data_1TQF
# 
_entry.id   1TQF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1TQF         
RCSB  RCSB022836   
WWPDB D_1000022836 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TQF 
_pdbx_database_status.recvd_initial_deposition_date   2004-06-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Munshi, S.' 1 
'Chen, Z.'   2 
'Kuo, L.'    3 
# 
_citation.id                        primary 
_citation.title                     
;Identification of a small molecule nonpeptide active site beta-secretase inhibitor that displays a nontraditional binding mode for aspartyl proteases.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            47 
_citation.page_first                6117 
_citation.page_last                 6119 
_citation.year                      2004 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15566281 
_citation.pdbx_database_id_DOI      10.1021/jm049388p 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coburn, C.A.'     1  
primary 'Stachel, S.J.'    2  
primary 'Li, Y.M.'         3  
primary 'Rush, D.M.'       4  
primary 'Steele, T.G.'     5  
primary 'Chen-Dodson, E.'  6  
primary 'Holloway, M.K.'   7  
primary 'Xu, M.'           8  
primary 'Huang, Q.'        9  
primary 'Lai, M.T.'        10 
primary 'DiMuzio, J.'      11 
primary 'Crouthamel, M.C.' 12 
primary 'Shi, X.P.'        13 
primary 'Sardana, V.'      14 
primary 'Chen, Z.'         15 
primary 'Munshi, S.'       16 
primary 'Kuo, L.'          17 
primary 'Makara, G.M.'     18 
primary 'Annis, D.A.'      19 
primary 'Tadikonda, P.K.'  20 
primary 'Nash, H.M.'       21 
primary 'Vacca, J.P.'      22 
primary 'Wang, T.'         23 
# 
_cell.entry_id           1TQF 
_cell.length_a           104.916 
_cell.length_b           128.181 
_cell.length_c           76.272 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1TQF 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Beta-secretase 1' 45122.750 1   3.4.23.46 'K75A, E77A' 'Protease domain (residues 43-446)' ? 
2 non-polymer syn 
'3-{2-[(5-AMINOPENTYL)AMINO]-2-OXOETHOXY}-5-({[1-(4-FLUOROPHENYL)ETHYL]AMINO}CARBONYL)PHENYL PHENYLMETHANESULFONATE' 571.660   1   
?         ?            ?                                   ? 
3 water       nat water 18.015    360 ?         ?            ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Beta-site APP cleaving enzyme 1, Beta-site amyloid precursor protein cleaving enzyme 1, Aspartyl protease 2, Asp 2, ASP2, Membrane-associated aspartic protease 2, Memapsin-2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
RDLRKGVYVPYTQGAWAGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSL
VKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEY
NYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITI
LPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDME
DCGYN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
RDLRKGVYVPYTQGAWAGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSL
VKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEY
NYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITI
LPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDME
DCGYN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   PRO n 
1 4   ARG n 
1 5   GLU n 
1 6   THR n 
1 7   ASP n 
1 8   GLU n 
1 9   GLU n 
1 10  PRO n 
1 11  GLU n 
1 12  GLU n 
1 13  PRO n 
1 14  GLY n 
1 15  ARG n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  PHE n 
1 20  VAL n 
1 21  GLU n 
1 22  MET n 
1 23  VAL n 
1 24  ASP n 
1 25  ASN n 
1 26  LEU n 
1 27  ARG n 
1 28  GLY n 
1 29  LYS n 
1 30  SER n 
1 31  GLY n 
1 32  GLN n 
1 33  GLY n 
1 34  TYR n 
1 35  TYR n 
1 36  VAL n 
1 37  GLU n 
1 38  MET n 
1 39  THR n 
1 40  VAL n 
1 41  GLY n 
1 42  SER n 
1 43  PRO n 
1 44  PRO n 
1 45  GLN n 
1 46  THR n 
1 47  LEU n 
1 48  ASN n 
1 49  ILE n 
1 50  LEU n 
1 51  VAL n 
1 52  ASP n 
1 53  THR n 
1 54  GLY n 
1 55  SER n 
1 56  SER n 
1 57  ASN n 
1 58  PHE n 
1 59  ALA n 
1 60  VAL n 
1 61  GLY n 
1 62  ALA n 
1 63  ALA n 
1 64  PRO n 
1 65  HIS n 
1 66  PRO n 
1 67  PHE n 
1 68  LEU n 
1 69  HIS n 
1 70  ARG n 
1 71  TYR n 
1 72  TYR n 
1 73  GLN n 
1 74  ARG n 
1 75  GLN n 
1 76  LEU n 
1 77  SER n 
1 78  SER n 
1 79  THR n 
1 80  TYR n 
1 81  ARG n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  LYS n 
1 86  GLY n 
1 87  VAL n 
1 88  TYR n 
1 89  VAL n 
1 90  PRO n 
1 91  TYR n 
1 92  THR n 
1 93  GLN n 
1 94  GLY n 
1 95  ALA n 
1 96  TRP n 
1 97  ALA n 
1 98  GLY n 
1 99  GLU n 
1 100 LEU n 
1 101 GLY n 
1 102 THR n 
1 103 ASP n 
1 104 LEU n 
1 105 VAL n 
1 106 SER n 
1 107 ILE n 
1 108 PRO n 
1 109 HIS n 
1 110 GLY n 
1 111 PRO n 
1 112 ASN n 
1 113 VAL n 
1 114 THR n 
1 115 VAL n 
1 116 ARG n 
1 117 ALA n 
1 118 ASN n 
1 119 ILE n 
1 120 ALA n 
1 121 ALA n 
1 122 ILE n 
1 123 THR n 
1 124 GLU n 
1 125 SER n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASN n 
1 132 GLY n 
1 133 SER n 
1 134 ASN n 
1 135 TRP n 
1 136 GLU n 
1 137 GLY n 
1 138 ILE n 
1 139 LEU n 
1 140 GLY n 
1 141 LEU n 
1 142 ALA n 
1 143 TYR n 
1 144 ALA n 
1 145 GLU n 
1 146 ILE n 
1 147 ALA n 
1 148 ARG n 
1 149 PRO n 
1 150 ASP n 
1 151 ASP n 
1 152 SER n 
1 153 LEU n 
1 154 GLU n 
1 155 PRO n 
1 156 PHE n 
1 157 PHE n 
1 158 ASP n 
1 159 SER n 
1 160 LEU n 
1 161 VAL n 
1 162 LYS n 
1 163 GLN n 
1 164 THR n 
1 165 HIS n 
1 166 VAL n 
1 167 PRO n 
1 168 ASN n 
1 169 LEU n 
1 170 PHE n 
1 171 SER n 
1 172 LEU n 
1 173 GLN n 
1 174 LEU n 
1 175 CYS n 
1 176 GLY n 
1 177 ALA n 
1 178 GLY n 
1 179 PHE n 
1 180 PRO n 
1 181 LEU n 
1 182 ASN n 
1 183 GLN n 
1 184 SER n 
1 185 GLU n 
1 186 VAL n 
1 187 LEU n 
1 188 ALA n 
1 189 SER n 
1 190 VAL n 
1 191 GLY n 
1 192 GLY n 
1 193 SER n 
1 194 MET n 
1 195 ILE n 
1 196 ILE n 
1 197 GLY n 
1 198 GLY n 
1 199 ILE n 
1 200 ASP n 
1 201 HIS n 
1 202 SER n 
1 203 LEU n 
1 204 TYR n 
1 205 THR n 
1 206 GLY n 
1 207 SER n 
1 208 LEU n 
1 209 TRP n 
1 210 TYR n 
1 211 THR n 
1 212 PRO n 
1 213 ILE n 
1 214 ARG n 
1 215 ARG n 
1 216 GLU n 
1 217 TRP n 
1 218 TYR n 
1 219 TYR n 
1 220 GLU n 
1 221 VAL n 
1 222 ILE n 
1 223 ILE n 
1 224 VAL n 
1 225 ARG n 
1 226 VAL n 
1 227 GLU n 
1 228 ILE n 
1 229 ASN n 
1 230 GLY n 
1 231 GLN n 
1 232 ASP n 
1 233 LEU n 
1 234 LYS n 
1 235 MET n 
1 236 ASP n 
1 237 CYS n 
1 238 LYS n 
1 239 GLU n 
1 240 TYR n 
1 241 ASN n 
1 242 TYR n 
1 243 ASP n 
1 244 LYS n 
1 245 SER n 
1 246 ILE n 
1 247 VAL n 
1 248 ASP n 
1 249 SER n 
1 250 GLY n 
1 251 THR n 
1 252 THR n 
1 253 ASN n 
1 254 LEU n 
1 255 ARG n 
1 256 LEU n 
1 257 PRO n 
1 258 LYS n 
1 259 LYS n 
1 260 VAL n 
1 261 PHE n 
1 262 GLU n 
1 263 ALA n 
1 264 ALA n 
1 265 VAL n 
1 266 LYS n 
1 267 SER n 
1 268 ILE n 
1 269 LYS n 
1 270 ALA n 
1 271 ALA n 
1 272 SER n 
1 273 SER n 
1 274 THR n 
1 275 GLU n 
1 276 LYS n 
1 277 PHE n 
1 278 PRO n 
1 279 ASP n 
1 280 GLY n 
1 281 PHE n 
1 282 TRP n 
1 283 LEU n 
1 284 GLY n 
1 285 GLU n 
1 286 GLN n 
1 287 LEU n 
1 288 VAL n 
1 289 CYS n 
1 290 TRP n 
1 291 GLN n 
1 292 ALA n 
1 293 GLY n 
1 294 THR n 
1 295 THR n 
1 296 PRO n 
1 297 TRP n 
1 298 ASN n 
1 299 ILE n 
1 300 PHE n 
1 301 PRO n 
1 302 VAL n 
1 303 ILE n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 LEU n 
1 308 MET n 
1 309 GLY n 
1 310 GLU n 
1 311 VAL n 
1 312 THR n 
1 313 ASN n 
1 314 GLN n 
1 315 SER n 
1 316 PHE n 
1 317 ARG n 
1 318 ILE n 
1 319 THR n 
1 320 ILE n 
1 321 LEU n 
1 322 PRO n 
1 323 GLN n 
1 324 GLN n 
1 325 TYR n 
1 326 LEU n 
1 327 ARG n 
1 328 PRO n 
1 329 VAL n 
1 330 GLU n 
1 331 ASP n 
1 332 VAL n 
1 333 ALA n 
1 334 THR n 
1 335 SER n 
1 336 GLN n 
1 337 ASP n 
1 338 ASP n 
1 339 CYS n 
1 340 TYR n 
1 341 LYS n 
1 342 PHE n 
1 343 ALA n 
1 344 ILE n 
1 345 SER n 
1 346 GLN n 
1 347 SER n 
1 348 SER n 
1 349 THR n 
1 350 GLY n 
1 351 THR n 
1 352 VAL n 
1 353 MET n 
1 354 GLY n 
1 355 ALA n 
1 356 VAL n 
1 357 ILE n 
1 358 MET n 
1 359 GLU n 
1 360 GLY n 
1 361 PHE n 
1 362 TYR n 
1 363 VAL n 
1 364 VAL n 
1 365 PHE n 
1 366 ASP n 
1 367 ARG n 
1 368 ALA n 
1 369 ARG n 
1 370 LYS n 
1 371 ARG n 
1 372 ILE n 
1 373 GLY n 
1 374 PHE n 
1 375 ALA n 
1 376 VAL n 
1 377 SER n 
1 378 ALA n 
1 379 CYS n 
1 380 HIS n 
1 381 VAL n 
1 382 HIS n 
1 383 ASP n 
1 384 GLU n 
1 385 PHE n 
1 386 ARG n 
1 387 THR n 
1 388 ALA n 
1 389 ALA n 
1 390 VAL n 
1 391 GLU n 
1 392 GLY n 
1 393 PRO n 
1 394 PHE n 
1 395 VAL n 
1 396 THR n 
1 397 LEU n 
1 398 ASP n 
1 399 MET n 
1 400 GLU n 
1 401 ASP n 
1 402 CYS n 
1 403 GLY n 
1 404 TYR n 
1 405 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'BACE1, BACE' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BACE1_HUMAN 
_struct_ref.pdbx_db_accession          P56817 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYR
DLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLV
KQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYN
YDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITIL
PQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMED
CGYN
;
_struct_ref.pdbx_align_begin           43 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1TQF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   P 
_struct_ref_seq.seq_align_end                 405 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P56817 
_struct_ref_seq.db_align_beg                  43 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  446 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       30 
_struct_ref_seq.pdbx_auth_seq_align_end       385 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1TQF MET A 1  P UNP P56817 ?   ?   'INITIATING METHIONINE' 29 1 
1 1TQF ALA A 95 ? UNP P56817 LYS 136 ENGINEERED              75 2 
1 1TQF ALA A 97 ? UNP P56817 GLU 138 ENGINEERED              77 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
32P non-polymer         . 
'3-{2-[(5-AMINOPENTYL)AMINO]-2-OXOETHOXY}-5-({[1-(4-FLUOROPHENYL)ETHYL]AMINO}CARBONYL)PHENYL PHENYLMETHANESULFONATE' ? 
'C29 H34 F N3 O6 S' 571.660 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1TQF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.84 
_exptl_crystal.density_percent_sol   56.69 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'1.5M Lithium sulfate, 0.1M  HEPES Buffer, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1TQF 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100.0 
_reflns.d_resolution_high            1.79 
_reflns.number_obs                   46287 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20 
_reflns.B_iso_Wilson_estimate        16.2 
_reflns.pdbx_redundancy              5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1TQF 
_refine.ls_number_reflns_obs                     44178 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               639138.99 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    94.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.221 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  4445 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               20.4 
_refine.aniso_B[1][1]                            -4.52 
_refine.aniso_B[2][2]                            1.97 
_refine.aniso_B[3][3]                            2.55 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1FKN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1TQF 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2917 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             360 
_refine_hist.number_atoms_total               3317 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.8  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.80  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             6209 
_refine_ls_shell.R_factor_R_work                  0.308 
_refine_ls_shell.percent_reflns_obs               89.5 
_refine_ls_shell.R_factor_R_free                  0.353 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            9.8 
_refine_ls_shell.number_reflns_R_free             678 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 IN.XPRM           ?           'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1TQF 
_struct.title                     'Crystal structure of human Beta secretase complexed with inhibitor' 
_struct.pdbx_descriptor           'Beta-secretase 1 (E.C.3.4.23.46)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TQF 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Aspartyl Protease, BACE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 19  P VAL A 23  ? PHE A 47  VAL A 3   5 ? 5  
HELX_P HELX_P2  2  GLN A 73  ? SER A 77  ? GLN A 53  SER A 57  5 ? 5  
HELX_P HELX_P3  3  TYR A 143 ? ALA A 147 ? TYR A 123 ALA A 127 5 ? 5  
HELX_P HELX_P4  4  PRO A 155 ? THR A 164 ? PRO A 135 THR A 144 1 ? 10 
HELX_P HELX_P5  5  ASP A 200 ? SER A 202 ? ASP A 180 SER A 182 5 ? 3  
HELX_P HELX_P6  6  ASP A 236 ? ASN A 241 ? ASP A 216 ASN A 221 1 ? 6  
HELX_P HELX_P7  7  LYS A 258 ? SER A 272 ? LYS A 238 SER A 252 1 ? 15 
HELX_P HELX_P8  8  PRO A 278 ? LEU A 283 ? PRO A 258 LEU A 263 1 ? 6  
HELX_P HELX_P9  9  PRO A 296 ? PHE A 300 ? PRO A 276 PHE A 280 5 ? 5  
HELX_P HELX_P10 10 LEU A 321 ? TYR A 325 ? LEU A 301 TYR A 305 1 ? 5  
HELX_P HELX_P11 11 GLY A 354 ? GLU A 359 ? GLY A 334 GLU A 339 1 ? 6  
HELX_P HELX_P12 12 ARG A 367 ? ARG A 369 ? ARG A 347 ARG A 349 5 ? 3  
HELX_P HELX_P13 13 ASP A 398 ? GLY A 403 ? ASP A 378 GLY A 383 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 175 SG ? ? ? 1_555 A CYS 379 SG ? ? A CYS 155 A CYS 359 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 237 SG ? ? ? 1_555 A CYS 402 SG ? ? A CYS 217 A CYS 382 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3 disulf ? ? A CYS 289 SG ? ? ? 1_555 A CYS 339 SG ? ? A CYS 269 A CYS 319 1_555 ? ? ? ? ? ? ? 2.028 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 42  A . ? SER 22  A PRO 43  A ? PRO 23  A 1 -0.23 
2 ARG 148 A . ? ARG 128 A PRO 149 A ? PRO 129 A 1 0.07  
3 GLY 392 A . ? GLY 372 A PRO 393 A ? PRO 373 A 1 -0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 4 ? 
C ? 5 ? 
D ? 5 ? 
E ? 4 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 26  ? ARG A 27  ? LEU A 6   ARG A 7   
A 2 TYR A 35  ? VAL A 40  ? TYR A 15  VAL A 20  
A 3 GLN A 45  ? ASP A 52  ? GLN A 25  ASP A 32  
A 4 GLY A 137 ? GLY A 140 ? GLY A 117 GLY A 120 
A 5 PHE A 58  ? GLY A 61  ? PHE A 38  GLY A 41  
A 6 VAL A 115 ? ASP A 126 ? VAL A 95  ASP A 106 
A 7 ALA A 95  ? SER A 106 ? ALA A 75  SER A 86  
A 8 ARG A 81  ? PRO A 90  ? ARG A 61  PRO A 70  
B 1 LEU A 26  ? ARG A 27  ? LEU A 6   ARG A 7   
B 2 TYR A 35  ? VAL A 40  ? TYR A 15  VAL A 20  
B 3 ALA A 95  ? SER A 106 ? ALA A 75  SER A 86  
B 4 ARG A 81  ? PRO A 90  ? ARG A 61  PRO A 70  
C 1 GLY A 192 ? ILE A 196 ? GLY A 172 ILE A 176 
C 2 PHE A 170 ? LEU A 174 ? PHE A 150 LEU A 154 
C 3 PHE A 361 ? ASP A 366 ? PHE A 341 ASP A 346 
C 4 ARG A 371 ? SER A 377 ? ARG A 351 SER A 357 
C 5 TYR A 204 ? PRO A 212 ? TYR A 184 PRO A 192 
D 1 GLN A 231 ? ASP A 232 ? GLN A 211 ASP A 212 
D 2 ILE A 223 ? ILE A 228 ? ILE A 203 ILE A 208 
D 3 ILE A 303 ? MET A 308 ? ILE A 283 MET A 288 
D 4 GLN A 314 ? ILE A 320 ? GLN A 294 ILE A 300 
D 5 ALA A 389 ? VAL A 395 ? ALA A 369 VAL A 375 
E 1 SER A 245 ? VAL A 247 ? SER A 225 VAL A 227 
E 2 THR A 351 ? MET A 353 ? THR A 331 MET A 333 
E 3 LEU A 254 ? PRO A 257 ? LEU A 234 PRO A 237 
E 4 ILE A 344 ? SER A 347 ? ILE A 324 SER A 327 
F 1 VAL A 288 ? GLN A 291 ? VAL A 268 GLN A 271 
F 2 ASP A 337 ? PHE A 342 ? ASP A 317 PHE A 322 
F 3 LEU A 326 ? PRO A 328 ? LEU A 306 PRO A 308 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 27  ? N ARG A 7   O TYR A 35  ? O TYR A 15  
A 2 3 N VAL A 40  ? N VAL A 20  O GLN A 45  ? O GLN A 25  
A 3 4 N LEU A 50  ? N LEU A 30  O LEU A 139 ? O LEU A 119 
A 4 5 O ILE A 138 ? O ILE A 118 N ALA A 59  ? N ALA A 39  
A 5 6 N VAL A 60  ? N VAL A 40  O ILE A 122 ? O ILE A 102 
A 6 7 O ALA A 121 ? O ALA A 101 N GLU A 99  ? N GLU A 79  
A 7 8 O GLY A 98  ? O GLY A 78  N VAL A 87  ? N VAL A 67  
B 1 2 N ARG A 27  ? N ARG A 7   O TYR A 35  ? O TYR A 15  
B 2 3 N THR A 39  ? N THR A 19  O SER A 106 ? O SER A 86  
B 3 4 O GLY A 98  ? O GLY A 78  N VAL A 87  ? N VAL A 67  
C 1 2 O SER A 193 ? O SER A 173 N GLN A 173 ? N GLN A 153 
C 2 3 N LEU A 172 ? N LEU A 152 O VAL A 363 ? O VAL A 343 
C 3 4 N TYR A 362 ? N TYR A 342 O ALA A 375 ? O ALA A 355 
C 4 5 O ILE A 372 ? O ILE A 352 N THR A 211 ? N THR A 191 
D 1 2 O GLN A 231 ? O GLN A 211 N ILE A 228 ? N ILE A 208 
D 2 3 N ARG A 225 ? N ARG A 205 O TYR A 306 ? O TYR A 286 
D 3 4 N ILE A 303 ? N ILE A 283 O ILE A 320 ? O ILE A 300 
D 4 5 N ARG A 317 ? N ARG A 297 O GLU A 391 ? O GLU A 371 
E 1 2 N ILE A 246 ? N ILE A 226 O MET A 353 ? O MET A 333 
E 2 3 O VAL A 352 ? O VAL A 332 N ARG A 255 ? N ARG A 235 
E 3 4 N LEU A 256 ? N LEU A 236 O SER A 345 ? O SER A 325 
F 1 2 N TRP A 290 ? N TRP A 270 O ASP A 338 ? O ASP A 318 
F 2 3 O LYS A 341 ? O LYS A 321 N ARG A 327 ? N ARG A 307 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    23 
_struct_site.details              'BINDING SITE FOR RESIDUE 32P A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 GLN A 32  ? GLN A 12  . ? 1_555 ? 
2  AC1 23 GLY A 33  ? GLY A 13  . ? 1_555 ? 
3  AC1 23 TYR A 34  ? TYR A 14  . ? 1_555 ? 
4  AC1 23 LEU A 50  ? LEU A 30  . ? 1_555 ? 
5  AC1 23 TYR A 91  ? TYR A 71  . ? 1_555 ? 
6  AC1 23 THR A 92  ? THR A 72  . ? 1_555 ? 
7  AC1 23 GLN A 93  ? GLN A 73  . ? 1_555 ? 
8  AC1 23 LYS A 127 ? LYS A 107 . ? 1_555 ? 
9  AC1 23 PHE A 128 ? PHE A 108 . ? 1_555 ? 
10 AC1 23 ILE A 138 ? ILE A 118 . ? 1_555 ? 
11 AC1 23 SER A 249 ? SER A 229 . ? 1_555 ? 
12 AC1 23 GLY A 250 ? GLY A 230 . ? 1_555 ? 
13 AC1 23 THR A 251 ? THR A 231 . ? 1_555 ? 
14 AC1 23 THR A 252 ? THR A 232 . ? 1_555 ? 
15 AC1 23 ASN A 253 ? ASN A 233 . ? 1_555 ? 
16 AC1 23 ARG A 255 ? ARG A 235 . ? 1_555 ? 
17 AC1 23 LYS A 341 ? LYS A 321 . ? 1_555 ? 
18 AC1 23 SER A 345 ? SER A 325 . ? 1_555 ? 
19 AC1 23 ALA A 355 ? ALA A 335 . ? 1_555 ? 
20 AC1 23 HOH C .   ? HOH A 436 . ? 1_555 ? 
21 AC1 23 HOH C .   ? HOH A 489 . ? 1_555 ? 
22 AC1 23 HOH C .   ? HOH A 644 . ? 1_555 ? 
23 AC1 23 HOH C .   ? HOH A 683 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1TQF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1TQF 
_atom_sites.fract_transf_matrix[1][1]   0.009531 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007801 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013111 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 17  P 40.067 42.403 33.012  1.00 24.22 ? 45  GLY A N   1 
ATOM   2    C CA  . GLY A 1 17  P 39.675 40.982 32.827  1.00 22.93 ? 45  GLY A CA  1 
ATOM   3    C C   . GLY A 1 17  P 40.828 40.120 32.356  1.00 22.64 ? 45  GLY A C   1 
ATOM   4    O O   . GLY A 1 17  P 41.826 40.623 31.839  1.00 23.12 ? 45  GLY A O   1 
ATOM   5    N N   . SER A 1 18  P 40.692 38.811 32.521  1.00 22.80 ? 46  SER A N   1 
ATOM   6    C CA  . SER A 1 18  P 41.741 37.892 32.103  1.00 23.39 ? 46  SER A CA  1 
ATOM   7    C C   . SER A 1 18  P 42.045 37.990 30.610  1.00 22.67 ? 46  SER A C   1 
ATOM   8    O O   . SER A 1 18  P 43.176 37.740 30.191  1.00 23.04 ? 46  SER A O   1 
ATOM   9    C CB  . SER A 1 18  P 41.357 36.455 32.463  1.00 24.84 ? 46  SER A CB  1 
ATOM   10   O OG  . SER A 1 18  P 40.246 36.022 31.700  1.00 27.83 ? 46  SER A OG  1 
ATOM   11   N N   . PHE A 1 19  P 41.043 38.352 29.805  1.00 20.09 ? 47  PHE A N   1 
ATOM   12   C CA  . PHE A 1 19  P 41.220 38.479 28.354  1.00 18.34 ? 47  PHE A CA  1 
ATOM   13   C C   . PHE A 1 19  P 41.637 39.873 27.879  1.00 16.95 ? 47  PHE A C   1 
ATOM   14   O O   . PHE A 1 19  P 41.551 40.167 26.688  1.00 15.86 ? 47  PHE A O   1 
ATOM   15   C CB  . PHE A 1 19  P 39.930 38.102 27.611  1.00 17.96 ? 47  PHE A CB  1 
ATOM   16   C CG  . PHE A 1 19  P 39.630 36.631 27.602  1.00 16.84 ? 47  PHE A CG  1 
ATOM   17   C CD1 . PHE A 1 19  P 38.847 36.058 28.597  1.00 17.33 ? 47  PHE A CD1 1 
ATOM   18   C CD2 . PHE A 1 19  P 40.129 35.817 26.590  1.00 16.17 ? 47  PHE A CD2 1 
ATOM   19   C CE1 . PHE A 1 19  P 38.564 34.695 28.584  1.00 16.51 ? 47  PHE A CE1 1 
ATOM   20   C CE2 . PHE A 1 19  P 39.854 34.455 26.569  1.00 15.50 ? 47  PHE A CE2 1 
ATOM   21   C CZ  . PHE A 1 19  P 39.069 33.892 27.569  1.00 16.47 ? 47  PHE A CZ  1 
ATOM   22   N N   . VAL A 1 20  P 42.093 40.720 28.797  1.00 17.00 ? 48  VAL A N   1 
ATOM   23   C CA  . VAL A 1 20  P 42.496 42.087 28.466  1.00 16.65 ? 48  VAL A CA  1 
ATOM   24   C C   . VAL A 1 20  P 43.385 42.290 27.249  1.00 16.77 ? 48  VAL A C   1 
ATOM   25   O O   . VAL A 1 20  P 43.209 43.261 26.517  1.00 16.61 ? 48  VAL A O   1 
ATOM   26   C CB  . VAL A 1 20  P 43.205 42.793 29.656  1.00 18.62 ? 48  VAL A CB  1 
ATOM   27   C CG1 . VAL A 1 20  P 42.205 43.113 30.736  1.00 22.67 ? 48  VAL A CG1 1 
ATOM   28   C CG2 . VAL A 1 20  P 44.319 41.922 30.207  1.00 16.41 ? 48  VAL A CG2 1 
ATOM   29   N N   . GLU A 1 21  ? 44.340 41.396 27.018  1.00 15.10 ? 1   GLU A N   1 
ATOM   30   C CA  . GLU A 1 21  ? 45.233 41.578 25.882  1.00 15.60 ? 1   GLU A CA  1 
ATOM   31   C C   . GLU A 1 21  ? 44.567 41.423 24.519  1.00 15.34 ? 1   GLU A C   1 
ATOM   32   O O   . GLU A 1 21  ? 45.154 41.767 23.494  1.00 13.31 ? 1   GLU A O   1 
ATOM   33   C CB  . GLU A 1 21  ? 46.423 40.630 25.974  1.00 16.55 ? 1   GLU A CB  1 
ATOM   34   C CG  . GLU A 1 21  ? 47.460 40.901 24.899  1.00 21.83 ? 1   GLU A CG  1 
ATOM   35   C CD  . GLU A 1 21  ? 48.602 39.919 24.935  1.00 25.25 ? 1   GLU A CD  1 
ATOM   36   O OE1 . GLU A 1 21  ? 49.204 39.764 26.031  1.00 23.40 ? 1   GLU A OE1 1 
ATOM   37   O OE2 . GLU A 1 21  ? 48.890 39.316 23.872  1.00 18.51 ? 1   GLU A OE2 1 
ATOM   38   N N   . MET A 1 22  ? 43.350 40.895 24.500  1.00 13.34 ? 2   MET A N   1 
ATOM   39   C CA  . MET A 1 22  ? 42.635 40.743 23.243  1.00 14.01 ? 2   MET A CA  1 
ATOM   40   C C   . MET A 1 22  ? 41.677 41.903 23.018  1.00 14.48 ? 2   MET A C   1 
ATOM   41   O O   . MET A 1 22  ? 41.097 42.028 21.945  1.00 12.76 ? 2   MET A O   1 
ATOM   42   C CB  . MET A 1 22  ? 41.866 39.427 23.220  1.00 14.52 ? 2   MET A CB  1 
ATOM   43   C CG  . MET A 1 22  ? 42.768 38.216 23.321  1.00 15.21 ? 2   MET A CG  1 
ATOM   44   S SD  . MET A 1 22  ? 41.899 36.706 22.920  1.00 15.75 ? 2   MET A SD  1 
ATOM   45   C CE  . MET A 1 22  ? 42.839 35.516 23.918  1.00 13.12 ? 2   MET A CE  1 
ATOM   46   N N   . VAL A 1 23  ? 41.510 42.754 24.028  1.00 13.29 ? 3   VAL A N   1 
ATOM   47   C CA  . VAL A 1 23  ? 40.619 43.901 23.894  1.00 14.60 ? 3   VAL A CA  1 
ATOM   48   C C   . VAL A 1 23  ? 41.232 44.931 22.948  1.00 14.45 ? 3   VAL A C   1 
ATOM   49   O O   . VAL A 1 23  ? 42.437 45.193 22.989  1.00 12.91 ? 3   VAL A O   1 
ATOM   50   C CB  . VAL A 1 23  ? 40.338 44.550 25.274  1.00 14.19 ? 3   VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 23  ? 39.616 45.881 25.106  1.00 16.45 ? 3   VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 23  ? 39.484 43.611 26.113  1.00 16.76 ? 3   VAL A CG2 1 
ATOM   53   N N   . ASP A 1 24  ? 40.392 45.493 22.082  1.00 15.31 ? 4   ASP A N   1 
ATOM   54   C CA  . ASP A 1 24  ? 40.810 46.499 21.113  1.00 15.77 ? 4   ASP A CA  1 
ATOM   55   C C   . ASP A 1 24  ? 41.794 45.957 20.083  1.00 15.64 ? 4   ASP A C   1 
ATOM   56   O O   . ASP A 1 24  ? 42.653 46.692 19.597  1.00 15.78 ? 4   ASP A O   1 
ATOM   57   C CB  . ASP A 1 24  ? 41.426 47.704 21.836  1.00 20.69 ? 4   ASP A CB  1 
ATOM   58   C CG  . ASP A 1 24  ? 40.418 48.441 22.705  1.00 24.49 ? 4   ASP A CG  1 
ATOM   59   O OD1 . ASP A 1 24  ? 40.818 49.377 23.429  1.00 28.62 ? 4   ASP A OD1 1 
ATOM   60   O OD2 . ASP A 1 24  ? 39.222 48.087 22.664  1.00 28.71 ? 4   ASP A OD2 1 
ATOM   61   N N   . ASN A 1 25  ? 41.665 44.679 19.734  1.00 13.59 ? 5   ASN A N   1 
ATOM   62   C CA  . ASN A 1 25  ? 42.576 44.088 18.756  1.00 13.86 ? 5   ASN A CA  1 
ATOM   63   C C   . ASN A 1 25  ? 42.081 44.184 17.309  1.00 13.99 ? 5   ASN A C   1 
ATOM   64   O O   . ASN A 1 25  ? 42.687 43.613 16.399  1.00 14.75 ? 5   ASN A O   1 
ATOM   65   C CB  . ASN A 1 25  ? 42.872 42.626 19.117  1.00 13.15 ? 5   ASN A CB  1 
ATOM   66   C CG  . ASN A 1 25  ? 41.630 41.754 19.119  1.00 15.56 ? 5   ASN A CG  1 
ATOM   67   O OD1 . ASN A 1 25  ? 40.526 42.217 18.829  1.00 13.74 ? 5   ASN A OD1 1 
ATOM   68   N ND2 . ASN A 1 25  ? 41.807 40.477 19.443  1.00 13.43 ? 5   ASN A ND2 1 
ATOM   69   N N   . LEU A 1 26  ? 40.991 44.914 17.092  1.00 13.23 ? 6   LEU A N   1 
ATOM   70   C CA  . LEU A 1 26  ? 40.451 45.080 15.746  1.00 14.41 ? 6   LEU A CA  1 
ATOM   71   C C   . LEU A 1 26  ? 40.551 46.525 15.268  1.00 15.28 ? 6   LEU A C   1 
ATOM   72   O O   . LEU A 1 26  ? 40.555 47.458 16.067  1.00 15.23 ? 6   LEU A O   1 
ATOM   73   C CB  . LEU A 1 26  ? 38.982 44.644 15.691  1.00 12.80 ? 6   LEU A CB  1 
ATOM   74   C CG  . LEU A 1 26  ? 38.626 43.196 16.036  1.00 11.94 ? 6   LEU A CG  1 
ATOM   75   C CD1 . LEU A 1 26  ? 37.125 43.006 15.820  1.00 13.91 ? 6   LEU A CD1 1 
ATOM   76   C CD2 . LEU A 1 26  ? 39.420 42.217 15.176  1.00 9.43  ? 6   LEU A CD2 1 
ATOM   77   N N   . ARG A 1 27  ? 40.661 46.699 13.957  1.00 16.97 ? 7   ARG A N   1 
ATOM   78   C CA  . ARG A 1 27  ? 40.711 48.026 13.365  1.00 19.35 ? 7   ARG A CA  1 
ATOM   79   C C   . ARG A 1 27  ? 39.726 48.046 12.206  1.00 21.73 ? 7   ARG A C   1 
ATOM   80   O O   . ARG A 1 27  ? 39.298 46.991 11.735  1.00 19.77 ? 7   ARG A O   1 
ATOM   81   C CB  . ARG A 1 27  ? 42.124 48.371 12.886  1.00 21.52 ? 7   ARG A CB  1 
ATOM   82   C CG  . ARG A 1 27  ? 43.104 48.615 14.026  1.00 27.19 ? 7   ARG A CG  1 
ATOM   83   C CD  . ARG A 1 27  ? 44.339 49.369 13.555  1.00 33.43 ? 7   ARG A CD  1 
ATOM   84   N NE  . ARG A 1 27  ? 45.100 48.640 12.542  1.00 38.94 ? 7   ARG A NE  1 
ATOM   85   C CZ  . ARG A 1 27  ? 46.170 49.123 11.915  1.00 39.70 ? 7   ARG A CZ  1 
ATOM   86   N NH1 . ARG A 1 27  ? 46.615 50.342 12.191  1.00 42.98 ? 7   ARG A NH1 1 
ATOM   87   N NH2 . ARG A 1 27  ? 46.798 48.387 11.008  1.00 41.85 ? 7   ARG A NH2 1 
ATOM   88   N N   . GLY A 1 28  ? 39.365 49.246 11.763  1.00 24.02 ? 8   GLY A N   1 
ATOM   89   C CA  . GLY A 1 28  ? 38.407 49.398 10.681  1.00 28.58 ? 8   GLY A CA  1 
ATOM   90   C C   . GLY A 1 28  ? 37.146 50.112 11.155  1.00 33.14 ? 8   GLY A C   1 
ATOM   91   O O   . GLY A 1 28  ? 36.111 50.073 10.490  1.00 32.77 ? 8   GLY A O   1 
ATOM   92   N N   . LYS A 1 29  ? 37.242 50.767 12.311  1.00 36.05 ? 9   LYS A N   1 
ATOM   93   C CA  . LYS A 1 29  ? 36.130 51.497 12.911  1.00 39.44 ? 9   LYS A CA  1 
ATOM   94   C C   . LYS A 1 29  ? 35.288 52.208 11.859  1.00 40.92 ? 9   LYS A C   1 
ATOM   95   O O   . LYS A 1 29  ? 34.175 51.783 11.553  1.00 42.89 ? 9   LYS A O   1 
ATOM   96   C CB  . LYS A 1 29  ? 36.669 52.508 13.928  1.00 41.08 ? 9   LYS A CB  1 
ATOM   97   C CG  . LYS A 1 29  ? 35.598 53.233 14.729  1.00 44.78 ? 9   LYS A CG  1 
ATOM   98   C CD  . LYS A 1 29  ? 36.221 54.112 15.802  1.00 45.88 ? 9   LYS A CD  1 
ATOM   99   C CE  . LYS A 1 29  ? 35.162 54.789 16.657  1.00 47.74 ? 9   LYS A CE  1 
ATOM   100  N NZ  . LYS A 1 29  ? 34.303 55.712 15.867  1.00 49.31 ? 9   LYS A NZ  1 
ATOM   101  N N   . SER A 1 30  ? 35.819 53.295 11.312  1.00 41.85 ? 10  SER A N   1 
ATOM   102  C CA  . SER A 1 30  ? 35.115 54.045 10.280  1.00 42.23 ? 10  SER A CA  1 
ATOM   103  C C   . SER A 1 30  ? 35.742 53.636 8.957   1.00 41.01 ? 10  SER A C   1 
ATOM   104  O O   . SER A 1 30  ? 36.401 54.437 8.293   1.00 43.43 ? 10  SER A O   1 
ATOM   105  C CB  . SER A 1 30  ? 35.291 55.548 10.500  1.00 42.58 ? 10  SER A CB  1 
ATOM   106  O OG  . SER A 1 30  ? 36.662 55.905 10.470  1.00 45.51 ? 10  SER A OG  1 
ATOM   107  N N   . GLY A 1 31  ? 35.539 52.380 8.577   1.00 38.02 ? 11  GLY A N   1 
ATOM   108  C CA  . GLY A 1 31  ? 36.129 51.909 7.346   1.00 33.10 ? 11  GLY A CA  1 
ATOM   109  C C   . GLY A 1 31  ? 35.343 50.917 6.519   1.00 29.23 ? 11  GLY A C   1 
ATOM   110  O O   . GLY A 1 31  ? 34.112 50.884 6.525   1.00 28.96 ? 11  GLY A O   1 
ATOM   111  N N   . GLN A 1 32  ? 36.094 50.088 5.807   1.00 26.14 ? 12  GLN A N   1 
ATOM   112  C CA  . GLN A 1 32  ? 35.530 49.099 4.911   1.00 21.54 ? 12  GLN A CA  1 
ATOM   113  C C   . GLN A 1 32  ? 35.874 47.662 5.304   1.00 19.04 ? 12  GLN A C   1 
ATOM   114  O O   . GLN A 1 32  ? 36.378 46.886 4.495   1.00 16.77 ? 12  GLN A O   1 
ATOM   115  C CB  . GLN A 1 32  ? 36.018 49.421 3.494   1.00 25.28 ? 12  GLN A CB  1 
ATOM   116  C CG  . GLN A 1 32  ? 35.636 50.846 3.060   1.00 25.68 ? 12  GLN A CG  1 
ATOM   117  C CD  . GLN A 1 32  ? 36.389 51.340 1.836   1.00 27.19 ? 12  GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 32  ? 37.590 51.603 1.891   1.00 28.50 ? 12  GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 32  ? 35.681 51.472 0.724   1.00 29.77 ? 12  GLN A NE2 1 
ATOM   120  N N   . GLY A 1 33  ? 35.586 47.317 6.554   1.00 17.96 ? 13  GLY A N   1 
ATOM   121  C CA  . GLY A 1 33  ? 35.847 45.971 7.034   1.00 16.51 ? 13  GLY A CA  1 
ATOM   122  C C   . GLY A 1 33  ? 36.711 45.971 8.273   1.00 16.41 ? 13  GLY A C   1 
ATOM   123  O O   . GLY A 1 33  ? 37.698 46.706 8.339   1.00 15.97 ? 13  GLY A O   1 
ATOM   124  N N   . TYR A 1 34  ? 36.336 45.152 9.256   1.00 13.88 ? 14  TYR A N   1 
ATOM   125  C CA  . TYR A 1 34  ? 37.085 45.047 10.504  1.00 13.55 ? 14  TYR A CA  1 
ATOM   126  C C   . TYR A 1 34  ? 38.127 43.956 10.348  1.00 13.20 ? 14  TYR A C   1 
ATOM   127  O O   . TYR A 1 34  ? 37.823 42.861 9.877   1.00 12.67 ? 14  TYR A O   1 
ATOM   128  C CB  . TYR A 1 34  ? 36.149 44.721 11.674  1.00 13.08 ? 14  TYR A CB  1 
ATOM   129  C CG  . TYR A 1 34  ? 35.152 45.817 11.977  1.00 13.32 ? 14  TYR A CG  1 
ATOM   130  C CD1 . TYR A 1 34  ? 33.919 45.876 11.321  1.00 14.41 ? 14  TYR A CD1 1 
ATOM   131  C CD2 . TYR A 1 34  ? 35.452 46.811 12.905  1.00 14.30 ? 14  TYR A CD2 1 
ATOM   132  C CE1 . TYR A 1 34  ? 33.011 46.905 11.588  1.00 15.03 ? 14  TYR A CE1 1 
ATOM   133  C CE2 . TYR A 1 34  ? 34.559 47.839 13.178  1.00 15.80 ? 14  TYR A CE2 1 
ATOM   134  C CZ  . TYR A 1 34  ? 33.343 47.883 12.521  1.00 15.92 ? 14  TYR A CZ  1 
ATOM   135  O OH  . TYR A 1 34  ? 32.469 48.906 12.807  1.00 17.90 ? 14  TYR A OH  1 
ATOM   136  N N   . TYR A 1 35  ? 39.357 44.252 10.749  1.00 12.51 ? 15  TYR A N   1 
ATOM   137  C CA  . TYR A 1 35  ? 40.430 43.287 10.594  1.00 12.75 ? 15  TYR A CA  1 
ATOM   138  C C   . TYR A 1 35  ? 41.324 43.148 11.816  1.00 12.50 ? 15  TYR A C   1 
ATOM   139  O O   . TYR A 1 35  ? 41.459 44.071 12.616  1.00 11.74 ? 15  TYR A O   1 
ATOM   140  C CB  . TYR A 1 35  ? 41.272 43.660 9.366   1.00 13.68 ? 15  TYR A CB  1 
ATOM   141  C CG  . TYR A 1 35  ? 41.850 45.058 9.416   1.00 15.17 ? 15  TYR A CG  1 
ATOM   142  C CD1 . TYR A 1 35  ? 42.965 45.345 10.206  1.00 15.79 ? 15  TYR A CD1 1 
ATOM   143  C CD2 . TYR A 1 35  ? 41.274 46.101 8.681   1.00 16.28 ? 15  TYR A CD2 1 
ATOM   144  C CE1 . TYR A 1 35  ? 43.494 46.631 10.265  1.00 15.85 ? 15  TYR A CE1 1 
ATOM   145  C CE2 . TYR A 1 35  ? 41.795 47.391 8.736   1.00 16.57 ? 15  TYR A CE2 1 
ATOM   146  C CZ  . TYR A 1 35  ? 42.905 47.646 9.531   1.00 18.15 ? 15  TYR A CZ  1 
ATOM   147  O OH  . TYR A 1 35  ? 43.420 48.920 9.609   1.00 22.81 ? 15  TYR A OH  1 
ATOM   148  N N   . VAL A 1 36  ? 41.930 41.973 11.936  1.00 11.91 ? 16  VAL A N   1 
ATOM   149  C CA  . VAL A 1 36  ? 42.819 41.644 13.037  1.00 12.79 ? 16  VAL A CA  1 
ATOM   150  C C   . VAL A 1 36  ? 44.178 41.247 12.469  1.00 13.02 ? 16  VAL A C   1 
ATOM   151  O O   . VAL A 1 36  ? 44.267 40.746 11.359  1.00 12.66 ? 16  VAL A O   1 
ATOM   152  C CB  . VAL A 1 36  ? 42.241 40.455 13.864  1.00 13.02 ? 16  VAL A CB  1 
ATOM   153  C CG1 . VAL A 1 36  ? 42.182 39.192 12.997  1.00 14.97 ? 16  VAL A CG1 1 
ATOM   154  C CG2 . VAL A 1 36  ? 43.073 40.218 15.102  1.00 14.64 ? 16  VAL A CG2 1 
ATOM   155  N N   . GLU A 1 37  ? 45.242 41.475 13.227  1.00 12.13 ? 17  GLU A N   1 
ATOM   156  C CA  . GLU A 1 37  ? 46.566 41.103 12.761  1.00 12.66 ? 17  GLU A CA  1 
ATOM   157  C C   . GLU A 1 37  ? 46.805 39.613 12.956  1.00 13.01 ? 17  GLU A C   1 
ATOM   158  O O   . GLU A 1 37  ? 46.478 39.049 13.999  1.00 14.00 ? 17  GLU A O   1 
ATOM   159  C CB  . GLU A 1 37  ? 47.630 41.898 13.515  1.00 14.80 ? 17  GLU A CB  1 
ATOM   160  C CG  . GLU A 1 37  ? 47.689 43.359 13.114  1.00 18.84 ? 17  GLU A CG  1 
ATOM   161  C CD  . GLU A 1 37  ? 48.754 44.105 13.878  1.00 23.32 ? 17  GLU A CD  1 
ATOM   162  O OE1 . GLU A 1 37  ? 48.531 44.389 15.072  1.00 27.00 ? 17  GLU A OE1 1 
ATOM   163  O OE2 . GLU A 1 37  ? 49.814 44.391 13.288  1.00 25.48 ? 17  GLU A OE2 1 
ATOM   164  N N   . MET A 1 38  ? 47.356 38.977 11.931  1.00 11.23 ? 18  MET A N   1 
ATOM   165  C CA  . MET A 1 38  ? 47.660 37.558 11.989  1.00 11.42 ? 18  MET A CA  1 
ATOM   166  C C   . MET A 1 38  ? 49.067 37.376 11.444  1.00 12.41 ? 18  MET A C   1 
ATOM   167  O O   . MET A 1 38  ? 49.409 37.918 10.394  1.00 13.10 ? 18  MET A O   1 
ATOM   168  C CB  . MET A 1 38  ? 46.656 36.756 11.154  1.00 12.33 ? 18  MET A CB  1 
ATOM   169  C CG  . MET A 1 38  ? 45.217 36.892 11.639  1.00 11.62 ? 18  MET A CG  1 
ATOM   170  S SD  . MET A 1 38  ? 44.063 35.765 10.806  1.00 13.57 ? 18  MET A SD  1 
ATOM   171  C CE  . MET A 1 38  ? 44.558 34.166 11.531  1.00 14.19 ? 18  MET A CE  1 
ATOM   172  N N   . THR A 1 39  ? 49.880 36.619 12.175  1.00 12.57 ? 19  THR A N   1 
ATOM   173  C CA  . THR A 1 39  ? 51.258 36.364 11.787  1.00 11.73 ? 19  THR A CA  1 
ATOM   174  C C   . THR A 1 39  ? 51.362 34.968 11.189  1.00 12.77 ? 19  THR A C   1 
ATOM   175  O O   . THR A 1 39  ? 51.019 33.975 11.840  1.00 11.85 ? 19  THR A O   1 
ATOM   176  C CB  . THR A 1 39  ? 52.182 36.465 13.001  1.00 13.17 ? 19  THR A CB  1 
ATOM   177  O OG1 . THR A 1 39  ? 51.942 37.710 13.673  1.00 12.57 ? 19  THR A OG1 1 
ATOM   178  C CG2 . THR A 1 39  ? 53.647 36.400 12.565  1.00 11.46 ? 19  THR A CG2 1 
ATOM   179  N N   . VAL A 1 40  ? 51.843 34.897 9.953   1.00 11.68 ? 20  VAL A N   1 
ATOM   180  C CA  . VAL A 1 40  ? 51.965 33.620 9.265   1.00 13.36 ? 20  VAL A CA  1 
ATOM   181  C C   . VAL A 1 40  ? 53.389 33.333 8.815   1.00 11.64 ? 20  VAL A C   1 
ATOM   182  O O   . VAL A 1 40  ? 54.147 34.248 8.501   1.00 11.24 ? 20  VAL A O   1 
ATOM   183  C CB  . VAL A 1 40  ? 51.053 33.566 8.005   1.00 15.28 ? 20  VAL A CB  1 
ATOM   184  C CG1 . VAL A 1 40  ? 49.618 33.934 8.379   1.00 16.56 ? 20  VAL A CG1 1 
ATOM   185  C CG2 . VAL A 1 40  ? 51.573 34.511 6.938   1.00 18.98 ? 20  VAL A CG2 1 
ATOM   186  N N   . GLY A 1 41  ? 53.737 32.051 8.795   1.00 12.49 ? 21  GLY A N   1 
ATOM   187  C CA  . GLY A 1 41  ? 55.049 31.636 8.336   1.00 13.57 ? 21  GLY A CA  1 
ATOM   188  C C   . GLY A 1 41  ? 56.208 31.865 9.277   1.00 13.73 ? 21  GLY A C   1 
ATOM   189  O O   . GLY A 1 41  ? 56.045 32.359 10.392  1.00 14.77 ? 21  GLY A O   1 
ATOM   190  N N   . SER A 1 42  ? 57.394 31.504 8.805   1.00 13.22 ? 22  SER A N   1 
ATOM   191  C CA  . SER A 1 42  ? 58.621 31.642 9.578   1.00 13.38 ? 22  SER A CA  1 
ATOM   192  C C   . SER A 1 42  ? 59.777 31.927 8.624   1.00 14.95 ? 22  SER A C   1 
ATOM   193  O O   . SER A 1 42  ? 60.012 31.159 7.700   1.00 13.06 ? 22  SER A O   1 
ATOM   194  C CB  . SER A 1 42  ? 58.903 30.342 10.332  1.00 14.64 ? 22  SER A CB  1 
ATOM   195  O OG  . SER A 1 42  ? 60.136 30.416 11.024  1.00 14.93 ? 22  SER A OG  1 
ATOM   196  N N   . PRO A 1 43  ? 60.499 33.044 8.822   1.00 14.75 ? 23  PRO A N   1 
ATOM   197  C CA  . PRO A 1 43  ? 60.288 34.042 9.876   1.00 14.94 ? 23  PRO A CA  1 
ATOM   198  C C   . PRO A 1 43  ? 58.903 34.679 9.759   1.00 14.76 ? 23  PRO A C   1 
ATOM   199  O O   . PRO A 1 43  ? 58.236 34.556 8.735   1.00 14.96 ? 23  PRO A O   1 
ATOM   200  C CB  . PRO A 1 43  ? 61.437 35.034 9.659   1.00 16.75 ? 23  PRO A CB  1 
ATOM   201  C CG  . PRO A 1 43  ? 61.794 34.846 8.208   1.00 19.38 ? 23  PRO A CG  1 
ATOM   202  C CD  . PRO A 1 43  ? 61.697 33.364 8.032   1.00 14.45 ? 23  PRO A CD  1 
ATOM   203  N N   . PRO A 1 44  ? 58.466 35.392 10.807  1.00 15.20 ? 24  PRO A N   1 
ATOM   204  C CA  . PRO A 1 44  ? 57.154 36.049 10.863  1.00 13.58 ? 24  PRO A CA  1 
ATOM   205  C C   . PRO A 1 44  ? 56.761 37.017 9.750   1.00 12.97 ? 24  PRO A C   1 
ATOM   206  O O   . PRO A 1 44  ? 57.536 37.891 9.365   1.00 12.15 ? 24  PRO A O   1 
ATOM   207  C CB  . PRO A 1 44  ? 57.174 36.750 12.225  1.00 14.17 ? 24  PRO A CB  1 
ATOM   208  C CG  . PRO A 1 44  ? 58.190 35.964 13.020  1.00 15.33 ? 24  PRO A CG  1 
ATOM   209  C CD  . PRO A 1 44  ? 59.259 35.710 12.004  1.00 14.14 ? 24  PRO A CD  1 
ATOM   210  N N   . GLN A 1 45  ? 55.537 36.846 9.253   1.00 11.73 ? 25  GLN A N   1 
ATOM   211  C CA  . GLN A 1 45  ? 54.960 37.713 8.226   1.00 13.07 ? 25  GLN A CA  1 
ATOM   212  C C   . GLN A 1 45  ? 53.571 38.087 8.736   1.00 12.88 ? 25  GLN A C   1 
ATOM   213  O O   . GLN A 1 45  ? 52.623 37.306 8.617   1.00 13.51 ? 25  GLN A O   1 
ATOM   214  C CB  . GLN A 1 45  ? 54.823 36.988 6.881   1.00 12.78 ? 25  GLN A CB  1 
ATOM   215  C CG  . GLN A 1 45  ? 56.142 36.744 6.143   1.00 12.73 ? 25  GLN A CG  1 
ATOM   216  C CD  . GLN A 1 45  ? 55.932 36.138 4.767   1.00 15.52 ? 25  GLN A CD  1 
ATOM   217  O OE1 . GLN A 1 45  ? 55.188 36.677 3.946   1.00 14.49 ? 25  GLN A OE1 1 
ATOM   218  N NE2 . GLN A 1 45  ? 56.594 35.015 4.504   1.00 14.26 ? 25  GLN A NE2 1 
ATOM   219  N N   . THR A 1 46  ? 53.449 39.277 9.314   1.00 12.86 ? 26  THR A N   1 
ATOM   220  C CA  . THR A 1 46  ? 52.166 39.719 9.845   1.00 12.79 ? 26  THR A CA  1 
ATOM   221  C C   . THR A 1 46  ? 51.352 40.471 8.786   1.00 13.72 ? 26  THR A C   1 
ATOM   222  O O   . THR A 1 46  ? 51.887 41.285 8.022   1.00 13.22 ? 26  THR A O   1 
ATOM   223  C CB  . THR A 1 46  ? 52.382 40.596 11.102  1.00 14.74 ? 26  THR A CB  1 
ATOM   224  O OG1 . THR A 1 46  ? 53.098 39.831 12.085  1.00 14.89 ? 26  THR A OG1 1 
ATOM   225  C CG2 . THR A 1 46  ? 51.049 41.028 11.704  1.00 16.29 ? 26  THR A CG2 1 
ATOM   226  N N   . LEU A 1 47  ? 50.058 40.175 8.743   1.00 11.99 ? 27  LEU A N   1 
ATOM   227  C CA  . LEU A 1 47  ? 49.146 40.791 7.783   1.00 13.17 ? 27  LEU A CA  1 
ATOM   228  C C   . LEU A 1 47  ? 47.830 41.189 8.449   1.00 13.39 ? 27  LEU A C   1 
ATOM   229  O O   . LEU A 1 47  ? 47.461 40.639 9.488   1.00 13.22 ? 27  LEU A O   1 
ATOM   230  C CB  . LEU A 1 47  ? 48.855 39.807 6.644   1.00 14.27 ? 27  LEU A CB  1 
ATOM   231  C CG  . LEU A 1 47  ? 50.055 39.349 5.806   1.00 17.04 ? 27  LEU A CG  1 
ATOM   232  C CD1 . LEU A 1 47  ? 49.657 38.144 4.967   1.00 17.82 ? 27  LEU A CD1 1 
ATOM   233  C CD2 . LEU A 1 47  ? 50.545 40.492 4.932   1.00 17.03 ? 27  LEU A CD2 1 
ATOM   234  N N   . ASN A 1 48  ? 47.132 42.146 7.841   1.00 13.07 ? 28  ASN A N   1 
ATOM   235  C CA  . ASN A 1 48  ? 45.837 42.611 8.342   1.00 13.24 ? 28  ASN A CA  1 
ATOM   236  C C   . ASN A 1 48  ? 44.796 41.705 7.692   1.00 11.79 ? 28  ASN A C   1 
ATOM   237  O O   . ASN A 1 48  ? 44.706 41.645 6.472   1.00 13.30 ? 28  ASN A O   1 
ATOM   238  C CB  . ASN A 1 48  ? 45.605 44.070 7.931   1.00 13.92 ? 28  ASN A CB  1 
ATOM   239  C CG  . ASN A 1 48  ? 46.409 45.057 8.772   1.00 15.60 ? 28  ASN A CG  1 
ATOM   240  O OD1 . ASN A 1 48  ? 46.653 46.189 8.350   1.00 18.34 ? 28  ASN A OD1 1 
ATOM   241  N ND2 . ASN A 1 48  ? 46.806 44.638 9.969   1.00 14.89 ? 28  ASN A ND2 1 
ATOM   242  N N   . ILE A 1 49  ? 44.009 41.013 8.509   1.00 10.92 ? 29  ILE A N   1 
ATOM   243  C CA  . ILE A 1 49  ? 43.023 40.062 7.998   1.00 10.33 ? 29  ILE A CA  1 
ATOM   244  C C   . ILE A 1 49  ? 41.577 40.390 8.346   1.00 10.02 ? 29  ILE A C   1 
ATOM   245  O O   . ILE A 1 49  ? 41.233 40.569 9.511   1.00 11.73 ? 29  ILE A O   1 
ATOM   246  C CB  . ILE A 1 49  ? 43.330 38.634 8.528   1.00 10.63 ? 29  ILE A CB  1 
ATOM   247  C CG1 . ILE A 1 49  ? 44.791 38.261 8.239   1.00 12.53 ? 29  ILE A CG1 1 
ATOM   248  C CG2 . ILE A 1 49  ? 42.386 37.619 7.874   1.00 10.39 ? 29  ILE A CG2 1 
ATOM   249  C CD1 . ILE A 1 49  ? 45.136 38.154 6.768   1.00 16.36 ? 29  ILE A CD1 1 
ATOM   250  N N   . LEU A 1 50  ? 40.728 40.444 7.325   1.00 10.87 ? 30  LEU A N   1 
ATOM   251  C CA  . LEU A 1 50  ? 39.316 40.736 7.516   1.00 10.41 ? 30  LEU A CA  1 
ATOM   252  C C   . LEU A 1 50  ? 38.635 39.638 8.334   1.00 9.23  ? 30  LEU A C   1 
ATOM   253  O O   . LEU A 1 50  ? 38.787 38.454 8.040   1.00 9.56  ? 30  LEU A O   1 
ATOM   254  C CB  . LEU A 1 50  ? 38.620 40.848 6.160   1.00 9.94  ? 30  LEU A CB  1 
ATOM   255  C CG  . LEU A 1 50  ? 37.113 41.097 6.213   1.00 12.33 ? 30  LEU A CG  1 
ATOM   256  C CD1 . LEU A 1 50  ? 36.849 42.532 6.645   1.00 13.76 ? 30  LEU A CD1 1 
ATOM   257  C CD2 . LEU A 1 50  ? 36.501 40.829 4.856   1.00 12.51 ? 30  LEU A CD2 1 
ATOM   258  N N   . VAL A 1 51  ? 37.883 40.039 9.352   1.00 10.08 ? 31  VAL A N   1 
ATOM   259  C CA  . VAL A 1 51  ? 37.154 39.093 10.203  1.00 11.49 ? 31  VAL A CA  1 
ATOM   260  C C   . VAL A 1 51  ? 35.822 38.842 9.499   1.00 12.86 ? 31  VAL A C   1 
ATOM   261  O O   . VAL A 1 51  ? 34.970 39.737 9.416   1.00 11.52 ? 31  VAL A O   1 
ATOM   262  C CB  . VAL A 1 51  ? 36.909 39.696 11.606  1.00 13.09 ? 31  VAL A CB  1 
ATOM   263  C CG1 . VAL A 1 51  ? 36.044 38.758 12.450  1.00 13.57 ? 31  VAL A CG1 1 
ATOM   264  C CG2 . VAL A 1 51  ? 38.242 39.942 12.297  1.00 15.03 ? 31  VAL A CG2 1 
ATOM   265  N N   . ASP A 1 52  ? 35.642 37.628 8.984   1.00 11.00 ? 32  ASP A N   1 
ATOM   266  C CA  . ASP A 1 52  ? 34.427 37.313 8.243   1.00 11.17 ? 32  ASP A CA  1 
ATOM   267  C C   . ASP A 1 52  ? 33.669 36.075 8.701   1.00 12.15 ? 32  ASP A C   1 
ATOM   268  O O   . ASP A 1 52  ? 34.051 34.950 8.380   1.00 12.86 ? 32  ASP A O   1 
ATOM   269  C CB  . ASP A 1 52  ? 34.765 37.183 6.755   1.00 12.15 ? 32  ASP A CB  1 
ATOM   270  C CG  . ASP A 1 52  ? 33.543 36.901 5.902   1.00 9.82  ? 32  ASP A CG  1 
ATOM   271  O OD1 . ASP A 1 52  ? 32.436 37.292 6.313   1.00 11.81 ? 32  ASP A OD1 1 
ATOM   272  O OD2 . ASP A 1 52  ? 33.692 36.300 4.822   1.00 14.14 ? 32  ASP A OD2 1 
ATOM   273  N N   . THR A 1 53  ? 32.577 36.282 9.433   1.00 9.78  ? 33  THR A N   1 
ATOM   274  C CA  . THR A 1 53  ? 31.776 35.157 9.897   1.00 9.62  ? 33  THR A CA  1 
ATOM   275  C C   . THR A 1 53  ? 30.852 34.632 8.785   1.00 11.38 ? 33  THR A C   1 
ATOM   276  O O   . THR A 1 53  ? 30.093 33.684 9.001   1.00 12.23 ? 33  THR A O   1 
ATOM   277  C CB  . THR A 1 53  ? 30.914 35.537 11.135  1.00 11.08 ? 33  THR A CB  1 
ATOM   278  O OG1 . THR A 1 53  ? 29.981 36.561 10.774  1.00 12.04 ? 33  THR A OG1 1 
ATOM   279  C CG2 . THR A 1 53  ? 31.807 36.042 12.289  1.00 8.69  ? 33  THR A CG2 1 
ATOM   280  N N   . GLY A 1 54  ? 30.929 35.241 7.599   1.00 11.75 ? 34  GLY A N   1 
ATOM   281  C CA  . GLY A 1 54  ? 30.107 34.820 6.472   1.00 10.02 ? 34  GLY A CA  1 
ATOM   282  C C   . GLY A 1 54  ? 30.773 33.898 5.457   1.00 11.96 ? 34  GLY A C   1 
ATOM   283  O O   . GLY A 1 54  ? 30.221 33.651 4.378   1.00 12.46 ? 34  GLY A O   1 
ATOM   284  N N   . SER A 1 55  ? 31.967 33.405 5.776   1.00 11.55 ? 35  SER A N   1 
ATOM   285  C CA  . SER A 1 55  ? 32.677 32.483 4.890   1.00 10.79 ? 35  SER A CA  1 
ATOM   286  C C   . SER A 1 55  ? 33.571 31.597 5.754   1.00 11.51 ? 35  SER A C   1 
ATOM   287  O O   . SER A 1 55  ? 33.703 31.835 6.952   1.00 12.13 ? 35  SER A O   1 
ATOM   288  C CB  . SER A 1 55  ? 33.502 33.236 3.839   1.00 10.80 ? 35  SER A CB  1 
ATOM   289  O OG  . SER A 1 55  ? 34.593 33.921 4.412   1.00 11.29 ? 35  SER A OG  1 
ATOM   290  N N   . SER A 1 56  ? 34.191 30.588 5.151   1.00 10.63 ? 36  SER A N   1 
ATOM   291  C CA  . SER A 1 56  ? 35.000 29.655 5.921   1.00 12.13 ? 36  SER A CA  1 
ATOM   292  C C   . SER A 1 56  ? 36.419 29.383 5.436   1.00 13.29 ? 36  SER A C   1 
ATOM   293  O O   . SER A 1 56  ? 37.038 28.403 5.857   1.00 13.65 ? 36  SER A O   1 
ATOM   294  C CB  . SER A 1 56  ? 34.243 28.340 6.024   1.00 12.08 ? 36  SER A CB  1 
ATOM   295  O OG  . SER A 1 56  ? 32.895 28.593 6.378   1.00 15.39 ? 36  SER A OG  1 
ATOM   296  N N   . ASN A 1 57  ? 36.938 30.237 4.562   1.00 11.75 ? 37  ASN A N   1 
ATOM   297  C CA  . ASN A 1 57  ? 38.296 30.065 4.060   1.00 12.56 ? 37  ASN A CA  1 
ATOM   298  C C   . ASN A 1 57  ? 39.233 31.137 4.583   1.00 13.08 ? 37  ASN A C   1 
ATOM   299  O O   . ASN A 1 57  ? 38.873 32.316 4.630   1.00 12.97 ? 37  ASN A O   1 
ATOM   300  C CB  . ASN A 1 57  ? 38.333 30.121 2.534   1.00 13.13 ? 37  ASN A CB  1 
ATOM   301  C CG  . ASN A 1 57  ? 37.876 28.839 1.893   1.00 14.81 ? 37  ASN A CG  1 
ATOM   302  O OD1 . ASN A 1 57  ? 36.682 28.600 1.731   1.00 15.14 ? 37  ASN A OD1 1 
ATOM   303  N ND2 . ASN A 1 57  ? 38.832 27.991 1.539   1.00 13.09 ? 37  ASN A ND2 1 
ATOM   304  N N   . PHE A 1 58  ? 40.430 30.713 4.988   1.00 13.31 ? 38  PHE A N   1 
ATOM   305  C CA  . PHE A 1 58  ? 41.472 31.625 5.444   1.00 11.77 ? 38  PHE A CA  1 
ATOM   306  C C   . PHE A 1 58  ? 42.322 31.825 4.184   1.00 13.02 ? 38  PHE A C   1 
ATOM   307  O O   . PHE A 1 58  ? 42.876 30.865 3.649   1.00 11.92 ? 38  PHE A O   1 
ATOM   308  C CB  . PHE A 1 58  ? 42.326 30.984 6.542   1.00 13.72 ? 38  PHE A CB  1 
ATOM   309  C CG  . PHE A 1 58  ? 43.456 31.858 7.022   1.00 13.11 ? 38  PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 58  ? 44.640 31.291 7.488   1.00 14.42 ? 38  PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 58  ? 43.337 33.246 7.015   1.00 15.44 ? 38  PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 58  ? 45.693 32.094 7.939   1.00 12.19 ? 38  PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 58  ? 44.381 34.057 7.465   1.00 14.88 ? 38  PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 58  ? 45.561 33.477 7.927   1.00 14.31 ? 38  PHE A CZ  1 
ATOM   315  N N   . ALA A 1 59  ? 42.405 33.059 3.698   1.00 11.39 ? 39  ALA A N   1 
ATOM   316  C CA  . ALA A 1 59  ? 43.169 33.339 2.487   1.00 13.01 ? 39  ALA A CA  1 
ATOM   317  C C   . ALA A 1 59  ? 43.872 34.674 2.619   1.00 12.87 ? 39  ALA A C   1 
ATOM   318  O O   . ALA A 1 59  ? 43.371 35.581 3.272   1.00 13.87 ? 39  ALA A O   1 
ATOM   319  C CB  . ALA A 1 59  ? 42.243 33.354 1.271   1.00 12.46 ? 39  ALA A CB  1 
ATOM   320  N N   . VAL A 1 60  ? 45.030 34.797 1.982   1.00 12.80 ? 40  VAL A N   1 
ATOM   321  C CA  . VAL A 1 60  ? 45.795 36.029 2.065   1.00 13.64 ? 40  VAL A CA  1 
ATOM   322  C C   . VAL A 1 60  ? 46.393 36.421 0.722   1.00 13.32 ? 40  VAL A C   1 
ATOM   323  O O   . VAL A 1 60  ? 46.791 35.564 -0.073  1.00 13.16 ? 40  VAL A O   1 
ATOM   324  C CB  . VAL A 1 60  ? 46.951 35.889 3.105   1.00 14.80 ? 40  VAL A CB  1 
ATOM   325  C CG1 . VAL A 1 60  ? 46.390 35.503 4.463   1.00 16.30 ? 40  VAL A CG1 1 
ATOM   326  C CG2 . VAL A 1 60  ? 47.952 34.835 2.643   1.00 16.23 ? 40  VAL A CG2 1 
ATOM   327  N N   . GLY A 1 61  ? 46.435 37.721 0.453   1.00 11.88 ? 41  GLY A N   1 
ATOM   328  C CA  . GLY A 1 61  ? 47.031 38.164 -0.790  1.00 13.02 ? 41  GLY A CA  1 
ATOM   329  C C   . GLY A 1 61  ? 48.448 37.626 -0.789  1.00 13.71 ? 41  GLY A C   1 
ATOM   330  O O   . GLY A 1 61  ? 49.149 37.743 0.215   1.00 15.18 ? 41  GLY A O   1 
ATOM   331  N N   . ALA A 1 62  ? 48.877 37.033 -1.900  1.00 15.32 ? 42  ALA A N   1 
ATOM   332  C CA  . ALA A 1 62  ? 50.219 36.468 -1.988  1.00 16.10 ? 42  ALA A CA  1 
ATOM   333  C C   . ALA A 1 62  ? 50.988 36.957 -3.214  1.00 17.42 ? 42  ALA A C   1 
ATOM   334  O O   . ALA A 1 62  ? 51.984 36.357 -3.616  1.00 19.11 ? 42  ALA A O   1 
ATOM   335  C CB  . ALA A 1 62  ? 50.135 34.948 -1.995  1.00 14.64 ? 42  ALA A CB  1 
ATOM   336  N N   . ALA A 1 63  ? 50.521 38.049 -3.802  1.00 19.12 ? 43  ALA A N   1 
ATOM   337  C CA  . ALA A 1 63  ? 51.158 38.636 -4.973  1.00 21.64 ? 43  ALA A CA  1 
ATOM   338  C C   . ALA A 1 63  ? 50.849 40.120 -4.917  1.00 22.50 ? 43  ALA A C   1 
ATOM   339  O O   . ALA A 1 63  ? 49.825 40.522 -4.366  1.00 23.57 ? 43  ALA A O   1 
ATOM   340  C CB  . ALA A 1 63  ? 50.587 38.024 -6.250  1.00 20.69 ? 43  ALA A CB  1 
ATOM   341  N N   . PRO A 1 64  ? 51.732 40.961 -5.471  1.00 23.52 ? 44  PRO A N   1 
ATOM   342  C CA  . PRO A 1 64  ? 51.430 42.391 -5.414  1.00 24.03 ? 44  PRO A CA  1 
ATOM   343  C C   . PRO A 1 64  ? 50.088 42.714 -6.063  1.00 23.04 ? 44  PRO A C   1 
ATOM   344  O O   . PRO A 1 64  ? 49.693 42.094 -7.048  1.00 22.30 ? 44  PRO A O   1 
ATOM   345  C CB  . PRO A 1 64  ? 52.619 43.027 -6.136  1.00 25.70 ? 44  PRO A CB  1 
ATOM   346  C CG  . PRO A 1 64  ? 53.060 41.960 -7.080  1.00 26.26 ? 44  PRO A CG  1 
ATOM   347  C CD  . PRO A 1 64  ? 52.953 40.707 -6.253  1.00 25.02 ? 44  PRO A CD  1 
ATOM   348  N N   . HIS A 1 65  ? 49.385 43.676 -5.479  1.00 24.12 ? 45  HIS A N   1 
ATOM   349  C CA  . HIS A 1 65  ? 48.084 44.108 -5.969  1.00 23.23 ? 45  HIS A CA  1 
ATOM   350  C C   . HIS A 1 65  ? 47.994 45.605 -5.663  1.00 23.57 ? 45  HIS A C   1 
ATOM   351  O O   . HIS A 1 65  ? 48.456 46.060 -4.617  1.00 23.28 ? 45  HIS A O   1 
ATOM   352  C CB  . HIS A 1 65  ? 46.977 43.320 -5.247  1.00 22.17 ? 45  HIS A CB  1 
ATOM   353  C CG  . HIS A 1 65  ? 45.597 43.578 -5.772  1.00 21.43 ? 45  HIS A CG  1 
ATOM   354  N ND1 . HIS A 1 65  ? 44.879 44.712 -5.459  1.00 21.58 ? 45  HIS A ND1 1 
ATOM   355  C CD2 . HIS A 1 65  ? 44.804 42.848 -6.593  1.00 21.40 ? 45  HIS A CD2 1 
ATOM   356  C CE1 . HIS A 1 65  ? 43.706 44.672 -6.064  1.00 20.66 ? 45  HIS A CE1 1 
ATOM   357  N NE2 . HIS A 1 65  ? 43.635 43.551 -6.759  1.00 22.31 ? 45  HIS A NE2 1 
ATOM   358  N N   . PRO A 1 66  ? 47.411 46.392 -6.582  1.00 23.76 ? 46  PRO A N   1 
ATOM   359  C CA  . PRO A 1 66  ? 47.264 47.842 -6.414  1.00 23.67 ? 46  PRO A CA  1 
ATOM   360  C C   . PRO A 1 66  ? 46.665 48.279 -5.074  1.00 22.98 ? 46  PRO A C   1 
ATOM   361  O O   . PRO A 1 66  ? 46.998 49.341 -4.551  1.00 23.59 ? 46  PRO A O   1 
ATOM   362  C CB  . PRO A 1 66  ? 46.367 48.232 -7.589  1.00 24.54 ? 46  PRO A CB  1 
ATOM   363  C CG  . PRO A 1 66  ? 46.743 47.237 -8.640  1.00 26.34 ? 46  PRO A CG  1 
ATOM   364  C CD  . PRO A 1 66  ? 46.810 45.951 -7.853  1.00 24.61 ? 46  PRO A CD  1 
ATOM   365  N N   . PHE A 1 67  ? 45.786 47.455 -4.515  1.00 20.79 ? 47  PHE A N   1 
ATOM   366  C CA  . PHE A 1 67  ? 45.129 47.791 -3.258  1.00 21.45 ? 47  PHE A CA  1 
ATOM   367  C C   . PHE A 1 67  ? 45.795 47.182 -2.020  1.00 21.52 ? 47  PHE A C   1 
ATOM   368  O O   . PHE A 1 67  ? 45.330 47.394 -0.902  1.00 20.34 ? 47  PHE A O   1 
ATOM   369  C CB  . PHE A 1 67  ? 43.657 47.361 -3.317  1.00 21.04 ? 47  PHE A CB  1 
ATOM   370  C CG  . PHE A 1 67  ? 42.848 48.065 -4.385  1.00 20.64 ? 47  PHE A CG  1 
ATOM   371  C CD1 . PHE A 1 67  ? 41.587 47.592 -4.737  1.00 20.18 ? 47  PHE A CD1 1 
ATOM   372  C CD2 . PHE A 1 67  ? 43.341 49.197 -5.037  1.00 21.64 ? 47  PHE A CD2 1 
ATOM   373  C CE1 . PHE A 1 67  ? 40.831 48.229 -5.720  1.00 22.40 ? 47  PHE A CE1 1 
ATOM   374  C CE2 . PHE A 1 67  ? 42.594 49.842 -6.022  1.00 21.68 ? 47  PHE A CE2 1 
ATOM   375  C CZ  . PHE A 1 67  ? 41.337 49.357 -6.364  1.00 21.85 ? 47  PHE A CZ  1 
ATOM   376  N N   . LEU A 1 68  ? 46.884 46.441 -2.226  1.00 21.63 ? 48  LEU A N   1 
ATOM   377  C CA  . LEU A 1 68  ? 47.611 45.793 -1.135  1.00 21.54 ? 48  LEU A CA  1 
ATOM   378  C C   . LEU A 1 68  ? 48.959 46.444 -0.830  1.00 23.11 ? 48  LEU A C   1 
ATOM   379  O O   . LEU A 1 68  ? 49.773 46.652 -1.729  1.00 23.86 ? 48  LEU A O   1 
ATOM   380  C CB  . LEU A 1 68  ? 47.850 44.317 -1.470  1.00 21.17 ? 48  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 68  ? 46.640 43.395 -1.636  1.00 21.42 ? 48  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 68  ? 47.114 41.995 -2.023  1.00 19.47 ? 48  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 68  ? 45.851 43.345 -0.338  1.00 20.57 ? 48  LEU A CD2 1 
ATOM   384  N N   . HIS A 1 69  ? 49.187 46.752 0.444   1.00 23.30 ? 49  HIS A N   1 
ATOM   385  C CA  . HIS A 1 69  ? 50.444 47.352 0.887   1.00 25.40 ? 49  HIS A CA  1 
ATOM   386  C C   . HIS A 1 69  ? 51.474 46.255 1.164   1.00 24.24 ? 49  HIS A C   1 
ATOM   387  O O   . HIS A 1 69  ? 52.677 46.467 1.046   1.00 24.76 ? 49  HIS A O   1 
ATOM   388  C CB  . HIS A 1 69  ? 50.224 48.182 2.152   1.00 27.79 ? 49  HIS A CB  1 
ATOM   389  C CG  . HIS A 1 69  ? 49.389 49.405 1.937   1.00 32.61 ? 49  HIS A CG  1 
ATOM   390  N ND1 . HIS A 1 69  ? 49.764 50.420 1.082   1.00 35.11 ? 49  HIS A ND1 1 
ATOM   391  C CD2 . HIS A 1 69  ? 48.201 49.779 2.469   1.00 34.64 ? 49  HIS A CD2 1 
ATOM   392  C CE1 . HIS A 1 69  ? 48.843 51.368 1.098   1.00 35.88 ? 49  HIS A CE1 1 
ATOM   393  N NE2 . HIS A 1 69  ? 47.884 51.004 1.932   1.00 37.03 ? 49  HIS A NE2 1 
ATOM   394  N N   . ARG A 1 70  ? 50.993 45.080 1.542   1.00 22.49 ? 50  ARG A N   1 
ATOM   395  C CA  . ARG A 1 70  ? 51.877 43.958 1.807   1.00 22.97 ? 50  ARG A CA  1 
ATOM   396  C C   . ARG A 1 70  ? 51.164 42.660 1.464   1.00 21.66 ? 50  ARG A C   1 
ATOM   397  O O   . ARG A 1 70  ? 49.938 42.622 1.356   1.00 19.96 ? 50  ARG A O   1 
ATOM   398  C CB  . ARG A 1 70  ? 52.325 43.961 3.272   1.00 25.97 ? 50  ARG A CB  1 
ATOM   399  C CG  . ARG A 1 70  ? 51.206 44.082 4.281   1.00 29.83 ? 50  ARG A CG  1 
ATOM   400  C CD  . ARG A 1 70  ? 51.751 44.329 5.684   1.00 32.25 ? 50  ARG A CD  1 
ATOM   401  N NE  . ARG A 1 70  ? 50.676 44.416 6.669   1.00 33.84 ? 50  ARG A NE  1 
ATOM   402  C CZ  . ARG A 1 70  ? 50.858 44.445 7.987   1.00 36.62 ? 50  ARG A CZ  1 
ATOM   403  N NH1 . ARG A 1 70  ? 52.083 44.395 8.503   1.00 36.17 ? 50  ARG A NH1 1 
ATOM   404  N NH2 . ARG A 1 70  ? 49.807 44.519 8.794   1.00 37.37 ? 50  ARG A NH2 1 
ATOM   405  N N   . TYR A 1 71  ? 51.939 41.602 1.267   1.00 18.90 ? 51  TYR A N   1 
ATOM   406  C CA  . TYR A 1 71  ? 51.367 40.312 0.930   1.00 16.47 ? 51  TYR A CA  1 
ATOM   407  C C   . TYR A 1 71  ? 52.268 39.183 1.395   1.00 16.12 ? 51  TYR A C   1 
ATOM   408  O O   . TYR A 1 71  ? 53.436 39.395 1.717   1.00 15.76 ? 51  TYR A O   1 
ATOM   409  C CB  . TYR A 1 71  ? 51.109 40.217 -0.583  1.00 16.36 ? 51  TYR A CB  1 
ATOM   410  C CG  . TYR A 1 71  ? 52.323 40.474 -1.453  1.00 16.89 ? 51  TYR A CG  1 
ATOM   411  C CD1 . TYR A 1 71  ? 53.195 39.442 -1.796  1.00 16.83 ? 51  TYR A CD1 1 
ATOM   412  C CD2 . TYR A 1 71  ? 52.616 41.761 -1.904  1.00 17.83 ? 51  TYR A CD2 1 
ATOM   413  C CE1 . TYR A 1 71  ? 54.332 39.686 -2.566  1.00 17.35 ? 51  TYR A CE1 1 
ATOM   414  C CE2 . TYR A 1 71  ? 53.750 42.015 -2.672  1.00 19.37 ? 51  TYR A CE2 1 
ATOM   415  C CZ  . TYR A 1 71  ? 54.602 40.974 -2.996  1.00 19.17 ? 51  TYR A CZ  1 
ATOM   416  O OH  . TYR A 1 71  ? 55.733 41.228 -3.741  1.00 22.34 ? 51  TYR A OH  1 
ATOM   417  N N   . TYR A 1 72  ? 51.692 37.989 1.437   1.00 15.05 ? 52  TYR A N   1 
ATOM   418  C CA  . TYR A 1 72  ? 52.357 36.766 1.863   1.00 13.54 ? 52  TYR A CA  1 
ATOM   419  C C   . TYR A 1 72  ? 53.363 36.302 0.804   1.00 13.46 ? 52  TYR A C   1 
ATOM   420  O O   . TYR A 1 72  ? 53.018 36.121 -0.365  1.00 13.47 ? 52  TYR A O   1 
ATOM   421  C CB  . TYR A 1 72  ? 51.266 35.716 2.102   1.00 12.58 ? 52  TYR A CB  1 
ATOM   422  C CG  . TYR A 1 72  ? 51.683 34.325 2.536   1.00 12.29 ? 52  TYR A CG  1 
ATOM   423  C CD1 . TYR A 1 72  ? 52.688 34.119 3.484   1.00 12.57 ? 52  TYR A CD1 1 
ATOM   424  C CD2 . TYR A 1 72  ? 50.979 33.213 2.076   1.00 10.97 ? 52  TYR A CD2 1 
ATOM   425  C CE1 . TYR A 1 72  ? 52.964 32.830 3.966   1.00 11.50 ? 52  TYR A CE1 1 
ATOM   426  C CE2 . TYR A 1 72  ? 51.243 31.942 2.545   1.00 12.25 ? 52  TYR A CE2 1 
ATOM   427  C CZ  . TYR A 1 72  ? 52.231 31.751 3.491   1.00 12.35 ? 52  TYR A CZ  1 
ATOM   428  O OH  . TYR A 1 72  ? 52.447 30.475 3.969   1.00 12.78 ? 52  TYR A OH  1 
ATOM   429  N N   . GLN A 1 73  ? 54.608 36.126 1.235   1.00 12.50 ? 53  GLN A N   1 
ATOM   430  C CA  . GLN A 1 73  ? 55.694 35.672 0.375   1.00 13.17 ? 53  GLN A CA  1 
ATOM   431  C C   . GLN A 1 73  ? 56.072 34.270 0.822   1.00 13.96 ? 53  GLN A C   1 
ATOM   432  O O   . GLN A 1 73  ? 56.888 34.086 1.723   1.00 13.60 ? 53  GLN A O   1 
ATOM   433  C CB  . GLN A 1 73  ? 56.888 36.613 0.505   1.00 14.56 ? 53  GLN A CB  1 
ATOM   434  C CG  . GLN A 1 73  ? 56.584 38.022 0.022   1.00 16.46 ? 53  GLN A CG  1 
ATOM   435  C CD  . GLN A 1 73  ? 57.791 38.925 0.073   1.00 17.74 ? 53  GLN A CD  1 
ATOM   436  O OE1 . GLN A 1 73  ? 58.171 39.411 1.135   1.00 18.80 ? 53  GLN A OE1 1 
ATOM   437  N NE2 . GLN A 1 73  ? 58.412 39.149 -1.086  1.00 18.61 ? 53  GLN A NE2 1 
ATOM   438  N N   . ARG A 1 74  ? 55.469 33.278 0.181   1.00 12.91 ? 54  ARG A N   1 
ATOM   439  C CA  . ARG A 1 74  ? 55.704 31.886 0.529   1.00 15.02 ? 54  ARG A CA  1 
ATOM   440  C C   . ARG A 1 74  ? 57.147 31.413 0.434   1.00 14.88 ? 54  ARG A C   1 
ATOM   441  O O   . ARG A 1 74  ? 57.567 30.575 1.233   1.00 14.72 ? 54  ARG A O   1 
ATOM   442  C CB  . ARG A 1 74  ? 54.820 30.985 -0.329  1.00 15.70 ? 54  ARG A CB  1 
ATOM   443  C CG  . ARG A 1 74  ? 53.349 31.029 0.059   1.00 16.22 ? 54  ARG A CG  1 
ATOM   444  C CD  . ARG A 1 74  ? 52.489 30.346 -0.989  1.00 15.85 ? 54  ARG A CD  1 
ATOM   445  N NE  . ARG A 1 74  ? 52.431 31.119 -2.224  1.00 18.38 ? 54  ARG A NE  1 
ATOM   446  C CZ  . ARG A 1 74  ? 51.832 30.706 -3.336  1.00 19.93 ? 54  ARG A CZ  1 
ATOM   447  N NH1 . ARG A 1 74  ? 51.235 29.519 -3.372  1.00 15.43 ? 54  ARG A NH1 1 
ATOM   448  N NH2 . ARG A 1 74  ? 51.835 31.476 -4.416  1.00 21.23 ? 54  ARG A NH2 1 
ATOM   449  N N   . GLN A 1 75  ? 57.900 31.926 -0.538  1.00 15.39 ? 55  GLN A N   1 
ATOM   450  C CA  . GLN A 1 75  ? 59.292 31.512 -0.695  1.00 15.86 ? 55  GLN A CA  1 
ATOM   451  C C   . GLN A 1 75  ? 60.142 31.918 0.513   1.00 16.43 ? 55  GLN A C   1 
ATOM   452  O O   . GLN A 1 75  ? 61.181 31.319 0.771   1.00 17.09 ? 55  GLN A O   1 
ATOM   453  C CB  . GLN A 1 75  ? 59.905 32.108 -1.972  1.00 17.88 ? 55  GLN A CB  1 
ATOM   454  C CG  . GLN A 1 75  ? 60.283 33.576 -1.862  1.00 20.85 ? 55  GLN A CG  1 
ATOM   455  C CD  . GLN A 1 75  ? 59.162 34.513 -2.258  1.00 24.30 ? 55  GLN A CD  1 
ATOM   456  O OE1 . GLN A 1 75  ? 57.988 34.248 -2.007  1.00 24.83 ? 55  GLN A OE1 1 
ATOM   457  N NE2 . GLN A 1 75  ? 59.526 35.631 -2.870  1.00 26.18 ? 55  GLN A NE2 1 
ATOM   458  N N   . LEU A 1 76  ? 59.705 32.932 1.255   1.00 15.83 ? 56  LEU A N   1 
ATOM   459  C CA  . LEU A 1 76  ? 60.452 33.373 2.431   1.00 15.13 ? 56  LEU A CA  1 
ATOM   460  C C   . LEU A 1 76  ? 60.066 32.614 3.706   1.00 15.61 ? 56  LEU A C   1 
ATOM   461  O O   . LEU A 1 76  ? 60.687 32.800 4.755   1.00 15.13 ? 56  LEU A O   1 
ATOM   462  C CB  . LEU A 1 76  ? 60.257 34.878 2.650   1.00 15.97 ? 56  LEU A CB  1 
ATOM   463  C CG  . LEU A 1 76  ? 60.680 35.812 1.509   1.00 17.10 ? 56  LEU A CG  1 
ATOM   464  C CD1 . LEU A 1 76  ? 60.558 37.256 1.979   1.00 20.51 ? 56  LEU A CD1 1 
ATOM   465  C CD2 . LEU A 1 76  ? 62.115 35.521 1.082   1.00 19.20 ? 56  LEU A CD2 1 
ATOM   466  N N   . SER A 1 77  ? 59.042 31.766 3.619   1.00 14.08 ? 57  SER A N   1 
ATOM   467  C CA  . SER A 1 77  ? 58.591 30.996 4.772   1.00 12.29 ? 57  SER A CA  1 
ATOM   468  C C   . SER A 1 77  ? 59.098 29.562 4.722   1.00 11.56 ? 57  SER A C   1 
ATOM   469  O O   . SER A 1 77  ? 58.639 28.761 3.915   1.00 13.31 ? 57  SER A O   1 
ATOM   470  C CB  . SER A 1 77  ? 57.065 30.988 4.846   1.00 13.57 ? 57  SER A CB  1 
ATOM   471  O OG  . SER A 1 77  ? 56.623 30.282 5.996   1.00 12.81 ? 57  SER A OG  1 
ATOM   472  N N   . SER A 1 78  ? 60.038 29.237 5.602   1.00 13.88 ? 58  SER A N   1 
ATOM   473  C CA  . SER A 1 78  ? 60.615 27.896 5.645   1.00 13.73 ? 58  SER A CA  1 
ATOM   474  C C   . SER A 1 78  ? 59.607 26.827 6.065   1.00 13.80 ? 58  SER A C   1 
ATOM   475  O O   . SER A 1 78  ? 59.778 25.651 5.765   1.00 14.18 ? 58  SER A O   1 
ATOM   476  C CB  . SER A 1 78  ? 61.805 27.871 6.609   1.00 14.86 ? 58  SER A CB  1 
ATOM   477  O OG  . SER A 1 78  ? 61.372 28.041 7.950   1.00 15.86 ? 58  SER A OG  1 
ATOM   478  N N   . THR A 1 79  ? 58.557 27.235 6.762   1.00 11.68 ? 59  THR A N   1 
ATOM   479  C CA  . THR A 1 79  ? 57.544 26.302 7.226   1.00 12.71 ? 59  THR A CA  1 
ATOM   480  C C   . THR A 1 79  ? 56.356 26.109 6.269   1.00 12.72 ? 59  THR A C   1 
ATOM   481  O O   . THR A 1 79  ? 55.464 25.305 6.539   1.00 12.43 ? 59  THR A O   1 
ATOM   482  C CB  . THR A 1 79  ? 57.030 26.746 8.594   1.00 12.46 ? 59  THR A CB  1 
ATOM   483  O OG1 . THR A 1 79  ? 56.728 28.147 8.554   1.00 12.97 ? 59  THR A OG1 1 
ATOM   484  C CG2 . THR A 1 79  ? 58.103 26.503 9.666   1.00 11.74 ? 59  THR A CG2 1 
ATOM   485  N N   . TYR A 1 80  ? 56.341 26.841 5.161   1.00 13.49 ? 60  TYR A N   1 
ATOM   486  C CA  . TYR A 1 80  ? 55.251 26.706 4.194   1.00 13.32 ? 60  TYR A CA  1 
ATOM   487  C C   . TYR A 1 80  ? 55.249 25.323 3.550   1.00 13.67 ? 60  TYR A C   1 
ATOM   488  O O   . TYR A 1 80  ? 56.301 24.809 3.180   1.00 11.51 ? 60  TYR A O   1 
ATOM   489  C CB  . TYR A 1 80  ? 55.364 27.755 3.082   1.00 16.18 ? 60  TYR A CB  1 
ATOM   490  C CG  . TYR A 1 80  ? 54.247 27.635 2.062   1.00 18.05 ? 60  TYR A CG  1 
ATOM   491  C CD1 . TYR A 1 80  ? 52.937 27.966 2.400   1.00 20.49 ? 60  TYR A CD1 1 
ATOM   492  C CD2 . TYR A 1 80  ? 54.488 27.128 0.786   1.00 20.96 ? 60  TYR A CD2 1 
ATOM   493  C CE1 . TYR A 1 80  ? 51.888 27.793 1.497   1.00 22.19 ? 60  TYR A CE1 1 
ATOM   494  C CE2 . TYR A 1 80  ? 53.442 26.950 -0.128  1.00 22.28 ? 60  TYR A CE2 1 
ATOM   495  C CZ  . TYR A 1 80  ? 52.148 27.285 0.238   1.00 22.36 ? 60  TYR A CZ  1 
ATOM   496  O OH  . TYR A 1 80  ? 51.108 27.109 -0.653  1.00 25.34 ? 60  TYR A OH  1 
ATOM   497  N N   . ARG A 1 81  ? 54.062 24.731 3.421   1.00 13.94 ? 61  ARG A N   1 
ATOM   498  C CA  . ARG A 1 81  ? 53.904 23.419 2.803   1.00 14.15 ? 61  ARG A CA  1 
ATOM   499  C C   . ARG A 1 81  ? 52.852 23.506 1.701   1.00 14.12 ? 61  ARG A C   1 
ATOM   500  O O   . ARG A 1 81  ? 51.686 23.798 1.963   1.00 13.11 ? 61  ARG A O   1 
ATOM   501  C CB  . ARG A 1 81  ? 53.466 22.377 3.834   1.00 16.50 ? 61  ARG A CB  1 
ATOM   502  C CG  . ARG A 1 81  ? 54.493 22.094 4.909   1.00 19.31 ? 61  ARG A CG  1 
ATOM   503  C CD  . ARG A 1 81  ? 53.946 21.108 5.931   1.00 19.62 ? 61  ARG A CD  1 
ATOM   504  N NE  . ARG A 1 81  ? 54.855 20.956 7.062   1.00 21.48 ? 61  ARG A NE  1 
ATOM   505  C CZ  . ARG A 1 81  ? 54.607 20.211 8.134   1.00 20.57 ? 61  ARG A CZ  1 
ATOM   506  N NH1 . ARG A 1 81  ? 53.472 19.538 8.235   1.00 20.68 ? 61  ARG A NH1 1 
ATOM   507  N NH2 . ARG A 1 81  ? 55.501 20.145 9.109   1.00 23.18 ? 61  ARG A NH2 1 
ATOM   508  N N   . ASP A 1 82  ? 53.274 23.249 0.469   1.00 15.89 ? 62  ASP A N   1 
ATOM   509  C CA  . ASP A 1 82  ? 52.374 23.306 -0.679  1.00 17.78 ? 62  ASP A CA  1 
ATOM   510  C C   . ASP A 1 82  ? 51.413 22.120 -0.640  1.00 19.19 ? 62  ASP A C   1 
ATOM   511  O O   . ASP A 1 82  ? 51.830 20.985 -0.408  1.00 17.78 ? 62  ASP A O   1 
ATOM   512  C CB  . ASP A 1 82  ? 53.190 23.262 -1.974  1.00 18.69 ? 62  ASP A CB  1 
ATOM   513  C CG  . ASP A 1 82  ? 52.400 23.729 -3.189  1.00 20.46 ? 62  ASP A CG  1 
ATOM   514  O OD1 . ASP A 1 82  ? 51.160 23.806 -3.118  1.00 19.83 ? 62  ASP A OD1 1 
ATOM   515  O OD2 . ASP A 1 82  ? 53.030 24.015 -4.226  1.00 20.56 ? 62  ASP A OD2 1 
ATOM   516  N N   . LEU A 1 83  ? 50.126 22.384 -0.848  1.00 20.07 ? 63  LEU A N   1 
ATOM   517  C CA  . LEU A 1 83  ? 49.131 21.316 -0.869  1.00 21.03 ? 63  LEU A CA  1 
ATOM   518  C C   . LEU A 1 83  ? 48.868 20.859 -2.302  1.00 22.06 ? 63  LEU A C   1 
ATOM   519  O O   . LEU A 1 83  ? 48.142 19.893 -2.526  1.00 21.15 ? 63  LEU A O   1 
ATOM   520  C CB  . LEU A 1 83  ? 47.819 21.773 -0.219  1.00 20.52 ? 63  LEU A CB  1 
ATOM   521  C CG  . LEU A 1 83  ? 47.783 21.734 1.310   1.00 21.59 ? 63  LEU A CG  1 
ATOM   522  C CD1 . LEU A 1 83  ? 46.469 22.299 1.824   1.00 19.69 ? 63  LEU A CD1 1 
ATOM   523  C CD2 . LEU A 1 83  ? 47.962 20.293 1.780   1.00 22.78 ? 63  LEU A CD2 1 
ATOM   524  N N   . ARG A 1 84  ? 49.460 21.568 -3.263  1.00 23.10 ? 64  ARG A N   1 
ATOM   525  C CA  . ARG A 1 84  ? 49.326 21.254 -4.679  1.00 25.26 ? 64  ARG A CA  1 
ATOM   526  C C   . ARG A 1 84  ? 47.879 21.196 -5.172  1.00 23.92 ? 64  ARG A C   1 
ATOM   527  O O   . ARG A 1 84  ? 47.476 20.245 -5.845  1.00 21.63 ? 64  ARG A O   1 
ATOM   528  C CB  . ARG A 1 84  ? 50.036 19.930 -4.975  1.00 27.46 ? 64  ARG A CB  1 
ATOM   529  C CG  . ARG A 1 84  ? 51.551 20.001 -4.798  1.00 33.28 ? 64  ARG A CG  1 
ATOM   530  C CD  . ARG A 1 84  ? 52.234 18.665 -5.078  1.00 37.35 ? 64  ARG A CD  1 
ATOM   531  N NE  . ARG A 1 84  ? 51.868 18.117 -6.383  1.00 43.19 ? 64  ARG A NE  1 
ATOM   532  C CZ  . ARG A 1 84  ? 50.927 17.197 -6.581  1.00 44.23 ? 64  ARG A CZ  1 
ATOM   533  N NH1 . ARG A 1 84  ? 50.244 16.698 -5.557  1.00 45.03 ? 64  ARG A NH1 1 
ATOM   534  N NH2 . ARG A 1 84  ? 50.662 16.778 -7.811  1.00 45.64 ? 64  ARG A NH2 1 
ATOM   535  N N   . LYS A 1 85  ? 47.105 22.225 -4.846  1.00 22.46 ? 65  LYS A N   1 
ATOM   536  C CA  . LYS A 1 85  ? 45.711 22.273 -5.258  1.00 20.81 ? 65  LYS A CA  1 
ATOM   537  C C   . LYS A 1 85  ? 45.225 23.708 -5.358  1.00 18.95 ? 65  LYS A C   1 
ATOM   538  O O   . LYS A 1 85  ? 45.491 24.527 -4.478  1.00 18.23 ? 65  LYS A O   1 
ATOM   539  C CB  . LYS A 1 85  ? 44.832 21.505 -4.263  1.00 23.61 ? 65  LYS A CB  1 
ATOM   540  C CG  . LYS A 1 85  ? 43.406 21.296 -4.765  1.00 28.32 ? 65  LYS A CG  1 
ATOM   541  C CD  . LYS A 1 85  ? 42.587 20.387 -3.863  1.00 31.64 ? 65  LYS A CD  1 
ATOM   542  C CE  . LYS A 1 85  ? 42.236 21.061 -2.549  1.00 34.06 ? 65  LYS A CE  1 
ATOM   543  N NZ  . LYS A 1 85  ? 41.296 20.231 -1.737  1.00 35.72 ? 65  LYS A NZ  1 
ATOM   544  N N   . GLY A 1 86  ? 44.513 24.010 -6.439  1.00 15.81 ? 66  GLY A N   1 
ATOM   545  C CA  . GLY A 1 86  ? 43.993 25.348 -6.623  1.00 13.74 ? 66  GLY A CA  1 
ATOM   546  C C   . GLY A 1 86  ? 42.706 25.511 -5.841  1.00 14.64 ? 66  GLY A C   1 
ATOM   547  O O   . GLY A 1 86  ? 42.061 24.526 -5.472  1.00 14.58 ? 66  GLY A O   1 
ATOM   548  N N   . VAL A 1 87  ? 42.337 26.757 -5.577  1.00 14.86 ? 67  VAL A N   1 
ATOM   549  C CA  . VAL A 1 87  ? 41.115 27.051 -4.843  1.00 15.28 ? 67  VAL A CA  1 
ATOM   550  C C   . VAL A 1 87  ? 40.549 28.353 -5.386  1.00 15.12 ? 67  VAL A C   1 
ATOM   551  O O   . VAL A 1 87  ? 41.291 29.270 -5.718  1.00 15.24 ? 67  VAL A O   1 
ATOM   552  C CB  . VAL A 1 87  ? 41.378 27.142 -3.302  1.00 17.53 ? 67  VAL A CB  1 
ATOM   553  C CG1 . VAL A 1 87  ? 42.428 28.197 -2.991  1.00 15.92 ? 67  VAL A CG1 1 
ATOM   554  C CG2 . VAL A 1 87  ? 40.087 27.445 -2.568  1.00 16.23 ? 67  VAL A CG2 1 
ATOM   555  N N   . TYR A 1 88  ? 39.227 28.403 -5.521  1.00 16.86 ? 68  TYR A N   1 
ATOM   556  C CA  . TYR A 1 88  ? 38.531 29.573 -6.045  1.00 15.46 ? 68  TYR A CA  1 
ATOM   557  C C   . TYR A 1 88  ? 37.352 29.840 -5.123  1.00 15.07 ? 68  TYR A C   1 
ATOM   558  O O   . TYR A 1 88  ? 36.592 28.924 -4.806  1.00 15.33 ? 68  TYR A O   1 
ATOM   559  C CB  . TYR A 1 88  ? 38.024 29.275 -7.458  1.00 15.57 ? 68  TYR A CB  1 
ATOM   560  C CG  . TYR A 1 88  ? 37.269 30.404 -8.124  1.00 15.77 ? 68  TYR A CG  1 
ATOM   561  C CD1 . TYR A 1 88  ? 37.915 31.290 -8.986  1.00 17.70 ? 68  TYR A CD1 1 
ATOM   562  C CD2 . TYR A 1 88  ? 35.897 30.562 -7.924  1.00 15.91 ? 68  TYR A CD2 1 
ATOM   563  C CE1 . TYR A 1 88  ? 37.207 32.303 -9.639  1.00 16.95 ? 68  TYR A CE1 1 
ATOM   564  C CE2 . TYR A 1 88  ? 35.184 31.569 -8.565  1.00 17.65 ? 68  TYR A CE2 1 
ATOM   565  C CZ  . TYR A 1 88  ? 35.844 32.433 -9.422  1.00 18.16 ? 68  TYR A CZ  1 
ATOM   566  O OH  . TYR A 1 88  ? 35.134 33.421 -10.063 1.00 19.97 ? 68  TYR A OH  1 
ATOM   567  N N   . VAL A 1 89  ? 37.196 31.084 -4.685  1.00 14.22 ? 69  VAL A N   1 
ATOM   568  C CA  . VAL A 1 89  ? 36.092 31.412 -3.788  1.00 14.79 ? 69  VAL A CA  1 
ATOM   569  C C   . VAL A 1 89  ? 35.348 32.666 -4.215  1.00 15.69 ? 69  VAL A C   1 
ATOM   570  O O   . VAL A 1 89  ? 35.915 33.765 -4.234  1.00 16.11 ? 69  VAL A O   1 
ATOM   571  C CB  . VAL A 1 89  ? 36.568 31.630 -2.335  1.00 15.85 ? 69  VAL A CB  1 
ATOM   572  C CG1 . VAL A 1 89  ? 35.355 31.860 -1.420  1.00 17.56 ? 69  VAL A CG1 1 
ATOM   573  C CG2 . VAL A 1 89  ? 37.364 30.430 -1.849  1.00 15.67 ? 69  VAL A CG2 1 
ATOM   574  N N   . PRO A 1 90  ? 34.068 32.515 -4.587  1.00 15.62 ? 70  PRO A N   1 
ATOM   575  C CA  . PRO A 1 90  ? 33.245 33.648 -5.008  1.00 15.50 ? 70  PRO A CA  1 
ATOM   576  C C   . PRO A 1 90  ? 32.454 34.118 -3.786  1.00 14.78 ? 70  PRO A C   1 
ATOM   577  O O   . PRO A 1 90  ? 32.047 33.302 -2.956  1.00 14.86 ? 70  PRO A O   1 
ATOM   578  C CB  . PRO A 1 90  ? 32.344 33.027 -6.064  1.00 14.24 ? 70  PRO A CB  1 
ATOM   579  C CG  . PRO A 1 90  ? 32.030 31.699 -5.441  1.00 15.55 ? 70  PRO A CG  1 
ATOM   580  C CD  . PRO A 1 90  ? 33.372 31.241 -4.857  1.00 15.43 ? 70  PRO A CD  1 
ATOM   581  N N   . TYR A 1 91  ? 32.245 35.425 -3.679  1.00 13.31 ? 71  TYR A N   1 
ATOM   582  C CA  . TYR A 1 91  ? 31.491 36.004 -2.566  1.00 14.17 ? 71  TYR A CA  1 
ATOM   583  C C   . TYR A 1 91  ? 30.443 36.926 -3.179  1.00 14.89 ? 71  TYR A C   1 
ATOM   584  O O   . TYR A 1 91  ? 30.381 37.075 -4.395  1.00 15.81 ? 71  TYR A O   1 
ATOM   585  C CB  . TYR A 1 91  ? 32.407 36.842 -1.659  1.00 15.53 ? 71  TYR A CB  1 
ATOM   586  C CG  . TYR A 1 91  ? 33.590 36.104 -1.062  1.00 14.24 ? 71  TYR A CG  1 
ATOM   587  C CD1 . TYR A 1 91  ? 33.544 35.595 0.240   1.00 16.77 ? 71  TYR A CD1 1 
ATOM   588  C CD2 . TYR A 1 91  ? 34.763 35.937 -1.796  1.00 16.68 ? 71  TYR A CD2 1 
ATOM   589  C CE1 . TYR A 1 91  ? 34.652 34.937 0.801   1.00 14.84 ? 71  TYR A CE1 1 
ATOM   590  C CE2 . TYR A 1 91  ? 35.863 35.286 -1.255  1.00 14.89 ? 71  TYR A CE2 1 
ATOM   591  C CZ  . TYR A 1 91  ? 35.805 34.792 0.035   1.00 16.32 ? 71  TYR A CZ  1 
ATOM   592  O OH  . TYR A 1 91  ? 36.909 34.159 0.538   1.00 15.04 ? 71  TYR A OH  1 
ATOM   593  N N   . THR A 1 92  ? 29.622 37.542 -2.333  1.00 15.95 ? 72  THR A N   1 
ATOM   594  C CA  . THR A 1 92  ? 28.607 38.479 -2.800  1.00 14.59 ? 72  THR A CA  1 
ATOM   595  C C   . THR A 1 92  ? 29.291 39.642 -3.517  1.00 15.76 ? 72  THR A C   1 
ATOM   596  O O   . THR A 1 92  ? 28.757 40.199 -4.472  1.00 14.40 ? 72  THR A O   1 
ATOM   597  C CB  . THR A 1 92  ? 27.796 39.047 -1.618  1.00 15.49 ? 72  THR A CB  1 
ATOM   598  O OG1 . THR A 1 92  ? 27.131 37.976 -0.946  1.00 18.90 ? 72  THR A OG1 1 
ATOM   599  C CG2 . THR A 1 92  ? 26.761 40.063 -2.101  1.00 16.83 ? 72  THR A CG2 1 
ATOM   600  N N   . GLN A 1 93  ? 30.478 40.009 -3.044  1.00 15.50 ? 73  GLN A N   1 
ATOM   601  C CA  . GLN A 1 93  ? 31.227 41.106 -3.634  1.00 15.60 ? 73  GLN A CA  1 
ATOM   602  C C   . GLN A 1 93  ? 32.612 40.662 -4.081  1.00 15.57 ? 73  GLN A C   1 
ATOM   603  O O   . GLN A 1 93  ? 33.573 40.743 -3.315  1.00 15.77 ? 73  GLN A O   1 
ATOM   604  C CB  . GLN A 1 93  ? 31.365 42.247 -2.626  1.00 18.39 ? 73  GLN A CB  1 
ATOM   605  C CG  . GLN A 1 93  ? 30.045 42.841 -2.190  1.00 21.10 ? 73  GLN A CG  1 
ATOM   606  C CD  . GLN A 1 93  ? 29.484 43.808 -3.205  1.00 21.45 ? 73  GLN A CD  1 
ATOM   607  O OE1 . GLN A 1 93  ? 29.939 44.945 -3.309  1.00 23.05 ? 73  GLN A OE1 1 
ATOM   608  N NE2 . GLN A 1 93  ? 28.500 43.360 -3.969  1.00 23.88 ? 73  GLN A NE2 1 
ATOM   609  N N   . GLY A 1 94  ? 32.709 40.183 -5.317  1.00 16.25 ? 74  GLY A N   1 
ATOM   610  C CA  . GLY A 1 94  ? 33.996 39.769 -5.844  1.00 13.84 ? 74  GLY A CA  1 
ATOM   611  C C   . GLY A 1 94  ? 34.359 38.320 -5.616  1.00 15.16 ? 74  GLY A C   1 
ATOM   612  O O   . GLY A 1 94  ? 33.599 37.551 -5.027  1.00 15.59 ? 74  GLY A O   1 
ATOM   613  N N   . ALA A 1 95  ? 35.540 37.948 -6.093  1.00 14.96 ? 75  ALA A N   1 
ATOM   614  C CA  . ALA A 1 95  ? 36.027 36.586 -5.960  1.00 14.09 ? 75  ALA A CA  1 
ATOM   615  C C   . ALA A 1 95  ? 37.537 36.555 -6.136  1.00 13.59 ? 75  ALA A C   1 
ATOM   616  O O   . ALA A 1 95  ? 38.132 37.504 -6.648  1.00 13.84 ? 75  ALA A O   1 
ATOM   617  C CB  . ALA A 1 95  ? 35.366 35.695 -7.019  1.00 15.17 ? 75  ALA A CB  1 
ATOM   618  N N   . TRP A 1 96  ? 38.161 35.473 -5.694  1.00 13.15 ? 76  TRP A N   1 
ATOM   619  C CA  . TRP A 1 96  ? 39.599 35.330 -5.876  1.00 13.63 ? 76  TRP A CA  1 
ATOM   620  C C   . TRP A 1 96  ? 39.976 33.896 -6.239  1.00 14.26 ? 76  TRP A C   1 
ATOM   621  O O   . TRP A 1 96  ? 39.220 32.952 -5.985  1.00 13.10 ? 76  TRP A O   1 
ATOM   622  C CB  . TRP A 1 96  ? 40.374 35.785 -4.621  1.00 12.93 ? 76  TRP A CB  1 
ATOM   623  C CG  . TRP A 1 96  ? 39.998 35.111 -3.330  1.00 13.42 ? 76  TRP A CG  1 
ATOM   624  C CD1 . TRP A 1 96  ? 39.227 35.630 -2.335  1.00 12.40 ? 76  TRP A CD1 1 
ATOM   625  C CD2 . TRP A 1 96  ? 40.372 33.794 -2.902  1.00 13.29 ? 76  TRP A CD2 1 
ATOM   626  N NE1 . TRP A 1 96  ? 39.095 34.722 -1.308  1.00 14.33 ? 76  TRP A NE1 1 
ATOM   627  C CE2 . TRP A 1 96  ? 39.786 33.584 -1.634  1.00 13.35 ? 76  TRP A CE2 1 
ATOM   628  C CE3 . TRP A 1 96  ? 41.143 32.770 -3.470  1.00 13.59 ? 76  TRP A CE3 1 
ATOM   629  C CZ2 . TRP A 1 96  ? 39.945 32.390 -0.919  1.00 13.40 ? 76  TRP A CZ2 1 
ATOM   630  C CZ3 . TRP A 1 96  ? 41.300 31.579 -2.759  1.00 15.25 ? 76  TRP A CZ3 1 
ATOM   631  C CH2 . TRP A 1 96  ? 40.702 31.402 -1.497  1.00 14.74 ? 76  TRP A CH2 1 
ATOM   632  N N   . ALA A 1 97  ? 41.138 33.746 -6.867  1.00 12.90 ? 77  ALA A N   1 
ATOM   633  C CA  . ALA A 1 97  ? 41.660 32.434 -7.236  1.00 12.89 ? 77  ALA A CA  1 
ATOM   634  C C   . ALA A 1 97  ? 43.008 32.314 -6.531  1.00 12.85 ? 77  ALA A C   1 
ATOM   635  O O   . ALA A 1 97  ? 43.749 33.292 -6.427  1.00 12.95 ? 77  ALA A O   1 
ATOM   636  C CB  . ALA A 1 97  ? 41.839 32.335 -8.741  1.00 13.20 ? 77  ALA A CB  1 
ATOM   637  N N   . GLY A 1 98  ? 43.326 31.125 -6.036  1.00 13.13 ? 78  GLY A N   1 
ATOM   638  C CA  . GLY A 1 98  ? 44.585 30.964 -5.341  1.00 12.56 ? 78  GLY A CA  1 
ATOM   639  C C   . GLY A 1 98  ? 45.105 29.549 -5.304  1.00 12.25 ? 78  GLY A C   1 
ATOM   640  O O   . GLY A 1 98  ? 44.623 28.668 -6.023  1.00 13.41 ? 78  GLY A O   1 
ATOM   641  N N   . GLU A 1 99  ? 46.096 29.345 -4.444  1.00 14.43 ? 79  GLU A N   1 
ATOM   642  C CA  . GLU A 1 99  ? 46.753 28.055 -4.278  1.00 15.96 ? 79  GLU A CA  1 
ATOM   643  C C   . GLU A 1 99  ? 46.758 27.675 -2.802  1.00 15.69 ? 79  GLU A C   1 
ATOM   644  O O   . GLU A 1 99  ? 47.044 28.505 -1.943  1.00 16.62 ? 79  GLU A O   1 
ATOM   645  C CB  . GLU A 1 99  ? 48.186 28.157 -4.821  1.00 16.36 ? 79  GLU A CB  1 
ATOM   646  C CG  . GLU A 1 99  ? 48.226 28.546 -6.294  1.00 21.55 ? 79  GLU A CG  1 
ATOM   647  C CD  . GLU A 1 99  ? 49.605 28.947 -6.785  1.00 22.89 ? 79  GLU A CD  1 
ATOM   648  O OE1 . GLU A 1 99  ? 49.718 29.323 -7.969  1.00 23.81 ? 79  GLU A OE1 1 
ATOM   649  O OE2 . GLU A 1 99  ? 50.572 28.890 -5.996  1.00 23.27 ? 79  GLU A OE2 1 
ATOM   650  N N   . LEU A 1 100 ? 46.438 26.420 -2.510  1.00 14.71 ? 80  LEU A N   1 
ATOM   651  C CA  . LEU A 1 100 ? 46.377 25.949 -1.129  1.00 15.99 ? 80  LEU A CA  1 
ATOM   652  C C   . LEU A 1 100 ? 47.695 25.446 -0.557  1.00 15.71 ? 80  LEU A C   1 
ATOM   653  O O   . LEU A 1 100 ? 48.534 24.895 -1.267  1.00 16.29 ? 80  LEU A O   1 
ATOM   654  C CB  . LEU A 1 100 ? 45.331 24.837 -0.999  1.00 14.74 ? 80  LEU A CB  1 
ATOM   655  C CG  . LEU A 1 100 ? 43.868 25.250 -1.175  1.00 16.22 ? 80  LEU A CG  1 
ATOM   656  C CD1 . LEU A 1 100 ? 42.996 24.010 -1.266  1.00 19.44 ? 80  LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1 100 ? 43.434 26.126 -0.014  1.00 18.29 ? 80  LEU A CD2 1 
ATOM   658  N N   . GLY A 1 101 ? 47.853 25.645 0.744   1.00 16.34 ? 81  GLY A N   1 
ATOM   659  C CA  . GLY A 1 101 ? 49.039 25.196 1.449   1.00 15.45 ? 81  GLY A CA  1 
ATOM   660  C C   . GLY A 1 101 ? 48.771 25.284 2.936   1.00 16.22 ? 81  GLY A C   1 
ATOM   661  O O   . GLY A 1 101 ? 47.652 25.580 3.347   1.00 15.64 ? 81  GLY A O   1 
ATOM   662  N N   . THR A 1 102 ? 49.777 25.000 3.756   1.00 14.48 ? 82  THR A N   1 
ATOM   663  C CA  . THR A 1 102 ? 49.610 25.115 5.190   1.00 15.38 ? 82  THR A CA  1 
ATOM   664  C C   . THR A 1 102 ? 50.857 25.803 5.710   1.00 13.98 ? 82  THR A C   1 
ATOM   665  O O   . THR A 1 102 ? 51.919 25.747 5.088   1.00 12.82 ? 82  THR A O   1 
ATOM   666  C CB  . THR A 1 102 ? 49.458 23.749 5.903   1.00 16.18 ? 82  THR A CB  1 
ATOM   667  O OG1 . THR A 1 102 ? 50.689 23.026 5.831   1.00 14.72 ? 82  THR A OG1 1 
ATOM   668  C CG2 . THR A 1 102 ? 48.338 22.926 5.262   1.00 14.67 ? 82  THR A CG2 1 
ATOM   669  N N   . ASP A 1 103 ? 50.709 26.490 6.826   1.00 12.84 ? 83  ASP A N   1 
ATOM   670  C CA  . ASP A 1 103 ? 51.827 27.183 7.438   1.00 12.39 ? 83  ASP A CA  1 
ATOM   671  C C   . ASP A 1 103 ? 51.460 27.470 8.883   1.00 12.62 ? 83  ASP A C   1 
ATOM   672  O O   . ASP A 1 103 ? 50.316 27.258 9.302   1.00 10.41 ? 83  ASP A O   1 
ATOM   673  C CB  . ASP A 1 103 ? 52.112 28.498 6.703   1.00 12.46 ? 83  ASP A CB  1 
ATOM   674  C CG  . ASP A 1 103 ? 53.590 28.861 6.706   1.00 13.04 ? 83  ASP A CG  1 
ATOM   675  O OD1 . ASP A 1 103 ? 54.316 28.391 7.609   1.00 14.22 ? 83  ASP A OD1 1 
ATOM   676  O OD2 . ASP A 1 103 ? 54.023 29.621 5.810   1.00 12.80 ? 83  ASP A OD2 1 
ATOM   677  N N   . LEU A 1 104 ? 52.439 27.939 9.648   1.00 11.44 ? 84  LEU A N   1 
ATOM   678  C CA  . LEU A 1 104 ? 52.220 28.277 11.039  1.00 12.27 ? 84  LEU A CA  1 
ATOM   679  C C   . LEU A 1 104 ? 51.467 29.588 11.058  1.00 13.02 ? 84  LEU A C   1 
ATOM   680  O O   . LEU A 1 104 ? 51.748 30.491 10.263  1.00 12.03 ? 84  LEU A O   1 
ATOM   681  C CB  . LEU A 1 104 ? 53.551 28.445 11.764  1.00 12.34 ? 84  LEU A CB  1 
ATOM   682  C CG  . LEU A 1 104 ? 54.438 27.205 11.737  1.00 14.26 ? 84  LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 104 ? 55.794 27.549 12.326  1.00 14.90 ? 84  LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 104 ? 53.771 26.077 12.513  1.00 15.16 ? 84  LEU A CD2 1 
ATOM   685  N N   . VAL A 1 105 ? 50.506 29.685 11.967  1.00 13.19 ? 85  VAL A N   1 
ATOM   686  C CA  . VAL A 1 105 ? 49.692 30.886 12.088  1.00 14.42 ? 85  VAL A CA  1 
ATOM   687  C C   . VAL A 1 105 ? 49.435 31.225 13.545  1.00 13.70 ? 85  VAL A C   1 
ATOM   688  O O   . VAL A 1 105 ? 49.077 30.362 14.350  1.00 16.49 ? 85  VAL A O   1 
ATOM   689  C CB  . VAL A 1 105 ? 48.319 30.710 11.380  1.00 13.75 ? 85  VAL A CB  1 
ATOM   690  C CG1 . VAL A 1 105 ? 47.521 32.012 11.454  1.00 14.40 ? 85  VAL A CG1 1 
ATOM   691  C CG2 . VAL A 1 105 ? 48.525 30.291 9.935   1.00 15.35 ? 85  VAL A CG2 1 
ATOM   692  N N   . SER A 1 106 ? 49.627 32.491 13.889  1.00 14.41 ? 86  SER A N   1 
ATOM   693  C CA  . SER A 1 106 ? 49.383 32.945 15.245  1.00 14.03 ? 86  SER A CA  1 
ATOM   694  C C   . SER A 1 106 ? 48.717 34.309 15.165  1.00 14.12 ? 86  SER A C   1 
ATOM   695  O O   . SER A 1 106 ? 48.838 35.014 14.165  1.00 16.98 ? 86  SER A O   1 
ATOM   696  C CB  . SER A 1 106 ? 50.693 33.056 16.033  1.00 16.39 ? 86  SER A CB  1 
ATOM   697  O OG  . SER A 1 106 ? 51.503 34.101 15.520  1.00 20.73 ? 86  SER A OG  1 
ATOM   698  N N   . ILE A 1 107 ? 47.995 34.665 16.216  1.00 12.99 ? 87  ILE A N   1 
ATOM   699  C CA  . ILE A 1 107 ? 47.322 35.949 16.281  1.00 11.82 ? 87  ILE A CA  1 
ATOM   700  C C   . ILE A 1 107 ? 47.947 36.624 17.509  1.00 12.59 ? 87  ILE A C   1 
ATOM   701  O O   . ILE A 1 107 ? 47.641 36.270 18.640  1.00 12.29 ? 87  ILE A O   1 
ATOM   702  C CB  . ILE A 1 107 ? 45.802 35.735 16.446  1.00 13.24 ? 87  ILE A CB  1 
ATOM   703  C CG1 . ILE A 1 107 ? 45.290 34.831 15.313  1.00 10.11 ? 87  ILE A CG1 1 
ATOM   704  C CG2 . ILE A 1 107 ? 45.071 37.062 16.403  1.00 13.00 ? 87  ILE A CG2 1 
ATOM   705  C CD1 . ILE A 1 107 ? 43.846 34.396 15.479  1.00 14.77 ? 87  ILE A CD1 1 
ATOM   706  N N   . PRO A 1 108 ? 48.856 37.589 17.286  1.00 13.47 ? 88  PRO A N   1 
ATOM   707  C CA  . PRO A 1 108 ? 49.581 38.346 18.320  1.00 13.69 ? 88  PRO A CA  1 
ATOM   708  C C   . PRO A 1 108 ? 48.722 38.856 19.469  1.00 13.77 ? 88  PRO A C   1 
ATOM   709  O O   . PRO A 1 108 ? 49.094 38.738 20.635  1.00 14.23 ? 88  PRO A O   1 
ATOM   710  C CB  . PRO A 1 108 ? 50.204 39.502 17.534  1.00 14.57 ? 88  PRO A CB  1 
ATOM   711  C CG  . PRO A 1 108 ? 50.361 38.950 16.176  1.00 17.89 ? 88  PRO A CG  1 
ATOM   712  C CD  . PRO A 1 108 ? 49.115 38.159 15.951  1.00 12.59 ? 88  PRO A CD  1 
ATOM   713  N N   . HIS A 1 109 ? 47.579 39.434 19.124  1.00 13.73 ? 89  HIS A N   1 
ATOM   714  C CA  . HIS A 1 109 ? 46.669 39.989 20.113  1.00 13.47 ? 89  HIS A CA  1 
ATOM   715  C C   . HIS A 1 109 ? 45.454 39.095 20.301  1.00 14.55 ? 89  HIS A C   1 
ATOM   716  O O   . HIS A 1 109 ? 44.369 39.559 20.647  1.00 15.03 ? 89  HIS A O   1 
ATOM   717  C CB  . HIS A 1 109 ? 46.261 41.396 19.681  1.00 14.46 ? 89  HIS A CB  1 
ATOM   718  C CG  . HIS A 1 109 ? 47.431 42.291 19.417  1.00 14.09 ? 89  HIS A CG  1 
ATOM   719  N ND1 . HIS A 1 109 ? 48.313 42.668 20.406  1.00 17.29 ? 89  HIS A ND1 1 
ATOM   720  C CD2 . HIS A 1 109 ? 47.907 42.822 18.265  1.00 16.43 ? 89  HIS A CD2 1 
ATOM   721  C CE1 . HIS A 1 109 ? 49.285 43.389 19.875  1.00 18.77 ? 89  HIS A CE1 1 
ATOM   722  N NE2 . HIS A 1 109 ? 49.062 43.496 18.578  1.00 17.91 ? 89  HIS A NE2 1 
ATOM   723  N N   . GLY A 1 110 ? 45.664 37.803 20.068  1.00 13.76 ? 90  GLY A N   1 
ATOM   724  C CA  . GLY A 1 110 ? 44.620 36.812 20.223  1.00 14.25 ? 90  GLY A CA  1 
ATOM   725  C C   . GLY A 1 110 ? 45.126 35.752 21.183  1.00 13.85 ? 90  GLY A C   1 
ATOM   726  O O   . GLY A 1 110 ? 45.895 36.074 22.088  1.00 12.52 ? 90  GLY A O   1 
ATOM   727  N N   . PRO A 1 111 ? 44.740 34.477 21.004  1.00 13.39 ? 91  PRO A N   1 
ATOM   728  C CA  . PRO A 1 111 ? 45.190 33.407 21.899  1.00 12.37 ? 91  PRO A CA  1 
ATOM   729  C C   . PRO A 1 111 ? 46.697 33.201 21.862  1.00 13.00 ? 91  PRO A C   1 
ATOM   730  O O   . PRO A 1 111 ? 47.342 33.444 20.843  1.00 15.88 ? 91  PRO A O   1 
ATOM   731  C CB  . PRO A 1 111 ? 44.422 32.190 21.394  1.00 13.22 ? 91  PRO A CB  1 
ATOM   732  C CG  . PRO A 1 111 ? 44.339 32.450 19.916  1.00 15.62 ? 91  PRO A CG  1 
ATOM   733  C CD  . PRO A 1 111 ? 43.983 33.930 19.862  1.00 13.84 ? 91  PRO A CD  1 
ATOM   734  N N   . ASN A 1 112 ? 47.254 32.749 22.981  1.00 13.31 ? 92  ASN A N   1 
ATOM   735  C CA  . ASN A 1 112 ? 48.686 32.521 23.072  1.00 13.38 ? 92  ASN A CA  1 
ATOM   736  C C   . ASN A 1 112 ? 49.028 31.113 22.608  1.00 14.40 ? 92  ASN A C   1 
ATOM   737  O O   . ASN A 1 112 ? 49.468 30.271 23.397  1.00 14.42 ? 92  ASN A O   1 
ATOM   738  C CB  . ASN A 1 112 ? 49.158 32.734 24.504  1.00 11.40 ? 92  ASN A CB  1 
ATOM   739  C CG  . ASN A 1 112 ? 50.662 32.705 24.631  1.00 13.00 ? 92  ASN A CG  1 
ATOM   740  O OD1 . ASN A 1 112 ? 51.387 32.944 23.658  1.00 13.29 ? 92  ASN A OD1 1 
ATOM   741  N ND2 . ASN A 1 112 ? 51.146 32.433 25.838  1.00 11.74 ? 92  ASN A ND2 1 
ATOM   742  N N   . VAL A 1 113 ? 48.802 30.872 21.321  1.00 13.65 ? 93  VAL A N   1 
ATOM   743  C CA  . VAL A 1 113 ? 49.075 29.584 20.695  1.00 14.16 ? 93  VAL A CA  1 
ATOM   744  C C   . VAL A 1 113 ? 49.518 29.794 19.255  1.00 14.18 ? 93  VAL A C   1 
ATOM   745  O O   . VAL A 1 113 ? 49.417 30.895 18.712  1.00 14.68 ? 93  VAL A O   1 
ATOM   746  C CB  . VAL A 1 113 ? 47.813 28.687 20.673  1.00 14.70 ? 93  VAL A CB  1 
ATOM   747  C CG1 . VAL A 1 113 ? 47.288 28.481 22.082  1.00 13.79 ? 93  VAL A CG1 1 
ATOM   748  C CG2 . VAL A 1 113 ? 46.737 29.323 19.794  1.00 13.51 ? 93  VAL A CG2 1 
ATOM   749  N N   . THR A 1 114 ? 50.000 28.722 18.637  1.00 13.63 ? 94  THR A N   1 
ATOM   750  C CA  . THR A 1 114 ? 50.423 28.747 17.249  1.00 13.38 ? 94  THR A CA  1 
ATOM   751  C C   . THR A 1 114 ? 49.938 27.438 16.631  1.00 13.54 ? 94  THR A C   1 
ATOM   752  O O   . THR A 1 114 ? 50.196 26.362 17.157  1.00 12.93 ? 94  THR A O   1 
ATOM   753  C CB  . THR A 1 114 ? 51.957 28.837 17.113  1.00 12.89 ? 94  THR A CB  1 
ATOM   754  O OG1 . THR A 1 114 ? 52.418 30.077 17.669  1.00 11.38 ? 94  THR A OG1 1 
ATOM   755  C CG2 . THR A 1 114 ? 52.365 28.762 15.644  1.00 14.35 ? 94  THR A CG2 1 
ATOM   756  N N   . VAL A 1 115 ? 49.208 27.531 15.532  1.00 13.51 ? 95  VAL A N   1 
ATOM   757  C CA  . VAL A 1 115 ? 48.708 26.327 14.884  1.00 15.77 ? 95  VAL A CA  1 
ATOM   758  C C   . VAL A 1 115 ? 49.157 26.248 13.433  1.00 15.62 ? 95  VAL A C   1 
ATOM   759  O O   . VAL A 1 115 ? 49.591 27.245 12.855  1.00 17.00 ? 95  VAL A O   1 
ATOM   760  C CB  . VAL A 1 115 ? 47.158 26.272 14.915  1.00 17.32 ? 95  VAL A CB  1 
ATOM   761  C CG1 . VAL A 1 115 ? 46.660 26.377 16.347  1.00 16.52 ? 95  VAL A CG1 1 
ATOM   762  C CG2 . VAL A 1 115 ? 46.576 27.391 14.065  1.00 17.22 ? 95  VAL A CG2 1 
ATOM   763  N N   . ARG A 1 116 ? 49.094 25.051 12.856  1.00 14.70 ? 96  ARG A N   1 
ATOM   764  C CA  . ARG A 1 116 ? 49.424 24.894 11.451  1.00 13.29 ? 96  ARG A CA  1 
ATOM   765  C C   . ARG A 1 116 ? 48.043 24.860 10.814  1.00 14.63 ? 96  ARG A C   1 
ATOM   766  O O   . ARG A 1 116 ? 47.235 23.980 11.112  1.00 15.17 ? 96  ARG A O   1 
ATOM   767  C CB  . ARG A 1 116 ? 50.176 23.586 11.165  1.00 15.17 ? 96  ARG A CB  1 
ATOM   768  C CG  . ARG A 1 116 ? 50.364 23.327 9.662   1.00 14.68 ? 96  ARG A CG  1 
ATOM   769  C CD  . ARG A 1 116 ? 51.417 22.257 9.365   1.00 13.55 ? 96  ARG A CD  1 
ATOM   770  N NE  . ARG A 1 116 ? 52.787 22.735 9.578   1.00 13.48 ? 96  ARG A NE  1 
ATOM   771  C CZ  . ARG A 1 116 ? 53.472 23.506 8.732   1.00 14.34 ? 96  ARG A CZ  1 
ATOM   772  N NH1 . ARG A 1 116 ? 52.935 23.909 7.586   1.00 13.84 ? 96  ARG A NH1 1 
ATOM   773  N NH2 . ARG A 1 116 ? 54.707 23.883 9.037   1.00 14.25 ? 96  ARG A NH2 1 
ATOM   774  N N   . ALA A 1 117 ? 47.768 25.838 9.963   1.00 11.98 ? 97  ALA A N   1 
ATOM   775  C CA  . ALA A 1 117 ? 46.467 25.942 9.323   1.00 13.11 ? 97  ALA A CA  1 
ATOM   776  C C   . ALA A 1 117 ? 46.509 25.956 7.808   1.00 14.67 ? 97  ALA A C   1 
ATOM   777  O O   . ALA A 1 117 ? 47.541 26.218 7.189   1.00 12.27 ? 97  ALA A O   1 
ATOM   778  C CB  . ALA A 1 117 ? 45.759 27.206 9.821   1.00 12.69 ? 97  ALA A CB  1 
ATOM   779  N N   . ASN A 1 118 ? 45.363 25.657 7.210   1.00 14.11 ? 98  ASN A N   1 
ATOM   780  C CA  . ASN A 1 118 ? 45.255 25.697 5.774   1.00 14.00 ? 98  ASN A CA  1 
ATOM   781  C C   . ASN A 1 118 ? 45.255 27.171 5.431   1.00 14.90 ? 98  ASN A C   1 
ATOM   782  O O   . ASN A 1 118 ? 44.598 27.967 6.101   1.00 15.07 ? 98  ASN A O   1 
ATOM   783  C CB  . ASN A 1 118 ? 43.947 25.064 5.310   1.00 14.54 ? 98  ASN A CB  1 
ATOM   784  C CG  . ASN A 1 118 ? 43.942 23.570 5.490   1.00 13.85 ? 98  ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 118 ? 44.883 22.890 5.084   1.00 16.27 ? 98  ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 118 ? 42.882 23.045 6.094   1.00 14.23 ? 98  ASN A ND2 1 
ATOM   787  N N   . ILE A 1 119 ? 46.013 27.538 4.411   1.00 14.18 ? 99  ILE A N   1 
ATOM   788  C CA  . ILE A 1 119 ? 46.065 28.926 3.989   1.00 17.82 ? 99  ILE A CA  1 
ATOM   789  C C   . ILE A 1 119 ? 45.966 28.984 2.479   1.00 16.67 ? 99  ILE A C   1 
ATOM   790  O O   . ILE A 1 119 ? 46.676 28.267 1.763   1.00 17.88 ? 99  ILE A O   1 
ATOM   791  C CB  . ILE A 1 119 ? 47.379 29.618 4.426   1.00 19.63 ? 99  ILE A CB  1 
ATOM   792  C CG1 . ILE A 1 119 ? 47.629 29.384 5.914   1.00 21.94 ? 99  ILE A CG1 1 
ATOM   793  C CG2 . ILE A 1 119 ? 47.285 31.121 4.163   1.00 19.89 ? 99  ILE A CG2 1 
ATOM   794  C CD1 . ILE A 1 119 ? 48.948 29.943 6.408   1.00 25.36 ? 99  ILE A CD1 1 
ATOM   795  N N   . ALA A 1 120 ? 45.073 29.830 1.985   1.00 16.35 ? 100 ALA A N   1 
ATOM   796  C CA  . ALA A 1 120 ? 44.914 29.981 0.552   1.00 14.71 ? 100 ALA A CA  1 
ATOM   797  C C   . ALA A 1 120 ? 45.699 31.208 0.116   1.00 14.42 ? 100 ALA A C   1 
ATOM   798  O O   . ALA A 1 120 ? 45.427 32.321 0.558   1.00 16.55 ? 100 ALA A O   1 
ATOM   799  C CB  . ALA A 1 120 ? 43.436 30.138 0.192   1.00 13.57 ? 100 ALA A CB  1 
ATOM   800  N N   . ALA A 1 121 ? 46.697 30.994 -0.729  1.00 13.49 ? 101 ALA A N   1 
ATOM   801  C CA  . ALA A 1 121 ? 47.508 32.088 -1.238  1.00 13.38 ? 101 ALA A CA  1 
ATOM   802  C C   . ALA A 1 121 ? 46.745 32.685 -2.419  1.00 12.26 ? 101 ALA A C   1 
ATOM   803  O O   . ALA A 1 121 ? 46.597 32.033 -3.450  1.00 15.21 ? 101 ALA A O   1 
ATOM   804  C CB  . ALA A 1 121 ? 48.868 31.564 -1.699  1.00 11.77 ? 101 ALA A CB  1 
ATOM   805  N N   . ILE A 1 122 ? 46.261 33.914 -2.266  1.00 11.38 ? 102 ILE A N   1 
ATOM   806  C CA  . ILE A 1 122 ? 45.512 34.576 -3.331  1.00 12.35 ? 102 ILE A CA  1 
ATOM   807  C C   . ILE A 1 122 ? 46.479 35.135 -4.363  1.00 15.02 ? 102 ILE A C   1 
ATOM   808  O O   . ILE A 1 122 ? 47.266 36.030 -4.068  1.00 15.29 ? 102 ILE A O   1 
ATOM   809  C CB  . ILE A 1 122 ? 44.639 35.729 -2.794  1.00 11.91 ? 102 ILE A CB  1 
ATOM   810  C CG1 . ILE A 1 122 ? 43.633 35.185 -1.769  1.00 11.97 ? 102 ILE A CG1 1 
ATOM   811  C CG2 . ILE A 1 122 ? 43.890 36.398 -3.955  1.00 12.95 ? 102 ILE A CG2 1 
ATOM   812  C CD1 . ILE A 1 122 ? 42.825 36.257 -1.068  1.00 14.29 ? 102 ILE A CD1 1 
ATOM   813  N N   . THR A 1 123 ? 46.399 34.607 -5.578  1.00 13.57 ? 103 THR A N   1 
ATOM   814  C CA  . THR A 1 123 ? 47.285 35.019 -6.657  1.00 15.00 ? 103 THR A CA  1 
ATOM   815  C C   . THR A 1 123 ? 46.632 35.966 -7.657  1.00 15.25 ? 103 THR A C   1 
ATOM   816  O O   . THR A 1 123 ? 47.307 36.795 -8.268  1.00 16.47 ? 103 THR A O   1 
ATOM   817  C CB  . THR A 1 123 ? 47.827 33.781 -7.393  1.00 15.17 ? 103 THR A CB  1 
ATOM   818  O OG1 . THR A 1 123 ? 46.734 32.955 -7.815  1.00 16.87 ? 103 THR A OG1 1 
ATOM   819  C CG2 . THR A 1 123 ? 48.715 32.969 -6.465  1.00 15.57 ? 103 THR A CG2 1 
ATOM   820  N N   . GLU A 1 124 ? 45.320 35.836 -7.820  1.00 14.67 ? 104 GLU A N   1 
ATOM   821  C CA  . GLU A 1 124 ? 44.555 36.678 -8.736  1.00 14.14 ? 104 GLU A CA  1 
ATOM   822  C C   . GLU A 1 124 ? 43.211 36.939 -8.060  1.00 14.27 ? 104 GLU A C   1 
ATOM   823  O O   . GLU A 1 124 ? 42.757 36.130 -7.252  1.00 11.65 ? 104 GLU A O   1 
ATOM   824  C CB  . GLU A 1 124 ? 44.320 35.957 -10.068 1.00 15.07 ? 104 GLU A CB  1 
ATOM   825  C CG  . GLU A 1 124 ? 45.574 35.583 -10.863 1.00 17.73 ? 104 GLU A CG  1 
ATOM   826  C CD  . GLU A 1 124 ? 46.299 36.778 -11.459 1.00 19.28 ? 104 GLU A CD  1 
ATOM   827  O OE1 . GLU A 1 124 ? 45.685 37.858 -11.590 1.00 20.02 ? 104 GLU A OE1 1 
ATOM   828  O OE2 . GLU A 1 124 ? 47.487 36.629 -11.818 1.00 20.89 ? 104 GLU A OE2 1 
ATOM   829  N N   . SER A 1 125 ? 42.571 38.054 -8.396  1.00 14.34 ? 105 SER A N   1 
ATOM   830  C CA  . SER A 1 125 ? 41.287 38.387 -7.791  1.00 14.20 ? 105 SER A CA  1 
ATOM   831  C C   . SER A 1 125 ? 40.509 39.388 -8.627  1.00 14.74 ? 105 SER A C   1 
ATOM   832  O O   . SER A 1 125 ? 41.081 40.108 -9.447  1.00 12.53 ? 105 SER A O   1 
ATOM   833  C CB  . SER A 1 125 ? 41.508 38.989 -6.410  1.00 14.32 ? 105 SER A CB  1 
ATOM   834  O OG  . SER A 1 125 ? 42.221 40.209 -6.522  1.00 14.86 ? 105 SER A OG  1 
ATOM   835  N N   . ASP A 1 126 ? 39.202 39.437 -8.395  1.00 14.84 ? 106 ASP A N   1 
ATOM   836  C CA  . ASP A 1 126 ? 38.329 40.365 -9.104  1.00 16.31 ? 106 ASP A CA  1 
ATOM   837  C C   . ASP A 1 126 ? 37.396 41.058 -8.120  1.00 16.42 ? 106 ASP A C   1 
ATOM   838  O O   . ASP A 1 126 ? 36.521 40.431 -7.519  1.00 15.18 ? 106 ASP A O   1 
ATOM   839  C CB  . ASP A 1 126 ? 37.511 39.633 -10.169 1.00 19.25 ? 106 ASP A CB  1 
ATOM   840  C CG  . ASP A 1 126 ? 36.495 40.540 -10.846 1.00 19.35 ? 106 ASP A CG  1 
ATOM   841  O OD1 . ASP A 1 126 ? 36.822 41.710 -11.115 1.00 24.00 ? 106 ASP A OD1 1 
ATOM   842  O OD2 . ASP A 1 126 ? 35.370 40.082 -11.116 1.00 25.26 ? 106 ASP A OD2 1 
ATOM   843  N N   . LYS A 1 127 ? 37.614 42.355 -7.940  1.00 16.62 ? 107 LYS A N   1 
ATOM   844  C CA  . LYS A 1 127 ? 36.795 43.162 -7.042  1.00 18.04 ? 107 LYS A CA  1 
ATOM   845  C C   . LYS A 1 127 ? 36.634 42.593 -5.637  1.00 17.17 ? 107 LYS A C   1 
ATOM   846  O O   . LYS A 1 127 ? 35.577 42.748 -5.023  1.00 14.72 ? 107 LYS A O   1 
ATOM   847  C CB  . LYS A 1 127 ? 35.416 43.377 -7.672  1.00 19.86 ? 107 LYS A CB  1 
ATOM   848  C CG  . LYS A 1 127 ? 35.476 44.089 -9.010  1.00 25.64 ? 107 LYS A CG  1 
ATOM   849  C CD  . LYS A 1 127 ? 34.094 44.239 -9.623  1.00 29.92 ? 107 LYS A CD  1 
ATOM   850  C CE  . LYS A 1 127 ? 34.164 44.980 -10.945 1.00 31.50 ? 107 LYS A CE  1 
ATOM   851  N NZ  . LYS A 1 127 ? 32.806 45.222 -11.499 1.00 35.19 ? 107 LYS A NZ  1 
ATOM   852  N N   . PHE A 1 128 ? 37.681 41.943 -5.132  1.00 16.14 ? 108 PHE A N   1 
ATOM   853  C CA  . PHE A 1 128 ? 37.655 41.367 -3.792  1.00 15.70 ? 108 PHE A CA  1 
ATOM   854  C C   . PHE A 1 128 ? 38.255 42.360 -2.805  1.00 15.64 ? 108 PHE A C   1 
ATOM   855  O O   . PHE A 1 128 ? 37.578 42.819 -1.882  1.00 13.62 ? 108 PHE A O   1 
ATOM   856  C CB  . PHE A 1 128 ? 38.447 40.058 -3.743  1.00 14.59 ? 108 PHE A CB  1 
ATOM   857  C CG  . PHE A 1 128 ? 38.461 39.414 -2.386  1.00 16.19 ? 108 PHE A CG  1 
ATOM   858  C CD1 . PHE A 1 128 ? 37.284 38.938 -1.816  1.00 15.07 ? 108 PHE A CD1 1 
ATOM   859  C CD2 . PHE A 1 128 ? 39.648 39.302 -1.664  1.00 16.48 ? 108 PHE A CD2 1 
ATOM   860  C CE1 . PHE A 1 128 ? 37.284 38.361 -0.549  1.00 14.57 ? 108 PHE A CE1 1 
ATOM   861  C CE2 . PHE A 1 128 ? 39.659 38.727 -0.396  1.00 15.06 ? 108 PHE A CE2 1 
ATOM   862  C CZ  . PHE A 1 128 ? 38.473 38.255 0.165   1.00 13.31 ? 108 PHE A CZ  1 
ATOM   863  N N   . PHE A 1 129 ? 39.528 42.693 -3.002  1.00 14.39 ? 109 PHE A N   1 
ATOM   864  C CA  . PHE A 1 129 ? 40.189 43.645 -2.125  1.00 14.33 ? 109 PHE A CA  1 
ATOM   865  C C   . PHE A 1 129 ? 39.547 45.010 -2.310  1.00 15.16 ? 109 PHE A C   1 
ATOM   866  O O   . PHE A 1 129 ? 39.051 45.330 -3.388  1.00 15.98 ? 109 PHE A O   1 
ATOM   867  C CB  . PHE A 1 129 ? 41.689 43.705 -2.426  1.00 13.36 ? 109 PHE A CB  1 
ATOM   868  C CG  . PHE A 1 129 ? 42.411 42.411 -2.152  1.00 14.01 ? 109 PHE A CG  1 
ATOM   869  C CD1 . PHE A 1 129 ? 43.074 41.738 -3.172  1.00 12.88 ? 109 PHE A CD1 1 
ATOM   870  C CD2 . PHE A 1 129 ? 42.406 41.854 -0.874  1.00 13.66 ? 109 PHE A CD2 1 
ATOM   871  C CE1 . PHE A 1 129 ? 43.721 40.527 -2.930  1.00 14.70 ? 109 PHE A CE1 1 
ATOM   872  C CE2 . PHE A 1 129 ? 43.050 40.640 -0.619  1.00 16.33 ? 109 PHE A CE2 1 
ATOM   873  C CZ  . PHE A 1 129 ? 43.710 39.975 -1.654  1.00 13.04 ? 109 PHE A CZ  1 
ATOM   874  N N   . ILE A 1 130 ? 39.537 45.800 -1.241  1.00 16.35 ? 110 ILE A N   1 
ATOM   875  C CA  . ILE A 1 130 ? 38.942 47.126 -1.266  1.00 16.79 ? 110 ILE A CA  1 
ATOM   876  C C   . ILE A 1 130 ? 40.020 48.185 -1.088  1.00 17.80 ? 110 ILE A C   1 
ATOM   877  O O   . ILE A 1 130 ? 40.788 48.154 -0.120  1.00 17.46 ? 110 ILE A O   1 
ATOM   878  C CB  . ILE A 1 130 ? 37.896 47.282 -0.140  1.00 17.36 ? 110 ILE A CB  1 
ATOM   879  C CG1 . ILE A 1 130 ? 36.759 46.275 -0.343  1.00 17.27 ? 110 ILE A CG1 1 
ATOM   880  C CG2 . ILE A 1 130 ? 37.353 48.709 -0.126  1.00 17.33 ? 110 ILE A CG2 1 
ATOM   881  C CD1 . ILE A 1 130 ? 35.732 46.266 0.782   1.00 17.33 ? 110 ILE A CD1 1 
ATOM   882  N N   . ASN A 1 131 ? 40.067 49.122 -2.028  1.00 18.34 ? 111 ASN A N   1 
ATOM   883  C CA  . ASN A 1 131 ? 41.049 50.197 -2.004  1.00 19.77 ? 111 ASN A CA  1 
ATOM   884  C C   . ASN A 1 131 ? 40.928 51.007 -0.717  1.00 18.18 ? 111 ASN A C   1 
ATOM   885  O O   . ASN A 1 131 ? 39.843 51.476 -0.374  1.00 18.46 ? 111 ASN A O   1 
ATOM   886  C CB  . ASN A 1 131 ? 40.833 51.114 -3.220  1.00 22.16 ? 111 ASN A CB  1 
ATOM   887  C CG  . ASN A 1 131 ? 41.974 52.104 -3.435  1.00 23.10 ? 111 ASN A CG  1 
ATOM   888  O OD1 . ASN A 1 131 ? 41.804 53.107 -4.123  1.00 27.52 ? 111 ASN A OD1 1 
ATOM   889  N ND2 . ASN A 1 131 ? 43.137 51.821 -2.865  1.00 24.25 ? 111 ASN A ND2 1 
ATOM   890  N N   . GLY A 1 132 ? 42.044 51.157 -0.004  1.00 18.25 ? 112 GLY A N   1 
ATOM   891  C CA  . GLY A 1 132 ? 42.057 51.926 1.229   1.00 16.16 ? 112 GLY A CA  1 
ATOM   892  C C   . GLY A 1 132 ? 41.499 51.250 2.474   1.00 16.77 ? 112 GLY A C   1 
ATOM   893  O O   . GLY A 1 132 ? 41.411 51.877 3.534   1.00 16.52 ? 112 GLY A O   1 
ATOM   894  N N   . SER A 1 133 ? 41.139 49.975 2.362   1.00 15.56 ? 113 SER A N   1 
ATOM   895  C CA  . SER A 1 133 ? 40.566 49.240 3.488   1.00 16.09 ? 113 SER A CA  1 
ATOM   896  C C   . SER A 1 133 ? 41.598 48.755 4.499   1.00 16.96 ? 113 SER A C   1 
ATOM   897  O O   . SER A 1 133 ? 41.256 48.433 5.635   1.00 16.45 ? 113 SER A O   1 
ATOM   898  C CB  . SER A 1 133 ? 39.783 48.036 2.982   1.00 14.50 ? 113 SER A CB  1 
ATOM   899  O OG  . SER A 1 133 ? 40.671 47.054 2.487   1.00 15.36 ? 113 SER A OG  1 
ATOM   900  N N   . ASN A 1 134 ? 42.850 48.674 4.067   1.00 16.74 ? 114 ASN A N   1 
ATOM   901  C CA  . ASN A 1 134 ? 43.950 48.231 4.915   1.00 19.25 ? 114 ASN A CA  1 
ATOM   902  C C   . ASN A 1 134 ? 44.040 46.740 5.232   1.00 17.59 ? 114 ASN A C   1 
ATOM   903  O O   . ASN A 1 134 ? 44.978 46.318 5.908   1.00 17.82 ? 114 ASN A O   1 
ATOM   904  C CB  . ASN A 1 134 ? 43.968 49.021 6.221   1.00 22.65 ? 114 ASN A CB  1 
ATOM   905  C CG  . ASN A 1 134 ? 45.184 49.905 6.335   1.00 29.22 ? 114 ASN A CG  1 
ATOM   906  O OD1 . ASN A 1 134 ? 45.324 50.885 5.600   1.00 32.45 ? 114 ASN A OD1 1 
ATOM   907  N ND2 . ASN A 1 134 ? 46.085 49.559 7.251   1.00 30.20 ? 114 ASN A ND2 1 
ATOM   908  N N   . TRP A 1 135 ? 43.081 45.934 4.780   1.00 15.92 ? 115 TRP A N   1 
ATOM   909  C CA  . TRP A 1 135 ? 43.197 44.503 5.034   1.00 14.48 ? 115 TRP A CA  1 
ATOM   910  C C   . TRP A 1 135 ? 43.733 43.838 3.768   1.00 13.52 ? 115 TRP A C   1 
ATOM   911  O O   . TRP A 1 135 ? 43.474 44.292 2.648   1.00 13.51 ? 115 TRP A O   1 
ATOM   912  C CB  . TRP A 1 135 ? 41.873 43.867 5.512   1.00 14.46 ? 115 TRP A CB  1 
ATOM   913  C CG  . TRP A 1 135 ? 40.622 44.185 4.745   1.00 14.09 ? 115 TRP A CG  1 
ATOM   914  C CD1 . TRP A 1 135 ? 39.752 45.212 4.985   1.00 15.70 ? 115 TRP A CD1 1 
ATOM   915  C CD2 . TRP A 1 135 ? 40.062 43.430 3.662   1.00 13.58 ? 115 TRP A CD2 1 
ATOM   916  N NE1 . TRP A 1 135 ? 38.683 45.140 4.124   1.00 16.85 ? 115 TRP A NE1 1 
ATOM   917  C CE2 . TRP A 1 135 ? 38.847 44.057 3.300   1.00 14.54 ? 115 TRP A CE2 1 
ATOM   918  C CE3 . TRP A 1 135 ? 40.467 42.283 2.965   1.00 15.18 ? 115 TRP A CE3 1 
ATOM   919  C CZ2 . TRP A 1 135 ? 38.032 43.577 2.269   1.00 15.28 ? 115 TRP A CZ2 1 
ATOM   920  C CZ3 . TRP A 1 135 ? 39.652 41.801 1.936   1.00 14.53 ? 115 TRP A CZ3 1 
ATOM   921  C CH2 . TRP A 1 135 ? 38.449 42.451 1.600   1.00 14.65 ? 115 TRP A CH2 1 
ATOM   922  N N   . GLU A 1 136 ? 44.499 42.771 3.961   1.00 12.53 ? 116 GLU A N   1 
ATOM   923  C CA  . GLU A 1 136 ? 45.160 42.070 2.868   1.00 12.34 ? 116 GLU A CA  1 
ATOM   924  C C   . GLU A 1 136 ? 44.828 40.581 2.793   1.00 11.79 ? 116 GLU A C   1 
ATOM   925  O O   . GLU A 1 136 ? 45.505 39.820 2.108   1.00 12.41 ? 116 GLU A O   1 
ATOM   926  C CB  . GLU A 1 136 ? 46.675 42.258 3.031   1.00 15.55 ? 116 GLU A CB  1 
ATOM   927  C CG  . GLU A 1 136 ? 47.110 43.735 3.069   1.00 18.94 ? 116 GLU A CG  1 
ATOM   928  C CD  . GLU A 1 136 ? 47.933 44.127 4.299   1.00 19.44 ? 116 GLU A CD  1 
ATOM   929  O OE1 . GLU A 1 136 ? 48.440 45.268 4.319   1.00 22.19 ? 116 GLU A OE1 1 
ATOM   930  O OE2 . GLU A 1 136 ? 48.088 43.323 5.244   1.00 17.47 ? 116 GLU A OE2 1 
ATOM   931  N N   . GLY A 1 137 ? 43.786 40.170 3.502   1.00 11.61 ? 117 GLY A N   1 
ATOM   932  C CA  . GLY A 1 137 ? 43.396 38.776 3.506   1.00 11.09 ? 117 GLY A CA  1 
ATOM   933  C C   . GLY A 1 137 ? 42.059 38.636 4.206   1.00 11.98 ? 117 GLY A C   1 
ATOM   934  O O   . GLY A 1 137 ? 41.468 39.632 4.612   1.00 11.25 ? 117 GLY A O   1 
ATOM   935  N N   . ILE A 1 138 ? 41.592 37.406 4.373   1.00 10.70 ? 118 ILE A N   1 
ATOM   936  C CA  . ILE A 1 138 ? 40.297 37.177 4.999   1.00 9.90  ? 118 ILE A CA  1 
ATOM   937  C C   . ILE A 1 138 ? 40.298 35.937 5.892   1.00 10.69 ? 118 ILE A C   1 
ATOM   938  O O   . ILE A 1 138 ? 40.889 34.916 5.552   1.00 11.69 ? 118 ILE A O   1 
ATOM   939  C CB  . ILE A 1 138 ? 39.201 37.037 3.890   1.00 10.59 ? 118 ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 138 ? 37.818 36.830 4.511   1.00 9.80  ? 118 ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 138 ? 39.542 35.880 2.964   1.00 11.77 ? 118 ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 138 ? 36.689 36.973 3.505   1.00 12.85 ? 118 ILE A CD1 1 
ATOM   943  N N   . LEU A 1 139 ? 39.648 36.045 7.044   1.00 10.17 ? 119 LEU A N   1 
ATOM   944  C CA  . LEU A 1 139 ? 39.547 34.927 7.972   1.00 12.29 ? 119 LEU A CA  1 
ATOM   945  C C   . LEU A 1 139 ? 38.092 34.477 8.006   1.00 11.55 ? 119 LEU A C   1 
ATOM   946  O O   . LEU A 1 139 ? 37.261 35.095 8.666   1.00 13.07 ? 119 LEU A O   1 
ATOM   947  C CB  . LEU A 1 139 ? 39.991 35.341 9.383   1.00 12.61 ? 119 LEU A CB  1 
ATOM   948  C CG  . LEU A 1 139 ? 39.862 34.252 10.458  1.00 12.98 ? 119 LEU A CG  1 
ATOM   949  C CD1 . LEU A 1 139 ? 40.729 33.071 10.067  1.00 14.49 ? 119 LEU A CD1 1 
ATOM   950  C CD2 . LEU A 1 139 ? 40.276 34.790 11.823  1.00 13.89 ? 119 LEU A CD2 1 
ATOM   951  N N   . GLY A 1 140 ? 37.783 33.417 7.266   1.00 11.84 ? 120 GLY A N   1 
ATOM   952  C CA  . GLY A 1 140 ? 36.426 32.911 7.245   1.00 12.44 ? 120 GLY A CA  1 
ATOM   953  C C   . GLY A 1 140 ? 36.204 32.107 8.508   1.00 12.96 ? 120 GLY A C   1 
ATOM   954  O O   . GLY A 1 140 ? 36.811 31.055 8.687   1.00 13.49 ? 120 GLY A O   1 
ATOM   955  N N   . LEU A 1 141 ? 35.338 32.607 9.387   1.00 12.74 ? 121 LEU A N   1 
ATOM   956  C CA  . LEU A 1 141 ? 35.055 31.952 10.657  1.00 11.40 ? 121 LEU A CA  1 
ATOM   957  C C   . LEU A 1 141 ? 33.840 31.032 10.698  1.00 11.77 ? 121 LEU A C   1 
ATOM   958  O O   . LEU A 1 141 ? 33.518 30.482 11.757  1.00 14.58 ? 121 LEU A O   1 
ATOM   959  C CB  . LEU A 1 141 ? 34.927 33.021 11.753  1.00 10.58 ? 121 LEU A CB  1 
ATOM   960  C CG  . LEU A 1 141 ? 36.235 33.747 12.069  1.00 10.10 ? 121 LEU A CG  1 
ATOM   961  C CD1 . LEU A 1 141 ? 35.956 35.067 12.763  1.00 14.34 ? 121 LEU A CD1 1 
ATOM   962  C CD2 . LEU A 1 141 ? 37.111 32.848 12.940  1.00 11.53 ? 121 LEU A CD2 1 
ATOM   963  N N   . ALA A 1 142 ? 33.163 30.867 9.566   1.00 12.33 ? 122 ALA A N   1 
ATOM   964  C CA  . ALA A 1 142 ? 32.000 29.995 9.501   1.00 12.43 ? 122 ALA A CA  1 
ATOM   965  C C   . ALA A 1 142 ? 32.431 28.527 9.474   1.00 14.07 ? 122 ALA A C   1 
ATOM   966  O O   . ALA A 1 142 ? 33.617 28.222 9.594   1.00 11.65 ? 122 ALA A O   1 
ATOM   967  C CB  . ALA A 1 142 ? 31.155 30.334 8.284   1.00 12.02 ? 122 ALA A CB  1 
ATOM   968  N N   . TYR A 1 143 ? 31.476 27.621 9.306   1.00 13.66 ? 123 TYR A N   1 
ATOM   969  C CA  . TYR A 1 143 ? 31.787 26.198 9.331   1.00 14.71 ? 123 TYR A CA  1 
ATOM   970  C C   . TYR A 1 143 ? 32.272 25.556 8.029   1.00 15.18 ? 123 TYR A C   1 
ATOM   971  O O   . TYR A 1 143 ? 32.144 26.118 6.938   1.00 14.28 ? 123 TYR A O   1 
ATOM   972  C CB  . TYR A 1 143 ? 30.588 25.417 9.889   1.00 14.22 ? 123 TYR A CB  1 
ATOM   973  C CG  . TYR A 1 143 ? 30.111 25.897 11.250  1.00 15.50 ? 123 TYR A CG  1 
ATOM   974  C CD1 . TYR A 1 143 ? 29.144 26.898 11.363  1.00 14.34 ? 123 TYR A CD1 1 
ATOM   975  C CD2 . TYR A 1 143 ? 30.618 25.341 12.428  1.00 14.79 ? 123 TYR A CD2 1 
ATOM   976  C CE1 . TYR A 1 143 ? 28.691 27.327 12.609  1.00 17.57 ? 123 TYR A CE1 1 
ATOM   977  C CE2 . TYR A 1 143 ? 30.173 25.764 13.676  1.00 15.55 ? 123 TYR A CE2 1 
ATOM   978  C CZ  . TYR A 1 143 ? 29.207 26.754 13.760  1.00 17.02 ? 123 TYR A CZ  1 
ATOM   979  O OH  . TYR A 1 143 ? 28.744 27.153 14.991  1.00 17.34 ? 123 TYR A OH  1 
ATOM   980  N N   . ALA A 1 144 ? 32.817 24.352 8.177   1.00 13.79 ? 124 ALA A N   1 
ATOM   981  C CA  . ALA A 1 144 ? 33.380 23.572 7.083   1.00 14.53 ? 124 ALA A CA  1 
ATOM   982  C C   . ALA A 1 144 ? 32.458 23.316 5.902   1.00 15.53 ? 124 ALA A C   1 
ATOM   983  O O   . ALA A 1 144 ? 32.915 23.276 4.765   1.00 16.11 ? 124 ALA A O   1 
ATOM   984  C CB  . ALA A 1 144 ? 33.900 22.241 7.621   1.00 13.24 ? 124 ALA A CB  1 
ATOM   985  N N   . GLU A 1 145 ? 31.168 23.136 6.166   1.00 17.01 ? 125 GLU A N   1 
ATOM   986  C CA  . GLU A 1 145 ? 30.218 22.862 5.096   1.00 19.03 ? 125 GLU A CA  1 
ATOM   987  C C   . GLU A 1 145 ? 30.311 23.810 3.903   1.00 18.47 ? 125 GLU A C   1 
ATOM   988  O O   . GLU A 1 145 ? 30.159 23.382 2.758   1.00 20.03 ? 125 GLU A O   1 
ATOM   989  C CB  . GLU A 1 145 ? 28.789 22.857 5.638   1.00 21.66 ? 125 GLU A CB  1 
ATOM   990  C CG  . GLU A 1 145 ? 27.733 22.682 4.555   1.00 29.14 ? 125 GLU A CG  1 
ATOM   991  C CD  . GLU A 1 145 ? 26.377 22.326 5.116   1.00 32.83 ? 125 GLU A CD  1 
ATOM   992  O OE1 . GLU A 1 145 ? 25.949 22.975 6.091   1.00 38.36 ? 125 GLU A OE1 1 
ATOM   993  O OE2 . GLU A 1 145 ? 25.735 21.399 4.580   1.00 36.20 ? 125 GLU A OE2 1 
ATOM   994  N N   . ILE A 1 146 ? 30.572 25.090 4.150   1.00 15.96 ? 126 ILE A N   1 
ATOM   995  C CA  . ILE A 1 146 ? 30.659 26.031 3.039   1.00 16.55 ? 126 ILE A CA  1 
ATOM   996  C C   . ILE A 1 146 ? 32.077 26.382 2.587   1.00 17.60 ? 126 ILE A C   1 
ATOM   997  O O   . ILE A 1 146 ? 32.259 27.278 1.768   1.00 15.85 ? 126 ILE A O   1 
ATOM   998  C CB  . ILE A 1 146 ? 29.899 27.343 3.346   1.00 17.00 ? 126 ILE A CB  1 
ATOM   999  C CG1 . ILE A 1 146 ? 30.456 27.993 4.610   1.00 16.19 ? 126 ILE A CG1 1 
ATOM   1000 C CG2 . ILE A 1 146 ? 28.404 27.056 3.491   1.00 18.50 ? 126 ILE A CG2 1 
ATOM   1001 C CD1 . ILE A 1 146 ? 29.803 29.315 4.946   1.00 16.89 ? 126 ILE A CD1 1 
ATOM   1002 N N   . ALA A 1 147 ? 33.078 25.683 3.114   1.00 17.90 ? 127 ALA A N   1 
ATOM   1003 C CA  . ALA A 1 147 ? 34.459 25.940 2.720   1.00 17.96 ? 127 ALA A CA  1 
ATOM   1004 C C   . ALA A 1 147 ? 34.698 25.422 1.301   1.00 19.23 ? 127 ALA A C   1 
ATOM   1005 O O   . ALA A 1 147 ? 34.026 24.493 0.847   1.00 19.74 ? 127 ALA A O   1 
ATOM   1006 C CB  . ALA A 1 147 ? 35.421 25.258 3.699   1.00 17.34 ? 127 ALA A CB  1 
ATOM   1007 N N   . ARG A 1 148 ? 35.650 26.032 0.601   1.00 17.49 ? 128 ARG A N   1 
ATOM   1008 C CA  . ARG A 1 148 ? 35.989 25.630 -0.761  1.00 18.47 ? 128 ARG A CA  1 
ATOM   1009 C C   . ARG A 1 148 ? 37.415 25.098 -0.714  1.00 17.01 ? 128 ARG A C   1 
ATOM   1010 O O   . ARG A 1 148 ? 38.226 25.581 0.066   1.00 15.62 ? 128 ARG A O   1 
ATOM   1011 C CB  . ARG A 1 148 ? 35.927 26.838 -1.703  1.00 20.30 ? 128 ARG A CB  1 
ATOM   1012 C CG  . ARG A 1 148 ? 34.689 27.712 -1.523  1.00 24.35 ? 128 ARG A CG  1 
ATOM   1013 C CD  . ARG A 1 148 ? 33.624 27.451 -2.576  1.00 26.99 ? 128 ARG A CD  1 
ATOM   1014 N NE  . ARG A 1 148 ? 32.461 28.315 -2.371  1.00 28.47 ? 128 ARG A NE  1 
ATOM   1015 C CZ  . ARG A 1 148 ? 31.474 28.480 -3.248  1.00 30.36 ? 128 ARG A CZ  1 
ATOM   1016 N NH1 . ARG A 1 148 ? 31.494 27.842 -4.412  1.00 32.00 ? 128 ARG A NH1 1 
ATOM   1017 N NH2 . ARG A 1 148 ? 30.457 29.281 -2.959  1.00 29.30 ? 128 ARG A NH2 1 
ATOM   1018 N N   . PRO A 1 149 ? 37.748 24.099 -1.547  1.00 18.27 ? 129 PRO A N   1 
ATOM   1019 C CA  . PRO A 1 149 ? 36.953 23.383 -2.552  1.00 17.74 ? 129 PRO A CA  1 
ATOM   1020 C C   . PRO A 1 149 ? 35.756 22.621 -1.981  1.00 20.03 ? 129 PRO A C   1 
ATOM   1021 O O   . PRO A 1 149 ? 34.717 22.506 -2.635  1.00 21.96 ? 129 PRO A O   1 
ATOM   1022 C CB  . PRO A 1 149 ? 37.973 22.437 -3.187  1.00 18.53 ? 129 PRO A CB  1 
ATOM   1023 C CG  . PRO A 1 149 ? 39.270 23.177 -3.027  1.00 18.45 ? 129 PRO A CG  1 
ATOM   1024 C CD  . PRO A 1 149 ? 39.159 23.686 -1.616  1.00 18.46 ? 129 PRO A CD  1 
ATOM   1025 N N   . ASP A 1 150 ? 35.909 22.086 -0.775  1.00 20.08 ? 130 ASP A N   1 
ATOM   1026 C CA  . ASP A 1 150 ? 34.831 21.343 -0.131  1.00 22.15 ? 130 ASP A CA  1 
ATOM   1027 C C   . ASP A 1 150 ? 35.001 21.335 1.383   1.00 21.45 ? 130 ASP A C   1 
ATOM   1028 O O   . ASP A 1 150 ? 35.926 21.952 1.905   1.00 20.18 ? 130 ASP A O   1 
ATOM   1029 C CB  . ASP A 1 150 ? 34.779 19.916 -0.687  1.00 24.04 ? 130 ASP A CB  1 
ATOM   1030 C CG  . ASP A 1 150 ? 36.097 19.189 -0.558  1.00 25.73 ? 130 ASP A CG  1 
ATOM   1031 O OD1 . ASP A 1 150 ? 36.438 18.417 -1.478  1.00 29.87 ? 130 ASP A OD1 1 
ATOM   1032 O OD2 . ASP A 1 150 ? 36.789 19.376 0.460   1.00 25.40 ? 130 ASP A OD2 1 
ATOM   1033 N N   . ASP A 1 151 ? 34.114 20.636 2.091   1.00 20.93 ? 131 ASP A N   1 
ATOM   1034 C CA  . ASP A 1 151 ? 34.184 20.596 3.545   1.00 21.62 ? 131 ASP A CA  1 
ATOM   1035 C C   . ASP A 1 151 ? 35.355 19.829 4.143   1.00 21.58 ? 131 ASP A C   1 
ATOM   1036 O O   . ASP A 1 151 ? 35.462 19.728 5.364   1.00 22.09 ? 131 ASP A O   1 
ATOM   1037 C CB  . ASP A 1 151 ? 32.872 20.069 4.148   1.00 22.21 ? 131 ASP A CB  1 
ATOM   1038 C CG  . ASP A 1 151 ? 32.560 18.639 3.742   1.00 23.71 ? 131 ASP A CG  1 
ATOM   1039 O OD1 . ASP A 1 151 ? 33.468 17.923 3.274   1.00 24.91 ? 131 ASP A OD1 1 
ATOM   1040 O OD2 . ASP A 1 151 ? 31.394 18.227 3.912   1.00 24.67 ? 131 ASP A OD2 1 
ATOM   1041 N N   . SER A 1 152 ? 36.233 19.289 3.302   1.00 21.14 ? 132 SER A N   1 
ATOM   1042 C CA  . SER A 1 152 ? 37.395 18.570 3.815   1.00 20.16 ? 132 SER A CA  1 
ATOM   1043 C C   . SER A 1 152 ? 38.505 19.564 4.146   1.00 19.16 ? 132 SER A C   1 
ATOM   1044 O O   . SER A 1 152 ? 39.443 19.233 4.863   1.00 18.03 ? 132 SER A O   1 
ATOM   1045 C CB  . SER A 1 152 ? 37.909 17.542 2.798   1.00 22.96 ? 132 SER A CB  1 
ATOM   1046 O OG  . SER A 1 152 ? 38.461 18.170 1.652   1.00 26.02 ? 132 SER A OG  1 
ATOM   1047 N N   . LEU A 1 153 ? 38.408 20.782 3.615   1.00 18.64 ? 133 LEU A N   1 
ATOM   1048 C CA  . LEU A 1 153 ? 39.419 21.795 3.895   1.00 17.67 ? 133 LEU A CA  1 
ATOM   1049 C C   . LEU A 1 153 ? 39.039 22.458 5.213   1.00 17.05 ? 133 LEU A C   1 
ATOM   1050 O O   . LEU A 1 153 ? 38.223 23.378 5.252   1.00 15.90 ? 133 LEU A O   1 
ATOM   1051 C CB  . LEU A 1 153 ? 39.481 22.840 2.770   1.00 16.92 ? 133 LEU A CB  1 
ATOM   1052 C CG  . LEU A 1 153 ? 40.687 23.780 2.894   1.00 16.98 ? 133 LEU A CG  1 
ATOM   1053 C CD1 . LEU A 1 153 ? 41.947 23.030 2.476   1.00 15.85 ? 133 LEU A CD1 1 
ATOM   1054 C CD2 . LEU A 1 153 ? 40.498 25.014 2.036   1.00 17.71 ? 133 LEU A CD2 1 
ATOM   1055 N N   . GLU A 1 154 ? 39.639 21.969 6.293   1.00 16.67 ? 134 GLU A N   1 
ATOM   1056 C CA  . GLU A 1 154 ? 39.370 22.459 7.637   1.00 16.21 ? 134 GLU A CA  1 
ATOM   1057 C C   . GLU A 1 154 ? 39.575 23.959 7.826   1.00 15.37 ? 134 GLU A C   1 
ATOM   1058 O O   . GLU A 1 154 ? 40.649 24.493 7.541   1.00 15.32 ? 134 GLU A O   1 
ATOM   1059 C CB  . GLU A 1 154 ? 40.240 21.686 8.628   1.00 17.26 ? 134 GLU A CB  1 
ATOM   1060 C CG  . GLU A 1 154 ? 40.081 22.081 10.073  1.00 17.57 ? 134 GLU A CG  1 
ATOM   1061 C CD  . GLU A 1 154 ? 40.867 21.167 10.988  1.00 20.16 ? 134 GLU A CD  1 
ATOM   1062 O OE1 . GLU A 1 154 ? 40.324 20.119 11.391  1.00 21.76 ? 134 GLU A OE1 1 
ATOM   1063 O OE2 . GLU A 1 154 ? 42.035 21.486 11.286  1.00 19.77 ? 134 GLU A OE2 1 
ATOM   1064 N N   . PRO A 1 155 ? 38.536 24.662 8.303   1.00 14.03 ? 135 PRO A N   1 
ATOM   1065 C CA  . PRO A 1 155 ? 38.652 26.107 8.521   1.00 13.11 ? 135 PRO A CA  1 
ATOM   1066 C C   . PRO A 1 155 ? 39.617 26.401 9.668   1.00 14.13 ? 135 PRO A C   1 
ATOM   1067 O O   . PRO A 1 155 ? 39.923 25.526 10.482  1.00 12.19 ? 135 PRO A O   1 
ATOM   1068 C CB  . PRO A 1 155 ? 37.223 26.527 8.860   1.00 15.02 ? 135 PRO A CB  1 
ATOM   1069 C CG  . PRO A 1 155 ? 36.384 25.510 8.117   1.00 14.59 ? 135 PRO A CG  1 
ATOM   1070 C CD  . PRO A 1 155 ? 37.132 24.227 8.413   1.00 14.89 ? 135 PRO A CD  1 
ATOM   1071 N N   . PHE A 1 156 ? 40.077 27.643 9.733   1.00 13.53 ? 136 PHE A N   1 
ATOM   1072 C CA  . PHE A 1 156 ? 41.012 28.068 10.767  1.00 12.68 ? 136 PHE A CA  1 
ATOM   1073 C C   . PHE A 1 156 ? 40.566 27.810 12.204  1.00 13.12 ? 136 PHE A C   1 
ATOM   1074 O O   . PHE A 1 156 ? 41.318 27.242 12.996  1.00 11.91 ? 136 PHE A O   1 
ATOM   1075 C CB  . PHE A 1 156 ? 41.313 29.559 10.623  1.00 12.19 ? 136 PHE A CB  1 
ATOM   1076 C CG  . PHE A 1 156 ? 42.294 30.063 11.630  1.00 12.11 ? 136 PHE A CG  1 
ATOM   1077 C CD1 . PHE A 1 156 ? 43.654 29.822 11.473  1.00 15.02 ? 136 PHE A CD1 1 
ATOM   1078 C CD2 . PHE A 1 156 ? 41.855 30.726 12.772  1.00 14.25 ? 136 PHE A CD2 1 
ATOM   1079 C CE1 . PHE A 1 156 ? 44.566 30.231 12.443  1.00 14.06 ? 136 PHE A CE1 1 
ATOM   1080 C CE2 . PHE A 1 156 ? 42.761 31.137 13.748  1.00 16.16 ? 136 PHE A CE2 1 
ATOM   1081 C CZ  . PHE A 1 156 ? 44.117 30.887 13.580  1.00 14.60 ? 136 PHE A CZ  1 
ATOM   1082 N N   . PHE A 1 157 ? 39.357 28.238 12.557  1.00 11.46 ? 137 PHE A N   1 
ATOM   1083 C CA  . PHE A 1 157 ? 38.901 28.053 13.924  1.00 13.79 ? 137 PHE A CA  1 
ATOM   1084 C C   . PHE A 1 157 ? 38.806 26.586 14.305  1.00 13.62 ? 137 PHE A C   1 
ATOM   1085 O O   . PHE A 1 157 ? 39.065 26.228 15.452  1.00 12.85 ? 137 PHE A O   1 
ATOM   1086 C CB  . PHE A 1 157 ? 37.560 28.743 14.166  1.00 14.48 ? 137 PHE A CB  1 
ATOM   1087 C CG  . PHE A 1 157 ? 37.393 29.219 15.578  1.00 14.60 ? 137 PHE A CG  1 
ATOM   1088 C CD1 . PHE A 1 157 ? 37.992 30.405 15.997  1.00 13.95 ? 137 PHE A CD1 1 
ATOM   1089 C CD2 . PHE A 1 157 ? 36.693 28.455 16.510  1.00 14.32 ? 137 PHE A CD2 1 
ATOM   1090 C CE1 . PHE A 1 157 ? 37.901 30.821 17.318  1.00 14.70 ? 137 PHE A CE1 1 
ATOM   1091 C CE2 . PHE A 1 157 ? 36.595 28.863 17.838  1.00 15.19 ? 137 PHE A CE2 1 
ATOM   1092 C CZ  . PHE A 1 157 ? 37.202 30.049 18.245  1.00 15.35 ? 137 PHE A CZ  1 
ATOM   1093 N N   . ASP A 1 158 ? 38.432 25.739 13.349  1.00 12.16 ? 138 ASP A N   1 
ATOM   1094 C CA  . ASP A 1 158 ? 38.344 24.307 13.617  1.00 15.33 ? 138 ASP A CA  1 
ATOM   1095 C C   . ASP A 1 158 ? 39.738 23.800 13.985  1.00 15.15 ? 138 ASP A C   1 
ATOM   1096 O O   . ASP A 1 158 ? 39.893 23.012 14.915  1.00 16.00 ? 138 ASP A O   1 
ATOM   1097 C CB  . ASP A 1 158 ? 37.819 23.559 12.385  1.00 17.36 ? 138 ASP A CB  1 
ATOM   1098 C CG  . ASP A 1 158 ? 36.337 23.794 12.145  1.00 21.09 ? 138 ASP A CG  1 
ATOM   1099 O OD1 . ASP A 1 158 ? 35.559 22.822 12.229  1.00 25.39 ? 138 ASP A OD1 1 
ATOM   1100 O OD2 . ASP A 1 158 ? 35.946 24.946 11.876  1.00 21.20 ? 138 ASP A OD2 1 
ATOM   1101 N N   . SER A 1 159 ? 40.749 24.259 13.251  1.00 15.19 ? 139 SER A N   1 
ATOM   1102 C CA  . SER A 1 159 ? 42.133 23.860 13.511  1.00 16.38 ? 139 SER A CA  1 
ATOM   1103 C C   . SER A 1 159 ? 42.573 24.351 14.880  1.00 16.03 ? 139 SER A C   1 
ATOM   1104 O O   . SER A 1 159 ? 43.207 23.624 15.643  1.00 17.55 ? 139 SER A O   1 
ATOM   1105 C CB  . SER A 1 159 ? 43.070 24.440 12.441  1.00 13.80 ? 139 SER A CB  1 
ATOM   1106 O OG  . SER A 1 159 ? 42.779 23.909 11.165  1.00 15.03 ? 139 SER A OG  1 
ATOM   1107 N N   . LEU A 1 160 ? 42.235 25.596 15.188  1.00 15.56 ? 140 LEU A N   1 
ATOM   1108 C CA  . LEU A 1 160 ? 42.589 26.193 16.466  1.00 15.67 ? 140 LEU A CA  1 
ATOM   1109 C C   . LEU A 1 160 ? 42.087 25.349 17.643  1.00 16.13 ? 140 LEU A C   1 
ATOM   1110 O O   . LEU A 1 160 ? 42.843 25.024 18.562  1.00 14.21 ? 140 LEU A O   1 
ATOM   1111 C CB  . LEU A 1 160 ? 41.998 27.602 16.548  1.00 15.76 ? 140 LEU A CB  1 
ATOM   1112 C CG  . LEU A 1 160 ? 42.241 28.385 17.839  1.00 17.85 ? 140 LEU A CG  1 
ATOM   1113 C CD1 . LEU A 1 160 ? 43.737 28.645 18.007  1.00 16.75 ? 140 LEU A CD1 1 
ATOM   1114 C CD2 . LEU A 1 160 ? 41.460 29.699 17.788  1.00 15.40 ? 140 LEU A CD2 1 
ATOM   1115 N N   . VAL A 1 161 ? 40.807 24.996 17.603  1.00 16.03 ? 141 VAL A N   1 
ATOM   1116 C CA  . VAL A 1 161 ? 40.181 24.202 18.658  1.00 13.71 ? 141 VAL A CA  1 
ATOM   1117 C C   . VAL A 1 161 ? 40.710 22.770 18.747  1.00 15.76 ? 141 VAL A C   1 
ATOM   1118 O O   . VAL A 1 161 ? 40.880 22.235 19.844  1.00 16.38 ? 141 VAL A O   1 
ATOM   1119 C CB  . VAL A 1 161 ? 38.643 24.165 18.464  1.00 12.89 ? 141 VAL A CB  1 
ATOM   1120 C CG1 . VAL A 1 161 ? 38.000 23.174 19.431  1.00 14.03 ? 141 VAL A CG1 1 
ATOM   1121 C CG2 . VAL A 1 161 ? 38.071 25.564 18.677  1.00 9.70  ? 141 VAL A CG2 1 
ATOM   1122 N N   . LYS A 1 162 ? 40.963 22.145 17.603  1.00 17.08 ? 142 LYS A N   1 
ATOM   1123 C CA  . LYS A 1 162 ? 41.461 20.774 17.607  1.00 19.36 ? 142 LYS A CA  1 
ATOM   1124 C C   . LYS A 1 162 ? 42.930 20.644 17.985  1.00 18.62 ? 142 LYS A C   1 
ATOM   1125 O O   . LYS A 1 162 ? 43.327 19.671 18.624  1.00 18.47 ? 142 LYS A O   1 
ATOM   1126 C CB  . LYS A 1 162 ? 41.208 20.122 16.250  1.00 22.20 ? 142 LYS A CB  1 
ATOM   1127 C CG  . LYS A 1 162 ? 39.738 19.809 16.034  1.00 27.48 ? 142 LYS A CG  1 
ATOM   1128 C CD  . LYS A 1 162 ? 39.223 20.360 14.720  1.00 29.56 ? 142 LYS A CD  1 
ATOM   1129 C CE  . LYS A 1 162 ? 37.732 20.647 14.815  1.00 28.93 ? 142 LYS A CE  1 
ATOM   1130 N NZ  . LYS A 1 162 ? 37.451 21.647 15.882  1.00 26.38 ? 142 LYS A NZ  1 
ATOM   1131 N N   . GLN A 1 163 ? 43.738 21.623 17.601  1.00 17.67 ? 143 GLN A N   1 
ATOM   1132 C CA  . GLN A 1 163 ? 45.161 21.584 17.911  1.00 17.82 ? 143 GLN A CA  1 
ATOM   1133 C C   . GLN A 1 163 ? 45.523 22.173 19.272  1.00 17.15 ? 143 GLN A C   1 
ATOM   1134 O O   . GLN A 1 163 ? 46.605 21.908 19.804  1.00 16.86 ? 143 GLN A O   1 
ATOM   1135 C CB  . GLN A 1 163 ? 45.947 22.312 16.814  1.00 15.51 ? 143 GLN A CB  1 
ATOM   1136 C CG  . GLN A 1 163 ? 46.039 21.559 15.514  1.00 15.83 ? 143 GLN A CG  1 
ATOM   1137 C CD  . GLN A 1 163 ? 46.710 22.375 14.429  1.00 15.21 ? 143 GLN A CD  1 
ATOM   1138 O OE1 . GLN A 1 163 ? 47.745 23.003 14.660  1.00 13.27 ? 143 GLN A OE1 1 
ATOM   1139 N NE2 . GLN A 1 163 ? 46.126 22.370 13.238  1.00 11.92 ? 143 GLN A NE2 1 
ATOM   1140 N N   . THR A 1 164 ? 44.623 22.957 19.854  1.00 16.61 ? 144 THR A N   1 
ATOM   1141 C CA  . THR A 1 164 ? 44.921 23.581 21.134  1.00 15.36 ? 144 THR A CA  1 
ATOM   1142 C C   . THR A 1 164 ? 43.809 23.427 22.169  1.00 15.74 ? 144 THR A C   1 
ATOM   1143 O O   . THR A 1 164 ? 42.788 22.792 21.918  1.00 17.80 ? 144 THR A O   1 
ATOM   1144 C CB  . THR A 1 164 ? 45.197 25.094 20.955  1.00 15.86 ? 144 THR A CB  1 
ATOM   1145 O OG1 . THR A 1 164 ? 43.955 25.785 20.781  1.00 16.86 ? 144 THR A OG1 1 
ATOM   1146 C CG2 . THR A 1 164 ? 46.071 25.344 19.729  1.00 15.06 ? 144 THR A CG2 1 
ATOM   1147 N N   . HIS A 1 165 ? 44.038 24.036 23.326  1.00 13.32 ? 145 HIS A N   1 
ATOM   1148 C CA  . HIS A 1 165 ? 43.117 24.036 24.462  1.00 15.29 ? 145 HIS A CA  1 
ATOM   1149 C C   . HIS A 1 165 ? 42.056 25.136 24.344  1.00 14.91 ? 145 HIS A C   1 
ATOM   1150 O O   . HIS A 1 165 ? 41.121 25.182 25.149  1.00 12.76 ? 145 HIS A O   1 
ATOM   1151 C CB  . HIS A 1 165 ? 43.899 24.307 25.748  1.00 15.43 ? 145 HIS A CB  1 
ATOM   1152 C CG  . HIS A 1 165 ? 44.423 25.708 25.826  1.00 16.06 ? 145 HIS A CG  1 
ATOM   1153 N ND1 . HIS A 1 165 ? 45.511 26.137 25.097  1.00 18.28 ? 145 HIS A ND1 1 
ATOM   1154 C CD2 . HIS A 1 165 ? 43.937 26.805 26.453  1.00 17.15 ? 145 HIS A CD2 1 
ATOM   1155 C CE1 . HIS A 1 165 ? 45.670 27.437 25.267  1.00 16.54 ? 145 HIS A CE1 1 
ATOM   1156 N NE2 . HIS A 1 165 ? 44.726 27.866 26.084  1.00 18.25 ? 145 HIS A NE2 1 
ATOM   1157 N N   . VAL A 1 166 ? 42.224 26.041 23.380  1.00 14.46 ? 146 VAL A N   1 
ATOM   1158 C CA  . VAL A 1 166 ? 41.293 27.154 23.205  1.00 13.64 ? 146 VAL A CA  1 
ATOM   1159 C C   . VAL A 1 166 ? 39.841 26.706 23.107  1.00 12.52 ? 146 VAL A C   1 
ATOM   1160 O O   . VAL A 1 166 ? 39.488 25.903 22.250  1.00 12.57 ? 146 VAL A O   1 
ATOM   1161 C CB  . VAL A 1 166 ? 41.622 27.991 21.943  1.00 15.01 ? 146 VAL A CB  1 
ATOM   1162 C CG1 . VAL A 1 166 ? 40.682 29.185 21.866  1.00 14.57 ? 146 VAL A CG1 1 
ATOM   1163 C CG2 . VAL A 1 166 ? 43.070 28.472 21.982  1.00 16.02 ? 146 VAL A CG2 1 
ATOM   1164 N N   . PRO A 1 167 ? 38.980 27.221 23.997  1.00 13.00 ? 147 PRO A N   1 
ATOM   1165 C CA  . PRO A 1 167 ? 37.559 26.864 23.998  1.00 13.83 ? 147 PRO A CA  1 
ATOM   1166 C C   . PRO A 1 167 ? 36.921 27.183 22.646  1.00 15.26 ? 147 PRO A C   1 
ATOM   1167 O O   . PRO A 1 167 ? 37.302 28.149 21.981  1.00 16.04 ? 147 PRO A O   1 
ATOM   1168 C CB  . PRO A 1 167 ? 36.993 27.714 25.134  1.00 13.97 ? 147 PRO A CB  1 
ATOM   1169 C CG  . PRO A 1 167 ? 38.152 27.783 26.099  1.00 14.71 ? 147 PRO A CG  1 
ATOM   1170 C CD  . PRO A 1 167 ? 39.313 28.060 25.163  1.00 12.25 ? 147 PRO A CD  1 
ATOM   1171 N N   . ASN A 1 168 ? 35.953 26.364 22.247  1.00 13.87 ? 148 ASN A N   1 
ATOM   1172 C CA  . ASN A 1 168 ? 35.274 26.536 20.970  1.00 16.28 ? 148 ASN A CA  1 
ATOM   1173 C C   . ASN A 1 168 ? 34.258 27.676 21.054  1.00 16.41 ? 148 ASN A C   1 
ATOM   1174 O O   . ASN A 1 168 ? 33.049 27.458 21.038  1.00 15.91 ? 148 ASN A O   1 
ATOM   1175 C CB  . ASN A 1 168 ? 34.594 25.217 20.573  1.00 15.07 ? 148 ASN A CB  1 
ATOM   1176 C CG  . ASN A 1 168 ? 34.064 25.225 19.151  1.00 16.25 ? 148 ASN A CG  1 
ATOM   1177 O OD1 . ASN A 1 168 ? 34.491 26.023 18.316  1.00 15.73 ? 148 ASN A OD1 1 
ATOM   1178 N ND2 . ASN A 1 168 ? 33.141 24.313 18.862  1.00 14.25 ? 148 ASN A ND2 1 
ATOM   1179 N N   . LEU A 1 169 ? 34.773 28.899 21.134  1.00 15.64 ? 149 LEU A N   1 
ATOM   1180 C CA  . LEU A 1 169 ? 33.934 30.080 21.227  1.00 15.44 ? 149 LEU A CA  1 
ATOM   1181 C C   . LEU A 1 169 ? 34.738 31.352 20.978  1.00 14.98 ? 149 LEU A C   1 
ATOM   1182 O O   . LEU A 1 169 ? 35.904 31.454 21.366  1.00 12.63 ? 149 LEU A O   1 
ATOM   1183 C CB  . LEU A 1 169 ? 33.292 30.140 22.622  1.00 16.90 ? 149 LEU A CB  1 
ATOM   1184 C CG  . LEU A 1 169 ? 32.459 31.347 23.085  1.00 18.69 ? 149 LEU A CG  1 
ATOM   1185 C CD1 . LEU A 1 169 ? 31.611 30.947 24.299  1.00 17.08 ? 149 LEU A CD1 1 
ATOM   1186 C CD2 . LEU A 1 169 ? 33.367 32.517 23.448  1.00 18.88 ? 149 LEU A CD2 1 
ATOM   1187 N N   . PHE A 1 170 ? 34.129 32.304 20.286  1.00 12.00 ? 150 PHE A N   1 
ATOM   1188 C CA  . PHE A 1 170 ? 34.768 33.591 20.078  1.00 13.92 ? 150 PHE A CA  1 
ATOM   1189 C C   . PHE A 1 170 ? 33.661 34.632 20.144  1.00 14.89 ? 150 PHE A C   1 
ATOM   1190 O O   . PHE A 1 170 ? 32.481 34.305 19.987  1.00 14.65 ? 150 PHE A O   1 
ATOM   1191 C CB  . PHE A 1 170 ? 35.543 33.670 18.744  1.00 12.45 ? 150 PHE A CB  1 
ATOM   1192 C CG  . PHE A 1 170 ? 34.684 33.596 17.510  1.00 13.96 ? 150 PHE A CG  1 
ATOM   1193 C CD1 . PHE A 1 170 ? 34.380 32.371 16.928  1.00 12.25 ? 150 PHE A CD1 1 
ATOM   1194 C CD2 . PHE A 1 170 ? 34.197 34.756 16.919  1.00 11.10 ? 150 PHE A CD2 1 
ATOM   1195 C CE1 . PHE A 1 170 ? 33.605 32.299 15.775  1.00 13.64 ? 150 PHE A CE1 1 
ATOM   1196 C CE2 . PHE A 1 170 ? 33.417 34.697 15.764  1.00 14.14 ? 150 PHE A CE2 1 
ATOM   1197 C CZ  . PHE A 1 170 ? 33.122 33.469 15.191  1.00 12.76 ? 150 PHE A CZ  1 
ATOM   1198 N N   . SER A 1 171 ? 34.029 35.878 20.413  1.00 14.55 ? 151 SER A N   1 
ATOM   1199 C CA  . SER A 1 171 ? 33.038 36.939 20.499  1.00 14.60 ? 151 SER A CA  1 
ATOM   1200 C C   . SER A 1 171 ? 33.540 38.186 19.784  1.00 14.94 ? 151 SER A C   1 
ATOM   1201 O O   . SER A 1 171 ? 34.736 38.475 19.793  1.00 14.77 ? 151 SER A O   1 
ATOM   1202 C CB  . SER A 1 171 ? 32.712 37.236 21.966  1.00 15.04 ? 151 SER A CB  1 
ATOM   1203 O OG  . SER A 1 171 ? 33.886 37.413 22.742  1.00 13.18 ? 151 SER A OG  1 
ATOM   1204 N N   . LEU A 1 172 ? 32.620 38.914 19.159  1.00 13.50 ? 152 LEU A N   1 
ATOM   1205 C CA  . LEU A 1 172 ? 32.972 40.114 18.413  1.00 14.15 ? 152 LEU A CA  1 
ATOM   1206 C C   . LEU A 1 172 ? 32.269 41.382 18.872  1.00 13.88 ? 152 LEU A C   1 
ATOM   1207 O O   . LEU A 1 172 ? 31.054 41.404 19.059  1.00 12.95 ? 152 LEU A O   1 
ATOM   1208 C CB  . LEU A 1 172 ? 32.668 39.914 16.926  1.00 14.39 ? 152 LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 172 ? 33.480 38.891 16.133  1.00 14.32 ? 152 LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 172 ? 32.839 38.682 14.774  1.00 15.60 ? 152 LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 172 ? 34.923 39.379 15.980  1.00 16.50 ? 152 LEU A CD2 1 
ATOM   1212 N N   . GLN A 1 173 ? 33.057 42.431 19.061  1.00 13.98 ? 153 GLN A N   1 
ATOM   1213 C CA  . GLN A 1 173 ? 32.533 43.740 19.423  1.00 14.11 ? 153 GLN A CA  1 
ATOM   1214 C C   . GLN A 1 173 ? 33.037 44.627 18.291  1.00 14.34 ? 153 GLN A C   1 
ATOM   1215 O O   . GLN A 1 173 ? 34.214 44.979 18.259  1.00 15.81 ? 153 GLN A O   1 
ATOM   1216 C CB  . GLN A 1 173 ? 33.109 44.249 20.748  1.00 14.77 ? 153 GLN A CB  1 
ATOM   1217 C CG  . GLN A 1 173 ? 32.452 45.555 21.197  1.00 15.13 ? 153 GLN A CG  1 
ATOM   1218 C CD  . GLN A 1 173 ? 33.305 46.360 22.154  1.00 17.06 ? 153 GLN A CD  1 
ATOM   1219 O OE1 . GLN A 1 173 ? 34.500 46.538 21.934  1.00 18.08 ? 153 GLN A OE1 1 
ATOM   1220 N NE2 . GLN A 1 173 ? 32.688 46.866 23.214  1.00 16.91 ? 153 GLN A NE2 1 
ATOM   1221 N N   . LEU A 1 174 ? 32.162 44.956 17.348  1.00 14.60 ? 154 LEU A N   1 
ATOM   1222 C CA  . LEU A 1 174 ? 32.544 45.796 16.219  1.00 14.95 ? 154 LEU A CA  1 
ATOM   1223 C C   . LEU A 1 174 ? 32.097 47.209 16.550  1.00 17.37 ? 154 LEU A C   1 
ATOM   1224 O O   . LEU A 1 174 ? 30.905 47.467 16.704  1.00 16.94 ? 154 LEU A O   1 
ATOM   1225 C CB  . LEU A 1 174 ? 31.864 45.310 14.931  1.00 15.39 ? 154 LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 174 ? 32.044 43.831 14.549  1.00 14.95 ? 154 LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 174 ? 31.400 43.585 13.197  1.00 16.52 ? 154 LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 174 ? 33.522 43.459 14.513  1.00 15.22 ? 154 LEU A CD2 1 
ATOM   1229 N N   . CYS A 1 175 ? 33.057 48.121 16.658  1.00 17.95 ? 155 CYS A N   1 
ATOM   1230 C CA  . CYS A 1 175 ? 32.756 49.500 17.012  1.00 20.12 ? 155 CYS A CA  1 
ATOM   1231 C C   . CYS A 1 175 ? 32.780 50.409 15.792  1.00 20.57 ? 155 CYS A C   1 
ATOM   1232 O O   . CYS A 1 175 ? 33.842 50.717 15.254  1.00 22.73 ? 155 CYS A O   1 
ATOM   1233 C CB  . CYS A 1 175 ? 33.758 49.991 18.064  1.00 19.39 ? 155 CYS A CB  1 
ATOM   1234 S SG  . CYS A 1 175 ? 33.866 48.908 19.529  1.00 21.06 ? 155 CYS A SG  1 
ATOM   1235 N N   . GLY A 1 176 ? 31.599 50.835 15.363  1.00 21.86 ? 156 GLY A N   1 
ATOM   1236 C CA  . GLY A 1 176 ? 31.503 51.699 14.204  1.00 23.13 ? 156 GLY A CA  1 
ATOM   1237 C C   . GLY A 1 176 ? 31.725 53.168 14.508  1.00 25.46 ? 156 GLY A C   1 
ATOM   1238 O O   . GLY A 1 176 ? 32.171 53.537 15.597  1.00 22.42 ? 156 GLY A O   1 
ATOM   1239 N N   . ALA A 1 177 ? 31.415 54.011 13.530  1.00 27.38 ? 157 ALA A N   1 
ATOM   1240 C CA  . ALA A 1 177 ? 31.580 55.451 13.668  1.00 31.18 ? 157 ALA A CA  1 
ATOM   1241 C C   . ALA A 1 177 ? 30.224 56.129 13.793  1.00 33.02 ? 157 ALA A C   1 
ATOM   1242 O O   . ALA A 1 177 ? 30.067 56.971 14.704  1.00 35.34 ? 157 ALA A O   1 
ATOM   1243 C CB  . ALA A 1 177 ? 32.335 56.004 12.465  1.00 31.48 ? 157 ALA A CB  1 
ATOM   1244 N N   . GLY A 1 191 ? 38.941 49.795 16.465  1.00 25.69 ? 171 GLY A N   1 
ATOM   1245 C CA  . GLY A 1 191 ? 37.804 49.273 15.656  1.00 21.88 ? 171 GLY A CA  1 
ATOM   1246 C C   . GLY A 1 191 ? 36.952 48.255 16.391  1.00 20.58 ? 171 GLY A C   1 
ATOM   1247 O O   . GLY A 1 191 ? 35.827 47.972 15.985  1.00 22.37 ? 171 GLY A O   1 
ATOM   1248 N N   . GLY A 1 192 ? 37.477 47.692 17.469  1.00 18.32 ? 172 GLY A N   1 
ATOM   1249 C CA  . GLY A 1 192 ? 36.703 46.713 18.204  1.00 15.05 ? 172 GLY A CA  1 
ATOM   1250 C C   . GLY A 1 192 ? 37.539 45.611 18.821  1.00 15.65 ? 172 GLY A C   1 
ATOM   1251 O O   . GLY A 1 192 ? 38.771 45.679 18.836  1.00 13.54 ? 172 GLY A O   1 
ATOM   1252 N N   . SER A 1 193 ? 36.857 44.586 19.323  1.00 12.44 ? 173 SER A N   1 
ATOM   1253 C CA  . SER A 1 193 ? 37.526 43.468 19.964  1.00 14.07 ? 173 SER A CA  1 
ATOM   1254 C C   . SER A 1 193 ? 37.022 42.118 19.480  1.00 14.02 ? 173 SER A C   1 
ATOM   1255 O O   . SER A 1 193 ? 35.826 41.924 19.272  1.00 13.73 ? 173 SER A O   1 
ATOM   1256 C CB  . SER A 1 193 ? 37.314 43.514 21.483  1.00 14.16 ? 173 SER A CB  1 
ATOM   1257 O OG  . SER A 1 193 ? 37.734 44.732 22.064  1.00 13.40 ? 173 SER A OG  1 
ATOM   1258 N N   . MET A 1 194 ? 37.951 41.191 19.292  1.00 13.53 ? 174 MET A N   1 
ATOM   1259 C CA  . MET A 1 194 ? 37.598 39.830 18.933  1.00 13.45 ? 174 MET A CA  1 
ATOM   1260 C C   . MET A 1 194 ? 38.201 39.012 20.069  1.00 13.05 ? 174 MET A C   1 
ATOM   1261 O O   . MET A 1 194 ? 39.419 38.848 20.142  1.00 12.54 ? 174 MET A O   1 
ATOM   1262 C CB  . MET A 1 194 ? 38.215 39.391 17.604  1.00 13.38 ? 174 MET A CB  1 
ATOM   1263 C CG  . MET A 1 194 ? 37.966 37.915 17.327  1.00 16.83 ? 174 MET A CG  1 
ATOM   1264 S SD  . MET A 1 194 ? 38.446 37.337 15.698  1.00 17.84 ? 174 MET A SD  1 
ATOM   1265 C CE  . MET A 1 194 ? 40.217 37.601 15.756  1.00 22.84 ? 174 MET A CE  1 
ATOM   1266 N N   . ILE A 1 195 ? 37.357 38.537 20.978  1.00 11.44 ? 175 ILE A N   1 
ATOM   1267 C CA  . ILE A 1 195 ? 37.842 37.736 22.096  1.00 13.11 ? 175 ILE A CA  1 
ATOM   1268 C C   . ILE A 1 195 ? 37.771 36.282 21.655  1.00 13.78 ? 175 ILE A C   1 
ATOM   1269 O O   . ILE A 1 195 ? 36.702 35.785 21.310  1.00 15.34 ? 175 ILE A O   1 
ATOM   1270 C CB  . ILE A 1 195 ? 36.982 37.927 23.370  1.00 13.25 ? 175 ILE A CB  1 
ATOM   1271 C CG1 . ILE A 1 195 ? 36.831 39.421 23.694  1.00 13.25 ? 175 ILE A CG1 1 
ATOM   1272 C CG2 . ILE A 1 195 ? 37.633 37.203 24.543  1.00 14.42 ? 175 ILE A CG2 1 
ATOM   1273 C CD1 . ILE A 1 195 ? 38.139 40.179 23.821  1.00 14.93 ? 175 ILE A CD1 1 
ATOM   1274 N N   . ILE A 1 196 ? 38.916 35.610 21.661  1.00 15.42 ? 176 ILE A N   1 
ATOM   1275 C CA  . ILE A 1 196 ? 39.000 34.218 21.225  1.00 14.05 ? 176 ILE A CA  1 
ATOM   1276 C C   . ILE A 1 196 ? 39.165 33.263 22.404  1.00 14.47 ? 176 ILE A C   1 
ATOM   1277 O O   . ILE A 1 196 ? 40.138 33.344 23.163  1.00 11.69 ? 176 ILE A O   1 
ATOM   1278 C CB  . ILE A 1 196 ? 40.174 34.044 20.223  1.00 14.23 ? 176 ILE A CB  1 
ATOM   1279 C CG1 . ILE A 1 196 ? 39.928 34.934 18.997  1.00 16.54 ? 176 ILE A CG1 1 
ATOM   1280 C CG2 . ILE A 1 196 ? 40.306 32.585 19.799  1.00 11.72 ? 176 ILE A CG2 1 
ATOM   1281 C CD1 . ILE A 1 196 ? 41.048 34.928 17.968  1.00 17.40 ? 176 ILE A CD1 1 
ATOM   1282 N N   . GLY A 1 197 ? 38.196 32.364 22.550  1.00 14.12 ? 177 GLY A N   1 
ATOM   1283 C CA  . GLY A 1 197 ? 38.219 31.402 23.633  1.00 15.39 ? 177 GLY A CA  1 
ATOM   1284 C C   . GLY A 1 197 ? 37.374 31.826 24.823  1.00 15.94 ? 177 GLY A C   1 
ATOM   1285 O O   . GLY A 1 197 ? 37.285 31.107 25.817  1.00 15.34 ? 177 GLY A O   1 
ATOM   1286 N N   . GLY A 1 198 ? 36.749 32.994 24.730  1.00 15.45 ? 178 GLY A N   1 
ATOM   1287 C CA  . GLY A 1 198 ? 35.937 33.453 25.834  1.00 16.35 ? 178 GLY A CA  1 
ATOM   1288 C C   . GLY A 1 198 ? 35.229 34.772 25.623  1.00 17.51 ? 178 GLY A C   1 
ATOM   1289 O O   . GLY A 1 198 ? 35.083 35.255 24.496  1.00 17.37 ? 178 GLY A O   1 
ATOM   1290 N N   . ILE A 1 199 ? 34.805 35.353 26.740  1.00 17.95 ? 179 ILE A N   1 
ATOM   1291 C CA  . ILE A 1 199 ? 34.072 36.611 26.759  1.00 20.74 ? 179 ILE A CA  1 
ATOM   1292 C C   . ILE A 1 199 ? 34.729 37.603 27.722  1.00 20.46 ? 179 ILE A C   1 
ATOM   1293 O O   . ILE A 1 199 ? 35.321 37.205 28.726  1.00 21.42 ? 179 ILE A O   1 
ATOM   1294 C CB  . ILE A 1 199 ? 32.612 36.347 27.219  1.00 22.72 ? 179 ILE A CB  1 
ATOM   1295 C CG1 . ILE A 1 199 ? 31.879 35.518 26.161  1.00 22.56 ? 179 ILE A CG1 1 
ATOM   1296 C CG2 . ILE A 1 199 ? 31.878 37.654 27.488  1.00 26.90 ? 179 ILE A CG2 1 
ATOM   1297 C CD1 . ILE A 1 199 ? 30.532 34.996 26.630  1.00 23.96 ? 179 ILE A CD1 1 
ATOM   1298 N N   . ASP A 1 200 ? 34.646 38.889 27.400  1.00 20.34 ? 180 ASP A N   1 
ATOM   1299 C CA  . ASP A 1 200 ? 35.186 39.937 28.261  1.00 20.19 ? 180 ASP A CA  1 
ATOM   1300 C C   . ASP A 1 200 ? 33.979 40.802 28.623  1.00 20.92 ? 180 ASP A C   1 
ATOM   1301 O O   . ASP A 1 200 ? 33.363 41.417 27.748  1.00 19.78 ? 180 ASP A O   1 
ATOM   1302 C CB  . ASP A 1 200 ? 36.225 40.772 27.516  1.00 18.86 ? 180 ASP A CB  1 
ATOM   1303 C CG  . ASP A 1 200 ? 36.870 41.814 28.402  1.00 21.42 ? 180 ASP A CG  1 
ATOM   1304 O OD1 . ASP A 1 200 ? 38.002 41.584 28.881  1.00 17.85 ? 180 ASP A OD1 1 
ATOM   1305 O OD2 . ASP A 1 200 ? 36.235 42.863 28.629  1.00 21.16 ? 180 ASP A OD2 1 
ATOM   1306 N N   . HIS A 1 201 ? 33.647 40.841 29.912  1.00 22.62 ? 181 HIS A N   1 
ATOM   1307 C CA  . HIS A 1 201 ? 32.486 41.580 30.406  1.00 24.23 ? 181 HIS A CA  1 
ATOM   1308 C C   . HIS A 1 201 ? 32.499 43.102 30.280  1.00 24.14 ? 181 HIS A C   1 
ATOM   1309 O O   . HIS A 1 201 ? 31.462 43.744 30.453  1.00 25.55 ? 181 HIS A O   1 
ATOM   1310 C CB  . HIS A 1 201 ? 32.218 41.186 31.864  1.00 25.45 ? 181 HIS A CB  1 
ATOM   1311 C CG  . HIS A 1 201 ? 32.011 39.715 32.055  1.00 26.83 ? 181 HIS A CG  1 
ATOM   1312 N ND1 . HIS A 1 201 ? 31.005 39.018 31.421  1.00 27.39 ? 181 HIS A ND1 1 
ATOM   1313 C CD2 . HIS A 1 201 ? 32.712 38.799 32.765  1.00 27.80 ? 181 HIS A CD2 1 
ATOM   1314 C CE1 . HIS A 1 201 ? 31.096 37.737 31.729  1.00 27.53 ? 181 HIS A CE1 1 
ATOM   1315 N NE2 . HIS A 1 201 ? 32.124 37.577 32.543  1.00 28.23 ? 181 HIS A NE2 1 
ATOM   1316 N N   . SER A 1 202 ? 33.651 43.686 29.968  1.00 23.71 ? 182 SER A N   1 
ATOM   1317 C CA  . SER A 1 202 ? 33.739 45.138 29.818  1.00 22.63 ? 182 SER A CA  1 
ATOM   1318 C C   . SER A 1 202 ? 33.248 45.598 28.445  1.00 23.10 ? 182 SER A C   1 
ATOM   1319 O O   . SER A 1 202 ? 33.084 46.796 28.207  1.00 22.27 ? 182 SER A O   1 
ATOM   1320 C CB  . SER A 1 202 ? 35.183 45.607 29.991  1.00 22.62 ? 182 SER A CB  1 
ATOM   1321 O OG  . SER A 1 202 ? 35.948 45.278 28.842  1.00 20.10 ? 182 SER A OG  1 
ATOM   1322 N N   . LEU A 1 203 ? 33.018 44.647 27.544  1.00 20.11 ? 183 LEU A N   1 
ATOM   1323 C CA  . LEU A 1 203 ? 32.580 44.963 26.193  1.00 19.14 ? 183 LEU A CA  1 
ATOM   1324 C C   . LEU A 1 203 ? 31.071 45.123 26.024  1.00 18.26 ? 183 LEU A C   1 
ATOM   1325 O O   . LEU A 1 203 ? 30.608 45.524 24.959  1.00 16.92 ? 183 LEU A O   1 
ATOM   1326 C CB  . LEU A 1 203 ? 33.096 43.893 25.223  1.00 18.94 ? 183 LEU A CB  1 
ATOM   1327 C CG  . LEU A 1 203 ? 34.617 43.698 25.204  1.00 19.20 ? 183 LEU A CG  1 
ATOM   1328 C CD1 . LEU A 1 203 ? 34.981 42.598 24.224  1.00 16.30 ? 183 LEU A CD1 1 
ATOM   1329 C CD2 . LEU A 1 203 ? 35.304 45.003 24.814  1.00 20.26 ? 183 LEU A CD2 1 
ATOM   1330 N N   . TYR A 1 204 ? 30.303 44.824 27.066  1.00 18.70 ? 184 TYR A N   1 
ATOM   1331 C CA  . TYR A 1 204 ? 28.854 44.949 26.967  1.00 18.79 ? 184 TYR A CA  1 
ATOM   1332 C C   . TYR A 1 204 ? 28.200 45.352 28.281  1.00 18.29 ? 184 TYR A C   1 
ATOM   1333 O O   . TYR A 1 204 ? 28.811 45.284 29.348  1.00 19.25 ? 184 TYR A O   1 
ATOM   1334 C CB  . TYR A 1 204 ? 28.236 43.632 26.494  1.00 17.62 ? 184 TYR A CB  1 
ATOM   1335 C CG  . TYR A 1 204 ? 28.313 42.510 27.511  1.00 19.83 ? 184 TYR A CG  1 
ATOM   1336 C CD1 . TYR A 1 204 ? 29.462 41.727 27.639  1.00 20.49 ? 184 TYR A CD1 1 
ATOM   1337 C CD2 . TYR A 1 204 ? 27.233 42.233 28.350  1.00 19.20 ? 184 TYR A CD2 1 
ATOM   1338 C CE1 . TYR A 1 204 ? 29.531 40.696 28.570  1.00 19.02 ? 184 TYR A CE1 1 
ATOM   1339 C CE2 . TYR A 1 204 ? 27.293 41.208 29.286  1.00 19.80 ? 184 TYR A CE2 1 
ATOM   1340 C CZ  . TYR A 1 204 ? 28.444 40.443 29.388  1.00 19.61 ? 184 TYR A CZ  1 
ATOM   1341 O OH  . TYR A 1 204 ? 28.496 39.424 30.310  1.00 20.56 ? 184 TYR A OH  1 
ATOM   1342 N N   . THR A 1 205 ? 26.949 45.782 28.188  1.00 17.25 ? 185 THR A N   1 
ATOM   1343 C CA  . THR A 1 205 ? 26.183 46.170 29.358  1.00 19.08 ? 185 THR A CA  1 
ATOM   1344 C C   . THR A 1 205 ? 24.908 45.337 29.322  1.00 19.72 ? 185 THR A C   1 
ATOM   1345 O O   . THR A 1 205 ? 24.526 44.823 28.266  1.00 18.67 ? 185 THR A O   1 
ATOM   1346 C CB  . THR A 1 205 ? 25.825 47.675 29.334  1.00 18.72 ? 185 THR A CB  1 
ATOM   1347 O OG1 . THR A 1 205 ? 24.989 47.951 28.210  1.00 17.71 ? 185 THR A OG1 1 
ATOM   1348 C CG2 . THR A 1 205 ? 27.089 48.530 29.236  1.00 19.21 ? 185 THR A CG2 1 
ATOM   1349 N N   . GLY A 1 206 ? 24.260 45.186 30.471  1.00 18.72 ? 186 GLY A N   1 
ATOM   1350 C CA  . GLY A 1 206 ? 23.037 44.408 30.515  1.00 19.08 ? 186 GLY A CA  1 
ATOM   1351 C C   . GLY A 1 206 ? 23.282 42.915 30.430  1.00 18.58 ? 186 GLY A C   1 
ATOM   1352 O O   . GLY A 1 206 ? 24.368 42.435 30.742  1.00 18.84 ? 186 GLY A O   1 
ATOM   1353 N N   . SER A 1 207 ? 22.266 42.175 30.002  1.00 18.45 ? 187 SER A N   1 
ATOM   1354 C CA  . SER A 1 207 ? 22.370 40.727 29.901  1.00 19.89 ? 187 SER A CA  1 
ATOM   1355 C C   . SER A 1 207 ? 22.616 40.234 28.484  1.00 19.23 ? 187 SER A C   1 
ATOM   1356 O O   . SER A 1 207 ? 22.300 40.910 27.500  1.00 17.62 ? 187 SER A O   1 
ATOM   1357 C CB  . SER A 1 207 ? 21.087 40.070 30.419  1.00 21.72 ? 187 SER A CB  1 
ATOM   1358 O OG  . SER A 1 207 ? 20.710 40.588 31.680  1.00 26.04 ? 187 SER A OG  1 
ATOM   1359 N N   . LEU A 1 208 ? 23.190 39.042 28.399  1.00 17.38 ? 188 LEU A N   1 
ATOM   1360 C CA  . LEU A 1 208 ? 23.446 38.395 27.128  1.00 16.44 ? 188 LEU A CA  1 
ATOM   1361 C C   . LEU A 1 208 ? 22.244 37.498 26.868  1.00 16.59 ? 188 LEU A C   1 
ATOM   1362 O O   . LEU A 1 208 ? 21.832 36.739 27.749  1.00 17.51 ? 188 LEU A O   1 
ATOM   1363 C CB  . LEU A 1 208 ? 24.714 37.541 27.207  1.00 17.38 ? 188 LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 208 ? 26.024 38.193 26.757  1.00 18.23 ? 188 LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 208 ? 27.216 37.334 27.185  1.00 20.67 ? 188 LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 208 ? 26.001 38.381 25.251  1.00 18.13 ? 188 LEU A CD2 1 
ATOM   1367 N N   . TRP A 1 209 ? 21.669 37.611 25.675  1.00 15.68 ? 189 TRP A N   1 
ATOM   1368 C CA  . TRP A 1 209 ? 20.525 36.795 25.276  1.00 13.23 ? 189 TRP A CA  1 
ATOM   1369 C C   . TRP A 1 209 ? 20.962 35.927 24.113  1.00 12.68 ? 189 TRP A C   1 
ATOM   1370 O O   . TRP A 1 209 ? 21.573 36.423 23.162  1.00 12.11 ? 189 TRP A O   1 
ATOM   1371 C CB  . TRP A 1 209 ? 19.354 37.675 24.850  1.00 13.78 ? 189 TRP A CB  1 
ATOM   1372 C CG  . TRP A 1 209 ? 18.665 38.328 26.005  1.00 13.42 ? 189 TRP A CG  1 
ATOM   1373 C CD1 . TRP A 1 209 ? 18.990 39.511 26.595  1.00 14.83 ? 189 TRP A CD1 1 
ATOM   1374 C CD2 . TRP A 1 209 ? 17.542 37.813 26.722  1.00 13.24 ? 189 TRP A CD2 1 
ATOM   1375 N NE1 . TRP A 1 209 ? 18.132 39.771 27.640  1.00 15.63 ? 189 TRP A NE1 1 
ATOM   1376 C CE2 . TRP A 1 209 ? 17.234 38.743 27.739  1.00 14.72 ? 189 TRP A CE2 1 
ATOM   1377 C CE3 . TRP A 1 209 ? 16.764 36.652 26.605  1.00 15.69 ? 189 TRP A CE3 1 
ATOM   1378 C CZ2 . TRP A 1 209 ? 16.179 38.551 28.632  1.00 15.58 ? 189 TRP A CZ2 1 
ATOM   1379 C CZ3 . TRP A 1 209 ? 15.715 36.459 27.497  1.00 12.48 ? 189 TRP A CZ3 1 
ATOM   1380 C CH2 . TRP A 1 209 ? 15.433 37.406 28.497  1.00 14.33 ? 189 TRP A CH2 1 
ATOM   1381 N N   . TYR A 1 210 ? 20.633 34.639 24.175  1.00 11.63 ? 190 TYR A N   1 
ATOM   1382 C CA  . TYR A 1 210 ? 21.046 33.713 23.132  1.00 12.49 ? 190 TYR A CA  1 
ATOM   1383 C C   . TYR A 1 210 ? 19.977 33.170 22.210  1.00 13.12 ? 190 TYR A C   1 
ATOM   1384 O O   . TYR A 1 210 ? 18.855 32.880 22.632  1.00 12.24 ? 190 TYR A O   1 
ATOM   1385 C CB  . TYR A 1 210 ? 21.774 32.513 23.741  1.00 12.43 ? 190 TYR A CB  1 
ATOM   1386 C CG  . TYR A 1 210 ? 23.067 32.857 24.430  1.00 15.78 ? 190 TYR A CG  1 
ATOM   1387 C CD1 . TYR A 1 210 ? 23.080 33.260 25.762  1.00 16.90 ? 190 TYR A CD1 1 
ATOM   1388 C CD2 . TYR A 1 210 ? 24.283 32.770 23.753  1.00 16.78 ? 190 TYR A CD2 1 
ATOM   1389 C CE1 . TYR A 1 210 ? 24.270 33.564 26.410  1.00 16.71 ? 190 TYR A CE1 1 
ATOM   1390 C CE2 . TYR A 1 210 ? 25.481 33.076 24.391  1.00 16.26 ? 190 TYR A CE2 1 
ATOM   1391 C CZ  . TYR A 1 210 ? 25.465 33.468 25.721  1.00 17.47 ? 190 TYR A CZ  1 
ATOM   1392 O OH  . TYR A 1 210 ? 26.642 33.748 26.379  1.00 19.84 ? 190 TYR A OH  1 
ATOM   1393 N N   . THR A 1 211 ? 20.362 33.015 20.947  1.00 11.66 ? 191 THR A N   1 
ATOM   1394 C CA  . THR A 1 211 ? 19.486 32.460 19.925  1.00 12.01 ? 191 THR A CA  1 
ATOM   1395 C C   . THR A 1 211 ? 20.215 31.227 19.394  1.00 14.11 ? 191 THR A C   1 
ATOM   1396 O O   . THR A 1 211 ? 21.441 31.214 19.290  1.00 13.76 ? 191 THR A O   1 
ATOM   1397 C CB  . THR A 1 211 ? 19.221 33.475 18.784  1.00 11.99 ? 191 THR A CB  1 
ATOM   1398 O OG1 . THR A 1 211 ? 18.157 32.988 17.958  1.00 11.88 ? 191 THR A OG1 1 
ATOM   1399 C CG2 . THR A 1 211 ? 20.467 33.672 17.914  1.00 8.82  ? 191 THR A CG2 1 
ATOM   1400 N N   . PRO A 1 212 ? 19.475 30.158 19.086  1.00 14.62 ? 192 PRO A N   1 
ATOM   1401 C CA  . PRO A 1 212 ? 20.124 28.947 18.577  1.00 15.90 ? 192 PRO A CA  1 
ATOM   1402 C C   . PRO A 1 212 ? 20.754 29.088 17.200  1.00 15.91 ? 192 PRO A C   1 
ATOM   1403 O O   . PRO A 1 212 ? 20.272 29.843 16.352  1.00 17.44 ? 192 PRO A O   1 
ATOM   1404 C CB  . PRO A 1 212 ? 18.985 27.929 18.551  1.00 15.97 ? 192 PRO A CB  1 
ATOM   1405 C CG  . PRO A 1 212 ? 18.071 28.408 19.640  1.00 16.40 ? 192 PRO A CG  1 
ATOM   1406 C CD  . PRO A 1 212 ? 18.064 29.896 19.417  1.00 15.65 ? 192 PRO A CD  1 
ATOM   1407 N N   . ILE A 1 213 ? 21.850 28.374 16.982  1.00 15.09 ? 193 ILE A N   1 
ATOM   1408 C CA  . ILE A 1 213 ? 22.463 28.365 15.666  1.00 13.53 ? 193 ILE A CA  1 
ATOM   1409 C C   . ILE A 1 213 ? 21.653 27.234 15.042  1.00 14.17 ? 193 ILE A C   1 
ATOM   1410 O O   . ILE A 1 213 ? 21.785 26.075 15.438  1.00 14.89 ? 193 ILE A O   1 
ATOM   1411 C CB  . ILE A 1 213 ? 23.958 27.993 15.723  1.00 14.00 ? 193 ILE A CB  1 
ATOM   1412 C CG1 . ILE A 1 213 ? 24.752 29.145 16.345  1.00 13.23 ? 193 ILE A CG1 1 
ATOM   1413 C CG2 . ILE A 1 213 ? 24.472 27.675 14.318  1.00 13.98 ? 193 ILE A CG2 1 
ATOM   1414 C CD1 . ILE A 1 213 ? 26.244 28.865 16.501  1.00 12.33 ? 193 ILE A CD1 1 
ATOM   1415 N N   . ARG A 1 214 ? 20.782 27.577 14.102  1.00 14.09 ? 194 ARG A N   1 
ATOM   1416 C CA  . ARG A 1 214 ? 19.911 26.593 13.472  1.00 15.45 ? 194 ARG A CA  1 
ATOM   1417 C C   . ARG A 1 214 ? 20.641 25.437 12.810  1.00 17.02 ? 194 ARG A C   1 
ATOM   1418 O O   . ARG A 1 214 ? 20.260 24.279 12.972  1.00 17.44 ? 194 ARG A O   1 
ATOM   1419 C CB  . ARG A 1 214 ? 19.012 27.269 12.440  1.00 17.42 ? 194 ARG A CB  1 
ATOM   1420 C CG  . ARG A 1 214 ? 17.868 26.387 11.987  1.00 20.55 ? 194 ARG A CG  1 
ATOM   1421 C CD  . ARG A 1 214 ? 17.197 26.946 10.756  1.00 22.97 ? 194 ARG A CD  1 
ATOM   1422 N NE  . ARG A 1 214 ? 16.058 26.131 10.352  1.00 23.07 ? 194 ARG A NE  1 
ATOM   1423 C CZ  . ARG A 1 214 ? 15.603 26.051 9.107   1.00 24.24 ? 194 ARG A CZ  1 
ATOM   1424 N NH1 . ARG A 1 214 ? 16.194 26.736 8.135   1.00 23.78 ? 194 ARG A NH1 1 
ATOM   1425 N NH2 . ARG A 1 214 ? 14.554 25.286 8.835   1.00 25.21 ? 194 ARG A NH2 1 
ATOM   1426 N N   . ARG A 1 215 ? 21.682 25.756 12.050  1.00 15.59 ? 195 ARG A N   1 
ATOM   1427 C CA  . ARG A 1 215 ? 22.459 24.740 11.361  1.00 18.29 ? 195 ARG A CA  1 
ATOM   1428 C C   . ARG A 1 215 ? 23.876 25.265 11.189  1.00 17.18 ? 195 ARG A C   1 
ATOM   1429 O O   . ARG A 1 215 ? 24.082 26.451 10.935  1.00 13.75 ? 195 ARG A O   1 
ATOM   1430 C CB  . ARG A 1 215 ? 21.847 24.435 9.994   1.00 19.79 ? 195 ARG A CB  1 
ATOM   1431 C CG  . ARG A 1 215 ? 22.167 23.045 9.489   1.00 25.31 ? 195 ARG A CG  1 
ATOM   1432 C CD  . ARG A 1 215 ? 22.739 23.076 8.088   1.00 28.42 ? 195 ARG A CD  1 
ATOM   1433 N NE  . ARG A 1 215 ? 21.800 23.588 7.093   1.00 27.72 ? 195 ARG A NE  1 
ATOM   1434 C CZ  . ARG A 1 215 ? 22.088 23.704 5.799   1.00 26.97 ? 195 ARG A CZ  1 
ATOM   1435 N NH1 . ARG A 1 215 ? 23.280 23.344 5.356   1.00 28.11 ? 195 ARG A NH1 1 
ATOM   1436 N NH2 . ARG A 1 215 ? 21.190 24.179 4.947   1.00 27.07 ? 195 ARG A NH2 1 
ATOM   1437 N N   . GLU A 1 216 ? 24.849 24.373 11.322  1.00 18.43 ? 196 GLU A N   1 
ATOM   1438 C CA  . GLU A 1 216 ? 26.245 24.757 11.216  1.00 19.54 ? 196 GLU A CA  1 
ATOM   1439 C C   . GLU A 1 216 ? 26.843 24.755 9.812   1.00 18.04 ? 196 GLU A C   1 
ATOM   1440 O O   . GLU A 1 216 ? 27.401 23.758 9.370   1.00 16.02 ? 196 GLU A O   1 
ATOM   1441 C CB  . GLU A 1 216 ? 27.086 23.868 12.139  1.00 20.46 ? 196 GLU A CB  1 
ATOM   1442 C CG  . GLU A 1 216 ? 26.656 23.941 13.595  1.00 22.57 ? 196 GLU A CG  1 
ATOM   1443 C CD  . GLU A 1 216 ? 27.109 22.742 14.393  1.00 24.90 ? 196 GLU A CD  1 
ATOM   1444 O OE1 . GLU A 1 216 ? 26.792 21.608 13.973  1.00 26.27 ? 196 GLU A OE1 1 
ATOM   1445 O OE2 . GLU A 1 216 ? 27.767 22.927 15.440  1.00 21.92 ? 196 GLU A OE2 1 
ATOM   1446 N N   . TRP A 1 217 ? 26.691 25.880 9.116   1.00 16.51 ? 197 TRP A N   1 
ATOM   1447 C CA  . TRP A 1 217 ? 27.262 26.097 7.787   1.00 15.33 ? 197 TRP A CA  1 
ATOM   1448 C C   . TRP A 1 217 ? 27.596 27.587 7.873   1.00 15.23 ? 197 TRP A C   1 
ATOM   1449 O O   . TRP A 1 217 ? 28.737 27.945 8.145   1.00 15.76 ? 197 TRP A O   1 
ATOM   1450 C CB  . TRP A 1 217 ? 26.276 25.711 6.646   1.00 15.12 ? 197 TRP A CB  1 
ATOM   1451 C CG  . TRP A 1 217 ? 24.883 26.309 6.619   1.00 16.11 ? 197 TRP A CG  1 
ATOM   1452 C CD1 . TRP A 1 217 ? 24.045 26.535 7.683   1.00 18.47 ? 197 TRP A CD1 1 
ATOM   1453 C CD2 . TRP A 1 217 ? 24.155 26.703 5.450   1.00 18.57 ? 197 TRP A CD2 1 
ATOM   1454 N NE1 . TRP A 1 217 ? 22.848 27.049 7.242   1.00 18.17 ? 197 TRP A NE1 1 
ATOM   1455 C CE2 . TRP A 1 217 ? 22.888 27.161 5.877   1.00 18.44 ? 197 TRP A CE2 1 
ATOM   1456 C CE3 . TRP A 1 217 ? 24.450 26.713 4.079   1.00 18.54 ? 197 TRP A CE3 1 
ATOM   1457 C CZ2 . TRP A 1 217 ? 21.916 27.627 4.980   1.00 19.40 ? 197 TRP A CZ2 1 
ATOM   1458 C CZ3 . TRP A 1 217 ? 23.485 27.177 3.187   1.00 20.74 ? 197 TRP A CZ3 1 
ATOM   1459 C CH2 . TRP A 1 217 ? 22.233 27.628 3.645   1.00 20.06 ? 197 TRP A CH2 1 
ATOM   1460 N N   . TYR A 1 218 ? 26.615 28.451 7.665   1.00 15.08 ? 198 TYR A N   1 
ATOM   1461 C CA  . TYR A 1 218 ? 26.807 29.878 7.872   1.00 14.18 ? 198 TYR A CA  1 
ATOM   1462 C C   . TYR A 1 218 ? 26.344 29.938 9.326   1.00 14.05 ? 198 TYR A C   1 
ATOM   1463 O O   . TYR A 1 218 ? 25.907 28.920 9.874   1.00 14.79 ? 198 TYR A O   1 
ATOM   1464 C CB  . TYR A 1 218 ? 25.831 30.696 7.018   1.00 14.47 ? 198 TYR A CB  1 
ATOM   1465 C CG  . TYR A 1 218 ? 26.186 30.794 5.559   1.00 15.78 ? 198 TYR A CG  1 
ATOM   1466 C CD1 . TYR A 1 218 ? 27.165 31.685 5.121   1.00 16.55 ? 198 TYR A CD1 1 
ATOM   1467 C CD2 . TYR A 1 218 ? 25.552 29.989 4.613   1.00 15.92 ? 198 TYR A CD2 1 
ATOM   1468 C CE1 . TYR A 1 218 ? 27.508 31.772 3.774   1.00 17.61 ? 198 TYR A CE1 1 
ATOM   1469 C CE2 . TYR A 1 218 ? 25.887 30.066 3.262   1.00 19.30 ? 198 TYR A CE2 1 
ATOM   1470 C CZ  . TYR A 1 218 ? 26.866 30.958 2.852   1.00 18.67 ? 198 TYR A CZ  1 
ATOM   1471 O OH  . TYR A 1 218 ? 27.217 31.022 1.526   1.00 21.12 ? 198 TYR A OH  1 
ATOM   1472 N N   . TYR A 1 219 ? 26.452 31.089 9.977   1.00 10.72 ? 199 TYR A N   1 
ATOM   1473 C CA  . TYR A 1 219 ? 25.942 31.180 11.333  1.00 12.36 ? 199 TYR A CA  1 
ATOM   1474 C C   . TYR A 1 219 ? 24.477 31.535 11.140  1.00 11.88 ? 199 TYR A C   1 
ATOM   1475 O O   . TYR A 1 219 ? 24.091 32.701 11.188  1.00 11.16 ? 199 TYR A O   1 
ATOM   1476 C CB  . TYR A 1 219 ? 26.685 32.249 12.138  1.00 9.92  ? 199 TYR A CB  1 
ATOM   1477 C CG  . TYR A 1 219 ? 28.052 31.774 12.580  1.00 8.06  ? 199 TYR A CG  1 
ATOM   1478 C CD1 . TYR A 1 219 ? 29.209 32.222 11.948  1.00 8.66  ? 199 TYR A CD1 1 
ATOM   1479 C CD2 . TYR A 1 219 ? 28.182 30.838 13.602  1.00 11.44 ? 199 TYR A CD2 1 
ATOM   1480 C CE1 . TYR A 1 219 ? 30.463 31.751 12.326  1.00 8.69  ? 199 TYR A CE1 1 
ATOM   1481 C CE2 . TYR A 1 219 ? 29.429 30.358 13.985  1.00 10.38 ? 199 TYR A CE2 1 
ATOM   1482 C CZ  . TYR A 1 219 ? 30.564 30.821 13.341  1.00 11.68 ? 199 TYR A CZ  1 
ATOM   1483 O OH  . TYR A 1 219 ? 31.798 30.357 13.719  1.00 11.94 ? 199 TYR A OH  1 
ATOM   1484 N N   . GLU A 1 220 ? 23.672 30.503 10.895  1.00 11.59 ? 200 GLU A N   1 
ATOM   1485 C CA  . GLU A 1 220 ? 22.249 30.672 10.636  1.00 12.00 ? 200 GLU A CA  1 
ATOM   1486 C C   . GLU A 1 220 ? 21.386 30.787 11.883  1.00 11.70 ? 200 GLU A C   1 
ATOM   1487 O O   . GLU A 1 220 ? 21.518 30.001 12.822  1.00 11.91 ? 200 GLU A O   1 
ATOM   1488 C CB  . GLU A 1 220 ? 21.724 29.518 9.774   1.00 13.10 ? 200 GLU A CB  1 
ATOM   1489 C CG  . GLU A 1 220 ? 20.272 29.711 9.352   1.00 13.02 ? 200 GLU A CG  1 
ATOM   1490 C CD  . GLU A 1 220 ? 19.679 28.525 8.614   1.00 17.32 ? 200 GLU A CD  1 
ATOM   1491 O OE1 . GLU A 1 220 ? 20.351 27.479 8.496   1.00 18.02 ? 200 GLU A OE1 1 
ATOM   1492 O OE2 . GLU A 1 220 ? 18.520 28.640 8.159   1.00 17.24 ? 200 GLU A OE2 1 
ATOM   1493 N N   . VAL A 1 221 ? 20.497 31.776 11.866  1.00 11.84 ? 201 VAL A N   1 
ATOM   1494 C CA  . VAL A 1 221 ? 19.572 32.030 12.959  1.00 11.50 ? 201 VAL A CA  1 
ATOM   1495 C C   . VAL A 1 221 ? 18.152 32.153 12.409  1.00 12.30 ? 201 VAL A C   1 
ATOM   1496 O O   . VAL A 1 221 ? 17.935 32.116 11.194  1.00 13.82 ? 201 VAL A O   1 
ATOM   1497 C CB  . VAL A 1 221 ? 19.920 33.343 13.711  1.00 13.43 ? 201 VAL A CB  1 
ATOM   1498 C CG1 . VAL A 1 221 ? 21.310 33.241 14.339  1.00 13.08 ? 201 VAL A CG1 1 
ATOM   1499 C CG2 . VAL A 1 221 ? 19.845 34.532 12.749  1.00 12.33 ? 201 VAL A CG2 1 
ATOM   1500 N N   . ILE A 1 222 ? 17.184 32.306 13.305  1.00 11.98 ? 202 ILE A N   1 
ATOM   1501 C CA  . ILE A 1 222 ? 15.792 32.435 12.892  1.00 13.19 ? 202 ILE A CA  1 
ATOM   1502 C C   . ILE A 1 222 ? 15.170 33.701 13.479  1.00 14.06 ? 202 ILE A C   1 
ATOM   1503 O O   . ILE A 1 222 ? 15.130 33.874 14.692  1.00 14.26 ? 202 ILE A O   1 
ATOM   1504 C CB  . ILE A 1 222 ? 14.975 31.194 13.335  1.00 15.16 ? 202 ILE A CB  1 
ATOM   1505 C CG1 . ILE A 1 222 ? 15.367 29.992 12.468  1.00 16.08 ? 202 ILE A CG1 1 
ATOM   1506 C CG2 . ILE A 1 222 ? 13.479 31.465 13.214  1.00 16.71 ? 202 ILE A CG2 1 
ATOM   1507 C CD1 . ILE A 1 222 ? 14.707 28.695 12.878  1.00 22.59 ? 202 ILE A CD1 1 
ATOM   1508 N N   . ILE A 1 223 ? 14.712 34.587 12.600  1.00 12.64 ? 203 ILE A N   1 
ATOM   1509 C CA  . ILE A 1 223 ? 14.068 35.835 12.994  1.00 12.57 ? 203 ILE A CA  1 
ATOM   1510 C C   . ILE A 1 223 ? 12.574 35.532 13.034  1.00 12.98 ? 203 ILE A C   1 
ATOM   1511 O O   . ILE A 1 223 ? 12.027 34.952 12.095  1.00 14.13 ? 203 ILE A O   1 
ATOM   1512 C CB  . ILE A 1 223 ? 14.377 36.951 11.969  1.00 11.50 ? 203 ILE A CB  1 
ATOM   1513 C CG1 . ILE A 1 223 ? 15.887 37.209 11.948  1.00 11.31 ? 203 ILE A CG1 1 
ATOM   1514 C CG2 . ILE A 1 223 ? 13.611 38.220 12.319  1.00 9.58  ? 203 ILE A CG2 1 
ATOM   1515 C CD1 . ILE A 1 223 ? 16.374 38.094 10.803  1.00 13.31 ? 203 ILE A CD1 1 
ATOM   1516 N N   . VAL A 1 224 ? 11.911 35.919 14.116  1.00 13.42 ? 204 VAL A N   1 
ATOM   1517 C CA  . VAL A 1 224 ? 10.495 35.611 14.268  1.00 14.52 ? 204 VAL A CA  1 
ATOM   1518 C C   . VAL A 1 224 ? 9.523  36.788 14.243  1.00 16.31 ? 204 VAL A C   1 
ATOM   1519 O O   . VAL A 1 224 ? 8.309  36.588 14.206  1.00 15.72 ? 204 VAL A O   1 
ATOM   1520 C CB  . VAL A 1 224 ? 10.262 34.801 15.573  1.00 14.06 ? 204 VAL A CB  1 
ATOM   1521 C CG1 . VAL A 1 224 ? 11.100 33.534 15.542  1.00 14.43 ? 204 VAL A CG1 1 
ATOM   1522 C CG2 . VAL A 1 224 ? 10.619 35.638 16.802  1.00 14.70 ? 204 VAL A CG2 1 
ATOM   1523 N N   . ARG A 1 225 ? 10.049 38.005 14.257  1.00 16.09 ? 205 ARG A N   1 
ATOM   1524 C CA  . ARG A 1 225 ? 9.207  39.193 14.255  1.00 17.19 ? 205 ARG A CA  1 
ATOM   1525 C C   . ARG A 1 225 ? 10.076 40.417 14.015  1.00 17.51 ? 205 ARG A C   1 
ATOM   1526 O O   . ARG A 1 225 ? 11.230 40.457 14.438  1.00 16.00 ? 205 ARG A O   1 
ATOM   1527 C CB  . ARG A 1 225 ? 8.495  39.312 15.604  1.00 17.42 ? 205 ARG A CB  1 
ATOM   1528 C CG  . ARG A 1 225 ? 7.568  40.513 15.771  1.00 19.14 ? 205 ARG A CG  1 
ATOM   1529 C CD  . ARG A 1 225 ? 7.080  40.583 17.211  1.00 21.97 ? 205 ARG A CD  1 
ATOM   1530 N NE  . ARG A 1 225 ? 6.200  41.720 17.468  1.00 22.70 ? 205 ARG A NE  1 
ATOM   1531 C CZ  . ARG A 1 225 ? 4.871  41.679 17.409  1.00 24.58 ? 205 ARG A CZ  1 
ATOM   1532 N NH1 . ARG A 1 225 ? 4.244  40.553 17.097  1.00 23.74 ? 205 ARG A NH1 1 
ATOM   1533 N NH2 . ARG A 1 225 ? 4.164  42.769 17.680  1.00 25.54 ? 205 ARG A NH2 1 
ATOM   1534 N N   . VAL A 1 226 ? 9.524  41.404 13.317  1.00 17.11 ? 206 VAL A N   1 
ATOM   1535 C CA  . VAL A 1 226 ? 10.249 42.636 13.036  1.00 16.34 ? 206 VAL A CA  1 
ATOM   1536 C C   . VAL A 1 226 ? 9.362  43.844 13.320  1.00 17.22 ? 206 VAL A C   1 
ATOM   1537 O O   . VAL A 1 226 ? 8.207  43.888 12.897  1.00 15.89 ? 206 VAL A O   1 
ATOM   1538 C CB  . VAL A 1 226 ? 10.713 42.698 11.564  1.00 16.22 ? 206 VAL A CB  1 
ATOM   1539 C CG1 . VAL A 1 226 ? 11.383 44.040 11.286  1.00 15.13 ? 206 VAL A CG1 1 
ATOM   1540 C CG2 . VAL A 1 226 ? 11.686 41.551 11.270  1.00 14.24 ? 206 VAL A CG2 1 
ATOM   1541 N N   . GLU A 1 227 ? 9.902  44.812 14.053  1.00 17.71 ? 207 GLU A N   1 
ATOM   1542 C CA  . GLU A 1 227 ? 9.156  46.022 14.370  1.00 19.24 ? 207 GLU A CA  1 
ATOM   1543 C C   . GLU A 1 227 ? 9.941  47.275 13.998  1.00 19.54 ? 207 GLU A C   1 
ATOM   1544 O O   . GLU A 1 227 ? 11.173 47.301 14.061  1.00 18.46 ? 207 GLU A O   1 
ATOM   1545 C CB  . GLU A 1 227 ? 8.818  46.085 15.857  1.00 19.10 ? 207 GLU A CB  1 
ATOM   1546 C CG  . GLU A 1 227 ? 8.053  44.885 16.388  1.00 20.57 ? 207 GLU A CG  1 
ATOM   1547 C CD  . GLU A 1 227 ? 7.805  44.972 17.886  1.00 20.34 ? 207 GLU A CD  1 
ATOM   1548 O OE1 . GLU A 1 227 ? 8.550  45.694 18.579  1.00 22.22 ? 207 GLU A OE1 1 
ATOM   1549 O OE2 . GLU A 1 227 ? 6.873  44.304 18.374  1.00 22.36 ? 207 GLU A OE2 1 
ATOM   1550 N N   . ILE A 1 228 ? 9.208  48.309 13.602  1.00 18.89 ? 208 ILE A N   1 
ATOM   1551 C CA  . ILE A 1 228 ? 9.790  49.597 13.251  1.00 19.96 ? 208 ILE A CA  1 
ATOM   1552 C C   . ILE A 1 228 ? 9.162  50.551 14.266  1.00 20.85 ? 208 ILE A C   1 
ATOM   1553 O O   . ILE A 1 228 ? 7.958  50.790 14.227  1.00 21.58 ? 208 ILE A O   1 
ATOM   1554 C CB  . ILE A 1 228 ? 9.390  50.032 11.814  1.00 20.20 ? 208 ILE A CB  1 
ATOM   1555 C CG1 . ILE A 1 228 ? 9.793  48.954 10.801  1.00 21.22 ? 208 ILE A CG1 1 
ATOM   1556 C CG2 . ILE A 1 228 ? 10.045 51.366 11.470  1.00 18.34 ? 208 ILE A CG2 1 
ATOM   1557 C CD1 . ILE A 1 228 ? 11.266 48.635 10.777  1.00 22.33 ? 208 ILE A CD1 1 
ATOM   1558 N N   . ASN A 1 229 ? 9.970  51.073 15.184  1.00 20.70 ? 209 ASN A N   1 
ATOM   1559 C CA  . ASN A 1 229 ? 9.467  51.970 16.221  1.00 22.86 ? 209 ASN A CA  1 
ATOM   1560 C C   . ASN A 1 229 ? 8.351  51.297 17.034  1.00 22.62 ? 209 ASN A C   1 
ATOM   1561 O O   . ASN A 1 229 ? 7.367  51.937 17.411  1.00 22.89 ? 209 ASN A O   1 
ATOM   1562 C CB  . ASN A 1 229 ? 8.951  53.272 15.594  1.00 24.24 ? 209 ASN A CB  1 
ATOM   1563 C CG  . ASN A 1 229 ? 9.852  54.460 15.891  1.00 25.92 ? 209 ASN A CG  1 
ATOM   1564 O OD1 . ASN A 1 229 ? 11.004 54.296 16.302  1.00 24.87 ? 209 ASN A OD1 1 
ATOM   1565 N ND2 . ASN A 1 229 ? 9.333  55.664 15.676  1.00 24.68 ? 209 ASN A ND2 1 
ATOM   1566 N N   . GLY A 1 230 ? 8.513  50.003 17.298  1.00 21.23 ? 210 GLY A N   1 
ATOM   1567 C CA  . GLY A 1 230 ? 7.524  49.270 18.067  1.00 22.09 ? 210 GLY A CA  1 
ATOM   1568 C C   . GLY A 1 230 ? 6.345  48.733 17.273  1.00 21.83 ? 210 GLY A C   1 
ATOM   1569 O O   . GLY A 1 230 ? 5.540  47.970 17.802  1.00 22.44 ? 210 GLY A O   1 
ATOM   1570 N N   . GLN A 1 231 ? 6.237  49.123 16.008  1.00 21.57 ? 211 GLN A N   1 
ATOM   1571 C CA  . GLN A 1 231 ? 5.138  48.676 15.162  1.00 21.56 ? 211 GLN A CA  1 
ATOM   1572 C C   . GLN A 1 231 ? 5.505  47.431 14.360  1.00 20.39 ? 211 GLN A C   1 
ATOM   1573 O O   . GLN A 1 231 ? 6.448  47.438 13.571  1.00 20.34 ? 211 GLN A O   1 
ATOM   1574 C CB  . GLN A 1 231 ? 4.720  49.806 14.220  1.00 23.49 ? 211 GLN A CB  1 
ATOM   1575 C CG  . GLN A 1 231 ? 3.537  49.474 13.329  1.00 30.51 ? 211 GLN A CG  1 
ATOM   1576 C CD  . GLN A 1 231 ? 3.128  50.645 12.460  1.00 33.26 ? 211 GLN A CD  1 
ATOM   1577 O OE1 . GLN A 1 231 ? 3.930  51.164 11.683  1.00 37.64 ? 211 GLN A OE1 1 
ATOM   1578 N NE2 . GLN A 1 231 ? 1.874  51.069 12.586  1.00 34.32 ? 211 GLN A NE2 1 
ATOM   1579 N N   . ASP A 1 232 ? 4.741  46.367 14.578  1.00 19.84 ? 212 ASP A N   1 
ATOM   1580 C CA  . ASP A 1 232 ? 4.935  45.082 13.905  1.00 19.69 ? 212 ASP A CA  1 
ATOM   1581 C C   . ASP A 1 232 ? 4.827  45.247 12.388  1.00 20.28 ? 212 ASP A C   1 
ATOM   1582 O O   . ASP A 1 232 ? 3.893  45.874 11.886  1.00 19.31 ? 212 ASP A O   1 
ATOM   1583 C CB  . ASP A 1 232 ? 3.872  44.094 14.416  1.00 18.98 ? 212 ASP A CB  1 
ATOM   1584 C CG  . ASP A 1 232 ? 4.079  42.672 13.916  1.00 20.49 ? 212 ASP A CG  1 
ATOM   1585 O OD1 . ASP A 1 232 ? 5.089  42.398 13.235  1.00 19.99 ? 212 ASP A OD1 1 
ATOM   1586 O OD2 . ASP A 1 232 ? 3.218  41.816 14.217  1.00 20.20 ? 212 ASP A OD2 1 
ATOM   1587 N N   . LEU A 1 233 ? 5.792  44.694 11.658  1.00 19.59 ? 213 LEU A N   1 
ATOM   1588 C CA  . LEU A 1 233 ? 5.776  44.772 10.200  1.00 20.69 ? 213 LEU A CA  1 
ATOM   1589 C C   . LEU A 1 233 ? 4.622  43.901 9.691   1.00 21.39 ? 213 LEU A C   1 
ATOM   1590 O O   . LEU A 1 233 ? 4.112  44.090 8.588   1.00 20.79 ? 213 LEU A O   1 
ATOM   1591 C CB  . LEU A 1 233 ? 7.119  44.287 9.635   1.00 20.19 ? 213 LEU A CB  1 
ATOM   1592 C CG  . LEU A 1 233 ? 7.535  44.792 8.247   1.00 22.02 ? 213 LEU A CG  1 
ATOM   1593 C CD1 . LEU A 1 233 ? 7.477  46.313 8.204   1.00 21.79 ? 213 LEU A CD1 1 
ATOM   1594 C CD2 . LEU A 1 233 ? 8.944  44.312 7.933   1.00 19.20 ? 213 LEU A CD2 1 
ATOM   1595 N N   . LYS A 1 234 ? 4.216  42.953 10.528  1.00 22.77 ? 214 LYS A N   1 
ATOM   1596 C CA  . LYS A 1 234 ? 3.123  42.035 10.254  1.00 25.05 ? 214 LYS A CA  1 
ATOM   1597 C C   . LYS A 1 234 ? 3.284  41.195 8.998   1.00 24.89 ? 214 LYS A C   1 
ATOM   1598 O O   . LYS A 1 234 ? 2.421  41.185 8.118   1.00 26.66 ? 214 LYS A O   1 
ATOM   1599 C CB  . LYS A 1 234 ? 1.787  42.786 10.209  1.00 28.08 ? 214 LYS A CB  1 
ATOM   1600 C CG  . LYS A 1 234 ? 0.585  41.848 10.250  1.00 32.56 ? 214 LYS A CG  1 
ATOM   1601 C CD  . LYS A 1 234 ? -0.731 42.592 10.423  1.00 37.06 ? 214 LYS A CD  1 
ATOM   1602 C CE  . LYS A 1 234 ? -1.892 41.612 10.540  1.00 38.63 ? 214 LYS A CE  1 
ATOM   1603 N NZ  . LYS A 1 234 ? -3.193 42.303 10.754  1.00 40.62 ? 214 LYS A NZ  1 
ATOM   1604 N N   . MET A 1 235 ? 4.405  40.491 8.920   1.00 22.82 ? 215 MET A N   1 
ATOM   1605 C CA  . MET A 1 235 ? 4.669  39.611 7.800   1.00 20.91 ? 215 MET A CA  1 
ATOM   1606 C C   . MET A 1 235 ? 4.820  38.215 8.369   1.00 21.09 ? 215 MET A C   1 
ATOM   1607 O O   . MET A 1 235 ? 5.184  38.049 9.537   1.00 21.46 ? 215 MET A O   1 
ATOM   1608 C CB  . MET A 1 235 ? 5.951  40.017 7.075   1.00 19.84 ? 215 MET A CB  1 
ATOM   1609 C CG  . MET A 1 235 ? 5.849  41.342 6.348   1.00 18.90 ? 215 MET A CG  1 
ATOM   1610 S SD  . MET A 1 235 ? 7.318  41.664 5.386   1.00 25.12 ? 215 MET A SD  1 
ATOM   1611 C CE  . MET A 1 235 ? 7.108  40.539 4.033   1.00 21.35 ? 215 MET A CE  1 
ATOM   1612 N N   . ASP A 1 236 ? 4.517  37.211 7.557   1.00 20.99 ? 216 ASP A N   1 
ATOM   1613 C CA  . ASP A 1 236 ? 4.656  35.837 8.001   1.00 21.53 ? 216 ASP A CA  1 
ATOM   1614 C C   . ASP A 1 236 ? 6.144  35.705 8.299   1.00 21.14 ? 216 ASP A C   1 
ATOM   1615 O O   . ASP A 1 236 ? 6.969  36.110 7.483   1.00 20.57 ? 216 ASP A O   1 
ATOM   1616 C CB  . ASP A 1 236 ? 4.250  34.883 6.879   1.00 23.54 ? 216 ASP A CB  1 
ATOM   1617 C CG  . ASP A 1 236 ? 4.161  33.451 7.341   1.00 26.13 ? 216 ASP A CG  1 
ATOM   1618 O OD1 . ASP A 1 236 ? 5.189  32.898 7.785   1.00 26.12 ? 216 ASP A OD1 1 
ATOM   1619 O OD2 . ASP A 1 236 ? 3.054  32.878 7.261   1.00 29.68 ? 216 ASP A OD2 1 
ATOM   1620 N N   . CYS A 1 237 ? 6.495  35.154 9.458   1.00 20.67 ? 217 CYS A N   1 
ATOM   1621 C CA  . CYS A 1 237 ? 7.904  35.021 9.815   1.00 20.38 ? 217 CYS A CA  1 
ATOM   1622 C C   . CYS A 1 237 ? 8.718  34.201 8.807   1.00 19.03 ? 217 CYS A C   1 
ATOM   1623 O O   . CYS A 1 237 ? 9.938  34.334 8.729   1.00 18.54 ? 217 CYS A O   1 
ATOM   1624 C CB  . CYS A 1 237 ? 8.040  34.434 11.222  1.00 21.54 ? 217 CYS A CB  1 
ATOM   1625 S SG  . CYS A 1 237 ? 7.464  32.720 11.407  1.00 22.89 ? 217 CYS A SG  1 
ATOM   1626 N N   . LYS A 1 238 ? 8.050  33.355 8.030   1.00 17.26 ? 218 LYS A N   1 
ATOM   1627 C CA  . LYS A 1 238 ? 8.753  32.566 7.031   1.00 17.21 ? 218 LYS A CA  1 
ATOM   1628 C C   . LYS A 1 238 ? 9.410  33.497 6.005   1.00 16.03 ? 218 LYS A C   1 
ATOM   1629 O O   . LYS A 1 238 ? 10.418 33.149 5.406   1.00 16.95 ? 218 LYS A O   1 
ATOM   1630 C CB  . LYS A 1 238 ? 7.782  31.606 6.339   1.00 20.03 ? 218 LYS A CB  1 
ATOM   1631 C CG  . LYS A 1 238 ? 7.084  30.663 7.307   1.00 23.71 ? 218 LYS A CG  1 
ATOM   1632 C CD  . LYS A 1 238 ? 5.889  29.986 6.667   1.00 28.00 ? 218 LYS A CD  1 
ATOM   1633 C CE  . LYS A 1 238 ? 6.305  28.779 5.865   1.00 30.46 ? 218 LYS A CE  1 
ATOM   1634 N NZ  . LYS A 1 238 ? 6.798  27.676 6.742   1.00 33.51 ? 218 LYS A NZ  1 
ATOM   1635 N N   . GLU A 1 239 ? 8.846  34.686 5.815   1.00 15.16 ? 219 GLU A N   1 
ATOM   1636 C CA  . GLU A 1 239 ? 9.401  35.652 4.867   1.00 16.69 ? 219 GLU A CA  1 
ATOM   1637 C C   . GLU A 1 239 ? 10.717 36.258 5.362   1.00 16.20 ? 219 GLU A C   1 
ATOM   1638 O O   . GLU A 1 239 ? 11.597 36.575 4.564   1.00 17.00 ? 219 GLU A O   1 
ATOM   1639 C CB  . GLU A 1 239 ? 8.399  36.782 4.601   1.00 17.18 ? 219 GLU A CB  1 
ATOM   1640 C CG  . GLU A 1 239 ? 7.081  36.334 3.989   1.00 18.16 ? 219 GLU A CG  1 
ATOM   1641 C CD  . GLU A 1 239 ? 7.195  35.947 2.526   1.00 21.44 ? 219 GLU A CD  1 
ATOM   1642 O OE1 . GLU A 1 239 ? 8.318  35.956 1.982   1.00 19.92 ? 219 GLU A OE1 1 
ATOM   1643 O OE2 . GLU A 1 239 ? 6.151  35.636 1.915   1.00 23.66 ? 219 GLU A OE2 1 
ATOM   1644 N N   . TYR A 1 240 ? 10.842 36.417 6.674   1.00 17.60 ? 220 TYR A N   1 
ATOM   1645 C CA  . TYR A 1 240 ? 12.044 36.993 7.285   1.00 16.31 ? 220 TYR A CA  1 
ATOM   1646 C C   . TYR A 1 240 ? 13.263 36.081 7.131   1.00 17.69 ? 220 TYR A C   1 
ATOM   1647 O O   . TYR A 1 240 ? 14.403 36.539 7.158   1.00 16.45 ? 220 TYR A O   1 
ATOM   1648 C CB  . TYR A 1 240 ? 11.809 37.235 8.777   1.00 16.24 ? 220 TYR A CB  1 
ATOM   1649 C CG  . TYR A 1 240 ? 10.662 38.163 9.115   1.00 15.74 ? 220 TYR A CG  1 
ATOM   1650 C CD1 . TYR A 1 240 ? 9.905  37.963 10.273  1.00 16.74 ? 220 TYR A CD1 1 
ATOM   1651 C CD2 . TYR A 1 240 ? 10.340 39.244 8.297   1.00 17.74 ? 220 TYR A CD2 1 
ATOM   1652 C CE1 . TYR A 1 240 ? 8.855  38.816 10.605  1.00 16.36 ? 220 TYR A CE1 1 
ATOM   1653 C CE2 . TYR A 1 240 ? 9.289  40.105 8.623   1.00 15.50 ? 220 TYR A CE2 1 
ATOM   1654 C CZ  . TYR A 1 240 ? 8.555  39.882 9.775   1.00 17.33 ? 220 TYR A CZ  1 
ATOM   1655 O OH  . TYR A 1 240 ? 7.514  40.721 10.092  1.00 17.77 ? 220 TYR A OH  1 
ATOM   1656 N N   . ASN A 1 241 ? 13.016 34.786 6.974   1.00 16.95 ? 221 ASN A N   1 
ATOM   1657 C CA  . ASN A 1 241 ? 14.096 33.816 6.849   1.00 17.63 ? 221 ASN A CA  1 
ATOM   1658 C C   . ASN A 1 241 ? 14.015 33.063 5.532   1.00 19.17 ? 221 ASN A C   1 
ATOM   1659 O O   . ASN A 1 241 ? 14.619 31.998 5.396   1.00 18.30 ? 221 ASN A O   1 
ATOM   1660 C CB  . ASN A 1 241 ? 14.013 32.810 8.005   1.00 17.99 ? 221 ASN A CB  1 
ATOM   1661 C CG  . ASN A 1 241 ? 13.842 33.482 9.347   1.00 17.52 ? 221 ASN A CG  1 
ATOM   1662 O OD1 . ASN A 1 241 ? 14.769 34.093 9.866   1.00 14.21 ? 221 ASN A OD1 1 
ATOM   1663 N ND2 . ASN A 1 241 ? 12.641 33.380 9.916   1.00 17.65 ? 221 ASN A ND2 1 
ATOM   1664 N N   . TYR A 1 242 ? 13.274 33.614 4.568   1.00 21.48 ? 222 TYR A N   1 
ATOM   1665 C CA  . TYR A 1 242 ? 13.100 32.965 3.281   1.00 24.15 ? 222 TYR A CA  1 
ATOM   1666 C C   . TYR A 1 242 ? 14.451 32.682 2.679   1.00 26.28 ? 222 TYR A C   1 
ATOM   1667 O O   . TYR A 1 242 ? 15.170 33.587 2.262   1.00 26.76 ? 222 TYR A O   1 
ATOM   1668 C CB  . TYR A 1 242 ? 12.256 33.819 2.333   1.00 27.21 ? 222 TYR A CB  1 
ATOM   1669 C CG  . TYR A 1 242 ? 12.187 33.243 0.939   1.00 29.29 ? 222 TYR A CG  1 
ATOM   1670 C CD1 . TYR A 1 242 ? 12.024 31.871 0.740   1.00 29.88 ? 222 TYR A CD1 1 
ATOM   1671 C CD2 . TYR A 1 242 ? 12.305 34.061 -0.182  1.00 30.51 ? 222 TYR A CD2 1 
ATOM   1672 C CE1 . TYR A 1 242 ? 11.989 31.329 -0.537  1.00 31.22 ? 222 TYR A CE1 1 
ATOM   1673 C CE2 . TYR A 1 242 ? 12.267 33.528 -1.465  1.00 32.04 ? 222 TYR A CE2 1 
ATOM   1674 C CZ  . TYR A 1 242 ? 12.111 32.162 -1.634  1.00 31.19 ? 222 TYR A CZ  1 
ATOM   1675 O OH  . TYR A 1 242 ? 12.085 31.629 -2.903  1.00 34.98 ? 222 TYR A OH  1 
ATOM   1676 N N   . ASP A 1 243 ? 14.761 31.392 2.640   1.00 27.32 ? 223 ASP A N   1 
ATOM   1677 C CA  . ASP A 1 243 ? 16.022 30.871 2.169   1.00 23.84 ? 223 ASP A CA  1 
ATOM   1678 C C   . ASP A 1 243 ? 16.840 30.695 3.445   1.00 21.07 ? 223 ASP A C   1 
ATOM   1679 O O   . ASP A 1 243 ? 17.060 29.568 3.875   1.00 21.13 ? 223 ASP A O   1 
ATOM   1680 C CB  . ASP A 1 243 ? 16.698 31.836 1.198   1.00 28.93 ? 223 ASP A CB  1 
ATOM   1681 C CG  . ASP A 1 243 ? 18.011 31.316 0.699   1.00 27.57 ? 223 ASP A CG  1 
ATOM   1682 O OD1 . ASP A 1 243 ? 19.011 31.448 1.428   1.00 33.49 ? 223 ASP A OD1 1 
ATOM   1683 O OD2 . ASP A 1 243 ? 18.039 30.754 -0.412  1.00 31.69 ? 223 ASP A OD2 1 
ATOM   1684 N N   . LYS A 1 244 ? 17.244 31.799 4.076   1.00 17.20 ? 224 LYS A N   1 
ATOM   1685 C CA  . LYS A 1 244 ? 18.022 31.728 5.315   1.00 15.88 ? 224 LYS A CA  1 
ATOM   1686 C C   . LYS A 1 244 ? 18.279 33.108 5.926   1.00 15.50 ? 224 LYS A C   1 
ATOM   1687 O O   . LYS A 1 244 ? 18.093 34.133 5.274   1.00 15.81 ? 224 LYS A O   1 
ATOM   1688 C CB  . LYS A 1 244 ? 19.378 31.065 5.048   1.00 15.54 ? 224 LYS A CB  1 
ATOM   1689 C CG  . LYS A 1 244 ? 20.318 31.924 4.192   1.00 16.51 ? 224 LYS A CG  1 
ATOM   1690 C CD  . LYS A 1 244 ? 21.678 31.271 4.016   1.00 17.40 ? 224 LYS A CD  1 
ATOM   1691 C CE  . LYS A 1 244 ? 22.619 32.124 3.168   1.00 19.73 ? 224 LYS A CE  1 
ATOM   1692 N NZ  . LYS A 1 244 ? 22.096 32.340 1.786   1.00 21.15 ? 224 LYS A NZ  1 
ATOM   1693 N N   . SER A 1 245 ? 18.703 33.118 7.186   1.00 13.24 ? 225 SER A N   1 
ATOM   1694 C CA  . SER A 1 245 ? 19.058 34.352 7.887   1.00 12.58 ? 225 SER A CA  1 
ATOM   1695 C C   . SER A 1 245 ? 20.407 34.058 8.532   1.00 12.81 ? 225 SER A C   1 
ATOM   1696 O O   . SER A 1 245 ? 20.546 33.067 9.239   1.00 12.99 ? 225 SER A O   1 
ATOM   1697 C CB  . SER A 1 245 ? 18.036 34.702 8.977   1.00 11.38 ? 225 SER A CB  1 
ATOM   1698 O OG  . SER A 1 245 ? 16.787 35.101 8.432   1.00 12.39 ? 225 SER A OG  1 
ATOM   1699 N N   . ILE A 1 246 ? 21.404 34.902 8.288   1.00 12.98 ? 226 ILE A N   1 
ATOM   1700 C CA  . ILE A 1 246 ? 22.725 34.667 8.869   1.00 13.17 ? 226 ILE A CA  1 
ATOM   1701 C C   . ILE A 1 246 ? 23.317 35.905 9.536   1.00 13.46 ? 226 ILE A C   1 
ATOM   1702 O O   . ILE A 1 246 ? 22.864 37.029 9.317   1.00 13.39 ? 226 ILE A O   1 
ATOM   1703 C CB  . ILE A 1 246 ? 23.730 34.177 7.791   1.00 13.10 ? 226 ILE A CB  1 
ATOM   1704 C CG1 . ILE A 1 246 ? 24.016 35.306 6.790   1.00 12.40 ? 226 ILE A CG1 1 
ATOM   1705 C CG2 . ILE A 1 246 ? 23.163 32.968 7.065   1.00 12.78 ? 226 ILE A CG2 1 
ATOM   1706 C CD1 . ILE A 1 246 ? 25.052 34.959 5.709   1.00 14.22 ? 226 ILE A CD1 1 
ATOM   1707 N N   . VAL A 1 247 ? 24.340 35.684 10.350  1.00 11.09 ? 227 VAL A N   1 
ATOM   1708 C CA  . VAL A 1 247 ? 25.033 36.769 11.036  1.00 13.94 ? 227 VAL A CA  1 
ATOM   1709 C C   . VAL A 1 247 ? 26.371 36.805 10.317  1.00 14.01 ? 227 VAL A C   1 
ATOM   1710 O O   . VAL A 1 247 ? 27.121 35.827 10.331  1.00 14.01 ? 227 VAL A O   1 
ATOM   1711 C CB  . VAL A 1 247 ? 25.212 36.459 12.531  1.00 13.92 ? 227 VAL A CB  1 
ATOM   1712 C CG1 . VAL A 1 247 ? 25.904 37.629 13.243  1.00 12.41 ? 227 VAL A CG1 1 
ATOM   1713 C CG2 . VAL A 1 247 ? 23.850 36.210 13.155  1.00 14.13 ? 227 VAL A CG2 1 
ATOM   1714 N N   . ASP A 1 248 ? 26.665 37.937 9.690   1.00 13.29 ? 228 ASP A N   1 
ATOM   1715 C CA  . ASP A 1 248 ? 27.863 38.048 8.883   1.00 14.57 ? 228 ASP A CA  1 
ATOM   1716 C C   . ASP A 1 248 ? 28.635 39.348 9.075   1.00 15.01 ? 228 ASP A C   1 
ATOM   1717 O O   . ASP A 1 248 ? 28.207 40.410 8.633   1.00 15.61 ? 228 ASP A O   1 
ATOM   1718 C CB  . ASP A 1 248 ? 27.435 37.866 7.422   1.00 14.89 ? 228 ASP A CB  1 
ATOM   1719 C CG  . ASP A 1 248 ? 28.577 38.010 6.442   1.00 14.71 ? 228 ASP A CG  1 
ATOM   1720 O OD1 . ASP A 1 248 ? 29.748 37.957 6.859   1.00 16.26 ? 228 ASP A OD1 1 
ATOM   1721 O OD2 . ASP A 1 248 ? 28.279 38.166 5.245   1.00 16.31 ? 228 ASP A OD2 1 
ATOM   1722 N N   . SER A 1 249 ? 29.787 39.247 9.729   1.00 12.99 ? 229 SER A N   1 
ATOM   1723 C CA  . SER A 1 249 ? 30.636 40.408 9.979   1.00 14.31 ? 229 SER A CA  1 
ATOM   1724 C C   . SER A 1 249 ? 31.302 40.925 8.701   1.00 14.69 ? 229 SER A C   1 
ATOM   1725 O O   . SER A 1 249 ? 31.833 42.037 8.677   1.00 14.57 ? 229 SER A O   1 
ATOM   1726 C CB  . SER A 1 249 ? 31.718 40.046 11.003  1.00 13.35 ? 229 SER A CB  1 
ATOM   1727 O OG  . SER A 1 249 ? 32.588 39.061 10.470  1.00 12.79 ? 229 SER A OG  1 
ATOM   1728 N N   . GLY A 1 250 ? 31.277 40.116 7.643   1.00 15.23 ? 230 GLY A N   1 
ATOM   1729 C CA  . GLY A 1 250 ? 31.882 40.513 6.386   1.00 14.84 ? 230 GLY A CA  1 
ATOM   1730 C C   . GLY A 1 250 ? 30.957 41.303 5.475   1.00 14.18 ? 230 GLY A C   1 
ATOM   1731 O O   . GLY A 1 250 ? 31.385 41.773 4.429   1.00 13.60 ? 230 GLY A O   1 
ATOM   1732 N N   . THR A 1 251 ? 29.691 41.442 5.867   1.00 13.29 ? 231 THR A N   1 
ATOM   1733 C CA  . THR A 1 251 ? 28.717 42.193 5.077   1.00 13.06 ? 231 THR A CA  1 
ATOM   1734 C C   . THR A 1 251 ? 28.407 43.509 5.787   1.00 13.55 ? 231 THR A C   1 
ATOM   1735 O O   . THR A 1 251 ? 28.140 43.538 6.982   1.00 14.72 ? 231 THR A O   1 
ATOM   1736 C CB  . THR A 1 251 ? 27.406 41.389 4.879   1.00 11.90 ? 231 THR A CB  1 
ATOM   1737 O OG1 . THR A 1 251 ? 27.645 40.312 3.964   1.00 13.22 ? 231 THR A OG1 1 
ATOM   1738 C CG2 . THR A 1 251 ? 26.300 42.279 4.311   1.00 13.08 ? 231 THR A CG2 1 
ATOM   1739 N N   . THR A 1 252 ? 28.448 44.601 5.033   1.00 14.14 ? 232 THR A N   1 
ATOM   1740 C CA  . THR A 1 252 ? 28.205 45.922 5.589   1.00 13.15 ? 232 THR A CA  1 
ATOM   1741 C C   . THR A 1 252 ? 26.784 46.160 6.093   1.00 12.71 ? 232 THR A C   1 
ATOM   1742 O O   . THR A 1 252 ? 26.574 46.568 7.231   1.00 12.00 ? 232 THR A O   1 
ATOM   1743 C CB  . THR A 1 252 ? 28.495 47.014 4.532   1.00 14.86 ? 232 THR A CB  1 
ATOM   1744 O OG1 . THR A 1 252 ? 29.802 46.818 3.980   1.00 17.46 ? 232 THR A OG1 1 
ATOM   1745 C CG2 . THR A 1 252 ? 28.416 48.389 5.156   1.00 16.13 ? 232 THR A CG2 1 
ATOM   1746 N N   . ASN A 1 253 ? 25.815 45.903 5.224   1.00 13.91 ? 233 ASN A N   1 
ATOM   1747 C CA  . ASN A 1 253 ? 24.411 46.170 5.506   1.00 13.42 ? 233 ASN A CA  1 
ATOM   1748 C C   . ASN A 1 253 ? 23.572 45.124 6.208   1.00 13.17 ? 233 ASN A C   1 
ATOM   1749 O O   . ASN A 1 253 ? 23.995 44.000 6.460   1.00 13.72 ? 233 ASN A O   1 
ATOM   1750 C CB  . ASN A 1 253 ? 23.682 46.481 4.191   1.00 14.66 ? 233 ASN A CB  1 
ATOM   1751 C CG  . ASN A 1 253 ? 24.208 47.714 3.493   1.00 14.09 ? 233 ASN A CG  1 
ATOM   1752 O OD1 . ASN A 1 253 ? 25.159 48.346 3.940   1.00 14.76 ? 233 ASN A OD1 1 
ATOM   1753 N ND2 . ASN A 1 253 ? 23.574 48.065 2.380   1.00 15.20 ? 233 ASN A ND2 1 
ATOM   1754 N N   . LEU A 1 254 ? 22.358 45.551 6.532   1.00 13.24 ? 234 LEU A N   1 
ATOM   1755 C CA  . LEU A 1 254 ? 21.353 44.674 7.086   1.00 13.98 ? 234 LEU A CA  1 
ATOM   1756 C C   . LEU A 1 254 ? 20.618 44.421 5.776   1.00 14.03 ? 234 LEU A C   1 
ATOM   1757 O O   . LEU A 1 254 ? 19.979 45.323 5.228   1.00 14.90 ? 234 LEU A O   1 
ATOM   1758 C CB  . LEU A 1 254 ? 20.427 45.402 8.058   1.00 11.27 ? 234 LEU A CB  1 
ATOM   1759 C CG  . LEU A 1 254 ? 19.086 44.682 8.261   1.00 13.25 ? 234 LEU A CG  1 
ATOM   1760 C CD1 . LEU A 1 254 ? 19.324 43.266 8.804   1.00 15.32 ? 234 LEU A CD1 1 
ATOM   1761 C CD2 . LEU A 1 254 ? 18.211 45.482 9.212   1.00 14.49 ? 234 LEU A CD2 1 
ATOM   1762 N N   . ARG A 1 255 ? 20.752 43.214 5.245   1.00 14.05 ? 235 ARG A N   1 
ATOM   1763 C CA  . ARG A 1 255 ? 20.109 42.879 3.991   1.00 13.68 ? 235 ARG A CA  1 
ATOM   1764 C C   . ARG A 1 255 ? 18.855 42.075 4.274   1.00 14.72 ? 235 ARG A C   1 
ATOM   1765 O O   . ARG A 1 255 ? 18.857 41.185 5.117   1.00 13.58 ? 235 ARG A O   1 
ATOM   1766 C CB  . ARG A 1 255 ? 21.078 42.096 3.104   1.00 15.40 ? 235 ARG A CB  1 
ATOM   1767 C CG  . ARG A 1 255 ? 22.423 42.796 2.914   1.00 14.04 ? 235 ARG A CG  1 
ATOM   1768 C CD  . ARG A 1 255 ? 23.310 42.043 1.933   1.00 14.29 ? 235 ARG A CD  1 
ATOM   1769 N NE  . ARG A 1 255 ? 22.721 42.026 0.598   1.00 17.36 ? 235 ARG A NE  1 
ATOM   1770 C CZ  . ARG A 1 255 ? 22.939 41.077 -0.305  1.00 16.78 ? 235 ARG A CZ  1 
ATOM   1771 N NH1 . ARG A 1 255 ? 22.357 41.149 -1.495  1.00 18.16 ? 235 ARG A NH1 1 
ATOM   1772 N NH2 . ARG A 1 255 ? 23.729 40.053 -0.016  1.00 15.90 ? 235 ARG A NH2 1 
ATOM   1773 N N   . LEU A 1 256 ? 17.781 42.391 3.559   1.00 15.60 ? 236 LEU A N   1 
ATOM   1774 C CA  . LEU A 1 256 ? 16.515 41.711 3.774   1.00 15.61 ? 236 LEU A CA  1 
ATOM   1775 C C   . LEU A 1 256 ? 15.906 41.171 2.490   1.00 15.91 ? 236 LEU A C   1 
ATOM   1776 O O   . LEU A 1 256 ? 16.091 41.738 1.411   1.00 15.64 ? 236 LEU A O   1 
ATOM   1777 C CB  . LEU A 1 256 ? 15.519 42.673 4.423   1.00 15.23 ? 236 LEU A CB  1 
ATOM   1778 C CG  . LEU A 1 256 ? 15.924 43.314 5.754   1.00 16.39 ? 236 LEU A CG  1 
ATOM   1779 C CD1 . LEU A 1 256 ? 15.000 44.485 6.070   1.00 15.57 ? 236 LEU A CD1 1 
ATOM   1780 C CD2 . LEU A 1 256 ? 15.875 42.266 6.864   1.00 16.32 ? 236 LEU A CD2 1 
ATOM   1781 N N   . PRO A 1 257 ? 15.177 40.052 2.589   1.00 15.93 ? 237 PRO A N   1 
ATOM   1782 C CA  . PRO A 1 257 ? 14.543 39.470 1.406   1.00 18.37 ? 237 PRO A CA  1 
ATOM   1783 C C   . PRO A 1 257 ? 13.695 40.569 0.765   1.00 17.55 ? 237 PRO A C   1 
ATOM   1784 O O   . PRO A 1 257 ? 13.127 41.398 1.471   1.00 18.49 ? 237 PRO A O   1 
ATOM   1785 C CB  . PRO A 1 257 ? 13.691 38.355 1.997   1.00 17.86 ? 237 PRO A CB  1 
ATOM   1786 C CG  . PRO A 1 257 ? 14.524 37.890 3.151   1.00 20.17 ? 237 PRO A CG  1 
ATOM   1787 C CD  . PRO A 1 257 ? 14.981 39.194 3.771   1.00 18.03 ? 237 PRO A CD  1 
ATOM   1788 N N   . LYS A 1 258 ? 13.613 40.571 -0.558  1.00 20.16 ? 238 LYS A N   1 
ATOM   1789 C CA  . LYS A 1 258 ? 12.851 41.578 -1.294  1.00 20.68 ? 238 LYS A CA  1 
ATOM   1790 C C   . LYS A 1 258 ? 11.514 41.998 -0.656  1.00 20.53 ? 238 LYS A C   1 
ATOM   1791 O O   . LYS A 1 258 ? 11.299 43.181 -0.399  1.00 20.42 ? 238 LYS A O   1 
ATOM   1792 C CB  . LYS A 1 258 ? 12.634 41.094 -2.730  1.00 23.73 ? 238 LYS A CB  1 
ATOM   1793 C CG  . LYS A 1 258 ? 11.757 41.996 -3.591  1.00 26.18 ? 238 LYS A CG  1 
ATOM   1794 C CD  . LYS A 1 258 ? 10.351 41.438 -3.665  1.00 29.01 ? 238 LYS A CD  1 
ATOM   1795 C CE  . LYS A 1 258 ? 10.372 40.061 -4.302  1.00 30.41 ? 238 LYS A CE  1 
ATOM   1796 N NZ  . LYS A 1 258 ? 9.092  39.361 -4.108  1.00 31.33 ? 238 LYS A NZ  1 
ATOM   1797 N N   . LYS A 1 259 ? 10.626 41.046 -0.382  1.00 20.25 ? 239 LYS A N   1 
ATOM   1798 C CA  . LYS A 1 259 ? 9.332  41.380 0.223   1.00 18.26 ? 239 LYS A CA  1 
ATOM   1799 C C   . LYS A 1 259 ? 9.449  42.098 1.563   1.00 18.77 ? 239 LYS A C   1 
ATOM   1800 O O   . LYS A 1 259 ? 8.700  43.042 1.839   1.00 17.53 ? 239 LYS A O   1 
ATOM   1801 C CB  . LYS A 1 259 ? 8.488  40.124 0.418   1.00 19.97 ? 239 LYS A CB  1 
ATOM   1802 C CG  . LYS A 1 259 ? 8.004  39.485 -0.860  1.00 21.07 ? 239 LYS A CG  1 
ATOM   1803 C CD  . LYS A 1 259 ? 7.248  38.215 -0.526  1.00 24.27 ? 239 LYS A CD  1 
ATOM   1804 C CE  . LYS A 1 259 ? 6.791  37.479 -1.765  1.00 25.04 ? 239 LYS A CE  1 
ATOM   1805 N NZ  . LYS A 1 259 ? 6.171  36.189 -1.352  1.00 24.72 ? 239 LYS A NZ  1 
ATOM   1806 N N   . VAL A 1 260 ? 10.373 41.638 2.404   1.00 16.45 ? 240 VAL A N   1 
ATOM   1807 C CA  . VAL A 1 260 ? 10.576 42.243 3.711   1.00 16.25 ? 240 VAL A CA  1 
ATOM   1808 C C   . VAL A 1 260 ? 11.188 43.623 3.540   1.00 15.35 ? 240 VAL A C   1 
ATOM   1809 O O   . VAL A 1 260 ? 10.802 44.569 4.224   1.00 16.87 ? 240 VAL A O   1 
ATOM   1810 C CB  . VAL A 1 260 ? 11.511 41.384 4.602   1.00 15.47 ? 240 VAL A CB  1 
ATOM   1811 C CG1 . VAL A 1 260 ? 11.680 42.040 5.960   1.00 17.98 ? 240 VAL A CG1 1 
ATOM   1812 C CG2 . VAL A 1 260 ? 10.939 39.981 4.756   1.00 16.75 ? 240 VAL A CG2 1 
ATOM   1813 N N   . PHE A 1 261 ? 12.149 43.738 2.630   1.00 14.44 ? 241 PHE A N   1 
ATOM   1814 C CA  . PHE A 1 261 ? 12.779 45.028 2.388   1.00 15.52 ? 241 PHE A CA  1 
ATOM   1815 C C   . PHE A 1 261 ? 11.720 46.059 2.001   1.00 15.90 ? 241 PHE A C   1 
ATOM   1816 O O   . PHE A 1 261 ? 11.660 47.147 2.572   1.00 16.74 ? 241 PHE A O   1 
ATOM   1817 C CB  . PHE A 1 261 ? 13.814 44.920 1.272   1.00 17.21 ? 241 PHE A CB  1 
ATOM   1818 C CG  . PHE A 1 261 ? 14.392 46.242 0.870   1.00 18.13 ? 241 PHE A CG  1 
ATOM   1819 C CD1 . PHE A 1 261 ? 15.296 46.897 1.698   1.00 17.23 ? 241 PHE A CD1 1 
ATOM   1820 C CD2 . PHE A 1 261 ? 14.000 46.852 -0.315  1.00 18.28 ? 241 PHE A CD2 1 
ATOM   1821 C CE1 . PHE A 1 261 ? 15.803 48.144 1.351   1.00 18.89 ? 241 PHE A CE1 1 
ATOM   1822 C CE2 . PHE A 1 261 ? 14.501 48.103 -0.675  1.00 18.78 ? 241 PHE A CE2 1 
ATOM   1823 C CZ  . PHE A 1 261 ? 15.403 48.750 0.157   1.00 19.01 ? 241 PHE A CZ  1 
ATOM   1824 N N   . GLU A 1 262 ? 10.877 45.707 1.037   1.00 15.88 ? 242 GLU A N   1 
ATOM   1825 C CA  . GLU A 1 262 ? 9.824  46.609 0.579   1.00 18.53 ? 242 GLU A CA  1 
ATOM   1826 C C   . GLU A 1 262 ? 8.918  47.081 1.714   1.00 17.41 ? 242 GLU A C   1 
ATOM   1827 O O   . GLU A 1 262 ? 8.660  48.275 1.850   1.00 17.11 ? 242 GLU A O   1 
ATOM   1828 C CB  . GLU A 1 262 ? 8.977  45.930 -0.502  1.00 20.57 ? 242 GLU A CB  1 
ATOM   1829 C CG  . GLU A 1 262 ? 9.744  45.553 -1.764  1.00 28.22 ? 242 GLU A CG  1 
ATOM   1830 C CD  . GLU A 1 262 ? 10.365 46.751 -2.455  1.00 32.03 ? 242 GLU A CD  1 
ATOM   1831 O OE1 . GLU A 1 262 ? 9.628  47.708 -2.772  1.00 37.06 ? 242 GLU A OE1 1 
ATOM   1832 O OE2 . GLU A 1 262 ? 11.591 46.736 -2.688  1.00 35.30 ? 242 GLU A OE2 1 
ATOM   1833 N N   . ALA A 1 263 ? 8.430  46.146 2.526   1.00 17.13 ? 243 ALA A N   1 
ATOM   1834 C CA  . ALA A 1 263 ? 7.556  46.496 3.642   1.00 17.51 ? 243 ALA A CA  1 
ATOM   1835 C C   . ALA A 1 263 ? 8.303  47.325 4.683   1.00 16.46 ? 243 ALA A C   1 
ATOM   1836 O O   . ALA A 1 263 ? 7.748  48.260 5.261   1.00 16.46 ? 243 ALA A O   1 
ATOM   1837 C CB  . ALA A 1 263 ? 6.988  45.230 4.290   1.00 19.64 ? 243 ALA A CB  1 
ATOM   1838 N N   . ALA A 1 264 ? 9.561  46.972 4.927   1.00 16.41 ? 244 ALA A N   1 
ATOM   1839 C CA  . ALA A 1 264 ? 10.383 47.689 5.892   1.00 15.12 ? 244 ALA A CA  1 
ATOM   1840 C C   . ALA A 1 264 ? 10.570 49.145 5.473   1.00 16.08 ? 244 ALA A C   1 
ATOM   1841 O O   . ALA A 1 264 ? 10.341 50.058 6.264   1.00 17.84 ? 244 ALA A O   1 
ATOM   1842 C CB  . ALA A 1 264 ? 11.738 47.008 6.030   1.00 16.17 ? 244 ALA A CB  1 
ATOM   1843 N N   . VAL A 1 265 ? 10.992 49.365 4.231   1.00 18.11 ? 245 VAL A N   1 
ATOM   1844 C CA  . VAL A 1 265 ? 11.196 50.727 3.744   1.00 19.73 ? 245 VAL A CA  1 
ATOM   1845 C C   . VAL A 1 265 ? 9.918  51.557 3.851   1.00 20.09 ? 245 VAL A C   1 
ATOM   1846 O O   . VAL A 1 265 ? 9.956  52.714 4.268   1.00 19.72 ? 245 VAL A O   1 
ATOM   1847 C CB  . VAL A 1 265 ? 11.693 50.733 2.287   1.00 20.43 ? 245 VAL A CB  1 
ATOM   1848 C CG1 . VAL A 1 265 ? 11.681 52.151 1.729   1.00 22.05 ? 245 VAL A CG1 1 
ATOM   1849 C CG2 . VAL A 1 265 ? 13.103 50.173 2.230   1.00 22.19 ? 245 VAL A CG2 1 
ATOM   1850 N N   . LYS A 1 266 ? 8.786  50.970 3.479   1.00 21.23 ? 246 LYS A N   1 
ATOM   1851 C CA  . LYS A 1 266 ? 7.518  51.684 3.572   1.00 21.83 ? 246 LYS A CA  1 
ATOM   1852 C C   . LYS A 1 266 ? 7.244  52.129 5.005   1.00 21.26 ? 246 LYS A C   1 
ATOM   1853 O O   . LYS A 1 266 ? 6.845  53.268 5.242   1.00 18.95 ? 246 LYS A O   1 
ATOM   1854 C CB  . LYS A 1 266 ? 6.376  50.800 3.075   1.00 24.52 ? 246 LYS A CB  1 
ATOM   1855 C CG  . LYS A 1 266 ? 6.283  50.736 1.568   1.00 29.79 ? 246 LYS A CG  1 
ATOM   1856 C CD  . LYS A 1 266 ? 5.837  52.080 1.007   1.00 33.37 ? 246 LYS A CD  1 
ATOM   1857 C CE  . LYS A 1 266 ? 6.643  52.467 -0.224  1.00 34.17 ? 246 LYS A CE  1 
ATOM   1858 N NZ  . LYS A 1 266 ? 8.080  52.664 0.110   1.00 30.58 ? 246 LYS A NZ  1 
ATOM   1859 N N   . SER A 1 267 ? 7.464  51.230 5.961   1.00 19.69 ? 247 SER A N   1 
ATOM   1860 C CA  . SER A 1 267 ? 7.235  51.543 7.365   1.00 18.57 ? 247 SER A CA  1 
ATOM   1861 C C   . SER A 1 267 ? 8.229  52.585 7.887   1.00 17.60 ? 247 SER A C   1 
ATOM   1862 O O   . SER A 1 267 ? 7.853  53.478 8.643   1.00 17.49 ? 247 SER A O   1 
ATOM   1863 C CB  . SER A 1 267 ? 7.324  50.266 8.209   1.00 18.54 ? 247 SER A CB  1 
ATOM   1864 O OG  . SER A 1 267 ? 7.060  50.536 9.572   1.00 19.70 ? 247 SER A OG  1 
ATOM   1865 N N   . ILE A 1 268 ? 9.495  52.470 7.495   1.00 16.50 ? 248 ILE A N   1 
ATOM   1866 C CA  . ILE A 1 268 ? 10.512 53.423 7.937   1.00 17.00 ? 248 ILE A CA  1 
ATOM   1867 C C   . ILE A 1 268 ? 10.186 54.822 7.403   1.00 18.52 ? 248 ILE A C   1 
ATOM   1868 O O   . ILE A 1 268 ? 10.303 55.822 8.118   1.00 20.03 ? 248 ILE A O   1 
ATOM   1869 C CB  . ILE A 1 268 ? 11.922 52.999 7.463   1.00 16.22 ? 248 ILE A CB  1 
ATOM   1870 C CG1 . ILE A 1 268 ? 12.312 51.674 8.129   1.00 17.66 ? 248 ILE A CG1 1 
ATOM   1871 C CG2 . ILE A 1 268 ? 12.940 54.075 7.825   1.00 15.27 ? 248 ILE A CG2 1 
ATOM   1872 C CD1 . ILE A 1 268 ? 13.545 51.019 7.538   1.00 17.46 ? 248 ILE A CD1 1 
ATOM   1873 N N   . LYS A 1 269 ? 9.765  54.889 6.148   1.00 20.46 ? 249 LYS A N   1 
ATOM   1874 C CA  . LYS A 1 269 ? 9.404  56.164 5.538   1.00 22.14 ? 249 LYS A CA  1 
ATOM   1875 C C   . LYS A 1 269 ? 8.240  56.789 6.301   1.00 22.22 ? 249 LYS A C   1 
ATOM   1876 O O   . LYS A 1 269 ? 8.261  57.980 6.618   1.00 21.61 ? 249 LYS A O   1 
ATOM   1877 C CB  . LYS A 1 269 ? 9.021  55.952 4.074   1.00 22.63 ? 249 LYS A CB  1 
ATOM   1878 C CG  . LYS A 1 269 ? 10.198 55.537 3.197   1.00 26.01 ? 249 LYS A CG  1 
ATOM   1879 C CD  . LYS A 1 269 ? 9.760  55.084 1.813   1.00 26.63 ? 249 LYS A CD  1 
ATOM   1880 C CE  . LYS A 1 269 ? 9.055  56.190 1.048   1.00 28.96 ? 249 LYS A CE  1 
ATOM   1881 N NZ  . LYS A 1 269 ? 8.748  55.784 -0.353  1.00 30.08 ? 249 LYS A NZ  1 
ATOM   1882 N N   . ALA A 1 270 ? 7.232  55.974 6.602   1.00 22.41 ? 250 ALA A N   1 
ATOM   1883 C CA  . ALA A 1 270 ? 6.057  56.437 7.329   1.00 22.60 ? 250 ALA A CA  1 
ATOM   1884 C C   . ALA A 1 270 ? 6.417  56.983 8.709   1.00 23.94 ? 250 ALA A C   1 
ATOM   1885 O O   . ALA A 1 270 ? 5.869  57.997 9.142   1.00 23.83 ? 250 ALA A O   1 
ATOM   1886 C CB  . ALA A 1 270 ? 5.047  55.298 7.462   1.00 21.82 ? 250 ALA A CB  1 
ATOM   1887 N N   . ALA A 1 271 ? 7.341  56.312 9.395   1.00 22.77 ? 251 ALA A N   1 
ATOM   1888 C CA  . ALA A 1 271 ? 7.766  56.731 10.726  1.00 24.39 ? 251 ALA A CA  1 
ATOM   1889 C C   . ALA A 1 271 ? 8.624  57.998 10.713  1.00 24.55 ? 251 ALA A C   1 
ATOM   1890 O O   . ALA A 1 271 ? 8.677  58.727 11.703  1.00 26.46 ? 251 ALA A O   1 
ATOM   1891 C CB  . ALA A 1 271 ? 8.527  55.589 11.413  1.00 23.35 ? 251 ALA A CB  1 
ATOM   1892 N N   . SER A 1 272 ? 9.295  58.258 9.596   1.00 25.11 ? 252 SER A N   1 
ATOM   1893 C CA  . SER A 1 272 ? 10.147 59.438 9.470   1.00 25.77 ? 252 SER A CA  1 
ATOM   1894 C C   . SER A 1 272 ? 9.544  60.463 8.511   1.00 27.37 ? 252 SER A C   1 
ATOM   1895 O O   . SER A 1 272 ? 10.270 61.256 7.910   1.00 27.60 ? 252 SER A O   1 
ATOM   1896 C CB  . SER A 1 272 ? 11.523 59.029 8.951   1.00 26.03 ? 252 SER A CB  1 
ATOM   1897 O OG  . SER A 1 272 ? 11.413 58.466 7.656   1.00 23.63 ? 252 SER A OG  1 
ATOM   1898 N N   . SER A 1 273 ? 8.219  60.453 8.385   1.00 27.89 ? 253 SER A N   1 
ATOM   1899 C CA  . SER A 1 273 ? 7.517  61.355 7.478   1.00 30.23 ? 253 SER A CA  1 
ATOM   1900 C C   . SER A 1 273 ? 7.641  62.853 7.759   1.00 31.52 ? 253 SER A C   1 
ATOM   1901 O O   . SER A 1 273 ? 7.195  63.664 6.950   1.00 32.33 ? 253 SER A O   1 
ATOM   1902 C CB  . SER A 1 273 ? 6.034  60.970 7.405   1.00 30.27 ? 253 SER A CB  1 
ATOM   1903 O OG  . SER A 1 273 ? 5.430  61.000 8.685   1.00 32.46 ? 253 SER A OG  1 
ATOM   1904 N N   . THR A 1 274 ? 8.234  63.234 8.887   1.00 32.89 ? 254 THR A N   1 
ATOM   1905 C CA  . THR A 1 274 ? 8.400  64.658 9.180   1.00 34.73 ? 254 THR A CA  1 
ATOM   1906 C C   . THR A 1 274 ? 9.424  65.249 8.209   1.00 34.93 ? 254 THR A C   1 
ATOM   1907 O O   . THR A 1 274 ? 9.580  66.465 8.112   1.00 34.83 ? 254 THR A O   1 
ATOM   1908 C CB  . THR A 1 274 ? 8.891  64.905 10.626  1.00 35.45 ? 254 THR A CB  1 
ATOM   1909 O OG1 . THR A 1 274 ? 10.204 64.358 10.791  1.00 36.54 ? 254 THR A OG1 1 
ATOM   1910 C CG2 . THR A 1 274 ? 7.942  64.266 11.628  1.00 37.41 ? 254 THR A CG2 1 
ATOM   1911 N N   . GLU A 1 275 ? 10.123 64.370 7.496   1.00 34.24 ? 255 GLU A N   1 
ATOM   1912 C CA  . GLU A 1 275 ? 11.120 64.772 6.522   1.00 33.32 ? 255 GLU A CA  1 
ATOM   1913 C C   . GLU A 1 275 ? 10.995 63.851 5.314   1.00 32.18 ? 255 GLU A C   1 
ATOM   1914 O O   . GLU A 1 275 ? 10.694 62.666 5.456   1.00 30.85 ? 255 GLU A O   1 
ATOM   1915 C CB  . GLU A 1 275 ? 12.516 64.652 7.125   1.00 35.38 ? 255 GLU A CB  1 
ATOM   1916 C CG  . GLU A 1 275 ? 13.547 65.522 6.441   1.00 37.64 ? 255 GLU A CG  1 
ATOM   1917 C CD  . GLU A 1 275 ? 13.171 66.987 6.491   1.00 38.42 ? 255 GLU A CD  1 
ATOM   1918 O OE1 . GLU A 1 275 ? 12.459 67.464 5.575   1.00 37.04 ? 255 GLU A OE1 1 
ATOM   1919 O OE2 . GLU A 1 275 ? 13.574 67.655 7.465   1.00 39.26 ? 255 GLU A OE2 1 
ATOM   1920 N N   . LYS A 1 276 ? 11.214 64.396 4.124   1.00 30.83 ? 256 LYS A N   1 
ATOM   1921 C CA  . LYS A 1 276 ? 11.118 63.596 2.915   1.00 29.59 ? 256 LYS A CA  1 
ATOM   1922 C C   . LYS A 1 276 ? 12.483 63.432 2.264   1.00 28.09 ? 256 LYS A C   1 
ATOM   1923 O O   . LYS A 1 276 ? 13.297 64.353 2.270   1.00 26.91 ? 256 LYS A O   1 
ATOM   1924 C CB  . LYS A 1 276 ? 10.141 64.243 1.928   1.00 32.88 ? 256 LYS A CB  1 
ATOM   1925 C CG  . LYS A 1 276 ? 8.697  64.291 2.419   1.00 35.98 ? 256 LYS A CG  1 
ATOM   1926 C CD  . LYS A 1 276 ? 8.187  62.895 2.780   1.00 38.22 ? 256 LYS A CD  1 
ATOM   1927 C CE  . LYS A 1 276 ? 6.690  62.894 3.069   1.00 39.73 ? 256 LYS A CE  1 
ATOM   1928 N NZ  . LYS A 1 276 ? 6.311  63.808 4.183   1.00 39.92 ? 256 LYS A NZ  1 
ATOM   1929 N N   . PHE A 1 277 ? 12.729 62.246 1.716   1.00 26.02 ? 257 PHE A N   1 
ATOM   1930 C CA  . PHE A 1 277 ? 13.989 61.947 1.049   1.00 25.18 ? 257 PHE A CA  1 
ATOM   1931 C C   . PHE A 1 277 ? 13.672 61.274 -0.280  1.00 25.01 ? 257 PHE A C   1 
ATOM   1932 O O   . PHE A 1 277 ? 12.639 60.622 -0.420  1.00 26.23 ? 257 PHE A O   1 
ATOM   1933 C CB  . PHE A 1 277 ? 14.858 61.017 1.913   1.00 24.10 ? 257 PHE A CB  1 
ATOM   1934 C CG  . PHE A 1 277 ? 15.156 61.563 3.283   1.00 23.82 ? 257 PHE A CG  1 
ATOM   1935 C CD1 . PHE A 1 277 ? 14.336 61.254 4.365   1.00 23.01 ? 257 PHE A CD1 1 
ATOM   1936 C CD2 . PHE A 1 277 ? 16.235 62.417 3.484   1.00 24.49 ? 257 PHE A CD2 1 
ATOM   1937 C CE1 . PHE A 1 277 ? 14.585 61.789 5.623   1.00 22.99 ? 257 PHE A CE1 1 
ATOM   1938 C CE2 . PHE A 1 277 ? 16.492 62.959 4.742   1.00 23.86 ? 257 PHE A CE2 1 
ATOM   1939 C CZ  . PHE A 1 277 ? 15.665 62.645 5.812   1.00 22.29 ? 257 PHE A CZ  1 
ATOM   1940 N N   . PRO A 1 278 ? 14.556 61.426 -1.279  1.00 24.07 ? 258 PRO A N   1 
ATOM   1941 C CA  . PRO A 1 278 ? 14.327 60.813 -2.591  1.00 23.67 ? 258 PRO A CA  1 
ATOM   1942 C C   . PRO A 1 278 ? 14.308 59.287 -2.535  1.00 23.69 ? 258 PRO A C   1 
ATOM   1943 O O   . PRO A 1 278 ? 14.887 58.686 -1.631  1.00 22.33 ? 258 PRO A O   1 
ATOM   1944 C CB  . PRO A 1 278 ? 15.482 61.356 -3.428  1.00 24.06 ? 258 PRO A CB  1 
ATOM   1945 C CG  . PRO A 1 278 ? 16.574 61.519 -2.419  1.00 24.33 ? 258 PRO A CG  1 
ATOM   1946 C CD  . PRO A 1 278 ? 15.846 62.137 -1.249  1.00 25.02 ? 258 PRO A CD  1 
ATOM   1947 N N   . ASP A 1 279 ? 13.635 58.668 -3.501  1.00 22.64 ? 259 ASP A N   1 
ATOM   1948 C CA  . ASP A 1 279 ? 13.544 57.211 -3.554  1.00 23.59 ? 259 ASP A CA  1 
ATOM   1949 C C   . ASP A 1 279 ? 14.918 56.560 -3.615  1.00 22.97 ? 259 ASP A C   1 
ATOM   1950 O O   . ASP A 1 279 ? 15.123 55.473 -3.070  1.00 23.09 ? 259 ASP A O   1 
ATOM   1951 C CB  . ASP A 1 279 ? 12.728 56.764 -4.770  1.00 26.24 ? 259 ASP A CB  1 
ATOM   1952 C CG  . ASP A 1 279 ? 11.334 57.345 -4.780  1.00 28.78 ? 259 ASP A CG  1 
ATOM   1953 O OD1 . ASP A 1 279 ? 10.694 57.369 -3.709  1.00 32.13 ? 259 ASP A OD1 1 
ATOM   1954 O OD2 . ASP A 1 279 ? 10.873 57.769 -5.862  1.00 33.87 ? 259 ASP A OD2 1 
ATOM   1955 N N   . GLY A 1 280 ? 15.853 57.225 -4.288  1.00 21.05 ? 260 GLY A N   1 
ATOM   1956 C CA  . GLY A 1 280 ? 17.202 56.707 -4.411  1.00 21.13 ? 260 GLY A CA  1 
ATOM   1957 C C   . GLY A 1 280 ? 17.918 56.568 -3.080  1.00 20.50 ? 260 GLY A C   1 
ATOM   1958 O O   . GLY A 1 280 ? 18.774 55.698 -2.923  1.00 20.01 ? 260 GLY A O   1 
ATOM   1959 N N   . PHE A 1 281 ? 17.584 57.428 -2.121  1.00 20.40 ? 261 PHE A N   1 
ATOM   1960 C CA  . PHE A 1 281 ? 18.202 57.364 -0.802  1.00 19.79 ? 261 PHE A CA  1 
ATOM   1961 C C   . PHE A 1 281 ? 17.868 56.007 -0.186  1.00 19.59 ? 261 PHE A C   1 
ATOM   1962 O O   . PHE A 1 281 ? 18.748 55.306 0.317   1.00 19.77 ? 261 PHE A O   1 
ATOM   1963 C CB  . PHE A 1 281 ? 17.660 58.491 0.088   1.00 19.23 ? 261 PHE A CB  1 
ATOM   1964 C CG  . PHE A 1 281 ? 18.133 58.429 1.516   1.00 19.68 ? 261 PHE A CG  1 
ATOM   1965 C CD1 . PHE A 1 281 ? 19.466 58.666 1.836   1.00 18.65 ? 261 PHE A CD1 1 
ATOM   1966 C CD2 . PHE A 1 281 ? 17.240 58.141 2.546   1.00 19.42 ? 261 PHE A CD2 1 
ATOM   1967 C CE1 . PHE A 1 281 ? 19.903 58.618 3.163   1.00 20.13 ? 261 PHE A CE1 1 
ATOM   1968 C CE2 . PHE A 1 281 ? 17.667 58.091 3.877   1.00 19.90 ? 261 PHE A CE2 1 
ATOM   1969 C CZ  . PHE A 1 281 ? 19.000 58.330 4.186   1.00 19.43 ? 261 PHE A CZ  1 
ATOM   1970 N N   . TRP A 1 282 ? 16.592 55.638 -0.251  1.00 19.74 ? 262 TRP A N   1 
ATOM   1971 C CA  . TRP A 1 282 ? 16.117 54.377 0.306   1.00 20.08 ? 262 TRP A CA  1 
ATOM   1972 C C   . TRP A 1 282 ? 16.668 53.149 -0.410  1.00 20.37 ? 262 TRP A C   1 
ATOM   1973 O O   . TRP A 1 282 ? 16.626 52.041 0.130   1.00 20.04 ? 262 TRP A O   1 
ATOM   1974 C CB  . TRP A 1 282 ? 14.587 54.352 0.295   1.00 19.53 ? 262 TRP A CB  1 
ATOM   1975 C CG  . TRP A 1 282 ? 13.994 55.483 1.077   1.00 20.49 ? 262 TRP A CG  1 
ATOM   1976 C CD1 . TRP A 1 282 ? 13.252 56.519 0.587   1.00 20.95 ? 262 TRP A CD1 1 
ATOM   1977 C CD2 . TRP A 1 282 ? 14.127 55.714 2.483   1.00 19.57 ? 262 TRP A CD2 1 
ATOM   1978 N NE1 . TRP A 1 282 ? 12.917 57.382 1.603   1.00 19.35 ? 262 TRP A NE1 1 
ATOM   1979 C CE2 . TRP A 1 282 ? 13.440 56.912 2.777   1.00 20.60 ? 262 TRP A CE2 1 
ATOM   1980 C CE3 . TRP A 1 282 ? 14.762 55.025 3.527   1.00 20.79 ? 262 TRP A CE3 1 
ATOM   1981 C CZ2 . TRP A 1 282 ? 13.368 57.438 4.072   1.00 19.14 ? 262 TRP A CZ2 1 
ATOM   1982 C CZ3 . TRP A 1 282 ? 14.691 55.547 4.813   1.00 20.93 ? 262 TRP A CZ3 1 
ATOM   1983 C CH2 . TRP A 1 282 ? 13.997 56.743 5.073   1.00 23.35 ? 262 TRP A CH2 1 
ATOM   1984 N N   . LEU A 1 283 ? 17.185 53.347 -1.621  1.00 21.19 ? 263 LEU A N   1 
ATOM   1985 C CA  . LEU A 1 283 ? 17.771 52.256 -2.400  1.00 20.52 ? 263 LEU A CA  1 
ATOM   1986 C C   . LEU A 1 283 ? 19.298 52.233 -2.266  1.00 20.93 ? 263 LEU A C   1 
ATOM   1987 O O   . LEU A 1 283 ? 19.975 51.402 -2.879  1.00 20.34 ? 263 LEU A O   1 
ATOM   1988 C CB  . LEU A 1 283 ? 17.379 52.392 -3.874  1.00 21.49 ? 263 LEU A CB  1 
ATOM   1989 C CG  . LEU A 1 283 ? 15.871 52.330 -4.134  1.00 23.40 ? 263 LEU A CG  1 
ATOM   1990 C CD1 . LEU A 1 283 ? 15.576 52.692 -5.577  1.00 22.60 ? 263 LEU A CD1 1 
ATOM   1991 C CD2 . LEU A 1 283 ? 15.354 50.936 -3.792  1.00 22.94 ? 263 LEU A CD2 1 
ATOM   1992 N N   . GLY A 1 284 ? 19.833 53.146 -1.459  1.00 21.23 ? 264 GLY A N   1 
ATOM   1993 C CA  . GLY A 1 284 ? 21.268 53.220 -1.252  1.00 22.24 ? 264 GLY A CA  1 
ATOM   1994 C C   . GLY A 1 284 ? 22.028 53.790 -2.436  1.00 23.61 ? 264 GLY A C   1 
ATOM   1995 O O   . GLY A 1 284 ? 23.253 53.683 -2.500  1.00 24.25 ? 264 GLY A O   1 
ATOM   1996 N N   . GLU A 1 285 ? 21.307 54.403 -3.370  1.00 23.83 ? 265 GLU A N   1 
ATOM   1997 C CA  . GLU A 1 285 ? 21.913 54.988 -4.564  1.00 25.64 ? 265 GLU A CA  1 
ATOM   1998 C C   . GLU A 1 285 ? 22.233 56.468 -4.400  1.00 26.46 ? 265 GLU A C   1 
ATOM   1999 O O   . GLU A 1 285 ? 23.107 56.998 -5.087  1.00 26.78 ? 265 GLU A O   1 
ATOM   2000 C CB  . GLU A 1 285 ? 20.984 54.792 -5.763  1.00 27.23 ? 265 GLU A CB  1 
ATOM   2001 C CG  . GLU A 1 285 ? 20.760 53.328 -6.116  1.00 29.46 ? 265 GLU A CG  1 
ATOM   2002 C CD  . GLU A 1 285 ? 19.626 53.128 -7.095  1.00 31.02 ? 265 GLU A CD  1 
ATOM   2003 O OE1 . GLU A 1 285 ? 19.381 51.969 -7.486  1.00 34.36 ? 265 GLU A OE1 1 
ATOM   2004 O OE2 . GLU A 1 285 ? 18.978 54.127 -7.469  1.00 32.31 ? 265 GLU A OE2 1 
ATOM   2005 N N   . GLN A 1 286 ? 21.525 57.132 -3.492  1.00 26.00 ? 266 GLN A N   1 
ATOM   2006 C CA  . GLN A 1 286 ? 21.744 58.551 -3.238  1.00 25.91 ? 266 GLN A CA  1 
ATOM   2007 C C   . GLN A 1 286 ? 22.122 58.785 -1.781  1.00 25.25 ? 266 GLN A C   1 
ATOM   2008 O O   . GLN A 1 286 ? 21.588 58.143 -0.875  1.00 25.32 ? 266 GLN A O   1 
ATOM   2009 C CB  . GLN A 1 286 ? 20.481 59.358 -3.541  1.00 24.77 ? 266 GLN A CB  1 
ATOM   2010 C CG  . GLN A 1 286 ? 19.943 59.215 -4.948  1.00 27.71 ? 266 GLN A CG  1 
ATOM   2011 C CD  . GLN A 1 286 ? 18.683 60.029 -5.153  1.00 27.28 ? 266 GLN A CD  1 
ATOM   2012 O OE1 . GLN A 1 286 ? 17.649 59.504 -5.559  1.00 27.72 ? 266 GLN A OE1 1 
ATOM   2013 N NE2 . GLN A 1 286 ? 18.764 61.323 -4.866  1.00 30.98 ? 266 GLN A NE2 1 
ATOM   2014 N N   . LEU A 1 287 ? 23.043 59.714 -1.562  1.00 25.24 ? 267 LEU A N   1 
ATOM   2015 C CA  . LEU A 1 287 ? 23.473 60.053 -0.217  1.00 25.30 ? 267 LEU A CA  1 
ATOM   2016 C C   . LEU A 1 287 ? 22.810 61.365 0.178   1.00 24.77 ? 267 LEU A C   1 
ATOM   2017 O O   . LEU A 1 287 ? 22.470 62.178 -0.680  1.00 24.51 ? 267 LEU A O   1 
ATOM   2018 C CB  . LEU A 1 287 ? 24.991 60.235 -0.164  1.00 27.51 ? 267 LEU A CB  1 
ATOM   2019 C CG  . LEU A 1 287 ? 25.896 59.112 -0.671  1.00 28.53 ? 267 LEU A CG  1 
ATOM   2020 C CD1 . LEU A 1 287 ? 27.346 59.543 -0.517  1.00 27.89 ? 267 LEU A CD1 1 
ATOM   2021 C CD2 . LEU A 1 287 ? 25.631 57.828 0.111   1.00 29.10 ? 267 LEU A CD2 1 
ATOM   2022 N N   . VAL A 1 288 ? 22.612 61.556 1.475   1.00 23.75 ? 268 VAL A N   1 
ATOM   2023 C CA  . VAL A 1 288 ? 22.030 62.788 1.988   1.00 23.17 ? 268 VAL A CA  1 
ATOM   2024 C C   . VAL A 1 288 ? 23.014 63.291 3.036   1.00 23.49 ? 268 VAL A C   1 
ATOM   2025 O O   . VAL A 1 288 ? 23.454 62.534 3.900   1.00 22.70 ? 268 VAL A O   1 
ATOM   2026 C CB  . VAL A 1 288 ? 20.646 62.547 2.626   1.00 22.89 ? 268 VAL A CB  1 
ATOM   2027 C CG1 . VAL A 1 288 ? 20.162 63.812 3.321   1.00 21.81 ? 268 VAL A CG1 1 
ATOM   2028 C CG2 . VAL A 1 288 ? 19.646 62.141 1.542   1.00 23.29 ? 268 VAL A CG2 1 
ATOM   2029 N N   . CYS A 1 289 ? 23.375 64.564 2.950   1.00 23.32 ? 269 CYS A N   1 
ATOM   2030 C CA  . CYS A 1 289 ? 24.335 65.124 3.889   1.00 24.64 ? 269 CYS A CA  1 
ATOM   2031 C C   . CYS A 1 289 ? 23.731 66.238 4.734   1.00 25.00 ? 269 CYS A C   1 
ATOM   2032 O O   . CYS A 1 289 ? 22.846 66.971 4.284   1.00 23.82 ? 269 CYS A O   1 
ATOM   2033 C CB  . CYS A 1 289 ? 25.546 65.667 3.133   1.00 24.93 ? 269 CYS A CB  1 
ATOM   2034 S SG  . CYS A 1 289 ? 26.136 64.633 1.756   1.00 25.26 ? 269 CYS A SG  1 
ATOM   2035 N N   . TRP A 1 290 ? 24.225 66.355 5.963   1.00 25.02 ? 270 TRP A N   1 
ATOM   2036 C CA  . TRP A 1 290 ? 23.775 67.372 6.904   1.00 26.30 ? 270 TRP A CA  1 
ATOM   2037 C C   . TRP A 1 290 ? 24.985 68.182 7.358   1.00 27.89 ? 270 TRP A C   1 
ATOM   2038 O O   . TRP A 1 290 ? 26.112 67.696 7.316   1.00 27.84 ? 270 TRP A O   1 
ATOM   2039 C CB  . TRP A 1 290 ? 23.135 66.711 8.127   1.00 28.11 ? 270 TRP A CB  1 
ATOM   2040 C CG  . TRP A 1 290 ? 21.725 66.251 7.931   1.00 28.32 ? 270 TRP A CG  1 
ATOM   2041 C CD1 . TRP A 1 290 ? 20.588 66.964 8.182   1.00 29.00 ? 270 TRP A CD1 1 
ATOM   2042 C CD2 . TRP A 1 290 ? 21.298 64.972 7.447   1.00 27.55 ? 270 TRP A CD2 1 
ATOM   2043 N NE1 . TRP A 1 290 ? 19.479 66.209 7.886   1.00 28.14 ? 270 TRP A NE1 1 
ATOM   2044 C CE2 . TRP A 1 290 ? 19.885 64.982 7.432   1.00 27.71 ? 270 TRP A CE2 1 
ATOM   2045 C CE3 . TRP A 1 290 ? 21.972 63.818 7.022   1.00 27.46 ? 270 TRP A CE3 1 
ATOM   2046 C CZ2 . TRP A 1 290 ? 19.131 63.881 7.010   1.00 27.70 ? 270 TRP A CZ2 1 
ATOM   2047 C CZ3 . TRP A 1 290 ? 21.220 62.720 6.601   1.00 26.94 ? 270 TRP A CZ3 1 
ATOM   2048 C CH2 . TRP A 1 290 ? 19.813 62.763 6.599   1.00 26.80 ? 270 TRP A CH2 1 
ATOM   2049 N N   . GLN A 1 291 ? 24.753 69.414 7.794   1.00 29.37 ? 271 GLN A N   1 
ATOM   2050 C CA  . GLN A 1 291 ? 25.841 70.256 8.277   1.00 31.27 ? 271 GLN A CA  1 
ATOM   2051 C C   . GLN A 1 291 ? 26.439 69.530 9.480   1.00 31.79 ? 271 GLN A C   1 
ATOM   2052 O O   . GLN A 1 291 ? 25.707 69.033 10.332  1.00 30.84 ? 271 GLN A O   1 
ATOM   2053 C CB  . GLN A 1 291 ? 25.315 71.628 8.711   1.00 33.27 ? 271 GLN A CB  1 
ATOM   2054 C CG  . GLN A 1 291 ? 24.201 72.185 7.829   1.00 38.16 ? 271 GLN A CG  1 
ATOM   2055 C CD  . GLN A 1 291 ? 22.826 72.050 8.474   1.00 41.11 ? 271 GLN A CD  1 
ATOM   2056 O OE1 . GLN A 1 291 ? 22.441 72.866 9.317   1.00 41.21 ? 271 GLN A OE1 1 
ATOM   2057 N NE2 . GLN A 1 291 ? 22.084 71.010 8.090   1.00 41.02 ? 271 GLN A NE2 1 
ATOM   2058 N N   . ALA A 1 292 ? 27.765 69.470 9.538   1.00 32.57 ? 272 ALA A N   1 
ATOM   2059 C CA  . ALA A 1 292 ? 28.475 68.797 10.620  1.00 34.05 ? 272 ALA A CA  1 
ATOM   2060 C C   . ALA A 1 292 ? 27.776 68.839 11.980  1.00 34.78 ? 272 ALA A C   1 
ATOM   2061 O O   . ALA A 1 292 ? 27.519 69.907 12.531  1.00 33.97 ? 272 ALA A O   1 
ATOM   2062 C CB  . ALA A 1 292 ? 29.880 69.370 10.744  1.00 34.28 ? 272 ALA A CB  1 
ATOM   2063 N N   . GLY A 1 293 ? 27.468 67.657 12.506  1.00 36.96 ? 273 GLY A N   1 
ATOM   2064 C CA  . GLY A 1 293 ? 26.826 67.546 13.805  1.00 37.27 ? 273 GLY A CA  1 
ATOM   2065 C C   . GLY A 1 293 ? 25.372 67.964 13.919  1.00 38.21 ? 273 GLY A C   1 
ATOM   2066 O O   . GLY A 1 293 ? 24.918 68.299 15.013  1.00 40.14 ? 273 GLY A O   1 
ATOM   2067 N N   . THR A 1 294 ? 24.631 67.937 12.815  1.00 37.99 ? 274 THR A N   1 
ATOM   2068 C CA  . THR A 1 294 ? 23.224 68.331 12.844  1.00 37.21 ? 274 THR A CA  1 
ATOM   2069 C C   . THR A 1 294 ? 22.261 67.244 12.363  1.00 36.45 ? 274 THR A C   1 
ATOM   2070 O O   . THR A 1 294 ? 21.070 67.504 12.196  1.00 36.27 ? 274 THR A O   1 
ATOM   2071 C CB  . THR A 1 294 ? 22.968 69.580 11.977  1.00 37.50 ? 274 THR A CB  1 
ATOM   2072 O OG1 . THR A 1 294 ? 23.218 69.260 10.604  1.00 36.05 ? 274 THR A OG1 1 
ATOM   2073 C CG2 . THR A 1 294 ? 23.872 70.731 12.404  1.00 37.87 ? 274 THR A CG2 1 
ATOM   2074 N N   . THR A 1 295 ? 22.765 66.036 12.133  1.00 35.25 ? 275 THR A N   1 
ATOM   2075 C CA  . THR A 1 295 ? 21.907 64.949 11.671  1.00 34.69 ? 275 THR A CA  1 
ATOM   2076 C C   . THR A 1 295 ? 20.763 64.731 12.655  1.00 33.61 ? 275 THR A C   1 
ATOM   2077 O O   . THR A 1 295 ? 20.989 64.438 13.826  1.00 34.43 ? 275 THR A O   1 
ATOM   2078 C CB  . THR A 1 295 ? 22.693 63.637 11.524  1.00 33.55 ? 275 THR A CB  1 
ATOM   2079 O OG1 . THR A 1 295 ? 23.826 63.857 10.677  1.00 35.32 ? 275 THR A OG1 1 
ATOM   2080 C CG2 . THR A 1 295 ? 21.815 62.559 10.900  1.00 33.37 ? 275 THR A CG2 1 
ATOM   2081 N N   . PRO A 1 296 ? 19.513 64.875 12.186  1.00 33.04 ? 276 PRO A N   1 
ATOM   2082 C CA  . PRO A 1 296 ? 18.311 64.702 13.007  1.00 32.12 ? 276 PRO A CA  1 
ATOM   2083 C C   . PRO A 1 296 ? 18.002 63.232 13.258  1.00 31.29 ? 276 PRO A C   1 
ATOM   2084 O O   . PRO A 1 296 ? 17.018 62.699 12.748  1.00 30.77 ? 276 PRO A O   1 
ATOM   2085 C CB  . PRO A 1 296 ? 17.236 65.379 12.170  1.00 32.49 ? 276 PRO A CB  1 
ATOM   2086 C CG  . PRO A 1 296 ? 17.644 65.000 10.788  1.00 32.59 ? 276 PRO A CG  1 
ATOM   2087 C CD  . PRO A 1 296 ? 19.146 65.242 10.808  1.00 32.58 ? 276 PRO A CD  1 
ATOM   2088 N N   . TRP A 1 297 ? 18.849 62.584 14.051  1.00 30.01 ? 277 TRP A N   1 
ATOM   2089 C CA  . TRP A 1 297 ? 18.673 61.174 14.371  1.00 27.31 ? 277 TRP A CA  1 
ATOM   2090 C C   . TRP A 1 297 ? 17.255 60.888 14.854  1.00 27.02 ? 277 TRP A C   1 
ATOM   2091 O O   . TRP A 1 297 ? 16.680 59.852 14.530  1.00 25.67 ? 277 TRP A O   1 
ATOM   2092 C CB  . TRP A 1 297 ? 19.675 60.747 15.451  1.00 26.56 ? 277 TRP A CB  1 
ATOM   2093 C CG  . TRP A 1 297 ? 21.115 60.969 15.080  1.00 25.04 ? 277 TRP A CG  1 
ATOM   2094 C CD1 . TRP A 1 297 ? 21.956 61.917 15.588  1.00 25.49 ? 277 TRP A CD1 1 
ATOM   2095 C CD2 . TRP A 1 297 ? 21.881 60.226 14.124  1.00 24.10 ? 277 TRP A CD2 1 
ATOM   2096 N NE1 . TRP A 1 297 ? 23.199 61.809 15.011  1.00 24.59 ? 277 TRP A NE1 1 
ATOM   2097 C CE2 . TRP A 1 297 ? 23.181 60.779 14.108  1.00 25.20 ? 277 TRP A CE2 1 
ATOM   2098 C CE3 . TRP A 1 297 ? 21.595 59.145 13.279  1.00 25.02 ? 277 TRP A CE3 1 
ATOM   2099 C CZ2 . TRP A 1 297 ? 24.196 60.287 13.278  1.00 23.65 ? 277 TRP A CZ2 1 
ATOM   2100 C CZ3 . TRP A 1 297 ? 22.607 58.656 12.451  1.00 24.74 ? 277 TRP A CZ3 1 
ATOM   2101 C CH2 . TRP A 1 297 ? 23.890 59.229 12.460  1.00 25.54 ? 277 TRP A CH2 1 
ATOM   2102 N N   . ASN A 1 298 ? 16.698 61.825 15.616  1.00 26.01 ? 278 ASN A N   1 
ATOM   2103 C CA  . ASN A 1 298 ? 15.360 61.705 16.189  1.00 28.96 ? 278 ASN A CA  1 
ATOM   2104 C C   . ASN A 1 298 ? 14.209 61.466 15.211  1.00 27.92 ? 278 ASN A C   1 
ATOM   2105 O O   . ASN A 1 298 ? 13.195 60.872 15.582  1.00 29.05 ? 278 ASN A O   1 
ATOM   2106 C CB  . ASN A 1 298 ? 15.055 62.950 17.027  1.00 31.92 ? 278 ASN A CB  1 
ATOM   2107 C CG  . ASN A 1 298 ? 14.986 64.214 16.188  1.00 34.57 ? 278 ASN A CG  1 
ATOM   2108 O OD1 . ASN A 1 298 ? 13.993 64.467 15.503  1.00 37.02 ? 278 ASN A OD1 1 
ATOM   2109 N ND2 . ASN A 1 298 ? 16.048 65.010 16.229  1.00 37.27 ? 278 ASN A ND2 1 
ATOM   2110 N N   . ILE A 1 299 ? 14.347 61.925 13.973  1.00 27.51 ? 279 ILE A N   1 
ATOM   2111 C CA  . ILE A 1 299 ? 13.272 61.741 13.001  1.00 26.10 ? 279 ILE A CA  1 
ATOM   2112 C C   . ILE A 1 299 ? 13.209 60.325 12.432  1.00 24.32 ? 279 ILE A C   1 
ATOM   2113 O O   . ILE A 1 299 ? 12.197 59.938 11.850  1.00 23.68 ? 279 ILE A O   1 
ATOM   2114 C CB  . ILE A 1 299 ? 13.383 62.732 11.821  1.00 27.70 ? 279 ILE A CB  1 
ATOM   2115 C CG1 . ILE A 1 299 ? 14.623 62.418 10.984  1.00 28.14 ? 279 ILE A CG1 1 
ATOM   2116 C CG2 . ILE A 1 299 ? 13.418 64.162 12.346  1.00 28.23 ? 279 ILE A CG2 1 
ATOM   2117 C CD1 . ILE A 1 299 ? 14.688 63.186 9.690   1.00 30.51 ? 279 ILE A CD1 1 
ATOM   2118 N N   . PHE A 1 300 ? 14.284 59.558 12.600  1.00 22.64 ? 280 PHE A N   1 
ATOM   2119 C CA  . PHE A 1 300 ? 14.336 58.182 12.103  1.00 21.31 ? 280 PHE A CA  1 
ATOM   2120 C C   . PHE A 1 300 ? 13.924 57.200 13.203  1.00 20.32 ? 280 PHE A C   1 
ATOM   2121 O O   . PHE A 1 300 ? 14.220 57.406 14.376  1.00 19.70 ? 280 PHE A O   1 
ATOM   2122 C CB  . PHE A 1 300 ? 15.749 57.857 11.611  1.00 21.72 ? 280 PHE A CB  1 
ATOM   2123 C CG  . PHE A 1 300 ? 16.159 58.632 10.391  1.00 23.88 ? 280 PHE A CG  1 
ATOM   2124 C CD1 . PHE A 1 300 ? 15.691 58.271 9.131   1.00 23.84 ? 280 PHE A CD1 1 
ATOM   2125 C CD2 . PHE A 1 300 ? 17.004 59.732 10.501  1.00 24.38 ? 280 PHE A CD2 1 
ATOM   2126 C CE1 . PHE A 1 300 ? 16.059 58.994 7.997   1.00 25.04 ? 280 PHE A CE1 1 
ATOM   2127 C CE2 . PHE A 1 300 ? 17.377 60.462 9.374   1.00 24.93 ? 280 PHE A CE2 1 
ATOM   2128 C CZ  . PHE A 1 300 ? 16.903 60.091 8.119   1.00 23.83 ? 280 PHE A CZ  1 
ATOM   2129 N N   . PRO A 1 301 ? 13.242 56.107 12.828  1.00 19.92 ? 281 PRO A N   1 
ATOM   2130 C CA  . PRO A 1 301 ? 12.786 55.098 13.791  1.00 18.91 ? 281 PRO A CA  1 
ATOM   2131 C C   . PRO A 1 301 ? 13.840 54.079 14.204  1.00 18.73 ? 281 PRO A C   1 
ATOM   2132 O O   . PRO A 1 301 ? 14.873 53.928 13.551  1.00 18.86 ? 281 PRO A O   1 
ATOM   2133 C CB  . PRO A 1 301 ? 11.639 54.430 13.049  1.00 18.33 ? 281 PRO A CB  1 
ATOM   2134 C CG  . PRO A 1 301 ? 12.171 54.396 11.643  1.00 18.41 ? 281 PRO A CG  1 
ATOM   2135 C CD  . PRO A 1 301 ? 12.740 55.801 11.476  1.00 18.34 ? 281 PRO A CD  1 
ATOM   2136 N N   . VAL A 1 302 ? 13.567 53.379 15.297  1.00 17.74 ? 282 VAL A N   1 
ATOM   2137 C CA  . VAL A 1 302 ? 14.465 52.326 15.750  1.00 18.31 ? 282 VAL A CA  1 
ATOM   2138 C C   . VAL A 1 302 ? 13.938 51.084 15.039  1.00 18.44 ? 282 VAL A C   1 
ATOM   2139 O O   . VAL A 1 302 ? 12.795 51.070 14.565  1.00 18.78 ? 282 VAL A O   1 
ATOM   2140 C CB  . VAL A 1 302 ? 14.414 52.109 17.286  1.00 18.45 ? 282 VAL A CB  1 
ATOM   2141 C CG1 . VAL A 1 302 ? 14.923 53.349 18.009  1.00 18.81 ? 282 VAL A CG1 1 
ATOM   2142 C CG2 . VAL A 1 302 ? 13.000 51.758 17.729  1.00 18.47 ? 282 VAL A CG2 1 
ATOM   2143 N N   . ILE A 1 303 ? 14.770 50.054 14.945  1.00 16.89 ? 283 ILE A N   1 
ATOM   2144 C CA  . ILE A 1 303 ? 14.377 48.825 14.277  1.00 14.85 ? 283 ILE A CA  1 
ATOM   2145 C C   . ILE A 1 303 ? 14.659 47.647 15.204  1.00 14.59 ? 283 ILE A C   1 
ATOM   2146 O O   . ILE A 1 303 ? 15.739 47.552 15.793  1.00 12.64 ? 283 ILE A O   1 
ATOM   2147 C CB  . ILE A 1 303 ? 15.150 48.663 12.944  1.00 16.54 ? 283 ILE A CB  1 
ATOM   2148 C CG1 . ILE A 1 303 ? 14.789 49.823 12.001  1.00 18.16 ? 283 ILE A CG1 1 
ATOM   2149 C CG2 . ILE A 1 303 ? 14.807 47.324 12.293  1.00 15.31 ? 283 ILE A CG2 1 
ATOM   2150 C CD1 . ILE A 1 303 ? 15.601 49.866 10.721  1.00 21.07 ? 283 ILE A CD1 1 
ATOM   2151 N N   . SER A 1 304 ? 13.676 46.764 15.341  1.00 15.27 ? 284 SER A N   1 
ATOM   2152 C CA  . SER A 1 304 ? 13.807 45.605 16.213  1.00 14.42 ? 284 SER A CA  1 
ATOM   2153 C C   . SER A 1 304 ? 13.644 44.275 15.488  1.00 14.82 ? 284 SER A C   1 
ATOM   2154 O O   . SER A 1 304 ? 12.725 44.094 14.691  1.00 15.77 ? 284 SER A O   1 
ATOM   2155 C CB  . SER A 1 304 ? 12.765 45.671 17.345  1.00 15.27 ? 284 SER A CB  1 
ATOM   2156 O OG  . SER A 1 304 ? 12.997 46.759 18.226  1.00 16.03 ? 284 SER A OG  1 
ATOM   2157 N N   . LEU A 1 305 ? 14.550 43.346 15.768  1.00 13.71 ? 285 LEU A N   1 
ATOM   2158 C CA  . LEU A 1 305 ? 14.475 42.014 15.197  1.00 12.71 ? 285 LEU A CA  1 
ATOM   2159 C C   . LEU A 1 305 ? 14.302 41.082 16.388  1.00 13.42 ? 285 LEU A C   1 
ATOM   2160 O O   . LEU A 1 305 ? 15.095 41.124 17.332  1.00 13.07 ? 285 LEU A O   1 
ATOM   2161 C CB  . LEU A 1 305 ? 15.769 41.637 14.460  1.00 14.35 ? 285 LEU A CB  1 
ATOM   2162 C CG  . LEU A 1 305 ? 16.318 42.486 13.307  1.00 13.85 ? 285 LEU A CG  1 
ATOM   2163 C CD1 . LEU A 1 305 ? 17.508 41.752 12.681  1.00 14.65 ? 285 LEU A CD1 1 
ATOM   2164 C CD2 . LEU A 1 305 ? 15.249 42.720 12.256  1.00 15.53 ? 285 LEU A CD2 1 
ATOM   2165 N N   . TYR A 1 306 ? 13.248 40.276 16.377  1.00 13.33 ? 286 TYR A N   1 
ATOM   2166 C CA  . TYR A 1 306 ? 13.042 39.322 17.461  1.00 12.74 ? 286 TYR A CA  1 
ATOM   2167 C C   . TYR A 1 306 ? 13.662 38.022 16.980  1.00 13.05 ? 286 TYR A C   1 
ATOM   2168 O O   . TYR A 1 306 ? 13.411 37.591 15.855  1.00 14.21 ? 286 TYR A O   1 
ATOM   2169 C CB  . TYR A 1 306 ? 11.558 39.086 17.741  1.00 14.37 ? 286 TYR A CB  1 
ATOM   2170 C CG  . TYR A 1 306 ? 10.853 40.207 18.475  1.00 15.33 ? 286 TYR A CG  1 
ATOM   2171 C CD1 . TYR A 1 306 ? 10.710 41.468 17.894  1.00 14.99 ? 286 TYR A CD1 1 
ATOM   2172 C CD2 . TYR A 1 306 ? 10.275 39.990 19.730  1.00 15.55 ? 286 TYR A CD2 1 
ATOM   2173 C CE1 . TYR A 1 306 ? 10.008 42.479 18.537  1.00 13.57 ? 286 TYR A CE1 1 
ATOM   2174 C CE2 . TYR A 1 306 ? 9.569  40.996 20.378  1.00 14.92 ? 286 TYR A CE2 1 
ATOM   2175 C CZ  . TYR A 1 306 ? 9.437  42.239 19.768  1.00 14.61 ? 286 TYR A CZ  1 
ATOM   2176 O OH  . TYR A 1 306 ? 8.712  43.243 20.371  1.00 16.82 ? 286 TYR A OH  1 
ATOM   2177 N N   . LEU A 1 307 ? 14.469 37.404 17.831  1.00 13.25 ? 287 LEU A N   1 
ATOM   2178 C CA  . LEU A 1 307 ? 15.132 36.155 17.486  1.00 13.16 ? 287 LEU A CA  1 
ATOM   2179 C C   . LEU A 1 307 ? 14.609 35.026 18.370  1.00 12.61 ? 287 LEU A C   1 
ATOM   2180 O O   . LEU A 1 307 ? 14.209 35.255 19.509  1.00 12.89 ? 287 LEU A O   1 
ATOM   2181 C CB  . LEU A 1 307 ? 16.646 36.308 17.672  1.00 14.93 ? 287 LEU A CB  1 
ATOM   2182 C CG  . LEU A 1 307 ? 17.274 37.473 16.888  1.00 16.19 ? 287 LEU A CG  1 
ATOM   2183 C CD1 . LEU A 1 307 ? 18.745 37.629 17.237  1.00 17.76 ? 287 LEU A CD1 1 
ATOM   2184 C CD2 . LEU A 1 307 ? 17.103 37.219 15.402  1.00 19.26 ? 287 LEU A CD2 1 
ATOM   2185 N N   . MET A 1 308 ? 14.593 33.817 17.823  1.00 12.48 ? 288 MET A N   1 
ATOM   2186 C CA  . MET A 1 308 ? 14.143 32.644 18.553  1.00 13.56 ? 288 MET A CA  1 
ATOM   2187 C C   . MET A 1 308 ? 15.056 32.504 19.754  1.00 14.01 ? 288 MET A C   1 
ATOM   2188 O O   . MET A 1 308 ? 16.268 32.686 19.627  1.00 14.77 ? 288 MET A O   1 
ATOM   2189 C CB  . MET A 1 308 ? 14.270 31.400 17.675  1.00 15.63 ? 288 MET A CB  1 
ATOM   2190 C CG  . MET A 1 308 ? 14.001 30.096 18.405  1.00 16.87 ? 288 MET A CG  1 
ATOM   2191 S SD  . MET A 1 308 ? 14.358 28.696 17.331  1.00 23.72 ? 288 MET A SD  1 
ATOM   2192 C CE  . MET A 1 308 ? 12.999 28.802 16.221  1.00 16.90 ? 288 MET A CE  1 
ATOM   2193 N N   . GLY A 1 309 ? 14.478 32.174 20.907  1.00 13.61 ? 289 GLY A N   1 
ATOM   2194 C CA  . GLY A 1 309 ? 15.265 32.028 22.120  1.00 13.74 ? 289 GLY A CA  1 
ATOM   2195 C C   . GLY A 1 309 ? 15.663 30.598 22.427  1.00 14.08 ? 289 GLY A C   1 
ATOM   2196 O O   . GLY A 1 309 ? 15.432 29.692 21.633  1.00 15.29 ? 289 GLY A O   1 
ATOM   2197 N N   . GLU A 1 310 ? 16.258 30.390 23.595  1.00 14.91 ? 290 GLU A N   1 
ATOM   2198 C CA  . GLU A 1 310 ? 16.694 29.056 23.992  1.00 14.27 ? 290 GLU A CA  1 
ATOM   2199 C C   . GLU A 1 310 ? 15.606 28.184 24.618  1.00 14.56 ? 290 GLU A C   1 
ATOM   2200 O O   . GLU A 1 310 ? 15.795 26.978 24.787  1.00 15.04 ? 290 GLU A O   1 
ATOM   2201 C CB  . GLU A 1 310 ? 17.872 29.165 24.959  1.00 13.50 ? 290 GLU A CB  1 
ATOM   2202 C CG  . GLU A 1 310 ? 19.109 29.794 24.343  1.00 15.83 ? 290 GLU A CG  1 
ATOM   2203 C CD  . GLU A 1 310 ? 20.346 29.553 25.173  1.00 15.13 ? 290 GLU A CD  1 
ATOM   2204 O OE1 . GLU A 1 310 ? 20.546 30.265 26.175  1.00 22.58 ? 290 GLU A OE1 1 
ATOM   2205 O OE2 . GLU A 1 310 ? 21.108 28.633 24.823  1.00 19.55 ? 290 GLU A OE2 1 
ATOM   2206 N N   . VAL A 1 311 ? 14.477 28.789 24.964  1.00 13.67 ? 291 VAL A N   1 
ATOM   2207 C CA  . VAL A 1 311 ? 13.365 28.058 25.569  1.00 13.42 ? 291 VAL A CA  1 
ATOM   2208 C C   . VAL A 1 311 ? 12.178 28.058 24.604  1.00 13.73 ? 291 VAL A C   1 
ATOM   2209 O O   . VAL A 1 311 ? 11.978 29.016 23.866  1.00 13.33 ? 291 VAL A O   1 
ATOM   2210 C CB  . VAL A 1 311 ? 12.955 28.715 26.922  1.00 12.66 ? 291 VAL A CB  1 
ATOM   2211 C CG1 . VAL A 1 311 ? 11.680 28.087 27.463  1.00 14.10 ? 291 VAL A CG1 1 
ATOM   2212 C CG2 . VAL A 1 311 ? 14.084 28.544 27.941  1.00 13.59 ? 291 VAL A CG2 1 
ATOM   2213 N N   . THR A 1 312 ? 11.404 26.975 24.602  1.00 15.24 ? 292 THR A N   1 
ATOM   2214 C CA  . THR A 1 312 ? 10.239 26.853 23.728  1.00 17.69 ? 292 THR A CA  1 
ATOM   2215 C C   . THR A 1 312 ? 9.291  28.050 23.841  1.00 17.14 ? 292 THR A C   1 
ATOM   2216 O O   . THR A 1 312 ? 8.967  28.491 24.942  1.00 16.93 ? 292 THR A O   1 
ATOM   2217 C CB  . THR A 1 312 ? 9.448  25.566 24.053  1.00 19.59 ? 292 THR A CB  1 
ATOM   2218 O OG1 . THR A 1 312 ? 10.320 24.436 23.949  1.00 22.09 ? 292 THR A OG1 1 
ATOM   2219 C CG2 . THR A 1 312 ? 8.284  25.387 23.088  1.00 21.03 ? 292 THR A CG2 1 
ATOM   2220 N N   . ASN A 1 313 ? 8.851  28.564 22.692  1.00 15.55 ? 293 ASN A N   1 
ATOM   2221 C CA  . ASN A 1 313 ? 7.934  29.701 22.621  1.00 15.98 ? 293 ASN A CA  1 
ATOM   2222 C C   . ASN A 1 313 ? 8.444  30.986 23.257  1.00 15.69 ? 293 ASN A C   1 
ATOM   2223 O O   . ASN A 1 313 ? 7.658  31.887 23.553  1.00 15.62 ? 293 ASN A O   1 
ATOM   2224 C CB  . ASN A 1 313 ? 6.577  29.340 23.243  1.00 17.28 ? 293 ASN A CB  1 
ATOM   2225 C CG  . ASN A 1 313 ? 5.886  28.217 22.498  1.00 17.97 ? 293 ASN A CG  1 
ATOM   2226 O OD1 . ASN A 1 313 ? 6.053  28.080 21.289  1.00 21.07 ? 293 ASN A OD1 1 
ATOM   2227 N ND2 . ASN A 1 313 ? 5.102  27.413 23.209  1.00 16.15 ? 293 ASN A ND2 1 
ATOM   2228 N N   . GLN A 1 314 ? 9.757  31.072 23.458  1.00 15.33 ? 294 GLN A N   1 
ATOM   2229 C CA  . GLN A 1 314 ? 10.370 32.255 24.050  1.00 13.38 ? 294 GLN A CA  1 
ATOM   2230 C C   . GLN A 1 314 ? 11.314 32.915 23.056  1.00 13.53 ? 294 GLN A C   1 
ATOM   2231 O O   . GLN A 1 314 ? 12.097 32.244 22.385  1.00 13.03 ? 294 GLN A O   1 
ATOM   2232 C CB  . GLN A 1 314 ? 11.129 31.868 25.324  1.00 13.75 ? 294 GLN A CB  1 
ATOM   2233 C CG  . GLN A 1 314 ? 12.046 32.944 25.895  1.00 15.93 ? 294 GLN A CG  1 
ATOM   2234 C CD  . GLN A 1 314 ? 13.467 32.823 25.379  1.00 16.16 ? 294 GLN A CD  1 
ATOM   2235 O OE1 . GLN A 1 314 ? 14.041 31.734 25.374  1.00 13.86 ? 294 GLN A OE1 1 
ATOM   2236 N NE2 . GLN A 1 314 ? 14.047 33.943 24.955  1.00 15.22 ? 294 GLN A NE2 1 
ATOM   2237 N N   . SER A 1 315 ? 11.228 34.235 22.958  1.00 12.59 ? 295 SER A N   1 
ATOM   2238 C CA  . SER A 1 315 ? 12.081 34.987 22.049  1.00 12.47 ? 295 SER A CA  1 
ATOM   2239 C C   . SER A 1 315 ? 12.607 36.205 22.791  1.00 13.92 ? 295 SER A C   1 
ATOM   2240 O O   . SER A 1 315 ? 12.250 36.440 23.941  1.00 13.13 ? 295 SER A O   1 
ATOM   2241 C CB  . SER A 1 315 ? 11.271 35.457 20.840  1.00 13.26 ? 295 SER A CB  1 
ATOM   2242 O OG  . SER A 1 315 ? 10.238 36.335 21.260  1.00 15.45 ? 295 SER A OG  1 
ATOM   2243 N N   . PHE A 1 316 ? 13.468 36.968 22.128  1.00 12.54 ? 296 PHE A N   1 
ATOM   2244 C CA  . PHE A 1 316 ? 13.999 38.196 22.694  1.00 11.95 ? 296 PHE A CA  1 
ATOM   2245 C C   . PHE A 1 316 ? 14.188 39.114 21.493  1.00 12.43 ? 296 PHE A C   1 
ATOM   2246 O O   . PHE A 1 316 ? 14.061 38.674 20.353  1.00 13.51 ? 296 PHE A O   1 
ATOM   2247 C CB  . PHE A 1 316 ? 15.319 37.944 23.458  1.00 8.56  ? 296 PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 316 ? 16.470 37.507 22.595  1.00 10.36 ? 296 PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 316 ? 17.356 38.442 22.068  1.00 10.59 ? 296 PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 316 ? 16.676 36.158 22.318  1.00 11.76 ? 296 PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 316 ? 18.433 38.041 21.275  1.00 10.10 ? 296 PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 316 ? 17.747 35.745 21.525  1.00 9.53  ? 296 PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 316 ? 18.626 36.686 21.003  1.00 11.01 ? 296 PHE A CZ  1 
ATOM   2254 N N   . ARG A 1 317 ? 14.460 40.387 21.725  1.00 11.96 ? 297 ARG A N   1 
ATOM   2255 C CA  . ARG A 1 317 ? 14.624 41.290 20.601  1.00 14.07 ? 297 ARG A CA  1 
ATOM   2256 C C   . ARG A 1 317 ? 15.857 42.159 20.706  1.00 14.17 ? 297 ARG A C   1 
ATOM   2257 O O   . ARG A 1 317 ? 16.293 42.519 21.803  1.00 15.98 ? 297 ARG A O   1 
ATOM   2258 C CB  . ARG A 1 317 ? 13.391 42.187 20.469  1.00 16.27 ? 297 ARG A CB  1 
ATOM   2259 C CG  . ARG A 1 317 ? 13.248 43.184 21.602  1.00 17.92 ? 297 ARG A CG  1 
ATOM   2260 C CD  . ARG A 1 317 ? 11.910 43.908 21.550  1.00 20.14 ? 297 ARG A CD  1 
ATOM   2261 N NE  . ARG A 1 317 ? 11.853 44.970 22.551  1.00 20.92 ? 297 ARG A NE  1 
ATOM   2262 C CZ  . ARG A 1 317 ? 10.735 45.561 22.961  1.00 23.37 ? 297 ARG A CZ  1 
ATOM   2263 N NH1 . ARG A 1 317 ? 9.562  45.194 22.460  1.00 22.97 ? 297 ARG A NH1 1 
ATOM   2264 N NH2 . ARG A 1 317 ? 10.793 46.523 23.876  1.00 22.94 ? 297 ARG A NH2 1 
ATOM   2265 N N   . ILE A 1 318 ? 16.428 42.474 19.550  1.00 13.58 ? 298 ILE A N   1 
ATOM   2266 C CA  . ILE A 1 318 ? 17.580 43.351 19.487  1.00 13.72 ? 298 ILE A CA  1 
ATOM   2267 C C   . ILE A 1 318 ? 17.072 44.561 18.721  1.00 12.43 ? 298 ILE A C   1 
ATOM   2268 O O   . ILE A 1 318 ? 16.352 44.420 17.733  1.00 13.33 ? 298 ILE A O   1 
ATOM   2269 C CB  . ILE A 1 318 ? 18.785 42.700 18.759  1.00 13.05 ? 298 ILE A CB  1 
ATOM   2270 C CG1 . ILE A 1 318 ? 18.420 42.311 17.326  1.00 12.26 ? 298 ILE A CG1 1 
ATOM   2271 C CG2 . ILE A 1 318 ? 19.248 41.476 19.539  1.00 13.28 ? 298 ILE A CG2 1 
ATOM   2272 C CD1 . ILE A 1 318 ? 19.601 41.706 16.558  1.00 8.35  ? 298 ILE A CD1 1 
ATOM   2273 N N   . THR A 1 319 ? 17.431 45.747 19.194  1.00 12.82 ? 299 THR A N   1 
ATOM   2274 C CA  . THR A 1 319 ? 16.976 46.984 18.583  1.00 12.66 ? 299 THR A CA  1 
ATOM   2275 C C   . THR A 1 319 ? 18.137 47.891 18.238  1.00 13.49 ? 299 THR A C   1 
ATOM   2276 O O   . THR A 1 319 ? 19.007 48.154 19.071  1.00 13.84 ? 299 THR A O   1 
ATOM   2277 C CB  . THR A 1 319 ? 16.040 47.750 19.538  1.00 16.16 ? 299 THR A CB  1 
ATOM   2278 O OG1 . THR A 1 319 ? 14.945 46.904 19.909  1.00 16.27 ? 299 THR A OG1 1 
ATOM   2279 C CG2 . THR A 1 319 ? 15.500 49.019 18.869  1.00 14.26 ? 299 THR A CG2 1 
ATOM   2280 N N   . ILE A 1 320 ? 18.142 48.378 17.005  1.00 15.35 ? 300 ILE A N   1 
ATOM   2281 C CA  . ILE A 1 320 ? 19.193 49.271 16.564  1.00 14.99 ? 300 ILE A CA  1 
ATOM   2282 C C   . ILE A 1 320 ? 18.616 50.647 16.282  1.00 16.40 ? 300 ILE A C   1 
ATOM   2283 O O   . ILE A 1 320 ? 17.413 50.804 16.061  1.00 16.82 ? 300 ILE A O   1 
ATOM   2284 C CB  . ILE A 1 320 ? 19.916 48.738 15.301  1.00 16.43 ? 300 ILE A CB  1 
ATOM   2285 C CG1 . ILE A 1 320 ? 18.928 48.558 14.149  1.00 17.10 ? 300 ILE A CG1 1 
ATOM   2286 C CG2 . ILE A 1 320 ? 20.609 47.423 15.625  1.00 15.33 ? 300 ILE A CG2 1 
ATOM   2287 C CD1 . ILE A 1 320 ? 19.607 48.366 12.794  1.00 16.76 ? 300 ILE A CD1 1 
ATOM   2288 N N   . LEU A 1 321 ? 19.500 51.634 16.299  1.00 17.18 ? 301 LEU A N   1 
ATOM   2289 C CA  . LEU A 1 321 ? 19.165 53.034 16.080  1.00 17.38 ? 301 LEU A CA  1 
ATOM   2290 C C   . LEU A 1 321 ? 19.603 53.493 14.691  1.00 18.06 ? 301 LEU A C   1 
ATOM   2291 O O   . LEU A 1 321 ? 20.319 52.783 13.977  1.00 18.21 ? 301 LEU A O   1 
ATOM   2292 C CB  . LEU A 1 321 ? 19.897 53.893 17.123  1.00 17.23 ? 301 LEU A CB  1 
ATOM   2293 C CG  . LEU A 1 321 ? 19.828 53.469 18.590  1.00 16.28 ? 301 LEU A CG  1 
ATOM   2294 C CD1 . LEU A 1 321 ? 20.750 54.348 19.444  1.00 14.11 ? 301 LEU A CD1 1 
ATOM   2295 C CD2 . LEU A 1 321 ? 18.398 53.568 19.064  1.00 16.48 ? 301 LEU A CD2 1 
ATOM   2296 N N   . PRO A 1 322 ? 19.155 54.686 14.273  1.00 17.17 ? 302 PRO A N   1 
ATOM   2297 C CA  . PRO A 1 322 ? 19.570 55.169 12.957  1.00 16.81 ? 302 PRO A CA  1 
ATOM   2298 C C   . PRO A 1 322 ? 21.092 55.311 12.895  1.00 15.73 ? 302 PRO A C   1 
ATOM   2299 O O   . PRO A 1 322 ? 21.683 55.250 11.818  1.00 16.14 ? 302 PRO A O   1 
ATOM   2300 C CB  . PRO A 1 322 ? 18.828 56.506 12.816  1.00 16.04 ? 302 PRO A CB  1 
ATOM   2301 C CG  . PRO A 1 322 ? 18.458 56.879 14.233  1.00 16.53 ? 302 PRO A CG  1 
ATOM   2302 C CD  . PRO A 1 322 ? 18.111 55.551 14.844  1.00 18.18 ? 302 PRO A CD  1 
ATOM   2303 N N   . GLN A 1 323 ? 21.736 55.486 14.047  1.00 16.78 ? 303 GLN A N   1 
ATOM   2304 C CA  . GLN A 1 323 ? 23.188 55.591 14.062  1.00 17.75 ? 303 GLN A CA  1 
ATOM   2305 C C   . GLN A 1 323 ? 23.831 54.309 13.519  1.00 17.38 ? 303 GLN A C   1 
ATOM   2306 O O   . GLN A 1 323 ? 24.973 54.330 13.067  1.00 18.93 ? 303 GLN A O   1 
ATOM   2307 C CB  . GLN A 1 323 ? 23.705 55.893 15.472  1.00 17.39 ? 303 GLN A CB  1 
ATOM   2308 C CG  . GLN A 1 323 ? 23.527 57.357 15.888  1.00 18.21 ? 303 GLN A CG  1 
ATOM   2309 C CD  . GLN A 1 323 ? 22.240 57.621 16.660  1.00 18.79 ? 303 GLN A CD  1 
ATOM   2310 O OE1 . GLN A 1 323 ? 21.229 56.951 16.463  1.00 18.40 ? 303 GLN A OE1 1 
ATOM   2311 N NE2 . GLN A 1 323 ? 22.276 58.622 17.538  1.00 19.66 ? 303 GLN A NE2 1 
ATOM   2312 N N   . GLN A 1 324 ? 23.096 53.200 13.562  1.00 16.26 ? 304 GLN A N   1 
ATOM   2313 C CA  . GLN A 1 324 ? 23.599 51.935 13.038  1.00 15.72 ? 304 GLN A CA  1 
ATOM   2314 C C   . GLN A 1 324 ? 23.245 51.713 11.566  1.00 16.63 ? 304 GLN A C   1 
ATOM   2315 O O   . GLN A 1 324 ? 24.094 51.278 10.789  1.00 16.38 ? 304 GLN A O   1 
ATOM   2316 C CB  . GLN A 1 324 ? 23.072 50.749 13.851  1.00 15.60 ? 304 GLN A CB  1 
ATOM   2317 C CG  . GLN A 1 324 ? 23.878 50.420 15.101  1.00 16.06 ? 304 GLN A CG  1 
ATOM   2318 C CD  . GLN A 1 324 ? 23.622 51.384 16.238  1.00 14.53 ? 304 GLN A CD  1 
ATOM   2319 O OE1 . GLN A 1 324 ? 24.529 52.059 16.720  1.00 18.39 ? 304 GLN A OE1 1 
ATOM   2320 N NE2 . GLN A 1 324 ? 22.381 51.446 16.678  1.00 12.89 ? 304 GLN A NE2 1 
ATOM   2321 N N   . TYR A 1 325 ? 22.007 52.005 11.170  1.00 15.37 ? 305 TYR A N   1 
ATOM   2322 C CA  . TYR A 1 325 ? 21.628 51.777 9.783   1.00 17.36 ? 305 TYR A CA  1 
ATOM   2323 C C   . TYR A 1 325 ? 21.847 52.934 8.806   1.00 16.98 ? 305 TYR A C   1 
ATOM   2324 O O   . TYR A 1 325 ? 21.573 52.795 7.621   1.00 16.07 ? 305 TYR A O   1 
ATOM   2325 C CB  . TYR A 1 325 ? 20.189 51.238 9.693   1.00 17.28 ? 305 TYR A CB  1 
ATOM   2326 C CG  . TYR A 1 325 ? 19.072 52.164 10.118  1.00 17.18 ? 305 TYR A CG  1 
ATOM   2327 C CD1 . TYR A 1 325 ? 18.655 53.215 9.299   1.00 17.66 ? 305 TYR A CD1 1 
ATOM   2328 C CD2 . TYR A 1 325 ? 18.375 51.937 11.299  1.00 19.67 ? 305 TYR A CD2 1 
ATOM   2329 C CE1 . TYR A 1 325 ? 17.563 54.007 9.649   1.00 17.04 ? 305 TYR A CE1 1 
ATOM   2330 C CE2 . TYR A 1 325 ? 17.288 52.721 11.657  1.00 18.06 ? 305 TYR A CE2 1 
ATOM   2331 C CZ  . TYR A 1 325 ? 16.884 53.751 10.828  1.00 17.86 ? 305 TYR A CZ  1 
ATOM   2332 O OH  . TYR A 1 325 ? 15.788 54.503 11.177  1.00 17.41 ? 305 TYR A OH  1 
ATOM   2333 N N   . LEU A 1 326 ? 22.334 54.066 9.312   1.00 15.62 ? 306 LEU A N   1 
ATOM   2334 C CA  . LEU A 1 326 ? 22.670 55.227 8.484   1.00 16.84 ? 306 LEU A CA  1 
ATOM   2335 C C   . LEU A 1 326 ? 24.189 55.328 8.607   1.00 16.68 ? 306 LEU A C   1 
ATOM   2336 O O   . LEU A 1 326 ? 24.703 55.823 9.605   1.00 19.68 ? 306 LEU A O   1 
ATOM   2337 C CB  . LEU A 1 326 ? 22.028 56.512 9.020   1.00 16.57 ? 306 LEU A CB  1 
ATOM   2338 C CG  . LEU A 1 326 ? 20.513 56.688 8.891   1.00 19.52 ? 306 LEU A CG  1 
ATOM   2339 C CD1 . LEU A 1 326 ? 20.133 58.119 9.275   1.00 20.58 ? 306 LEU A CD1 1 
ATOM   2340 C CD2 . LEU A 1 326 ? 20.078 56.400 7.459   1.00 19.13 ? 306 LEU A CD2 1 
ATOM   2341 N N   . ARG A 1 327 ? 24.906 54.860 7.591   1.00 19.43 ? 307 ARG A N   1 
ATOM   2342 C CA  . ARG A 1 327 ? 26.365 54.854 7.630   1.00 19.71 ? 307 ARG A CA  1 
ATOM   2343 C C   . ARG A 1 327 ? 27.075 56.058 7.021   1.00 22.37 ? 307 ARG A C   1 
ATOM   2344 O O   . ARG A 1 327 ? 26.781 56.468 5.902   1.00 20.17 ? 307 ARG A O   1 
ATOM   2345 C CB  . ARG A 1 327 ? 26.877 53.570 6.978   1.00 18.64 ? 307 ARG A CB  1 
ATOM   2346 C CG  . ARG A 1 327 ? 26.439 52.307 7.716   1.00 18.15 ? 307 ARG A CG  1 
ATOM   2347 C CD  . ARG A 1 327 ? 26.943 51.054 7.016   1.00 19.83 ? 307 ARG A CD  1 
ATOM   2348 N NE  . ARG A 1 327 ? 28.402 51.012 6.936   1.00 20.35 ? 307 ARG A NE  1 
ATOM   2349 C CZ  . ARG A 1 327 ? 29.203 50.595 7.913   1.00 20.44 ? 307 ARG A CZ  1 
ATOM   2350 N NH1 . ARG A 1 327 ? 30.515 50.600 7.738   1.00 21.32 ? 307 ARG A NH1 1 
ATOM   2351 N NH2 . ARG A 1 327 ? 28.702 50.161 9.056   1.00 16.76 ? 307 ARG A NH2 1 
ATOM   2352 N N   . PRO A 1 328 ? 28.042 56.630 7.761   1.00 24.95 ? 308 PRO A N   1 
ATOM   2353 C CA  . PRO A 1 328 ? 28.821 57.793 7.323   1.00 27.18 ? 308 PRO A CA  1 
ATOM   2354 C C   . PRO A 1 328 ? 29.632 57.472 6.073   1.00 29.06 ? 308 PRO A C   1 
ATOM   2355 O O   . PRO A 1 328 ? 30.029 56.327 5.859   1.00 28.34 ? 308 PRO A O   1 
ATOM   2356 C CB  . PRO A 1 328 ? 29.727 58.081 8.521   1.00 26.92 ? 308 PRO A CB  1 
ATOM   2357 C CG  . PRO A 1 328 ? 28.984 57.487 9.684   1.00 29.39 ? 308 PRO A CG  1 
ATOM   2358 C CD  . PRO A 1 328 ? 28.459 56.204 9.107   1.00 25.60 ? 308 PRO A CD  1 
ATOM   2359 N N   . VAL A 1 329 ? 29.879 58.486 5.251   1.00 31.96 ? 309 VAL A N   1 
ATOM   2360 C CA  . VAL A 1 329 ? 30.652 58.302 4.029   1.00 35.60 ? 309 VAL A CA  1 
ATOM   2361 C C   . VAL A 1 329 ? 31.861 59.228 4.043   1.00 38.34 ? 309 VAL A C   1 
ATOM   2362 O O   . VAL A 1 329 ? 31.718 60.445 3.924   1.00 38.44 ? 309 VAL A O   1 
ATOM   2363 C CB  . VAL A 1 329 ? 29.800 58.596 2.774   1.00 35.66 ? 309 VAL A CB  1 
ATOM   2364 C CG1 . VAL A 1 329 ? 30.649 58.444 1.521   1.00 35.19 ? 309 VAL A CG1 1 
ATOM   2365 C CG2 . VAL A 1 329 ? 28.607 57.645 2.724   1.00 35.19 ? 309 VAL A CG2 1 
ATOM   2366 N N   . GLU A 1 330 ? 33.040 58.629 4.199   1.00 41.60 ? 310 GLU A N   1 
ATOM   2367 C CA  . GLU A 1 330 ? 34.324 59.332 4.247   1.00 44.78 ? 310 GLU A CA  1 
ATOM   2368 C C   . GLU A 1 330 ? 34.186 60.850 4.255   1.00 45.61 ? 310 GLU A C   1 
ATOM   2369 O O   . GLU A 1 330 ? 34.527 61.481 3.231   1.00 46.37 ? 310 GLU A O   1 
ATOM   2370 C CB  . GLU A 1 330 ? 35.205 58.901 3.070   1.00 46.57 ? 310 GLU A CB  1 
ATOM   2371 C CG  . GLU A 1 330 ? 36.707 59.037 3.322   1.00 49.28 ? 310 GLU A CG  1 
ATOM   2372 C CD  . GLU A 1 330 ? 37.158 60.477 3.514   1.00 50.53 ? 310 GLU A CD  1 
ATOM   2373 O OE1 . GLU A 1 330 ? 37.036 61.274 2.560   1.00 50.81 ? 310 GLU A OE1 1 
ATOM   2374 O OE2 . GLU A 1 330 ? 37.639 60.809 4.620   1.00 50.53 ? 310 GLU A OE2 1 
ATOM   2375 N N   . GLN A 1 336 ? 32.680 70.566 6.353   1.00 46.25 ? 316 GLN A N   1 
ATOM   2376 C CA  . GLN A 1 336 ? 31.643 70.563 7.424   1.00 46.08 ? 316 GLN A CA  1 
ATOM   2377 C C   . GLN A 1 336 ? 30.366 69.863 6.978   1.00 44.37 ? 316 GLN A C   1 
ATOM   2378 O O   . GLN A 1 336 ? 29.265 70.351 7.230   1.00 44.55 ? 316 GLN A O   1 
ATOM   2379 C CB  . GLN A 1 336 ? 31.302 71.996 7.842   1.00 48.23 ? 316 GLN A CB  1 
ATOM   2380 C CG  . GLN A 1 336 ? 32.432 72.743 8.524   1.00 51.37 ? 316 GLN A CG  1 
ATOM   2381 C CD  . GLN A 1 336 ? 31.970 74.059 9.118   1.00 53.52 ? 316 GLN A CD  1 
ATOM   2382 O OE1 . GLN A 1 336 ? 31.083 74.088 9.973   1.00 54.90 ? 316 GLN A OE1 1 
ATOM   2383 N NE2 . GLN A 1 336 ? 32.569 75.157 8.668   1.00 54.66 ? 316 GLN A NE2 1 
ATOM   2384 N N   . ASP A 1 337 ? 30.510 68.718 6.321   1.00 42.22 ? 317 ASP A N   1 
ATOM   2385 C CA  . ASP A 1 337 ? 29.353 67.972 5.847   1.00 40.10 ? 317 ASP A CA  1 
ATOM   2386 C C   . ASP A 1 337 ? 29.410 66.503 6.242   1.00 38.27 ? 317 ASP A C   1 
ATOM   2387 O O   . ASP A 1 337 ? 30.401 65.820 5.996   1.00 38.67 ? 317 ASP A O   1 
ATOM   2388 C CB  . ASP A 1 337 ? 29.246 68.098 4.328   1.00 40.82 ? 317 ASP A CB  1 
ATOM   2389 C CG  . ASP A 1 337 ? 28.861 69.495 3.889   1.00 41.44 ? 317 ASP A CG  1 
ATOM   2390 O OD1 . ASP A 1 337 ? 29.291 69.913 2.795   1.00 43.25 ? 317 ASP A OD1 1 
ATOM   2391 O OD2 . ASP A 1 337 ? 28.118 70.171 4.633   1.00 40.09 ? 317 ASP A OD2 1 
ATOM   2392 N N   . ASP A 1 338 ? 28.336 66.031 6.864   1.00 35.04 ? 318 ASP A N   1 
ATOM   2393 C CA  . ASP A 1 338 ? 28.231 64.642 7.291   1.00 32.85 ? 318 ASP A CA  1 
ATOM   2394 C C   . ASP A 1 338 ? 27.288 63.916 6.339   1.00 30.40 ? 318 ASP A C   1 
ATOM   2395 O O   . ASP A 1 338 ? 26.068 64.018 6.465   1.00 30.60 ? 318 ASP A O   1 
ATOM   2396 C CB  . ASP A 1 338 ? 27.679 64.566 8.715   1.00 32.14 ? 318 ASP A CB  1 
ATOM   2397 C CG  . ASP A 1 338 ? 28.656 65.093 9.749   1.00 33.60 ? 318 ASP A CG  1 
ATOM   2398 O OD1 . ASP A 1 338 ? 28.233 65.317 10.901  1.00 33.66 ? 318 ASP A OD1 1 
ATOM   2399 O OD2 . ASP A 1 338 ? 29.845 65.276 9.415   1.00 33.63 ? 318 ASP A OD2 1 
ATOM   2400 N N   . CYS A 1 339 ? 27.859 63.189 5.386   1.00 28.03 ? 319 CYS A N   1 
ATOM   2401 C CA  . CYS A 1 339 ? 27.060 62.458 4.412   1.00 26.16 ? 319 CYS A CA  1 
ATOM   2402 C C   . CYS A 1 339 ? 26.774 61.034 4.870   1.00 24.96 ? 319 CYS A C   1 
ATOM   2403 O O   . CYS A 1 339 ? 27.651 60.358 5.410   1.00 23.68 ? 319 CYS A O   1 
ATOM   2404 C CB  . CYS A 1 339 ? 27.770 62.434 3.064   1.00 26.47 ? 319 CYS A CB  1 
ATOM   2405 S SG  . CYS A 1 339 ? 28.007 64.075 2.305   1.00 27.19 ? 319 CYS A SG  1 
ATOM   2406 N N   . TYR A 1 340 ? 25.544 60.582 4.646   1.00 23.06 ? 320 TYR A N   1 
ATOM   2407 C CA  . TYR A 1 340 ? 25.142 59.243 5.059   1.00 22.33 ? 320 TYR A CA  1 
ATOM   2408 C C   . TYR A 1 340 ? 24.467 58.441 3.957   1.00 21.42 ? 320 TYR A C   1 
ATOM   2409 O O   . TYR A 1 340 ? 23.855 58.992 3.044   1.00 19.00 ? 320 TYR A O   1 
ATOM   2410 C CB  . TYR A 1 340 ? 24.184 59.311 6.253   1.00 23.19 ? 320 TYR A CB  1 
ATOM   2411 C CG  . TYR A 1 340 ? 24.781 59.897 7.510   1.00 25.51 ? 320 TYR A CG  1 
ATOM   2412 C CD1 . TYR A 1 340 ? 24.752 61.269 7.745   1.00 26.87 ? 320 TYR A CD1 1 
ATOM   2413 C CD2 . TYR A 1 340 ? 25.378 59.076 8.467   1.00 25.03 ? 320 TYR A CD2 1 
ATOM   2414 C CE1 . TYR A 1 340 ? 25.298 61.810 8.905   1.00 27.63 ? 320 TYR A CE1 1 
ATOM   2415 C CE2 . TYR A 1 340 ? 25.929 59.608 9.627   1.00 27.56 ? 320 TYR A CE2 1 
ATOM   2416 C CZ  . TYR A 1 340 ? 25.883 60.974 9.838   1.00 28.04 ? 320 TYR A CZ  1 
ATOM   2417 O OH  . TYR A 1 340 ? 26.418 61.509 10.985  1.00 31.52 ? 320 TYR A OH  1 
ATOM   2418 N N   . LYS A 1 341 ? 24.579 57.125 4.069   1.00 19.72 ? 321 LYS A N   1 
ATOM   2419 C CA  . LYS A 1 341 ? 23.969 56.215 3.118   1.00 19.21 ? 321 LYS A CA  1 
ATOM   2420 C C   . LYS A 1 341 ? 23.048 55.291 3.907   1.00 17.39 ? 321 LYS A C   1 
ATOM   2421 O O   . LYS A 1 341 ? 23.431 54.783 4.956   1.00 17.59 ? 321 LYS A O   1 
ATOM   2422 C CB  . LYS A 1 341 ? 25.044 55.384 2.412   1.00 20.53 ? 321 LYS A CB  1 
ATOM   2423 C CG  . LYS A 1 341 ? 24.485 54.297 1.517   1.00 22.50 ? 321 LYS A CG  1 
ATOM   2424 C CD  . LYS A 1 341 ? 25.567 53.361 1.011   1.00 24.19 ? 321 LYS A CD  1 
ATOM   2425 C CE  . LYS A 1 341 ? 24.955 52.239 0.184   1.00 26.44 ? 321 LYS A CE  1 
ATOM   2426 N NZ  . LYS A 1 341 ? 25.954 51.207 -0.209  1.00 27.47 ? 321 LYS A NZ  1 
ATOM   2427 N N   . PHE A 1 342 ? 21.831 55.098 3.411   1.00 14.87 ? 322 PHE A N   1 
ATOM   2428 C CA  . PHE A 1 342 ? 20.865 54.212 4.049   1.00 15.66 ? 322 PHE A CA  1 
ATOM   2429 C C   . PHE A 1 342 ? 21.445 52.822 3.817   1.00 15.78 ? 322 PHE A C   1 
ATOM   2430 O O   . PHE A 1 342 ? 21.581 52.384 2.669   1.00 18.25 ? 322 PHE A O   1 
ATOM   2431 C CB  . PHE A 1 342 ? 19.504 54.365 3.366   1.00 15.24 ? 322 PHE A CB  1 
ATOM   2432 C CG  . PHE A 1 342 ? 18.416 53.505 3.951   1.00 13.65 ? 322 PHE A CG  1 
ATOM   2433 C CD1 . PHE A 1 342 ? 17.993 53.681 5.268   1.00 15.14 ? 322 PHE A CD1 1 
ATOM   2434 C CD2 . PHE A 1 342 ? 17.791 52.537 3.169   1.00 13.69 ? 322 PHE A CD2 1 
ATOM   2435 C CE1 . PHE A 1 342 ? 16.958 52.905 5.798   1.00 13.62 ? 322 PHE A CE1 1 
ATOM   2436 C CE2 . PHE A 1 342 ? 16.756 51.755 3.686   1.00 13.86 ? 322 PHE A CE2 1 
ATOM   2437 C CZ  . PHE A 1 342 ? 16.339 51.942 5.005   1.00 13.52 ? 322 PHE A CZ  1 
ATOM   2438 N N   . ALA A 1 343 ? 21.783 52.137 4.907   1.00 17.47 ? 323 ALA A N   1 
ATOM   2439 C CA  . ALA A 1 343 ? 22.417 50.828 4.834   1.00 15.18 ? 323 ALA A CA  1 
ATOM   2440 C C   . ALA A 1 343 ? 21.559 49.583 5.066   1.00 14.97 ? 323 ALA A C   1 
ATOM   2441 O O   . ALA A 1 343 ? 22.030 48.599 5.629   1.00 14.29 ? 323 ALA A O   1 
ATOM   2442 C CB  . ALA A 1 343 ? 23.618 50.809 5.769   1.00 14.01 ? 323 ALA A CB  1 
ATOM   2443 N N   . ILE A 1 344 ? 20.302 49.635 4.644   1.00 16.11 ? 324 ILE A N   1 
ATOM   2444 C CA  . ILE A 1 344 ? 19.411 48.483 4.733   1.00 15.92 ? 324 ILE A CA  1 
ATOM   2445 C C   . ILE A 1 344 ? 19.070 48.271 3.266   1.00 17.39 ? 324 ILE A C   1 
ATOM   2446 O O   . ILE A 1 344 ? 18.536 49.168 2.616   1.00 17.95 ? 324 ILE A O   1 
ATOM   2447 C CB  . ILE A 1 344 ? 18.128 48.788 5.545   1.00 16.69 ? 324 ILE A CB  1 
ATOM   2448 C CG1 . ILE A 1 344 ? 18.487 49.051 7.010   1.00 16.90 ? 324 ILE A CG1 1 
ATOM   2449 C CG2 . ILE A 1 344 ? 17.158 47.607 5.458   1.00 17.15 ? 324 ILE A CG2 1 
ATOM   2450 C CD1 . ILE A 1 344 ? 17.299 49.424 7.880   1.00 16.54 ? 324 ILE A CD1 1 
ATOM   2451 N N   . SER A 1 345 ? 19.402 47.100 2.734   1.00 17.25 ? 325 SER A N   1 
ATOM   2452 C CA  . SER A 1 345 ? 19.169 46.830 1.326   1.00 17.02 ? 325 SER A CA  1 
ATOM   2453 C C   . SER A 1 345 ? 18.517 45.482 1.083   1.00 17.75 ? 325 SER A C   1 
ATOM   2454 O O   . SER A 1 345 ? 18.319 44.701 2.015   1.00 18.68 ? 325 SER A O   1 
ATOM   2455 C CB  . SER A 1 345 ? 20.496 46.924 0.565   1.00 15.60 ? 325 SER A CB  1 
ATOM   2456 O OG  . SER A 1 345 ? 21.495 46.139 1.193   1.00 15.82 ? 325 SER A OG  1 
ATOM   2457 N N   . GLN A 1 346 ? 18.185 45.205 -0.173  1.00 18.81 ? 326 GLN A N   1 
ATOM   2458 C CA  . GLN A 1 346 ? 17.531 43.948 -0.495  1.00 20.80 ? 326 GLN A CA  1 
ATOM   2459 C C   . GLN A 1 346 ? 18.491 42.841 -0.893  1.00 20.52 ? 326 GLN A C   1 
ATOM   2460 O O   . GLN A 1 346 ? 19.596 43.087 -1.383  1.00 18.80 ? 326 GLN A O   1 
ATOM   2461 C CB  . GLN A 1 346 ? 16.494 44.147 -1.601  1.00 23.75 ? 326 GLN A CB  1 
ATOM   2462 C CG  . GLN A 1 346 ? 17.070 44.363 -2.979  1.00 29.00 ? 326 GLN A CG  1 
ATOM   2463 C CD  . GLN A 1 346 ? 16.025 44.168 -4.058  1.00 32.42 ? 326 GLN A CD  1 
ATOM   2464 O OE1 . GLN A 1 346 ? 15.031 44.892 -4.114  1.00 32.38 ? 326 GLN A OE1 1 
ATOM   2465 N NE2 . GLN A 1 346 ? 16.237 43.176 -4.915  1.00 33.71 ? 326 GLN A NE2 1 
ATOM   2466 N N   . SER A 1 347 ? 18.036 41.612 -0.683  1.00 20.24 ? 327 SER A N   1 
ATOM   2467 C CA  . SER A 1 347 ? 18.812 40.423 -0.989  1.00 20.01 ? 327 SER A CA  1 
ATOM   2468 C C   . SER A 1 347 ? 17.930 39.330 -1.583  1.00 18.88 ? 327 SER A C   1 
ATOM   2469 O O   . SER A 1 347 ? 16.745 39.245 -1.270  1.00 19.03 ? 327 SER A O   1 
ATOM   2470 C CB  . SER A 1 347 ? 19.454 39.900 0.295   1.00 19.55 ? 327 SER A CB  1 
ATOM   2471 O OG  . SER A 1 347 ? 19.873 38.557 0.145   1.00 19.52 ? 327 SER A OG  1 
ATOM   2472 N N   . SER A 1 348 ? 18.508 38.500 -2.443  1.00 19.08 ? 328 SER A N   1 
ATOM   2473 C CA  . SER A 1 348 ? 17.761 37.385 -3.020  1.00 19.94 ? 328 SER A CA  1 
ATOM   2474 C C   . SER A 1 348 ? 18.241 36.069 -2.388  1.00 19.76 ? 328 SER A C   1 
ATOM   2475 O O   . SER A 1 348 ? 17.785 34.987 -2.763  1.00 19.26 ? 328 SER A O   1 
ATOM   2476 C CB  . SER A 1 348 ? 17.949 37.337 -4.539  1.00 22.83 ? 328 SER A CB  1 
ATOM   2477 O OG  . SER A 1 348 ? 19.295 37.062 -4.882  1.00 26.62 ? 328 SER A OG  1 
ATOM   2478 N N   . THR A 1 349 ? 19.155 36.173 -1.422  1.00 18.37 ? 329 THR A N   1 
ATOM   2479 C CA  . THR A 1 349 ? 19.703 35.007 -0.728  1.00 18.23 ? 329 THR A CA  1 
ATOM   2480 C C   . THR A 1 349 ? 19.427 35.024 0.783   1.00 19.02 ? 329 THR A C   1 
ATOM   2481 O O   . THR A 1 349 ? 20.221 34.509 1.573   1.00 18.80 ? 329 THR A O   1 
ATOM   2482 C CB  . THR A 1 349 ? 21.232 34.901 -0.930  1.00 20.06 ? 329 THR A CB  1 
ATOM   2483 O OG1 . THR A 1 349 ? 21.865 36.087 -0.431  1.00 18.14 ? 329 THR A OG1 1 
ATOM   2484 C CG2 . THR A 1 349 ? 21.568 34.732 -2.402  1.00 20.40 ? 329 THR A CG2 1 
ATOM   2485 N N   . GLY A 1 350 ? 18.313 35.623 1.187   1.00 18.11 ? 330 GLY A N   1 
ATOM   2486 C CA  . GLY A 1 350 ? 17.976 35.663 2.598   1.00 17.72 ? 330 GLY A CA  1 
ATOM   2487 C C   . GLY A 1 350 ? 18.423 36.902 3.360   1.00 17.04 ? 330 GLY A C   1 
ATOM   2488 O O   . GLY A 1 350 ? 19.031 37.815 2.799   1.00 16.69 ? 330 GLY A O   1 
ATOM   2489 N N   . THR A 1 351 ? 18.109 36.926 4.650   1.00 15.69 ? 331 THR A N   1 
ATOM   2490 C CA  . THR A 1 351 ? 18.468 38.042 5.516   1.00 14.95 ? 331 THR A CA  1 
ATOM   2491 C C   . THR A 1 351 ? 19.926 37.937 5.927   1.00 15.49 ? 331 THR A C   1 
ATOM   2492 O O   . THR A 1 351 ? 20.399 36.858 6.280   1.00 14.37 ? 331 THR A O   1 
ATOM   2493 C CB  . THR A 1 351 ? 17.605 38.060 6.803   1.00 14.44 ? 331 THR A CB  1 
ATOM   2494 O OG1 . THR A 1 351 ? 16.243 38.345 6.466   1.00 16.16 ? 331 THR A OG1 1 
ATOM   2495 C CG2 . THR A 1 351 ? 18.101 39.117 7.782   1.00 14.06 ? 331 THR A CG2 1 
ATOM   2496 N N   . VAL A 1 352 ? 20.640 39.056 5.856   1.00 14.28 ? 332 VAL A N   1 
ATOM   2497 C CA  . VAL A 1 352 ? 22.031 39.080 6.273   1.00 14.99 ? 332 VAL A CA  1 
ATOM   2498 C C   . VAL A 1 352 ? 22.175 40.135 7.360   1.00 14.73 ? 332 VAL A C   1 
ATOM   2499 O O   . VAL A 1 352 ? 22.027 41.329 7.103   1.00 15.66 ? 332 VAL A O   1 
ATOM   2500 C CB  . VAL A 1 352 ? 22.993 39.431 5.109   1.00 13.92 ? 332 VAL A CB  1 
ATOM   2501 C CG1 . VAL A 1 352 ? 24.439 39.406 5.612   1.00 12.92 ? 332 VAL A CG1 1 
ATOM   2502 C CG2 . VAL A 1 352 ? 22.820 38.441 3.971   1.00 15.02 ? 332 VAL A CG2 1 
ATOM   2503 N N   . MET A 1 353 ? 22.441 39.686 8.580   1.00 14.64 ? 333 MET A N   1 
ATOM   2504 C CA  . MET A 1 353 ? 22.627 40.595 9.701   1.00 14.03 ? 333 MET A CA  1 
ATOM   2505 C C   . MET A 1 353 ? 24.101 40.975 9.701   1.00 14.24 ? 333 MET A C   1 
ATOM   2506 O O   . MET A 1 353 ? 24.923 40.336 10.358  1.00 13.51 ? 333 MET A O   1 
ATOM   2507 C CB  . MET A 1 353 ? 22.221 39.899 11.003  1.00 14.09 ? 333 MET A CB  1 
ATOM   2508 C CG  . MET A 1 353 ? 20.735 39.564 11.044  1.00 14.57 ? 333 MET A CG  1 
ATOM   2509 S SD  . MET A 1 353 ? 20.297 38.349 12.303  1.00 19.82 ? 333 MET A SD  1 
ATOM   2510 C CE  . MET A 1 353 ? 20.549 39.303 13.748  1.00 17.75 ? 333 MET A CE  1 
ATOM   2511 N N   . GLY A 1 354 ? 24.424 42.020 8.942   1.00 12.63 ? 334 GLY A N   1 
ATOM   2512 C CA  . GLY A 1 354 ? 25.800 42.469 8.825   1.00 12.70 ? 334 GLY A CA  1 
ATOM   2513 C C   . GLY A 1 354 ? 26.235 43.488 9.861   1.00 13.66 ? 334 GLY A C   1 
ATOM   2514 O O   . GLY A 1 354 ? 25.673 43.547 10.946  1.00 11.56 ? 334 GLY A O   1 
ATOM   2515 N N   . ALA A 1 355 ? 27.231 44.300 9.511   1.00 13.67 ? 335 ALA A N   1 
ATOM   2516 C CA  . ALA A 1 355 ? 27.771 45.315 10.417  1.00 13.73 ? 335 ALA A CA  1 
ATOM   2517 C C   . ALA A 1 355 ? 26.710 46.248 10.992  1.00 13.75 ? 335 ALA A C   1 
ATOM   2518 O O   . ALA A 1 355 ? 26.807 46.666 12.142  1.00 14.20 ? 335 ALA A O   1 
ATOM   2519 C CB  . ALA A 1 355 ? 28.844 46.126 9.701   1.00 14.68 ? 335 ALA A CB  1 
ATOM   2520 N N   . VAL A 1 356 ? 25.712 46.596 10.183  1.00 13.18 ? 336 VAL A N   1 
ATOM   2521 C CA  . VAL A 1 356 ? 24.628 47.461 10.634  1.00 12.48 ? 336 VAL A CA  1 
ATOM   2522 C C   . VAL A 1 356 ? 24.011 46.905 11.914  1.00 13.40 ? 336 VAL A C   1 
ATOM   2523 O O   . VAL A 1 356 ? 23.661 47.657 12.826  1.00 11.98 ? 336 VAL A O   1 
ATOM   2524 C CB  . VAL A 1 356 ? 23.543 47.600 9.533   1.00 12.79 ? 336 VAL A CB  1 
ATOM   2525 C CG1 . VAL A 1 356 ? 22.241 48.137 10.120  1.00 12.96 ? 336 VAL A CG1 1 
ATOM   2526 C CG2 . VAL A 1 356 ? 24.048 48.548 8.455   1.00 12.55 ? 336 VAL A CG2 1 
ATOM   2527 N N   . ILE A 1 357 ? 23.879 45.585 11.981  1.00 11.60 ? 337 ILE A N   1 
ATOM   2528 C CA  . ILE A 1 357 ? 23.329 44.951 13.173  1.00 13.56 ? 337 ILE A CA  1 
ATOM   2529 C C   . ILE A 1 357 ? 24.424 44.755 14.230  1.00 12.43 ? 337 ILE A C   1 
ATOM   2530 O O   . ILE A 1 357 ? 24.280 45.184 15.370  1.00 15.02 ? 337 ILE A O   1 
ATOM   2531 C CB  . ILE A 1 357 ? 22.690 43.577 12.832  1.00 13.97 ? 337 ILE A CB  1 
ATOM   2532 C CG1 . ILE A 1 357 ? 21.309 43.784 12.204  1.00 14.04 ? 337 ILE A CG1 1 
ATOM   2533 C CG2 . ILE A 1 357 ? 22.570 42.719 14.084  1.00 16.53 ? 337 ILE A CG2 1 
ATOM   2534 C CD1 . ILE A 1 357 ? 20.285 44.365 13.148  1.00 14.82 ? 337 ILE A CD1 1 
ATOM   2535 N N   . MET A 1 358 ? 25.533 44.142 13.835  1.00 12.69 ? 338 MET A N   1 
ATOM   2536 C CA  . MET A 1 358 ? 26.618 43.854 14.768  1.00 14.00 ? 338 MET A CA  1 
ATOM   2537 C C   . MET A 1 358 ? 27.258 45.042 15.482  1.00 14.79 ? 338 MET A C   1 
ATOM   2538 O O   . MET A 1 358 ? 27.742 44.895 16.602  1.00 16.42 ? 338 MET A O   1 
ATOM   2539 C CB  . MET A 1 358 ? 27.694 43.019 14.062  1.00 14.54 ? 338 MET A CB  1 
ATOM   2540 C CG  . MET A 1 358 ? 27.200 41.626 13.682  1.00 13.37 ? 338 MET A CG  1 
ATOM   2541 S SD  . MET A 1 358 ? 28.458 40.615 12.911  1.00 15.88 ? 338 MET A SD  1 
ATOM   2542 C CE  . MET A 1 358 ? 29.416 40.119 14.354  1.00 14.03 ? 338 MET A CE  1 
ATOM   2543 N N   . GLU A 1 359 ? 27.254 46.215 14.854  1.00 14.34 ? 339 GLU A N   1 
ATOM   2544 C CA  . GLU A 1 359 ? 27.849 47.399 15.467  1.00 13.55 ? 339 GLU A CA  1 
ATOM   2545 C C   . GLU A 1 359 ? 27.068 47.929 16.671  1.00 15.45 ? 339 GLU A C   1 
ATOM   2546 O O   . GLU A 1 359 ? 27.535 48.817 17.380  1.00 16.70 ? 339 GLU A O   1 
ATOM   2547 C CB  . GLU A 1 359 ? 28.033 48.508 14.419  1.00 12.80 ? 339 GLU A CB  1 
ATOM   2548 C CG  . GLU A 1 359 ? 29.142 48.201 13.412  1.00 13.98 ? 339 GLU A CG  1 
ATOM   2549 C CD  . GLU A 1 359 ? 29.329 49.294 12.371  1.00 14.64 ? 339 GLU A CD  1 
ATOM   2550 O OE1 . GLU A 1 359 ? 30.205 49.136 11.498  1.00 15.90 ? 339 GLU A OE1 1 
ATOM   2551 O OE2 . GLU A 1 359 ? 28.604 50.310 12.420  1.00 17.77 ? 339 GLU A OE2 1 
ATOM   2552 N N   . GLY A 1 360 ? 25.881 47.390 16.910  1.00 14.04 ? 340 GLY A N   1 
ATOM   2553 C CA  . GLY A 1 360 ? 25.123 47.833 18.061  1.00 13.49 ? 340 GLY A CA  1 
ATOM   2554 C C   . GLY A 1 360 ? 25.263 46.865 19.226  1.00 14.58 ? 340 GLY A C   1 
ATOM   2555 O O   . GLY A 1 360 ? 24.859 47.172 20.343  1.00 12.43 ? 340 GLY A O   1 
ATOM   2556 N N   . PHE A 1 361 ? 25.882 45.713 18.980  1.00 13.49 ? 341 PHE A N   1 
ATOM   2557 C CA  . PHE A 1 361 ? 25.984 44.694 20.010  1.00 14.01 ? 341 PHE A CA  1 
ATOM   2558 C C   . PHE A 1 361 ? 27.317 43.973 20.149  1.00 14.38 ? 341 PHE A C   1 
ATOM   2559 O O   . PHE A 1 361 ? 28.192 44.041 19.286  1.00 15.18 ? 341 PHE A O   1 
ATOM   2560 C CB  . PHE A 1 361 ? 24.912 43.624 19.754  1.00 14.24 ? 341 PHE A CB  1 
ATOM   2561 C CG  . PHE A 1 361 ? 23.591 44.184 19.315  1.00 12.50 ? 341 PHE A CG  1 
ATOM   2562 C CD1 . PHE A 1 361 ? 23.245 44.220 17.969  1.00 14.60 ? 341 PHE A CD1 1 
ATOM   2563 C CD2 . PHE A 1 361 ? 22.712 44.725 20.249  1.00 14.65 ? 341 PHE A CD2 1 
ATOM   2564 C CE1 . PHE A 1 361 ? 22.045 44.791 17.556  1.00 14.79 ? 341 PHE A CE1 1 
ATOM   2565 C CE2 . PHE A 1 361 ? 21.509 45.300 19.846  1.00 14.79 ? 341 PHE A CE2 1 
ATOM   2566 C CZ  . PHE A 1 361 ? 21.176 45.333 18.498  1.00 15.22 ? 341 PHE A CZ  1 
ATOM   2567 N N   . TYR A 1 362 ? 27.446 43.278 21.269  1.00 15.02 ? 342 TYR A N   1 
ATOM   2568 C CA  . TYR A 1 362 ? 28.601 42.444 21.534  1.00 13.52 ? 342 TYR A CA  1 
ATOM   2569 C C   . TYR A 1 362 ? 27.990 41.103 21.161  1.00 13.56 ? 342 TYR A C   1 
ATOM   2570 O O   . TYR A 1 362 ? 26.977 40.700 21.731  1.00 14.38 ? 342 TYR A O   1 
ATOM   2571 C CB  . TYR A 1 362 ? 28.958 42.474 23.008  1.00 13.63 ? 342 TYR A CB  1 
ATOM   2572 C CG  . TYR A 1 362 ? 30.083 41.540 23.386  1.00 15.84 ? 342 TYR A CG  1 
ATOM   2573 C CD1 . TYR A 1 362 ? 31.253 41.475 22.624  1.00 13.58 ? 342 TYR A CD1 1 
ATOM   2574 C CD2 . TYR A 1 362 ? 30.009 40.777 24.545  1.00 14.86 ? 342 TYR A CD2 1 
ATOM   2575 C CE1 . TYR A 1 362 ? 32.324 40.675 23.020  1.00 15.89 ? 342 TYR A CE1 1 
ATOM   2576 C CE2 . TYR A 1 362 ? 31.072 39.977 24.955  1.00 15.93 ? 342 TYR A CE2 1 
ATOM   2577 C CZ  . TYR A 1 362 ? 32.226 39.932 24.191  1.00 15.56 ? 342 TYR A CZ  1 
ATOM   2578 O OH  . TYR A 1 362 ? 33.284 39.162 24.624  1.00 16.02 ? 342 TYR A OH  1 
ATOM   2579 N N   . VAL A 1 363 ? 28.586 40.426 20.192  1.00 12.29 ? 343 VAL A N   1 
ATOM   2580 C CA  . VAL A 1 363 ? 28.045 39.160 19.723  1.00 13.76 ? 343 VAL A CA  1 
ATOM   2581 C C   . VAL A 1 363 ? 28.924 37.971 20.083  1.00 12.90 ? 343 VAL A C   1 
ATOM   2582 O O   . VAL A 1 363 ? 30.089 37.911 19.709  1.00 14.43 ? 343 VAL A O   1 
ATOM   2583 C CB  . VAL A 1 363 ? 27.833 39.210 18.196  1.00 12.95 ? 343 VAL A CB  1 
ATOM   2584 C CG1 . VAL A 1 363 ? 27.180 37.931 17.717  1.00 12.28 ? 343 VAL A CG1 1 
ATOM   2585 C CG2 . VAL A 1 363 ? 26.976 40.431 17.828  1.00 12.45 ? 343 VAL A CG2 1 
ATOM   2586 N N   . VAL A 1 364 ? 28.347 37.022 20.810  1.00 14.23 ? 344 VAL A N   1 
ATOM   2587 C CA  . VAL A 1 364 ? 29.068 35.833 21.250  1.00 12.62 ? 344 VAL A CA  1 
ATOM   2588 C C   . VAL A 1 364 ? 28.762 34.625 20.368  1.00 11.77 ? 344 VAL A C   1 
ATOM   2589 O O   . VAL A 1 364 ? 27.647 34.116 20.375  1.00 12.05 ? 344 VAL A O   1 
ATOM   2590 C CB  . VAL A 1 364 ? 28.693 35.465 22.712  1.00 15.67 ? 344 VAL A CB  1 
ATOM   2591 C CG1 . VAL A 1 364 ? 29.488 34.243 23.165  1.00 13.70 ? 344 VAL A CG1 1 
ATOM   2592 C CG2 . VAL A 1 364 ? 28.951 36.656 23.640  1.00 14.01 ? 344 VAL A CG2 1 
ATOM   2593 N N   . PHE A 1 365 ? 29.756 34.173 19.610  1.00 10.74 ? 345 PHE A N   1 
ATOM   2594 C CA  . PHE A 1 365 ? 29.588 33.007 18.749  1.00 11.12 ? 345 PHE A CA  1 
ATOM   2595 C C   . PHE A 1 365 ? 29.976 31.777 19.563  1.00 12.01 ? 345 PHE A C   1 
ATOM   2596 O O   . PHE A 1 365 ? 31.098 31.278 19.478  1.00 12.16 ? 345 PHE A O   1 
ATOM   2597 C CB  . PHE A 1 365 ? 30.461 33.144 17.497  1.00 10.68 ? 345 PHE A CB  1 
ATOM   2598 C CG  . PHE A 1 365 ? 30.003 34.239 16.566  1.00 10.85 ? 345 PHE A CG  1 
ATOM   2599 C CD1 . PHE A 1 365 ? 29.195 33.947 15.474  1.00 11.62 ? 345 PHE A CD1 1 
ATOM   2600 C CD2 . PHE A 1 365 ? 30.333 35.568 16.817  1.00 10.93 ? 345 PHE A CD2 1 
ATOM   2601 C CE1 . PHE A 1 365 ? 28.720 34.963 14.645  1.00 12.71 ? 345 PHE A CE1 1 
ATOM   2602 C CE2 . PHE A 1 365 ? 29.864 36.588 15.997  1.00 7.98  ? 345 PHE A CE2 1 
ATOM   2603 C CZ  . PHE A 1 365 ? 29.052 36.282 14.907  1.00 11.46 ? 345 PHE A CZ  1 
ATOM   2604 N N   . ASP A 1 366 ? 29.027 31.318 20.371  1.00 12.97 ? 346 ASP A N   1 
ATOM   2605 C CA  . ASP A 1 366 ? 29.206 30.165 21.243  1.00 12.87 ? 346 ASP A CA  1 
ATOM   2606 C C   . ASP A 1 366 ? 29.034 28.881 20.441  1.00 13.58 ? 346 ASP A C   1 
ATOM   2607 O O   . ASP A 1 366 ? 27.981 28.251 20.486  1.00 15.70 ? 346 ASP A O   1 
ATOM   2608 C CB  . ASP A 1 366 ? 28.168 30.230 22.372  1.00 14.14 ? 346 ASP A CB  1 
ATOM   2609 C CG  . ASP A 1 366 ? 28.465 29.269 23.507  1.00 14.00 ? 346 ASP A CG  1 
ATOM   2610 O OD1 . ASP A 1 366 ? 29.255 28.325 23.309  1.00 15.71 ? 346 ASP A OD1 1 
ATOM   2611 O OD2 . ASP A 1 366 ? 27.892 29.455 24.600  1.00 17.60 ? 346 ASP A OD2 1 
ATOM   2612 N N   . ARG A 1 367 ? 30.069 28.495 19.701  1.00 12.49 ? 347 ARG A N   1 
ATOM   2613 C CA  . ARG A 1 367 ? 30.009 27.287 18.884  1.00 12.00 ? 347 ARG A CA  1 
ATOM   2614 C C   . ARG A 1 367 ? 29.837 26.021 19.729  1.00 12.59 ? 347 ARG A C   1 
ATOM   2615 O O   . ARG A 1 367 ? 29.127 25.089 19.337  1.00 11.59 ? 347 ARG A O   1 
ATOM   2616 C CB  . ARG A 1 367 ? 31.273 27.183 18.025  1.00 12.92 ? 347 ARG A CB  1 
ATOM   2617 C CG  . ARG A 1 367 ? 31.390 28.284 16.964  1.00 12.05 ? 347 ARG A CG  1 
ATOM   2618 C CD  . ARG A 1 367 ? 32.846 28.546 16.593  1.00 12.07 ? 347 ARG A CD  1 
ATOM   2619 N NE  . ARG A 1 367 ? 33.531 27.353 16.100  1.00 13.98 ? 347 ARG A NE  1 
ATOM   2620 C CZ  . ARG A 1 367 ? 33.792 27.105 14.819  1.00 13.12 ? 347 ARG A CZ  1 
ATOM   2621 N NH1 . ARG A 1 367 ? 33.423 27.962 13.875  1.00 14.08 ? 347 ARG A NH1 1 
ATOM   2622 N NH2 . ARG A 1 367 ? 34.451 26.005 14.481  1.00 12.79 ? 347 ARG A NH2 1 
ATOM   2623 N N   . ALA A 1 368 ? 30.472 26.002 20.897  1.00 12.01 ? 348 ALA A N   1 
ATOM   2624 C CA  . ALA A 1 368 ? 30.396 24.852 21.795  1.00 13.11 ? 348 ALA A CA  1 
ATOM   2625 C C   . ALA A 1 368 ? 28.969 24.540 22.232  1.00 13.09 ? 348 ALA A C   1 
ATOM   2626 O O   . ALA A 1 368 ? 28.619 23.378 22.431  1.00 13.80 ? 348 ALA A O   1 
ATOM   2627 C CB  . ALA A 1 368 ? 31.281 25.088 23.019  1.00 11.89 ? 348 ALA A CB  1 
ATOM   2628 N N   . ARG A 1 369 ? 28.145 25.573 22.388  1.00 12.82 ? 349 ARG A N   1 
ATOM   2629 C CA  . ARG A 1 369 ? 26.758 25.371 22.796  1.00 13.78 ? 349 ARG A CA  1 
ATOM   2630 C C   . ARG A 1 369 ? 25.760 25.674 21.671  1.00 14.73 ? 349 ARG A C   1 
ATOM   2631 O O   . ARG A 1 369 ? 24.563 25.840 21.917  1.00 14.72 ? 349 ARG A O   1 
ATOM   2632 C CB  . ARG A 1 369 ? 26.453 26.210 24.045  1.00 15.95 ? 349 ARG A CB  1 
ATOM   2633 C CG  . ARG A 1 369 ? 27.256 25.752 25.277  1.00 17.29 ? 349 ARG A CG  1 
ATOM   2634 C CD  . ARG A 1 369 ? 26.953 26.554 26.538  1.00 22.92 ? 349 ARG A CD  1 
ATOM   2635 N NE  . ARG A 1 369 ? 25.555 26.440 26.944  1.00 26.79 ? 349 ARG A NE  1 
ATOM   2636 C CZ  . ARG A 1 369 ? 25.081 26.813 28.128  1.00 28.82 ? 349 ARG A CZ  1 
ATOM   2637 N NH1 . ARG A 1 369 ? 25.890 27.328 29.044  1.00 30.07 ? 349 ARG A NH1 1 
ATOM   2638 N NH2 . ARG A 1 369 ? 23.789 26.677 28.394  1.00 31.08 ? 349 ARG A NH2 1 
ATOM   2639 N N   . LYS A 1 370 ? 26.270 25.720 20.440  1.00 14.29 ? 350 LYS A N   1 
ATOM   2640 C CA  . LYS A 1 370 ? 25.472 25.973 19.236  1.00 15.96 ? 350 LYS A CA  1 
ATOM   2641 C C   . LYS A 1 370 ? 24.483 27.123 19.416  1.00 14.47 ? 350 LYS A C   1 
ATOM   2642 O O   . LYS A 1 370 ? 23.287 26.982 19.144  1.00 13.91 ? 350 LYS A O   1 
ATOM   2643 C CB  . LYS A 1 370 ? 24.727 24.693 18.840  1.00 16.73 ? 350 LYS A CB  1 
ATOM   2644 C CG  . LYS A 1 370 ? 24.157 24.697 17.433  1.00 23.84 ? 350 LYS A CG  1 
ATOM   2645 C CD  . LYS A 1 370 ? 23.642 23.315 17.063  1.00 25.69 ? 350 LYS A CD  1 
ATOM   2646 C CE  . LYS A 1 370 ? 23.127 23.265 15.632  1.00 29.11 ? 350 LYS A CE  1 
ATOM   2647 N NZ  . LYS A 1 370 ? 22.647 21.896 15.289  1.00 32.27 ? 350 LYS A NZ  1 
ATOM   2648 N N   . ARG A 1 371 ? 24.990 28.269 19.857  1.00 13.40 ? 351 ARG A N   1 
ATOM   2649 C CA  . ARG A 1 371 ? 24.143 29.433 20.082  1.00 14.00 ? 351 ARG A CA  1 
ATOM   2650 C C   . ARG A 1 371 ? 24.907 30.741 19.901  1.00 14.12 ? 351 ARG A C   1 
ATOM   2651 O O   . ARG A 1 371 ? 26.121 30.796 20.094  1.00 13.15 ? 351 ARG A O   1 
ATOM   2652 C CB  . ARG A 1 371 ? 23.555 29.374 21.494  1.00 14.64 ? 351 ARG A CB  1 
ATOM   2653 C CG  . ARG A 1 371 ? 24.607 29.348 22.611  1.00 14.39 ? 351 ARG A CG  1 
ATOM   2654 C CD  . ARG A 1 371 ? 23.976 29.363 23.996  1.00 14.13 ? 351 ARG A CD  1 
ATOM   2655 N NE  . ARG A 1 371 ? 24.978 29.600 25.041  1.00 13.82 ? 351 ARG A NE  1 
ATOM   2656 C CZ  . ARG A 1 371 ? 24.714 29.774 26.333  1.00 17.06 ? 351 ARG A CZ  1 
ATOM   2657 N NH1 . ARG A 1 371 ? 23.466 29.738 26.789  1.00 15.51 ? 351 ARG A NH1 1 
ATOM   2658 N NH2 . ARG A 1 371 ? 25.709 30.012 27.176  1.00 17.37 ? 351 ARG A NH2 1 
ATOM   2659 N N   . ILE A 1 372 ? 24.188 31.791 19.515  1.00 14.31 ? 352 ILE A N   1 
ATOM   2660 C CA  . ILE A 1 372 ? 24.796 33.102 19.327  1.00 13.20 ? 352 ILE A CA  1 
ATOM   2661 C C   . ILE A 1 372 ? 24.202 34.046 20.368  1.00 13.16 ? 352 ILE A C   1 
ATOM   2662 O O   . ILE A 1 372 ? 22.984 34.139 20.509  1.00 12.12 ? 352 ILE A O   1 
ATOM   2663 C CB  . ILE A 1 372 ? 24.525 33.662 17.907  1.00 14.16 ? 352 ILE A CB  1 
ATOM   2664 C CG1 . ILE A 1 372 ? 25.175 32.758 16.850  1.00 14.31 ? 352 ILE A CG1 1 
ATOM   2665 C CG2 . ILE A 1 372 ? 25.085 35.081 17.788  1.00 14.29 ? 352 ILE A CG2 1 
ATOM   2666 C CD1 . ILE A 1 372 ? 24.996 33.251 15.434  1.00 18.23 ? 352 ILE A CD1 1 
ATOM   2667 N N   . GLY A 1 373 ? 25.060 34.734 21.111  1.00 11.55 ? 353 GLY A N   1 
ATOM   2668 C CA  . GLY A 1 373 ? 24.567 35.650 22.121  1.00 10.54 ? 353 GLY A CA  1 
ATOM   2669 C C   . GLY A 1 373 ? 24.645 37.104 21.706  1.00 11.55 ? 353 GLY A C   1 
ATOM   2670 O O   . GLY A 1 373 ? 25.539 37.493 20.953  1.00 10.64 ? 353 GLY A O   1 
ATOM   2671 N N   . PHE A 1 374 ? 23.695 37.905 22.186  1.00 10.59 ? 354 PHE A N   1 
ATOM   2672 C CA  . PHE A 1 374 ? 23.652 39.330 21.875  1.00 11.68 ? 354 PHE A CA  1 
ATOM   2673 C C   . PHE A 1 374 ? 23.515 40.139 23.155  1.00 13.43 ? 354 PHE A C   1 
ATOM   2674 O O   . PHE A 1 374 ? 22.749 39.786 24.058  1.00 14.45 ? 354 PHE A O   1 
ATOM   2675 C CB  . PHE A 1 374 ? 22.462 39.680 20.964  1.00 10.56 ? 354 PHE A CB  1 
ATOM   2676 C CG  . PHE A 1 374 ? 22.585 39.171 19.554  1.00 11.60 ? 354 PHE A CG  1 
ATOM   2677 C CD1 . PHE A 1 374 ? 22.269 37.852 19.243  1.00 12.34 ? 354 PHE A CD1 1 
ATOM   2678 C CD2 . PHE A 1 374 ? 22.997 40.020 18.529  1.00 12.14 ? 354 PHE A CD2 1 
ATOM   2679 C CE1 . PHE A 1 374 ? 22.358 37.387 17.933  1.00 12.26 ? 354 PHE A CE1 1 
ATOM   2680 C CE2 . PHE A 1 374 ? 23.090 39.561 17.212  1.00 12.10 ? 354 PHE A CE2 1 
ATOM   2681 C CZ  . PHE A 1 374 ? 22.769 38.241 16.916  1.00 11.83 ? 354 PHE A CZ  1 
ATOM   2682 N N   . ALA A 1 375 ? 24.256 41.236 23.224  1.00 13.14 ? 355 ALA A N   1 
ATOM   2683 C CA  . ALA A 1 375 ? 24.205 42.124 24.377  1.00 14.72 ? 355 ALA A CA  1 
ATOM   2684 C C   . ALA A 1 375 ? 24.511 43.530 23.882  1.00 14.88 ? 355 ALA A C   1 
ATOM   2685 O O   . ALA A 1 375 ? 25.258 43.699 22.922  1.00 14.35 ? 355 ALA A O   1 
ATOM   2686 C CB  . ALA A 1 375 ? 25.228 41.697 25.412  1.00 14.66 ? 355 ALA A CB  1 
ATOM   2687 N N   . VAL A 1 376 ? 23.932 44.539 24.526  1.00 15.84 ? 356 VAL A N   1 
ATOM   2688 C CA  . VAL A 1 376 ? 24.185 45.920 24.121  1.00 15.51 ? 356 VAL A CA  1 
ATOM   2689 C C   . VAL A 1 376 ? 25.688 46.184 24.193  1.00 15.22 ? 356 VAL A C   1 
ATOM   2690 O O   . VAL A 1 376 ? 26.324 45.927 25.217  1.00 16.59 ? 356 VAL A O   1 
ATOM   2691 C CB  . VAL A 1 376 ? 23.448 46.918 25.046  1.00 16.06 ? 356 VAL A CB  1 
ATOM   2692 C CG1 . VAL A 1 376 ? 23.780 48.348 24.645  1.00 16.24 ? 356 VAL A CG1 1 
ATOM   2693 C CG2 . VAL A 1 376 ? 21.938 46.680 24.965  1.00 15.35 ? 356 VAL A CG2 1 
ATOM   2694 N N   . SER A 1 377 ? 26.257 46.686 23.102  1.00 16.93 ? 357 SER A N   1 
ATOM   2695 C CA  . SER A 1 377 ? 27.688 46.957 23.062  1.00 17.06 ? 357 SER A CA  1 
ATOM   2696 C C   . SER A 1 377 ? 28.086 48.211 23.837  1.00 17.91 ? 357 SER A C   1 
ATOM   2697 O O   . SER A 1 377 ? 27.417 49.240 23.766  1.00 17.30 ? 357 SER A O   1 
ATOM   2698 C CB  . SER A 1 377 ? 28.157 47.101 21.614  1.00 16.53 ? 357 SER A CB  1 
ATOM   2699 O OG  . SER A 1 377 ? 29.515 47.493 21.573  1.00 17.09 ? 357 SER A OG  1 
ATOM   2700 N N   . ALA A 1 378 ? 29.191 48.120 24.569  1.00 16.84 ? 358 ALA A N   1 
ATOM   2701 C CA  . ALA A 1 378 ? 29.683 49.262 25.324  1.00 18.71 ? 358 ALA A CA  1 
ATOM   2702 C C   . ALA A 1 378 ? 30.242 50.351 24.398  1.00 19.88 ? 358 ALA A C   1 
ATOM   2703 O O   . ALA A 1 378 ? 30.498 51.470 24.841  1.00 21.58 ? 358 ALA A O   1 
ATOM   2704 C CB  . ALA A 1 378 ? 30.757 48.813 26.311  1.00 18.63 ? 358 ALA A CB  1 
ATOM   2705 N N   . CYS A 1 379 ? 30.434 50.033 23.120  1.00 19.00 ? 359 CYS A N   1 
ATOM   2706 C CA  . CYS A 1 379 ? 30.957 51.017 22.174  1.00 19.62 ? 359 CYS A CA  1 
ATOM   2707 C C   . CYS A 1 379 ? 29.983 51.391 21.059  1.00 20.10 ? 359 CYS A C   1 
ATOM   2708 O O   . CYS A 1 379 ? 30.374 52.059 20.096  1.00 20.22 ? 359 CYS A O   1 
ATOM   2709 C CB  . CYS A 1 379 ? 32.255 50.512 21.539  1.00 19.85 ? 359 CYS A CB  1 
ATOM   2710 S SG  . CYS A 1 379 ? 32.035 49.117 20.386  1.00 22.08 ? 359 CYS A SG  1 
ATOM   2711 N N   . HIS A 1 380 ? 28.724 50.974 21.164  1.00 19.28 ? 360 HIS A N   1 
ATOM   2712 C CA  . HIS A 1 380 ? 27.786 51.309 20.106  1.00 18.93 ? 360 HIS A CA  1 
ATOM   2713 C C   . HIS A 1 380 ? 27.469 52.795 20.154  1.00 20.12 ? 360 HIS A C   1 
ATOM   2714 O O   . HIS A 1 380 ? 27.413 53.403 21.226  1.00 19.54 ? 360 HIS A O   1 
ATOM   2715 C CB  . HIS A 1 380 ? 26.503 50.469 20.196  1.00 18.35 ? 360 HIS A CB  1 
ATOM   2716 C CG  . HIS A 1 380 ? 25.463 51.022 21.119  1.00 19.00 ? 360 HIS A CG  1 
ATOM   2717 N ND1 . HIS A 1 380 ? 25.492 50.826 22.483  1.00 16.97 ? 360 HIS A ND1 1 
ATOM   2718 C CD2 . HIS A 1 380 ? 24.357 51.763 20.868  1.00 17.02 ? 360 HIS A CD2 1 
ATOM   2719 C CE1 . HIS A 1 380 ? 24.449 51.421 23.033  1.00 17.00 ? 360 HIS A CE1 1 
ATOM   2720 N NE2 . HIS A 1 380 ? 23.745 51.998 22.074  1.00 18.33 ? 360 HIS A NE2 1 
ATOM   2721 N N   . VAL A 1 381 ? 27.287 53.371 18.973  1.00 20.66 ? 361 VAL A N   1 
ATOM   2722 C CA  . VAL A 1 381 ? 26.998 54.789 18.819  1.00 19.95 ? 361 VAL A CA  1 
ATOM   2723 C C   . VAL A 1 381 ? 25.535 55.089 19.098  1.00 19.65 ? 361 VAL A C   1 
ATOM   2724 O O   . VAL A 1 381 ? 24.638 54.443 18.557  1.00 18.25 ? 361 VAL A O   1 
ATOM   2725 C CB  . VAL A 1 381 ? 27.352 55.258 17.393  1.00 21.43 ? 361 VAL A CB  1 
ATOM   2726 C CG1 . VAL A 1 381 ? 27.092 56.753 17.249  1.00 22.24 ? 361 VAL A CG1 1 
ATOM   2727 C CG2 . VAL A 1 381 ? 28.815 54.929 17.087  1.00 21.53 ? 361 VAL A CG2 1 
ATOM   2728 N N   . HIS A 1 382 ? 25.302 56.076 19.953  1.00 19.83 ? 362 HIS A N   1 
ATOM   2729 C CA  . HIS A 1 382 ? 23.952 56.474 20.311  1.00 21.48 ? 362 HIS A CA  1 
ATOM   2730 C C   . HIS A 1 382 ? 23.949 57.929 20.765  1.00 22.32 ? 362 HIS A C   1 
ATOM   2731 O O   . HIS A 1 382 ? 24.969 58.617 20.689  1.00 21.70 ? 362 HIS A O   1 
ATOM   2732 C CB  . HIS A 1 382 ? 23.406 55.573 21.428  1.00 22.86 ? 362 HIS A CB  1 
ATOM   2733 C CG  . HIS A 1 382 ? 24.226 55.587 22.683  1.00 25.18 ? 362 HIS A CG  1 
ATOM   2734 N ND1 . HIS A 1 382 ? 25.415 54.900 22.807  1.00 26.31 ? 362 HIS A ND1 1 
ATOM   2735 C CD2 . HIS A 1 382 ? 24.023 56.204 23.871  1.00 26.32 ? 362 HIS A CD2 1 
ATOM   2736 C CE1 . HIS A 1 382 ? 25.908 55.091 24.017  1.00 25.70 ? 362 HIS A CE1 1 
ATOM   2737 N NE2 . HIS A 1 382 ? 25.083 55.878 24.683  1.00 28.33 ? 362 HIS A NE2 1 
ATOM   2738 N N   . ASP A 1 383 ? 22.796 58.402 21.223  1.00 23.47 ? 363 ASP A N   1 
ATOM   2739 C CA  . ASP A 1 383 ? 22.692 59.771 21.701  1.00 24.51 ? 363 ASP A CA  1 
ATOM   2740 C C   . ASP A 1 383 ? 22.092 59.784 23.106  1.00 26.08 ? 363 ASP A C   1 
ATOM   2741 O O   . ASP A 1 383 ? 21.881 58.729 23.707  1.00 25.46 ? 363 ASP A O   1 
ATOM   2742 C CB  . ASP A 1 383 ? 21.864 60.624 20.725  1.00 23.72 ? 363 ASP A CB  1 
ATOM   2743 C CG  . ASP A 1 383 ? 20.529 59.996 20.372  1.00 22.56 ? 363 ASP A CG  1 
ATOM   2744 O OD1 . ASP A 1 383 ? 19.757 59.669 21.293  1.00 23.96 ? 363 ASP A OD1 1 
ATOM   2745 O OD2 . ASP A 1 383 ? 20.242 59.841 19.164  1.00 24.60 ? 363 ASP A OD2 1 
ATOM   2746 N N   . GLU A 1 384 ? 21.827 60.974 23.633  1.00 27.59 ? 364 GLU A N   1 
ATOM   2747 C CA  . GLU A 1 384 ? 21.280 61.109 24.980  1.00 29.60 ? 364 GLU A CA  1 
ATOM   2748 C C   . GLU A 1 384 ? 19.808 60.715 25.119  1.00 29.32 ? 364 GLU A C   1 
ATOM   2749 O O   . GLU A 1 384 ? 19.280 60.679 26.229  1.00 30.82 ? 364 GLU A O   1 
ATOM   2750 C CB  . GLU A 1 384 ? 21.462 62.552 25.464  1.00 32.62 ? 364 GLU A CB  1 
ATOM   2751 C CG  . GLU A 1 384 ? 20.588 63.562 24.736  1.00 36.95 ? 364 GLU A CG  1 
ATOM   2752 C CD  . GLU A 1 384 ? 20.959 64.999 25.049  1.00 40.14 ? 364 GLU A CD  1 
ATOM   2753 O OE1 . GLU A 1 384 ? 22.022 65.457 24.575  1.00 42.85 ? 364 GLU A OE1 1 
ATOM   2754 O OE2 . GLU A 1 384 ? 20.192 65.671 25.772  1.00 41.98 ? 364 GLU A OE2 1 
ATOM   2755 N N   . PHE A 1 385 ? 19.148 60.411 24.005  1.00 28.66 ? 365 PHE A N   1 
ATOM   2756 C CA  . PHE A 1 385 ? 17.733 60.048 24.039  1.00 27.10 ? 365 PHE A CA  1 
ATOM   2757 C C   . PHE A 1 385 ? 17.449 58.566 23.842  1.00 25.71 ? 365 PHE A C   1 
ATOM   2758 O O   . PHE A 1 385 ? 16.554 58.014 24.478  1.00 24.10 ? 365 PHE A O   1 
ATOM   2759 C CB  . PHE A 1 385 ? 16.956 60.834 22.978  1.00 28.87 ? 365 PHE A CB  1 
ATOM   2760 C CG  . PHE A 1 385 ? 17.112 62.323 23.091  1.00 32.13 ? 365 PHE A CG  1 
ATOM   2761 C CD1 . PHE A 1 385 ? 18.089 62.992 22.362  1.00 32.22 ? 365 PHE A CD1 1 
ATOM   2762 C CD2 . PHE A 1 385 ? 16.293 63.056 23.946  1.00 33.87 ? 365 PHE A CD2 1 
ATOM   2763 C CE1 . PHE A 1 385 ? 18.251 64.370 22.482  1.00 33.60 ? 365 PHE A CE1 1 
ATOM   2764 C CE2 . PHE A 1 385 ? 16.448 64.434 24.072  1.00 34.34 ? 365 PHE A CE2 1 
ATOM   2765 C CZ  . PHE A 1 385 ? 17.428 65.091 23.338  1.00 34.59 ? 365 PHE A CZ  1 
ATOM   2766 N N   . ARG A 1 386 ? 18.199 57.925 22.952  1.00 23.45 ? 366 ARG A N   1 
ATOM   2767 C CA  . ARG A 1 386 ? 17.980 56.511 22.682  1.00 22.96 ? 366 ARG A CA  1 
ATOM   2768 C C   . ARG A 1 386 ? 19.263 55.699 22.684  1.00 21.80 ? 366 ARG A C   1 
ATOM   2769 O O   . ARG A 1 386 ? 20.350 56.218 22.443  1.00 20.33 ? 366 ARG A O   1 
ATOM   2770 C CB  . ARG A 1 386 ? 17.281 56.334 21.328  1.00 22.20 ? 366 ARG A CB  1 
ATOM   2771 C CG  . ARG A 1 386 ? 15.918 57.004 21.238  1.00 22.97 ? 366 ARG A CG  1 
ATOM   2772 C CD  . ARG A 1 386 ? 15.222 56.711 19.913  1.00 22.37 ? 366 ARG A CD  1 
ATOM   2773 N NE  . ARG A 1 386 ? 15.934 57.283 18.773  1.00 22.27 ? 366 ARG A NE  1 
ATOM   2774 C CZ  . ARG A 1 386 ? 15.439 57.367 17.541  1.00 22.30 ? 366 ARG A CZ  1 
ATOM   2775 N NH1 . ARG A 1 386 ? 14.220 56.917 17.277  1.00 22.69 ? 366 ARG A NH1 1 
ATOM   2776 N NH2 . ARG A 1 386 ? 16.161 57.911 16.570  1.00 22.16 ? 366 ARG A NH2 1 
ATOM   2777 N N   . THR A 1 387 ? 19.116 54.412 22.963  1.00 21.01 ? 367 THR A N   1 
ATOM   2778 C CA  . THR A 1 387 ? 20.242 53.495 22.975  1.00 20.65 ? 367 THR A CA  1 
ATOM   2779 C C   . THR A 1 387 ? 19.803 52.202 22.304  1.00 19.81 ? 367 THR A C   1 
ATOM   2780 O O   . THR A 1 387 ? 18.608 51.912 22.226  1.00 18.67 ? 367 THR A O   1 
ATOM   2781 C CB  . THR A 1 387 ? 20.682 53.160 24.413  1.00 22.64 ? 367 THR A CB  1 
ATOM   2782 O OG1 . THR A 1 387 ? 21.794 52.259 24.375  1.00 26.87 ? 367 THR A OG1 1 
ATOM   2783 C CG2 . THR A 1 387 ? 19.548 52.497 25.180  1.00 22.14 ? 367 THR A CG2 1 
ATOM   2784 N N   . ALA A 1 388 ? 20.767 51.442 21.798  1.00 16.89 ? 368 ALA A N   1 
ATOM   2785 C CA  . ALA A 1 388 ? 20.464 50.158 21.191  1.00 16.65 ? 368 ALA A CA  1 
ATOM   2786 C C   . ALA A 1 388 ? 20.028 49.322 22.389  1.00 15.48 ? 368 ALA A C   1 
ATOM   2787 O O   . ALA A 1 388 ? 20.322 49.677 23.534  1.00 17.20 ? 368 ALA A O   1 
ATOM   2788 C CB  . ALA A 1 388 ? 21.712 49.563 20.556  1.00 15.40 ? 368 ALA A CB  1 
ATOM   2789 N N   . ALA A 1 389 ? 19.337 48.218 22.145  1.00 14.30 ? 369 ALA A N   1 
ATOM   2790 C CA  . ALA A 1 389 ? 18.874 47.402 23.253  1.00 14.50 ? 369 ALA A CA  1 
ATOM   2791 C C   . ALA A 1 389 ? 18.710 45.935 22.918  1.00 14.12 ? 369 ALA A C   1 
ATOM   2792 O O   . ALA A 1 389 ? 18.584 45.555 21.758  1.00 13.67 ? 369 ALA A O   1 
ATOM   2793 C CB  . ALA A 1 389 ? 17.546 47.954 23.771  1.00 14.42 ? 369 ALA A CB  1 
ATOM   2794 N N   . VAL A 1 390 ? 18.725 45.114 23.961  1.00 13.36 ? 370 VAL A N   1 
ATOM   2795 C CA  . VAL A 1 390 ? 18.520 43.678 23.827  1.00 14.38 ? 370 VAL A CA  1 
ATOM   2796 C C   . VAL A 1 390 ? 17.578 43.401 24.987  1.00 14.71 ? 370 VAL A C   1 
ATOM   2797 O O   . VAL A 1 390 ? 17.962 43.533 26.148  1.00 15.71 ? 370 VAL A O   1 
ATOM   2798 C CB  . VAL A 1 390 ? 19.821 42.878 24.009  1.00 13.77 ? 370 VAL A CB  1 
ATOM   2799 C CG1 . VAL A 1 390 ? 19.534 41.395 23.831  1.00 11.13 ? 370 VAL A CG1 1 
ATOM   2800 C CG2 . VAL A 1 390 ? 20.859 43.333 22.989  1.00 13.80 ? 370 VAL A CG2 1 
ATOM   2801 N N   . GLU A 1 391 ? 16.341 43.042 24.667  1.00 14.26 ? 371 GLU A N   1 
ATOM   2802 C CA  . GLU A 1 391 ? 15.339 42.817 25.694  1.00 15.84 ? 371 GLU A CA  1 
ATOM   2803 C C   . GLU A 1 391 ? 14.569 41.525 25.525  1.00 15.32 ? 371 GLU A C   1 
ATOM   2804 O O   . GLU A 1 391 ? 14.425 41.001 24.422  1.00 17.64 ? 371 GLU A O   1 
ATOM   2805 C CB  . GLU A 1 391 ? 14.351 43.988 25.701  1.00 16.99 ? 371 GLU A CB  1 
ATOM   2806 C CG  . GLU A 1 391 ? 15.011 45.360 25.761  1.00 21.35 ? 371 GLU A CG  1 
ATOM   2807 C CD  . GLU A 1 391 ? 14.021 46.492 25.554  1.00 27.09 ? 371 GLU A CD  1 
ATOM   2808 O OE1 . GLU A 1 391 ? 13.229 46.778 26.478  1.00 31.06 ? 371 GLU A OE1 1 
ATOM   2809 O OE2 . GLU A 1 391 ? 14.028 47.090 24.458  1.00 30.62 ? 371 GLU A OE2 1 
ATOM   2810 N N   . GLY A 1 392 ? 14.048 41.035 26.639  1.00 16.60 ? 372 GLY A N   1 
ATOM   2811 C CA  . GLY A 1 392 ? 13.281 39.812 26.626  1.00 14.67 ? 372 GLY A CA  1 
ATOM   2812 C C   . GLY A 1 392 ? 12.830 39.487 28.039  1.00 14.29 ? 372 GLY A C   1 
ATOM   2813 O O   . GLY A 1 392 ? 13.131 40.228 28.977  1.00 13.32 ? 372 GLY A O   1 
ATOM   2814 N N   . PRO A 1 393 ? 12.096 38.382 28.216  1.00 12.99 ? 373 PRO A N   1 
ATOM   2815 C CA  . PRO A 1 393 ? 11.728 37.507 27.104  1.00 12.99 ? 373 PRO A CA  1 
ATOM   2816 C C   . PRO A 1 393 ? 10.358 37.898 26.563  1.00 14.66 ? 373 PRO A C   1 
ATOM   2817 O O   . PRO A 1 393 ? 9.628  38.678 27.180  1.00 15.27 ? 373 PRO A O   1 
ATOM   2818 C CB  . PRO A 1 393 ? 11.694 36.139 27.760  1.00 13.04 ? 373 PRO A CB  1 
ATOM   2819 C CG  . PRO A 1 393 ? 11.040 36.474 29.085  1.00 13.19 ? 373 PRO A CG  1 
ATOM   2820 C CD  . PRO A 1 393 ? 11.763 37.755 29.509  1.00 13.65 ? 373 PRO A CD  1 
ATOM   2821 N N   . PHE A 1 394 ? 10.013 37.347 25.409  1.00 16.07 ? 374 PHE A N   1 
ATOM   2822 C CA  . PHE A 1 394 ? 8.717  37.600 24.802  1.00 17.72 ? 374 PHE A CA  1 
ATOM   2823 C C   . PHE A 1 394 ? 8.131  36.254 24.429  1.00 18.69 ? 374 PHE A C   1 
ATOM   2824 O O   . PHE A 1 394 ? 8.853  35.262 24.320  1.00 18.75 ? 374 PHE A O   1 
ATOM   2825 C CB  . PHE A 1 394 ? 8.847  38.490 23.559  1.00 17.89 ? 374 PHE A CB  1 
ATOM   2826 C CG  . PHE A 1 394 ? 9.337  39.876 23.864  1.00 17.64 ? 374 PHE A CG  1 
ATOM   2827 C CD1 . PHE A 1 394 ? 10.688 40.191 23.755  1.00 17.72 ? 374 PHE A CD1 1 
ATOM   2828 C CD2 . PHE A 1 394 ? 8.458  40.848 24.332  1.00 15.95 ? 374 PHE A CD2 1 
ATOM   2829 C CE1 . PHE A 1 394 ? 11.158 41.449 24.114  1.00 16.27 ? 374 PHE A CE1 1 
ATOM   2830 C CE2 . PHE A 1 394 ? 8.918  42.114 24.695  1.00 16.70 ? 374 PHE A CE2 1 
ATOM   2831 C CZ  . PHE A 1 394 ? 10.272 42.413 24.587  1.00 17.08 ? 374 PHE A CZ  1 
ATOM   2832 N N   . VAL A 1 395 ? 6.819  36.220 24.246  1.00 18.55 ? 375 VAL A N   1 
ATOM   2833 C CA  . VAL A 1 395 ? 6.133  34.995 23.888  1.00 18.94 ? 375 VAL A CA  1 
ATOM   2834 C C   . VAL A 1 395 ? 5.846  34.991 22.398  1.00 19.16 ? 375 VAL A C   1 
ATOM   2835 O O   . VAL A 1 395 ? 5.153  35.867 21.891  1.00 18.48 ? 375 VAL A O   1 
ATOM   2836 C CB  . VAL A 1 395 ? 4.793  34.864 24.655  1.00 19.23 ? 375 VAL A CB  1 
ATOM   2837 C CG1 . VAL A 1 395 ? 4.061  33.604 24.215  1.00 21.40 ? 375 VAL A CG1 1 
ATOM   2838 C CG2 . VAL A 1 395 ? 5.055  34.834 26.151  1.00 20.25 ? 375 VAL A CG2 1 
ATOM   2839 N N   . THR A 1 396 ? 6.399  34.009 21.700  1.00 18.93 ? 376 THR A N   1 
ATOM   2840 C CA  . THR A 1 396 ? 6.187  33.878 20.270  1.00 19.80 ? 376 THR A CA  1 
ATOM   2841 C C   . THR A 1 396 ? 5.947  32.401 20.002  1.00 18.57 ? 376 THR A C   1 
ATOM   2842 O O   . THR A 1 396 ? 6.776  31.569 20.345  1.00 17.97 ? 376 THR A O   1 
ATOM   2843 C CB  . THR A 1 396 ? 7.423  34.343 19.474  1.00 21.01 ? 376 THR A CB  1 
ATOM   2844 O OG1 . THR A 1 396 ? 7.856  35.618 19.964  1.00 21.68 ? 376 THR A OG1 1 
ATOM   2845 C CG2 . THR A 1 396 ? 7.079  34.474 18.000  1.00 21.14 ? 376 THR A CG2 1 
ATOM   2846 N N   . LEU A 1 397 ? 4.809  32.080 19.395  1.00 19.11 ? 377 LEU A N   1 
ATOM   2847 C CA  . LEU A 1 397 ? 4.465  30.690 19.105  1.00 21.17 ? 377 LEU A CA  1 
ATOM   2848 C C   . LEU A 1 397 ? 4.833  30.270 17.682  1.00 21.61 ? 377 LEU A C   1 
ATOM   2849 O O   . LEU A 1 397 ? 5.046  31.112 16.808  1.00 22.45 ? 377 LEU A O   1 
ATOM   2850 C CB  . LEU A 1 397 ? 2.962  30.471 19.316  1.00 21.32 ? 377 LEU A CB  1 
ATOM   2851 C CG  . LEU A 1 397 ? 2.342  30.984 20.620  1.00 22.04 ? 377 LEU A CG  1 
ATOM   2852 C CD1 . LEU A 1 397 ? 0.853  30.658 20.631  1.00 22.92 ? 377 LEU A CD1 1 
ATOM   2853 C CD2 . LEU A 1 397 ? 3.041  30.355 21.821  1.00 21.47 ? 377 LEU A CD2 1 
ATOM   2854 N N   . ASP A 1 398 ? 4.909  28.961 17.461  1.00 22.40 ? 378 ASP A N   1 
ATOM   2855 C CA  . ASP A 1 398 ? 5.220  28.408 16.140  1.00 23.91 ? 378 ASP A CA  1 
ATOM   2856 C C   . ASP A 1 398 ? 6.513  28.921 15.502  1.00 24.24 ? 378 ASP A C   1 
ATOM   2857 O O   . ASP A 1 398 ? 6.609  28.996 14.276  1.00 25.05 ? 378 ASP A O   1 
ATOM   2858 C CB  . ASP A 1 398 ? 4.056  28.688 15.183  1.00 25.76 ? 378 ASP A CB  1 
ATOM   2859 C CG  . ASP A 1 398 ? 2.746  28.083 15.657  1.00 29.54 ? 378 ASP A CG  1 
ATOM   2860 O OD1 . ASP A 1 398 ? 1.679  28.587 15.250  1.00 32.43 ? 378 ASP A OD1 1 
ATOM   2861 O OD2 . ASP A 1 398 ? 2.779  27.099 16.426  1.00 32.05 ? 378 ASP A OD2 1 
ATOM   2862 N N   . MET A 1 399 ? 7.508  29.262 16.314  1.00 23.13 ? 379 MET A N   1 
ATOM   2863 C CA  . MET A 1 399 ? 8.770  29.763 15.777  1.00 23.42 ? 379 MET A CA  1 
ATOM   2864 C C   . MET A 1 399 ? 9.498  28.743 14.908  1.00 24.83 ? 379 MET A C   1 
ATOM   2865 O O   . MET A 1 399 ? 10.271 29.113 14.027  1.00 24.55 ? 379 MET A O   1 
ATOM   2866 C CB  . MET A 1 399 ? 9.695  30.214 16.910  1.00 19.77 ? 379 MET A CB  1 
ATOM   2867 C CG  . MET A 1 399 ? 9.167  31.398 17.698  1.00 18.29 ? 379 MET A CG  1 
ATOM   2868 S SD  . MET A 1 399 ? 10.386 32.014 18.870  1.00 18.52 ? 379 MET A SD  1 
ATOM   2869 C CE  . MET A 1 399 ? 10.346 30.706 20.079  1.00 15.88 ? 379 MET A CE  1 
ATOM   2870 N N   . GLU A 1 400 ? 9.255  27.463 15.160  1.00 27.50 ? 380 GLU A N   1 
ATOM   2871 C CA  . GLU A 1 400 ? 9.890  26.399 14.391  1.00 30.06 ? 380 GLU A CA  1 
ATOM   2872 C C   . GLU A 1 400 ? 9.490  26.453 12.911  1.00 30.93 ? 380 GLU A C   1 
ATOM   2873 O O   . GLU A 1 400 ? 10.272 26.078 12.030  1.00 32.54 ? 380 GLU A O   1 
ATOM   2874 C CB  . GLU A 1 400 ? 9.507  25.041 14.979  1.00 32.60 ? 380 GLU A CB  1 
ATOM   2875 C CG  . GLU A 1 400 ? 10.661 24.062 15.075  1.00 37.43 ? 380 GLU A CG  1 
ATOM   2876 C CD  . GLU A 1 400 ? 11.771 24.572 15.972  1.00 39.41 ? 380 GLU A CD  1 
ATOM   2877 O OE1 . GLU A 1 400 ? 11.498 24.834 17.161  1.00 42.62 ? 380 GLU A OE1 1 
ATOM   2878 O OE2 . GLU A 1 400 ? 12.915 24.712 15.492  1.00 40.88 ? 380 GLU A OE2 1 
ATOM   2879 N N   . ASP A 1 401 ? 8.276  26.924 12.639  1.00 28.89 ? 381 ASP A N   1 
ATOM   2880 C CA  . ASP A 1 401 ? 7.782  27.015 11.271  1.00 29.04 ? 381 ASP A CA  1 
ATOM   2881 C C   . ASP A 1 401 ? 8.370  28.172 10.464  1.00 27.78 ? 381 ASP A C   1 
ATOM   2882 O O   . ASP A 1 401 ? 8.192  28.227 9.250   1.00 27.50 ? 381 ASP A O   1 
ATOM   2883 C CB  . ASP A 1 401 ? 6.256  27.135 11.263  1.00 31.34 ? 381 ASP A CB  1 
ATOM   2884 C CG  . ASP A 1 401 ? 5.575  25.956 11.924  1.00 33.47 ? 381 ASP A CG  1 
ATOM   2885 O OD1 . ASP A 1 401 ? 5.991  24.807 11.664  1.00 35.08 ? 381 ASP A OD1 1 
ATOM   2886 O OD2 . ASP A 1 401 ? 4.620  26.178 12.696  1.00 34.98 ? 381 ASP A OD2 1 
ATOM   2887 N N   . CYS A 1 402 ? 9.065  29.092 11.130  1.00 25.42 ? 382 CYS A N   1 
ATOM   2888 C CA  . CYS A 1 402 ? 9.654  30.240 10.443  1.00 23.83 ? 382 CYS A CA  1 
ATOM   2889 C C   . CYS A 1 402 ? 10.822 29.875 9.542   1.00 23.41 ? 382 CYS A C   1 
ATOM   2890 O O   . CYS A 1 402 ? 11.107 30.586 8.582   1.00 22.39 ? 382 CYS A O   1 
ATOM   2891 C CB  . CYS A 1 402 ? 10.143 31.281 11.447  1.00 22.97 ? 382 CYS A CB  1 
ATOM   2892 S SG  . CYS A 1 402 ? 8.876  31.876 12.600  1.00 19.99 ? 382 CYS A SG  1 
ATOM   2893 N N   . GLY A 1 403 ? 11.505 28.781 9.862   1.00 23.42 ? 383 GLY A N   1 
ATOM   2894 C CA  . GLY A 1 403 ? 12.651 28.367 9.072   1.00 23.81 ? 383 GLY A CA  1 
ATOM   2895 C C   . GLY A 1 403 ? 12.317 27.798 7.708   1.00 25.26 ? 383 GLY A C   1 
ATOM   2896 O O   . GLY A 1 403 ? 11.289 27.145 7.532   1.00 24.52 ? 383 GLY A O   1 
ATOM   2897 N N   . TYR A 1 404 ? 13.197 28.059 6.743   1.00 25.95 ? 384 TYR A N   1 
ATOM   2898 C CA  . TYR A 1 404 ? 13.043 27.577 5.374   1.00 28.81 ? 384 TYR A CA  1 
ATOM   2899 C C   . TYR A 1 404 ? 13.620 26.168 5.279   1.00 30.45 ? 384 TYR A C   1 
ATOM   2900 O O   . TYR A 1 404 ? 14.673 25.885 5.848   1.00 29.70 ? 384 TYR A O   1 
ATOM   2901 C CB  . TYR A 1 404 ? 13.791 28.498 4.404   1.00 29.50 ? 384 TYR A CB  1 
ATOM   2902 C CG  . TYR A 1 404 ? 13.859 27.977 2.985   1.00 32.67 ? 384 TYR A CG  1 
ATOM   2903 C CD1 . TYR A 1 404 ? 12.741 28.011 2.153   1.00 32.89 ? 384 TYR A CD1 1 
ATOM   2904 C CD2 . TYR A 1 404 ? 15.039 27.434 2.479   1.00 32.35 ? 384 TYR A CD2 1 
ATOM   2905 C CE1 . TYR A 1 404 ? 12.796 27.519 0.853   1.00 34.27 ? 384 TYR A CE1 1 
ATOM   2906 C CE2 . TYR A 1 404 ? 15.104 26.938 1.180   1.00 35.09 ? 384 TYR A CE2 1 
ATOM   2907 C CZ  . TYR A 1 404 ? 13.979 26.984 0.374   1.00 35.32 ? 384 TYR A CZ  1 
ATOM   2908 O OH  . TYR A 1 404 ? 14.038 26.498 -0.911  1.00 38.31 ? 384 TYR A OH  1 
ATOM   2909 N N   . ASN A 1 405 ? 12.934 25.288 4.558   1.00 33.10 ? 385 ASN A N   1 
ATOM   2910 C CA  . ASN A 1 405 ? 13.398 23.914 4.404   1.00 35.59 ? 385 ASN A CA  1 
ATOM   2911 C C   . ASN A 1 405 ? 13.684 23.580 2.945   1.00 36.95 ? 385 ASN A C   1 
ATOM   2912 O O   . ASN A 1 405 ? 13.357 24.403 2.066   1.00 38.79 ? 385 ASN A O   1 
ATOM   2913 C CB  . ASN A 1 405 ? 12.354 22.942 4.953   1.00 36.13 ? 385 ASN A CB  1 
ATOM   2914 C CG  . ASN A 1 405 ? 11.962 23.257 6.378   1.00 36.52 ? 385 ASN A CG  1 
ATOM   2915 O OD1 . ASN A 1 405 ? 12.803 23.267 7.276   1.00 39.19 ? 385 ASN A OD1 1 
ATOM   2916 N ND2 . ASN A 1 405 ? 10.681 23.521 6.594   1.00 37.08 ? 385 ASN A ND2 1 
ATOM   2917 O OXT . ASN A 1 405 ? 14.226 22.485 2.699   1.00 40.64 ? 385 ASN A OXT 1 
HETATM 2918 C C1  . 32P B 2 .   ? 29.145 47.938 -1.433  1.00 24.79 ? 401 32P A C1  1 
HETATM 2919 C C2  . 32P B 2 .   ? 29.683 48.686 -0.304  1.00 26.16 ? 401 32P A C2  1 
HETATM 2920 C C3  . 32P B 2 .   ? 28.944 48.912 0.934   1.00 25.55 ? 401 32P A C3  1 
HETATM 2921 C C4  . 32P B 2 .   ? 27.611 48.343 1.050   1.00 25.48 ? 401 32P A C4  1 
HETATM 2922 C C5  . 32P B 2 .   ? 27.073 47.570 -0.074  1.00 24.90 ? 401 32P A C5  1 
HETATM 2923 C C6  . 32P B 2 .   ? 27.815 47.369 -1.318  1.00 24.92 ? 401 32P A C6  1 
HETATM 2924 S S1  . 32P B 2 .   ? 25.784 45.361 0.868   1.00 22.97 ? 401 32P A S1  1 
HETATM 2925 O O1  . 32P B 2 .   ? 26.807 44.543 -0.052  1.00 21.77 ? 401 32P A O1  1 
HETATM 2926 O O2  . 32P B 2 .   ? 24.480 44.768 0.746   1.00 23.33 ? 401 32P A O2  1 
HETATM 2927 O O3  . 32P B 2 .   ? 26.350 45.506 2.158   1.00 21.69 ? 401 32P A O3  1 
HETATM 2928 C C7  . 32P B 2 .   ? 25.700 46.951 0.057   1.00 24.00 ? 401 32P A C7  1 
HETATM 2929 C C8  . 32P B 2 .   ? 27.908 43.922 0.535   1.00 19.25 ? 401 32P A C8  1 
HETATM 2930 C C9  . 32P B 2 .   ? 27.911 42.488 0.571   1.00 19.35 ? 401 32P A C9  1 
HETATM 2931 C C10 . 32P B 2 .   ? 29.041 41.764 1.076   1.00 16.55 ? 401 32P A C10 1 
HETATM 2932 C C11 . 32P B 2 .   ? 30.170 42.509 1.570   1.00 14.95 ? 401 32P A C11 1 
HETATM 2933 C C12 . 32P B 2 .   ? 30.195 43.943 1.568   1.00 14.66 ? 401 32P A C12 1 
HETATM 2934 C C13 . 32P B 2 .   ? 29.056 44.643 1.039   1.00 18.48 ? 401 32P A C13 1 
HETATM 2935 O O4  . 32P B 2 .   ? 28.957 40.380 0.975   1.00 15.58 ? 401 32P A O4  1 
HETATM 2936 C C14 . 32P B 2 .   ? 31.356 44.711 2.060   1.00 13.94 ? 401 32P A C14 1 
HETATM 2937 C C15 . 32P B 2 .   ? 29.855 39.489 1.680   1.00 16.07 ? 401 32P A C15 1 
HETATM 2938 C C16 . 32P B 2 .   ? 31.221 39.466 1.015   1.00 16.18 ? 401 32P A C16 1 
HETATM 2939 N N1  . 32P B 2 .   ? 32.179 38.948 1.810   1.00 14.36 ? 401 32P A N1  1 
HETATM 2940 O O5  . 32P B 2 .   ? 31.368 39.870 -0.140  1.00 15.11 ? 401 32P A O5  1 
HETATM 2941 N N2  . 32P B 2 .   ? 32.096 44.118 3.016   1.00 12.51 ? 401 32P A N2  1 
HETATM 2942 O O6  . 32P B 2 .   ? 31.665 45.827 1.638   1.00 14.21 ? 401 32P A O6  1 
HETATM 2943 C C17 . 32P B 2 .   ? 33.122 44.887 3.714   1.00 13.69 ? 401 32P A C17 1 
HETATM 2944 C C18 . 32P B 2 .   ? 34.368 44.005 3.841   1.00 14.89 ? 401 32P A C18 1 
HETATM 2945 C C19 . 32P B 2 .   ? 34.672 41.222 0.143   1.00 15.41 ? 401 32P A C19 1 
HETATM 2946 C C20 . 32P B 2 .   ? 34.390 41.036 1.631   1.00 16.10 ? 401 32P A C20 1 
HETATM 2947 C C21 . 32P B 2 .   ? 34.556 39.590 2.062   1.00 13.15 ? 401 32P A C21 1 
HETATM 2948 C C22 . 32P B 2 .   ? 33.544 38.683 1.373   1.00 15.48 ? 401 32P A C22 1 
HETATM 2949 N N3  . 32P B 2 .   ? 34.735 42.794 -1.716  1.00 13.26 ? 401 32P A N3  1 
HETATM 2950 C C23 . 32P B 2 .   ? 34.459 42.672 -0.275  1.00 16.40 ? 401 32P A C23 1 
HETATM 2951 C C24 . 32P B 2 .   ? 32.283 44.475 6.133   1.00 13.54 ? 401 32P A C24 1 
HETATM 2952 C C25 . 32P B 2 .   ? 32.668 45.385 5.038   1.00 13.77 ? 401 32P A C25 1 
HETATM 2953 C C26 . 32P B 2 .   ? 32.639 46.835 5.145   1.00 13.87 ? 401 32P A C26 1 
HETATM 2954 C C27 . 32P B 2 .   ? 32.232 47.413 6.388   1.00 13.45 ? 401 32P A C27 1 
HETATM 2955 C C28 . 32P B 2 .   ? 31.908 46.504 7.468   1.00 14.67 ? 401 32P A C28 1 
HETATM 2956 C C29 . 32P B 2 .   ? 31.915 45.058 7.394   1.00 13.47 ? 401 32P A C29 1 
HETATM 2957 F F1  . 32P B 2 .   ? 31.567 47.059 8.620   1.00 16.24 ? 401 32P A F1  1 
HETATM 2958 O O   . HOH C 3 .   ? 44.897 32.348 25.065  1.00 6.07  ? 402 HOH A O   1 
HETATM 2959 O O   . HOH C 3 .   ? 41.652 28.373 2.557   1.00 13.61 ? 403 HOH A O   1 
HETATM 2960 O O   . HOH C 3 .   ? 41.137 44.777 1.019   1.00 15.40 ? 404 HOH A O   1 
HETATM 2961 O O   . HOH C 3 .   ? 32.417 50.173 9.781   1.00 22.89 ? 405 HOH A O   1 
HETATM 2962 O O   . HOH C 3 .   ? 38.616 26.100 5.143   1.00 16.06 ? 406 HOH A O   1 
HETATM 2963 O O   . HOH C 3 .   ? 47.420 32.642 18.167  1.00 12.97 ? 407 HOH A O   1 
HETATM 2964 O O   . HOH C 3 .   ? 45.166 42.658 16.099  1.00 11.67 ? 408 HOH A O   1 
HETATM 2965 O O   . HOH C 3 .   ? 22.451 43.645 26.953  1.00 17.00 ? 409 HOH A O   1 
HETATM 2966 O O   . HOH C 3 .   ? 29.735 43.154 17.244  1.00 12.78 ? 410 HOH A O   1 
HETATM 2967 O O   . HOH C 3 .   ? 18.062 31.276 15.888  1.00 12.20 ? 411 HOH A O   1 
HETATM 2968 O O   . HOH C 3 .   ? 58.969 34.588 6.024   1.00 12.87 ? 412 HOH A O   1 
HETATM 2969 O O   . HOH C 3 .   ? 42.917 25.256 8.818   1.00 11.91 ? 413 HOH A O   1 
HETATM 2970 O O   . HOH C 3 .   ? 37.251 29.232 10.946  1.00 9.98  ? 414 HOH A O   1 
HETATM 2971 O O   . HOH C 3 .   ? 38.981 29.552 7.713   1.00 10.78 ? 415 HOH A O   1 
HETATM 2972 O O   . HOH C 3 .   ? 27.318 33.601 8.836   1.00 11.49 ? 416 HOH A O   1 
HETATM 2973 O O   . HOH C 3 .   ? 33.357 23.394 10.837  1.00 16.06 ? 417 HOH A O   1 
HETATM 2974 O O   . HOH C 3 .   ? 60.105 38.603 10.054  1.00 14.89 ? 418 HOH A O   1 
HETATM 2975 O O   . HOH C 3 .   ? 6.564  40.382 12.402  1.00 18.37 ? 419 HOH A O   1 
HETATM 2976 O O   . HOH C 3 .   ? 46.367 40.192 16.518  1.00 12.79 ? 420 HOH A O   1 
HETATM 2977 O O   . HOH C 3 .   ? 42.343 27.843 7.649   1.00 12.27 ? 421 HOH A O   1 
HETATM 2978 O O   . HOH C 3 .   ? 19.178 33.451 26.481  1.00 14.52 ? 422 HOH A O   1 
HETATM 2979 O O   . HOH C 3 .   ? 53.635 33.904 -1.912  1.00 14.02 ? 423 HOH A O   1 
HETATM 2980 O O   . HOH C 3 .   ? 15.513 29.826 7.066   1.00 16.65 ? 424 HOH A O   1 
HETATM 2981 O O   . HOH C 3 .   ? 36.692 33.123 3.139   1.00 12.28 ? 425 HOH A O   1 
HETATM 2982 O O   . HOH C 3 .   ? 34.393 29.897 2.387   1.00 15.05 ? 426 HOH A O   1 
HETATM 2983 O O   . HOH C 3 .   ? 49.209 40.951 28.156  1.00 14.65 ? 427 HOH A O   1 
HETATM 2984 O O   . HOH C 3 .   ? 18.710 46.770 26.572  1.00 14.54 ? 428 HOH A O   1 
HETATM 2985 O O   . HOH C 3 .   ? 40.783 27.722 5.414   1.00 15.42 ? 429 HOH A O   1 
HETATM 2986 O O   . HOH C 3 .   ? 50.364 26.364 20.537  1.00 18.39 ? 430 HOH A O   1 
HETATM 2987 O O   . HOH C 3 .   ? 34.383 42.800 9.111   1.00 12.40 ? 431 HOH A O   1 
HETATM 2988 O O   . HOH C 3 .   ? 54.330 41.059 6.321   1.00 19.53 ? 432 HOH A O   1 
HETATM 2989 O O   . HOH C 3 .   ? 30.604 35.645 2.592   1.00 15.84 ? 433 HOH A O   1 
HETATM 2990 O O   . HOH C 3 .   ? 53.403 38.162 16.000  1.00 16.61 ? 434 HOH A O   1 
HETATM 2991 O O   . HOH C 3 .   ? 21.506 35.199 4.004   1.00 14.96 ? 435 HOH A O   1 
HETATM 2992 O O   . HOH C 3 .   ? 30.815 37.805 4.147   1.00 18.52 ? 436 HOH A O   1 
HETATM 2993 O O   . HOH C 3 .   ? 43.816 45.094 13.730  1.00 15.85 ? 437 HOH A O   1 
HETATM 2994 O O   . HOH C 3 .   ? 40.622 42.088 -5.689  1.00 14.11 ? 438 HOH A O   1 
HETATM 2995 O O   . HOH C 3 .   ? 18.866 57.801 17.795  1.00 18.66 ? 439 HOH A O   1 
HETATM 2996 O O   . HOH C 3 .   ? 29.787 46.303 18.976  1.00 18.34 ? 440 HOH A O   1 
HETATM 2997 O O   . HOH C 3 .   ? 17.059 33.234 24.749  1.00 14.09 ? 441 HOH A O   1 
HETATM 2998 O O   . HOH C 3 .   ? 58.001 39.594 7.187   1.00 19.01 ? 442 HOH A O   1 
HETATM 2999 O O   . HOH C 3 .   ? 21.389 55.950 0.602   1.00 15.07 ? 443 HOH A O   1 
HETATM 3000 O O   . HOH C 3 .   ? 45.013 37.276 32.197  1.00 21.76 ? 444 HOH A O   1 
HETATM 3001 O O   . HOH C 3 .   ? 44.618 46.691 1.875   1.00 20.24 ? 445 HOH A O   1 
HETATM 3002 O O   . HOH C 3 .   ? 17.323 30.887 8.774   1.00 14.98 ? 446 HOH A O   1 
HETATM 3003 O O   . HOH C 3 .   ? 37.838 25.750 -5.430  1.00 12.58 ? 447 HOH A O   1 
HETATM 3004 O O   . HOH C 3 .   ? 58.280 23.673 4.629   1.00 16.93 ? 448 HOH A O   1 
HETATM 3005 O O   . HOH C 3 .   ? 54.768 39.442 4.162   1.00 20.21 ? 449 HOH A O   1 
HETATM 3006 O O   . HOH C 3 .   ? 21.273 50.501 0.801   1.00 17.28 ? 450 HOH A O   1 
HETATM 3007 O O   . HOH C 3 .   ? 20.237 46.768 -3.087  1.00 56.34 ? 451 HOH A O   1 
HETATM 3008 O O   . HOH C 3 .   ? 29.316 36.205 0.376   1.00 20.01 ? 452 HOH A O   1 
HETATM 3009 O O   . HOH C 3 .   ? 9.710  28.695 4.306   1.00 21.86 ? 453 HOH A O   1 
HETATM 3010 O O   . HOH C 3 .   ? 22.373 47.637 28.725  1.00 17.68 ? 454 HOH A O   1 
HETATM 3011 O O   . HOH C 3 .   ? 62.404 29.959 9.369   1.00 23.00 ? 455 HOH A O   1 
HETATM 3012 O O   . HOH C 3 .   ? 30.423 27.542 25.696  1.00 19.14 ? 456 HOH A O   1 
HETATM 3013 O O   . HOH C 3 .   ? 11.331 38.161 -0.393  1.00 19.46 ? 457 HOH A O   1 
HETATM 3014 O O   . HOH C 3 .   ? 18.572 50.156 0.082   1.00 20.20 ? 458 HOH A O   1 
HETATM 3015 O O   . HOH C 3 .   ? 23.167 37.862 -1.905  1.00 22.56 ? 459 HOH A O   1 
HETATM 3016 O O   . HOH C 3 .   ? 38.673 48.781 6.758   1.00 16.76 ? 460 HOH A O   1 
HETATM 3017 O O   . HOH C 3 .   ? 15.053 42.797 28.966  1.00 21.67 ? 461 HOH A O   1 
HETATM 3018 O O   . HOH C 3 .   ? 35.283 27.466 11.466  1.00 16.41 ? 462 HOH A O   1 
HETATM 3019 O O   . HOH C 3 .   ? 57.692 39.212 4.034   1.00 23.35 ? 463 HOH A O   1 
HETATM 3020 O O   . HOH C 3 .   ? 39.589 43.880 -9.487  1.00 21.96 ? 464 HOH A O   1 
HETATM 3021 O O   . HOH C 3 .   ? 48.784 24.762 -4.072  1.00 17.09 ? 465 HOH A O   1 
HETATM 3022 O O   . HOH C 3 .   ? 47.464 24.263 24.265  1.00 23.46 ? 466 HOH A O   1 
HETATM 3023 O O   . HOH C 3 .   ? 41.897 42.577 -9.005  1.00 25.50 ? 467 HOH A O   1 
HETATM 3024 O O   . HOH C 3 .   ? 7.752  28.482 19.281  1.00 19.29 ? 468 HOH A O   1 
HETATM 3025 O O   . HOH C 3 .   ? 34.886 33.430 29.092  1.00 23.31 ? 469 HOH A O   1 
HETATM 3026 O O   . HOH C 3 .   ? 44.916 39.432 -6.404  1.00 16.54 ? 470 HOH A O   1 
HETATM 3027 O O   . HOH C 3 .   ? 31.876 23.792 16.167  1.00 19.30 ? 471 HOH A O   1 
HETATM 3028 O O   . HOH C 3 .   ? 44.531 43.913 21.676  1.00 18.23 ? 472 HOH A O   1 
HETATM 3029 O O   . HOH C 3 .   ? 48.726 36.257 22.498  1.00 15.10 ? 473 HOH A O   1 
HETATM 3030 O O   . HOH C 3 .   ? 6.285  34.964 14.805  1.00 23.20 ? 474 HOH A O   1 
HETATM 3031 O O   . HOH C 3 .   ? 33.526 67.992 3.615   1.00 47.12 ? 475 HOH A O   1 
HETATM 3032 O O   . HOH C 3 .   ? 46.857 38.826 -4.466  1.00 18.57 ? 476 HOH A O   1 
HETATM 3033 O O   . HOH C 3 .   ? 12.862 28.759 21.176  1.00 22.01 ? 477 HOH A O   1 
HETATM 3034 O O   . HOH C 3 .   ? 35.926 39.729 31.504  1.00 21.54 ? 478 HOH A O   1 
HETATM 3035 O O   . HOH C 3 .   ? 18.081 27.849 5.471   1.00 18.09 ? 479 HOH A O   1 
HETATM 3036 O O   . HOH C 3 .   ? 28.283 31.724 25.891  1.00 19.23 ? 480 HOH A O   1 
HETATM 3037 O O   . HOH C 3 .   ? 43.886 20.487 12.798  1.00 19.82 ? 481 HOH A O   1 
HETATM 3038 O O   . HOH C 3 .   ? 26.155 50.576 2.870   1.00 17.74 ? 482 HOH A O   1 
HETATM 3039 O O   . HOH C 3 .   ? 12.269 24.558 26.034  1.00 18.36 ? 483 HOH A O   1 
HETATM 3040 O O   . HOH C 3 .   ? 44.078 39.659 -10.370 1.00 21.63 ? 484 HOH A O   1 
HETATM 3041 O O   . HOH C 3 .   ? 52.436 34.270 -5.256  1.00 25.21 ? 485 HOH A O   1 
HETATM 3042 O O   . HOH C 3 .   ? 42.051 31.948 24.364  1.00 19.40 ? 486 HOH A O   1 
HETATM 3043 O O   . HOH C 3 .   ? 49.812 36.500 -9.294  1.00 31.28 ? 487 HOH A O   1 
HETATM 3044 O O   . HOH C 3 .   ? 50.503 20.459 5.144   1.00 27.23 ? 488 HOH A O   1 
HETATM 3045 O O   . HOH C 3 .   ? 32.539 48.331 2.052   1.00 29.30 ? 489 HOH A O   1 
HETATM 3046 O O   . HOH C 3 .   ? 39.684 23.209 22.453  1.00 16.55 ? 490 HOH A O   1 
HETATM 3047 O O   . HOH C 3 .   ? 32.138 29.630 0.818   1.00 27.53 ? 491 HOH A O   1 
HETATM 3048 O O   . HOH C 3 .   ? 23.235 35.537 1.972   1.00 27.74 ? 492 HOH A O   1 
HETATM 3049 O O   . HOH C 3 .   ? 61.812 25.376 8.723   1.00 22.30 ? 493 HOH A O   1 
HETATM 3050 O O   . HOH C 3 .   ? 45.045 23.305 29.512  1.00 31.65 ? 494 HOH A O   1 
HETATM 3051 O O   . HOH C 3 .   ? 40.213 44.718 -6.025  1.00 20.11 ? 495 HOH A O   1 
HETATM 3052 O O   . HOH C 3 .   ? 26.601 50.791 10.819  1.00 20.75 ? 496 HOH A O   1 
HETATM 3053 O O   . HOH C 3 .   ? 13.785 37.693 -1.493  1.00 24.41 ? 497 HOH A O   1 
HETATM 3054 O O   . HOH C 3 .   ? 48.570 34.271 -11.843 1.00 34.74 ? 498 HOH A O   1 
HETATM 3055 O O   . HOH C 3 .   ? 15.275 69.353 6.747   1.00 26.11 ? 499 HOH A O   1 
HETATM 3056 O O   . HOH C 3 .   ? 50.045 22.621 15.930  1.00 40.51 ? 500 HOH A O   1 
HETATM 3057 O O   . HOH C 3 .   ? 19.873 43.902 30.142  1.00 37.68 ? 501 HOH A O   1 
HETATM 3058 O O   . HOH C 3 .   ? 21.462 25.347 20.408  1.00 21.05 ? 502 HOH A O   1 
HETATM 3059 O O   . HOH C 3 .   ? 5.236  38.704 24.664  1.00 26.57 ? 503 HOH A O   1 
HETATM 3060 O O   . HOH C 3 .   ? 8.656  49.828 -0.270  1.00 29.92 ? 504 HOH A O   1 
HETATM 3061 O O   . HOH C 3 .   ? 51.323 32.847 19.859  1.00 21.76 ? 505 HOH A O   1 
HETATM 3062 O O   . HOH C 3 .   ? 42.200 20.156 5.951   1.00 24.33 ? 506 HOH A O   1 
HETATM 3063 O O   . HOH C 3 .   ? 25.504 31.045 29.898  1.00 35.51 ? 507 HOH A O   1 
HETATM 3064 O O   . HOH C 3 .   ? 10.595 59.974 5.453   1.00 23.19 ? 508 HOH A O   1 
HETATM 3065 O O   . HOH C 3 .   ? 18.152 47.941 -1.787  1.00 29.02 ? 509 HOH A O   1 
HETATM 3066 O O   . HOH C 3 .   ? 25.344 36.519 -2.607  1.00 29.05 ? 510 HOH A O   1 
HETATM 3067 O O   . HOH C 3 .   ? 37.001 20.119 7.580   1.00 24.29 ? 511 HOH A O   1 
HETATM 3068 O O   . HOH C 3 .   ? 19.398 49.429 26.226  1.00 23.39 ? 512 HOH A O   1 
HETATM 3069 O O   . HOH C 3 .   ? 9.870  27.173 20.228  1.00 28.35 ? 513 HOH A O   1 
HETATM 3070 O O   . HOH C 3 .   ? 44.684 50.009 -0.453  1.00 23.41 ? 514 HOH A O   1 
HETATM 3071 O O   . HOH C 3 .   ? 27.133 53.681 11.087  1.00 24.35 ? 515 HOH A O   1 
HETATM 3072 O O   . HOH C 3 .   ? 38.341 39.315 30.160  1.00 21.54 ? 516 HOH A O   1 
HETATM 3073 O O   . HOH C 3 .   ? 40.736 20.546 22.241  1.00 24.52 ? 517 HOH A O   1 
HETATM 3074 O O   . HOH C 3 .   ? 24.243 21.527 12.285  1.00 30.30 ? 518 HOH A O   1 
HETATM 3075 O O   . HOH C 3 .   ? 49.072 28.729 0.309   1.00 21.01 ? 519 HOH A O   1 
HETATM 3076 O O   . HOH C 3 .   ? 39.402 43.626 30.177  1.00 25.81 ? 520 HOH A O   1 
HETATM 3077 O O   . HOH C 3 .   ? 13.032 40.335 31.834  1.00 20.76 ? 521 HOH A O   1 
HETATM 3078 O O   . HOH C 3 .   ? 32.199 53.132 18.253  1.00 24.25 ? 522 HOH A O   1 
HETATM 3079 O O   . HOH C 3 .   ? 34.389 27.521 -5.906  1.00 25.81 ? 523 HOH A O   1 
HETATM 3080 O O   . HOH C 3 .   ? 60.681 22.233 5.988   1.00 68.60 ? 524 HOH A O   1 
HETATM 3081 O O   . HOH C 3 .   ? 36.725 46.381 -4.381  1.00 24.78 ? 525 HOH A O   1 
HETATM 3082 O O   . HOH C 3 .   ? 43.294 22.603 -8.988  1.00 38.39 ? 526 HOH A O   1 
HETATM 3083 O O   . HOH C 3 .   ? 4.355  38.566 1.884   1.00 21.34 ? 527 HOH A O   1 
HETATM 3084 O O   . HOH C 3 .   ? 53.605 18.494 11.577  1.00 40.20 ? 528 HOH A O   1 
HETATM 3085 O O   . HOH C 3 .   ? 29.678 52.573 11.366  1.00 22.90 ? 529 HOH A O   1 
HETATM 3086 O O   . HOH C 3 .   ? 45.085 20.366 4.691   1.00 24.25 ? 530 HOH A O   1 
HETATM 3087 O O   . HOH C 3 .   ? 11.146 59.769 2.691   1.00 22.86 ? 531 HOH A O   1 
HETATM 3088 O O   . HOH C 3 .   ? 47.245 46.853 2.697   1.00 20.19 ? 532 HOH A O   1 
HETATM 3089 O O   . HOH C 3 .   ? 26.452 56.232 11.815  1.00 30.66 ? 533 HOH A O   1 
HETATM 3090 O O   . HOH C 3 .   ? 36.746 31.116 28.547  1.00 31.25 ? 534 HOH A O   1 
HETATM 3091 O O   . HOH C 3 .   ? 51.154 45.074 -3.538  1.00 26.49 ? 535 HOH A O   1 
HETATM 3092 O O   . HOH C 3 .   ? 10.732 37.147 1.977   1.00 23.93 ? 536 HOH A O   1 
HETATM 3093 O O   . HOH C 3 .   ? 31.717 45.949 -1.467  1.00 21.53 ? 537 HOH A O   1 
HETATM 3094 O O   . HOH C 3 .   ? 26.534 33.905 29.104  1.00 27.37 ? 538 HOH A O   1 
HETATM 3095 O O   . HOH C 3 .   ? 30.173 22.064 8.801   1.00 27.43 ? 539 HOH A O   1 
HETATM 3096 O O   . HOH C 3 .   ? 62.994 31.323 4.989   1.00 27.76 ? 540 HOH A O   1 
HETATM 3097 O O   . HOH C 3 .   ? 57.554 22.144 6.694   1.00 29.35 ? 541 HOH A O   1 
HETATM 3098 O O   . HOH C 3 .   ? 27.496 52.206 13.920  1.00 26.91 ? 542 HOH A O   1 
HETATM 3099 O O   . HOH C 3 .   ? 26.448 39.141 -5.773  1.00 38.51 ? 543 HOH A O   1 
HETATM 3100 O O   . HOH C 3 .   ? 40.763 25.299 28.137  1.00 29.32 ? 544 HOH A O   1 
HETATM 3101 O O   . HOH C 3 .   ? 5.083  48.082 5.477   1.00 31.60 ? 545 HOH A O   1 
HETATM 3102 O O   . HOH C 3 .   ? 53.248 28.449 -6.371  1.00 32.69 ? 546 HOH A O   1 
HETATM 3103 O O   . HOH C 3 .   ? 7.202  39.746 27.885  1.00 38.59 ? 547 HOH A O   1 
HETATM 3104 O O   . HOH C 3 .   ? 27.785 36.179 3.258   1.00 24.52 ? 548 HOH A O   1 
HETATM 3105 O O   . HOH C 3 .   ? 34.331 48.780 24.918  1.00 23.18 ? 549 HOH A O   1 
HETATM 3106 O O   . HOH C 3 .   ? 11.989 55.636 18.630  1.00 26.58 ? 550 HOH A O   1 
HETATM 3107 O O   . HOH C 3 .   ? 35.661 23.996 16.295  1.00 29.57 ? 551 HOH A O   1 
HETATM 3108 O O   . HOH C 3 .   ? 0.887  42.472 15.436  1.00 31.68 ? 552 HOH A O   1 
HETATM 3109 O O   . HOH C 3 .   ? 56.191 23.196 11.506  1.00 23.26 ? 553 HOH A O   1 
HETATM 3110 O O   . HOH C 3 .   ? 37.324 47.134 27.600  1.00 28.80 ? 554 HOH A O   1 
HETATM 3111 O O   . HOH C 3 .   ? 29.108 43.637 31.914  1.00 33.35 ? 555 HOH A O   1 
HETATM 3112 O O   . HOH C 3 .   ? 43.966 20.013 -0.183  1.00 34.92 ? 556 HOH A O   1 
HETATM 3113 O O   . HOH C 3 .   ? 51.339 40.844 21.174  1.00 24.79 ? 557 HOH A O   1 
HETATM 3114 O O   . HOH C 3 .   ? 37.733 49.361 -3.882  1.00 25.16 ? 558 HOH A O   1 
HETATM 3115 O O   . HOH C 3 .   ? 29.406 32.481 0.853   1.00 34.91 ? 559 HOH A O   1 
HETATM 3116 O O   . HOH C 3 .   ? 37.433 52.381 -1.484  1.00 35.35 ? 560 HOH A O   1 
HETATM 3117 O O   . HOH C 3 .   ? 44.819 49.966 2.314   1.00 27.93 ? 561 HOH A O   1 
HETATM 3118 O O   . HOH C 3 .   ? 33.092 43.724 -5.170  1.00 25.77 ? 562 HOH A O   1 
HETATM 3119 O O   . HOH C 3 .   ? 45.452 32.279 -11.722 1.00 33.98 ? 563 HOH A O   1 
HETATM 3120 O O   . HOH C 3 .   ? 10.256 25.186 9.278   1.00 32.60 ? 564 HOH A O   1 
HETATM 3121 O O   . HOH C 3 .   ? 27.741 57.345 21.205  1.00 29.52 ? 565 HOH A O   1 
HETATM 3122 O O   . HOH C 3 .   ? 33.546 49.760 -0.220  1.00 33.21 ? 566 HOH A O   1 
HETATM 3123 O O   . HOH C 3 .   ? 6.091  48.461 10.847  1.00 20.09 ? 567 HOH A O   1 
HETATM 3124 O O   . HOH C 3 .   ? 45.047 48.100 20.546  1.00 33.17 ? 568 HOH A O   1 
HETATM 3125 O O   . HOH C 3 .   ? 31.568 42.751 -7.189  1.00 31.59 ? 569 HOH A O   1 
HETATM 3126 O O   . HOH C 3 .   ? 5.976  37.629 19.570  1.00 41.10 ? 570 HOH A O   1 
HETATM 3127 O O   . HOH C 3 .   ? 12.693 48.837 -3.686  1.00 43.33 ? 571 HOH A O   1 
HETATM 3128 O O   . HOH C 3 .   ? 28.558 25.140 16.685  1.00 26.11 ? 572 HOH A O   1 
HETATM 3129 O O   . HOH C 3 .   ? 10.987 58.496 -0.991  1.00 28.63 ? 573 HOH A O   1 
HETATM 3130 O O   . HOH C 3 .   ? 5.608  53.158 10.357  1.00 22.96 ? 574 HOH A O   1 
HETATM 3131 O O   . HOH C 3 .   ? 48.481 20.247 18.657  1.00 42.37 ? 575 HOH A O   1 
HETATM 3132 O O   . HOH C 3 .   ? 19.247 25.389 7.116   1.00 43.13 ? 576 HOH A O   1 
HETATM 3133 O O   . HOH C 3 .   ? 24.250 37.911 30.936  1.00 31.04 ? 577 HOH A O   1 
HETATM 3134 O O   . HOH C 3 .   ? 49.346 47.340 5.799   1.00 31.95 ? 578 HOH A O   1 
HETATM 3135 O O   . HOH C 3 .   ? 4.157  47.092 7.860   1.00 39.36 ? 579 HOH A O   1 
HETATM 3136 O O   . HOH C 3 .   ? 29.377 20.530 1.962   1.00 36.72 ? 580 HOH A O   1 
HETATM 3137 O O   . HOH C 3 .   ? 47.449 30.590 -8.943  1.00 28.55 ? 581 HOH A O   1 
HETATM 3138 O O   . HOH C 3 .   ? 9.596  22.560 25.908  1.00 30.92 ? 582 HOH A O   1 
HETATM 3139 O O   . HOH C 3 .   ? 22.211 63.650 22.056  1.00 47.68 ? 583 HOH A O   1 
HETATM 3140 O O   . HOH C 3 .   ? 20.171 43.873 -4.517  1.00 43.16 ? 584 HOH A O   1 
HETATM 3141 O O   . HOH C 3 .   ? 53.771 21.871 12.266  1.00 26.44 ? 585 HOH A O   1 
HETATM 3142 O O   . HOH C 3 .   ? 56.593 23.655 0.222   1.00 36.98 ? 586 HOH A O   1 
HETATM 3143 O O   . HOH C 3 .   ? 27.242 51.711 16.511  1.00 31.28 ? 587 HOH A O   1 
HETATM 3144 O O   . HOH C 3 .   ? 5.334  54.934 3.752   1.00 27.80 ? 588 HOH A O   1 
HETATM 3145 O O   . HOH C 3 .   ? 3.292  44.307 5.501   1.00 32.84 ? 589 HOH A O   1 
HETATM 3146 O O   . HOH C 3 .   ? 51.410 19.652 2.390   1.00 30.12 ? 590 HOH A O   1 
HETATM 3147 O O   . HOH C 3 .   ? 33.899 38.888 -9.233  1.00 34.64 ? 591 HOH A O   1 
HETATM 3148 O O   . HOH C 3 .   ? 1.928  31.268 14.816  1.00 40.34 ? 592 HOH A O   1 
HETATM 3149 O O   . HOH C 3 .   ? 18.927 57.264 -7.867  1.00 47.19 ? 593 HOH A O   1 
HETATM 3150 O O   . HOH C 3 .   ? 15.277 26.641 20.908  1.00 38.86 ? 594 HOH A O   1 
HETATM 3151 O O   . HOH C 3 .   ? 23.431 39.368 33.359  1.00 47.63 ? 595 HOH A O   1 
HETATM 3152 O O   . HOH C 3 .   ? 26.515 42.821 32.364  1.00 33.60 ? 596 HOH A O   1 
HETATM 3153 O O   . HOH C 3 .   ? 6.024  56.561 -1.506  1.00 64.30 ? 597 HOH A O   1 
HETATM 3154 O O   . HOH C 3 .   ? 51.748 31.630 -7.969  1.00 35.22 ? 598 HOH A O   1 
HETATM 3155 O O   . HOH C 3 .   ? 23.447 49.308 -0.635  1.00 28.89 ? 599 HOH A O   1 
HETATM 3156 O O   . HOH C 3 .   ? 27.007 37.548 31.343  1.00 43.40 ? 600 HOH A O   1 
HETATM 3157 O O   . HOH C 3 .   ? 51.136 24.873 -6.235  1.00 40.67 ? 601 HOH A O   1 
HETATM 3158 O O   . HOH C 3 .   ? 31.705 23.183 0.561   1.00 33.93 ? 602 HOH A O   1 
HETATM 3159 O O   . HOH C 3 .   ? 31.463 31.520 -0.844  1.00 33.31 ? 603 HOH A O   1 
HETATM 3160 O O   . HOH C 3 .   ? 19.383 35.596 28.920  1.00 41.61 ? 604 HOH A O   1 
HETATM 3161 O O   . HOH C 3 .   ? 36.897 47.265 21.950  1.00 31.79 ? 605 HOH A O   1 
HETATM 3162 O O   . HOH C 3 .   ? 4.496  26.770 19.606  1.00 30.87 ? 606 HOH A O   1 
HETATM 3163 O O   . HOH C 3 .   ? 4.688  34.941 12.012  1.00 29.50 ? 607 HOH A O   1 
HETATM 3164 O O   . HOH C 3 .   ? 44.249 45.380 25.138  1.00 30.80 ? 608 HOH A O   1 
HETATM 3165 O O   . HOH C 3 .   ? 17.883 23.294 14.277  1.00 27.17 ? 609 HOH A O   1 
HETATM 3166 O O   . HOH C 3 .   ? 24.611 46.553 33.226  1.00 44.26 ? 610 HOH A O   1 
HETATM 3167 O O   . HOH C 3 .   ? 49.009 22.592 20.770  1.00 37.97 ? 611 HOH A O   1 
HETATM 3168 O O   . HOH C 3 .   ? 15.128 22.130 6.439   1.00 43.90 ? 612 HOH A O   1 
HETATM 3169 O O   . HOH C 3 .   ? 11.299 30.577 5.496   1.00 25.90 ? 613 HOH A O   1 
HETATM 3170 O O   . HOH C 3 .   ? 22.611 25.338 23.864  1.00 32.44 ? 614 HOH A O   1 
HETATM 3171 O O   . HOH C 3 .   ? 55.304 23.027 -4.671  1.00 31.29 ? 615 HOH A O   1 
HETATM 3172 O O   . HOH C 3 .   ? 60.381 40.834 1.819   1.00 29.89 ? 616 HOH A O   1 
HETATM 3173 O O   . HOH C 3 .   ? 6.139  43.638 1.243   1.00 28.45 ? 617 HOH A O   1 
HETATM 3174 O O   . HOH C 3 .   ? 41.568 18.100 19.909  1.00 34.77 ? 618 HOH A O   1 
HETATM 3175 O O   . HOH C 3 .   ? 21.086 57.711 26.107  1.00 40.46 ? 619 HOH A O   1 
HETATM 3176 O O   . HOH C 3 .   ? 36.133 20.786 10.203  1.00 23.85 ? 620 HOH A O   1 
HETATM 3177 O O   . HOH C 3 .   ? 33.970 49.301 27.753  1.00 45.00 ? 621 HOH A O   1 
HETATM 3178 O O   . HOH C 3 .   ? 25.304 69.708 4.167   1.00 32.22 ? 622 HOH A O   1 
HETATM 3179 O O   . HOH C 3 .   ? 10.531 57.827 13.561  1.00 47.60 ? 623 HOH A O   1 
HETATM 3180 O O   . HOH C 3 .   ? 22.997 51.167 -3.467  1.00 43.87 ? 624 HOH A O   1 
HETATM 3181 O O   . HOH C 3 .   ? 3.543  51.655 9.136   1.00 41.27 ? 625 HOH A O   1 
HETATM 3182 O O   . HOH C 3 .   ? 4.853  31.024 9.722   1.00 36.93 ? 626 HOH A O   1 
HETATM 3183 O O   . HOH C 3 .   ? 35.578 36.145 31.153  1.00 37.57 ? 627 HOH A O   1 
HETATM 3184 O O   . HOH C 3 .   ? 33.249 22.923 14.133  1.00 37.62 ? 628 HOH A O   1 
HETATM 3185 O O   . HOH C 3 .   ? 2.381  30.717 5.912   1.00 43.08 ? 629 HOH A O   1 
HETATM 3186 O O   . HOH C 3 .   ? 29.093 28.770 28.003  1.00 45.21 ? 630 HOH A O   1 
HETATM 3187 O O   . HOH C 3 .   ? 54.291 36.985 -5.531  1.00 47.36 ? 631 HOH A O   1 
HETATM 3188 O O   . HOH C 3 .   ? 18.800 41.240 -4.286  1.00 53.79 ? 632 HOH A O   1 
HETATM 3189 O O   . HOH C 3 .   ? 38.094 49.288 20.581  1.00 49.04 ? 633 HOH A O   1 
HETATM 3190 O O   . HOH C 3 .   ? 44.619 21.066 9.714   1.00 47.87 ? 634 HOH A O   1 
HETATM 3191 O O   . HOH C 3 .   ? 24.942 60.022 17.919  1.00 36.20 ? 635 HOH A O   1 
HETATM 3192 O O   . HOH C 3 .   ? 6.857  46.514 20.457  1.00 40.90 ? 636 HOH A O   1 
HETATM 3193 O O   . HOH C 3 .   ? -4.771 41.256 8.328   1.00 33.47 ? 637 HOH A O   1 
HETATM 3194 O O   . HOH C 3 .   ? 10.044 61.785 11.769  1.00 35.63 ? 638 HOH A O   1 
HETATM 3195 O O   . HOH C 3 .   ? 2.791  34.281 18.940  1.00 42.30 ? 639 HOH A O   1 
HETATM 3196 O O   . HOH C 3 .   ? 16.255 53.741 24.015  1.00 43.35 ? 640 HOH A O   1 
HETATM 3197 O O   . HOH C 3 .   ? 6.448  52.837 13.224  1.00 30.83 ? 641 HOH A O   1 
HETATM 3198 O O   . HOH C 3 .   ? 25.973 39.525 1.846   1.00 16.72 ? 642 HOH A O   1 
HETATM 3199 O O   . HOH C 3 .   ? 43.721 30.159 -10.773 1.00 18.13 ? 643 HOH A O   1 
HETATM 3200 O O   . HOH C 3 .   ? 21.933 44.480 -0.792  1.00 20.12 ? 644 HOH A O   1 
HETATM 3201 O O   . HOH C 3 .   ? 34.508 48.603 9.056   1.00 23.73 ? 645 HOH A O   1 
HETATM 3202 O O   . HOH C 3 .   ? 45.134 28.814 -8.876  1.00 20.06 ? 646 HOH A O   1 
HETATM 3203 O O   . HOH C 3 .   ? 55.159 41.979 1.098   1.00 26.02 ? 647 HOH A O   1 
HETATM 3204 O O   . HOH C 3 .   ? 20.694 45.518 28.050  1.00 17.41 ? 648 HOH A O   1 
HETATM 3205 O O   . HOH C 3 .   ? 18.003 42.441 28.863  1.00 26.38 ? 649 HOH A O   1 
HETATM 3206 O O   . HOH C 3 .   ? 21.281 39.650 -4.334  1.00 32.88 ? 650 HOH A O   1 
HETATM 3207 O O   . HOH C 3 .   ? 60.210 40.236 5.013   1.00 27.74 ? 651 HOH A O   1 
HETATM 3208 O O   . HOH C 3 .   ? 28.466 51.746 3.866   1.00 29.68 ? 652 HOH A O   1 
HETATM 3209 O O   . HOH C 3 .   ? 34.975 24.355 24.172  1.00 28.76 ? 653 HOH A O   1 
HETATM 3210 O O   . HOH C 3 .   ? 56.653 41.853 7.616   1.00 23.04 ? 654 HOH A O   1 
HETATM 3211 O O   . HOH C 3 .   ? 52.536 36.148 17.616  1.00 22.63 ? 655 HOH A O   1 
HETATM 3212 O O   . HOH C 3 .   ? 56.119 25.674 -4.572  1.00 32.95 ? 656 HOH A O   1 
HETATM 3213 O O   . HOH C 3 .   ? 49.525 38.346 -12.202 1.00 42.14 ? 657 HOH A O   1 
HETATM 3214 O O   . HOH C 3 .   ? 49.289 24.761 22.391  1.00 27.88 ? 658 HOH A O   1 
HETATM 3215 O O   . HOH C 3 .   ? 46.144 40.278 -8.647  1.00 28.30 ? 659 HOH A O   1 
HETATM 3216 O O   . HOH C 3 .   ? 32.711 22.157 21.134  1.00 26.63 ? 660 HOH A O   1 
HETATM 3217 O O   . HOH C 3 .   ? 64.808 30.182 8.342   1.00 37.41 ? 661 HOH A O   1 
HETATM 3218 O O   . HOH C 3 .   ? 6.499  32.411 14.777  1.00 27.90 ? 662 HOH A O   1 
HETATM 3219 O O   . HOH C 3 .   ? 5.925  37.769 29.103  1.00 27.43 ? 663 HOH A O   1 
HETATM 3220 O O   . HOH C 3 .   ? 3.852  34.885 2.998   1.00 28.96 ? 664 HOH A O   1 
HETATM 3221 O O   . HOH C 3 .   ? 46.425 45.740 20.686  1.00 33.65 ? 665 HOH A O   1 
HETATM 3222 O O   . HOH C 3 .   ? 5.379  46.429 1.245   1.00 34.94 ? 666 HOH A O   1 
HETATM 3223 O O   . HOH C 3 .   ? 4.277  55.516 11.069  1.00 33.76 ? 667 HOH A O   1 
HETATM 3224 O O   . HOH C 3 .   ? 39.736 46.219 29.124  1.00 36.78 ? 668 HOH A O   1 
HETATM 3225 O O   . HOH C 3 .   ? 3.654  46.631 3.698   1.00 34.82 ? 669 HOH A O   1 
HETATM 3226 O O   . HOH C 3 .   ? 46.847 21.944 28.098  1.00 38.70 ? 670 HOH A O   1 
HETATM 3227 O O   . HOH C 3 .   ? 52.682 23.341 14.938  1.00 39.45 ? 671 HOH A O   1 
HETATM 3228 O O   . HOH C 3 .   ? 49.706 35.057 20.107  1.00 34.16 ? 672 HOH A O   1 
HETATM 3229 O O   . HOH C 3 .   ? 55.653 43.130 4.536   1.00 25.20 ? 673 HOH A O   1 
HETATM 3230 O O   . HOH C 3 .   ? 46.974 40.165 -12.518 1.00 30.52 ? 674 HOH A O   1 
HETATM 3231 O O   . HOH C 3 .   ? 21.557 50.200 27.748  1.00 35.19 ? 675 HOH A O   1 
HETATM 3232 O O   . HOH C 3 .   ? -4.499 38.998 6.741   1.00 27.47 ? 676 HOH A O   1 
HETATM 3233 O O   . HOH C 3 .   ? 59.195 21.592 3.092   1.00 35.88 ? 677 HOH A O   1 
HETATM 3234 O O   . HOH C 3 .   ? 51.057 34.339 -13.114 1.00 34.74 ? 678 HOH A O   1 
HETATM 3235 O O   . HOH C 3 .   ? 23.314 32.166 30.848  1.00 40.75 ? 679 HOH A O   1 
HETATM 3236 O O   . HOH C 3 .   ? 24.425 62.691 18.453  1.00 34.91 ? 680 HOH A O   1 
HETATM 3237 O O   . HOH C 3 .   ? 15.501 23.349 11.922  1.00 38.46 ? 681 HOH A O   1 
HETATM 3238 O O   . HOH C 3 .   ? 33.193 27.474 25.273  1.00 27.80 ? 682 HOH A O   1 
HETATM 3239 O O   . HOH C 3 .   ? 34.028 45.444 -2.727  1.00 27.15 ? 683 HOH A O   1 
HETATM 3240 O O   . HOH C 3 .   ? 29.488 50.585 17.413  1.00 28.93 ? 684 HOH A O   1 
HETATM 3241 O O   . HOH C 3 .   ? 3.872  43.065 2.987   1.00 30.09 ? 685 HOH A O   1 
HETATM 3242 O O   . HOH C 3 .   ? 42.110 17.999 11.389  1.00 37.54 ? 686 HOH A O   1 
HETATM 3243 O O   . HOH C 3 .   ? 5.865  40.480 21.008  1.00 43.28 ? 687 HOH A O   1 
HETATM 3244 O O   . HOH C 3 .   ? 15.713 35.969 -0.300  1.00 25.56 ? 688 HOH A O   1 
HETATM 3245 O O   . HOH C 3 .   ? 47.939 19.417 5.108   1.00 34.11 ? 689 HOH A O   1 
HETATM 3246 O O   . HOH C 3 .   ? 54.251 27.612 -3.933  1.00 33.01 ? 690 HOH A O   1 
HETATM 3247 O O   . HOH C 3 .   ? 37.147 48.293 24.806  1.00 35.27 ? 691 HOH A O   1 
HETATM 3248 O O   . HOH C 3 .   ? 34.975 25.002 -4.840  1.00 39.20 ? 692 HOH A O   1 
HETATM 3249 O O   . HOH C 3 .   ? 15.474 21.960 0.327   1.00 45.85 ? 693 HOH A O   1 
HETATM 3250 O O   . HOH C 3 .   ? 2.427  46.648 16.419  1.00 27.06 ? 694 HOH A O   1 
HETATM 3251 O O   . HOH C 3 .   ? 61.232 28.876 0.460   1.00 31.70 ? 695 HOH A O   1 
HETATM 3252 O O   . HOH C 3 .   ? 3.861  50.392 6.599   1.00 38.71 ? 696 HOH A O   1 
HETATM 3253 O O   . HOH C 3 .   ? 28.475 52.930 23.835  1.00 32.08 ? 697 HOH A O   1 
HETATM 3254 O O   . HOH C 3 .   ? 30.543 24.956 26.976  1.00 29.34 ? 698 HOH A O   1 
HETATM 3255 O O   . HOH C 3 .   ? 40.922 19.401 1.090   1.00 42.60 ? 699 HOH A O   1 
HETATM 3256 O O   . HOH C 3 .   ? 30.655 53.672 6.758   1.00 33.92 ? 700 HOH A O   1 
HETATM 3257 O O   . HOH C 3 .   ? 19.790 26.921 21.926  1.00 35.20 ? 701 HOH A O   1 
HETATM 3258 O O   . HOH C 3 .   ? 5.695  37.856 12.569  1.00 36.95 ? 702 HOH A O   1 
HETATM 3259 O O   . HOH C 3 .   ? 31.720 19.667 0.593   1.00 32.34 ? 703 HOH A O   1 
HETATM 3260 O O   . HOH C 3 .   ? 6.547  55.381 14.658  1.00 32.37 ? 704 HOH A O   1 
HETATM 3261 O O   . HOH C 3 .   ? 12.857 29.140 -3.006  1.00 34.43 ? 705 HOH A O   1 
HETATM 3262 O O   . HOH C 3 .   ? 25.740 36.711 1.553   1.00 43.65 ? 706 HOH A O   1 
HETATM 3263 O O   . HOH C 3 .   ? 63.858 24.703 7.072   1.00 39.59 ? 707 HOH A O   1 
HETATM 3264 O O   . HOH C 3 .   ? 11.543 57.917 16.048  1.00 34.55 ? 708 HOH A O   1 
HETATM 3265 O O   . HOH C 3 .   ? 10.749 36.888 -3.271  1.00 43.39 ? 709 HOH A O   1 
HETATM 3266 O O   . HOH C 3 .   ? 50.704 44.724 16.447  1.00 38.48 ? 710 HOH A O   1 
HETATM 3267 O O   . HOH C 3 .   ? 16.061 47.463 -3.638  1.00 41.78 ? 711 HOH A O   1 
HETATM 3268 O O   . HOH C 3 .   ? 3.077  39.296 13.337  1.00 31.60 ? 712 HOH A O   1 
HETATM 3269 O O   . HOH C 3 .   ? 47.258 21.003 9.045   1.00 44.95 ? 713 HOH A O   1 
HETATM 3270 O O   . HOH C 3 .   ? 46.775 45.094 26.717  1.00 38.70 ? 714 HOH A O   1 
HETATM 3271 O O   . HOH C 3 .   ? 42.106 44.585 33.385  1.00 39.82 ? 715 HOH A O   1 
HETATM 3272 O O   . HOH C 3 .   ? 51.679 34.487 -7.917  1.00 33.23 ? 716 HOH A O   1 
HETATM 3273 O O   . HOH C 3 .   ? 36.599 49.485 28.953  1.00 45.72 ? 717 HOH A O   1 
HETATM 3274 O O   . HOH C 3 .   ? 30.271 31.367 27.697  1.00 36.15 ? 718 HOH A O   1 
HETATM 3275 O O   . HOH C 3 .   ? 10.635 47.127 19.382  1.00 32.67 ? 719 HOH A O   1 
HETATM 3276 O O   . HOH C 3 .   ? 18.067 25.429 24.030  1.00 34.18 ? 720 HOH A O   1 
HETATM 3277 O O   . HOH C 3 .   ? 16.969 28.664 15.473  1.00 39.29 ? 721 HOH A O   1 
HETATM 3278 O O   . HOH C 3 .   ? 32.199 36.623 -9.137  1.00 41.11 ? 722 HOH A O   1 
HETATM 3279 O O   . HOH C 3 .   ? 20.240 24.439 16.937  1.00 35.96 ? 723 HOH A O   1 
HETATM 3280 O O   . HOH C 3 .   ? 16.431 66.314 6.961   1.00 41.11 ? 724 HOH A O   1 
HETATM 3281 O O   . HOH C 3 .   ? 25.320 33.658 1.207   1.00 42.62 ? 725 HOH A O   1 
HETATM 3282 O O   . HOH C 3 .   ? 34.689 29.903 26.580  1.00 32.20 ? 726 HOH A O   1 
HETATM 3283 O O   . HOH C 3 .   ? 33.607 18.434 7.124   1.00 35.45 ? 727 HOH A O   1 
HETATM 3284 O O   . HOH C 3 .   ? 32.979 31.698 27.789  1.00 41.05 ? 728 HOH A O   1 
HETATM 3285 O O   . HOH C 3 .   ? 37.230 22.427 23.508  1.00 38.07 ? 729 HOH A O   1 
HETATM 3286 O O   . HOH C 3 .   ? 55.888 34.609 -3.610  1.00 38.03 ? 730 HOH A O   1 
HETATM 3287 O O   . HOH C 3 .   ? 30.524 19.521 7.156   1.00 46.05 ? 731 HOH A O   1 
HETATM 3288 O O   . HOH C 3 .   ? 15.761 33.455 -1.393  1.00 39.55 ? 732 HOH A O   1 
HETATM 3289 O O   . HOH C 3 .   ? 41.888 49.233 17.645  1.00 39.95 ? 733 HOH A O   1 
HETATM 3290 O O   . HOH C 3 .   ? 46.702 21.756 24.154  1.00 36.66 ? 734 HOH A O   1 
HETATM 3291 O O   . HOH C 3 .   ? 38.930 19.236 20.309  1.00 35.73 ? 735 HOH A O   1 
HETATM 3292 O O   . HOH C 3 .   ? 13.235 36.675 -4.349  1.00 48.47 ? 736 HOH A O   1 
HETATM 3293 O O   . HOH C 3 .   ? 31.874 52.992 9.709   1.00 38.79 ? 737 HOH A O   1 
HETATM 3294 O O   . HOH C 3 .   ? 33.707 19.274 9.850   1.00 40.27 ? 738 HOH A O   1 
HETATM 3295 O O   . HOH C 3 .   ? 11.722 53.987 -2.093  1.00 45.38 ? 739 HOH A O   1 
HETATM 3296 O O   . HOH C 3 .   ? 4.024  32.266 4.186   1.00 41.94 ? 740 HOH A O   1 
HETATM 3297 O O   . HOH C 3 .   ? 12.407 53.892 20.767  1.00 40.68 ? 741 HOH A O   1 
HETATM 3298 O O   . HOH C 3 .   ? 34.835 16.565 1.187   1.00 41.41 ? 742 HOH A O   1 
HETATM 3299 O O   . HOH C 3 .   ? 45.132 18.240 13.618  1.00 35.43 ? 743 HOH A O   1 
HETATM 3300 O O   . HOH C 3 .   ? 45.272 19.458 -7.696  1.00 39.21 ? 744 HOH A O   1 
HETATM 3301 O O   . HOH C 3 .   ? 29.766 62.133 10.005  1.00 46.27 ? 745 HOH A O   1 
HETATM 3302 O O   . HOH C 3 .   ? 46.382 38.594 23.128  1.00 41.22 ? 746 HOH A O   1 
HETATM 3303 O O   . HOH C 3 .   ? 44.078 46.507 16.426  1.00 41.00 ? 747 HOH A O   1 
HETATM 3304 O O   . HOH C 3 .   ? 55.276 46.202 1.937   1.00 39.31 ? 748 HOH A O   1 
HETATM 3305 O O   . HOH C 3 .   ? 3.467  25.180 21.839  1.00 47.58 ? 749 HOH A O   1 
HETATM 3306 O O   . HOH C 3 .   ? -1.000 27.751 15.120  1.00 35.12 ? 750 HOH A O   1 
HETATM 3307 O O   . HOH C 3 .   ? 50.960 40.538 -8.857  1.00 37.71 ? 751 HOH A O   1 
HETATM 3308 O O   . HOH C 3 .   ? -0.549 32.227 13.972  1.00 32.77 ? 752 HOH A O   1 
HETATM 3309 O O   . HOH C 3 .   ? 26.866 59.977 15.908  1.00 37.41 ? 753 HOH A O   1 
HETATM 3310 O O   . HOH C 3 .   ? -0.995 40.680 13.983  1.00 44.91 ? 754 HOH A O   1 
HETATM 3311 O O   . HOH C 3 .   ? 23.039 50.388 -6.261  1.00 52.37 ? 755 HOH A O   1 
HETATM 3312 O O   . HOH C 3 .   ? 30.134 46.231 31.863  1.00 42.02 ? 756 HOH A O   1 
HETATM 3313 O O   . HOH C 3 .   ? 21.713 47.524 31.611  1.00 39.03 ? 757 HOH A O   1 
HETATM 3314 O O   . HOH C 3 .   ? 33.011 55.739 3.108   1.00 40.64 ? 758 HOH A O   1 
HETATM 3315 O O   . HOH C 3 .   ? 49.369 23.989 18.380  1.00 43.24 ? 759 HOH A O   1 
HETATM 3316 O O   . HOH C 3 .   ? 39.762 33.255 31.711  1.00 43.13 ? 760 HOH A O   1 
HETATM 3317 O O   . HOH C 3 .   ? 20.525 34.856 -6.163  1.00 56.38 ? 761 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   29  ?   ?   ?   A P n 
A 1 2   LEU 2   30  ?   ?   ?   A P n 
A 1 3   PRO 3   31  ?   ?   ?   A P n 
A 1 4   ARG 4   32  ?   ?   ?   A P n 
A 1 5   GLU 5   33  ?   ?   ?   A P n 
A 1 6   THR 6   34  ?   ?   ?   A P n 
A 1 7   ASP 7   35  ?   ?   ?   A P n 
A 1 8   GLU 8   36  ?   ?   ?   A P n 
A 1 9   GLU 9   37  ?   ?   ?   A P n 
A 1 10  PRO 10  38  ?   ?   ?   A P n 
A 1 11  GLU 11  39  ?   ?   ?   A P n 
A 1 12  GLU 12  40  ?   ?   ?   A P n 
A 1 13  PRO 13  41  ?   ?   ?   A P n 
A 1 14  GLY 14  42  ?   ?   ?   A P n 
A 1 15  ARG 15  43  ?   ?   ?   A P n 
A 1 16  ARG 16  44  ?   ?   ?   A P n 
A 1 17  GLY 17  45  45  GLY GLY A P n 
A 1 18  SER 18  46  46  SER SER A P n 
A 1 19  PHE 19  47  47  PHE PHE A P n 
A 1 20  VAL 20  48  48  VAL VAL A P n 
A 1 21  GLU 21  1   1   GLU GLU A . n 
A 1 22  MET 22  2   2   MET MET A . n 
A 1 23  VAL 23  3   3   VAL VAL A . n 
A 1 24  ASP 24  4   4   ASP ASP A . n 
A 1 25  ASN 25  5   5   ASN ASN A . n 
A 1 26  LEU 26  6   6   LEU LEU A . n 
A 1 27  ARG 27  7   7   ARG ARG A . n 
A 1 28  GLY 28  8   8   GLY GLY A . n 
A 1 29  LYS 29  9   9   LYS LYS A . n 
A 1 30  SER 30  10  10  SER SER A . n 
A 1 31  GLY 31  11  11  GLY GLY A . n 
A 1 32  GLN 32  12  12  GLN GLN A . n 
A 1 33  GLY 33  13  13  GLY GLY A . n 
A 1 34  TYR 34  14  14  TYR TYR A . n 
A 1 35  TYR 35  15  15  TYR TYR A . n 
A 1 36  VAL 36  16  16  VAL VAL A . n 
A 1 37  GLU 37  17  17  GLU GLU A . n 
A 1 38  MET 38  18  18  MET MET A . n 
A 1 39  THR 39  19  19  THR THR A . n 
A 1 40  VAL 40  20  20  VAL VAL A . n 
A 1 41  GLY 41  21  21  GLY GLY A . n 
A 1 42  SER 42  22  22  SER SER A . n 
A 1 43  PRO 43  23  23  PRO PRO A . n 
A 1 44  PRO 44  24  24  PRO PRO A . n 
A 1 45  GLN 45  25  25  GLN GLN A . n 
A 1 46  THR 46  26  26  THR THR A . n 
A 1 47  LEU 47  27  27  LEU LEU A . n 
A 1 48  ASN 48  28  28  ASN ASN A . n 
A 1 49  ILE 49  29  29  ILE ILE A . n 
A 1 50  LEU 50  30  30  LEU LEU A . n 
A 1 51  VAL 51  31  31  VAL VAL A . n 
A 1 52  ASP 52  32  32  ASP ASP A . n 
A 1 53  THR 53  33  33  THR THR A . n 
A 1 54  GLY 54  34  34  GLY GLY A . n 
A 1 55  SER 55  35  35  SER SER A . n 
A 1 56  SER 56  36  36  SER SER A . n 
A 1 57  ASN 57  37  37  ASN ASN A . n 
A 1 58  PHE 58  38  38  PHE PHE A . n 
A 1 59  ALA 59  39  39  ALA ALA A . n 
A 1 60  VAL 60  40  40  VAL VAL A . n 
A 1 61  GLY 61  41  41  GLY GLY A . n 
A 1 62  ALA 62  42  42  ALA ALA A . n 
A 1 63  ALA 63  43  43  ALA ALA A . n 
A 1 64  PRO 64  44  44  PRO PRO A . n 
A 1 65  HIS 65  45  45  HIS HIS A . n 
A 1 66  PRO 66  46  46  PRO PRO A . n 
A 1 67  PHE 67  47  47  PHE PHE A . n 
A 1 68  LEU 68  48  48  LEU LEU A . n 
A 1 69  HIS 69  49  49  HIS HIS A . n 
A 1 70  ARG 70  50  50  ARG ARG A . n 
A 1 71  TYR 71  51  51  TYR TYR A . n 
A 1 72  TYR 72  52  52  TYR TYR A . n 
A 1 73  GLN 73  53  53  GLN GLN A . n 
A 1 74  ARG 74  54  54  ARG ARG A . n 
A 1 75  GLN 75  55  55  GLN GLN A . n 
A 1 76  LEU 76  56  56  LEU LEU A . n 
A 1 77  SER 77  57  57  SER SER A . n 
A 1 78  SER 78  58  58  SER SER A . n 
A 1 79  THR 79  59  59  THR THR A . n 
A 1 80  TYR 80  60  60  TYR TYR A . n 
A 1 81  ARG 81  61  61  ARG ARG A . n 
A 1 82  ASP 82  62  62  ASP ASP A . n 
A 1 83  LEU 83  63  63  LEU LEU A . n 
A 1 84  ARG 84  64  64  ARG ARG A . n 
A 1 85  LYS 85  65  65  LYS LYS A . n 
A 1 86  GLY 86  66  66  GLY GLY A . n 
A 1 87  VAL 87  67  67  VAL VAL A . n 
A 1 88  TYR 88  68  68  TYR TYR A . n 
A 1 89  VAL 89  69  69  VAL VAL A . n 
A 1 90  PRO 90  70  70  PRO PRO A . n 
A 1 91  TYR 91  71  71  TYR TYR A . n 
A 1 92  THR 92  72  72  THR THR A . n 
A 1 93  GLN 93  73  73  GLN GLN A . n 
A 1 94  GLY 94  74  74  GLY GLY A . n 
A 1 95  ALA 95  75  75  ALA ALA A . n 
A 1 96  TRP 96  76  76  TRP TRP A . n 
A 1 97  ALA 97  77  77  ALA ALA A . n 
A 1 98  GLY 98  78  78  GLY GLY A . n 
A 1 99  GLU 99  79  79  GLU GLU A . n 
A 1 100 LEU 100 80  80  LEU LEU A . n 
A 1 101 GLY 101 81  81  GLY GLY A . n 
A 1 102 THR 102 82  82  THR THR A . n 
A 1 103 ASP 103 83  83  ASP ASP A . n 
A 1 104 LEU 104 84  84  LEU LEU A . n 
A 1 105 VAL 105 85  85  VAL VAL A . n 
A 1 106 SER 106 86  86  SER SER A . n 
A 1 107 ILE 107 87  87  ILE ILE A . n 
A 1 108 PRO 108 88  88  PRO PRO A . n 
A 1 109 HIS 109 89  89  HIS HIS A . n 
A 1 110 GLY 110 90  90  GLY GLY A . n 
A 1 111 PRO 111 91  91  PRO PRO A . n 
A 1 112 ASN 112 92  92  ASN ASN A . n 
A 1 113 VAL 113 93  93  VAL VAL A . n 
A 1 114 THR 114 94  94  THR THR A . n 
A 1 115 VAL 115 95  95  VAL VAL A . n 
A 1 116 ARG 116 96  96  ARG ARG A . n 
A 1 117 ALA 117 97  97  ALA ALA A . n 
A 1 118 ASN 118 98  98  ASN ASN A . n 
A 1 119 ILE 119 99  99  ILE ILE A . n 
A 1 120 ALA 120 100 100 ALA ALA A . n 
A 1 121 ALA 121 101 101 ALA ALA A . n 
A 1 122 ILE 122 102 102 ILE ILE A . n 
A 1 123 THR 123 103 103 THR THR A . n 
A 1 124 GLU 124 104 104 GLU GLU A . n 
A 1 125 SER 125 105 105 SER SER A . n 
A 1 126 ASP 126 106 106 ASP ASP A . n 
A 1 127 LYS 127 107 107 LYS LYS A . n 
A 1 128 PHE 128 108 108 PHE PHE A . n 
A 1 129 PHE 129 109 109 PHE PHE A . n 
A 1 130 ILE 130 110 110 ILE ILE A . n 
A 1 131 ASN 131 111 111 ASN ASN A . n 
A 1 132 GLY 132 112 112 GLY GLY A . n 
A 1 133 SER 133 113 113 SER SER A . n 
A 1 134 ASN 134 114 114 ASN ASN A . n 
A 1 135 TRP 135 115 115 TRP TRP A . n 
A 1 136 GLU 136 116 116 GLU GLU A . n 
A 1 137 GLY 137 117 117 GLY GLY A . n 
A 1 138 ILE 138 118 118 ILE ILE A . n 
A 1 139 LEU 139 119 119 LEU LEU A . n 
A 1 140 GLY 140 120 120 GLY GLY A . n 
A 1 141 LEU 141 121 121 LEU LEU A . n 
A 1 142 ALA 142 122 122 ALA ALA A . n 
A 1 143 TYR 143 123 123 TYR TYR A . n 
A 1 144 ALA 144 124 124 ALA ALA A . n 
A 1 145 GLU 145 125 125 GLU GLU A . n 
A 1 146 ILE 146 126 126 ILE ILE A . n 
A 1 147 ALA 147 127 127 ALA ALA A . n 
A 1 148 ARG 148 128 128 ARG ARG A . n 
A 1 149 PRO 149 129 129 PRO PRO A . n 
A 1 150 ASP 150 130 130 ASP ASP A . n 
A 1 151 ASP 151 131 131 ASP ASP A . n 
A 1 152 SER 152 132 132 SER SER A . n 
A 1 153 LEU 153 133 133 LEU LEU A . n 
A 1 154 GLU 154 134 134 GLU GLU A . n 
A 1 155 PRO 155 135 135 PRO PRO A . n 
A 1 156 PHE 156 136 136 PHE PHE A . n 
A 1 157 PHE 157 137 137 PHE PHE A . n 
A 1 158 ASP 158 138 138 ASP ASP A . n 
A 1 159 SER 159 139 139 SER SER A . n 
A 1 160 LEU 160 140 140 LEU LEU A . n 
A 1 161 VAL 161 141 141 VAL VAL A . n 
A 1 162 LYS 162 142 142 LYS LYS A . n 
A 1 163 GLN 163 143 143 GLN GLN A . n 
A 1 164 THR 164 144 144 THR THR A . n 
A 1 165 HIS 165 145 145 HIS HIS A . n 
A 1 166 VAL 166 146 146 VAL VAL A . n 
A 1 167 PRO 167 147 147 PRO PRO A . n 
A 1 168 ASN 168 148 148 ASN ASN A . n 
A 1 169 LEU 169 149 149 LEU LEU A . n 
A 1 170 PHE 170 150 150 PHE PHE A . n 
A 1 171 SER 171 151 151 SER SER A . n 
A 1 172 LEU 172 152 152 LEU LEU A . n 
A 1 173 GLN 173 153 153 GLN GLN A . n 
A 1 174 LEU 174 154 154 LEU LEU A . n 
A 1 175 CYS 175 155 155 CYS CYS A . n 
A 1 176 GLY 176 156 156 GLY GLY A . n 
A 1 177 ALA 177 157 157 ALA ALA A . n 
A 1 178 GLY 178 158 ?   ?   ?   A . n 
A 1 179 PHE 179 159 ?   ?   ?   A . n 
A 1 180 PRO 180 160 ?   ?   ?   A . n 
A 1 181 LEU 181 161 ?   ?   ?   A . n 
A 1 182 ASN 182 162 ?   ?   ?   A . n 
A 1 183 GLN 183 163 ?   ?   ?   A . n 
A 1 184 SER 184 164 ?   ?   ?   A . n 
A 1 185 GLU 185 165 ?   ?   ?   A . n 
A 1 186 VAL 186 166 ?   ?   ?   A . n 
A 1 187 LEU 187 167 ?   ?   ?   A . n 
A 1 188 ALA 188 168 ?   ?   ?   A . n 
A 1 189 SER 189 169 ?   ?   ?   A . n 
A 1 190 VAL 190 170 ?   ?   ?   A . n 
A 1 191 GLY 191 171 171 GLY GLY A . n 
A 1 192 GLY 192 172 172 GLY GLY A . n 
A 1 193 SER 193 173 173 SER SER A . n 
A 1 194 MET 194 174 174 MET MET A . n 
A 1 195 ILE 195 175 175 ILE ILE A . n 
A 1 196 ILE 196 176 176 ILE ILE A . n 
A 1 197 GLY 197 177 177 GLY GLY A . n 
A 1 198 GLY 198 178 178 GLY GLY A . n 
A 1 199 ILE 199 179 179 ILE ILE A . n 
A 1 200 ASP 200 180 180 ASP ASP A . n 
A 1 201 HIS 201 181 181 HIS HIS A . n 
A 1 202 SER 202 182 182 SER SER A . n 
A 1 203 LEU 203 183 183 LEU LEU A . n 
A 1 204 TYR 204 184 184 TYR TYR A . n 
A 1 205 THR 205 185 185 THR THR A . n 
A 1 206 GLY 206 186 186 GLY GLY A . n 
A 1 207 SER 207 187 187 SER SER A . n 
A 1 208 LEU 208 188 188 LEU LEU A . n 
A 1 209 TRP 209 189 189 TRP TRP A . n 
A 1 210 TYR 210 190 190 TYR TYR A . n 
A 1 211 THR 211 191 191 THR THR A . n 
A 1 212 PRO 212 192 192 PRO PRO A . n 
A 1 213 ILE 213 193 193 ILE ILE A . n 
A 1 214 ARG 214 194 194 ARG ARG A . n 
A 1 215 ARG 215 195 195 ARG ARG A . n 
A 1 216 GLU 216 196 196 GLU GLU A . n 
A 1 217 TRP 217 197 197 TRP TRP A . n 
A 1 218 TYR 218 198 198 TYR TYR A . n 
A 1 219 TYR 219 199 199 TYR TYR A . n 
A 1 220 GLU 220 200 200 GLU GLU A . n 
A 1 221 VAL 221 201 201 VAL VAL A . n 
A 1 222 ILE 222 202 202 ILE ILE A . n 
A 1 223 ILE 223 203 203 ILE ILE A . n 
A 1 224 VAL 224 204 204 VAL VAL A . n 
A 1 225 ARG 225 205 205 ARG ARG A . n 
A 1 226 VAL 226 206 206 VAL VAL A . n 
A 1 227 GLU 227 207 207 GLU GLU A . n 
A 1 228 ILE 228 208 208 ILE ILE A . n 
A 1 229 ASN 229 209 209 ASN ASN A . n 
A 1 230 GLY 230 210 210 GLY GLY A . n 
A 1 231 GLN 231 211 211 GLN GLN A . n 
A 1 232 ASP 232 212 212 ASP ASP A . n 
A 1 233 LEU 233 213 213 LEU LEU A . n 
A 1 234 LYS 234 214 214 LYS LYS A . n 
A 1 235 MET 235 215 215 MET MET A . n 
A 1 236 ASP 236 216 216 ASP ASP A . n 
A 1 237 CYS 237 217 217 CYS CYS A . n 
A 1 238 LYS 238 218 218 LYS LYS A . n 
A 1 239 GLU 239 219 219 GLU GLU A . n 
A 1 240 TYR 240 220 220 TYR TYR A . n 
A 1 241 ASN 241 221 221 ASN ASN A . n 
A 1 242 TYR 242 222 222 TYR TYR A . n 
A 1 243 ASP 243 223 223 ASP ASP A . n 
A 1 244 LYS 244 224 224 LYS LYS A . n 
A 1 245 SER 245 225 225 SER SER A . n 
A 1 246 ILE 246 226 226 ILE ILE A . n 
A 1 247 VAL 247 227 227 VAL VAL A . n 
A 1 248 ASP 248 228 228 ASP ASP A . n 
A 1 249 SER 249 229 229 SER SER A . n 
A 1 250 GLY 250 230 230 GLY GLY A . n 
A 1 251 THR 251 231 231 THR THR A . n 
A 1 252 THR 252 232 232 THR THR A . n 
A 1 253 ASN 253 233 233 ASN ASN A . n 
A 1 254 LEU 254 234 234 LEU LEU A . n 
A 1 255 ARG 255 235 235 ARG ARG A . n 
A 1 256 LEU 256 236 236 LEU LEU A . n 
A 1 257 PRO 257 237 237 PRO PRO A . n 
A 1 258 LYS 258 238 238 LYS LYS A . n 
A 1 259 LYS 259 239 239 LYS LYS A . n 
A 1 260 VAL 260 240 240 VAL VAL A . n 
A 1 261 PHE 261 241 241 PHE PHE A . n 
A 1 262 GLU 262 242 242 GLU GLU A . n 
A 1 263 ALA 263 243 243 ALA ALA A . n 
A 1 264 ALA 264 244 244 ALA ALA A . n 
A 1 265 VAL 265 245 245 VAL VAL A . n 
A 1 266 LYS 266 246 246 LYS LYS A . n 
A 1 267 SER 267 247 247 SER SER A . n 
A 1 268 ILE 268 248 248 ILE ILE A . n 
A 1 269 LYS 269 249 249 LYS LYS A . n 
A 1 270 ALA 270 250 250 ALA ALA A . n 
A 1 271 ALA 271 251 251 ALA ALA A . n 
A 1 272 SER 272 252 252 SER SER A . n 
A 1 273 SER 273 253 253 SER SER A . n 
A 1 274 THR 274 254 254 THR THR A . n 
A 1 275 GLU 275 255 255 GLU GLU A . n 
A 1 276 LYS 276 256 256 LYS LYS A . n 
A 1 277 PHE 277 257 257 PHE PHE A . n 
A 1 278 PRO 278 258 258 PRO PRO A . n 
A 1 279 ASP 279 259 259 ASP ASP A . n 
A 1 280 GLY 280 260 260 GLY GLY A . n 
A 1 281 PHE 281 261 261 PHE PHE A . n 
A 1 282 TRP 282 262 262 TRP TRP A . n 
A 1 283 LEU 283 263 263 LEU LEU A . n 
A 1 284 GLY 284 264 264 GLY GLY A . n 
A 1 285 GLU 285 265 265 GLU GLU A . n 
A 1 286 GLN 286 266 266 GLN GLN A . n 
A 1 287 LEU 287 267 267 LEU LEU A . n 
A 1 288 VAL 288 268 268 VAL VAL A . n 
A 1 289 CYS 289 269 269 CYS CYS A . n 
A 1 290 TRP 290 270 270 TRP TRP A . n 
A 1 291 GLN 291 271 271 GLN GLN A . n 
A 1 292 ALA 292 272 272 ALA ALA A . n 
A 1 293 GLY 293 273 273 GLY GLY A . n 
A 1 294 THR 294 274 274 THR THR A . n 
A 1 295 THR 295 275 275 THR THR A . n 
A 1 296 PRO 296 276 276 PRO PRO A . n 
A 1 297 TRP 297 277 277 TRP TRP A . n 
A 1 298 ASN 298 278 278 ASN ASN A . n 
A 1 299 ILE 299 279 279 ILE ILE A . n 
A 1 300 PHE 300 280 280 PHE PHE A . n 
A 1 301 PRO 301 281 281 PRO PRO A . n 
A 1 302 VAL 302 282 282 VAL VAL A . n 
A 1 303 ILE 303 283 283 ILE ILE A . n 
A 1 304 SER 304 284 284 SER SER A . n 
A 1 305 LEU 305 285 285 LEU LEU A . n 
A 1 306 TYR 306 286 286 TYR TYR A . n 
A 1 307 LEU 307 287 287 LEU LEU A . n 
A 1 308 MET 308 288 288 MET MET A . n 
A 1 309 GLY 309 289 289 GLY GLY A . n 
A 1 310 GLU 310 290 290 GLU GLU A . n 
A 1 311 VAL 311 291 291 VAL VAL A . n 
A 1 312 THR 312 292 292 THR THR A . n 
A 1 313 ASN 313 293 293 ASN ASN A . n 
A 1 314 GLN 314 294 294 GLN GLN A . n 
A 1 315 SER 315 295 295 SER SER A . n 
A 1 316 PHE 316 296 296 PHE PHE A . n 
A 1 317 ARG 317 297 297 ARG ARG A . n 
A 1 318 ILE 318 298 298 ILE ILE A . n 
A 1 319 THR 319 299 299 THR THR A . n 
A 1 320 ILE 320 300 300 ILE ILE A . n 
A 1 321 LEU 321 301 301 LEU LEU A . n 
A 1 322 PRO 322 302 302 PRO PRO A . n 
A 1 323 GLN 323 303 303 GLN GLN A . n 
A 1 324 GLN 324 304 304 GLN GLN A . n 
A 1 325 TYR 325 305 305 TYR TYR A . n 
A 1 326 LEU 326 306 306 LEU LEU A . n 
A 1 327 ARG 327 307 307 ARG ARG A . n 
A 1 328 PRO 328 308 308 PRO PRO A . n 
A 1 329 VAL 329 309 309 VAL VAL A . n 
A 1 330 GLU 330 310 310 GLU GLU A . n 
A 1 331 ASP 331 311 ?   ?   ?   A . n 
A 1 332 VAL 332 312 ?   ?   ?   A . n 
A 1 333 ALA 333 313 ?   ?   ?   A . n 
A 1 334 THR 334 314 ?   ?   ?   A . n 
A 1 335 SER 335 315 ?   ?   ?   A . n 
A 1 336 GLN 336 316 316 GLN GLN A . n 
A 1 337 ASP 337 317 317 ASP ASP A . n 
A 1 338 ASP 338 318 318 ASP ASP A . n 
A 1 339 CYS 339 319 319 CYS CYS A . n 
A 1 340 TYR 340 320 320 TYR TYR A . n 
A 1 341 LYS 341 321 321 LYS LYS A . n 
A 1 342 PHE 342 322 322 PHE PHE A . n 
A 1 343 ALA 343 323 323 ALA ALA A . n 
A 1 344 ILE 344 324 324 ILE ILE A . n 
A 1 345 SER 345 325 325 SER SER A . n 
A 1 346 GLN 346 326 326 GLN GLN A . n 
A 1 347 SER 347 327 327 SER SER A . n 
A 1 348 SER 348 328 328 SER SER A . n 
A 1 349 THR 349 329 329 THR THR A . n 
A 1 350 GLY 350 330 330 GLY GLY A . n 
A 1 351 THR 351 331 331 THR THR A . n 
A 1 352 VAL 352 332 332 VAL VAL A . n 
A 1 353 MET 353 333 333 MET MET A . n 
A 1 354 GLY 354 334 334 GLY GLY A . n 
A 1 355 ALA 355 335 335 ALA ALA A . n 
A 1 356 VAL 356 336 336 VAL VAL A . n 
A 1 357 ILE 357 337 337 ILE ILE A . n 
A 1 358 MET 358 338 338 MET MET A . n 
A 1 359 GLU 359 339 339 GLU GLU A . n 
A 1 360 GLY 360 340 340 GLY GLY A . n 
A 1 361 PHE 361 341 341 PHE PHE A . n 
A 1 362 TYR 362 342 342 TYR TYR A . n 
A 1 363 VAL 363 343 343 VAL VAL A . n 
A 1 364 VAL 364 344 344 VAL VAL A . n 
A 1 365 PHE 365 345 345 PHE PHE A . n 
A 1 366 ASP 366 346 346 ASP ASP A . n 
A 1 367 ARG 367 347 347 ARG ARG A . n 
A 1 368 ALA 368 348 348 ALA ALA A . n 
A 1 369 ARG 369 349 349 ARG ARG A . n 
A 1 370 LYS 370 350 350 LYS LYS A . n 
A 1 371 ARG 371 351 351 ARG ARG A . n 
A 1 372 ILE 372 352 352 ILE ILE A . n 
A 1 373 GLY 373 353 353 GLY GLY A . n 
A 1 374 PHE 374 354 354 PHE PHE A . n 
A 1 375 ALA 375 355 355 ALA ALA A . n 
A 1 376 VAL 376 356 356 VAL VAL A . n 
A 1 377 SER 377 357 357 SER SER A . n 
A 1 378 ALA 378 358 358 ALA ALA A . n 
A 1 379 CYS 379 359 359 CYS CYS A . n 
A 1 380 HIS 380 360 360 HIS HIS A . n 
A 1 381 VAL 381 361 361 VAL VAL A . n 
A 1 382 HIS 382 362 362 HIS HIS A . n 
A 1 383 ASP 383 363 363 ASP ASP A . n 
A 1 384 GLU 384 364 364 GLU GLU A . n 
A 1 385 PHE 385 365 365 PHE PHE A . n 
A 1 386 ARG 386 366 366 ARG ARG A . n 
A 1 387 THR 387 367 367 THR THR A . n 
A 1 388 ALA 388 368 368 ALA ALA A . n 
A 1 389 ALA 389 369 369 ALA ALA A . n 
A 1 390 VAL 390 370 370 VAL VAL A . n 
A 1 391 GLU 391 371 371 GLU GLU A . n 
A 1 392 GLY 392 372 372 GLY GLY A . n 
A 1 393 PRO 393 373 373 PRO PRO A . n 
A 1 394 PHE 394 374 374 PHE PHE A . n 
A 1 395 VAL 395 375 375 VAL VAL A . n 
A 1 396 THR 396 376 376 THR THR A . n 
A 1 397 LEU 397 377 377 LEU LEU A . n 
A 1 398 ASP 398 378 378 ASP ASP A . n 
A 1 399 MET 399 379 379 MET MET A . n 
A 1 400 GLU 400 380 380 GLU GLU A . n 
A 1 401 ASP 401 381 381 ASP ASP A . n 
A 1 402 CYS 402 382 382 CYS CYS A . n 
A 1 403 GLY 403 383 383 GLY GLY A . n 
A 1 404 TYR 404 384 384 TYR TYR A . n 
A 1 405 ASN 405 385 385 ASN ASN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 32P 1   401 1   32P IN  A . 
C 3 HOH 1   402 1   HOH TIP A . 
C 3 HOH 2   403 2   HOH TIP A . 
C 3 HOH 3   404 3   HOH TIP A . 
C 3 HOH 4   405 4   HOH TIP A . 
C 3 HOH 5   406 5   HOH TIP A . 
C 3 HOH 6   407 6   HOH TIP A . 
C 3 HOH 7   408 7   HOH TIP A . 
C 3 HOH 8   409 8   HOH TIP A . 
C 3 HOH 9   410 9   HOH TIP A . 
C 3 HOH 10  411 10  HOH TIP A . 
C 3 HOH 11  412 11  HOH TIP A . 
C 3 HOH 12  413 12  HOH TIP A . 
C 3 HOH 13  414 13  HOH TIP A . 
C 3 HOH 14  415 14  HOH TIP A . 
C 3 HOH 15  416 15  HOH TIP A . 
C 3 HOH 16  417 16  HOH TIP A . 
C 3 HOH 17  418 17  HOH TIP A . 
C 3 HOH 18  419 18  HOH TIP A . 
C 3 HOH 19  420 19  HOH TIP A . 
C 3 HOH 20  421 20  HOH TIP A . 
C 3 HOH 21  422 21  HOH TIP A . 
C 3 HOH 22  423 22  HOH TIP A . 
C 3 HOH 23  424 23  HOH TIP A . 
C 3 HOH 24  425 24  HOH TIP A . 
C 3 HOH 25  426 25  HOH TIP A . 
C 3 HOH 26  427 26  HOH TIP A . 
C 3 HOH 27  428 27  HOH TIP A . 
C 3 HOH 28  429 28  HOH TIP A . 
C 3 HOH 29  430 29  HOH TIP A . 
C 3 HOH 30  431 30  HOH TIP A . 
C 3 HOH 31  432 31  HOH TIP A . 
C 3 HOH 32  433 32  HOH TIP A . 
C 3 HOH 33  434 33  HOH TIP A . 
C 3 HOH 34  435 34  HOH TIP A . 
C 3 HOH 35  436 35  HOH TIP A . 
C 3 HOH 36  437 36  HOH TIP A . 
C 3 HOH 37  438 37  HOH TIP A . 
C 3 HOH 38  439 38  HOH TIP A . 
C 3 HOH 39  440 39  HOH TIP A . 
C 3 HOH 40  441 40  HOH TIP A . 
C 3 HOH 41  442 41  HOH TIP A . 
C 3 HOH 42  443 42  HOH TIP A . 
C 3 HOH 43  444 43  HOH TIP A . 
C 3 HOH 44  445 44  HOH TIP A . 
C 3 HOH 45  446 45  HOH TIP A . 
C 3 HOH 46  447 46  HOH TIP A . 
C 3 HOH 47  448 47  HOH TIP A . 
C 3 HOH 48  449 48  HOH TIP A . 
C 3 HOH 49  450 49  HOH TIP A . 
C 3 HOH 50  451 50  HOH TIP A . 
C 3 HOH 51  452 51  HOH TIP A . 
C 3 HOH 52  453 52  HOH TIP A . 
C 3 HOH 53  454 53  HOH TIP A . 
C 3 HOH 54  455 54  HOH TIP A . 
C 3 HOH 55  456 55  HOH TIP A . 
C 3 HOH 56  457 56  HOH TIP A . 
C 3 HOH 57  458 57  HOH TIP A . 
C 3 HOH 58  459 58  HOH TIP A . 
C 3 HOH 59  460 59  HOH TIP A . 
C 3 HOH 60  461 60  HOH TIP A . 
C 3 HOH 61  462 61  HOH TIP A . 
C 3 HOH 62  463 62  HOH TIP A . 
C 3 HOH 63  464 63  HOH TIP A . 
C 3 HOH 64  465 64  HOH TIP A . 
C 3 HOH 65  466 65  HOH TIP A . 
C 3 HOH 66  467 66  HOH TIP A . 
C 3 HOH 67  468 67  HOH TIP A . 
C 3 HOH 68  469 68  HOH TIP A . 
C 3 HOH 69  470 69  HOH TIP A . 
C 3 HOH 70  471 70  HOH TIP A . 
C 3 HOH 71  472 71  HOH TIP A . 
C 3 HOH 72  473 72  HOH TIP A . 
C 3 HOH 73  474 73  HOH TIP A . 
C 3 HOH 74  475 74  HOH TIP A . 
C 3 HOH 75  476 75  HOH TIP A . 
C 3 HOH 76  477 76  HOH TIP A . 
C 3 HOH 77  478 77  HOH TIP A . 
C 3 HOH 78  479 78  HOH TIP A . 
C 3 HOH 79  480 79  HOH TIP A . 
C 3 HOH 80  481 80  HOH TIP A . 
C 3 HOH 81  482 81  HOH TIP A . 
C 3 HOH 82  483 82  HOH TIP A . 
C 3 HOH 83  484 83  HOH TIP A . 
C 3 HOH 84  485 84  HOH TIP A . 
C 3 HOH 85  486 85  HOH TIP A . 
C 3 HOH 86  487 86  HOH TIP A . 
C 3 HOH 87  488 87  HOH TIP A . 
C 3 HOH 88  489 88  HOH TIP A . 
C 3 HOH 89  490 89  HOH TIP A . 
C 3 HOH 90  491 90  HOH TIP A . 
C 3 HOH 91  492 91  HOH TIP A . 
C 3 HOH 92  493 92  HOH TIP A . 
C 3 HOH 93  494 93  HOH TIP A . 
C 3 HOH 94  495 94  HOH TIP A . 
C 3 HOH 95  496 95  HOH TIP A . 
C 3 HOH 96  497 96  HOH TIP A . 
C 3 HOH 97  498 97  HOH TIP A . 
C 3 HOH 98  499 98  HOH TIP A . 
C 3 HOH 99  500 99  HOH TIP A . 
C 3 HOH 100 501 100 HOH TIP A . 
C 3 HOH 101 502 101 HOH TIP A . 
C 3 HOH 102 503 102 HOH TIP A . 
C 3 HOH 103 504 103 HOH TIP A . 
C 3 HOH 104 505 104 HOH TIP A . 
C 3 HOH 105 506 105 HOH TIP A . 
C 3 HOH 106 507 106 HOH TIP A . 
C 3 HOH 107 508 107 HOH TIP A . 
C 3 HOH 108 509 108 HOH TIP A . 
C 3 HOH 109 510 109 HOH TIP A . 
C 3 HOH 110 511 110 HOH TIP A . 
C 3 HOH 111 512 111 HOH TIP A . 
C 3 HOH 112 513 112 HOH TIP A . 
C 3 HOH 113 514 113 HOH TIP A . 
C 3 HOH 114 515 114 HOH TIP A . 
C 3 HOH 115 516 115 HOH TIP A . 
C 3 HOH 116 517 116 HOH TIP A . 
C 3 HOH 117 518 117 HOH TIP A . 
C 3 HOH 118 519 118 HOH TIP A . 
C 3 HOH 119 520 119 HOH TIP A . 
C 3 HOH 120 521 120 HOH TIP A . 
C 3 HOH 121 522 121 HOH TIP A . 
C 3 HOH 122 523 122 HOH TIP A . 
C 3 HOH 123 524 123 HOH TIP A . 
C 3 HOH 124 525 124 HOH TIP A . 
C 3 HOH 125 526 125 HOH TIP A . 
C 3 HOH 126 527 126 HOH TIP A . 
C 3 HOH 127 528 127 HOH TIP A . 
C 3 HOH 128 529 128 HOH TIP A . 
C 3 HOH 129 530 129 HOH TIP A . 
C 3 HOH 130 531 130 HOH TIP A . 
C 3 HOH 131 532 131 HOH TIP A . 
C 3 HOH 132 533 132 HOH TIP A . 
C 3 HOH 133 534 133 HOH TIP A . 
C 3 HOH 134 535 134 HOH TIP A . 
C 3 HOH 135 536 135 HOH TIP A . 
C 3 HOH 136 537 136 HOH TIP A . 
C 3 HOH 137 538 137 HOH TIP A . 
C 3 HOH 138 539 138 HOH TIP A . 
C 3 HOH 139 540 139 HOH TIP A . 
C 3 HOH 140 541 140 HOH TIP A . 
C 3 HOH 141 542 141 HOH TIP A . 
C 3 HOH 142 543 142 HOH TIP A . 
C 3 HOH 143 544 143 HOH TIP A . 
C 3 HOH 144 545 144 HOH TIP A . 
C 3 HOH 145 546 145 HOH TIP A . 
C 3 HOH 146 547 146 HOH TIP A . 
C 3 HOH 147 548 147 HOH TIP A . 
C 3 HOH 148 549 148 HOH TIP A . 
C 3 HOH 149 550 149 HOH TIP A . 
C 3 HOH 150 551 150 HOH TIP A . 
C 3 HOH 151 552 151 HOH TIP A . 
C 3 HOH 152 553 152 HOH TIP A . 
C 3 HOH 153 554 153 HOH TIP A . 
C 3 HOH 154 555 154 HOH TIP A . 
C 3 HOH 155 556 155 HOH TIP A . 
C 3 HOH 156 557 156 HOH TIP A . 
C 3 HOH 157 558 157 HOH TIP A . 
C 3 HOH 158 559 158 HOH TIP A . 
C 3 HOH 159 560 159 HOH TIP A . 
C 3 HOH 160 561 160 HOH TIP A . 
C 3 HOH 161 562 161 HOH TIP A . 
C 3 HOH 162 563 162 HOH TIP A . 
C 3 HOH 163 564 163 HOH TIP A . 
C 3 HOH 164 565 164 HOH TIP A . 
C 3 HOH 165 566 165 HOH TIP A . 
C 3 HOH 166 567 166 HOH TIP A . 
C 3 HOH 167 568 167 HOH TIP A . 
C 3 HOH 168 569 168 HOH TIP A . 
C 3 HOH 169 570 169 HOH TIP A . 
C 3 HOH 170 571 170 HOH TIP A . 
C 3 HOH 171 572 171 HOH TIP A . 
C 3 HOH 172 573 172 HOH TIP A . 
C 3 HOH 173 574 173 HOH TIP A . 
C 3 HOH 174 575 174 HOH TIP A . 
C 3 HOH 175 576 175 HOH TIP A . 
C 3 HOH 176 577 176 HOH TIP A . 
C 3 HOH 177 578 177 HOH TIP A . 
C 3 HOH 178 579 178 HOH TIP A . 
C 3 HOH 179 580 179 HOH TIP A . 
C 3 HOH 180 581 180 HOH TIP A . 
C 3 HOH 181 582 181 HOH TIP A . 
C 3 HOH 182 583 182 HOH TIP A . 
C 3 HOH 183 584 183 HOH TIP A . 
C 3 HOH 184 585 184 HOH TIP A . 
C 3 HOH 185 586 185 HOH TIP A . 
C 3 HOH 186 587 186 HOH TIP A . 
C 3 HOH 187 588 187 HOH TIP A . 
C 3 HOH 188 589 188 HOH TIP A . 
C 3 HOH 189 590 189 HOH TIP A . 
C 3 HOH 190 591 190 HOH TIP A . 
C 3 HOH 191 592 191 HOH TIP A . 
C 3 HOH 192 593 192 HOH TIP A . 
C 3 HOH 193 594 193 HOH TIP A . 
C 3 HOH 194 595 194 HOH TIP A . 
C 3 HOH 195 596 195 HOH TIP A . 
C 3 HOH 196 597 196 HOH TIP A . 
C 3 HOH 197 598 197 HOH TIP A . 
C 3 HOH 198 599 198 HOH TIP A . 
C 3 HOH 199 600 199 HOH TIP A . 
C 3 HOH 200 601 200 HOH TIP A . 
C 3 HOH 201 602 201 HOH TIP A . 
C 3 HOH 202 603 202 HOH TIP A . 
C 3 HOH 203 604 203 HOH TIP A . 
C 3 HOH 204 605 204 HOH TIP A . 
C 3 HOH 205 606 205 HOH TIP A . 
C 3 HOH 206 607 206 HOH TIP A . 
C 3 HOH 207 608 207 HOH TIP A . 
C 3 HOH 208 609 208 HOH TIP A . 
C 3 HOH 209 610 209 HOH TIP A . 
C 3 HOH 210 611 210 HOH TIP A . 
C 3 HOH 211 612 211 HOH TIP A . 
C 3 HOH 212 613 212 HOH TIP A . 
C 3 HOH 213 614 213 HOH TIP A . 
C 3 HOH 214 615 214 HOH TIP A . 
C 3 HOH 215 616 215 HOH TIP A . 
C 3 HOH 216 617 216 HOH TIP A . 
C 3 HOH 217 618 217 HOH TIP A . 
C 3 HOH 218 619 218 HOH TIP A . 
C 3 HOH 219 620 219 HOH TIP A . 
C 3 HOH 220 621 220 HOH TIP A . 
C 3 HOH 221 622 221 HOH TIP A . 
C 3 HOH 222 623 222 HOH TIP A . 
C 3 HOH 223 624 223 HOH TIP A . 
C 3 HOH 224 625 224 HOH TIP A . 
C 3 HOH 225 626 225 HOH TIP A . 
C 3 HOH 226 627 226 HOH TIP A . 
C 3 HOH 227 628 227 HOH TIP A . 
C 3 HOH 228 629 228 HOH TIP A . 
C 3 HOH 229 630 229 HOH TIP A . 
C 3 HOH 230 631 230 HOH TIP A . 
C 3 HOH 231 632 231 HOH TIP A . 
C 3 HOH 232 633 232 HOH TIP A . 
C 3 HOH 233 634 233 HOH TIP A . 
C 3 HOH 234 635 234 HOH TIP A . 
C 3 HOH 235 636 235 HOH TIP A . 
C 3 HOH 236 637 236 HOH TIP A . 
C 3 HOH 237 638 237 HOH TIP A . 
C 3 HOH 238 639 238 HOH TIP A . 
C 3 HOH 239 640 239 HOH TIP A . 
C 3 HOH 240 641 240 HOH TIP A . 
C 3 HOH 241 642 241 HOH TIP A . 
C 3 HOH 242 643 242 HOH TIP A . 
C 3 HOH 243 644 243 HOH TIP A . 
C 3 HOH 244 645 244 HOH TIP A . 
C 3 HOH 245 646 245 HOH TIP A . 
C 3 HOH 246 647 246 HOH TIP A . 
C 3 HOH 247 648 247 HOH TIP A . 
C 3 HOH 248 649 248 HOH TIP A . 
C 3 HOH 249 650 249 HOH TIP A . 
C 3 HOH 250 651 250 HOH TIP A . 
C 3 HOH 251 652 251 HOH TIP A . 
C 3 HOH 252 653 252 HOH TIP A . 
C 3 HOH 253 654 253 HOH TIP A . 
C 3 HOH 254 655 254 HOH TIP A . 
C 3 HOH 255 656 255 HOH TIP A . 
C 3 HOH 256 657 256 HOH TIP A . 
C 3 HOH 257 658 257 HOH TIP A . 
C 3 HOH 258 659 258 HOH TIP A . 
C 3 HOH 259 660 259 HOH TIP A . 
C 3 HOH 260 661 260 HOH TIP A . 
C 3 HOH 261 662 261 HOH TIP A . 
C 3 HOH 262 663 262 HOH TIP A . 
C 3 HOH 263 664 263 HOH TIP A . 
C 3 HOH 264 665 264 HOH TIP A . 
C 3 HOH 265 666 265 HOH TIP A . 
C 3 HOH 266 667 266 HOH TIP A . 
C 3 HOH 267 668 267 HOH TIP A . 
C 3 HOH 268 669 268 HOH TIP A . 
C 3 HOH 269 670 269 HOH TIP A . 
C 3 HOH 270 671 270 HOH TIP A . 
C 3 HOH 271 672 271 HOH TIP A . 
C 3 HOH 272 673 272 HOH TIP A . 
C 3 HOH 273 674 273 HOH TIP A . 
C 3 HOH 274 675 274 HOH TIP A . 
C 3 HOH 275 676 275 HOH TIP A . 
C 3 HOH 276 677 276 HOH TIP A . 
C 3 HOH 277 678 277 HOH TIP A . 
C 3 HOH 278 679 278 HOH TIP A . 
C 3 HOH 279 680 279 HOH TIP A . 
C 3 HOH 280 681 280 HOH TIP A . 
C 3 HOH 281 682 281 HOH TIP A . 
C 3 HOH 282 683 282 HOH TIP A . 
C 3 HOH 283 684 283 HOH TIP A . 
C 3 HOH 284 685 284 HOH TIP A . 
C 3 HOH 285 686 285 HOH TIP A . 
C 3 HOH 286 687 286 HOH TIP A . 
C 3 HOH 287 688 287 HOH TIP A . 
C 3 HOH 288 689 288 HOH TIP A . 
C 3 HOH 289 690 289 HOH TIP A . 
C 3 HOH 290 691 290 HOH TIP A . 
C 3 HOH 291 692 291 HOH TIP A . 
C 3 HOH 292 693 292 HOH TIP A . 
C 3 HOH 293 694 293 HOH TIP A . 
C 3 HOH 294 695 294 HOH TIP A . 
C 3 HOH 295 696 295 HOH TIP A . 
C 3 HOH 296 697 296 HOH TIP A . 
C 3 HOH 297 698 297 HOH TIP A . 
C 3 HOH 298 699 298 HOH TIP A . 
C 3 HOH 299 700 299 HOH TIP A . 
C 3 HOH 300 701 300 HOH TIP A . 
C 3 HOH 301 702 301 HOH TIP A . 
C 3 HOH 302 703 302 HOH TIP A . 
C 3 HOH 303 704 303 HOH TIP A . 
C 3 HOH 304 705 304 HOH TIP A . 
C 3 HOH 305 706 305 HOH TIP A . 
C 3 HOH 306 707 306 HOH TIP A . 
C 3 HOH 307 708 307 HOH TIP A . 
C 3 HOH 308 709 308 HOH TIP A . 
C 3 HOH 309 710 309 HOH TIP A . 
C 3 HOH 310 711 310 HOH TIP A . 
C 3 HOH 311 712 311 HOH TIP A . 
C 3 HOH 312 713 312 HOH TIP A . 
C 3 HOH 313 714 313 HOH TIP A . 
C 3 HOH 314 715 314 HOH TIP A . 
C 3 HOH 315 716 315 HOH TIP A . 
C 3 HOH 316 717 316 HOH TIP A . 
C 3 HOH 317 718 317 HOH TIP A . 
C 3 HOH 318 719 318 HOH TIP A . 
C 3 HOH 319 720 319 HOH TIP A . 
C 3 HOH 320 721 320 HOH TIP A . 
C 3 HOH 321 722 321 HOH TIP A . 
C 3 HOH 322 723 322 HOH TIP A . 
C 3 HOH 323 724 323 HOH TIP A . 
C 3 HOH 324 725 324 HOH TIP A . 
C 3 HOH 325 726 325 HOH TIP A . 
C 3 HOH 326 727 326 HOH TIP A . 
C 3 HOH 327 728 327 HOH TIP A . 
C 3 HOH 328 729 328 HOH TIP A . 
C 3 HOH 329 730 329 HOH TIP A . 
C 3 HOH 330 731 330 HOH TIP A . 
C 3 HOH 331 732 331 HOH TIP A . 
C 3 HOH 332 733 332 HOH TIP A . 
C 3 HOH 333 734 333 HOH TIP A . 
C 3 HOH 334 735 334 HOH TIP A . 
C 3 HOH 335 736 335 HOH TIP A . 
C 3 HOH 336 737 336 HOH TIP A . 
C 3 HOH 337 738 337 HOH TIP A . 
C 3 HOH 338 739 338 HOH TIP A . 
C 3 HOH 339 740 339 HOH TIP A . 
C 3 HOH 340 741 340 HOH TIP A . 
C 3 HOH 341 742 341 HOH TIP A . 
C 3 HOH 342 743 342 HOH TIP A . 
C 3 HOH 343 744 343 HOH TIP A . 
C 3 HOH 344 745 344 HOH TIP A . 
C 3 HOH 345 746 345 HOH TIP A . 
C 3 HOH 346 747 346 HOH TIP A . 
C 3 HOH 347 748 347 HOH TIP A . 
C 3 HOH 348 749 348 HOH TIP A . 
C 3 HOH 349 750 349 HOH TIP A . 
C 3 HOH 350 751 350 HOH TIP A . 
C 3 HOH 351 752 351 HOH TIP A . 
C 3 HOH 352 753 352 HOH TIP A . 
C 3 HOH 353 754 353 HOH TIP A . 
C 3 HOH 354 755 354 HOH TIP A . 
C 3 HOH 355 756 355 HOH TIP A . 
C 3 HOH 356 757 356 HOH TIP A . 
C 3 HOH 357 758 357 HOH TIP A . 
C 3 HOH 358 759 358 HOH TIP A . 
C 3 HOH 359 760 359 HOH TIP A . 
C 3 HOH 360 761 360 HOH TIP A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-09 
2 'Structure model' 1 1 2007-10-11 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNX       refinement       2000.1 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;BIOMOLECULE: 1
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 1 CHAIN(S). SOME REPORTS INDICATE 
THAT THE BIOLOGICAL UNIT FOR THE PROTEIN IS A DIMER. 
HOWEVER, THE TRUNCATED BACE IS FULLY FUNCTIONAL AS A 
MONOMER IN SOLUTION.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 9   ? ? -37.95  -73.96 
2  1 SER A 10  ? ? -101.13 67.28  
3  1 GLN A 12  ? ? -118.07 53.37  
4  1 PHE A 108 ? ? -94.50  -61.86 
5  1 ASN A 114 ? ? 74.26   -3.35  
6  1 ASP A 131 ? ? -69.76  1.64   
7  1 TRP A 197 ? ? -144.93 -81.23 
8  1 ASP A 223 ? ? 95.65   -69.75 
9  1 ALA A 272 ? ? -31.94  119.91 
10 1 ASN A 293 ? ? 59.94   18.57  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 29  P A MET 1   
2  1 Y 1 A LEU 30  P A LEU 2   
3  1 Y 1 A PRO 31  P A PRO 3   
4  1 Y 1 A ARG 32  P A ARG 4   
5  1 Y 1 A GLU 33  P A GLU 5   
6  1 Y 1 A THR 34  P A THR 6   
7  1 Y 1 A ASP 35  P A ASP 7   
8  1 Y 1 A GLU 36  P A GLU 8   
9  1 Y 1 A GLU 37  P A GLU 9   
10 1 Y 1 A PRO 38  P A PRO 10  
11 1 Y 1 A GLU 39  P A GLU 11  
12 1 Y 1 A GLU 40  P A GLU 12  
13 1 Y 1 A PRO 41  P A PRO 13  
14 1 Y 1 A GLY 42  P A GLY 14  
15 1 Y 1 A ARG 43  P A ARG 15  
16 1 Y 1 A ARG 44  P A ARG 16  
17 1 Y 1 A GLY 158 ? A GLY 178 
18 1 Y 1 A PHE 159 ? A PHE 179 
19 1 Y 1 A PRO 160 ? A PRO 180 
20 1 Y 1 A LEU 161 ? A LEU 181 
21 1 Y 1 A ASN 162 ? A ASN 182 
22 1 Y 1 A GLN 163 ? A GLN 183 
23 1 Y 1 A SER 164 ? A SER 184 
24 1 Y 1 A GLU 165 ? A GLU 185 
25 1 Y 1 A VAL 166 ? A VAL 186 
26 1 Y 1 A LEU 167 ? A LEU 187 
27 1 Y 1 A ALA 168 ? A ALA 188 
28 1 Y 1 A SER 169 ? A SER 189 
29 1 Y 1 A VAL 170 ? A VAL 190 
30 1 Y 1 A ASP 311 ? A ASP 331 
31 1 Y 1 A VAL 312 ? A VAL 332 
32 1 Y 1 A ALA 313 ? A ALA 333 
33 1 Y 1 A THR 314 ? A THR 334 
34 1 Y 1 A SER 315 ? A SER 335 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '3-{2-[(5-AMINOPENTYL)AMINO]-2-OXOETHOXY}-5-({[1-(4-FLUOROPHENYL)ETHYL]AMINO}CARBONYL)PHENYL PHENYLMETHANESULFONATE' 32P 
3 water                                                                                                                HOH 
#