00 75.69  ? 306 GLN D CB    1 
ATOM   10233 C  CG    . GLN D 1 247 ? -6.605  63.453 42.054 1.00 75.69  ? 306 GLN D CG    1 
ATOM   10234 C  CD    . GLN D 1 247 ? -5.698  64.494 41.416 1.00 75.69  ? 306 GLN D CD    1 
ATOM   10235 O  OE1   . GLN D 1 247 ? -5.583  64.574 40.192 1.00 75.69  ? 306 GLN D OE1   1 
ATOM   10236 N  NE2   . GLN D 1 247 ? -5.039  65.289 42.248 1.00 75.69  ? 306 GLN D NE2   1 
ATOM   10237 H  H     . GLN D 1 247 ? -8.047  61.154 41.560 1.00 0.00   ? 306 GLN D H     1 
ATOM   10238 N  N     . LEU D 1 248 ? -10.863 62.732 41.034 1.00 49.09  ? 307 LEU D N     1 
ATOM   10239 C  CA    . LEU D 1 248 ? -12.218 62.966 40.568 1.00 49.09  ? 307 LEU D CA    1 
ATOM   10240 C  C     . LEU D 1 248 ? -13.240 62.397 41.565 1.00 49.09  ? 307 LEU D C     1 
ATOM   10241 O  O     . LEU D 1 248 ? -14.175 63.088 41.986 1.00 55.67  ? 307 LEU D O     1 
ATOM   10242 C  CB    . LEU D 1 248 ? -12.407 62.329 39.188 1.00 55.67  ? 307 LEU D CB    1 
ATOM   10243 C  CG    . LEU D 1 248 ? -12.156 63.180 37.942 1.00 55.67  ? 307 LEU D CG    1 
ATOM   10244 C  CD1   . LEU D 1 248 ? -10.904 64.002 38.083 1.00 55.67  ? 307 LEU D CD1   1 
ATOM   10245 C  CD2   . LEU D 1 248 ? -12.079 62.287 36.721 1.00 55.67  ? 307 LEU D CD2   1 
ATOM   10246 H  H     . LEU D 1 248 ? -10.244 62.244 40.461 1.00 0.00   ? 307 LEU D H     1 
ATOM   10247 N  N     . SER D 1 249 ? -13.039 61.148 41.968 1.00 51.98  ? 308 SER D N     1 
ATOM   10248 C  CA    . SER D 1 249 ? -13.933 60.496 42.919 1.00 51.98  ? 308 SER D CA    1 
ATOM   10249 C  C     . SER D 1 249 ? -13.745 61.011 44.353 1.00 51.98  ? 308 SER D C     1 
ATOM   10250 O  O     . SER D 1 249 ? -14.165 60.368 45.312 1.00 60.55  ? 308 SER D O     1 
ATOM   10251 C  CB    . SER D 1 249 ? -13.742 58.970 42.864 1.00 60.55  ? 308 SER D CB    1 
ATOM   10252 O  OG    . SER D 1 249 ? -12.371 58.600 42.853 1.00 60.55  ? 308 SER D OG    1 
ATOM   10253 H  H     . SER D 1 249 ? -12.273 60.623 41.644 1.00 0.00   ? 308 SER D H     1 
ATOM   10254 H  HG    . SER D 1 249 ? -12.345 57.643 42.856 1.00 30.00  ? 308 SER D HG    1 
ATOM   10255 N  N     . GLN D 1 250 ? -13.065 62.142 44.495 1.00 29.51  ? 309 GLN D N     1 
ATOM   10256 C  CA    . GLN D 1 250 ? -12.825 62.723 45.799 1.00 29.51  ? 309 GLN D CA    1 
ATOM   10257 C  C     . GLN D 1 250 ? -12.992 64.230 45.743 1.00 29.51  ? 309 GLN D C     1 
ATOM   10258 O  O     . GLN D 1 250 ? -12.540 64.937 46.639 1.00 93.96  ? 309 GLN D O     1 
ATOM   10259 C  CB    . GLN D 1 250 ? -11.422 62.375 46.291 1.00 93.96  ? 309 GLN D CB    1 
ATOM   10260 C  CG    . GLN D 1 250 ? -11.234 60.923 46.678 1.00 93.96  ? 309 GLN D CG    1 
ATOM   10261 C  CD    . GLN D 1 250 ? -9.797  60.599 47.060 1.00 93.96  ? 309 GLN D CD    1 
ATOM   10262 O  OE1   . GLN D 1 250 ? -9.190  61.278 47.893 1.00 93.96  ? 309 GLN D OE1   1 
ATOM   10263 N  NE2   . GLN D 1 250 ? -9.248  59.549 46.458 1.00 93.96  ? 309 GLN D NE2   1 
ATOM   10264 H  H     . GLN D 1 250 ? -12.654 62.586 43.732 1.00 0.00   ? 309 GLN D H     1 
ATOM   10265 N  N     . GLY D 1 251 ? -13.632 64.715 44.688 1.00 35.43  ? 310 GLY D N     1 
ATOM   10266 C  CA    . GLY D 1 251 ? -13.852 66.140 44.539 1.00 35.43  ? 310 GLY D CA    1 
ATOM   10267 C  C     . GLY D 1 251 ? -12.612 66.973 44.263 1.00 35.43  ? 310 GLY D C     1 
ATOM   10268 O  O     . GLY D 1 251 ? -12.731 68.164 43.967 1.00 68.78  ? 310 GLY D O     1 
ATOM   10269 H  H     . GLY D 1 251 ? -13.969 64.106 43.994 1.00 0.00   ? 310 GLY D H     1 
ATOM   10270 N  N     . GLN D 1 252 ? -11.433 66.354 44.330 1.00 62.76  ? 311 GLN D N     1 
ATOM   10271 C  CA    . GLN D 1 252 ? -10.161 67.038 44.088 1.00 62.76  ? 311 GLN D CA    1 
ATOM   10272 C  C     . GLN D 1 252 ? -9.799  66.919 42.609 1.00 62.76  ? 311 GLN D C     1 
ATOM   10273 O  O     . GLN D 1 252 ? -8.674  66.583 42.248 1.00 119.36 ? 311 GLN D O     1 
ATOM   10274 C  CB    . GLN D 1 252 ? -9.059  66.417 44.957 1.00 119.36 ? 311 GLN D CB    1 
ATOM   10275 C  CG    . GLN D 1 252 ? -7.731  67.169 44.924 1.00 119.36 ? 311 GLN D CG    1 
ATOM   10276 C  CD    . GLN D 1 252 ? -6.624  66.454 45.681 1.00 119.36 ? 311 GLN D CD    1 
ATOM   10277 O  OE1   . GLN D 1 252 ? -6.118  65.420 45.242 1.00 119.36 ? 311 GLN D OE1   1 
ATOM   10278 N  NE2   . GLN D 1 252 ? -6.232  67.012 46.817 1.00 119.36 ? 311 GLN D NE2   1 
ATOM   10279 H  H     . GLN D 1 252 ? -11.392 65.399 44.529 1.00 0.00   ? 311 GLN D H     1 
ATOM   10280 N  N     . ALA D 1 253 ? -10.771 67.212 41.757 1.00 110.16 ? 312 ALA D N     1 
ATOM   10281 C  CA    . ALA D 1 253 ? -10.598 67.120 40.314 1.00 110.16 ? 312 ALA D CA    1 
ATOM   10282 C  C     . ALA D 1 253 ? -9.933  68.336 39.681 1.00 110.16 ? 312 ALA D C     1 
ATOM   10283 O  O     . ALA D 1 253 ? -9.857  69.408 40.280 1.00 69.54  ? 312 ALA D O     1 
ATOM   10284 C  CB    . ALA D 1 253 ? -11.955 66.872 39.650 1.00 69.54  ? 312 ALA D CB    1 
ATOM   10285 H  H     . ALA D 1 253 ? -11.616 67.548 42.122 1.00 0.00   ? 312 ALA D H     1 
ATOM   10286 N  N     . VAL D 1 254 ? -9.420  68.136 38.473 1.00 80.19  ? 313 VAL D N     1 
ATOM   10287 C  CA    . VAL D 1 254 ? -8.801  69.205 37.707 1.00 80.19  ? 313 VAL D CA    1 
ATOM   10288 C  C     . VAL D 1 254 ? -9.883  69.605 36.701 1.00 80.19  ? 313 VAL D C     1 
ATOM   10289 O  O     . VAL D 1 254 ? -9.952  70.742 36.222 1.00 52.34  ? 313 VAL D O     1 
ATOM   10290 C  CB    . VAL D 1 254 ? -7.531  68.705 37.014 1.00 52.34  ? 313 VAL D CB    1 
ATOM   10291 C  CG1   . VAL D 1 254 ? -6.883  69.816 36.206 1.00 52.34  ? 313 VAL D CG1   1 
ATOM   10292 C  CG2   . VAL D 1 254 ? -6.562  68.187 38.063 1.00 52.34  ? 313 VAL D CG2   1 
ATOM   10293 H  H     . VAL D 1 254 ? -9.418  67.225 38.125 1.00 0.00   ? 313 VAL D H     1 
ATOM   10294 N  N     . LYS D 1 255 ? -10.739 68.638 36.404 1.00 61.85  ? 314 LYS D N     1 
ATOM   10295 C  CA    . LYS D 1 255 ? -11.879 68.823 35.515 1.00 61.85  ? 314 LYS D CA    1 
ATOM   10296 C  C     . LYS D 1 255 ? -11.669 69.076 34.017 1.00 61.85  ? 314 LYS D C     1 
ATOM   10297 O  O     . LYS D 1 255 ? -12.483 68.634 33.201 1.00 122.94 ? 314 LYS D O     1 
ATOM   10298 C  CB    . LYS D 1 255 ? -12.843 69.856 36.115 1.00 122.94 ? 314 LYS D CB    1 
ATOM   10299 C  CG    . LYS D 1 255 ? -13.509 69.374 37.401 1.00 122.94 ? 314 LYS D CG    1 
ATOM   10300 C  CD    . LYS D 1 255 ? -14.672 70.259 37.812 1.00 122.94 ? 314 LYS D CD    1 
ATOM   10301 C  CE    . LYS D 1 255 ? -15.615 69.516 38.748 1.00 122.94 ? 314 LYS D CE    1 
ATOM   10302 N  NZ    . LYS D 1 255 ? -16.190 68.297 38.100 1.00 122.94 ? 314 LYS D NZ    1 
ATOM   10303 H  H     . LYS D 1 255 ? -10.594 67.753 36.778 1.00 0.00   ? 314 LYS D H     1 
ATOM   10304 H  HZ1   . LYS D 1 255 ? -16.724 68.568 37.248 1.00 0.00   ? 314 LYS D HZ1   1 
ATOM   10305 H  HZ2   . LYS D 1 255 ? -15.420 67.650 37.835 1.00 0.00   ? 314 LYS D HZ2   1 
ATOM   10306 H  HZ3   . LYS D 1 255 ? -16.829 67.816 38.765 1.00 0.00   ? 314 LYS D HZ3   1 
ATOM   10307 N  N     . GLY D 1 256 ? -10.579 69.728 33.639 1.00 70.63  ? 315 GLY D N     1 
ATOM   10308 C  CA    . GLY D 1 256 ? -10.374 69.996 32.224 1.00 70.63  ? 315 GLY D CA    1 
ATOM   10309 C  C     . GLY D 1 256 ? -9.639  68.935 31.431 1.00 70.63  ? 315 GLY D C     1 
ATOM   10310 O  O     . GLY D 1 256 ? -9.594  67.771 31.834 1.00 34.25  ? 315 GLY D O     1 
ATOM   10311 H  H     . GLY D 1 256 ? -9.935  70.056 34.297 1.00 0.00   ? 315 GLY D H     1 
ATOM   10312 N  N     . ASN D 1 257 ? -9.118  69.347 30.269 1.00 54.25  ? 316 ASN D N     1 
ATOM   10313 C  CA    . ASN D 1 257 ? -8.330  68.481 29.378 1.00 54.25  ? 316 ASN D CA    1 
ATOM   10314 C  C     . ASN D 1 257 ? -6.899  68.616 29.850 1.00 54.25  ? 316 ASN D C     1 
ATOM   10315 O  O     . ASN D 1 257 ? -6.558  69.584 30.533 1.00 36.27  ? 316 ASN D O     1 
ATOM   10316 C  CB    . ASN D 1 257 ? -8.436  68.938 27.903 1.00 36.27  ? 316 ASN D CB    1 
ATOM   10317 C  CG    . ASN D 1 257 ? -7.261  68.448 27.030 1.00 36.27  ? 316 ASN D CG    1 
ATOM   10318 O  OD1   . ASN D 1 257 ? -7.102  67.248 26.774 1.00 36.27  ? 316 ASN D OD1   1 
ATOM   10319 N  ND2   . ASN D 1 257 ? -6.433  69.384 26.583 1.00 36.27  ? 316 ASN D ND2   1 
ATOM   10320 H  H     . ASN D 1 257 ? -9.250  70.277 30.012 1.00 0.00   ? 316 ASN D H     1 
ATOM   10321 H  HD21  . ASN D 1 257 ? -5.691  69.051 26.041 1.00 0.00   ? 316 ASN D HD21  1 
ATOM   10322 H  HD22  . ASN D 1 257 ? -6.592  70.325 26.800 1.00 0.00   ? 316 ASN D HD22  1 
ATOM   10323 N  N     . GLN D 1 258 ? -6.066  67.638 29.537 1.00 37.45  ? 317 GLN D N     1 
ATOM   10324 C  CA    . GLN D 1 258 ? -4.681  67.720 29.941 1.00 37.45  ? 317 GLN D CA    1 
ATOM   10325 C  C     . GLN D 1 258 ? -3.810  67.151 28.830 1.00 37.45  ? 317 GLN D C     1 
ATOM   10326 O  O     . GLN D 1 258 ? -4.225  66.229 28.124 1.00 47.80  ? 317 GLN D O     1 
ATOM   10327 C  CB    . GLN D 1 258 ? -4.481  67.021 31.285 1.00 47.80  ? 317 GLN D CB    1 
ATOM   10328 C  CG    . GLN D 1 258 ? -5.345  67.635 32.379 1.00 47.80  ? 317 GLN D CG    1 
ATOM   10329 C  CD    . GLN D 1 258 ? -5.148  67.006 33.729 1.00 47.80  ? 317 GLN D CD    1 
ATOM   10330 O  OE1   . GLN D 1 258 ? -5.326  65.804 33.907 1.00 47.80  ? 317 GLN D OE1   1 
ATOM   10331 N  NE2   . GLN D 1 258 ? -4.790  67.824 34.702 1.00 47.80  ? 317 GLN D NE2   1 
ATOM   10332 H  H     . GLN D 1 258 ? -6.377  66.849 29.038 1.00 0.00   ? 317 GLN D H     1 
ATOM   10333 N  N     . LEU D 1 259 ? -2.647  67.770 28.621 1.00 37.14  ? 318 LEU D N     1 
ATOM   10334 C  CA    . LEU D 1 259 ? -1.725  67.341 27.571 1.00 37.14  ? 318 LEU D CA    1 
ATOM   10335 C  C     . LEU D 1 259 ? -0.421  66.768 28.066 1.00 37.14  ? 318 LEU D C     1 
ATOM   10336 O  O     . LEU D 1 259 ? 0.348   67.423 28.794 1.00 23.61  ? 318 LEU D O     1 
ATOM   10337 C  CB    . LEU D 1 259 ? -1.418  68.464 26.579 1.00 23.61  ? 318 LEU D CB    1 
ATOM   10338 C  CG    . LEU D 1 259 ? -2.595  69.006 25.774 1.00 23.61  ? 318 LEU D CG    1 
ATOM   10339 C  CD1   . LEU D 1 259 ? -2.190  70.330 25.138 1.00 23.61  ? 318 LEU D CD1   1 
ATOM   10340 C  CD2   . LEU D 1 259 ? -3.038  67.989 24.738 1.00 23.61  ? 318 LEU D CD2   1 
ATOM   10341 H  H     . LEU D 1 259 ? -2.369  68.502 29.207 1.00 0.00   ? 318 LEU D H     1 
ATOM   10342 N  N     . LEU D 1 260 ? -0.185  65.543 27.607 1.00 21.54  ? 319 LEU D N     1 
ATOM   10343 C  CA    . LEU D 1 260 ? 1.003   64.778 27.911 1.00 21.54  ? 319 LEU D CA    1 
ATOM   10344 C  C     . LEU D 1 260 ? 2.032   65.029 26.811 1.00 21.54  ? 319 LEU D C     1 
ATOM   10345 O  O     . LEU D 1 260 ? 1.670   65.270 25.664 1.00 20.25  ? 319 LEU D O     1 
ATOM   10346 C  CB    . LEU D 1 260 ? 0.629   63.300 27.939 1.00 20.25  ? 319 LEU D CB    1 
ATOM   10347 C  CG    . LEU D 1 260 ? -0.116  62.878 29.189 1.00 20.25  ? 319 LEU D CG    1 
ATOM   10348 C  CD1   . LEU D 1 260 ? -0.427  61.415 29.134 1.00 20.25  ? 319 LEU D CD1   1 
ATOM   10349 C  CD2   . LEU D 1 260 ? 0.795   63.156 30.367 1.00 20.25  ? 319 LEU D CD2   1 
ATOM   10350 H  H     . LEU D 1 260 ? -0.877  65.155 27.027 1.00 0.00   ? 319 LEU D H     1 
ATOM   10351 N  N     . PRO D 1 261 ? 3.326   65.017 27.149 1.00 24.64  ? 320 PRO D N     1 
ATOM   10352 C  CA    . PRO D 1 261 ? 4.333   65.247 26.120 1.00 24.64  ? 320 PRO D CA    1 
ATOM   10353 C  C     . PRO D 1 261 ? 4.397   64.120 25.075 1.00 24.64  ? 320 PRO D C     1 
ATOM   10354 O  O     . PRO D 1 261 ? 3.596   63.191 25.083 1.00 52.54  ? 320 PRO D O     1 
ATOM   10355 C  CB    . PRO D 1 261 ? 5.624   65.363 26.936 1.00 52.54  ? 320 PRO D CB    1 
ATOM   10356 C  CG    . PRO D 1 261 ? 5.377   64.505 28.099 1.00 52.54  ? 320 PRO D CG    1 
ATOM   10357 C  CD    . PRO D 1 261 ? 3.962   64.893 28.471 1.00 52.54  ? 320 PRO D CD    1 
ATOM   10358 N  N     . VAL D 1 262 ? 5.386   64.212 24.198 1.00 31.36  ? 321 VAL D N     1 
ATOM   10359 C  CA    . VAL D 1 262 ? 5.595   63.262 23.122 1.00 31.36  ? 321 VAL D CA    1 
ATOM   10360 C  C     . VAL D 1 262 ? 7.054   63.540 22.683 1.00 31.36  ? 321 VAL D C     1 
ATOM   10361 O  O     . VAL D 1 262 ? 7.597   64.593 23.026 1.00 30.14  ? 321 VAL D O     1 
ATOM   10362 C  CB    . VAL D 1 262 ? 4.562   63.576 22.005 1.00 30.14  ? 321 VAL D CB    1 
ATOM   10363 C  CG1   . VAL D 1 262 ? 5.034   64.738 21.134 1.00 30.14  ? 321 VAL D CG1   1 
ATOM   10364 C  CG2   . VAL D 1 262 ? 4.211   62.357 21.214 1.00 30.14  ? 321 VAL D CG2   1 
ATOM   10365 H  H     . VAL D 1 262 ? 6.034   64.950 24.251 1.00 0.00   ? 321 VAL D H     1 
ATOM   10366 N  N     . SER D 1 263 ? 7.721   62.600 22.010 1.00 20.73  ? 322 SER D N     1 
ATOM   10367 C  CA    . SER D 1 263 ? 9.108   62.822 21.575 1.00 20.73  ? 322 SER D CA    1 
ATOM   10368 C  C     . SER D 1 263 ? 9.515   61.895 20.433 1.00 20.73  ? 322 SER D C     1 
ATOM   10369 O  O     . SER D 1 263 ? 9.011   60.785 20.329 1.00 30.39  ? 322 SER D O     1 
ATOM   10370 C  CB    . SER D 1 263 ? 10.072  62.654 22.747 1.00 30.39  ? 322 SER D CB    1 
ATOM   10371 O  OG    . SER D 1 263 ? 10.052  61.330 23.264 1.00 30.39  ? 322 SER D OG    1 
ATOM   10372 H  H     . SER D 1 263 ? 7.314   61.726 21.816 1.00 0.00   ? 322 SER D H     1 
ATOM   10373 H  HG    . SER D 1 263 ? 9.200   61.134 23.669 1.00 30.00  ? 322 SER D HG    1 
ATOM   10374 N  N     . LEU D 1 264 ? 10.391  62.366 19.552 1.00 29.77  ? 323 LEU D N     1 
ATOM   10375 C  CA    . LEU D 1 264 ? 10.827  61.569 18.425 1.00 29.77  ? 323 LEU D CA    1 
ATOM   10376 C  C     . LEU D 1 264 ? 11.982  60.672 18.831 1.00 29.77  ? 323 LEU D C     1 
ATOM   10377 O  O     . LEU D 1 264 ? 13.063  61.156 19.194 1.00 2.00   ? 323 LEU D O     1 
ATOM   10378 C  CB    . LEU D 1 264 ? 11.262  62.465 17.247 1.00 2.00   ? 323 LEU D CB    1 
ATOM   10379 C  CG    . LEU D 1 264 ? 11.844  61.847 15.960 1.00 2.00   ? 323 LEU D CG    1 
ATOM   10380 C  CD1   . LEU D 1 264 ? 10.771  61.497 15.005 1.00 2.00   ? 323 LEU D CD1   1 
ATOM   10381 C  CD2   . LEU D 1 264 ? 12.719  62.837 15.279 1.00 2.00   ? 323 LEU D CD2   1 
ATOM   10382 H  H     . LEU D 1 264 ? 10.766  63.263 19.649 1.00 0.00   ? 323 LEU D H     1 
ATOM   10383 N  N     . VAL D 1 265 ? 11.723  59.372 18.854 1.00 20.44  ? 324 VAL D N     1 
ATOM   10384 C  CA    . VAL D 1 265 ? 12.757  58.393 19.146 1.00 20.44  ? 324 VAL D CA    1 
ATOM   10385 C  C     . VAL D 1 265 ? 13.318  58.067 17.768 1.00 20.44  ? 324 VAL D C     1 
ATOM   10386 O  O     . VAL D 1 265 ? 12.642  57.408 16.968 1.00 2.00   ? 324 VAL D O     1 
ATOM   10387 C  CB    . VAL D 1 265 ? 12.167  57.085 19.728 1.00 2.00   ? 324 VAL D CB    1 
ATOM   10388 C  CG1   . VAL D 1 265 ? 13.257  56.091 20.013 1.00 2.00   ? 324 VAL D CG1   1 
ATOM   10389 C  CG2   . VAL D 1 265 ? 11.400  57.379 21.003 1.00 2.00   ? 324 VAL D CG2   1 
ATOM   10390 H  H     . VAL D 1 265 ? 10.805  59.074 18.732 1.00 0.00   ? 324 VAL D H     1 
ATOM   10391 N  N     . LYS D 1 266 ? 14.490  58.609 17.444 1.00 13.62  ? 325 LYS D N     1 
ATOM   10392 C  CA    . LYS D 1 266 ? 15.098  58.319 16.146 1.00 13.62  ? 325 LYS D CA    1 
ATOM   10393 C  C     . LYS D 1 266 ? 15.954  57.067 16.207 1.00 13.62  ? 325 LYS D C     1 
ATOM   10394 O  O     . LYS D 1 266 ? 16.797  56.913 17.083 1.00 34.02  ? 325 LYS D O     1 
ATOM   10395 C  CB    . LYS D 1 266 ? 15.888  59.519 15.602 1.00 34.02  ? 325 LYS D CB    1 
ATOM   10396 C  CG    . LYS D 1 266 ? 16.926  60.062 16.519 1.00 34.02  ? 325 LYS D CG    1 
ATOM   10397 C  CD    . LYS D 1 266 ? 17.636  61.239 15.895 1.00 34.02  ? 325 LYS D CD    1 
ATOM   10398 C  CE    . LYS D 1 266 ? 16.719  62.432 15.744 1.00 34.02  ? 325 LYS D CE    1 
ATOM   10399 N  NZ    . LYS D 1 266 ? 17.498  63.718 15.734 1.00 34.02  ? 325 LYS D NZ    1 
ATOM   10400 H  H     . LYS D 1 266 ? 14.918  59.241 18.068 1.00 0.00   ? 325 LYS D H     1 
ATOM   10401 H  HZ1   . LYS D 1 266 ? 18.177  63.718 14.946 1.00 0.00   ? 325 LYS D HZ1   1 
ATOM   10402 H  HZ2   . LYS D 1 266 ? 16.851  64.529 15.638 1.00 0.00   ? 325 LYS D HZ2   1 
ATOM   10403 H  HZ3   . LYS D 1 266 ? 18.015  63.807 16.634 1.00 0.00   ? 325 LYS D HZ3   1 
ATOM   10404 N  N     . ARG D 1 267 ? 15.636  56.136 15.318 1.00 17.63  ? 326 ARG D N     1 
ATOM   10405 C  CA    . ARG D 1 267 ? 16.335  54.873 15.216 1.00 17.63  ? 326 ARG D CA    1 
ATOM   10406 C  C     . ARG D 1 267 ? 16.875  54.628 13.801 1.00 17.63  ? 326 ARG D C     1 
ATOM   10407 O  O     . ARG D 1 267 ? 17.639  55.439 13.321 1.00 22.20  ? 326 ARG D O     1 
ATOM   10408 C  CB    . ARG D 1 267 ? 15.461  53.739 15.706 1.00 22.20  ? 326 ARG D CB    1 
ATOM   10409 C  CG    . ARG D 1 267 ? 15.139  53.843 17.180 1.00 22.20  ? 326 ARG D CG    1 
ATOM   10410 C  CD    . ARG D 1 267 ? 14.285  52.677 17.583 1.00 22.20  ? 326 ARG D CD    1 
ATOM   10411 N  NE    . ARG D 1 267 ? 13.826  52.716 18.957 1.00 22.20  ? 326 ARG D NE    1 
ATOM   10412 C  CZ    . ARG D 1 267 ? 12.545  52.692 19.302 1.00 22.20  ? 326 ARG D CZ    1 
ATOM   10413 N  NH1   . ARG D 1 267 ? 11.584  52.661 18.375 1.00 22.20  ? 326 ARG D NH1   1 
ATOM   10414 N  NH2   . ARG D 1 267 ? 12.228  52.579 20.584 1.00 22.20  ? 326 ARG D NH2   1 
ATOM   10415 H  H     . ARG D 1 267 ? 14.894  56.321 14.730 1.00 0.00   ? 326 ARG D H     1 
ATOM   10416 H  HE    . ARG D 1 267 ? 14.493  52.787 19.671 1.00 0.00   ? 326 ARG D HE    1 
ATOM   10417 H  HH11  . ARG D 1 267 ? 11.820  52.657 17.406 1.00 0.00   ? 326 ARG D HH11  1 
ATOM   10418 H  HH12  . ARG D 1 267 ? 10.627  52.638 18.653 1.00 0.00   ? 326 ARG D HH12  1 
ATOM   10419 H  HH21  . ARG D 1 267 ? 12.952  52.520 21.269 1.00 0.00   ? 326 ARG D HH21  1 
ATOM   10420 H  HH22  . ARG D 1 267 ? 11.272  52.552 20.869 1.00 0.00   ? 326 ARG D HH22  1 
ATOM   10421 N  N     . LYS D 1 268 ? 16.431  53.613 13.071 1.00 2.00   ? 327 LYS D N     1 
ATOM   10422 C  CA    . LYS D 1 268 ? 17.051  53.389 11.767 1.00 2.00   ? 327 LYS D CA    1 
ATOM   10423 C  C     . LYS D 1 268 ? 16.209  53.264 10.492 1.00 2.00   ? 327 LYS D C     1 
ATOM   10424 O  O     . LYS D 1 268 ? 16.685  52.779 9.462  1.00 30.11  ? 327 LYS D O     1 
ATOM   10425 C  CB    . LYS D 1 268 ? 18.061  52.247 11.895 1.00 30.11  ? 327 LYS D CB    1 
ATOM   10426 C  CG    . LYS D 1 268 ? 19.329  52.691 12.622 1.00 30.11  ? 327 LYS D CG    1 
ATOM   10427 C  CD    . LYS D 1 268 ? 19.870  51.641 13.579 1.00 30.11  ? 327 LYS D CD    1 
ATOM   10428 C  CE    . LYS D 1 268 ? 21.096  52.149 14.323 1.00 30.11  ? 327 LYS D CE    1 
ATOM   10429 N  NZ    . LYS D 1 268 ? 20.875  53.479 14.976 1.00 30.11  ? 327 LYS D NZ    1 
ATOM   10430 H  H     . LYS D 1 268 ? 15.739  52.987 13.357 1.00 0.00   ? 327 LYS D H     1 
ATOM   10431 H  HZ1   . LYS D 1 268 ? 20.627  54.181 14.250 1.00 0.00   ? 327 LYS D HZ1   1 
ATOM   10432 H  HZ2   . LYS D 1 268 ? 20.107  53.408 15.674 1.00 0.00   ? 327 LYS D HZ2   1 
ATOM   10433 H  HZ3   . LYS D 1 268 ? 21.758  53.763 15.446 1.00 0.00   ? 327 LYS D HZ3   1 
ATOM   10434 N  N     . THR D 1 269 ? 14.970  53.738 10.552 1.00 18.11  ? 328 THR D N     1 
ATOM   10435 C  CA    . THR D 1 269 ? 14.111  53.690 9.383  1.00 18.11  ? 328 THR D CA    1 
ATOM   10436 C  C     . THR D 1 269 ? 14.114  55.067 8.732  1.00 18.11  ? 328 THR D C     1 
ATOM   10437 O  O     . THR D 1 269 ? 13.339  55.339 7.818  1.00 23.61  ? 328 THR D O     1 
ATOM   10438 C  CB    . THR D 1 269 ? 12.676  53.334 9.762  1.00 23.61  ? 328 THR D CB    1 
ATOM   10439 O  OG1   . THR D 1 269 ? 12.254  54.190 10.823 1.00 23.61  ? 328 THR D OG1   1 
ATOM   10440 C  CG2   . THR D 1 269 ? 12.568  51.897 10.197 1.00 23.61  ? 328 THR D CG2   1 
ATOM   10441 H  H     . THR D 1 269 ? 14.588  54.097 11.370 1.00 0.00   ? 328 THR D H     1 
ATOM   10442 H  HG1   . THR D 1 269 ? 11.623  54.823 10.431 1.00 30.00  ? 328 THR D HG1   1 
ATOM   10443 N  N     . THR D 1 270 ? 15.043  55.913 9.146  1.00 24.85  ? 329 THR D N     1 
ATOM   10444 C  CA    . THR D 1 270 ? 15.091  57.274 8.639  1.00 24.85  ? 329 THR D CA    1 
ATOM   10445 C  C     . THR D 1 270 ? 16.457  57.659 8.076  1.00 24.85  ? 329 THR D C     1 
ATOM   10446 O  O     . THR D 1 270 ? 17.487  57.529 8.753  1.00 36.95  ? 329 THR D O     1 
ATOM   10447 C  CB    . THR D 1 270 ? 14.694  58.231 9.751  1.00 36.95  ? 329 THR D CB    1 
ATOM   10448 O  OG1   . THR D 1 270 ? 14.758  59.563 9.254  1.00 36.95  ? 329 THR D OG1   1 
ATOM   10449 C  CG2   . THR D 1 270 ? 15.627  58.070 10.979 1.00 36.95  ? 329 THR D CG2   1 
ATOM   10450 H  H     . THR D 1 270 ? 15.734  55.636 9.777  1.00 0.00   ? 329 THR D H     1 
ATOM   10451 H  HG1   . THR D 1 270 ? 15.649  59.713 8.909  1.00 30.00  ? 329 THR D HG1   1 
ATOM   10452 N  N     . LEU D 1 271 ? 16.463  58.218 6.870  1.00 19.75  ? 330 LEU D N     1 
ATOM   10453 C  CA    . LEU D 1 271 ? 17.724  58.571 6.226  1.00 19.75  ? 330 LEU D CA    1 
ATOM   10454 C  C     . LEU D 1 271 ? 17.509  59.659 5.222  1.00 19.75  ? 330 LEU D C     1 
ATOM   10455 O  O     . LEU D 1 271 ? 16.394  59.879 4.772  1.00 24.20  ? 330 LEU D O     1 
ATOM   10456 C  CB    . LEU D 1 271 ? 18.238  57.337 5.490  1.00 24.20  ? 330 LEU D CB    1 
ATOM   10457 C  CG    . LEU D 1 271 ? 19.704  57.121 5.192  1.00 24.20  ? 330 LEU D CG    1 
ATOM   10458 C  CD1   . LEU D 1 271 ? 20.507  57.032 6.471  1.00 24.20  ? 330 LEU D CD1   1 
ATOM   10459 C  CD2   . LEU D 1 271 ? 19.787  55.832 4.451  1.00 24.20  ? 330 LEU D CD2   1 
ATOM   10460 H  H     . LEU D 1 271 ? 15.635  58.365 6.358  1.00 0.00   ? 330 LEU D H     1 
ATOM   10461 N  N     . ALA D 1 272 ? 18.574  60.378 4.906  1.00 39.18  ? 331 ALA D N     1 
ATOM   10462 C  CA    . ALA D 1 272 ? 18.475  61.433 3.907  1.00 39.18  ? 331 ALA D CA    1 
ATOM   10463 C  C     . ALA D 1 272 ? 18.192  60.740 2.560  1.00 39.18  ? 331 ALA D C     1 
ATOM   10464 O  O     . ALA D 1 272 ? 18.719  59.653 2.290  1.00 39.45  ? 331 ALA D O     1 
ATOM   10465 C  CB    . ALA D 1 272 ? 19.778  62.225 3.850  1.00 39.45  ? 331 ALA D CB    1 
ATOM   10466 H  H     . ALA D 1 272 ? 19.439  60.179 5.317  1.00 0.00   ? 331 ALA D H     1 
ATOM   10467 N  N     . PRO D 1 273 ? 17.361  61.349 1.698  1.00 29.16  ? 332 PRO D N     1 
ATOM   10468 C  CA    . PRO D 1 273 ? 17.066  60.711 0.413  1.00 29.16  ? 332 PRO D CA    1 
ATOM   10469 C  C     . PRO D 1 273 ? 18.308  60.644 -0.461 1.00 29.16  ? 332 PRO D C     1 
ATOM   10470 O  O     . PRO D 1 273 ? 19.367  61.077 -0.039 1.00 29.63  ? 332 PRO D O     1 
ATOM   10471 C  CB    . PRO D 1 273 ? 15.997  61.624 -0.172 1.00 29.63  ? 332 PRO D CB    1 
ATOM   10472 C  CG    . PRO D 1 273 ? 16.399  62.957 0.335  1.00 29.63  ? 332 PRO D CG    1 
ATOM   10473 C  CD    . PRO D 1 273 ? 16.783  62.703 1.763  1.00 29.63  ? 332 PRO D CD    1 
ATOM   10474 N  N     . ASN D 1 274 ? 18.180  60.043 -1.644 1.00 31.77  ? 333 ASN D N     1 
ATOM   10475 C  CA    . ASN D 1 274 ? 19.278  59.907 -2.620 1.00 31.77  ? 333 ASN D CA    1 
ATOM   10476 C  C     . ASN D 1 274 ? 20.670  59.932 -1.990 1.00 31.77  ? 333 ASN D C     1 
ATOM   10477 O  O     . ASN D 1 274 ? 21.536  60.729 -2.372 1.00 98.50  ? 333 ASN D O     1 
ATOM   10478 C  CB    . ASN D 1 274 ? 19.174  60.998 -3.708 1.00 98.50  ? 333 ASN D CB    1 
ATOM   10479 C  CG    . ASN D 1 274 ? 20.082  60.726 -4.914 1.00 98.50  ? 333 ASN D CG    1 
ATOM   10480 O  OD1   . ASN D 1 274 ? 20.074  59.627 -5.477 1.00 98.50  ? 333 ASN D OD1   1 
ATOM   10481 N  ND2   . ASN D 1 274 ? 20.858  61.730 -5.317 1.00 98.50  ? 333 ASN D ND2   1 
ATOM   10482 H  H     . ASN D 1 274 ? 17.319  59.646 -1.880 1.00 0.00   ? 333 ASN D H     1 
ATOM   10483 H  HD21  . ASN D 1 274 ? 21.402  61.525 -6.105 1.00 0.00   ? 333 ASN D HD21  1 
ATOM   10484 H  HD22  . ASN D 1 274 ? 20.853  62.579 -4.836 1.00 0.00   ? 333 ASN D HD22  1 
ATOM   10485 N  N     . THR D 1 275 ? 20.861  59.093 -0.984 1.00 45.75  ? 334 THR D N     1 
ATOM   10486 C  CA    . THR D 1 275 ? 22.130  59.038 -0.301 1.00 45.75  ? 334 THR D CA    1 
ATOM   10487 C  C     . THR D 1 275 ? 23.035  58.016 -0.927 1.00 45.75  ? 334 THR D C     1 
ATOM   10488 O  O     . THR D 1 275 ? 22.648  56.867 -1.132 1.00 41.59  ? 334 THR D O     1 
ATOM   10489 C  CB    . THR D 1 275 ? 21.937  58.767 1.179  1.00 41.59  ? 334 THR D CB    1 
ATOM   10490 O  OG1   . THR D 1 275 ? 21.443  59.961 1.776  1.00 41.59  ? 334 THR D OG1   1 
ATOM   10491 C  CG2   . THR D 1 275 ? 23.236  58.388 1.850  1.00 41.59  ? 334 THR D CG2   1 
ATOM   10492 H  H     . THR D 1 275 ? 20.152  58.488 -0.693 1.00 0.00   ? 334 THR D H     1 
ATOM   10493 H  HG1   . THR D 1 275 ? 20.575  60.141 1.378  1.00 30.00  ? 334 THR D HG1   1 
ATOM   10494 N  N     . GLN D 1 276 ? 24.192  58.499 -1.354 1.00 52.64  ? 335 GLN D N     1 
ATOM   10495 C  CA    . GLN D 1 276 ? 25.227  57.681 -1.956 1.00 52.64  ? 335 GLN D CA    1 
ATOM   10496 C  C     . GLN D 1 276 ? 26.326  57.969 -0.961 1.00 52.64  ? 335 GLN D C     1 
ATOM   10497 O  O     . GLN D 1 276 ? 26.521  59.126 -0.585 1.00 104.68 ? 335 GLN D O     1 
ATOM   10498 C  CB    . GLN D 1 276 ? 25.570  58.197 -3.360 1.00 104.68 ? 335 GLN D CB    1 
ATOM   10499 C  CG    . GLN D 1 276 ? 24.476  57.891 -4.409 1.00 104.68 ? 335 GLN D CG    1 
ATOM   10500 C  CD    . GLN D 1 276 ? 24.049  59.102 -5.265 1.00 104.68 ? 335 GLN D CD    1 
ATOM   10501 O  OE1   . GLN D 1 276 ? 23.470  58.939 -6.347 1.00 104.68 ? 335 GLN D OE1   1 
ATOM   10502 N  NE2   . GLN D 1 276 ? 24.311  60.311 -4.773 1.00 104.68 ? 335 GLN D NE2   1 
ATOM   10503 H  H     . GLN D 1 276 ? 24.393  59.450 -1.203 1.00 0.00   ? 335 GLN D H     1 
ATOM   10504 N  N     . THR D 1 277 ? 26.943  56.914 -0.443 1.00 80.16  ? 336 THR D N     1 
ATOM   10505 C  CA    . THR D 1 277 ? 27.999  57.043 0.559  1.00 80.16  ? 336 THR D CA    1 
ATOM   10506 C  C     . THR D 1 277 ? 27.391  57.245 1.961  1.00 80.16  ? 336 THR D C     1 
ATOM   10507 O  O     . THR D 1 277 ? 26.487  58.061 2.158  1.00 82.44  ? 336 THR D O     1 
ATOM   10508 C  CB    . THR D 1 277 ? 29.022  58.164 0.175  1.00 82.44  ? 336 THR D CB    1 
ATOM   10509 O  OG1   . THR D 1 277 ? 29.995  57.629 -0.739 1.00 82.44  ? 336 THR D OG1   1 
ATOM   10510 C  CG2   . THR D 1 277 ? 29.723  58.743 1.405  1.00 82.44  ? 336 THR D CG2   1 
ATOM   10511 H  H     . THR D 1 277 ? 26.672  56.024 -0.734 1.00 0.00   ? 336 THR D H     1 
ATOM   10512 H  HG1   . THR D 1 277 ? 30.560  58.361 -1.002 1.00 30.00  ? 336 THR D HG1   1 
ATOM   10513 N  N     . ALA D 1 278 ? 27.892  56.470 2.918  1.00 40.65  ? 337 ALA D N     1 
ATOM   10514 C  CA    . ALA D 1 278 ? 27.408  56.489 4.289  1.00 40.65  ? 337 ALA D CA    1 
ATOM   10515 C  C     . ALA D 1 278 ? 27.879  57.614 5.201  1.00 40.65  ? 337 ALA D C     1 
ATOM   10516 O  O     . ALA D 1 278 ? 28.684  58.471 4.809  1.00 51.10  ? 337 ALA D O     1 
ATOM   10517 C  CB    . ALA D 1 278 ? 27.691  55.154 4.937  1.00 51.10  ? 337 ALA D CB    1 
ATOM   10518 H  H     . ALA D 1 278 ? 28.640  55.892 2.692  1.00 0.00   ? 337 ALA D H     1 
ATOM   10519 N  N     . SER D 1 279 ? 27.363  57.563 6.434  1.00 70.46  ? 338 SER D N     1 
ATOM   10520 C  CA    . SER D 1 279 ? 27.640  58.512 7.516  1.00 70.46  ? 338 SER D CA    1 
ATOM   10521 C  C     . SER D 1 279 ? 28.478  57.819 8.589  1.00 70.46  ? 338 SER D C     1 
ATOM   10522 O  O     . SER D 1 279 ? 28.470  56.598 8.682  1.00 53.40  ? 338 SER D O     1 
ATOM   10523 C  CB    . SER D 1 279 ? 26.323  58.953 8.156  1.00 53.40  ? 338 SER D CB    1 
ATOM   10524 O  OG    . SER D 1 279 ? 25.682  57.864 8.803  1.00 53.40  ? 338 SER D OG    1 
ATOM   10525 H  H     . SER D 1 279 ? 26.746  56.841 6.664  1.00 0.00   ? 338 SER D H     1 
ATOM   10526 H  HG    . SER D 1 279 ? 24.773  58.133 9.000  1.00 30.00  ? 338 SER D HG    1 
ATOM   10527 N  N     . PRO D 1 280 ? 29.163  58.594 9.447  1.00 39.55  ? 339 PRO D N     1 
ATOM   10528 C  CA    . PRO D 1 280 ? 30.016  58.098 10.539 1.00 39.55  ? 339 PRO D CA    1 
ATOM   10529 C  C     . PRO D 1 280 ? 29.386  56.994 11.383 1.00 39.55  ? 339 PRO D C     1 
ATOM   10530 O  O     . PRO D 1 280 ? 29.973  55.916 11.550 1.00 75.23  ? 339 PRO D O     1 
ATOM   10531 C  CB    . PRO D 1 280 ? 30.248  59.347 11.379 1.00 75.23  ? 339 PRO D CB    1 
ATOM   10532 C  CG    . PRO D 1 280 ? 30.349  60.411 10.339 1.00 75.23  ? 339 PRO D CG    1 
ATOM   10533 C  CD    . PRO D 1 280 ? 29.228  60.066 9.367  1.00 75.23  ? 339 PRO D CD    1 
ATOM   10534 N  N     . ARG D 1 281 ? 28.195  57.255 11.918 1.00 46.98  ? 340 ARG D N     1 
ATOM   10535 C  CA    . ARG D 1 281 ? 27.523  56.258 12.738 1.00 46.98  ? 340 ARG D CA    1 
ATOM   10536 C  C     . ARG D 1 281 ? 27.303  54.974 11.940 1.00 46.98  ? 340 ARG D C     1 
ATOM   10537 O  O     . ARG D 1 281 ? 27.589  53.879 12.426 1.00 88.28  ? 340 ARG D O     1 
ATOM   10538 C  CB    . ARG D 1 281 ? 26.205  56.803 13.293 1.00 88.28  ? 340 ARG D CB    1 
ATOM   10539 C  CG    . ARG D 1 281 ? 25.979  56.445 14.770 1.00 88.28  ? 340 ARG D CG    1 
ATOM   10540 C  CD    . ARG D 1 281 ? 25.848  54.929 14.979 1.00 88.28  ? 340 ARG D CD    1 
ATOM   10541 N  NE    . ARG D 1 281 ? 26.316  54.484 16.297 1.00 88.28  ? 340 ARG D NE    1 
ATOM   10542 C  CZ    . ARG D 1 281 ? 27.168  53.476 16.493 1.00 88.28  ? 340 ARG D CZ    1 
ATOM   10543 N  NH1   . ARG D 1 281 ? 27.654  52.799 15.462 1.00 88.28  ? 340 ARG D NH1   1 
ATOM   10544 N  NH2   . ARG D 1 281 ? 27.533  53.134 17.724 1.00 88.28  ? 340 ARG D NH2   1 
ATOM   10545 H  H     . ARG D 1 281 ? 27.799  58.136 11.785 1.00 0.00   ? 340 ARG D H     1 
ATOM   10546 H  HE    . ARG D 1 281 ? 25.981  54.964 17.082 1.00 0.00   ? 340 ARG D HE    1 
ATOM   10547 H  HH11  . ARG D 1 281 ? 27.383  53.038 14.529 1.00 0.00   ? 340 ARG D HH11  1 
ATOM   10548 H  HH12  . ARG D 1 281 ? 28.290  52.043 15.615 1.00 0.00   ? 340 ARG D HH12  1 
ATOM   10549 H  HH21  . ARG D 1 281 ? 27.169  53.641 18.505 1.00 0.00   ? 340 ARG D HH21  1 
ATOM   10550 H  HH22  . ARG D 1 281 ? 28.172  52.379 17.866 1.00 0.00   ? 340 ARG D HH22  1 
ATOM   10551 N  N     . ALA D 1 282 ? 26.853  55.114 10.696 1.00 47.50  ? 341 ALA D N     1 
ATOM   10552 C  CA    . ALA D 1 282 ? 26.621  53.956 9.836  1.00 47.50  ? 341 ALA D CA    1 
ATOM   10553 C  C     . ALA D 1 282 ? 27.903  53.131 9.627  1.00 47.50  ? 341 ALA D C     1 
ATOM   10554 O  O     . ALA D 1 282 ? 27.849  51.902 9.562  1.00 51.07  ? 341 ALA D O     1 
ATOM   10555 C  CB    . ALA D 1 282 ? 26.043  54.396 8.498  1.00 51.07  ? 341 ALA D CB    1 
ATOM   10556 H  H     . ALA D 1 282 ? 26.691  56.007 10.329 1.00 0.00   ? 341 ALA D H     1 
ATOM   10557 N  N     . LEU D 1 283 ? 29.056  53.792 9.526  1.00 33.34  ? 342 LEU D N     1 
ATOM   10558 C  CA    . LEU D 1 283 ? 30.305  53.067 9.345  1.00 33.34  ? 342 LEU D CA    1 
ATOM   10559 C  C     . LEU D 1 283 ? 30.633  52.284 10.601 1.00 33.34  ? 342 LEU D C     1 
ATOM   10560 O  O     . LEU D 1 283 ? 31.155  51.176 10.528 1.00 40.04  ? 342 LEU D O     1 
ATOM   10561 C  CB    . LEU D 1 283 ? 31.459  53.995 8.956  1.00 40.04  ? 342 LEU D CB    1 
ATOM   10562 C  CG    . LEU D 1 283 ? 31.547  54.345 7.464  1.00 40.04  ? 342 LEU D CG    1 
ATOM   10563 C  CD1   . LEU D 1 283 ? 31.112  53.148 6.651  1.00 40.04  ? 342 LEU D CD1   1 
ATOM   10564 C  CD2   . LEU D 1 283 ? 30.672  55.520 7.114  1.00 40.04  ? 342 LEU D CD2   1 
ATOM   10565 H  H     . LEU D 1 283 ? 29.064  54.771 9.571  1.00 0.00   ? 342 LEU D H     1 
ATOM   10566 N  N     . ALA D 1 284 ? 30.257  52.830 11.751 1.00 35.06  ? 343 ALA D N     1 
ATOM   10567 C  CA    . ALA D 1 284 ? 30.492  52.155 13.023 1.00 35.06  ? 343 ALA D CA    1 
ATOM   10568 C  C     . ALA D 1 284 ? 29.594  50.929 13.108 1.00 35.06  ? 343 ALA D C     1 
ATOM   10569 O  O     . ALA D 1 284 ? 30.037  49.866 13.515 1.00 18.53  ? 343 ALA D O     1 
ATOM   10570 C  CB    . ALA D 1 284 ? 30.211  53.090 14.172 1.00 18.53  ? 343 ALA D CB    1 
ATOM   10571 H  H     . ALA D 1 284 ? 29.815  53.707 11.748 1.00 0.00   ? 343 ALA D H     1 
ATOM   10572 N  N     . ASP D 1 285 ? 28.339  51.070 12.702 1.00 17.51  ? 344 ASP D N     1 
ATOM   10573 C  CA    . ASP D 1 285 ? 27.404  49.950 12.736 1.00 17.51  ? 344 ASP D CA    1 
ATOM   10574 C  C     . ASP D 1 285 ? 27.901  48.798 11.879 1.00 17.51  ? 344 ASP D C     1 
ATOM   10575 O  O     . ASP D 1 285 ? 27.909  47.640 12.308 1.00 65.69  ? 344 ASP D O     1 
ATOM   10576 C  CB    . ASP D 1 285 ? 26.025  50.391 12.262 1.00 65.69  ? 344 ASP D CB    1 
ATOM   10577 C  CG    . ASP D 1 285 ? 25.275  51.184 13.313 1.00 65.69  ? 344 ASP D CG    1 
ATOM   10578 O  OD1   . ASP D 1 285 ? 24.902  50.578 14.345 1.00 65.69  ? 344 ASP D OD1   1 
ATOM   10579 O  OD2   . ASP D 1 285 ? 25.059  52.404 13.112 1.00 65.69  ? 344 ASP D OD2   1 
ATOM   10580 H  H     . ASP D 1 285 ? 28.042  51.949 12.390 1.00 0.00   ? 344 ASP D H     1 
ATOM   10581 N  N     . SER D 1 286 ? 28.331  49.129 10.667 1.00 49.40  ? 345 SER D N     1 
ATOM   10582 C  CA    . SER D 1 286 ? 28.839  48.136 9.738  1.00 49.40  ? 345 SER D CA    1 
ATOM   10583 C  C     . SER D 1 286 ? 30.064  47.480 10.323 1.00 49.40  ? 345 SER D C     1 
ATOM   10584 O  O     . SER D 1 286 ? 30.204  46.260 10.266 1.00 28.15  ? 345 SER D O     1 
ATOM   10585 C  CB    . SER D 1 286 ? 29.209  48.786 8.414  1.00 28.15  ? 345 SER D CB    1 
ATOM   10586 O  OG    . SER D 1 286 ? 28.062  49.190 7.695  1.00 28.15  ? 345 SER D OG    1 
ATOM   10587 H  H     . SER D 1 286 ? 28.298  50.064 10.369 1.00 0.00   ? 345 SER D H     1 
ATOM   10588 H  HG    . SER D 1 286 ? 28.338  49.634 6.893  1.00 30.00  ? 345 SER D HG    1 
ATOM   10589 N  N     . LEU D 1 287 ? 30.950  48.304 10.878 1.00 38.49  ? 346 LEU D N     1 
ATOM   10590 C  CA    . LEU D 1 287 ? 32.189  47.834 11.488 1.00 38.49  ? 346 LEU D CA    1 
ATOM   10591 C  C     . LEU D 1 287 ? 31.871  46.836 12.592 1.00 38.49  ? 346 LEU D C     1 
ATOM   10592 O  O     . LEU D 1 287 ? 32.344  45.692 12.561 1.00 60.62  ? 346 LEU D O     1 
ATOM   10593 C  CB    . LEU D 1 287 ? 32.977  49.006 12.094 1.00 60.62  ? 346 LEU D CB    1 
ATOM   10594 C  CG    . LEU D 1 287 ? 34.267  49.549 11.464 1.00 60.62  ? 346 LEU D CG    1 
ATOM   10595 C  CD1   . LEU D 1 287 ? 35.066  48.403 10.855 1.00 60.62  ? 346 LEU D CD1   1 
ATOM   10596 C  CD2   . LEU D 1 287 ? 33.944  50.613 10.426 1.00 60.62  ? 346 LEU D CD2   1 
ATOM   10597 H  H     . LEU D 1 287 ? 30.774  49.267 10.879 1.00 0.00   ? 346 LEU D H     1 
ATOM   10598 N  N     . MET D 1 288 ? 31.047  47.260 13.549 1.00 38.14  ? 347 MET D N     1 
ATOM   10599 C  CA    . MET D 1 288 ? 30.678  46.396 14.662 1.00 38.14  ? 347 MET D CA    1 
ATOM   10600 C  C     . MET D 1 288 ? 30.087  45.069 14.189 1.00 38.14  ? 347 MET D C     1 
ATOM   10601 O  O     . MET D 1 288 ? 30.430  44.025 14.729 1.00 58.12  ? 347 MET D O     1 
ATOM   10602 C  CB    . MET D 1 288 ? 29.779  47.128 15.668 1.00 58.12  ? 347 MET D CB    1 
ATOM   10603 C  CG    . MET D 1 288 ? 30.501  48.284 16.387 1.00 58.12  ? 347 MET D CG    1 
ATOM   10604 S  SD    . MET D 1 288 ? 29.521  49.232 17.617 1.00 58.12  ? 347 MET D SD    1 
ATOM   10605 C  CE    . MET D 1 288 ? 28.059  49.699 16.675 1.00 58.12  ? 347 MET D CE    1 
ATOM   10606 H  H     . MET D 1 288 ? 30.686  48.160 13.499 1.00 0.00   ? 347 MET D H     1 
ATOM   10607 N  N     . GLN D 1 289 ? 29.293  45.075 13.128 1.00 33.31  ? 348 GLN D N     1 
ATOM   10608 C  CA    . GLN D 1 289 ? 28.759  43.809 12.642 1.00 33.31  ? 348 GLN D CA    1 
ATOM   10609 C  C     . GLN D 1 289 ? 29.901  42.885 12.232 1.00 33.31  ? 348 GLN D C     1 
ATOM   10610 O  O     . GLN D 1 289 ? 29.963  41.734 12.676 1.00 47.12  ? 348 GLN D O     1 
ATOM   10611 C  CB    . GLN D 1 289 ? 27.812  44.029 11.481 1.00 47.12  ? 348 GLN D CB    1 
ATOM   10612 C  CG    . GLN D 1 289 ? 26.603  44.850 11.859 1.00 47.12  ? 348 GLN D CG    1 
ATOM   10613 C  CD    . GLN D 1 289 ? 25.526  44.817 10.798 1.00 47.12  ? 348 GLN D CD    1 
ATOM   10614 O  OE1   . GLN D 1 289 ? 25.355  43.819 10.089 1.00 47.12  ? 348 GLN D OE1   1 
ATOM   10615 N  NE2   . GLN D 1 289 ? 24.794  45.911 10.674 1.00 47.12  ? 348 GLN D NE2   1 
ATOM   10616 H  H     . GLN D 1 289 ? 29.080  45.918 12.674 1.00 0.00   ? 348 GLN D H     1 
ATOM   10617 N  N     . LEU D 1 290 ? 30.844  43.412 11.450 1.00 31.12  ? 349 LEU D N     1 
ATOM   10618 C  CA    . LEU D 1 290 ? 32.006  42.646 11.002 1.00 31.12  ? 349 LEU D CA    1 
ATOM   10619 C  C     . LEU D 1 290 ? 32.812  42.171 12.199 1.00 31.12  ? 349 LEU D C     1 
ATOM   10620 O  O     . LEU D 1 290 ? 33.362  41.069 12.179 1.00 38.00  ? 349 LEU D O     1 
ATOM   10621 C  CB    . LEU D 1 290 ? 32.912  43.496 10.115 1.00 38.00  ? 349 LEU D CB    1 
ATOM   10622 C  CG    . LEU D 1 290 ? 32.477  43.754 8.673  1.00 38.00  ? 349 LEU D CG    1 
ATOM   10623 C  CD1   . LEU D 1 290 ? 33.282  44.901 8.077  1.00 38.00  ? 349 LEU D CD1   1 
ATOM   10624 C  CD2   . LEU D 1 290 ? 32.639  42.493 7.844  1.00 38.00  ? 349 LEU D CD2   1 
ATOM   10625 H  H     . LEU D 1 290 ? 30.752  44.347 11.165 1.00 0.00   ? 349 LEU D H     1 
ATOM   10626 N  N     . ALA D 1 291 ? 32.883  43.001 13.238 1.00 22.94  ? 350 ALA D N     1 
ATOM   10627 C  CA    . ALA D 1 291 ? 33.632  42.656 14.442 1.00 22.94  ? 350 ALA D CA    1 
ATOM   10628 C  C     . ALA D 1 291 ? 32.988  41.456 15.096 1.00 22.94  ? 350 ALA D C     1 
ATOM   10629 O  O     . ALA D 1 291 ? 33.664  40.497 15.453 1.00 44.17  ? 350 ALA D O     1 
ATOM   10630 C  CB    . ALA D 1 291 ? 33.657  43.815 15.405 1.00 44.17  ? 350 ALA D CB    1 
ATOM   10631 H  H     . ALA D 1 291 ? 32.418  43.860 13.181 1.00 0.00   ? 350 ALA D H     1 
ATOM   10632 N  N     . ARG D 1 292 ? 31.669  41.499 15.233 1.00 34.11  ? 351 ARG D N     1 
ATOM   10633 C  CA    . ARG D 1 292 ? 30.941  40.396 15.832 1.00 34.11  ? 351 ARG D CA    1 
ATOM   10634 C  C     . ARG D 1 292 ? 31.161  39.199 14.949 1.00 34.11  ? 351 ARG D C     1 
ATOM   10635 O  O     . ARG D 1 292 ? 31.272  38.079 15.422 1.00 61.16  ? 351 ARG D O     1 
ATOM   10636 C  CB    . ARG D 1 292 ? 29.453  40.700 15.888 1.00 61.16  ? 351 ARG D CB    1 
ATOM   10637 C  CG    . ARG D 1 292 ? 29.067  41.787 16.854 1.00 61.16  ? 351 ARG D CG    1 
ATOM   10638 C  CD    . ARG D 1 292 ? 27.563  41.869 17.003 1.00 61.16  ? 351 ARG D CD    1 
ATOM   10639 N  NE    . ARG D 1 292 ? 27.016  40.973 18.031 1.00 61.16  ? 351 ARG D NE    1 
ATOM   10640 C  CZ    . ARG D 1 292 ? 26.900  39.640 17.947 1.00 61.16  ? 351 ARG D CZ    1 
ATOM   10641 N  NH1   . ARG D 1 292 ? 27.305  38.961 16.877 1.00 61.16  ? 351 ARG D NH1   1 
ATOM   10642 N  NH2   . ARG D 1 292 ? 26.260  38.985 18.906 1.00 61.16  ? 351 ARG D NH2   1 
ATOM   10643 H  H     . ARG D 1 292 ? 31.182  42.289 14.922 1.00 0.00   ? 351 ARG D H     1 
ATOM   10644 H  HE    . ARG D 1 292 ? 26.705  41.384 18.864 1.00 0.00   ? 351 ARG D HE    1 
ATOM   10645 H  HH11  . ARG D 1 292 ? 27.681  39.418 16.078 1.00 0.00   ? 351 ARG D HH11  1 
ATOM   10646 H  HH12  . ARG D 1 292 ? 27.188  37.968 16.858 1.00 0.00   ? 351 ARG D HH12  1 
ATOM   10647 H  HH21  . ARG D 1 292 ? 25.869  39.488 19.677 1.00 0.00   ? 351 ARG D HH21  1 
ATOM   10648 H  HH22  . ARG D 1 292 ? 26.157  37.991 18.856 1.00 0.00   ? 351 ARG D HH22  1 
ATOM   10649 N  N     . GLN D 1 293 ? 31.242  39.453 13.652 1.00 27.94  ? 352 GLN D N     1 
ATOM   10650 C  CA    . GLN D 1 293 ? 31.451  38.383 12.688 1.00 27.94  ? 352 GLN D CA    1 
ATOM   10651 C  C     . GLN D 1 293 ? 32.826  37.742 12.793 1.00 27.94  ? 352 GLN D C     1 
ATOM   10652 O  O     . GLN D 1 293 ? 32.992  36.568 12.451 1.00 40.62  ? 352 GLN D O     1 
ATOM   10653 C  CB    . GLN D 1 293 ? 31.204  38.884 11.268 1.00 40.62  ? 352 GLN D CB    1 
ATOM   10654 C  CG    . GLN D 1 293 ? 29.767  39.276 11.021 1.00 40.62  ? 352 GLN D CG    1 
ATOM   10655 C  CD    . GLN D 1 293 ? 29.461  39.396 9.550  1.00 40.62  ? 352 GLN D CD    1 
ATOM   10656 O  OE1   . GLN D 1 293 ? 29.107  40.476 9.056  1.00 40.62  ? 352 GLN D OE1   1 
ATOM   10657 N  NE2   . GLN D 1 293 ? 29.593  38.287 8.831  1.00 40.62  ? 352 GLN D NE2   1 
ATOM   10658 H  H     . GLN D 1 293 ? 31.135  40.368 13.324 1.00 0.00   ? 352 GLN D H     1 
ATOM   10659 N  N     . VAL D 1 294 ? 33.808  38.532 13.222 1.00 38.36  ? 353 VAL D N     1 
ATOM   10660 C  CA    . VAL D 1 294 ? 35.185  38.063 13.414 1.00 38.36  ? 353 VAL D CA    1 
ATOM   10661 C  C     . VAL D 1 294 ? 35.267  37.372 14.789 1.00 38.36  ? 353 VAL D C     1 
ATOM   10662 O  O     . VAL D 1 294 ? 35.938  36.350 14.942 1.00 44.34  ? 353 VAL D O     1 
ATOM   10663 C  CB    . VAL D 1 294 ? 36.210  39.254 13.353 1.00 44.34  ? 353 VAL D CB    1 
ATOM   10664 C  CG1   . VAL D 1 294 ? 37.608  38.814 13.762 1.00 44.34  ? 353 VAL D CG1   1 
ATOM   10665 C  CG2   . VAL D 1 294 ? 36.252  39.832 11.956 1.00 44.34  ? 353 VAL D CG2   1 
ATOM   10666 H  H     . VAL D 1 294 ? 33.606  39.472 13.396 1.00 0.00   ? 353 VAL D H     1 
ATOM   10667 N  N     . SER D 1 295 ? 34.581  37.925 15.789 1.00 54.87  ? 354 SER D N     1 
ATOM   10668 C  CA    . SER D 1 295 ? 34.599  37.343 17.127 1.00 54.87  ? 354 SER D CA    1 
ATOM   10669 C  C     . SER D 1 295 ? 34.274  35.862 17.014 1.00 54.87  ? 354 SER D C     1 
ATOM   10670 O  O     . SER D 1 295 ? 35.047  35.017 17.457 1.00 63.20  ? 354 SER D O     1 
ATOM   10671 C  CB    . SER D 1 295 ? 33.564  38.020 18.022 1.00 63.20  ? 354 SER D CB    1 
ATOM   10672 O  OG    . SER D 1 295 ? 32.241  37.648 17.657 1.00 63.20  ? 354 SER D OG    1 
ATOM   10673 H  H     . SER D 1 295 ? 34.039  38.713 15.627 1.00 0.00   ? 354 SER D H     1 
ATOM   10674 H  HG    . SER D 1 295 ? 31.605  38.030 18.265 1.00 30.00  ? 354 SER D HG    1 
ATOM   10675 N  N     . ARG D 1 296 ? 33.158  35.563 16.352 1.00 43.81  ? 355 ARG D N     1 
ATOM   10676 C  CA    . ARG D 1 296 ? 32.705  34.195 16.157 1.00 43.81  ? 355 ARG D CA    1 
ATOM   10677 C  C     . ARG D 1 296 ? 33.648  33.380 15.282 1.00 43.81  ? 355 ARG D C     1 
ATOM   10678 O  O     . ARG D 1 296 ? 33.281  32.311 14.799 1.00 38.85  ? 355 ARG D O     1 
ATOM   10679 C  CB    . ARG D 1 296 ? 31.291  34.187 15.560 1.00 38.85  ? 355 ARG D CB    1 
ATOM   10680 C  CG    . ARG D 1 296 ? 30.200  34.526 16.564 1.00 38.85  ? 355 ARG D CG    1 
ATOM   10681 C  CD    . ARG D 1 296 ? 28.791  34.421 15.988 1.00 38.85  ? 355 ARG D CD    1 
ATOM   10682 N  NE    . ARG D 1 296 ? 28.304  35.722 15.565 1.00 38.85  ? 355 ARG D NE    1 
ATOM   10683 C  CZ    . ARG D 1 296 ? 28.154  36.085 14.298 1.00 38.85  ? 355 ARG D CZ    1 
ATOM   10684 N  NH1   . ARG D 1 296 ? 28.441  35.235 13.323 1.00 38.85  ? 355 ARG D NH1   1 
ATOM   10685 N  NH2   . ARG D 1 296 ? 27.765  37.311 13.999 1.00 38.85  ? 355 ARG D NH2   1 
ATOM   10686 H  H     . ARG D 1 296 ? 32.616  36.306 16.006 1.00 0.00   ? 355 ARG D H     1 
ATOM   10687 H  HE    . ARG D 1 296 ? 28.070  36.370 16.263 1.00 0.00   ? 355 ARG D HE    1 
ATOM   10688 H  HH11  . ARG D 1 296 ? 28.765  34.315 13.544 1.00 0.00   ? 355 ARG D HH11  1 
ATOM   10689 H  HH12  . ARG D 1 296 ? 28.326  35.501 12.367 1.00 0.00   ? 355 ARG D HH12  1 
ATOM   10690 H  HH21  . ARG D 1 296 ? 27.575  37.977 14.720 1.00 0.00   ? 355 ARG D HH21  1 
ATOM   10691 H  HH22  . ARG D 1 296 ? 27.663  37.556 13.035 1.00 0.00   ? 355 ARG D HH22  1 
ATOM   10692 N  N     . LEU D 1 297 ? 34.867  33.873 15.106 1.00 50.17  ? 356 LEU D N     1 
ATOM   10693 C  CA    . LEU D 1 297 ? 35.877  33.214 14.289 1.00 50.17  ? 356 LEU D CA    1 
ATOM   10694 C  C     . LEU D 1 297 ? 37.008  32.649 15.153 1.00 50.17  ? 356 LEU D C     1 
ATOM   10695 O  O     . LEU D 1 297 ? 36.968  32.851 16.388 1.00 56.81  ? 356 LEU D O     1 
ATOM   10696 C  CB    . LEU D 1 297 ? 36.431  34.222 13.280 1.00 56.81  ? 356 LEU D CB    1 
ATOM   10697 C  CG    . LEU D 1 297 ? 37.494  33.886 12.239 1.00 56.81  ? 356 LEU D CG    1 
ATOM   10698 C  CD1   . LEU D 1 297 ? 36.991  32.809 11.276 1.00 56.81  ? 356 LEU D CD1   1 
ATOM   10699 C  CD2   . LEU D 1 297 ? 37.838  35.173 11.486 1.00 56.81  ? 356 LEU D CD2   1 
ATOM   10700 H  H     . LEU D 1 297 ? 35.214  34.664 15.531 1.00 0.00   ? 356 LEU D H     1 
HETATM 10701 HG HG    . EMC E 2 .   ? 29.391  37.234 34.073 1.00 69.23  ? 999 EMC A HG    1 
HETATM 10702 C  C1    . EMC E 2 .   ? 30.426  32.809 31.433 1.00 69.23  ? 999 EMC A C1    1 
HETATM 10703 C  C2    . EMC E 2 .   ? 29.040  32.348 31.830 1.00 69.23  ? 999 EMC A C2    1 
HETATM 10704 C  C1    . IPT F 3 .   ? 36.763  26.029 50.555 1.00 27.02  ? 998 IPT A C1    1 
HETATM 10705 C  C2    . IPT F 3 .   ? 36.981  26.931 49.338 1.00 27.02  ? 998 IPT A C2    1 
HETATM 10706 O  O2    . IPT F 3 .   ? 37.549  26.155 48.299 1.00 27.02  ? 998 IPT A O2    1 
HETATM 10707 C  C3    . IPT F 3 .   ? 37.908  28.126 49.629 1.00 27.02  ? 998 IPT A C3    1 
HETATM 10708 O  O3    . IPT F 3 .   ? 37.779  29.100 48.611 1.00 27.02  ? 998 IPT A O3    1 
HETATM 10709 C  C4    . IPT F 3 .   ? 37.613  28.791 50.971 1.00 27.02  ? 998 IPT A C4    1 
HETATM 10710 O  O4    . IPT F 3 .   ? 36.410  29.531 50.889 1.00 27.02  ? 998 IPT A O4    1 
HETATM 10711 C  C5    . IPT F 3 .   ? 37.508  27.715 52.034 1.00 27.02  ? 998 IPT A C5    1 
HETATM 10712 O  O5    . IPT F 3 .   ? 36.463  26.811 51.700 1.00 27.02  ? 998 IPT A O5    1 
HETATM 10713 C  C6    . IPT F 3 .   ? 37.228  28.195 53.436 1.00 27.02  ? 998 IPT A C6    1 
HETATM 10714 O  O6    . IPT F 3 .   ? 37.373  27.116 54.356 1.00 27.02  ? 998 IPT A O6    1 
HETATM 10715 S  S1    . IPT F 3 .   ? 35.318  25.018 50.268 1.00 27.02  ? 998 IPT A S1    1 
HETATM 10716 C  "C1'" . IPT F 3 .   ? 35.351  23.769 51.591 1.00 27.02  ? 998 IPT A "C1'" 1 
HETATM 10717 C  "C2'" . IPT F 3 .   ? 34.163  22.853 51.480 1.00 27.02  ? 998 IPT A "C2'" 1 
HETATM 10718 C  "C3'" . IPT F 3 .   ? 36.637  22.958 51.593 1.00 27.02  ? 998 IPT A "C3'" 1 
HETATM 10719 H  H1    . IPT F 3 .   ? 37.670  25.422 50.714 1.00 0.00   ? 998 IPT A H1    1 
HETATM 10720 H  H2    . IPT F 3 .   ? 36.023  27.266 48.971 1.00 0.00   ? 998 IPT A H2    1 
HETATM 10721 H  HO2   . IPT F 3 .   ? 37.733  26.718 47.542 1.00 0.00   ? 998 IPT A HO2   1 
HETATM 10722 H  H3    . IPT F 3 .   ? 38.909  27.699 49.642 1.00 0.00   ? 998 IPT A H3    1 
HETATM 10723 H  HO3   . IPT F 3 .   ? 36.910  29.503 48.733 1.00 0.00   ? 998 IPT A HO3   1 
HETATM 10724 H  H4    . IPT F 3 .   ? 38.409  29.498 51.222 1.00 0.00   ? 998 IPT A H4    1 
HETATM 10725 H  HO4   . IPT F 3 .   ? 36.237  29.908 51.759 1.00 0.00   ? 998 IPT A HO4   1 
HETATM 10726 H  H5    . IPT F 3 .   ? 38.484  27.197 52.074 1.00 0.00   ? 998 IPT A H5    1 
HETATM 10727 H  H61   . IPT F 3 .   ? 36.219  28.617 53.525 1.00 0.00   ? 998 IPT A H61   1 
HETATM 10728 H  H62   . IPT F 3 .   ? 37.948  28.977 53.715 1.00 0.00   ? 998 IPT A H62   1 
HETATM 10729 H  HO6   . IPT F 3 .   ? 36.510  26.884 54.723 1.00 0.00   ? 998 IPT A HO6   1 
HETATM 10730 HG HG    . EMC G 2 .   ? 43.567  44.529 45.918 1.00 50.71  ? 999 EMC B HG    1 
HETATM 10731 C  C1    . EMC G 2 .   ? 42.612  50.171 48.562 1.00 50.71  ? 999 EMC B C1    1 
HETATM 10732 C  C2    . EMC G 2 .   ? 41.551  51.238 48.839 1.00 50.71  ? 999 EMC B C2    1 
HETATM 10733 C  C1    . IPT H 3 .   ? 23.023  46.189 51.094 1.00 23.66  ? 998 IPT B C1    1 
HETATM 10734 C  C2    . IPT H 3 .   ? 24.145  46.260 50.102 1.00 23.66  ? 998 IPT B C2    1 
HETATM 10735 O  O2    . IPT H 3 .   ? 24.445  47.610 49.858 1.00 23.66  ? 998 IPT B O2    1 
HETATM 10736 C  C3    . IPT H 3 .   ? 23.756  45.627 48.792 1.00 23.66  ? 998 IPT B C3    1 
HETATM 10737 O  O3    . IPT H 3 .   ? 24.901  45.555 47.963 1.00 23.66  ? 998 IPT B O3    1 
HETATM 10738 C  C4    . IPT H 3 .   ? 23.160  44.237 48.994 1.00 23.66  ? 998 IPT B C4    1 
HETATM 10739 O  O4    . IPT H 3 .   ? 24.156  43.329 49.431 1.00 23.66  ? 998 IPT B O4    1 
HETATM 10740 C  C5    . IPT H 3 .   ? 22.056  44.324 50.015 1.00 23.66  ? 998 IPT B C5    1 
HETATM 10741 O  O5    . IPT H 3 .   ? 22.587  44.845 51.236 1.00 23.66  ? 998 IPT B O5    1 
HETATM 10742 C  C6    . IPT H 3 .   ? 21.439  43.001 50.336 1.00 23.66  ? 998 IPT B C6    1 
HETATM 10743 O  O6    . IPT H 3 .   ? 20.442  43.153 51.338 1.00 23.66  ? 998 IPT B O6    1 
HETATM 10744 S  S1    . IPT H 3 .   ? 23.625  46.699 52.638 1.00 23.66  ? 998 IPT B S1    1 
HETATM 10745 C  "C1'" . IPT H 3 .   ? 22.122  46.978 53.493 1.00 23.66  ? 998 IPT B "C1'" 1 
HETATM 10746 C  "C2'" . IPT H 3 .   ? 22.317  46.680 54.947 1.00 23.66  ? 998 IPT B "C2'" 1 
HETATM 10747 C  "C3'" . IPT H 3 .   ? 21.632  48.389 53.294 1.00 23.66  ? 998 IPT B "C3'" 1 
HETATM 10748 H  H1    . IPT H 3 .   ? 22.185  46.830 50.760 1.00 0.00   ? 998 IPT B H1    1 
HETATM 10749 H  H2    . IPT H 3 .   ? 25.026  45.763 50.511 1.00 0.00   ? 998 IPT B H2    1 
HETATM 10750 H  HO2   . IPT H 3 .   ? 24.829  48.021 50.648 1.00 0.00   ? 998 IPT B HO2   1 
HETATM 10751 H  H3    . IPT H 3 .   ? 23.019  46.288 48.323 1.00 0.00   ? 998 IPT B H3    1 
HETATM 10752 H  HO3   . IPT H 3 .   ? 25.235  46.473 47.994 1.00 0.00   ? 998 IPT B HO3   1 
HETATM 10753 H  H4    . IPT H 3 .   ? 22.802  43.867 48.037 1.00 0.00   ? 998 IPT B H4    1 
HETATM 10754 H  HO4   . IPT H 3 .   ? 24.881  43.485 48.811 1.00 0.00   ? 998 IPT B HO4   1 
HETATM 10755 H  H5    . IPT H 3 .   ? 21.245  44.976 49.651 1.00 0.00   ? 998 IPT B H5    1 
HETATM 10756 H  H61   . IPT H 3 .   ? 22.212  42.308 50.687 1.00 0.00   ? 998 IPT B H61   1 
HETATM 10757 H  H62   . IPT H 3 .   ? 21.011  42.532 49.440 1.00 0.00   ? 998 IPT B H62   1 
HETATM 10758 H  HO6   . IPT H 3 .   ? 20.627  42.515 52.046 1.00 0.00   ? 998 IPT B HO6   1 
HETATM 10759 HG HG    . EMC I 2 .   ? 1.814   41.533 6.001  1.00 51.29  ? 999 EMC C HG    1 
HETATM 10760 C  C1    . EMC I 2 .   ? -1.293  34.560 7.221  1.00 51.29  ? 999 EMC C C1    1 
HETATM 10761 C  C2    . EMC I 2 .   ? -1.321  33.060 7.022  1.00 51.29  ? 999 EMC C C2    1 
HETATM 10762 C  C1    . IPT J 3 .   ? 0.642   31.792 24.991 1.00 26.71  ? 998 IPT C C1    1 
HETATM 10763 C  C2    . IPT J 3 .   ? 1.503   32.304 23.852 1.00 26.71  ? 998 IPT C C2    1 
HETATM 10764 O  O2    . IPT J 3 .   ? 1.920   31.223 23.046 1.00 26.71  ? 998 IPT C O2    1 
HETATM 10765 C  C3    . IPT J 3 .   ? 2.731   32.994 24.369 1.00 26.71  ? 998 IPT C C3    1 
HETATM 10766 O  O3    . IPT J 3 .   ? 3.425   33.548 23.264 1.00 26.71  ? 998 IPT C O3    1 
HETATM 10767 C  C4    . IPT J 3 .   ? 2.363   34.091 25.369 1.00 26.71  ? 998 IPT C C4    1 
HETATM 10768 O  O4    . IPT J 3 .   ? 1.690   35.144 24.694 1.00 26.71  ? 998 IPT C O4    1 
HETATM 10769 C  C5    . IPT J 3 .   ? 1.485   33.466 26.468 1.00 26.71  ? 998 IPT C C5    1 
HETATM 10770 O  O5    . IPT J 3 .   ? 0.317   32.852 25.888 1.00 26.71  ? 998 IPT C O5    1 
HETATM 10771 C  C6    . IPT J 3 .   ? 1.006   34.414 27.558 1.00 26.71  ? 998 IPT C C6    1 
HETATM 10772 O  O6    . IPT J 3 .   ? 0.688   33.711 28.763 1.00 26.71  ? 998 IPT C O6    1 
HETATM 10773 S  S1    . IPT J 3 .   ? -0.859  31.241 24.319 1.00 26.71  ? 998 IPT C S1    1 
HETATM 10774 C  "C1'" . IPT J 3 .   ? -1.793  30.738 25.776 1.00 26.71  ? 998 IPT C "C1'" 1 
HETATM 10775 C  "C2'" . IPT J 3 .   ? -3.223  30.337 25.429 1.00 26.71  ? 998 IPT C "C2'" 1 
HETATM 10776 C  "C3'" . IPT J 3 .   ? -1.097  29.602 26.506 1.00 26.71  ? 998 IPT C "C3'" 1 
HETATM 10777 H  H1    . IPT J 3 .   ? 1.171   30.987 25.523 1.00 0.00   ? 998 IPT C H1    1 
HETATM 10778 H  H2    . IPT J 3 .   ? 0.915   32.999 23.253 1.00 0.00   ? 998 IPT C H2    1 
HETATM 10779 H  HO2   . IPT J 3 .   ? 1.149   30.820 22.625 1.00 0.00   ? 998 IPT C HO2   1 
HETATM 10780 H  H3    . IPT J 3 .   ? 3.338   32.233 24.858 1.00 0.00   ? 998 IPT C H3    1 
HETATM 10781 H  HO3   . IPT J 3 .   ? 3.446   32.808 22.628 1.00 0.00   ? 998 IPT C HO3   1 
HETATM 10782 H  H4    . IPT J 3 .   ? 3.264   34.507 25.824 1.00 0.00   ? 998 IPT C H4    1 
HETATM 10783 H  HO4   . IPT J 3 .   ? 2.293   35.361 23.975 1.00 0.00   ? 998 IPT C HO4   1 
HETATM 10784 H  H5    . IPT J 3 .   ? 2.122   32.716 26.969 1.00 0.00   ? 998 IPT C H5    1 
HETATM 10785 H  H61   . IPT J 3 .   ? 0.103   34.915 27.218 1.00 0.00   ? 998 IPT C H61   1 
HETATM 10786 H  H62   . IPT J 3 .   ? 1.760   35.189 27.752 1.00 0.00   ? 998 IPT C H62   1 
HETATM 10787 H  HO6   . IPT J 3 .   ? -0.032  34.188 29.209 1.00 0.00   ? 998 IPT C HO6   1 
HETATM 10788 HG HG    . EMC K 2 .   ? 15.087  45.083 20.198 1.00 48.10  ? 999 EMC D HG    1 
HETATM 10789 C  C1    . EMC K 2 .   ? 9.080   50.822 25.868 1.00 48.10  ? 999 EMC D C1    1 
HETATM 10790 C  C2    . EMC K 2 .   ? 9.036   52.015 24.943 1.00 48.10  ? 999 EMC D C2    1 
HETATM 10791 C  C1    . IPT L 3 .   ? -3.923  55.142 19.725 1.00 2.00   ? 998 IPT D C1    1 
HETATM 10792 C  C2    . IPT L 3 .   ? -2.655  54.560 19.113 1.00 2.00   ? 998 IPT D C2    1 
HETATM 10793 O  O2    . IPT L 3 .   ? -1.703  55.600 18.870 1.00 2.00   ? 998 IPT D O2    1 
HETATM 10794 C  C3    . IPT L 3 .   ? -2.944  53.915 17.788 1.00 2.00   ? 998 IPT D C3    1 
HETATM 10795 O  O3    . IPT L 3 .   ? -1.778  53.207 17.425 1.00 2.00   ? 998 IPT D O3    1 
HETATM 10796 C  C4    . IPT L 3 .   ? -4.105  52.956 17.870 1.00 2.00   ? 998 IPT D C4    1 
HETATM 10797 O  O4    . IPT L 3 .   ? -3.688  51.807 18.592 1.00 2.00   ? 998 IPT D O4    1 
HETATM 10798 C  C5    . IPT L 3 .   ? -5.293  53.659 18.557 1.00 2.00   ? 998 IPT D C5    1 
HETATM 10799 O  O5    . IPT L 3 .   ? -4.907  54.134 19.839 1.00 2.00   ? 998 IPT D O5    1 
HETATM 10800 C  C6    . IPT L 3 .   ? -6.560  52.870 18.762 1.00 2.00   ? 998 IPT D C6    1 
HETATM 10801 O  O6    . IPT L 3 .   ? -7.678  53.743 18.742 1.00 2.00   ? 998 IPT D O6    1 
HETATM 10802 S  S1    . IPT L 3 .   ? -3.592  55.703 21.328 1.00 2.00   ? 998 IPT D S1    1 
HETATM 10803 C  "C1'" . IPT L 3 .   ? -5.081  56.639 21.782 1.00 2.00   ? 998 IPT D "C1'" 1 
HETATM 10804 C  "C2'" . IPT L 3 .   ? -4.874  57.382 23.072 1.00 2.00   ? 998 IPT D "C2'" 1 
HETATM 10805 C  "C3'" . IPT L 3 .   ? -5.519  57.596 20.758 1.00 2.00   ? 998 IPT D "C3'" 1 
HETATM 10806 H  H1    . IPT L 3 .   ? -4.257  55.935 19.036 1.00 0.00   ? 998 IPT D H1    1 
HETATM 10807 H  H2    . IPT L 3 .   ? -2.250  53.831 19.789 1.00 0.00   ? 998 IPT D H2    1 
HETATM 10808 H  HO2   . IPT L 3 .   ? -1.491  56.049 19.689 1.00 0.00   ? 998 IPT D HO2   1 
HETATM 10809 H  H3    . IPT L 3 .   ? -3.119  54.710 17.044 1.00 0.00   ? 998 IPT D H3    1 
HETATM 10810 H  HO3   . IPT L 3 .   ? -1.091  53.885 17.397 1.00 0.00   ? 998 IPT D HO3   1 
HETATM 10811 H  H4    . IPT L 3 .   ? -4.399  52.584 16.897 1.00 0.00   ? 998 IPT D H4    1 
HETATM 10812 H  HO4   . IPT L 3 .   ? -4.195  51.042 18.313 1.00 0.00   ? 998 IPT D HO4   1 
HETATM 10813 H  H5    . IPT L 3 .   ? -5.550  54.480 17.869 1.00 0.00   ? 998 IPT D H5    1 
HETATM 10814 H  H61   . IPT L 3 .   ? -6.647  52.121 17.977 1.00 0.00   ? 998 IPT D H61   1 
HETATM 10815 H  H62   . IPT L 3 .   ? -6.506  52.360 19.735 1.00 0.00   ? 998 IPT D H62   1 
HETATM 10816 H  HO6   . IPT L 3 .   ? -8.194  53.619 19.548 1.00 0.00   ? 998 IPT D HO6   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   60  ?   ?   ?   A . n 
A 1 2   SER 2   61  61  SER SER A . n 
A 1 3   LEU 3   62  62  LEU LEU A . n 
A 1 4   LEU 4   63  63  LEU LEU A . n 
A 1 5   ILE 5   64  64  ILE ILE A . n 
A 1 6   GLY 6   65  65  GLY GLY A . n 
A 1 7   VAL 7   66  66  VAL VAL A . n 
A 1 8   ALA 8   67  67  ALA ALA A . n 
A 1 9   THR 9   68  68  THR THR A . n 
A 1 10  SER 10  69  69  SER SER A . n 
A 1 11  SER 11  70  70  SER SER A . n 
A 1 12  LEU 12  71  71  LEU LEU A . n 
A 1 13  ALA 13  72  72  ALA ALA A . n 
A 1 14  LEU 14  73  73  LEU LEU A . n 
A 1 15  HIS 15  74  74  HIS HIS A . n 
A 1 16  ALA 16  75  75  ALA ALA A . n 
A 1 17  PRO 17  76  76  PRO PRO A . n 
A 1 18  SER 18  77  77  SER SER A . n 
A 1 19  GLN 19  78  78  GLN GLN A . n 
A 1 20  ILE 20  79  79  ILE ILE A . n 
A 1 21  VAL 21  80  80  VAL VAL A . n 
A 1 22  ALA 22  81  81  ALA ALA A . n 
A 1 23  ALA 23  82  82  ALA ALA A . n 
A 1 24  ILE 24  83  83  ILE ILE A . n 
A 1 25  LYS 25  84  84  LYS LYS A . n 
A 1 26  SER 26  85  85  SER SER A . n 
A 1 27  ARG 27  86  86  ARG ARG A . n 
A 1 28  ALA 28  87  87  ALA ALA A . n 
A 1 29  ASP 29  88  88  ASP ASP A . n 
A 1 30  GLN 30  89  89  GLN GLN A . n 
A 1 31  LEU 31  90  90  LEU LEU A . n 
A 1 32  GLY 32  91  91  GLY GLY A . n 
A 1 33  ALA 33  92  92  ALA ALA A . n 
A 1 34  SER 34  93  93  SER SER A . n 
A 1 35  VAL 35  94  94  VAL VAL A . n 
A 1 36  VAL 36  95  95  VAL VAL A . n 
A 1 37  VAL 37  96  96  VAL VAL A . n 
A 1 38  SER 38  97  97  SER SER A . n 
A 1 39  MET 39  98  98  MET MET A . n 
A 1 40  VAL 40  99  99  VAL VAL A . n 
A 1 41  GLU 41  100 100 GLU GLU A . n 
A 1 42  ARG 42  101 101 ARG ARG A . n 
A 1 43  SER 43  102 102 SER SER A . n 
A 1 44  GLY 44  103 103 GLY GLY A . n 
A 1 45  VAL 45  104 104 VAL VAL A . n 
A 1 46  GLU 46  105 105 GLU GLU A . n 
A 1 47  ALA 47  106 106 ALA ALA A . n 
A 1 48  CYS 48  107 107 CYS CYS A . n 
A 1 49  LYS 49  108 108 LYS LYS A . n 
A 1 50  ALA 50  109 109 ALA ALA A . n 
A 1 51  ALA 51  110 110 ALA ALA A . n 
A 1 52  VAL 52  111 111 VAL VAL A . n 
A 1 53  HIS 53  112 112 HIS HIS A . n 
A 1 54  ASN 54  113 113 ASN ASN A . n 
A 1 55  LEU 55  114 114 LEU LEU A . n 
A 1 56  LEU 56  115 115 LEU LEU A . n 
A 1 57  ALA 57  116 116 ALA ALA A . n 
A 1 58  GLN 58  117 117 GLN GLN A . n 
A 1 59  ARG 59  118 118 ARG ARG A . n 
A 1 60  VAL 60  119 119 VAL VAL A . n 
A 1 61  SER 61  120 120 SER SER A . n 
A 1 62  GLY 62  121 121 GLY GLY A . n 
A 1 63  LEU 63  122 122 LEU LEU A . n 
A 1 64  ILE 64  123 123 ILE ILE A . n 
A 1 65  ILE 65  124 124 ILE ILE A . n 
A 1 66  ASN 66  125 125 ASN ASN A . n 
A 1 67  TYR 67  126 126 TYR TYR A . n 
A 1 68  PRO 68  127 127 PRO PRO A . n 
A 1 69  LEU 69  128 128 LEU LEU A . n 
A 1 70  ASP 70  129 129 ASP ASP A . n 
A 1 71  ASP 71  130 130 ASP ASP A . n 
A 1 72  GLN 72  131 131 GLN GLN A . n 
A 1 73  ASP 73  132 132 ASP ASP A . n 
A 1 74  ALA 74  133 133 ALA ALA A . n 
A 1 75  ILE 75  134 134 ILE ILE A . n 
A 1 76  ALA 76  135 135 ALA ALA A . n 
A 1 77  VAL 77  136 136 VAL VAL A . n 
A 1 78  GLU 78  137 137 GLU GLU A . n 
A 1 79  ALA 79  138 138 ALA ALA A . n 
A 1 80  ALA 80  139 139 ALA ALA A . n 
A 1 81  CYS 81  140 140 CYS CYS A . n 
A 1 82  THR 82  141 141 THR THR A . n 
A 1 83  ASN 83  142 142 ASN ASN A . n 
A 1 84  VAL 84  143 143 VAL VAL A . n 
A 1 85  PRO 85  144 144 PRO PRO A . n 
A 1 86  ALA 86  145 145 ALA ALA A . n 
A 1 87  LEU 87  146 146 LEU LEU A . n 
A 1 88  PHE 88  147 147 PHE PHE A . n 
A 1 89  LEU 89  148 148 LEU LEU A . n 
A 1 90  ASP 90  149 149 ASP ASP A . n 
A 1 91  VAL 91  150 150 VAL VAL A . n 
A 1 92  SER 92  151 151 SER SER A . n 
A 1 93  ASP 93  152 152 ASP ASP A . n 
A 1 94  GLN 94  153 153 GLN GLN A . n 
A 1 95  THR 95  154 154 THR THR A . n 
A 1 96  PRO 96  155 155 PRO PRO A . n 
A 1 97  ILE 97  156 156 ILE ILE A . n 
A 1 98  ASN 98  157 157 ASN ASN A . n 
A 1 99  SER 99  158 158 SER SER A . n 
A 1 100 ILE 100 159 159 ILE ILE A . n 
A 1 101 ILE 101 160 160 ILE ILE A . n 
A 1 102 PHE 102 161 161 PHE PHE A . n 
A 1 103 SER 103 162 162 SER SER A . n 
A 1 104 HIS 104 163 163 HIS HIS A . n 
A 1 105 GLU 105 164 164 GLU GLU A . n 
A 1 106 ASP 106 165 165 ASP ASP A . n 
A 1 107 GLY 107 166 166 GLY GLY A . n 
A 1 108 THR 108 167 167 THR THR A . n 
A 1 109 ARG 109 168 168 ARG ARG A . n 
A 1 110 LEU 110 169 169 LEU LEU A . n 
A 1 111 GLY 111 170 170 GLY GLY A . n 
A 1 112 VAL 112 171 171 VAL VAL A . n 
A 1 113 GLU 113 172 172 GLU GLU A . n 
A 1 114 HIS 114 173 173 HIS HIS A . n 
A 1 115 LEU 115 174 174 LEU LEU A . n 
A 1 116 VAL 116 175 175 VAL VAL A . n 
A 1 117 ALA 117 176 176 ALA ALA A . n 
A 1 118 LEU 118 177 177 LEU LEU A . n 
A 1 119 GLY 119 178 178 GLY GLY A . n 
A 1 120 HIS 120 179 179 HIS HIS A . n 
A 1 121 GLN 121 180 180 GLN GLN A . n 
A 1 122 GLN 122 181 181 GLN GLN A . n 
A 1 123 ILE 123 182 182 ILE ILE A . n 
A 1 124 ALA 124 183 183 ALA ALA A . n 
A 1 125 LEU 125 184 184 LEU LEU A . n 
A 1 126 LEU 126 185 185 LEU LEU A . n 
A 1 127 ALA 127 186 186 ALA ALA A . n 
A 1 128 GLY 128 187 187 GLY GLY A . n 
A 1 129 PRO 129 188 188 PRO PRO A . n 
A 1 130 LEU 130 189 189 LEU LEU A . n 
A 1 131 SER 131 190 190 SER SER A . n 
A 1 132 SER 132 191 191 SER SER A . n 
A 1 133 VAL 133 192 192 VAL VAL A . n 
A 1 134 SER 134 193 193 SER SER A . n 
A 1 135 ALA 135 194 194 ALA ALA A . n 
A 1 136 ARG 136 195 195 ARG ARG A . n 
A 1 137 LEU 137 196 196 LEU LEU A . n 
A 1 138 ARG 138 197 197 ARG ARG A . n 
A 1 139 LEU 139 198 198 LEU LEU A . n 
A 1 140 ALA 140 199 199 ALA ALA A . n 
A 1 141 GLY 141 200 200 GLY GLY A . n 
A 1 142 TRP 142 201 201 TRP TRP A . n 
A 1 143 HIS 143 202 202 HIS HIS A . n 
A 1 144 LYS 144 203 203 LYS LYS A . n 
A 1 145 TYR 145 204 204 TYR TYR A . n 
A 1 146 LEU 146 205 205 LEU LEU A . n 
A 1 147 THR 147 206 206 THR THR A . n 
A 1 148 ARG 148 207 207 ARG ARG A . n 
A 1 149 ASN 149 208 208 ASN ASN A . n 
A 1 150 GLN 150 209 209 GLN GLN A . n 
A 1 151 ILE 151 210 210 ILE ILE A . n 
A 1 152 GLN 152 211 211 GLN GLN A . n 
A 1 153 PRO 153 212 212 PRO PRO A . n 
A 1 154 ILE 154 213 213 ILE ILE A . n 
A 1 155 ALA 155 214 214 ALA ALA A . n 
A 1 156 GLU 156 215 215 GLU GLU A . n 
A 1 157 ARG 157 216 216 ARG ARG A . n 
A 1 158 GLU 158 217 217 GLU GLU A . n 
A 1 159 GLY 159 218 218 GLY GLY A . n 
A 1 160 ASP 160 219 219 ASP ASP A . n 
A 1 161 TRP 161 220 220 TRP TRP A . n 
A 1 162 SER 162 221 221 SER SER A . n 
A 1 163 ALA 163 222 222 ALA ALA A . n 
A 1 164 MET 164 223 223 MET MET A . n 
A 1 165 SER 165 224 224 SER SER A . n 
A 1 166 GLY 166 225 225 GLY GLY A . n 
A 1 167 PHE 167 226 226 PHE PHE A . n 
A 1 168 GLN 168 227 227 GLN GLN A . n 
A 1 169 GLN 169 228 228 GLN GLN A . n 
A 1 170 THR 170 229 229 THR THR A . n 
A 1 171 MET 171 230 230 MET MET A . n 
A 1 172 GLN 172 231 231 GLN GLN A . n 
A 1 173 MET 173 232 232 MET MET A . n 
A 1 174 LEU 174 233 233 LEU LEU A . n 
A 1 175 ASN 175 234 234 ASN ASN A . n 
A 1 176 GLU 176 235 235 GLU GLU A . n 
A 1 177 GLY 177 236 236 GLY GLY A . n 
A 1 178 ILE 178 237 237 ILE ILE A . n 
A 1 179 VAL 179 238 238 VAL VAL A . n 
A 1 180 PRO 180 239 239 PRO PRO A . n 
A 1 181 THR 181 240 240 THR THR A . n 
A 1 182 ALA 182 241 241 ALA ALA A . n 
A 1 183 MET 183 242 242 MET MET A . n 
A 1 184 LEU 184 243 243 LEU LEU A . n 
A 1 185 VAL 185 244 244 VAL VAL A . n 
A 1 186 ALA 186 245 245 ALA ALA A . n 
A 1 187 ASN 187 246 246 ASN ASN A . n 
A 1 188 ASP 188 247 247 ASP ASP A . n 
A 1 189 GLN 189 248 248 GLN GLN A . n 
A 1 190 MET 190 249 249 MET MET A . n 
A 1 191 ALA 191 250 250 ALA ALA A . n 
A 1 192 LEU 192 251 251 LEU LEU A . n 
A 1 193 GLY 193 252 252 GLY GLY A . n 
A 1 194 ALA 194 253 253 ALA ALA A . n 
A 1 195 MET 195 254 254 MET MET A . n 
A 1 196 ARG 196 255 255 ARG ARG A . n 
A 1 197 ALA 197 256 256 ALA ALA A . n 
A 1 198 ILE 198 257 257 ILE ILE A . n 
A 1 199 THR 199 258 258 THR THR A . n 
A 1 200 GLU 200 259 259 GLU GLU A . n 
A 1 201 SER 201 260 260 SER SER A . n 
A 1 202 GLY 202 261 261 GLY GLY A . n 
A 1 203 LEU 203 262 262 LEU LEU A . n 
A 1 204 ARG 204 263 263 ARG ARG A . n 
A 1 205 VAL 205 264 264 VAL VAL A . n 
A 1 206 GLY 206 265 265 GLY GLY A . n 
A 1 207 ALA 207 266 266 ALA ALA A . n 
A 1 208 ASP 208 267 267 ASP ASP A . n 
A 1 209 ILE 209 268 268 ILE ILE A . n 
A 1 210 SER 210 269 269 SER SER A . n 
A 1 211 VAL 211 270 270 VAL VAL A . n 
A 1 212 VAL 212 271 271 VAL VAL A . n 
A 1 213 GLY 213 272 272 GLY GLY A . n 
A 1 214 TYR 214 273 273 TYR TYR A . n 
A 1 215 ASP 215 274 274 ASP ASP A . n 
A 1 216 ASP 216 275 275 ASP ASP A . n 
A 1 217 THR 217 276 276 THR THR A . n 
A 1 218 GLU 218 277 277 GLU GLU A . n 
A 1 219 ASP 219 278 278 ASP ASP A . n 
A 1 220 SER 220 279 279 SER SER A . n 
A 1 221 SER 221 280 280 SER SER A . n 
A 1 222 CYS 222 281 281 CYS CYS A . n 
A 1 223 TYR 223 282 282 TYR TYR A . n 
A 1 224 ILE 224 283 283 ILE ILE A . n 
A 1 225 PRO 225 284 284 PRO PRO A . n 
A 1 226 PRO 226 285 285 PRO PRO A . n 
A 1 227 LEU 227 286 286 LEU LEU A . n 
A 1 228 THR 228 287 287 THR THR A . n 
A 1 229 THR 229 288 288 THR THR A . n 
A 1 230 ILE 230 289 289 ILE ILE A . n 
A 1 231 LYS 231 290 290 LYS LYS A . n 
A 1 232 GLN 232 291 291 GLN GLN A . n 
A 1 233 ASP 233 292 292 ASP ASP A . n 
A 1 234 PHE 234 293 293 PHE PHE A . n 
A 1 235 ARG 235 294 294 ARG ARG A . n 
A 1 236 LEU 236 295 295 LEU LEU A . n 
A 1 237 LEU 237 296 296 LEU LEU A . n 
A 1 238 GLY 238 297 297 GLY GLY A . n 
A 1 239 GLN 239 298 298 GLN GLN A . n 
A 1 240 THR 240 299 299 THR THR