data_1U54
# 
_entry.id   1U54 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1U54         
RCSB  RCSB023256   
WWPDB D_1000023256 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1U54 
_pdbx_database_status.recvd_initial_deposition_date   2004-07-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lougheed, J.C.' 1 
'Chen, R.H.'     2 
'Mak, P.'        3 
'Stout, T.J.'    4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the Cdc42-associated Tyrosine Kinase ACK1.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            279 
_citation.page_first                44039 
_citation.page_last                 44045 
_citation.year                      2004 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15308621 
_citation.pdbx_database_id_DOI      10.1074/jbc.M406703200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lougheed, J.C.' 1 
primary 'Chen, R.H.'     2 
primary 'Mak, P.'        3 
primary 'Stout, T.J.'    4 
# 
_cell.entry_id           1U54 
_cell.length_a           200.384 
_cell.length_b           42.332 
_cell.length_c           70.848 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.28 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1U54 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Activated CDC42 kinase 1'                     33138.023 1  2.7.1.112 ? 'Kinase Domain' 
'phosphorylated at residue 284'   
2 polymer     man 'Activated CDC42 kinase 1'                     33058.047 1  2.7.1.112 ? 'Kinase Domain' 
'unphosphorylated at residue 284' 
3 non-polymer syn 'MAGNESIUM ION'                                24.305    4  ?         ? ?               ? 
4 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 505.208   2  ?         ? ?               ? 
5 water       nat water                                          18.015    10 ?         ? ?               ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 ACK-1 
2 ACK-1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;GSAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDH
RNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLV
KIGDFGLMRALPQNDDH(PTR)VMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHK
IDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRAEF
;
;GSAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDH
RNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLV
KIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKE
GERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRAEF
;
A ? 
2 'polypeptide(L)' no no  
;GSAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDH
RNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLV
KIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKE
GERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRAEF
;
;GSAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDH
RNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLV
KIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKE
GERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRAEF
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   GLY n 
1 5   GLU n 
1 6   GLY n 
1 7   PRO n 
1 8   LEU n 
1 9   GLN n 
1 10  SER n 
1 11  LEU n 
1 12  THR n 
1 13  CYS n 
1 14  LEU n 
1 15  ILE n 
1 16  GLY n 
1 17  GLU n 
1 18  LYS n 
1 19  ASP n 
1 20  LEU n 
1 21  ARG n 
1 22  LEU n 
1 23  LEU n 
1 24  GLU n 
1 25  LYS n 
1 26  LEU n 
1 27  GLY n 
1 28  ASP n 
1 29  GLY n 
1 30  SER n 
1 31  PHE n 
1 32  GLY n 
1 33  VAL n 
1 34  VAL n 
1 35  ARG n 
1 36  ARG n 
1 37  GLY n 
1 38  GLU n 
1 39  TRP n 
1 40  ASP n 
1 41  ALA n 
1 42  PRO n 
1 43  SER n 
1 44  GLY n 
1 45  LYS n 
1 46  THR n 
1 47  VAL n 
1 48  SER n 
1 49  VAL n 
1 50  ALA n 
1 51  VAL n 
1 52  LYS n 
1 53  CYS n 
1 54  LEU n 
1 55  LYS n 
1 56  PRO n 
1 57  ASP n 
1 58  VAL n 
1 59  LEU n 
1 60  SER n 
1 61  GLN n 
1 62  PRO n 
1 63  GLU n 
1 64  ALA n 
1 65  MET n 
1 66  ASP n 
1 67  ASP n 
1 68  PHE n 
1 69  ILE n 
1 70  ARG n 
1 71  GLU n 
1 72  VAL n 
1 73  ASN n 
1 74  ALA n 
1 75  MET n 
1 76  HIS n 
1 77  SER n 
1 78  LEU n 
1 79  ASP n 
1 80  HIS n 
1 81  ARG n 
1 82  ASN n 
1 83  LEU n 
1 84  ILE n 
1 85  ARG n 
1 86  LEU n 
1 87  TYR n 
1 88  GLY n 
1 89  VAL n 
1 90  VAL n 
1 91  LEU n 
1 92  THR n 
1 93  PRO n 
1 94  PRO n 
1 95  MET n 
1 96  LYS n 
1 97  MET n 
1 98  VAL n 
1 99  THR n 
1 100 GLU n 
1 101 LEU n 
1 102 ALA n 
1 103 PRO n 
1 104 LEU n 
1 105 GLY n 
1 106 SER n 
1 107 LEU n 
1 108 LEU n 
1 109 ASP n 
1 110 ARG n 
1 111 LEU n 
1 112 ARG n 
1 113 LYS n 
1 114 HIS n 
1 115 GLN n 
1 116 GLY n 
1 117 HIS n 
1 118 PHE n 
1 119 LEU n 
1 120 LEU n 
1 121 GLY n 
1 122 THR n 
1 123 LEU n 
1 124 SER n 
1 125 ARG n 
1 126 TYR n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 VAL n 
1 131 ALA n 
1 132 GLU n 
1 133 GLY n 
1 134 MET n 
1 135 GLY n 
1 136 TYR n 
1 137 LEU n 
1 138 GLU n 
1 139 SER n 
1 140 LYS n 
1 141 ARG n 
1 142 PHE n 
1 143 ILE n 
1 144 HIS n 
1 145 ARG n 
1 146 ASP n 
1 147 LEU n 
1 148 ALA n 
1 149 ALA n 
1 150 ARG n 
1 151 ASN n 
1 152 LEU n 
1 153 LEU n 
1 154 LEU n 
1 155 ALA n 
1 156 THR n 
1 157 ARG n 
1 158 ASP n 
1 159 LEU n 
1 160 VAL n 
1 161 LYS n 
1 162 ILE n 
1 163 GLY n 
1 164 ASP n 
1 165 PHE n 
1 166 GLY n 
1 167 LEU n 
1 168 MET n 
1 169 ARG n 
1 170 ALA n 
1 171 LEU n 
1 172 PRO n 
1 173 GLN n 
1 174 ASN n 
1 175 ASP n 
1 176 ASP n 
1 177 HIS n 
1 178 PTR n 
1 179 VAL n 
1 180 MET n 
1 181 GLN n 
1 182 GLU n 
1 183 HIS n 
1 184 ARG n 
1 185 LYS n 
1 186 VAL n 
1 187 PRO n 
1 188 PHE n 
1 189 ALA n 
1 190 TRP n 
1 191 CYS n 
1 192 ALA n 
1 193 PRO n 
1 194 GLU n 
1 195 SER n 
1 196 LEU n 
1 197 LYS n 
1 198 THR n 
1 199 ARG n 
1 200 THR n 
1 201 PHE n 
1 202 SER n 
1 203 HIS n 
1 204 ALA n 
1 205 SER n 
1 206 ASP n 
1 207 THR n 
1 208 TRP n 
1 209 MET n 
1 210 PHE n 
1 211 GLY n 
1 212 VAL n 
1 213 THR n 
1 214 LEU n 
1 215 TRP n 
1 216 GLU n 
1 217 MET n 
1 218 PHE n 
1 219 THR n 
1 220 TYR n 
1 221 GLY n 
1 222 GLN n 
1 223 GLU n 
1 224 PRO n 
1 225 TRP n 
1 226 ILE n 
1 227 GLY n 
1 228 LEU n 
1 229 ASN n 
1 230 GLY n 
1 231 SER n 
1 232 GLN n 
1 233 ILE n 
1 234 LEU n 
1 235 HIS n 
1 236 LYS n 
1 237 ILE n 
1 238 ASP n 
1 239 LYS n 
1 240 GLU n 
1 241 GLY n 
1 242 GLU n 
1 243 ARG n 
1 244 LEU n 
1 245 PRO n 
1 246 ARG n 
1 247 PRO n 
1 248 GLU n 
1 249 ASP n 
1 250 CYS n 
1 251 PRO n 
1 252 GLN n 
1 253 ASP n 
1 254 ILE n 
1 255 TYR n 
1 256 ASN n 
1 257 VAL n 
1 258 MET n 
1 259 VAL n 
1 260 GLN n 
1 261 CYS n 
1 262 TRP n 
1 263 ALA n 
1 264 HIS n 
1 265 LYS n 
1 266 PRO n 
1 267 GLU n 
1 268 ASP n 
1 269 ARG n 
1 270 PRO n 
1 271 THR n 
1 272 PHE n 
1 273 VAL n 
1 274 ALA n 
1 275 LEU n 
1 276 ARG n 
1 277 ASP n 
1 278 PHE n 
1 279 LEU n 
1 280 LEU n 
1 281 GLU n 
1 282 ALA n 
1 283 GLN n 
1 284 PRO n 
1 285 THR n 
1 286 ASP n 
1 287 MET n 
1 288 ARG n 
1 289 ALA n 
1 290 GLU n 
1 291 PHE n 
2 1   GLY n 
2 2   SER n 
2 3   ALA n 
2 4   GLY n 
2 5   GLU n 
2 6   GLY n 
2 7   PRO n 
2 8   LEU n 
2 9   GLN n 
2 10  SER n 
2 11  LEU n 
2 12  THR n 
2 13  CYS n 
2 14  LEU n 
2 15  ILE n 
2 16  GLY n 
2 17  GLU n 
2 18  LYS n 
2 19  ASP n 
2 20  LEU n 
2 21  ARG n 
2 22  LEU n 
2 23  LEU n 
2 24  GLU n 
2 25  LYS n 
2 26  LEU n 
2 27  GLY n 
2 28  ASP n 
2 29  GLY n 
2 30  SER n 
2 31  PHE n 
2 32  GLY n 
2 33  VAL n 
2 34  VAL n 
2 35  ARG n 
2 36  ARG n 
2 37  GLY n 
2 38  GLU n 
2 39  TRP n 
2 40  ASP n 
2 41  ALA n 
2 42  PRO n 
2 43  SER n 
2 44  GLY n 
2 45  LYS n 
2 46  THR n 
2 47  VAL n 
2 48  SER n 
2 49  VAL n 
2 50  ALA n 
2 51  VAL n 
2 52  LYS n 
2 53  CYS n 
2 54  LEU n 
2 55  LYS n 
2 56  PRO n 
2 57  ASP n 
2 58  VAL n 
2 59  LEU n 
2 60  SER n 
2 61  GLN n 
2 62  PRO n 
2 63  GLU n 
2 64  ALA n 
2 65  MET n 
2 66  ASP n 
2 67  ASP n 
2 68  PHE n 
2 69  ILE n 
2 70  ARG n 
2 71  GLU n 
2 72  VAL n 
2 73  ASN n 
2 74  ALA n 
2 75  MET n 
2 76  HIS n 
2 77  SER n 
2 78  LEU n 
2 79  ASP n 
2 80  HIS n 
2 81  ARG n 
2 82  ASN n 
2 83  LEU n 
2 84  ILE n 
2 85  ARG n 
2 86  LEU n 
2 87  TYR n 
2 88  GLY n 
2 89  VAL n 
2 90  VAL n 
2 91  LEU n 
2 92  THR n 
2 93  PRO n 
2 94  PRO n 
2 95  MET n 
2 96  LYS n 
2 97  MET n 
2 98  VAL n 
2 99  THR n 
2 100 GLU n 
2 101 LEU n 
2 102 ALA n 
2 103 PRO n 
2 104 LEU n 
2 105 GLY n 
2 106 SER n 
2 107 LEU n 
2 108 LEU n 
2 109 ASP n 
2 110 ARG n 
2 111 LEU n 
2 112 ARG n 
2 113 LYS n 
2 114 HIS n 
2 115 GLN n 
2 116 GLY n 
2 117 HIS n 
2 118 PHE n 
2 119 LEU n 
2 120 LEU n 
2 121 GLY n 
2 122 THR n 
2 123 LEU n 
2 124 SER n 
2 125 ARG n 
2 126 TYR n 
2 127 ALA n 
2 128 VAL n 
2 129 GLN n 
2 130 VAL n 
2 131 ALA n 
2 132 GLU n 
2 133 GLY n 
2 134 MET n 
2 135 GLY n 
2 136 TYR n 
2 137 LEU n 
2 138 GLU n 
2 139 SER n 
2 140 LYS n 
2 141 ARG n 
2 142 PHE n 
2 143 ILE n 
2 144 HIS n 
2 145 ARG n 
2 146 ASP n 
2 147 LEU n 
2 148 ALA n 
2 149 ALA n 
2 150 ARG n 
2 151 ASN n 
2 152 LEU n 
2 153 LEU n 
2 154 LEU n 
2 155 ALA n 
2 156 THR n 
2 157 ARG n 
2 158 ASP n 
2 159 LEU n 
2 160 VAL n 
2 161 LYS n 
2 162 ILE n 
2 163 GLY n 
2 164 ASP n 
2 165 PHE n 
2 166 GLY n 
2 167 LEU n 
2 168 MET n 
2 169 ARG n 
2 170 ALA n 
2 171 LEU n 
2 172 PRO n 
2 173 GLN n 
2 174 ASN n 
2 175 ASP n 
2 176 ASP n 
2 177 HIS n 
2 178 TYR n 
2 179 VAL n 
2 180 MET n 
2 181 GLN n 
2 182 GLU n 
2 183 HIS n 
2 184 ARG n 
2 185 LYS n 
2 186 VAL n 
2 187 PRO n 
2 188 PHE n 
2 189 ALA n 
2 190 TRP n 
2 191 CYS n 
2 192 ALA n 
2 193 PRO n 
2 194 GLU n 
2 195 SER n 
2 196 LEU n 
2 197 LYS n 
2 198 THR n 
2 199 ARG n 
2 200 THR n 
2 201 PHE n 
2 202 SER n 
2 203 HIS n 
2 204 ALA n 
2 205 SER n 
2 206 ASP n 
2 207 THR n 
2 208 TRP n 
2 209 MET n 
2 210 PHE n 
2 211 GLY n 
2 212 VAL n 
2 213 THR n 
2 214 LEU n 
2 215 TRP n 
2 216 GLU n 
2 217 MET n 
2 218 PHE n 
2 219 THR n 
2 220 TYR n 
2 221 GLY n 
2 222 GLN n 
2 223 GLU n 
2 224 PRO n 
2 225 TRP n 
2 226 ILE n 
2 227 GLY n 
2 228 LEU n 
2 229 ASN n 
2 230 GLY n 
2 231 SER n 
2 232 GLN n 
2 233 ILE n 
2 234 LEU n 
2 235 HIS n 
2 236 LYS n 
2 237 ILE n 
2 238 ASP n 
2 239 LYS n 
2 240 GLU n 
2 241 GLY n 
2 242 GLU n 
2 243 ARG n 
2 244 LEU n 
2 245 PRO n 
2 246 ARG n 
2 247 PRO n 
2 248 GLU n 
2 249 ASP n 
2 250 CYS n 
2 251 PRO n 
2 252 GLN n 
2 253 ASP n 
2 254 ILE n 
2 255 TYR n 
2 256 ASN n 
2 257 VAL n 
2 258 MET n 
2 259 VAL n 
2 260 GLN n 
2 261 CYS n 
2 262 TRP n 
2 263 ALA n 
2 264 HIS n 
2 265 LYS n 
2 266 PRO n 
2 267 GLU n 
2 268 ASP n 
2 269 ARG n 
2 270 PRO n 
2 271 THR n 
2 272 PHE n 
2 273 VAL n 
2 274 ALA n 
2 275 LEU n 
2 276 ARG n 
2 277 ASP n 
2 278 PHE n 
2 279 LEU n 
2 280 LEU n 
2 281 GLU n 
2 282 ALA n 
2 283 GLN n 
2 284 PRO n 
2 285 THR n 
2 286 ASP n 
2 287 MET n 
2 288 ARG n 
2 289 ALA n 
2 290 GLU n 
2 291 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ACK1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? ? ? Sf-9 ? ? ? ? ? baculovirus pAcGP67 ? ? ? ? ? 
2 1 sample ? ? ? human Homo ACK1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? ? ? Sf-9 ? ? ? ? ? baculovirus pAcGP67 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ACK1_HUMAN Q07912 1 
;AGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRN
LIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKI
GDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGE
RLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRA
;
109 ? 
2 UNP ACK1_HUMAN Q07912 2 
;AGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRN
LIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKI
GDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGE
RLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRA
;
109 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1U54 A 3 ? 289 ? Q07912 109 ? 395 ? 109 395 
2 2 1U54 B 3 ? 289 ? Q07912 109 ? 395 ? 109 395 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1U54 GLY A 1   ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 107 1 
1 1U54 SER A 2   ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 108 2 
1 1U54 PTR A 178 ? UNP Q07912 TYR 284 'MODIFIED RESIDUE' 284 3 
1 1U54 GLU A 290 ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 396 4 
1 1U54 PHE A 291 ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 397 5 
2 1U54 GLY B 1   ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 107 6 
2 1U54 SER B 2   ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 108 7 
2 1U54 GLU B 290 ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 396 8 
2 1U54 PHE B 291 ? UNP Q07912 ?   ?   'CLONING ARTIFACT' 397 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACP non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 
;ADENOSINE-5'-[BETA, GAMMA-METHYLENE]TRIPHOSPHATE
;
'C11 H18 N5 O12 P3' 505.208 
ALA 'L-peptide linking' y ALANINE                                        ?                                                  
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                                                  
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                                                  
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                                                  
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ?                                                  
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                                                  
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                                                  
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                                                  
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?                                                  
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ?                                                  'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                                                  
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                                                  
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                                                  
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                                                  
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                ?                                                  'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                                                  
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                                                  
'C5 H9 N O2'        115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                              PHOSPHONOTYROSINE                                  
'C9 H12 N O6 P'     261.168 
SER 'L-peptide linking' y SERINE                                         ?                                                  
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                      ?                                                  
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?                                                  
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?                                                  
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?                                                  
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1U54 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   45.2 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_details    
;PEG 4000, lithium sulfate, magnesium chloride, sodium chloride, AMP-PCP, Tris, TCEP, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K, pH 8.50
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2003-01-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.954 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             0.954 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1U54 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             38.710 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   14697 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.058 
_reflns.pdbx_netI_over_sigmaI        12.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   97.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.319 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        3.64 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1U54 
_refine.ls_number_reflns_obs                     14697 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.71 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.226 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.322 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  684 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.916 
_refine.correlation_coeff_Fo_to_Fc_free          0.842 
_refine.B_iso_mean                               27.15 
_refine.aniso_B[1][1]                            0.26000 
_refine.aniso_B[2][2]                            2.98000 
_refine.aniso_B[3][3]                            -2.89000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            1.56000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS, TLS REFINEMENT WAS USED' 
_refine.pdbx_starting_model                      1U46 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.510 
_refine.overall_SU_ML                            0.396 
_refine.overall_SU_B                             19.960 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4217 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               4293 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        38.71 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.019 0.021 ? 4379 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 4008 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.972 1.977 ? 5935 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.912 3.000 ? 9292 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   8.343 5.000 ? 517  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.094 0.200 ? 644  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006 0.020 ? 4744 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.004 0.020 ? 910  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.252 0.200 ? 968  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.231 0.200 ? 4650 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.093 0.200 ? 2671 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.188 0.200 ? 93   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.083 0.200 ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.230 0.200 ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.260 0.200 ? 67   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.128 0.200 ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.515 1.500 ? 2604 'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.896 2.000 ? 4188 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.510 3.000 ? 1775 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.290 4.500 ? 1747 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.87 
_refine_ls_shell.number_reflns_R_work             1010 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.352 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             40 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1U54 
_struct.title                     
;Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the CDC42-associated Tyrosine Kinase ACK1 bound to AMP-PCP
;
_struct.pdbx_descriptor           'Activated CDC42 kinase 1 (E.C.2.7.1.112)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1U54 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Tyrosine Kinase, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 16  ? LYS A 18  ? GLY A 122 LYS A 124 5 ? 3  
HELX_P HELX_P2  2  MET A 65  ? LEU A 78  ? MET A 171 LEU A 184 1 ? 14 
HELX_P HELX_P3  3  SER A 106 ? HIS A 114 ? SER A 212 HIS A 220 1 ? 9  
HELX_P HELX_P4  4  LEU A 119 ? LYS A 140 ? LEU A 225 LYS A 246 1 ? 22 
HELX_P HELX_P5  5  ALA A 148 ? ARG A 150 ? ALA A 254 ARG A 256 5 ? 3  
HELX_P HELX_P6  6  PRO A 187 ? CYS A 191 ? PRO A 293 CYS A 297 5 ? 5  
HELX_P HELX_P7  7  ALA A 192 ? ARG A 199 ? ALA A 298 ARG A 305 1 ? 8  
HELX_P HELX_P8  8  SER A 202 ? PHE A 218 ? SER A 308 PHE A 324 1 ? 17 
HELX_P HELX_P9  9  ASN A 229 ? ASP A 238 ? ASN A 335 ASP A 344 1 ? 10 
HELX_P HELX_P10 10 PRO A 251 ? TRP A 262 ? PRO A 357 TRP A 368 1 ? 12 
HELX_P HELX_P11 11 LYS A 265 ? ARG A 269 ? LYS A 371 ARG A 375 5 ? 5  
HELX_P HELX_P12 12 THR A 271 ? GLU A 281 ? THR A 377 GLU A 387 1 ? 11 
HELX_P HELX_P13 13 MET B 65  ? LEU B 78  ? MET B 171 LEU B 184 1 ? 14 
HELX_P HELX_P14 14 LEU B 107 ? LYS B 113 ? LEU B 213 LYS B 219 1 ? 7  
HELX_P HELX_P15 15 LEU B 119 ? ARG B 141 ? LEU B 225 ARG B 247 1 ? 23 
HELX_P HELX_P16 16 ALA B 148 ? ARG B 150 ? ALA B 254 ARG B 256 5 ? 3  
HELX_P HELX_P17 17 PRO B 187 ? CYS B 191 ? PRO B 293 CYS B 297 5 ? 5  
HELX_P HELX_P18 18 ALA B 192 ? ARG B 199 ? ALA B 298 ARG B 305 1 ? 8  
HELX_P HELX_P19 19 SER B 202 ? TYR B 220 ? SER B 308 TYR B 326 1 ? 19 
HELX_P HELX_P20 20 ASN B 229 ? LYS B 239 ? ASN B 335 LYS B 345 1 ? 11 
HELX_P HELX_P21 21 PRO B 251 ? TRP B 262 ? PRO B 357 TRP B 368 1 ? 12 
HELX_P HELX_P22 22 LYS B 265 ? ARG B 269 ? LYS B 371 ARG B 375 5 ? 5  
HELX_P HELX_P23 23 THR B 271 ? ALA B 282 ? THR B 377 ALA B 388 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A HIS 177 C  ? ? ? 1_555 A PTR 178 N   ? ? A HIS 283 A PTR 284 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale2  covale ? ? A PTR 178 C  ? ? ? 1_555 A VAL 179 N   ? ? A PTR 284 A VAL 285 1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc1  metalc ? ? C MG  .   MG ? ? ? 1_555 D MG  .   MG  ? ? A MG  398 A MG  399 1_555 ? ? ? ? ? ? ? 2.962 ? 
metalc2  metalc ? ? C MG  .   MG ? ? ? 1_555 E ACP .   O2G ? ? A MG  398 A ACP 101 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc3  metalc ? ? C MG  .   MG ? ? ? 1_555 A ASP 164 OD1 ? ? A MG  398 A ASP 270 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc4  metalc ? ? C MG  .   MG ? ? ? 1_555 A ASP 164 OD2 ? ? A MG  398 A ASP 270 1_555 ? ? ? ? ? ? ? 3.095 ? 
metalc5  metalc ? ? C MG  .   MG ? ? ? 1_555 E ACP .   O2B ? ? A MG  398 A ACP 101 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc6  metalc ? ? D MG  .   MG ? ? ? 1_555 A ASN 151 ND2 ? ? A MG  399 A ASN 257 1_555 ? ? ? ? ? ? ? 2.909 ? 
metalc7  metalc ? ? D MG  .   MG ? ? ? 1_555 E ACP .   O1G ? ? A MG  399 A ACP 101 1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc8  metalc ? ? D MG  .   MG ? ? ? 1_555 E ACP .   O2G ? ? A MG  399 A ACP 101 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc9  metalc ? ? D MG  .   MG ? ? ? 1_555 A ASP 164 OD1 ? ? A MG  399 A ASP 270 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc10 metalc ? ? D MG  .   MG ? ? ? 1_555 E ACP .   O3A ? ? A MG  399 A ACP 101 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc11 metalc ? ? D MG  .   MG ? ? ? 1_555 E ACP .   O2A ? ? A MG  399 A ACP 101 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc12 metalc ? ? F MG  .   MG ? ? ? 1_555 H ACP .   O1G ? ? B MG  398 B ACP 400 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc13 metalc ? ? F MG  .   MG ? ? ? 1_555 H ACP .   O2B ? ? B MG  398 B ACP 400 1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc14 metalc ? ? F MG  .   MG ? ? ? 1_555 B ASP 164 OD2 ? ? B MG  398 B ASP 270 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc15 metalc ? ? F MG  .   MG ? ? ? 1_555 B ASP 164 OD1 ? ? B MG  398 B ASP 270 1_555 ? ? ? ? ? ? ? 2.597 ? 
metalc16 metalc ? ? G MG  .   MG ? ? ? 1_555 H ACP .   O3G ? ? B MG  399 B ACP 400 1_555 ? ? ? ? ? ? ? 1.907 ? 
metalc17 metalc ? ? G MG  .   MG ? ? ? 1_555 B ASN 151 OD1 ? ? B MG  399 B ASN 257 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc18 metalc ? ? G MG  .   MG ? ? ? 1_555 H ACP .   O2A ? ? B MG  399 B ACP 400 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc19 metalc ? ? G MG  .   MG ? ? ? 1_555 H ACP .   O1G ? ? B MG  399 B ACP 400 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc20 metalc ? ? G MG  .   MG ? ? ? 1_555 B ASP 164 OD1 ? ? B MG  399 B ASP 270 1_555 ? ? ? ? ? ? ? 2.485 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 93 A . ? PRO 199 A PRO 94 A ? PRO 200 A 1 -6.90 
2 PRO 93 B . ? PRO 199 B PRO 94 B ? PRO 200 B 1 0.43  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 6 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 13  ? LEU A 14  ? CYS A 119 LEU A 120 
A 2 LEU A 86  ? VAL A 90  ? LEU A 192 VAL A 196 
A 3 LYS A 96  ? GLU A 100 ? LYS A 202 GLU A 206 
A 4 THR A 46  ? CYS A 53  ? THR A 152 CYS A 159 
A 5 VAL A 34  ? ASP A 40  ? VAL A 140 ASP A 146 
A 6 LEU A 20  ? LEU A 22  ? LEU A 126 LEU A 128 
B 1 PHE A 142 ? ILE A 143 ? PHE A 248 ILE A 249 
B 2 ARG A 169 ? ALA A 170 ? ARG A 275 ALA A 276 
C 1 LEU A 152 ? LEU A 154 ? LEU A 258 LEU A 260 
C 2 VAL A 160 ? ILE A 162 ? VAL A 266 ILE A 268 
D 1 PTR A 178 ? VAL A 179 ? PTR A 284 VAL A 285 
D 2 THR A 200 ? PHE A 201 ? THR A 306 PHE A 307 
E 1 CYS B 13  ? LEU B 14  ? CYS B 119 LEU B 120 
E 2 LEU B 86  ? VAL B 90  ? LEU B 192 VAL B 196 
E 3 LYS B 96  ? GLU B 100 ? LYS B 202 GLU B 206 
E 4 THR B 46  ? CYS B 53  ? THR B 152 CYS B 159 
E 5 VAL B 34  ? ASP B 40  ? VAL B 140 ASP B 146 
E 6 LEU B 20  ? GLY B 27  ? LEU B 126 GLY B 133 
F 1 GLY B 105 ? SER B 106 ? GLY B 211 SER B 212 
F 2 LEU B 152 ? LEU B 154 ? LEU B 258 LEU B 260 
F 3 VAL B 160 ? ILE B 162 ? VAL B 266 ILE B 268 
G 1 PHE B 142 ? ILE B 143 ? PHE B 248 ILE B 249 
G 2 ARG B 169 ? ALA B 170 ? ARG B 275 ALA B 276 
H 1 TYR B 178 ? VAL B 179 ? TYR B 284 VAL B 285 
H 2 THR B 200 ? PHE B 201 ? THR B 306 PHE B 307 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 13  ? N CYS A 119 O VAL A 89  ? O VAL A 195 
A 2 3 N VAL A 90  ? N VAL A 196 O LYS A 96  ? O LYS A 202 
A 3 4 O MET A 97  ? O MET A 203 N LYS A 52  ? N LYS A 158 
A 4 5 O VAL A 47  ? O VAL A 153 N TRP A 39  ? N TRP A 145 
A 5 6 O GLU A 38  ? O GLU A 144 N ARG A 21  ? N ARG A 127 
B 1 2 N ILE A 143 ? N ILE A 249 O ARG A 169 ? O ARG A 275 
C 1 2 N LEU A 153 ? N LEU A 259 O LYS A 161 ? O LYS A 267 
D 1 2 N PTR A 178 ? N PTR A 284 O PHE A 201 ? O PHE A 307 
E 1 2 N CYS B 13  ? N CYS B 119 O VAL B 89  ? O VAL B 195 
E 2 3 N GLY B 88  ? N GLY B 194 O VAL B 98  ? O VAL B 204 
E 3 4 O MET B 97  ? O MET B 203 N LYS B 52  ? N LYS B 158 
E 4 5 O VAL B 51  ? O VAL B 157 N ARG B 35  ? N ARG B 141 
E 5 6 O VAL B 34  ? O VAL B 140 N LEU B 26  ? N LEU B 132 
F 1 2 N GLY B 105 ? N GLY B 211 O LEU B 154 ? O LEU B 260 
F 2 3 N LEU B 153 ? N LEU B 259 O LYS B 161 ? O LYS B 267 
G 1 2 N ILE B 143 ? N ILE B 249 O ARG B 169 ? O ARG B 275 
H 1 2 N TYR B 178 ? N TYR B 284 O PHE B 201 ? O PHE B 307 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 398'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 399'  
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B 398'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 399'  
AC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ACP A 101' 
AC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ACP B 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  ACP E .   ? ACP A 101 . ? 1_555 ? 
2  AC1 3  ASP A 164 ? ASP A 270 . ? 1_555 ? 
3  AC1 3  MG  D .   ? MG  A 399 . ? 1_555 ? 
4  AC2 4  ACP E .   ? ACP A 101 . ? 1_555 ? 
5  AC2 4  ASN A 151 ? ASN A 257 . ? 1_555 ? 
6  AC2 4  ASP A 164 ? ASP A 270 . ? 1_555 ? 
7  AC2 4  MG  C .   ? MG  A 398 . ? 1_555 ? 
8  AC3 2  ASP B 164 ? ASP B 270 . ? 1_555 ? 
9  AC3 2  ACP H .   ? ACP B 400 . ? 1_555 ? 
10 AC4 3  ASN B 151 ? ASN B 257 . ? 1_555 ? 
11 AC4 3  ASP B 164 ? ASP B 270 . ? 1_555 ? 
12 AC4 3  ACP H .   ? ACP B 400 . ? 1_555 ? 
13 AC5 12 GLY A 27  ? GLY A 133 . ? 1_555 ? 
14 AC5 12 ASP A 28  ? ASP A 134 . ? 1_555 ? 
15 AC5 12 VAL A 34  ? VAL A 140 . ? 1_555 ? 
16 AC5 12 ALA A 50  ? ALA A 156 . ? 1_555 ? 
17 AC5 12 LYS A 52  ? LYS A 158 . ? 1_555 ? 
18 AC5 12 GLU A 100 ? GLU A 206 . ? 1_555 ? 
19 AC5 12 ALA A 102 ? ALA A 208 . ? 1_555 ? 
20 AC5 12 ASN A 151 ? ASN A 257 . ? 1_555 ? 
21 AC5 12 LEU A 153 ? LEU A 259 . ? 1_555 ? 
22 AC5 12 ASP A 164 ? ASP A 270 . ? 1_555 ? 
23 AC5 12 MG  C .   ? MG  A 398 . ? 1_555 ? 
24 AC5 12 MG  D .   ? MG  A 399 . ? 1_555 ? 
25 AC6 15 LEU B 26  ? LEU B 132 . ? 1_555 ? 
26 AC6 15 GLY B 27  ? GLY B 133 . ? 1_555 ? 
27 AC6 15 VAL B 34  ? VAL B 140 . ? 1_555 ? 
28 AC6 15 ALA B 50  ? ALA B 156 . ? 1_555 ? 
29 AC6 15 LYS B 52  ? LYS B 158 . ? 1_555 ? 
30 AC6 15 GLU B 100 ? GLU B 206 . ? 1_555 ? 
31 AC6 15 LEU B 101 ? LEU B 207 . ? 1_555 ? 
32 AC6 15 ALA B 102 ? ALA B 208 . ? 1_555 ? 
33 AC6 15 SER B 106 ? SER B 212 . ? 1_555 ? 
34 AC6 15 ARG B 150 ? ARG B 256 . ? 1_555 ? 
35 AC6 15 ASN B 151 ? ASN B 257 . ? 1_555 ? 
36 AC6 15 LEU B 153 ? LEU B 259 . ? 1_555 ? 
37 AC6 15 ASP B 164 ? ASP B 270 . ? 1_555 ? 
38 AC6 15 MG  F .   ? MG  B 398 . ? 1_555 ? 
39 AC6 15 MG  G .   ? MG  B 399 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1U54 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1U54 
_atom_sites.fract_transf_matrix[1][1]   0.004990 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000549 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023623 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014200 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLN A 1 9   ? 48.249  24.417 39.805  1.00 33.12 ? 115 GLN A N     1 
ATOM   2    C  CA    . GLN A 1 9   ? 47.797  23.396 40.808  1.00 33.71 ? 115 GLN A CA    1 
ATOM   3    C  C     . GLN A 1 9   ? 47.167  22.172 40.094  1.00 34.08 ? 115 GLN A C     1 
ATOM   4    O  O     . GLN A 1 9   ? 47.577  21.870 38.952  1.00 34.06 ? 115 GLN A O     1 
ATOM   5    C  CB    . GLN A 1 9   ? 46.817  24.021 41.816  1.00 33.61 ? 115 GLN A CB    1 
ATOM   6    C  CG    . GLN A 1 9   ? 47.230  25.396 42.349  0.01 32.80 ? 115 GLN A CG    1 
ATOM   7    C  CD    . GLN A 1 9   ? 46.180  26.030 43.254  0.01 32.11 ? 115 GLN A CD    1 
ATOM   8    O  OE1   . GLN A 1 9   ? 46.476  26.984 43.973  0.01 31.74 ? 115 GLN A OE1   1 
ATOM   9    N  NE2   . GLN A 1 9   ? 44.957  25.507 43.220  0.01 31.70 ? 115 GLN A NE2   1 
ATOM   10   N  N     . SER A 1 10  ? 46.183  21.507 40.746  1.00 34.05 ? 116 SER A N     1 
ATOM   11   C  CA    . SER A 1 10  ? 45.542  20.235 40.278  1.00 34.24 ? 116 SER A CA    1 
ATOM   12   C  C     . SER A 1 10  ? 45.899  19.036 41.191  1.00 34.56 ? 116 SER A C     1 
ATOM   13   O  O     . SER A 1 10  ? 45.178  18.015 41.242  1.00 35.30 ? 116 SER A O     1 
ATOM   14   C  CB    . SER A 1 10  ? 45.880  19.860 38.815  1.00 33.91 ? 116 SER A CB    1 
ATOM   15   O  OG    . SER A 1 10  ? 47.211  19.380 38.688  0.01 33.87 ? 116 SER A OG    1 
ATOM   16   N  N     . LEU A 1 11  ? 47.008  19.200 41.922  1.00 34.13 ? 117 LEU A N     1 
ATOM   17   C  CA    . LEU A 1 11  ? 47.609  18.166 42.779  1.00 32.89 ? 117 LEU A CA    1 
ATOM   18   C  C     . LEU A 1 11  ? 47.238  18.269 44.268  1.00 32.06 ? 117 LEU A C     1 
ATOM   19   O  O     . LEU A 1 11  ? 46.762  19.306 44.747  1.00 31.91 ? 117 LEU A O     1 
ATOM   20   C  CB    . LEU A 1 11  ? 49.132  18.252 42.668  1.00 32.63 ? 117 LEU A CB    1 
ATOM   21   C  CG    . LEU A 1 11  ? 49.697  19.676 42.614  1.00 32.22 ? 117 LEU A CG    1 
ATOM   22   C  CD1   . LEU A 1 11  ? 49.254  20.564 43.805  1.00 30.22 ? 117 LEU A CD1   1 
ATOM   23   C  CD2   . LEU A 1 11  ? 51.242  19.596 42.491  1.00 32.77 ? 117 LEU A CD2   1 
ATOM   24   N  N     . THR A 1 12  ? 47.525  17.182 44.987  1.00 30.93 ? 118 THR A N     1 
ATOM   25   C  CA    . THR A 1 12  ? 47.431  17.113 46.442  1.00 29.86 ? 118 THR A CA    1 
ATOM   26   C  C     . THR A 1 12  ? 48.791  16.859 47.063  1.00 29.11 ? 118 THR A C     1 
ATOM   27   O  O     . THR A 1 12  ? 49.618  16.222 46.435  1.00 29.40 ? 118 THR A O     1 
ATOM   28   C  CB    . THR A 1 12  ? 46.554  15.981 46.758  1.00 29.68 ? 118 THR A CB    1 
ATOM   29   O  OG1   . THR A 1 12  ? 45.426  16.046 45.877  1.00 30.51 ? 118 THR A OG1   1 
ATOM   30   C  CG2   . THR A 1 12  ? 45.998  16.128 48.167  1.00 30.23 ? 118 THR A CG2   1 
ATOM   31   N  N     . CYS A 1 13  ? 49.033  17.304 48.292  1.00 28.23 ? 119 CYS A N     1 
ATOM   32   C  CA    . CYS A 1 13  ? 50.384  17.199 48.827  1.00 28.26 ? 119 CYS A CA    1 
ATOM   33   C  C     . CYS A 1 13  ? 50.515  17.156 50.332  1.00 27.76 ? 119 CYS A C     1 
ATOM   34   O  O     . CYS A 1 13  ? 49.592  17.560 51.015  1.00 27.56 ? 119 CYS A O     1 
ATOM   35   C  CB    . CYS A 1 13  ? 51.166  18.408 48.334  1.00 28.58 ? 119 CYS A CB    1 
ATOM   36   S  SG    . CYS A 1 13  ? 50.552  19.897 49.105  1.00 30.14 ? 119 CYS A SG    1 
ATOM   37   N  N     . LEU A 1 14  ? 51.684  16.710 50.823  1.00 27.60 ? 120 LEU A N     1 
ATOM   38   C  CA    . LEU A 1 14  ? 52.069  16.828 52.248  1.00 27.76 ? 120 LEU A CA    1 
ATOM   39   C  C     . LEU A 1 14  ? 52.441  18.235 52.650  1.00 27.93 ? 120 LEU A C     1 
ATOM   40   O  O     . LEU A 1 14  ? 53.153  18.917 51.940  1.00 28.21 ? 120 LEU A O     1 
ATOM   41   C  CB    . LEU A 1 14  ? 53.277  15.975 52.597  1.00 27.44 ? 120 LEU A CB    1 
ATOM   42   C  CG    . LEU A 1 14  ? 53.097  14.479 52.464  1.00 28.04 ? 120 LEU A CG    1 
ATOM   43   C  CD1   . LEU A 1 14  ? 54.394  13.779 52.816  1.00 28.79 ? 120 LEU A CD1   1 
ATOM   44   C  CD2   . LEU A 1 14  ? 51.959  13.950 53.331  1.00 28.62 ? 120 LEU A CD2   1 
ATOM   45   N  N     . ILE A 1 15  ? 52.017  18.629 53.841  1.00 28.46 ? 121 ILE A N     1 
ATOM   46   C  CA    . ILE A 1 15  ? 52.122  20.015 54.303  1.00 28.50 ? 121 ILE A CA    1 
ATOM   47   C  C     . ILE A 1 15  ? 52.795  20.053 55.688  1.00 27.92 ? 121 ILE A C     1 
ATOM   48   O  O     . ILE A 1 15  ? 52.386  19.322 56.604  1.00 27.81 ? 121 ILE A O     1 
ATOM   49   C  CB    . ILE A 1 15  ? 50.688  20.640 54.345  1.00 28.85 ? 121 ILE A CB    1 
ATOM   50   C  CG1   . ILE A 1 15  ? 50.133  20.796 52.920  1.00 29.42 ? 121 ILE A CG1   1 
ATOM   51   C  CG2   . ILE A 1 15  ? 50.674  21.996 55.070  1.00 28.94 ? 121 ILE A CG2   1 
ATOM   52   C  CD1   . ILE A 1 15  ? 48.683  21.286 52.853  1.00 29.25 ? 121 ILE A CD1   1 
ATOM   53   N  N     . GLY A 1 16  ? 53.820  20.894 55.835  1.00 26.99 ? 122 GLY A N     1 
ATOM   54   C  CA    . GLY A 1 16  ? 54.454  21.077 57.121  1.00 26.56 ? 122 GLY A CA    1 
ATOM   55   C  C     . GLY A 1 16  ? 53.636  22.061 57.916  1.00 26.51 ? 122 GLY A C     1 
ATOM   56   O  O     . GLY A 1 16  ? 53.196  23.064 57.369  1.00 25.94 ? 122 GLY A O     1 
ATOM   57   N  N     . GLU A 1 17  ? 53.432  21.788 59.203  1.00 26.78 ? 123 GLU A N     1 
ATOM   58   C  CA    . GLU A 1 17  ? 52.724  22.720 60.088  1.00 27.10 ? 123 GLU A CA    1 
ATOM   59   C  C     . GLU A 1 17  ? 53.427  24.079 60.156  1.00 27.57 ? 123 GLU A C     1 
ATOM   60   O  O     . GLU A 1 17  ? 52.901  25.025 60.739  1.00 27.46 ? 123 GLU A O     1 
ATOM   61   C  CB    . GLU A 1 17  ? 52.549  22.114 61.491  1.00 27.04 ? 123 GLU A CB    1 
ATOM   62   C  CG    . GLU A 1 17  ? 51.508  22.806 62.363  0.01 27.19 ? 123 GLU A CG    1 
ATOM   63   C  CD    . GLU A 1 17  ? 51.267  22.095 63.684  0.01 27.28 ? 123 GLU A CD    1 
ATOM   64   O  OE1   . GLU A 1 17  ? 51.726  20.944 63.851  0.01 27.34 ? 123 GLU A OE1   1 
ATOM   65   O  OE2   . GLU A 1 17  ? 50.615  22.693 64.565  0.01 27.35 ? 123 GLU A OE2   1 
ATOM   66   N  N     . LYS A 1 18  ? 54.631  24.163 59.575  1.00 28.61 ? 124 LYS A N     1 
ATOM   67   C  CA    . LYS A 1 18  ? 55.315  25.443 59.360  1.00 28.78 ? 124 LYS A CA    1 
ATOM   68   C  C     . LYS A 1 18  ? 54.509  26.323 58.377  1.00 28.80 ? 124 LYS A C     1 
ATOM   69   O  O     . LYS A 1 18  ? 54.606  27.555 58.427  1.00 29.59 ? 124 LYS A O     1 
ATOM   70   C  CB    . LYS A 1 18  ? 56.745  25.222 58.861  0.01 28.71 ? 124 LYS A CB    1 
ATOM   71   C  CG    . LYS A 1 18  ? 57.658  24.551 59.890  0.01 28.64 ? 124 LYS A CG    1 
ATOM   72   C  CD    . LYS A 1 18  ? 58.651  25.530 60.508  0.01 28.50 ? 124 LYS A CD    1 
ATOM   73   C  CE    . LYS A 1 18  ? 59.216  25.001 61.820  0.01 28.43 ? 124 LYS A CE    1 
ATOM   74   N  NZ    . LYS A 1 18  ? 60.511  25.647 62.173  0.01 28.38 ? 124 LYS A NZ    1 
ATOM   75   N  N     . ASP A 1 19  ? 53.713  25.683 57.513  1.00 28.02 ? 125 ASP A N     1 
ATOM   76   C  CA    . ASP A 1 19  ? 52.922  26.356 56.475  1.00 27.68 ? 125 ASP A CA    1 
ATOM   77   C  C     . ASP A 1 19  ? 51.433  26.468 56.836  1.00 27.43 ? 125 ASP A C     1 
ATOM   78   O  O     . ASP A 1 19  ? 50.599  26.624 55.961  1.00 26.94 ? 125 ASP A O     1 
ATOM   79   C  CB    . ASP A 1 19  ? 53.030  25.598 55.135  1.00 27.47 ? 125 ASP A CB    1 
ATOM   80   C  CG    . ASP A 1 19  ? 54.444  25.139 54.824  1.00 26.86 ? 125 ASP A CG    1 
ATOM   81   O  OD1   . ASP A 1 19  ? 55.367  25.980 54.939  1.00 25.01 ? 125 ASP A OD1   1 
ATOM   82   O  OD2   . ASP A 1 19  ? 54.713  23.966 54.445  1.00 25.48 ? 125 ASP A OD2   1 
ATOM   83   N  N     . LEU A 1 20  ? 51.114  26.393 58.122  1.00 27.36 ? 126 LEU A N     1 
ATOM   84   C  CA    . LEU A 1 20  ? 49.748  26.395 58.579  1.00 27.10 ? 126 LEU A CA    1 
ATOM   85   C  C     . LEU A 1 20  ? 49.570  27.070 59.942  1.00 27.48 ? 126 LEU A C     1 
ATOM   86   O  O     . LEU A 1 20  ? 50.118  26.597 60.944  1.00 27.07 ? 126 LEU A O     1 
ATOM   87   C  CB    . LEU A 1 20  ? 49.256  24.963 58.657  1.00 27.20 ? 126 LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 20  ? 47.763  24.796 58.306  1.00 27.91 ? 126 LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 20  ? 47.472  25.202 56.827  1.00 27.35 ? 126 LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 20  ? 47.259  23.359 58.618  1.00 27.42 ? 126 LEU A CD2   1 
ATOM   91   N  N     . ARG A 1 21  ? 48.814  28.180 59.946  1.00 27.94 ? 127 ARG A N     1 
ATOM   92   C  CA    . ARG A 1 21  ? 48.264  28.826 61.151  1.00 28.25 ? 127 ARG A CA    1 
ATOM   93   C  C     . ARG A 1 21  ? 46.745  28.500 61.333  1.00 28.71 ? 127 ARG A C     1 
ATOM   94   O  O     . ARG A 1 21  ? 45.856  29.045 60.635  1.00 28.91 ? 127 ARG A O     1 
ATOM   95   C  CB    . ARG A 1 21  ? 48.462  30.341 61.081  0.01 28.26 ? 127 ARG A CB    1 
ATOM   96   C  CG    . ARG A 1 21  ? 49.917  30.780 61.123  0.01 28.18 ? 127 ARG A CG    1 
ATOM   97   C  CD    . ARG A 1 21  ? 50.121  32.194 61.647  0.01 28.13 ? 127 ARG A CD    1 
ATOM   98   N  NE    . ARG A 1 21  ? 51.534  32.515 61.840  0.01 28.08 ? 127 ARG A NE    1 
ATOM   99   C  CZ    . ARG A 1 21  ? 51.992  33.677 62.304  0.01 28.02 ? 127 ARG A CZ    1 
ATOM   100  N  NH1   . ARG A 1 21  ? 53.300  33.864 62.441  0.01 28.02 ? 127 ARG A NH1   1 
ATOM   101  N  NH2   . ARG A 1 21  ? 51.153  34.656 62.633  0.01 28.01 ? 127 ARG A NH2   1 
ATOM   102  N  N     . LEU A 1 22  ? 46.453  27.610 62.280  1.00 28.62 ? 128 LEU A N     1 
ATOM   103  C  CA    . LEU A 1 22  ? 45.077  27.261 62.609  1.00 28.50 ? 128 LEU A CA    1 
ATOM   104  C  C     . LEU A 1 22  ? 44.326  28.523 63.108  1.00 28.49 ? 128 LEU A C     1 
ATOM   105  O  O     . LEU A 1 22  ? 44.947  29.472 63.543  1.00 28.35 ? 128 LEU A O     1 
ATOM   106  C  CB    . LEU A 1 22  ? 45.067  26.127 63.654  1.00 28.16 ? 128 LEU A CB    1 
ATOM   107  C  CG    . LEU A 1 22  ? 45.669  24.785 63.228  0.01 28.20 ? 128 LEU A CG    1 
ATOM   108  C  CD1   . LEU A 1 22  ? 45.797  23.856 64.426  0.01 28.09 ? 128 LEU A CD1   1 
ATOM   109  C  CD2   . LEU A 1 22  ? 44.835  24.136 62.136  0.01 28.10 ? 128 LEU A CD2   1 
ATOM   110  N  N     . LEU A 1 23  ? 42.999  28.563 63.020  1.00 28.78 ? 129 LEU A N     1 
ATOM   111  C  CA    . LEU A 1 23  ? 42.264  29.720 63.551  1.00 28.72 ? 129 LEU A CA    1 
ATOM   112  C  C     . LEU A 1 23  ? 40.931  29.273 64.200  1.00 28.78 ? 129 LEU A C     1 
ATOM   113  O  O     . LEU A 1 23  ? 40.899  28.207 64.836  1.00 28.69 ? 129 LEU A O     1 
ATOM   114  C  CB    . LEU A 1 23  ? 42.049  30.811 62.480  1.00 28.74 ? 129 LEU A CB    1 
ATOM   115  C  CG    . LEU A 1 23  ? 43.166  31.389 61.624  1.00 27.82 ? 129 LEU A CG    1 
ATOM   116  C  CD1   . LEU A 1 23  ? 42.539  32.156 60.466  1.00 27.53 ? 129 LEU A CD1   1 
ATOM   117  C  CD2   . LEU A 1 23  ? 44.018  32.302 62.449  1.00 27.10 ? 129 LEU A CD2   1 
ATOM   118  N  N     . GLU A 1 24  ? 39.862  30.072 64.019  1.00 28.48 ? 130 GLU A N     1 
ATOM   119  C  CA    . GLU A 1 24  ? 38.605  29.930 64.742  1.00 28.36 ? 130 GLU A CA    1 
ATOM   120  C  C     . GLU A 1 24  ? 37.953  28.588 64.510  1.00 28.52 ? 130 GLU A C     1 
ATOM   121  O  O     . GLU A 1 24  ? 38.080  27.990 63.428  1.00 28.88 ? 130 GLU A O     1 
ATOM   122  C  CB    . GLU A 1 24  ? 37.629  31.061 64.368  1.00 28.56 ? 130 GLU A CB    1 
ATOM   123  C  CG    . GLU A 1 24  ? 36.931  30.953 63.008  1.00 29.59 ? 130 GLU A CG    1 
ATOM   124  C  CD    . GLU A 1 24  ? 37.498  31.875 61.930  1.00 30.82 ? 130 GLU A CD    1 
ATOM   125  O  OE1   . GLU A 1 24  ? 38.561  32.493 62.138  1.00 31.07 ? 130 GLU A OE1   1 
ATOM   126  O  OE2   . GLU A 1 24  ? 36.871  31.978 60.850  1.00 31.92 ? 130 GLU A OE2   1 
ATOM   127  N  N     . LYS A 1 25  ? 37.251  28.105 65.529  1.00 28.39 ? 131 LYS A N     1 
ATOM   128  C  CA    . LYS A 1 25  ? 36.500  26.853 65.403  1.00 28.28 ? 131 LYS A CA    1 
ATOM   129  C  C     . LYS A 1 25  ? 35.277  27.027 64.484  1.00 27.84 ? 131 LYS A C     1 
ATOM   130  O  O     . LYS A 1 25  ? 34.274  27.587 64.899  1.00 27.40 ? 131 LYS A O     1 
ATOM   131  C  CB    . LYS A 1 25  ? 36.063  26.335 66.788  1.00 28.20 ? 131 LYS A CB    1 
ATOM   132  C  CG    . LYS A 1 25  ? 37.222  25.981 67.708  0.01 28.18 ? 131 LYS A CG    1 
ATOM   133  C  CD    . LYS A 1 25  ? 36.753  25.200 68.925  0.01 28.11 ? 131 LYS A CD    1 
ATOM   134  C  CE    . LYS A 1 25  ? 37.928  24.727 69.766  0.01 28.08 ? 131 LYS A CE    1 
ATOM   135  N  NZ    . LYS A 1 25  ? 37.487  24.130 71.057  0.01 28.05 ? 131 LYS A NZ    1 
ATOM   136  N  N     . LEU A 1 26  ? 35.374  26.545 63.248  1.00 27.69 ? 132 LEU A N     1 
ATOM   137  C  CA    . LEU A 1 26  ? 34.228  26.517 62.342  1.00 27.99 ? 132 LEU A CA    1 
ATOM   138  C  C     . LEU A 1 26  ? 33.162  25.476 62.751  1.00 28.77 ? 132 LEU A C     1 
ATOM   139  O  O     . LEU A 1 26  ? 31.969  25.684 62.522  1.00 28.63 ? 132 LEU A O     1 
ATOM   140  C  CB    . LEU A 1 26  ? 34.669  26.221 60.922  1.00 27.61 ? 132 LEU A CB    1 
ATOM   141  C  CG    . LEU A 1 26  ? 35.706  27.139 60.316  1.00 26.91 ? 132 LEU A CG    1 
ATOM   142  C  CD1   . LEU A 1 26  ? 36.255  26.475 59.078  1.00 25.54 ? 132 LEU A CD1   1 
ATOM   143  C  CD2   . LEU A 1 26  ? 35.111  28.520 60.029  1.00 27.52 ? 132 LEU A CD2   1 
ATOM   144  N  N     . GLY A 1 27  ? 33.585  24.357 63.337  1.00 29.45 ? 133 GLY A N     1 
ATOM   145  C  CA    . GLY A 1 27  ? 32.641  23.363 63.847  1.00 29.80 ? 133 GLY A CA    1 
ATOM   146  C  C     . GLY A 1 27  ? 33.342  22.352 64.727  1.00 30.12 ? 133 GLY A C     1 
ATOM   147  O  O     . GLY A 1 27  ? 34.541  22.217 64.617  1.00 31.11 ? 133 GLY A O     1 
ATOM   148  N  N     . ASP A 1 28  ? 32.616  21.660 65.607  1.00 30.52 ? 134 ASP A N     1 
ATOM   149  C  CA    . ASP A 1 28  ? 33.156  20.486 66.331  1.00 30.45 ? 134 ASP A CA    1 
ATOM   150  C  C     . ASP A 1 28  ? 33.447  19.338 65.372  1.00 30.43 ? 134 ASP A C     1 
ATOM   151  O  O     . ASP A 1 28  ? 32.522  18.770 64.806  1.00 30.55 ? 134 ASP A O     1 
ATOM   152  C  CB    . ASP A 1 28  ? 32.179  19.977 67.404  1.00 30.36 ? 134 ASP A CB    1 
ATOM   153  C  CG    . ASP A 1 28  ? 32.379  20.639 68.729  1.00 30.23 ? 134 ASP A CG    1 
ATOM   154  O  OD1   . ASP A 1 28  ? 33.509  21.080 69.022  1.00 30.65 ? 134 ASP A OD1   1 
ATOM   155  O  OD2   . ASP A 1 28  ? 31.459  20.766 69.551  1.00 31.77 ? 134 ASP A OD2   1 
ATOM   156  N  N     . GLY A 1 32  ? 38.094  14.503 65.988  1.00 29.76 ? 138 GLY A N     1 
ATOM   157  C  CA    . GLY A 1 32  ? 38.640  15.852 66.034  1.00 30.24 ? 138 GLY A CA    1 
ATOM   158  C  C     . GLY A 1 32  ? 37.662  16.992 65.702  1.00 30.51 ? 138 GLY A C     1 
ATOM   159  O  O     . GLY A 1 32  ? 36.513  16.769 65.292  1.00 31.35 ? 138 GLY A O     1 
ATOM   160  N  N     . VAL A 1 33  ? 38.151  18.225 65.843  1.00 30.30 ? 139 VAL A N     1 
ATOM   161  C  CA    . VAL A 1 33  ? 37.387  19.459 65.605  1.00 29.70 ? 139 VAL A CA    1 
ATOM   162  C  C     . VAL A 1 33  ? 37.721  20.059 64.218  1.00 28.96 ? 139 VAL A C     1 
ATOM   163  O  O     . VAL A 1 33  ? 38.706  19.646 63.574  1.00 28.38 ? 139 VAL A O     1 
ATOM   164  C  CB    . VAL A 1 33  ? 37.726  20.453 66.742  1.00 30.14 ? 139 VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 33  ? 37.638  21.904 66.291  1.00 31.06 ? 139 VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 33  ? 36.842  20.181 67.995  1.00 30.08 ? 139 VAL A CG2   1 
ATOM   167  N  N     . VAL A 1 34  ? 36.883  20.986 63.737  1.00 28.18 ? 140 VAL A N     1 
ATOM   168  C  CA    . VAL A 1 34  ? 37.175  21.763 62.501  1.00 27.91 ? 140 VAL A CA    1 
ATOM   169  C  C     . VAL A 1 34  ? 37.572  23.198 62.837  1.00 27.60 ? 140 VAL A C     1 
ATOM   170  O  O     . VAL A 1 34  ? 36.972  23.805 63.706  1.00 27.61 ? 140 VAL A O     1 
ATOM   171  C  CB    . VAL A 1 34  ? 35.987  21.792 61.482  1.00 27.42 ? 140 VAL A CB    1 
ATOM   172  C  CG1   . VAL A 1 34  ? 36.308  22.649 60.263  1.00 27.60 ? 140 VAL A CG1   1 
ATOM   173  C  CG2   . VAL A 1 34  ? 35.677  20.425 61.004  1.00 26.86 ? 140 VAL A CG2   1 
ATOM   174  N  N     . ARG A 1 35  ? 38.585  23.719 62.139  1.00 27.41 ? 141 ARG A N     1 
ATOM   175  C  CA    . ARG A 1 35  ? 39.053  25.105 62.304  1.00 27.40 ? 141 ARG A CA    1 
ATOM   176  C  C     . ARG A 1 35  ? 39.390  25.704 60.946  1.00 27.13 ? 141 ARG A C     1 
ATOM   177  O  O     . ARG A 1 35  ? 39.849  24.988 60.072  1.00 26.84 ? 141 ARG A O     1 
ATOM   178  C  CB    . ARG A 1 35  ? 40.298  25.162 63.206  1.00 27.38 ? 141 ARG A CB    1 
ATOM   179  C  CG    . ARG A 1 35  ? 40.051  24.713 64.638  0.01 27.48 ? 141 ARG A CG    1 
ATOM   180  C  CD    . ARG A 1 35  ? 41.263  24.843 65.548  0.01 27.57 ? 141 ARG A CD    1 
ATOM   181  N  NE    . ARG A 1 35  ? 40.916  24.671 66.958  0.01 27.64 ? 141 ARG A NE    1 
ATOM   182  C  CZ    . ARG A 1 35  ? 41.778  24.759 67.970  0.01 27.70 ? 141 ARG A CZ    1 
ATOM   183  N  NH1   . ARG A 1 35  ? 41.353  24.584 69.216  0.01 27.71 ? 141 ARG A NH1   1 
ATOM   184  N  NH2   . ARG A 1 35  ? 43.063  25.022 67.748  0.01 27.73 ? 141 ARG A NH2   1 
ATOM   185  N  N     . ARG A 1 36  ? 39.161  27.004 60.769  1.00 27.07 ? 142 ARG A N     1 
ATOM   186  C  CA    . ARG A 1 36  ? 39.617  27.726 59.573  1.00 27.52 ? 142 ARG A CA    1 
ATOM   187  C  C     . ARG A 1 36  ? 41.088  28.091 59.709  1.00 28.00 ? 142 ARG A C     1 
ATOM   188  O  O     . ARG A 1 36  ? 41.585  28.321 60.828  1.00 28.52 ? 142 ARG A O     1 
ATOM   189  C  CB    . ARG A 1 36  ? 38.828  29.015 59.396  1.00 27.80 ? 142 ARG A CB    1 
ATOM   190  C  CG    . ARG A 1 36  ? 39.097  29.770 58.095  1.00 28.42 ? 142 ARG A CG    1 
ATOM   191  C  CD    . ARG A 1 36  ? 38.716  31.248 58.173  1.00 29.89 ? 142 ARG A CD    1 
ATOM   192  N  NE    . ARG A 1 36  ? 39.106  31.990 56.972  1.00 30.75 ? 142 ARG A NE    1 
ATOM   193  C  CZ    . ARG A 1 36  ? 38.829  33.270 56.750  1.00 29.77 ? 142 ARG A CZ    1 
ATOM   194  N  NH1   . ARG A 1 36  ? 39.220  33.843 55.614  1.00 28.70 ? 142 ARG A NH1   1 
ATOM   195  N  NH2   . ARG A 1 36  ? 38.166  33.978 57.661  1.00 30.65 ? 142 ARG A NH2   1 
ATOM   196  N  N     . GLY A 1 37  ? 41.789  28.173 58.581  1.00 28.15 ? 143 GLY A N     1 
ATOM   197  C  CA    . GLY A 1 37  ? 43.245  28.273 58.606  1.00 28.31 ? 143 GLY A CA    1 
ATOM   198  C  C     . GLY A 1 37  ? 43.868  29.024 57.443  1.00 28.18 ? 143 GLY A C     1 
ATOM   199  O  O     . GLY A 1 37  ? 43.181  29.406 56.479  1.00 28.34 ? 143 GLY A O     1 
ATOM   200  N  N     . GLU A 1 38  ? 45.180  29.228 57.554  1.00 27.65 ? 144 GLU A N     1 
ATOM   201  C  CA    . GLU A 1 38  ? 45.961  29.940 56.564  1.00 27.26 ? 144 GLU A CA    1 
ATOM   202  C  C     . GLU A 1 38  ? 47.053  28.988 56.060  1.00 27.10 ? 144 GLU A C     1 
ATOM   203  O  O     . GLU A 1 38  ? 47.944  28.624 56.805  1.00 26.80 ? 144 GLU A O     1 
ATOM   204  C  CB    . GLU A 1 38  ? 46.541  31.185 57.215  1.00 27.22 ? 144 GLU A CB    1 
ATOM   205  C  CG    . GLU A 1 38  ? 45.508  32.261 57.513  0.01 27.31 ? 144 GLU A CG    1 
ATOM   206  C  CD    . GLU A 1 38  ? 46.137  33.578 57.926  0.01 27.35 ? 144 GLU A CD    1 
ATOM   207  O  OE1   . GLU A 1 38  ? 46.938  33.581 58.885  0.01 27.38 ? 144 GLU A OE1   1 
ATOM   208  O  OE2   . GLU A 1 38  ? 45.831  34.611 57.293  0.01 27.35 ? 144 GLU A OE2   1 
ATOM   209  N  N     . TRP A 1 39  ? 46.947  28.547 54.811  1.00 27.23 ? 145 TRP A N     1 
ATOM   210  C  CA    . TRP A 1 39  ? 47.857  27.559 54.228  1.00 27.39 ? 145 TRP A CA    1 
ATOM   211  C  C     . TRP A 1 39  ? 48.837  28.249 53.304  1.00 27.64 ? 145 TRP A C     1 
ATOM   212  O  O     . TRP A 1 39  ? 48.452  28.679 52.212  1.00 27.39 ? 145 TRP A O     1 
ATOM   213  C  CB    . TRP A 1 39  ? 47.090  26.528 53.399  1.00 27.72 ? 145 TRP A CB    1 
ATOM   214  C  CG    . TRP A 1 39  ? 47.999  25.587 52.613  1.00 28.01 ? 145 TRP A CG    1 
ATOM   215  C  CD1   . TRP A 1 39  ? 49.159  25.028 53.061  1.00 27.96 ? 145 TRP A CD1   1 
ATOM   216  C  CD2   . TRP A 1 39  ? 47.816  25.093 51.272  1.00 28.55 ? 145 TRP A CD2   1 
ATOM   217  N  NE1   . TRP A 1 39  ? 49.707  24.212 52.101  1.00 27.39 ? 145 TRP A NE1   1 
ATOM   218  C  CE2   . TRP A 1 39  ? 48.921  24.236 50.984  1.00 27.91 ? 145 TRP A CE2   1 
ATOM   219  C  CE3   . TRP A 1 39  ? 46.848  25.295 50.274  1.00 28.42 ? 145 TRP A CE3   1 
ATOM   220  C  CZ2   . TRP A 1 39  ? 49.087  23.578 49.745  1.00 26.95 ? 145 TRP A CZ2   1 
ATOM   221  C  CZ3   . TRP A 1 39  ? 47.017  24.642 49.026  1.00 28.89 ? 145 TRP A CZ3   1 
ATOM   222  C  CH2   . TRP A 1 39  ? 48.134  23.793 48.785  1.00 28.38 ? 145 TRP A CH2   1 
ATOM   223  N  N     . ASP A 1 40  ? 50.101  28.337 53.728  1.00 27.79 ? 146 ASP A N     1 
ATOM   224  C  CA    . ASP A 1 40  ? 51.124  29.097 53.001  1.00 27.65 ? 146 ASP A CA    1 
ATOM   225  C  C     . ASP A 1 40  ? 51.538  28.325 51.770  1.00 27.44 ? 146 ASP A C     1 
ATOM   226  O  O     . ASP A 1 40  ? 52.652  27.861 51.687  1.00 27.50 ? 146 ASP A O     1 
ATOM   227  C  CB    . ASP A 1 40  ? 52.348  29.382 53.899  1.00 27.59 ? 146 ASP A CB    1 
ATOM   228  C  CG    . ASP A 1 40  ? 52.345  30.795 54.479  1.00 27.59 ? 146 ASP A CG    1 
ATOM   229  O  OD1   . ASP A 1 40  ? 51.474  31.627 54.125  1.00 25.25 ? 146 ASP A OD1   1 
ATOM   230  O  OD2   . ASP A 1 40  ? 53.202  31.161 55.306  1.00 27.46 ? 146 ASP A OD2   1 
ATOM   231  N  N     . ALA A 1 41  ? 50.629  28.223 50.807  1.00 27.56 ? 147 ALA A N     1 
ATOM   232  C  CA    . ALA A 1 41  ? 50.761  27.299 49.681  1.00 27.56 ? 147 ALA A CA    1 
ATOM   233  C  C     . ALA A 1 41  ? 52.050  27.480 48.873  1.00 27.79 ? 147 ALA A C     1 
ATOM   234  O  O     . ALA A 1 41  ? 52.656  28.586 48.852  1.00 27.31 ? 147 ALA A O     1 
ATOM   235  C  CB    . ALA A 1 41  ? 49.577  27.450 48.755  1.00 27.51 ? 147 ALA A CB    1 
ATOM   236  N  N     . PRO A 1 42  ? 52.455  26.401 48.193  1.00 27.60 ? 148 PRO A N     1 
ATOM   237  C  CA    . PRO A 1 42  ? 53.609  26.433 47.283  1.00 27.74 ? 148 PRO A CA    1 
ATOM   238  C  C     . PRO A 1 42  ? 53.447  27.292 46.000  1.00 27.53 ? 148 PRO A C     1 
ATOM   239  O  O     . PRO A 1 42  ? 54.076  26.956 44.983  1.00 27.33 ? 148 PRO A O     1 
ATOM   240  C  CB    . PRO A 1 42  ? 53.831  24.943 46.959  1.00 27.62 ? 148 PRO A CB    1 
ATOM   241  C  CG    . PRO A 1 42  ? 52.556  24.345 47.159  1.00 27.78 ? 148 PRO A CG    1 
ATOM   242  C  CD    . PRO A 1 42  ? 51.896  25.049 48.295  1.00 27.39 ? 148 PRO A CD    1 
ATOM   243  N  N     . SER A 1 43  ? 52.658  28.375 46.067  1.00 27.30 ? 149 SER A N     1 
ATOM   244  C  CA    . SER A 1 43  ? 52.637  29.430 45.041  1.00 27.30 ? 149 SER A CA    1 
ATOM   245  C  C     . SER A 1 43  ? 52.981  30.834 45.617  1.00 27.54 ? 149 SER A C     1 
ATOM   246  O  O     . SER A 1 43  ? 52.674  31.866 45.002  1.00 27.18 ? 149 SER A O     1 
ATOM   247  C  CB    . SER A 1 43  ? 51.258  29.456 44.394  1.00 27.08 ? 149 SER A CB    1 
ATOM   248  O  OG    . SER A 1 43  ? 50.249  29.366 45.385  1.00 26.50 ? 149 SER A OG    1 
ATOM   249  N  N     . GLY A 1 44  ? 53.624  30.861 46.789  1.00 27.77 ? 150 GLY A N     1 
ATOM   250  C  CA    . GLY A 1 44  ? 53.633  32.040 47.643  1.00 27.99 ? 150 GLY A CA    1 
ATOM   251  C  C     . GLY A 1 44  ? 52.300  32.245 48.381  1.00 28.23 ? 150 GLY A C     1 
ATOM   252  O  O     . GLY A 1 44  ? 52.264  32.646 49.550  1.00 28.39 ? 150 GLY A O     1 
ATOM   253  N  N     . LYS A 1 45  ? 51.198  31.931 47.709  1.00 28.20 ? 151 LYS A N     1 
ATOM   254  C  CA    . LYS A 1 45  ? 49.870  32.307 48.168  1.00 28.32 ? 151 LYS A CA    1 
ATOM   255  C  C     . LYS A 1 45  ? 49.500  31.676 49.506  1.00 28.24 ? 151 LYS A C     1 
ATOM   256  O  O     . LYS A 1 45  ? 49.454  30.452 49.632  1.00 28.07 ? 151 LYS A O     1 
ATOM   257  C  CB    . LYS A 1 45  ? 48.824  31.941 47.102  1.00 28.48 ? 151 LYS A CB    1 
ATOM   258  C  CG    . LYS A 1 45  ? 49.048  32.641 45.747  1.00 28.86 ? 151 LYS A CG    1 
ATOM   259  C  CD    . LYS A 1 45  ? 47.736  32.864 45.006  0.01 28.57 ? 151 LYS A CD    1 
ATOM   260  C  CE    . LYS A 1 45  ? 47.951  33.611 43.699  0.01 28.49 ? 151 LYS A CE    1 
ATOM   261  N  NZ    . LYS A 1 45  ? 46.691  34.226 43.195  0.01 28.42 ? 151 LYS A NZ    1 
ATOM   262  N  N     . THR A 1 46  ? 49.256  32.531 50.498  1.00 28.13 ? 152 THR A N     1 
ATOM   263  C  CA    . THR A 1 46  ? 48.648  32.116 51.752  1.00 28.21 ? 152 THR A CA    1 
ATOM   264  C  C     . THR A 1 46  ? 47.180  31.965 51.393  1.00 28.02 ? 152 THR A C     1 
ATOM   265  O  O     . THR A 1 46  ? 46.598  32.875 50.802  1.00 27.81 ? 152 THR A O     1 
ATOM   266  C  CB    . THR A 1 46  ? 48.950  33.147 52.925  1.00 28.48 ? 152 THR A CB    1 
ATOM   267  O  OG1   . THR A 1 46  ? 49.256  32.444 54.139  1.00 29.53 ? 152 THR A OG1   1 
ATOM   268  C  CG2   . THR A 1 46  ? 47.758  34.024 53.326  1.00 28.29 ? 152 THR A CG2   1 
ATOM   269  N  N     . VAL A 1 47  ? 46.607  30.795 51.697  1.00 27.63 ? 153 VAL A N     1 
ATOM   270  C  CA    . VAL A 1 47  ? 45.291  30.406 51.184  1.00 27.11 ? 153 VAL A CA    1 
ATOM   271  C  C     . VAL A 1 47  ? 44.360  30.090 52.328  1.00 26.72 ? 153 VAL A C     1 
ATOM   272  O  O     . VAL A 1 47  ? 44.780  29.603 53.376  1.00 26.07 ? 153 VAL A O     1 
ATOM   273  C  CB    . VAL A 1 47  ? 45.339  29.155 50.253  1.00 27.24 ? 153 VAL A CB    1 
ATOM   274  C  CG1   . VAL A 1 47  ? 44.165  29.153 49.305  1.00 27.43 ? 153 VAL A CG1   1 
ATOM   275  C  CG2   . VAL A 1 47  ? 46.614  29.108 49.463  1.00 27.37 ? 153 VAL A CG2   1 
ATOM   276  N  N     . SER A 1 48  ? 43.080  30.376 52.126  1.00 26.49 ? 154 SER A N     1 
ATOM   277  C  CA    . SER A 1 48  ? 42.118  30.125 53.169  1.00 26.00 ? 154 SER A CA    1 
ATOM   278  C  C     . SER A 1 48  ? 41.540  28.768 52.945  1.00 25.62 ? 154 SER A C     1 
ATOM   279  O  O     . SER A 1 48  ? 41.093  28.409 51.866  1.00 25.45 ? 154 SER A O     1 
ATOM   280  C  CB    . SER A 1 48  ? 41.058  31.207 53.244  1.00 26.18 ? 154 SER A CB    1 
ATOM   281  O  OG    . SER A 1 48  ? 41.508  32.201 54.147  1.00 26.17 ? 154 SER A OG    1 
ATOM   282  N  N     . VAL A 1 49  ? 41.602  27.997 54.006  1.00 25.40 ? 155 VAL A N     1 
ATOM   283  C  CA    . VAL A 1 49  ? 41.423  26.581 53.939  1.00 25.21 ? 155 VAL A CA    1 
ATOM   284  C  C     . VAL A 1 49  ? 40.619  26.301 55.171  1.00 25.59 ? 155 VAL A C     1 
ATOM   285  O  O     . VAL A 1 49  ? 40.725  27.005 56.164  1.00 25.14 ? 155 VAL A O     1 
ATOM   286  C  CB    . VAL A 1 49  ? 42.823  25.820 53.908  1.00 25.33 ? 155 VAL A CB    1 
ATOM   287  C  CG1   . VAL A 1 49  ? 43.608  26.190 52.692  1.00 24.28 ? 155 VAL A CG1   1 
ATOM   288  C  CG2   . VAL A 1 49  ? 43.721  26.110 55.146  1.00 24.96 ? 155 VAL A CG2   1 
ATOM   289  N  N     . ALA A 1 50  ? 39.715  25.346 55.059  1.00 26.57 ? 156 ALA A N     1 
ATOM   290  C  CA    . ALA A 1 50  ? 39.123  24.712 56.220  1.00 26.66 ? 156 ALA A CA    1 
ATOM   291  C  C     . ALA A 1 50  ? 40.133  23.584 56.559  1.00 26.89 ? 156 ALA A C     1 
ATOM   292  O  O     . ALA A 1 50  ? 40.896  23.121 55.697  1.00 25.63 ? 156 ALA A O     1 
ATOM   293  C  CB    . ALA A 1 50  ? 37.693  24.176 55.896  1.00 26.32 ? 156 ALA A CB    1 
ATOM   294  N  N     . VAL A 1 51  ? 40.150  23.203 57.831  1.00 27.33 ? 157 VAL A N     1 
ATOM   295  C  CA    . VAL A 1 51  ? 41.168  22.328 58.391  1.00 27.24 ? 157 VAL A CA    1 
ATOM   296  C  C     . VAL A 1 51  ? 40.466  21.346 59.354  1.00 27.77 ? 157 VAL A C     1 
ATOM   297  O  O     . VAL A 1 51  ? 40.102  21.654 60.499  1.00 27.06 ? 157 VAL A O     1 
ATOM   298  C  CB    . VAL A 1 51  ? 42.303  23.124 59.074  1.00 26.86 ? 157 VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1 51  ? 43.334  22.183 59.627  1.00 26.74 ? 157 VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1 51  ? 42.961  24.098 58.086  1.00 26.25 ? 157 VAL A CG2   1 
ATOM   301  N  N     . LYS A 1 52  ? 40.221  20.170 58.816  1.00 28.33 ? 158 LYS A N     1 
ATOM   302  C  CA    . LYS A 1 52  ? 39.594  19.097 59.532  1.00 28.91 ? 158 LYS A CA    1 
ATOM   303  C  C     . LYS A 1 52  ? 40.722  18.366 60.319  1.00 29.44 ? 158 LYS A C     1 
ATOM   304  O  O     . LYS A 1 52  ? 41.305  17.375 59.850  1.00 29.34 ? 158 LYS A O     1 
ATOM   305  C  CB    . LYS A 1 52  ? 38.858  18.236 58.500  1.00 28.71 ? 158 LYS A CB    1 
ATOM   306  C  CG    . LYS A 1 52  ? 37.894  17.217 59.028  1.00 29.23 ? 158 LYS A CG    1 
ATOM   307  C  CD    . LYS A 1 52  ? 36.632  17.014 58.076  1.00 29.21 ? 158 LYS A CD    1 
ATOM   308  C  CE    . LYS A 1 52  ? 35.680  15.949 58.701  1.00 30.57 ? 158 LYS A CE    1 
ATOM   309  N  NZ    . LYS A 1 52  ? 35.051  14.921 57.783  1.00 31.21 ? 158 LYS A NZ    1 
ATOM   310  N  N     . CYS A 1 53  ? 41.021  18.889 61.512  1.00 29.78 ? 159 CYS A N     1 
ATOM   311  C  CA    . CYS A 1 53  ? 42.030  18.304 62.428  1.00 30.37 ? 159 CYS A CA    1 
ATOM   312  C  C     . CYS A 1 53  ? 41.620  16.981 63.054  1.00 30.39 ? 159 CYS A C     1 
ATOM   313  O  O     . CYS A 1 53  ? 40.459  16.553 62.936  1.00 31.64 ? 159 CYS A O     1 
ATOM   314  C  CB    . CYS A 1 53  ? 42.331  19.249 63.602  1.00 30.35 ? 159 CYS A CB    1 
ATOM   315  S  SG    . CYS A 1 53  ? 42.853  20.910 63.131  1.00 31.05 ? 159 CYS A SG    1 
ATOM   316  N  N     . LEU A 1 54  ? 42.574  16.371 63.758  1.00 29.93 ? 160 LEU A N     1 
ATOM   317  C  CA    . LEU A 1 54  ? 42.364  15.113 64.486  1.00 29.71 ? 160 LEU A CA    1 
ATOM   318  C  C     . LEU A 1 54  ? 43.424  14.939 65.587  1.00 29.24 ? 160 LEU A C     1 
ATOM   319  O  O     . LEU A 1 54  ? 43.133  14.430 66.663  1.00 28.75 ? 160 LEU A O     1 
ATOM   320  C  CB    . LEU A 1 54  ? 42.416  13.929 63.518  0.01 29.50 ? 160 LEU A CB    1 
ATOM   321  C  CG    . LEU A 1 54  ? 42.170  12.541 64.123  0.01 29.17 ? 160 LEU A CG    1 
ATOM   322  C  CD1   . LEU A 1 54  ? 41.148  11.766 63.304  0.01 28.92 ? 160 LEU A CD1   1 
ATOM   323  C  CD2   . LEU A 1 54  ? 43.471  11.752 64.238  0.01 28.92 ? 160 LEU A CD2   1 
ATOM   324  N  N     . ALA A 1 64  ? 39.643  5.230  63.568  1.00 25.82 ? 170 ALA A N     1 
ATOM   325  C  CA    . ALA A 1 64  ? 39.803  6.653  63.829  1.00 25.98 ? 170 ALA A CA    1 
ATOM   326  C  C     . ALA A 1 64  ? 40.951  7.196  62.981  1.00 26.45 ? 170 ALA A C     1 
ATOM   327  O  O     . ALA A 1 64  ? 40.798  8.175  62.259  1.00 25.90 ? 170 ALA A O     1 
ATOM   328  C  CB    . ALA A 1 64  ? 40.038  6.896  65.296  1.00 25.63 ? 170 ALA A CB    1 
ATOM   329  N  N     . MET A 1 65  ? 42.094  6.524  63.075  1.00 27.48 ? 171 MET A N     1 
ATOM   330  C  CA    . MET A 1 65  ? 43.216  6.683  62.143  1.00 28.22 ? 171 MET A CA    1 
ATOM   331  C  C     . MET A 1 65  ? 42.828  6.085  60.779  1.00 28.71 ? 171 MET A C     1 
ATOM   332  O  O     . MET A 1 65  ? 43.098  6.666  59.736  1.00 29.10 ? 171 MET A O     1 
ATOM   333  C  CB    . MET A 1 65  ? 44.455  5.955  62.705  1.00 28.40 ? 171 MET A CB    1 
ATOM   334  C  CG    . MET A 1 65  ? 45.620  5.812  61.749  1.00 28.77 ? 171 MET A CG    1 
ATOM   335  S  SD    . MET A 1 65  ? 46.145  7.431  61.206  1.00 31.11 ? 171 MET A SD    1 
ATOM   336  C  CE    . MET A 1 65  ? 47.779  7.051  60.703  1.00 31.36 ? 171 MET A CE    1 
ATOM   337  N  N     . ASP A 1 66  ? 42.203  4.906  60.811  1.00 29.20 ? 172 ASP A N     1 
ATOM   338  C  CA    . ASP A 1 66  ? 41.569  4.297  59.626  1.00 29.02 ? 172 ASP A CA    1 
ATOM   339  C  C     . ASP A 1 66  ? 40.551  5.186  58.967  1.00 28.44 ? 172 ASP A C     1 
ATOM   340  O  O     . ASP A 1 66  ? 40.332  5.081  57.776  1.00 28.14 ? 172 ASP A O     1 
ATOM   341  C  CB    . ASP A 1 66  ? 40.853  2.999  60.005  1.00 29.05 ? 172 ASP A CB    1 
ATOM   342  C  CG    . ASP A 1 66  ? 41.535  1.803  59.438  1.00 29.51 ? 172 ASP A CG    1 
ATOM   343  O  OD1   . ASP A 1 66  ? 41.140  1.403  58.310  1.00 29.46 ? 172 ASP A OD1   1 
ATOM   344  O  OD2   . ASP A 1 66  ? 42.507  1.256  60.025  1.00 28.41 ? 172 ASP A OD2   1 
ATOM   345  N  N     . ASP A 1 67  ? 39.906  6.011  59.785  1.00 28.14 ? 173 ASP A N     1 
ATOM   346  C  CA    . ASP A 1 67  ? 38.796  6.844  59.365  1.00 27.75 ? 173 ASP A CA    1 
ATOM   347  C  C     . ASP A 1 67  ? 39.283  8.196  58.942  1.00 27.60 ? 173 ASP A C     1 
ATOM   348  O  O     . ASP A 1 67  ? 38.521  8.974  58.397  1.00 27.14 ? 173 ASP A O     1 
ATOM   349  C  CB    . ASP A 1 67  ? 37.780  7.011  60.500  1.00 27.72 ? 173 ASP A CB    1 
ATOM   350  C  CG    . ASP A 1 67  ? 36.989  5.737  60.783  1.00 27.03 ? 173 ASP A CG    1 
ATOM   351  O  OD1   . ASP A 1 67  ? 36.634  5.008  59.818  1.00 25.99 ? 173 ASP A OD1   1 
ATOM   352  O  OD2   . ASP A 1 67  ? 36.677  5.409  61.948  1.00 24.52 ? 173 ASP A OD2   1 
ATOM   353  N  N     . PHE A 1 68  ? 40.551  8.494  59.210  1.00 27.85 ? 174 PHE A N     1 
ATOM   354  C  CA    . PHE A 1 68  ? 41.131  9.753  58.741  1.00 27.41 ? 174 PHE A CA    1 
ATOM   355  C  C     . PHE A 1 68  ? 41.580  9.493  57.322  1.00 27.19 ? 174 PHE A C     1 
ATOM   356  O  O     . PHE A 1 68  ? 41.194  10.196 56.384  1.00 25.67 ? 174 PHE A O     1 
ATOM   357  C  CB    . PHE A 1 68  ? 42.295  10.217 59.635  1.00 27.02 ? 174 PHE A CB    1 
ATOM   358  C  CG    . PHE A 1 68  ? 43.021  11.438 59.107  1.00 28.16 ? 174 PHE A CG    1 
ATOM   359  C  CD1   . PHE A 1 68  ? 44.027  11.311 58.153  1.00 29.21 ? 174 PHE A CD1   1 
ATOM   360  C  CD2   . PHE A 1 68  ? 42.713  12.697 59.563  1.00 29.22 ? 174 PHE A CD2   1 
ATOM   361  C  CE1   . PHE A 1 68  ? 44.696  12.415 57.641  1.00 29.99 ? 174 PHE A CE1   1 
ATOM   362  C  CE2   . PHE A 1 68  ? 43.387  13.818 59.045  1.00 31.25 ? 174 PHE A CE2   1 
ATOM   363  C  CZ    . PHE A 1 68  ? 44.381  13.665 58.078  1.00 30.40 ? 174 PHE A CZ    1 
ATOM   364  N  N     . ILE A 1 69  ? 42.376  8.437  57.186  1.00 27.39 ? 175 ILE A N     1 
ATOM   365  C  CA    . ILE A 1 69  ? 43.043  8.155  55.939  1.00 27.89 ? 175 ILE A CA    1 
ATOM   366  C  C     . ILE A 1 69  ? 42.077  7.629  54.909  1.00 28.34 ? 175 ILE A C     1 
ATOM   367  O  O     . ILE A 1 69  ? 42.368  7.689  53.732  1.00 29.36 ? 175 ILE A O     1 
ATOM   368  C  CB    . ILE A 1 69  ? 44.201  7.208  56.181  1.00 28.00 ? 175 ILE A CB    1 
ATOM   369  C  CG1   . ILE A 1 69  ? 45.450  8.038  56.442  1.00 28.12 ? 175 ILE A CG1   1 
ATOM   370  C  CG2   . ILE A 1 69  ? 44.412  6.218  55.019  1.00 28.14 ? 175 ILE A CG2   1 
ATOM   371  C  CD1   . ILE A 1 69  ? 46.373  7.368  57.440  1.00 29.32 ? 175 ILE A CD1   1 
ATOM   372  N  N     . ARG A 1 70  ? 40.929  7.122  55.341  1.00 28.35 ? 176 ARG A N     1 
ATOM   373  C  CA    . ARG A 1 70  ? 39.896  6.733  54.403  1.00 28.05 ? 176 ARG A CA    1 
ATOM   374  C  C     . ARG A 1 70  ? 39.310  7.950  53.750  1.00 27.89 ? 176 ARG A C     1 
ATOM   375  O  O     . ARG A 1 70  ? 39.084  7.938  52.546  1.00 28.22 ? 176 ARG A O     1 
ATOM   376  C  CB    . ARG A 1 70  ? 38.771  5.965  55.087  1.00 28.18 ? 176 ARG A CB    1 
ATOM   377  C  CG    . ARG A 1 70  ? 38.370  4.736  54.330  1.00 27.89 ? 176 ARG A CG    1 
ATOM   378  C  CD    . ARG A 1 70  ? 37.374  3.944  55.036  1.00 27.95 ? 176 ARG A CD    1 
ATOM   379  N  NE    . ARG A 1 70  ? 37.979  3.108  56.060  1.00 28.92 ? 176 ARG A NE    1 
ATOM   380  C  CZ    . ARG A 1 70  ? 38.138  1.786  55.968  1.00 29.45 ? 176 ARG A CZ    1 
ATOM   381  N  NH1   . ARG A 1 70  ? 37.781  1.105  54.881  1.00 28.34 ? 176 ARG A NH1   1 
ATOM   382  N  NH2   . ARG A 1 70  ? 38.684  1.135  56.981  1.00 30.57 ? 176 ARG A NH2   1 
ATOM   383  N  N     . GLU A 1 71  ? 39.034  8.974  54.560  1.00 27.68 ? 177 GLU A N     1 
ATOM   384  C  CA    . GLU A 1 71  ? 38.425  10.214 54.083  1.00 27.22 ? 177 GLU A CA    1 
ATOM   385  C  C     . GLU A 1 71  ? 39.373  10.949 53.166  1.00 26.92 ? 177 GLU A C     1 
ATOM   386  O  O     . GLU A 1 71  ? 38.947  11.421 52.152  1.00 28.06 ? 177 GLU A O     1 
ATOM   387  C  CB    . GLU A 1 71  ? 37.983  11.132 55.242  1.00 27.16 ? 177 GLU A CB    1 
ATOM   388  C  CG    . GLU A 1 71  ? 37.429  12.457 54.744  1.00 26.55 ? 177 GLU A CG    1 
ATOM   389  C  CD    . GLU A 1 71  ? 36.650  13.297 55.749  1.00 25.59 ? 177 GLU A CD    1 
ATOM   390  O  OE1   . GLU A 1 71  ? 35.975  14.249 55.253  1.00 25.63 ? 177 GLU A OE1   1 
ATOM   391  O  OE2   . GLU A 1 71  ? 36.712  13.052 56.986  1.00 21.99 ? 177 GLU A OE2   1 
ATOM   392  N  N     . VAL A 1 72  ? 40.647  11.044 53.531  1.00 26.44 ? 178 VAL A N     1 
ATOM   393  C  CA    . VAL A 1 72  ? 41.707  11.605 52.685  1.00 25.71 ? 178 VAL A CA    1 
ATOM   394  C  C     . VAL A 1 72  ? 41.740  10.927 51.335  1.00 25.02 ? 178 VAL A C     1 
ATOM   395  O  O     . VAL A 1 72  ? 41.804  11.570 50.314  1.00 24.98 ? 178 VAL A O     1 
ATOM   396  C  CB    . VAL A 1 72  ? 43.099  11.379 53.342  1.00 25.83 ? 178 VAL A CB    1 
ATOM   397  C  CG1   . VAL A 1 72  ? 44.246  11.629 52.389  1.00 26.50 ? 178 VAL A CG1   1 
ATOM   398  C  CG2   . VAL A 1 72  ? 43.278  12.260 54.521  1.00 26.97 ? 178 VAL A CG2   1 
ATOM   399  N  N     . ASN A 1 73  ? 41.712  9.612  51.336  1.00 24.41 ? 179 ASN A N     1 
ATOM   400  C  CA    . ASN A 1 73  ? 41.761  8.857  50.100  1.00 24.31 ? 179 ASN A CA    1 
ATOM   401  C  C     . ASN A 1 73  ? 40.541  9.022  49.235  1.00 24.53 ? 179 ASN A C     1 
ATOM   402  O  O     . ASN A 1 73  ? 40.613  8.782  48.038  1.00 24.59 ? 179 ASN A O     1 
ATOM   403  C  CB    . ASN A 1 73  ? 42.017  7.364  50.389  1.00 23.68 ? 179 ASN A CB    1 
ATOM   404  C  CG    . ASN A 1 73  ? 43.427  7.130  50.776  1.00 21.85 ? 179 ASN A CG    1 
ATOM   405  O  OD1   . ASN A 1 73  ? 44.288  7.900  50.351  1.00 23.41 ? 179 ASN A OD1   1 
ATOM   406  N  ND2   . ASN A 1 73  ? 43.689  6.145  51.620  1.00 17.45 ? 179 ASN A ND2   1 
ATOM   407  N  N     . ALA A 1 74  ? 39.430  9.408  49.852  1.00 25.23 ? 180 ALA A N     1 
ATOM   408  C  CA    . ALA A 1 74  ? 38.136  9.495  49.184  1.00 25.75 ? 180 ALA A CA    1 
ATOM   409  C  C     . ALA A 1 74  ? 38.158  10.754 48.421  1.00 25.96 ? 180 ALA A C     1 
ATOM   410  O  O     . ALA A 1 74  ? 37.830  10.791 47.251  1.00 25.57 ? 180 ALA A O     1 
ATOM   411  C  CB    . ALA A 1 74  ? 36.995  9.538  50.204  1.00 25.84 ? 180 ALA A CB    1 
ATOM   412  N  N     . MET A 1 75  ? 38.584  11.786 49.130  1.00 26.94 ? 181 MET A N     1 
ATOM   413  C  CA    . MET A 1 75  ? 38.693  13.148 48.617  1.00 27.69 ? 181 MET A CA    1 
ATOM   414  C  C     . MET A 1 75  ? 39.697  13.331 47.503  1.00 27.43 ? 181 MET A C     1 
ATOM   415  O  O     . MET A 1 75  ? 39.618  14.304 46.742  1.00 27.06 ? 181 MET A O     1 
ATOM   416  C  CB    . MET A 1 75  ? 39.165  14.048 49.734  1.00 28.06 ? 181 MET A CB    1 
ATOM   417  C  CG    . MET A 1 75  ? 38.325  15.300 49.963  1.00 30.13 ? 181 MET A CG    1 
ATOM   418  S  SD    . MET A 1 75  ? 38.131  15.459 51.680  1.00 31.56 ? 181 MET A SD    1 
ATOM   419  C  CE    . MET A 1 75  ? 37.274  13.941 51.882  1.00 29.69 ? 181 MET A CE    1 
ATOM   420  N  N     . HIS A 1 76  ? 40.659  12.415 47.451  1.00 27.80 ? 182 HIS A N     1 
ATOM   421  C  CA    . HIS A 1 76  ? 41.880  12.624 46.703  1.00 28.01 ? 182 HIS A CA    1 
ATOM   422  C  C     . HIS A 1 76  ? 41.518  12.304 45.279  1.00 28.55 ? 182 HIS A C     1 
ATOM   423  O  O     . HIS A 1 76  ? 41.826  13.053 44.317  1.00 27.69 ? 182 HIS A O     1 
ATOM   424  C  CB    . HIS A 1 76  ? 42.979  11.719 47.278  1.00 28.06 ? 182 HIS A CB    1 
ATOM   425  C  CG    . HIS A 1 76  ? 44.184  11.581 46.397  1.00 28.79 ? 182 HIS A CG    1 
ATOM   426  N  ND1   . HIS A 1 76  ? 44.870  12.664 45.889  1.00 28.51 ? 182 HIS A ND1   1 
ATOM   427  C  CD2   . HIS A 1 76  ? 44.803  10.481 45.913  1.00 28.90 ? 182 HIS A CD2   1 
ATOM   428  C  CE1   . HIS A 1 76  ? 45.850  12.241 45.123  1.00 28.02 ? 182 HIS A CE1   1 
ATOM   429  N  NE2   . HIS A 1 76  ? 45.842  10.918 45.132  1.00 29.94 ? 182 HIS A NE2   1 
ATOM   430  N  N     . SER A 1 77  ? 40.814  11.187 45.172  1.00 29.49 ? 183 SER A N     1 
ATOM   431  C  CA    . SER A 1 77  ? 40.228  10.764 43.912  1.00 30.48 ? 183 SER A CA    1 
ATOM   432  C  C     . SER A 1 77  ? 39.471  11.937 43.250  1.00 31.21 ? 183 SER A C     1 
ATOM   433  O  O     . SER A 1 77  ? 39.781  12.297 42.112  1.00 32.57 ? 183 SER A O     1 
ATOM   434  C  CB    . SER A 1 77  ? 39.308  9.567  44.146  1.00 30.41 ? 183 SER A CB    1 
ATOM   435  O  OG    . SER A 1 77  ? 38.755  9.607  45.445  1.00 30.22 ? 183 SER A OG    1 
ATOM   436  N  N     . LEU A 1 78  ? 38.585  12.599 44.006  1.00 30.91 ? 184 LEU A N     1 
ATOM   437  C  CA    . LEU A 1 78  ? 37.646  13.587 43.470  1.00 30.15 ? 184 LEU A CA    1 
ATOM   438  C  C     . LEU A 1 78  ? 38.251  14.931 43.141  1.00 29.86 ? 184 LEU A C     1 
ATOM   439  O  O     . LEU A 1 78  ? 39.181  15.354 43.793  1.00 29.93 ? 184 LEU A O     1 
ATOM   440  C  CB    . LEU A 1 78  ? 36.548  13.878 44.468  1.00 29.79 ? 184 LEU A CB    1 
ATOM   441  C  CG    . LEU A 1 78  ? 35.970  12.627 45.102  1.00 31.11 ? 184 LEU A CG    1 
ATOM   442  C  CD1   . LEU A 1 78  ? 35.202  13.073 46.314  1.00 32.71 ? 184 LEU A CD1   1 
ATOM   443  C  CD2   . LEU A 1 78  ? 35.116  11.807 44.144  1.00 30.84 ? 184 LEU A CD2   1 
ATOM   444  N  N     . ASP A 1 79  ? 37.620  15.600 42.171  1.00 29.62 ? 185 ASP A N     1 
ATOM   445  C  CA    . ASP A 1 79  ? 37.892  16.974 41.741  1.00 29.11 ? 185 ASP A CA    1 
ATOM   446  C  C     . ASP A 1 79  ? 36.631  17.579 41.045  1.00 28.96 ? 185 ASP A C     1 
ATOM   447  O  O     . ASP A 1 79  ? 36.292  17.141 39.936  1.00 29.80 ? 185 ASP A O     1 
ATOM   448  C  CB    . ASP A 1 79  ? 39.052  16.967 40.744  1.00 28.64 ? 185 ASP A CB    1 
ATOM   449  C  CG    . ASP A 1 79  ? 39.224  18.282 40.061  1.00 27.63 ? 185 ASP A CG    1 
ATOM   450  O  OD1   . ASP A 1 79  ? 38.346  19.142 40.238  1.00 29.52 ? 185 ASP A OD1   1 
ATOM   451  O  OD2   . ASP A 1 79  ? 40.181  18.560 39.323  1.00 27.37 ? 185 ASP A OD2   1 
ATOM   452  N  N     . HIS A 1 80  ? 35.970  18.585 41.643  1.00 27.74 ? 186 HIS A N     1 
ATOM   453  C  CA    . HIS A 1 80  ? 34.635  19.039 41.161  1.00 26.71 ? 186 HIS A CA    1 
ATOM   454  C  C     . HIS A 1 80  ? 34.141  20.330 41.822  1.00 26.67 ? 186 HIS A C     1 
ATOM   455  O  O     . HIS A 1 80  ? 34.314  20.552 43.013  1.00 26.77 ? 186 HIS A O     1 
ATOM   456  C  CB    . HIS A 1 80  ? 33.595  17.953 41.408  1.00 26.03 ? 186 HIS A CB    1 
ATOM   457  C  CG    . HIS A 1 80  ? 32.347  18.078 40.593  1.00 25.02 ? 186 HIS A CG    1 
ATOM   458  N  ND1   . HIS A 1 80  ? 31.360  18.995 40.869  1.00 24.38 ? 186 HIS A ND1   1 
ATOM   459  C  CD2   . HIS A 1 80  ? 31.880  17.339 39.560  1.00 24.19 ? 186 HIS A CD2   1 
ATOM   460  C  CE1   . HIS A 1 80  ? 30.369  18.858 40.009  1.00 21.72 ? 186 HIS A CE1   1 
ATOM   461  N  NE2   . HIS A 1 80  ? 30.655  17.853 39.210  1.00 21.40 ? 186 HIS A NE2   1 
ATOM   462  N  N     . ARG A 1 81  ? 33.502  21.167 41.027  1.00 26.62 ? 187 ARG A N     1 
ATOM   463  C  CA    . ARG A 1 81  ? 33.027  22.474 41.475  1.00 26.68 ? 187 ARG A CA    1 
ATOM   464  C  C     . ARG A 1 81  ? 31.969  22.318 42.596  1.00 25.91 ? 187 ARG A C     1 
ATOM   465  O  O     . ARG A 1 81  ? 31.922  23.086 43.545  1.00 25.45 ? 187 ARG A O     1 
ATOM   466  C  CB    . ARG A 1 81  ? 32.528  23.280 40.233  1.00 26.85 ? 187 ARG A CB    1 
ATOM   467  C  CG    . ARG A 1 81  ? 31.596  24.482 40.451  1.00 27.05 ? 187 ARG A CG    1 
ATOM   468  C  CD    . ARG A 1 81  ? 31.419  25.362 39.217  0.01 27.32 ? 187 ARG A CD    1 
ATOM   469  N  NE    . ARG A 1 81  ? 31.141  26.757 39.557  0.01 27.50 ? 187 ARG A NE    1 
ATOM   470  C  CZ    . ARG A 1 81  ? 30.984  27.737 38.668  0.01 27.66 ? 187 ARG A CZ    1 
ATOM   471  N  NH1   . ARG A 1 81  ? 30.734  28.974 39.086  0.01 27.70 ? 187 ARG A NH1   1 
ATOM   472  N  NH2   . ARG A 1 81  ? 31.072  27.493 37.363  0.01 27.72 ? 187 ARG A NH2   1 
ATOM   473  N  N     . ASN A 1 82  ? 31.134  21.311 42.481  1.00 25.54 ? 188 ASN A N     1 
ATOM   474  C  CA    . ASN A 1 82  ? 30.215  20.938 43.560  1.00 25.75 ? 188 ASN A CA    1 
ATOM   475  C  C     . ASN A 1 82  ? 30.672  19.929 44.662  1.00 25.39 ? 188 ASN A C     1 
ATOM   476  O  O     . ASN A 1 82  ? 29.850  19.491 45.439  1.00 25.67 ? 188 ASN A O     1 
ATOM   477  C  CB    . ASN A 1 82  ? 28.928  20.419 42.927  1.00 25.54 ? 188 ASN A CB    1 
ATOM   478  C  CG    . ASN A 1 82  ? 28.234  21.464 42.178  1.00 24.50 ? 188 ASN A CG    1 
ATOM   479  O  OD1   . ASN A 1 82  ? 27.688  21.211 41.084  1.00 24.28 ? 188 ASN A OD1   1 
ATOM   480  N  ND2   . ASN A 1 82  ? 28.232  22.682 42.749  1.00 22.15 ? 188 ASN A ND2   1 
ATOM   481  N  N     . LEU A 1 83  ? 31.941  19.558 44.718  1.00 25.30 ? 189 LEU A N     1 
ATOM   482  C  CA    . LEU A 1 83  ? 32.477  18.755 45.817  1.00 25.65 ? 189 LEU A CA    1 
ATOM   483  C  C     . LEU A 1 83  ? 33.568  19.557 46.517  1.00 25.70 ? 189 LEU A C     1 
ATOM   484  O  O     . LEU A 1 83  ? 34.236  20.361 45.876  1.00 26.28 ? 189 LEU A O     1 
ATOM   485  C  CB    . LEU A 1 83  ? 33.005  17.408 45.272  1.00 25.71 ? 189 LEU A CB    1 
ATOM   486  C  CG    . LEU A 1 83  ? 31.999  16.575 44.436  1.00 26.17 ? 189 LEU A CG    1 
ATOM   487  C  CD1   . LEU A 1 83  ? 32.575  15.280 43.906  1.00 25.03 ? 189 LEU A CD1   1 
ATOM   488  C  CD2   . LEU A 1 83  ? 30.713  16.295 45.216  1.00 25.94 ? 189 LEU A CD2   1 
ATOM   489  N  N     . ILE A 1 84  ? 33.754  19.376 47.818  1.00 26.06 ? 190 ILE A N     1 
ATOM   490  C  CA    . ILE A 1 84  ? 34.838  20.100 48.524  1.00 26.99 ? 190 ILE A CA    1 
ATOM   491  C  C     . ILE A 1 84  ? 36.166  19.465 48.140  1.00 26.89 ? 190 ILE A C     1 
ATOM   492  O  O     . ILE A 1 84  ? 36.269  18.242 48.152  1.00 27.58 ? 190 ILE A O     1 
ATOM   493  C  CB    . ILE A 1 84  ? 34.649  20.138 50.101  1.00 27.10 ? 190 ILE A CB    1 
ATOM   494  C  CG1   . ILE A 1 84  ? 33.473  21.065 50.496  1.00 27.68 ? 190 ILE A CG1   1 
ATOM   495  C  CG2   . ILE A 1 84  ? 35.907  20.631 50.818  1.00 27.07 ? 190 ILE A CG2   1 
ATOM   496  C  CD1   . ILE A 1 84  ? 33.725  22.574 50.351  1.00 26.80 ? 190 ILE A CD1   1 
ATOM   497  N  N     . ARG A 1 85  ? 37.160  20.284 47.763  1.00 27.01 ? 191 ARG A N     1 
ATOM   498  C  CA    . ARG A 1 85  ? 38.470  19.761 47.322  1.00 26.99 ? 191 ARG A CA    1 
ATOM   499  C  C     . ARG A 1 85  ? 39.288  19.475 48.549  1.00 27.11 ? 191 ARG A C     1 
ATOM   500  O  O     . ARG A 1 85  ? 39.226  20.209 49.536  1.00 27.28 ? 191 ARG A O     1 
ATOM   501  C  CB    . ARG A 1 85  ? 39.246  20.735 46.416  1.00 26.33 ? 191 ARG A CB    1 
ATOM   502  C  CG    . ARG A 1 85  ? 38.687  20.826 45.003  0.01 26.95 ? 191 ARG A CG    1 
ATOM   503  C  CD    . ARG A 1 85  ? 39.472  21.742 44.077  0.01 27.13 ? 191 ARG A CD    1 
ATOM   504  N  NE    . ARG A 1 85  ? 38.938  21.732 42.715  0.01 27.32 ? 191 ARG A NE    1 
ATOM   505  C  CZ    . ARG A 1 85  ? 39.452  22.412 41.691  0.01 27.46 ? 191 ARG A CZ    1 
ATOM   506  N  NH1   . ARG A 1 85  ? 38.884  22.328 40.492  0.01 27.51 ? 191 ARG A NH1   1 
ATOM   507  N  NH2   . ARG A 1 85  ? 40.529  23.175 41.853  0.01 27.51 ? 191 ARG A NH2   1 
ATOM   508  N  N     . LEU A 1 86  ? 40.038  18.396 48.503  1.00 27.04 ? 192 LEU A N     1 
ATOM   509  C  CA    . LEU A 1 86  ? 41.118  18.236 49.452  1.00 27.21 ? 192 LEU A CA    1 
ATOM   510  C  C     . LEU A 1 86  ? 42.366  18.823 48.828  1.00 26.28 ? 192 LEU A C     1 
ATOM   511  O  O     . LEU A 1 86  ? 42.755  18.376 47.778  1.00 25.62 ? 192 LEU A O     1 
ATOM   512  C  CB    . LEU A 1 86  ? 41.327  16.747 49.775  1.00 27.62 ? 192 LEU A CB    1 
ATOM   513  C  CG    . LEU A 1 86  ? 42.730  16.341 50.193  1.00 27.94 ? 192 LEU A CG    1 
ATOM   514  C  CD1   . LEU A 1 86  ? 43.014  16.924 51.615  1.00 28.74 ? 192 LEU A CD1   1 
ATOM   515  C  CD2   . LEU A 1 86  ? 42.840  14.834 50.112  1.00 27.59 ? 192 LEU A CD2   1 
ATOM   516  N  N     . TYR A 1 87  ? 42.979  19.813 49.462  1.00 26.23 ? 193 TYR A N     1 
ATOM   517  C  CA    . TYR A 1 87  ? 44.268  20.338 49.007  1.00 26.74 ? 193 TYR A CA    1 
ATOM   518  C  C     . TYR A 1 87  ? 45.511  19.509 49.455  1.00 26.79 ? 193 TYR A C     1 
ATOM   519  O  O     . TYR A 1 87  ? 46.492  19.435 48.746  1.00 27.24 ? 193 TYR A O     1 
ATOM   520  C  CB    . TYR A 1 87  ? 44.463  21.761 49.509  1.00 27.02 ? 193 TYR A CB    1 
ATOM   521  C  CG    . TYR A 1 87  ? 43.522  22.812 48.973  1.00 28.38 ? 193 TYR A CG    1 
ATOM   522  C  CD1   . TYR A 1 87  ? 43.068  23.821 49.804  1.00 31.22 ? 193 TYR A CD1   1 
ATOM   523  C  CD2   . TYR A 1 87  ? 43.136  22.844 47.641  1.00 29.44 ? 193 TYR A CD2   1 
ATOM   524  C  CE1   . TYR A 1 87  ? 42.215  24.836 49.335  1.00 31.97 ? 193 TYR A CE1   1 
ATOM   525  C  CE2   . TYR A 1 87  ? 42.289  23.852 47.154  1.00 30.13 ? 193 TYR A CE2   1 
ATOM   526  C  CZ    . TYR A 1 87  ? 41.825  24.846 48.017  1.00 30.80 ? 193 TYR A CZ    1 
ATOM   527  O  OH    . TYR A 1 87  ? 40.990  25.850 47.598  1.00 26.82 ? 193 TYR A OH    1 
ATOM   528  N  N     . GLY A 1 88  ? 45.471  18.909 50.634  1.00 26.84 ? 194 GLY A N     1 
ATOM   529  C  CA    . GLY A 1 88  ? 46.638  18.284 51.219  1.00 26.38 ? 194 GLY A CA    1 
ATOM   530  C  C     . GLY A 1 88  ? 46.435  17.833 52.659  1.00 26.20 ? 194 GLY A C     1 
ATOM   531  O  O     . GLY A 1 88  ? 45.393  17.998 53.260  1.00 25.69 ? 194 GLY A O     1 
ATOM   532  N  N     . VAL A 1 89  ? 47.473  17.239 53.214  1.00 26.30 ? 195 VAL A N     1 
ATOM   533  C  CA    . VAL A 1 89  ? 47.375  16.536 54.473  1.00 26.29 ? 195 VAL A CA    1 
ATOM   534  C  C     . VAL A 1 89  ? 48.590  16.847 55.297  1.00 26.19 ? 195 VAL A C     1 
ATOM   535  O  O     . VAL A 1 89  ? 49.694  16.935 54.776  1.00 26.73 ? 195 VAL A O     1 
ATOM   536  C  CB    . VAL A 1 89  ? 47.309  15.052 54.195  1.00 26.52 ? 195 VAL A CB    1 
ATOM   537  C  CG1   . VAL A 1 89  ? 47.575  14.246 55.430  1.00 27.68 ? 195 VAL A CG1   1 
ATOM   538  C  CG2   . VAL A 1 89  ? 45.918  14.705 53.643  1.00 27.47 ? 195 VAL A CG2   1 
ATOM   539  N  N     . VAL A 1 90  ? 48.393  17.068 56.584  1.00 25.59 ? 196 VAL A N     1 
ATOM   540  C  CA    . VAL A 1 90  ? 49.508  17.182 57.496  1.00 25.15 ? 196 VAL A CA    1 
ATOM   541  C  C     . VAL A 1 90  ? 49.514  15.855 58.186  1.00 24.70 ? 196 VAL A C     1 
ATOM   542  O  O     . VAL A 1 90  ? 48.487  15.476 58.719  1.00 24.91 ? 196 VAL A O     1 
ATOM   543  C  CB    . VAL A 1 90  ? 49.287  18.283 58.519  1.00 25.12 ? 196 VAL A CB    1 
ATOM   544  C  CG1   . VAL A 1 90  ? 50.500  18.413 59.437  1.00 25.73 ? 196 VAL A CG1   1 
ATOM   545  C  CG2   . VAL A 1 90  ? 49.004  19.599 57.828  1.00 25.46 ? 196 VAL A CG2   1 
ATOM   546  N  N     . LEU A 1 91  ? 50.623  15.125 58.137  1.00 24.36 ? 197 LEU A N     1 
ATOM   547  C  CA    . LEU A 1 91  ? 50.713  13.850 58.836  1.00 24.54 ? 197 LEU A CA    1 
ATOM   548  C  C     . LEU A 1 91  ? 51.476  14.000 60.127  1.00 25.02 ? 197 LEU A C     1 
ATOM   549  O  O     . LEU A 1 91  ? 51.601  13.021 60.885  1.00 25.03 ? 197 LEU A O     1 
ATOM   550  C  CB    . LEU A 1 91  ? 51.369  12.765 57.980  1.00 24.50 ? 197 LEU A CB    1 
ATOM   551  C  CG    . LEU A 1 91  ? 50.703  12.511 56.629  1.00 24.36 ? 197 LEU A CG    1 
ATOM   552  C  CD1   . LEU A 1 91  ? 51.655  11.757 55.767  1.00 24.93 ? 197 LEU A CD1   1 
ATOM   553  C  CD2   . LEU A 1 91  ? 49.374  11.765 56.740  1.00 24.44 ? 197 LEU A CD2   1 
ATOM   554  N  N     . THR A 1 92  ? 52.004  15.208 60.372  1.00 25.46 ? 198 THR A N     1 
ATOM   555  C  CA    . THR A 1 92  ? 52.652  15.499 61.649  1.00 25.73 ? 198 THR A CA    1 
ATOM   556  C  C     . THR A 1 92  ? 51.548  15.574 62.727  1.00 26.52 ? 198 THR A C     1 
ATOM   557  O  O     . THR A 1 92  ? 50.476  16.180 62.518  1.00 25.85 ? 198 THR A O     1 
ATOM   558  C  CB    . THR A 1 92  ? 53.583  16.777 61.615  1.00 25.59 ? 198 THR A CB    1 
ATOM   559  O  OG1   . THR A 1 92  ? 52.992  17.864 60.883  1.00 24.43 ? 198 THR A OG1   1 
ATOM   560  C  CG2   . THR A 1 92  ? 54.881  16.482 60.863  1.00 25.58 ? 198 THR A CG2   1 
ATOM   561  N  N     . PRO A 1 93  ? 51.800  14.937 63.871  1.00 27.24 ? 199 PRO A N     1 
ATOM   562  C  CA    . PRO A 1 93  ? 50.752  14.732 64.875  1.00 27.55 ? 199 PRO A CA    1 
ATOM   563  C  C     . PRO A 1 93  ? 50.479  16.007 65.692  1.00 27.79 ? 199 PRO A C     1 
ATOM   564  O  O     . PRO A 1 93  ? 51.457  16.669 66.090  1.00 27.09 ? 199 PRO A O     1 
ATOM   565  C  CB    . PRO A 1 93  ? 51.336  13.620 65.751  1.00 27.37 ? 199 PRO A CB    1 
ATOM   566  C  CG    . PRO A 1 93  ? 52.838  13.892 65.720  1.00 27.61 ? 199 PRO A CG    1 
ATOM   567  C  CD    . PRO A 1 93  ? 53.101  14.392 64.315  1.00 27.33 ? 199 PRO A CD    1 
ATOM   568  N  N     . PRO A 1 94  ? 49.204  16.360 65.927  1.00 28.46 ? 200 PRO A N     1 
ATOM   569  C  CA    . PRO A 1 94  ? 48.008  15.699 65.340  1.00 28.91 ? 200 PRO A CA    1 
ATOM   570  C  C     . PRO A 1 94  ? 47.773  15.916 63.836  1.00 28.94 ? 200 PRO A C     1 
ATOM   571  O  O     . PRO A 1 94  ? 47.817  17.062 63.388  1.00 29.38 ? 200 PRO A O     1 
ATOM   572  C  CB    . PRO A 1 94  ? 46.837  16.356 66.096  1.00 29.29 ? 200 PRO A CB    1 
ATOM   573  C  CG    . PRO A 1 94  ? 47.383  17.693 66.594  1.00 29.18 ? 200 PRO A CG    1 
ATOM   574  C  CD    . PRO A 1 94  ? 48.833  17.435 66.866  1.00 28.50 ? 200 PRO A CD    1 
ATOM   575  N  N     . MET A 1 95  ? 47.462  14.846 63.097  1.00 28.77 ? 201 MET A N     1 
ATOM   576  C  CA    . MET A 1 95  ? 47.275  14.907 61.635  1.00 28.34 ? 201 MET A CA    1 
ATOM   577  C  C     . MET A 1 95  ? 46.170  15.882 61.249  1.00 28.11 ? 201 MET A C     1 
ATOM   578  O  O     . MET A 1 95  ? 45.248  16.101 62.019  1.00 28.22 ? 201 MET A O     1 
ATOM   579  C  CB    . MET A 1 95  ? 46.960  13.515 61.057  1.00 28.27 ? 201 MET A CB    1 
ATOM   580  C  CG    . MET A 1 95  ? 47.914  12.428 61.535  1.00 28.20 ? 201 MET A CG    1 
ATOM   581  S  SD    . MET A 1 95  ? 48.241  11.063 60.379  1.00 28.75 ? 201 MET A SD    1 
ATOM   582  C  CE    . MET A 1 95  ? 49.328  10.155 61.366  1.00 28.77 ? 201 MET A CE    1 
ATOM   583  N  N     . LYS A 1 96  ? 46.263  16.480 60.068  1.00 27.90 ? 202 LYS A N     1 
ATOM   584  C  CA    . LYS A 1 96  ? 45.243  17.421 59.628  1.00 27.87 ? 202 LYS A CA    1 
ATOM   585  C  C     . LYS A 1 96  ? 44.909  17.238 58.153  1.00 28.06 ? 202 LYS A C     1 
ATOM   586  O  O     . LYS A 1 96  ? 45.757  16.892 57.354  1.00 28.08 ? 202 LYS A O     1 
ATOM   587  C  CB    . LYS A 1 96  ? 45.650  18.872 59.933  1.00 27.70 ? 202 LYS A CB    1 
ATOM   588  C  CG    . LYS A 1 96  ? 46.372  19.087 61.257  0.01 27.74 ? 202 LYS A CG    1 
ATOM   589  C  CD    . LYS A 1 96  ? 46.610  20.565 61.518  0.01 27.71 ? 202 LYS A CD    1 
ATOM   590  C  CE    . LYS A 1 96  ? 47.353  20.790 62.825  0.01 27.71 ? 202 LYS A CE    1 
ATOM   591  N  NZ    . LYS A 1 96  ? 48.773  20.349 62.746  0.01 27.71 ? 202 LYS A NZ    1 
ATOM   592  N  N     . MET A 1 97  ? 43.629  17.443 57.838  1.00 28.98 ? 203 MET A N     1 
ATOM   593  C  CA    . MET A 1 97  ? 43.062  17.451 56.479  1.00 28.82 ? 203 MET A CA    1 
ATOM   594  C  C     . MET A 1 97  ? 42.779  18.911 56.016  1.00 28.12 ? 203 MET A C     1 
ATOM   595  O  O     . MET A 1 97  ? 42.009  19.651 56.613  1.00 27.85 ? 203 MET A O     1 
ATOM   596  C  CB    . MET A 1 97  ? 41.768  16.645 56.484  1.00 29.31 ? 203 MET A CB    1 
ATOM   597  C  CG    . MET A 1 97  ? 41.511  15.780 55.241  1.00 31.01 ? 203 MET A CG    1 
ATOM   598  S  SD    . MET A 1 97  ? 39.782  15.206 55.216  1.00 32.52 ? 203 MET A SD    1 
ATOM   599  C  CE    . MET A 1 97  ? 39.773  14.221 56.689  1.00 32.51 ? 203 MET A CE    1 
ATOM   600  N  N     . VAL A 1 98  ? 43.427  19.332 54.956  1.00 27.36 ? 204 VAL A N     1 
ATOM   601  C  CA    . VAL A 1 98  ? 43.306  20.692 54.526  1.00 27.15 ? 204 VAL A CA    1 
ATOM   602  C  C     . VAL A 1 98  ? 42.413  20.777 53.315  1.00 27.38 ? 204 VAL A C     1 
ATOM   603  O  O     . VAL A 1 98  ? 42.798  20.455 52.202  1.00 27.77 ? 204 VAL A O     1 
ATOM   604  C  CB    . VAL A 1 98  ? 44.658  21.245 54.193  1.00 27.25 ? 204 VAL A CB    1 
ATOM   605  C  CG1   . VAL A 1 98  ? 44.546  22.716 53.824  1.00 26.62 ? 204 VAL A CG1   1 
ATOM   606  C  CG2   . VAL A 1 98  ? 45.577  21.044 55.388  1.00 27.34 ? 204 VAL A CG2   1 
ATOM   607  N  N     . THR A 1 99  ? 41.196  21.218 53.536  1.00 27.22 ? 205 THR A N     1 
ATOM   608  C  CA    . THR A 1 99  ? 40.264  21.297 52.459  1.00 26.95 ? 205 THR A CA    1 
ATOM   609  C  C     . THR A 1 99  ? 40.042  22.708 52.085  1.00 26.93 ? 205 THR A C     1 
ATOM   610  O  O     . THR A 1 99  ? 40.406  23.621 52.814  1.00 26.31 ? 205 THR A O     1 
ATOM   611  C  CB    . THR A 1 99  ? 38.946  20.710 52.883  1.00 26.87 ? 205 THR A CB    1 
ATOM   612  O  OG1   . THR A 1 99  ? 38.503  21.377 54.072  1.00 27.40 ? 205 THR A OG1   1 
ATOM   613  C  CG2   . THR A 1 99  ? 39.126  19.247 53.268  1.00 26.39 ? 205 THR A CG2   1 
ATOM   614  N  N     . GLU A 1 100 ? 39.416  22.830 50.918  1.00 27.57 ? 206 GLU A N     1 
ATOM   615  C  CA    . GLU A 1 100 ? 38.841  24.063 50.355  1.00 27.37 ? 206 GLU A CA    1 
ATOM   616  C  C     . GLU A 1 100 ? 37.792  24.580 51.268  1.00 26.94 ? 206 GLU A C     1 
ATOM   617  O  O     . GLU A 1 100 ? 37.005  23.775 51.789  1.00 27.24 ? 206 GLU A O     1 
ATOM   618  C  CB    . GLU A 1 100 ? 38.199  23.700 49.025  1.00 27.33 ? 206 GLU A CB    1 
ATOM   619  C  CG    . GLU A 1 100 ? 37.298  24.709 48.374  1.00 27.17 ? 206 GLU A CG    1 
ATOM   620  C  CD    . GLU A 1 100 ? 36.458  24.026 47.327  1.00 28.38 ? 206 GLU A CD    1 
ATOM   621  O  OE1   . GLU A 1 100 ? 37.014  23.251 46.537  1.00 28.23 ? 206 GLU A OE1   1 
ATOM   622  O  OE2   . GLU A 1 100 ? 35.238  24.213 47.314  1.00 29.69 ? 206 GLU A OE2   1 
ATOM   623  N  N     . LEU A 1 101 ? 37.760  25.900 51.452  1.00 26.49 ? 207 LEU A N     1 
ATOM   624  C  CA    . LEU A 1 101 ? 36.860  26.517 52.437  1.00 26.69 ? 207 LEU A CA    1 
ATOM   625  C  C     . LEU A 1 101 ? 35.566  27.002 51.776  1.00 26.65 ? 207 LEU A C     1 
ATOM   626  O  O     . LEU A 1 101 ? 35.578  27.581 50.686  1.00 27.32 ? 207 LEU A O     1 
ATOM   627  C  CB    . LEU A 1 101 ? 37.564  27.673 53.183  1.00 26.50 ? 207 LEU A CB    1 
ATOM   628  C  CG    . LEU A 1 101 ? 36.698  28.608 54.059  1.00 26.88 ? 207 LEU A CG    1 
ATOM   629  C  CD1   . LEU A 1 101 ? 36.427  28.079 55.479  1.00 27.17 ? 207 LEU A CD1   1 
ATOM   630  C  CD2   . LEU A 1 101 ? 37.311  29.966 54.152  1.00 26.76 ? 207 LEU A CD2   1 
ATOM   631  N  N     . ALA A 1 102 ? 34.452  26.774 52.444  1.00 26.32 ? 208 ALA A N     1 
ATOM   632  C  CA    . ALA A 1 102 ? 33.191  27.302 51.991  1.00 26.54 ? 208 ALA A CA    1 
ATOM   633  C  C     . ALA A 1 102 ? 32.815  28.310 53.047  1.00 26.61 ? 208 ALA A C     1 
ATOM   634  O  O     . ALA A 1 102 ? 32.279  27.938 54.087  1.00 27.14 ? 208 ALA A O     1 
ATOM   635  C  CB    . ALA A 1 102 ? 32.174  26.216 51.918  1.00 26.96 ? 208 ALA A CB    1 
ATOM   636  N  N     . PRO A 1 103 ? 33.120  29.579 52.801  1.00 26.39 ? 209 PRO A N     1 
ATOM   637  C  CA    . PRO A 1 103 ? 33.053  30.613 53.835  1.00 25.92 ? 209 PRO A CA    1 
ATOM   638  C  C     . PRO A 1 103 ? 31.695  30.917 54.389  1.00 26.07 ? 209 PRO A C     1 
ATOM   639  O  O     . PRO A 1 103 ? 31.640  31.437 55.497  1.00 26.42 ? 209 PRO A O     1 
ATOM   640  C  CB    . PRO A 1 103 ? 33.599  31.838 53.139  1.00 26.20 ? 209 PRO A CB    1 
ATOM   641  C  CG    . PRO A 1 103 ? 33.504  31.549 51.676  1.00 26.65 ? 209 PRO A CG    1 
ATOM   642  C  CD    . PRO A 1 103 ? 33.608  30.100 51.513  1.00 26.50 ? 209 PRO A CD    1 
ATOM   643  N  N     . LEU A 1 104 ? 30.617  30.604 53.681  1.00 26.34 ? 210 LEU A N     1 
ATOM   644  C  CA    . LEU A 1 104 ? 29.272  30.786 54.260  1.00 26.37 ? 210 LEU A CA    1 
ATOM   645  C  C     . LEU A 1 104 ? 28.786  29.648 55.168  1.00 26.29 ? 210 LEU A C     1 
ATOM   646  O  O     . LEU A 1 104 ? 27.716  29.737 55.737  1.00 26.09 ? 210 LEU A O     1 
ATOM   647  C  CB    . LEU A 1 104 ? 28.233  31.014 53.171  1.00 26.22 ? 210 LEU A CB    1 
ATOM   648  C  CG    . LEU A 1 104 ? 28.543  32.138 52.219  1.00 25.94 ? 210 LEU A CG    1 
ATOM   649  C  CD1   . LEU A 1 104 ? 27.547  32.070 51.122  1.00 26.40 ? 210 LEU A CD1   1 
ATOM   650  C  CD2   . LEU A 1 104 ? 28.503  33.462 52.933  1.00 25.64 ? 210 LEU A CD2   1 
ATOM   651  N  N     . GLY A 1 105 ? 29.538  28.565 55.273  1.00 26.76 ? 211 GLY A N     1 
ATOM   652  C  CA    . GLY A 1 105 ? 29.217  27.495 56.222  1.00 27.15 ? 211 GLY A CA    1 
ATOM   653  C  C     . GLY A 1 105 ? 28.120  26.484 55.895  1.00 26.54 ? 211 GLY A C     1 
ATOM   654  O  O     . GLY A 1 105 ? 27.974  26.051 54.785  1.00 24.89 ? 211 GLY A O     1 
ATOM   655  N  N     . SER A 1 106 ? 27.353  26.103 56.899  1.00 27.51 ? 212 SER A N     1 
ATOM   656  C  CA    . SER A 1 106 ? 26.391  25.007 56.740  1.00 29.14 ? 212 SER A CA    1 
ATOM   657  C  C     . SER A 1 106 ? 25.066  25.471 56.094  1.00 29.30 ? 212 SER A C     1 
ATOM   658  O  O     . SER A 1 106 ? 24.331  26.274 56.678  1.00 29.51 ? 212 SER A O     1 
ATOM   659  C  CB    . SER A 1 106 ? 26.109  24.345 58.118  1.00 29.38 ? 212 SER A CB    1 
ATOM   660  O  OG    . SER A 1 106 ? 25.306  23.159 57.999  1.00 32.24 ? 212 SER A OG    1 
ATOM   661  N  N     . LEU A 1 107 ? 24.752  24.979 54.899  1.00 29.24 ? 213 LEU A N     1 
ATOM   662  C  CA    . LEU A 1 107 ? 23.445  25.276 54.339  1.00 29.14 ? 213 LEU A CA    1 
ATOM   663  C  C     . LEU A 1 107 ? 22.396  24.963 55.372  1.00 28.83 ? 213 LEU A C     1 
ATOM   664  O  O     . LEU A 1 107 ? 21.548  25.807 55.594  1.00 29.77 ? 213 LEU A O     1 
ATOM   665  C  CB    . LEU A 1 107 ? 23.084  24.492 53.050  1.00 29.51 ? 213 LEU A CB    1 
ATOM   666  C  CG    . LEU A 1 107 ? 21.783  25.000 52.326  1.00 28.95 ? 213 LEU A CG    1 
ATOM   667  C  CD1   . LEU A 1 107 ? 21.830  26.448 51.778  1.00 26.78 ? 213 LEU A CD1   1 
ATOM   668  C  CD2   . LEU A 1 107 ? 21.434  24.070 51.206  1.00 29.36 ? 213 LEU A CD2   1 
ATOM   669  N  N     . LEU A 1 108 ? 22.423  23.783 55.984  1.00 27.76 ? 214 LEU A N     1 
ATOM   670  C  CA    . LEU A 1 108 ? 21.378  23.465 56.945  1.00 27.60 ? 214 LEU A CA    1 
ATOM   671  C  C     . LEU A 1 108 ? 21.234  24.523 58.062  1.00 27.85 ? 214 LEU A C     1 
ATOM   672  O  O     . LEU A 1 108 ? 20.134  24.950 58.366  1.00 28.45 ? 214 LEU A O     1 
ATOM   673  C  CB    . LEU A 1 108 ? 21.551  22.082 57.562  1.00 27.29 ? 214 LEU A CB    1 
ATOM   674  C  CG    . LEU A 1 108 ? 20.410  21.692 58.519  1.00 26.27 ? 214 LEU A CG    1 
ATOM   675  C  CD1   . LEU A 1 108 ? 19.141  21.292 57.757  1.00 25.09 ? 214 LEU A CD1   1 
ATOM   676  C  CD2   . LEU A 1 108 ? 20.860  20.609 59.459  1.00 24.94 ? 214 LEU A CD2   1 
ATOM   677  N  N     . ASP A 1 109 ? 22.320  24.958 58.671  1.00 27.99 ? 215 ASP A N     1 
ATOM   678  C  CA    . ASP A 1 109 ? 22.251  26.122 59.550  1.00 27.72 ? 215 ASP A CA    1 
ATOM   679  C  C     . ASP A 1 109 ? 21.640  27.328 58.877  1.00 27.09 ? 215 ASP A C     1 
ATOM   680  O  O     . ASP A 1 109 ? 20.957  28.047 59.528  1.00 28.43 ? 215 ASP A O     1 
ATOM   681  C  CB    . ASP A 1 109 ? 23.634  26.525 60.050  1.00 28.04 ? 215 ASP A CB    1 
ATOM   682  C  CG    . ASP A 1 109 ? 24.272  25.469 60.958  1.00 29.50 ? 215 ASP A CG    1 
ATOM   683  O  OD1   . ASP A 1 109 ? 23.477  24.586 61.437  1.00 31.45 ? 215 ASP A OD1   1 
ATOM   684  O  OD2   . ASP A 1 109 ? 25.519  25.491 61.267  1.00 25.28 ? 215 ASP A OD2   1 
ATOM   685  N  N     . ARG A 1 110 ? 21.883  27.595 57.608  1.00 26.89 ? 216 ARG A N     1 
ATOM   686  C  CA    . ARG A 1 110 ? 21.285  28.778 57.001  1.00 27.55 ? 216 ARG A CA    1 
ATOM   687  C  C     . ARG A 1 110 ? 19.827  28.587 56.712  1.00 27.33 ? 216 ARG A C     1 
ATOM   688  O  O     . ARG A 1 110 ? 19.057  29.536 56.846  1.00 27.60 ? 216 ARG A O     1 
ATOM   689  C  CB    . ARG A 1 110 ? 21.936  29.183 55.694  1.00 28.15 ? 216 ARG A CB    1 
ATOM   690  C  CG    . ARG A 1 110 ? 23.425  29.440 55.764  1.00 29.99 ? 216 ARG A CG    1 
ATOM   691  C  CD    . ARG A 1 110 ? 23.920  30.388 54.678  1.00 31.26 ? 216 ARG A CD    1 
ATOM   692  N  NE    . ARG A 1 110 ? 23.888  31.761 55.161  1.00 33.43 ? 216 ARG A NE    1 
ATOM   693  C  CZ    . ARG A 1 110 ? 24.850  32.327 55.889  1.00 33.44 ? 216 ARG A CZ    1 
ATOM   694  N  NH1   . ARG A 1 110 ? 25.952  31.639 56.192  1.00 30.45 ? 216 ARG A NH1   1 
ATOM   695  N  NH2   . ARG A 1 110 ? 24.723  33.606 56.294  1.00 35.24 ? 216 ARG A NH2   1 
ATOM   696  N  N     . LEU A 1 111 ? 19.442  27.394 56.279  1.00 26.94 ? 217 LEU A N     1 
ATOM   697  C  CA    . LEU A 1 111 ? 18.031  27.077 56.054  1.00 27.28 ? 217 LEU A CA    1 
ATOM   698  C  C     . LEU A 1 111 ? 17.188  27.272 57.316  1.00 27.74 ? 217 LEU A C     1 
ATOM   699  O  O     . LEU A 1 111 ? 16.100  27.813 57.249  1.00 29.26 ? 217 LEU A O     1 
ATOM   700  C  CB    . LEU A 1 111 ? 17.857  25.649 55.542  1.00 27.44 ? 217 LEU A CB    1 
ATOM   701  C  CG    . LEU A 1 111 ? 18.388  25.391 54.122  1.00 27.46 ? 217 LEU A CG    1 
ATOM   702  C  CD1   . LEU A 1 111 ? 18.423  23.923 53.932  1.00 28.18 ? 217 LEU A CD1   1 
ATOM   703  C  CD2   . LEU A 1 111 ? 17.598  26.080 52.989  1.00 27.11 ? 217 LEU A CD2   1 
ATOM   704  N  N     . ARG A 1 112 ? 17.707  26.898 58.471  1.00 27.99 ? 218 ARG A N     1 
ATOM   705  C  CA    . ARG A 1 112 ? 16.996  27.084 59.715  1.00 27.88 ? 218 ARG A CA    1 
ATOM   706  C  C     . ARG A 1 112 ? 16.911  28.492 60.236  1.00 28.73 ? 218 ARG A C     1 
ATOM   707  O  O     . ARG A 1 112 ? 16.000  28.769 60.992  1.00 29.81 ? 218 ARG A O     1 
ATOM   708  C  CB    . ARG A 1 112 ? 17.626  26.246 60.791  1.00 27.94 ? 218 ARG A CB    1 
ATOM   709  C  CG    . ARG A 1 112 ? 17.331  24.813 60.617  1.00 27.23 ? 218 ARG A CG    1 
ATOM   710  C  CD    . ARG A 1 112 ? 17.992  23.955 61.573  1.00 25.45 ? 218 ARG A CD    1 
ATOM   711  N  NE    . ARG A 1 112 ? 17.758  22.604 61.118  1.00 29.97 ? 218 ARG A NE    1 
ATOM   712  C  CZ    . ARG A 1 112 ? 18.409  21.533 61.547  1.00 31.96 ? 218 ARG A CZ    1 
ATOM   713  N  NH1   . ARG A 1 112 ? 19.376  21.639 62.450  1.00 34.82 ? 218 ARG A NH1   1 
ATOM   714  N  NH2   . ARG A 1 112 ? 18.117  20.349 61.053  1.00 30.03 ? 218 ARG A NH2   1 
ATOM   715  N  N     . LYS A 1 113 ? 17.836  29.387 59.905  1.00 29.04 ? 219 LYS A N     1 
ATOM   716  C  CA    . LYS A 1 113 ? 17.766  30.758 60.459  1.00 29.56 ? 219 LYS A CA    1 
ATOM   717  C  C     . LYS A 1 113 ? 16.983  31.731 59.569  1.00 30.30 ? 219 LYS A C     1 
ATOM   718  O  O     . LYS A 1 113 ? 16.376  32.669 60.061  1.00 30.74 ? 219 LYS A O     1 
ATOM   719  C  CB    . LYS A 1 113 ? 19.179  31.319 60.748  1.00 29.20 ? 219 LYS A CB    1 
ATOM   720  C  CG    . LYS A 1 113 ? 19.886  30.572 61.850  0.01 29.64 ? 219 LYS A CG    1 
ATOM   721  C  CD    . LYS A 1 113 ? 21.383  30.621 61.687  0.01 30.12 ? 219 LYS A CD    1 
ATOM   722  C  CE    . LYS A 1 113 ? 22.051  29.671 62.652  1.00 31.09 ? 219 LYS A CE    1 
ATOM   723  N  NZ    . LYS A 1 113 ? 23.054  30.397 63.474  1.00 31.27 ? 219 LYS A NZ    1 
ATOM   724  N  N     . HIS A 1 114 ? 17.020  31.501 58.259  1.00 31.42 ? 220 HIS A N     1 
ATOM   725  C  CA    . HIS A 1 114 ? 16.470  32.392 57.248  1.00 31.69 ? 220 HIS A CA    1 
ATOM   726  C  C     . HIS A 1 114 ? 15.494  31.553 56.462  1.00 32.99 ? 220 HIS A C     1 
ATOM   727  O  O     . HIS A 1 114 ? 15.691  31.343 55.271  1.00 34.56 ? 220 HIS A O     1 
ATOM   728  C  CB    . HIS A 1 114 ? 17.617  32.882 56.371  1.00 31.02 ? 220 HIS A CB    1 
ATOM   729  C  CG    . HIS A 1 114 ? 18.798  33.337 57.170  1.00 31.67 ? 220 HIS A CG    1 
ATOM   730  N  ND1   . HIS A 1 114 ? 20.033  32.752 57.086  1.00 32.26 ? 220 HIS A ND1   1 
ATOM   731  C  CD2   . HIS A 1 114 ? 18.918  34.323 58.094  1.00 33.74 ? 220 HIS A CD2   1 
ATOM   732  C  CE1   . HIS A 1 114 ? 20.867  33.358 57.914  1.00 32.33 ? 220 HIS A CE1   1 
ATOM   733  N  NE2   . HIS A 1 114 ? 20.215  34.317 58.538  1.00 32.37 ? 220 HIS A NE2   1 
ATOM   734  N  N     . GLN A 1 115 ? 14.479  31.005 57.137  1.00 33.77 ? 221 GLN A N     1 
ATOM   735  C  CA    . GLN A 1 115 ? 13.448  30.180 56.455  1.00 34.13 ? 221 GLN A CA    1 
ATOM   736  C  C     . GLN A 1 115 ? 13.214  30.636 54.988  1.00 33.93 ? 221 GLN A C     1 
ATOM   737  O  O     . GLN A 1 115 ? 13.766  30.049 54.037  1.00 33.34 ? 221 GLN A O     1 
ATOM   738  C  CB    . GLN A 1 115 ? 12.074  30.207 57.188  1.00 34.14 ? 221 GLN A CB    1 
ATOM   739  C  CG    . GLN A 1 115 ? 12.085  29.932 58.681  1.00 35.29 ? 221 GLN A CG    1 
ATOM   740  C  CD    . GLN A 1 115 ? 12.833  28.695 59.005  1.00 37.34 ? 221 GLN A CD    1 
ATOM   741  O  OE1   . GLN A 1 115 ? 13.552  28.614 60.003  1.00 38.16 ? 221 GLN A OE1   1 
ATOM   742  N  NE2   . GLN A 1 115 ? 12.653  27.697 58.173  1.00 41.85 ? 221 GLN A NE2   1 
ATOM   743  N  N     . GLY A 1 116 ? 12.424  31.707 54.836  1.00 33.47 ? 222 GLY A N     1 
ATOM   744  C  CA    . GLY A 1 116 ? 11.878  32.089 53.560  1.00 33.08 ? 222 GLY A CA    1 
ATOM   745  C  C     . GLY A 1 116 ? 12.892  32.797 52.717  1.00 32.96 ? 222 GLY A C     1 
ATOM   746  O  O     . GLY A 1 116 ? 12.649  32.984 51.521  1.00 33.42 ? 222 GLY A O     1 
ATOM   747  N  N     . HIS A 1 117 ? 14.023  33.188 53.321  1.00 32.53 ? 223 HIS A N     1 
ATOM   748  C  CA    . HIS A 1 117 ? 15.071  33.946 52.612  1.00 32.09 ? 223 HIS A CA    1 
ATOM   749  C  C     . HIS A 1 117 ? 15.458  33.269 51.344  1.00 32.11 ? 223 HIS A C     1 
ATOM   750  O  O     . HIS A 1 117 ? 16.031  33.906 50.446  1.00 31.90 ? 223 HIS A O     1 
ATOM   751  C  CB    . HIS A 1 117 ? 16.352  34.030 53.425  1.00 32.18 ? 223 HIS A CB    1 
ATOM   752  C  CG    . HIS A 1 117 ? 17.551  34.425 52.613  0.01 31.44 ? 223 HIS A CG    1 
ATOM   753  N  ND1   . HIS A 1 117 ? 18.441  33.501 52.107  0.01 30.91 ? 223 HIS A ND1   1 
ATOM   754  C  CD2   . HIS A 1 117 ? 17.986  35.636 52.187  0.01 30.89 ? 223 HIS A CD2   1 
ATOM   755  C  CE1   . HIS A 1 117 ? 19.384  34.128 51.424  0.01 30.63 ? 223 HIS A CE1   1 
ATOM   756  N  NE2   . HIS A 1 117 ? 19.135  35.424 51.465  0.01 30.66 ? 223 HIS A NE2   1 
ATOM   757  N  N     . PHE A 1 118 ? 15.257  31.946 51.346  1.00 32.14 ? 224 PHE A N     1 
ATOM   758  C  CA    . PHE A 1 118 ? 15.449  31.118 50.175  1.00 32.10 ? 224 PHE A CA    1 
ATOM   759  C  C     . PHE A 1 118 ? 14.168  31.009 49.376  1.00 31.80 ? 224 PHE A C     1 
ATOM   760  O  O     . PHE A 1 118 ? 13.354  30.045 49.561  1.00 30.66 ? 224 PHE A O     1 
ATOM   761  C  CB    . PHE A 1 118 ? 15.931  29.736 50.570  1.00 32.42 ? 224 PHE A CB    1 
ATOM   762  C  CG    . PHE A 1 118 ? 17.298  29.737 51.150  1.00 34.20 ? 224 PHE A CG    1 
ATOM   763  C  CD1   . PHE A 1 118 ? 18.401  29.566 50.337  1.00 33.08 ? 224 PHE A CD1   1 
ATOM   764  C  CD2   . PHE A 1 118 ? 17.485  29.950 52.529  1.00 36.11 ? 224 PHE A CD2   1 
ATOM   765  C  CE1   . PHE A 1 118 ? 19.676  29.582 50.888  1.00 34.98 ? 224 PHE A CE1   1 
ATOM   766  C  CE2   . PHE A 1 118 ? 18.769  29.965 53.079  1.00 36.13 ? 224 PHE A CE2   1 
ATOM   767  C  CZ    . PHE A 1 118 ? 19.865  29.784 52.254  1.00 35.13 ? 224 PHE A CZ    1 
ATOM   768  N  N     . LEU A 1 119 ? 13.999  31.997 48.476  1.00 31.30 ? 225 LEU A N     1 
ATOM   769  C  CA    . LEU A 1 119 ? 12.995  31.870 47.428  1.00 31.16 ? 225 LEU A CA    1 
ATOM   770  C  C     . LEU A 1 119 ? 13.320  30.531 46.707  1.00 31.22 ? 225 LEU A C     1 
ATOM   771  O  O     . LEU A 1 119 ? 14.501  30.158 46.593  1.00 31.37 ? 225 LEU A O     1 
ATOM   772  C  CB    . LEU A 1 119 ? 12.995  33.069 46.485  1.00 30.60 ? 225 LEU A CB    1 
ATOM   773  C  CG    . LEU A 1 119 ? 12.210  32.722 45.218  1.00 30.36 ? 225 LEU A CG    1 
ATOM   774  C  CD1   . LEU A 1 119 ? 10.695  32.856 45.482  1.00 29.75 ? 225 LEU A CD1   1 
ATOM   775  C  CD2   . LEU A 1 119 ? 12.688  33.462 43.971  1.00 28.61 ? 225 LEU A CD2   1 
ATOM   776  N  N     . LEU A 1 120 ? 12.283  29.811 46.262  1.00 31.01 ? 226 LEU A N     1 
ATOM   777  C  CA    . LEU A 1 120 ? 12.441  28.426 45.766  1.00 31.12 ? 226 LEU A CA    1 
ATOM   778  C  C     . LEU A 1 120 ? 13.251  28.317 44.488  1.00 31.01 ? 226 LEU A C     1 
ATOM   779  O  O     . LEU A 1 120 ? 13.639  27.229 44.119  1.00 31.31 ? 226 LEU A O     1 
ATOM   780  C  CB    . LEU A 1 120 ? 11.072  27.753 45.541  1.00 31.45 ? 226 LEU A CB    1 
ATOM   781  C  CG    . LEU A 1 120 ? 9.981   27.906 46.637  1.00 30.98 ? 226 LEU A CG    1 
ATOM   782  C  CD1   . LEU A 1 120 ? 8.596   27.648 46.076  1.00 28.93 ? 226 LEU A CD1   1 
ATOM   783  C  CD2   . LEU A 1 120 ? 10.282  26.986 47.879  1.00 30.79 ? 226 LEU A CD2   1 
ATOM   784  N  N     . GLY A 1 121 ? 13.475  29.431 43.794  1.00 31.13 ? 227 GLY A N     1 
ATOM   785  C  CA    . GLY A 1 121 ? 14.498  29.495 42.760  1.00 31.47 ? 227 GLY A CA    1 
ATOM   786  C  C     . GLY A 1 121 ? 15.859  29.014 43.270  1.00 31.84 ? 227 GLY A C     1 
ATOM   787  O  O     . GLY A 1 121 ? 16.482  28.086 42.701  1.00 31.87 ? 227 GLY A O     1 
ATOM   788  N  N     . THR A 1 122 ? 16.296  29.632 44.374  1.00 31.78 ? 228 THR A N     1 
ATOM   789  C  CA    . THR A 1 122 ? 17.604  29.388 44.962  1.00 30.93 ? 228 THR A CA    1 
ATOM   790  C  C     . THR A 1 122 ? 17.797  27.969 45.399  1.00 31.30 ? 228 THR A C     1 
ATOM   791  O  O     . THR A 1 122 ? 18.881  27.412 45.166  1.00 32.58 ? 228 THR A O     1 
ATOM   792  C  CB    . THR A 1 122 ? 17.845  30.284 46.169  1.00 31.29 ? 228 THR A CB    1 
ATOM   793  O  OG1   . THR A 1 122 ? 17.792  31.707 45.820  1.00 30.44 ? 228 THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 122 ? 19.254  30.036 46.685  1.00 30.61 ? 228 THR A CG2   1 
ATOM   795  N  N     . LEU A 1 123 ? 16.780  27.381 46.056  1.00 30.69 ? 229 LEU A N     1 
ATOM   796  C  CA    . LEU A 1 123 ? 16.871  26.006 46.575  1.00 28.99 ? 229 LEU A CA    1 
ATOM   797  C  C     . LEU A 1 123 ? 16.934  25.045 45.448  1.00 28.82 ? 229 LEU A C     1 
ATOM   798  O  O     . LEU A 1 123 ? 17.515  23.971 45.564  1.00 28.93 ? 229 LEU A O     1 
ATOM   799  C  CB    . LEU A 1 123 ? 15.666  25.605 47.402  1.00 28.59 ? 229 LEU A CB    1 
ATOM   800  C  CG    . LEU A 1 123 ? 15.285  26.445 48.613  1.00 28.65 ? 229 LEU A CG    1 
ATOM   801  C  CD1   . LEU A 1 123 ? 14.100  25.799 49.320  1.00 28.62 ? 229 LEU A CD1   1 
ATOM   802  C  CD2   . LEU A 1 123 ? 16.416  26.626 49.553  1.00 28.82 ? 229 LEU A CD2   1 
ATOM   803  N  N     . SER A 1 124 ? 16.335  25.384 44.327  1.00 28.81 ? 230 SER A N     1 
ATOM   804  C  CA    . SER A 1 124 ? 16.435  24.447 43.212  1.00 29.18 ? 230 SER A CA    1 
ATOM   805  C  C     . SER A 1 124 ? 17.796  24.486 42.530  1.00 28.68 ? 230 SER A C     1 
ATOM   806  O  O     . SER A 1 124 ? 18.336  23.454 42.191  1.00 27.71 ? 230 SER A O     1 
ATOM   807  C  CB    . SER A 1 124 ? 15.286  24.663 42.274  1.00 29.53 ? 230 SER A CB    1 
ATOM   808  O  OG    . SER A 1 124 ? 14.105  24.433 43.029  1.00 31.33 ? 230 SER A OG    1 
ATOM   809  N  N     . ARG A 1 125 ? 18.369  25.683 42.413  1.00 28.91 ? 231 ARG A N     1 
ATOM   810  C  CA    . ARG A 1 125 ? 19.753  25.855 41.965  1.00 29.11 ? 231 ARG A CA    1 
ATOM   811  C  C     . ARG A 1 125 ? 20.730  25.024 42.805  1.00 29.15 ? 231 ARG A C     1 
ATOM   812  O  O     . ARG A 1 125 ? 21.736  24.539 42.299  1.00 29.69 ? 231 ARG A O     1 
ATOM   813  C  CB    . ARG A 1 125 ? 20.163  27.335 42.007  1.00 29.33 ? 231 ARG A CB    1 
ATOM   814  C  CG    . ARG A 1 125 ? 19.476  28.231 40.989  0.01 28.91 ? 231 ARG A CG    1 
ATOM   815  C  CD    . ARG A 1 125 ? 19.662  29.716 41.275  0.01 28.66 ? 231 ARG A CD    1 
ATOM   816  N  NE    . ARG A 1 125 ? 18.776  30.562 40.478  0.01 28.46 ? 231 ARG A NE    1 
ATOM   817  C  CZ    . ARG A 1 125 ? 18.711  31.890 40.573  0.01 28.33 ? 231 ARG A CZ    1 
ATOM   818  N  NH1   . ARG A 1 125 ? 17.869  32.568 39.801  0.01 28.27 ? 231 ARG A NH1   1 
ATOM   819  N  NH2   . ARG A 1 125 ? 19.482  32.548 41.435  0.01 28.29 ? 231 ARG A NH2   1 
ATOM   820  N  N     . TYR A 1 126 ? 20.422  24.840 44.080  1.00 28.82 ? 232 TYR A N     1 
ATOM   821  C  CA    . TYR A 1 126 ? 21.175  23.919 44.911  1.00 28.54 ? 232 TYR A CA    1 
ATOM   822  C  C     . TYR A 1 126 ? 20.841  22.460 44.547  1.00 28.56 ? 232 TYR A C     1 
ATOM   823  O  O     . TYR A 1 126 ? 21.753  21.621 44.418  1.00 28.63 ? 232 TYR A O     1 
ATOM   824  C  CB    . TYR A 1 126 ? 20.874  24.150 46.409  1.00 28.83 ? 232 TYR A CB    1 
ATOM   825  C  CG    . TYR A 1 126 ? 21.092  25.566 46.937  1.00 28.46 ? 232 TYR A CG    1 
ATOM   826  C  CD1   . TYR A 1 126 ? 22.065  26.385 46.407  1.00 29.42 ? 232 TYR A CD1   1 
ATOM   827  C  CD2   . TYR A 1 126 ? 20.347  26.068 47.987  1.00 27.86 ? 232 TYR A CD2   1 
ATOM   828  C  CE1   . TYR A 1 126 ? 22.284  27.658 46.885  1.00 27.21 ? 232 TYR A CE1   1 
ATOM   829  C  CE2   . TYR A 1 126 ? 20.587  27.330 48.483  1.00 26.13 ? 232 TYR A CE2   1 
ATOM   830  C  CZ    . TYR A 1 126 ? 21.561  28.112 47.919  1.00 25.19 ? 232 TYR A CZ    1 
ATOM   831  O  OH    . TYR A 1 126 ? 21.849  29.357 48.360  1.00 23.09 ? 232 TYR A OH    1 
ATOM   832  N  N     . ALA A 1 127 ? 19.555  22.120 44.410  1.00 27.58 ? 233 ALA A N     1 
ATOM   833  C  CA    . ALA A 1 127 ? 19.250  20.714 44.206  1.00 26.87 ? 233 ALA A CA    1 
ATOM   834  C  C     . ALA A 1 127 ? 20.000  20.236 42.987  1.00 26.41 ? 233 ALA A C     1 
ATOM   835  O  O     . ALA A 1 127 ? 20.686  19.255 43.073  1.00 27.30 ? 233 ALA A O     1 
ATOM   836  C  CB    . ALA A 1 127 ? 17.788  20.462 44.069  1.00 26.93 ? 233 ALA A CB    1 
ATOM   837  N  N     . VAL A 1 128 ? 19.887  20.942 41.867  1.00 25.87 ? 234 VAL A N     1 
ATOM   838  C  CA    . VAL A 1 128 ? 20.686  20.680 40.660  1.00 25.22 ? 234 VAL A CA    1 
ATOM   839  C  C     . VAL A 1 128 ? 22.150  20.540 40.998  1.00 24.67 ? 234 VAL A C     1 
ATOM   840  O  O     . VAL A 1 128 ? 22.746  19.538 40.694  1.00 24.36 ? 234 VAL A O     1 
ATOM   841  C  CB    . VAL A 1 128 ? 20.525  21.823 39.594  1.00 25.30 ? 234 VAL A CB    1 
ATOM   842  C  CG1   . VAL A 1 128 ? 21.439  21.635 38.361  1.00 25.07 ? 234 VAL A CG1   1 
ATOM   843  C  CG2   . VAL A 1 128 ? 19.114  21.875 39.101  1.00 26.22 ? 234 VAL A CG2   1 
ATOM   844  N  N     . GLN A 1 129 ? 22.738  21.542 41.632  1.00 24.55 ? 235 GLN A N     1 
ATOM   845  C  CA    . GLN A 1 129 ? 24.167  21.469 41.970  1.00 24.53 ? 235 GLN A CA    1 
ATOM   846  C  C     . GLN A 1 129 ? 24.497  20.239 42.820  1.00 24.56 ? 235 GLN A C     1 
ATOM   847  O  O     . GLN A 1 129 ? 25.560  19.635 42.670  1.00 24.83 ? 235 GLN A O     1 
ATOM   848  C  CB    . GLN A 1 129 ? 24.654  22.741 42.675  1.00 24.20 ? 235 GLN A CB    1 
ATOM   849  C  CG    . GLN A 1 129 ? 24.993  23.886 41.738  1.00 23.88 ? 235 GLN A CG    1 
ATOM   850  C  CD    . GLN A 1 129 ? 25.029  25.263 42.425  1.00 25.46 ? 235 GLN A CD    1 
ATOM   851  O  OE1   . GLN A 1 129 ? 25.059  25.384 43.639  1.00 27.33 ? 235 GLN A OE1   1 
ATOM   852  N  NE2   . GLN A 1 129 ? 25.024  26.300 41.629  1.00 28.94 ? 235 GLN A NE2   1 
ATOM   853  N  N     . VAL A 1 130 ? 23.601  19.847 43.702  1.00 24.78 ? 236 VAL A N     1 
ATOM   854  C  CA    . VAL A 1 130 ? 23.850  18.649 44.486  1.00 25.74 ? 236 VAL A CA    1 
ATOM   855  C  C     . VAL A 1 130 ? 23.850  17.424 43.601  1.00 25.62 ? 236 VAL A C     1 
ATOM   856  O  O     . VAL A 1 130 ? 24.583  16.465 43.867  1.00 25.82 ? 236 VAL A O     1 
ATOM   857  C  CB    . VAL A 1 130 ? 22.829  18.444 45.617  1.00 25.98 ? 236 VAL A CB    1 
ATOM   858  C  CG1   . VAL A 1 130 ? 22.988  17.079 46.207  1.00 26.63 ? 236 VAL A CG1   1 
ATOM   859  C  CG2   . VAL A 1 130 ? 23.041  19.500 46.708  1.00 27.51 ? 236 VAL A CG2   1 
ATOM   860  N  N     . ALA A 1 131 ? 23.021  17.459 42.566  1.00 25.36 ? 237 ALA A N     1 
ATOM   861  C  CA    . ALA A 1 131 ? 22.854  16.334 41.687  1.00 25.74 ? 237 ALA A CA    1 
ATOM   862  C  C     . ALA A 1 131 ? 24.030  16.189 40.674  1.00 26.07 ? 237 ALA A C     1 
ATOM   863  O  O     . ALA A 1 131 ? 24.537  15.078 40.459  1.00 26.13 ? 237 ALA A O     1 
ATOM   864  C  CB    . ALA A 1 131 ? 21.532  16.421 40.997  1.00 25.77 ? 237 ALA A CB    1 
ATOM   865  N  N     . GLU A 1 132 ? 24.463  17.293 40.074  1.00 26.25 ? 238 GLU A N     1 
ATOM   866  C  CA    . GLU A 1 132 ? 25.751  17.350 39.382  1.00 27.13 ? 238 GLU A CA    1 
ATOM   867  C  C     . GLU A 1 132 ? 26.919  16.820 40.250  1.00 27.43 ? 238 GLU A C     1 
ATOM   868  O  O     . GLU A 1 132 ? 27.690  15.941 39.819  1.00 27.46 ? 238 GLU A O     1 
ATOM   869  C  CB    . GLU A 1 132 ? 26.052  18.784 38.968  1.00 27.36 ? 238 GLU A CB    1 
ATOM   870  C  CG    . GLU A 1 132 ? 25.804  19.048 37.493  1.00 29.27 ? 238 GLU A CG    1 
ATOM   871  C  CD    . GLU A 1 132 ? 25.287  20.443 37.225  1.00 30.55 ? 238 GLU A CD    1 
ATOM   872  O  OE1   . GLU A 1 132 ? 25.304  21.270 38.176  1.00 30.47 ? 238 GLU A OE1   1 
ATOM   873  O  OE2   . GLU A 1 132 ? 24.863  20.684 36.060  1.00 31.10 ? 238 GLU A OE2   1 
ATOM   874  N  N     . GLY A 1 133 ? 27.031  17.350 41.471  1.00 27.58 ? 239 GLY A N     1 
ATOM   875  C  CA    . GLY A 1 133 ? 27.907  16.779 42.467  1.00 27.98 ? 239 GLY A CA    1 
ATOM   876  C  C     . GLY A 1 133 ? 27.807  15.256 42.506  1.00 28.32 ? 239 GLY A C     1 
ATOM   877  O  O     . GLY A 1 133 ? 28.803  14.531 42.391  1.00 28.23 ? 239 GLY A O     1 
ATOM   878  N  N     . MET A 1 134 ? 26.584  14.770 42.630  1.00 28.43 ? 240 MET A N     1 
ATOM   879  C  CA    . MET A 1 134 ? 26.375  13.365 42.866  1.00 28.73 ? 240 MET A CA    1 
ATOM   880  C  C     . MET A 1 134 ? 26.425  12.514 41.609  1.00 28.15 ? 240 MET A C     1 
ATOM   881  O  O     . MET A 1 134 ? 26.543  11.304 41.697  1.00 28.15 ? 240 MET A O     1 
ATOM   882  C  CB    . MET A 1 134 ? 25.062  13.182 43.616  1.00 29.45 ? 240 MET A CB    1 
ATOM   883  C  CG    . MET A 1 134 ? 25.168  13.634 45.096  1.00 29.76 ? 240 MET A CG    1 
ATOM   884  S  SD    . MET A 1 134 ? 26.208  12.497 46.016  1.00 31.39 ? 240 MET A SD    1 
ATOM   885  C  CE    . MET A 1 134 ? 25.151  11.012 45.889  1.00 32.56 ? 240 MET A CE    1 
ATOM   886  N  N     . GLY A 1 135 ? 26.379  13.128 40.441  1.00 27.28 ? 241 GLY A N     1 
ATOM   887  C  CA    . GLY A 1 135 ? 26.374  12.361 39.216  1.00 26.56 ? 241 GLY A CA    1 
ATOM   888  C  C     . GLY A 1 135 ? 27.780  12.069 38.829  1.00 26.18 ? 241 GLY A C     1 
ATOM   889  O  O     . GLY A 1 135 ? 28.050  11.100 38.175  1.00 26.06 ? 241 GLY A O     1 
ATOM   890  N  N     . TYR A 1 136 ? 28.674  12.964 39.221  1.00 26.28 ? 242 TYR A N     1 
ATOM   891  C  CA    . TYR A 1 136 ? 30.112  12.739 39.161  1.00 25.76 ? 242 TYR A CA    1 
ATOM   892  C  C     . TYR A 1 136 ? 30.532  11.528 40.014  1.00 25.28 ? 242 TYR A C     1 
ATOM   893  O  O     . TYR A 1 136 ? 31.172  10.622 39.503  1.00 24.93 ? 242 TYR A O     1 
ATOM   894  C  CB    . TYR A 1 136 ? 30.803  14.007 39.625  1.00 25.62 ? 242 TYR A CB    1 
ATOM   895  C  CG    . TYR A 1 136 ? 32.302  13.949 39.707  1.00 26.72 ? 242 TYR A CG    1 
ATOM   896  C  CD1   . TYR A 1 136 ? 33.063  14.268 38.632  1.00 27.58 ? 242 TYR A CD1   1 
ATOM   897  C  CD2   . TYR A 1 136 ? 32.959  13.633 40.886  1.00 27.91 ? 242 TYR A CD2   1 
ATOM   898  C  CE1   . TYR A 1 136 ? 34.443  14.240 38.701  1.00 28.39 ? 242 TYR A CE1   1 
ATOM   899  C  CE2   . TYR A 1 136 ? 34.336  13.634 40.962  1.00 28.28 ? 242 TYR A CE2   1 
ATOM   900  C  CZ    . TYR A 1 136 ? 35.072  13.936 39.856  1.00 27.43 ? 242 TYR A CZ    1 
ATOM   901  O  OH    . TYR A 1 136 ? 36.440  13.918 39.845  1.00 26.77 ? 242 TYR A OH    1 
ATOM   902  N  N     . LEU A 1 137 ? 30.136  11.489 41.289  1.00 24.91 ? 243 LEU A N     1 
ATOM   903  C  CA    . LEU A 1 137 ? 30.423  10.316 42.119  1.00 25.33 ? 243 LEU A CA    1 
ATOM   904  C  C     . LEU A 1 137 ? 29.861  9.074  41.452  1.00 26.03 ? 243 LEU A C     1 
ATOM   905  O  O     . LEU A 1 137 ? 30.543  8.035  41.386  1.00 26.67 ? 243 LEU A O     1 
ATOM   906  C  CB    . LEU A 1 137 ? 29.923  10.429 43.563  1.00 25.10 ? 243 LEU A CB    1 
ATOM   907  C  CG    . LEU A 1 137 ? 30.271  11.696 44.391  1.00 24.57 ? 243 LEU A CG    1 
ATOM   908  C  CD1   . LEU A 1 137 ? 29.792  11.602 45.795  1.00 21.93 ? 243 LEU A CD1   1 
ATOM   909  C  CD2   . LEU A 1 137 ? 31.751  11.963 44.436  1.00 27.43 ? 243 LEU A CD2   1 
ATOM   910  N  N     . GLU A 1 138 ? 28.666  9.186  40.885  1.00 26.12 ? 244 GLU A N     1 
ATOM   911  C  CA    . GLU A 1 138 ? 28.055  8.036  40.234  1.00 26.42 ? 244 GLU A CA    1 
ATOM   912  C  C     . GLU A 1 138 ? 28.918  7.522  39.113  1.00 25.99 ? 244 GLU A C     1 
ATOM   913  O  O     . GLU A 1 138 ? 29.130  6.323  39.002  1.00 25.91 ? 244 GLU A O     1 
ATOM   914  C  CB    . GLU A 1 138 ? 26.660  8.370  39.723  1.00 27.01 ? 244 GLU A CB    1 
ATOM   915  C  CG    . GLU A 1 138 ? 25.912  7.239  39.008  1.00 27.88 ? 244 GLU A CG    1 
ATOM   916  C  CD    . GLU A 1 138 ? 24.435  7.580  38.873  1.00 31.13 ? 244 GLU A CD    1 
ATOM   917  O  OE1   . GLU A 1 138 ? 24.068  8.421  38.000  1.00 31.86 ? 244 GLU A OE1   1 
ATOM   918  O  OE2   . GLU A 1 138 ? 23.639  7.052  39.681  1.00 33.70 ? 244 GLU A OE2   1 
ATOM   919  N  N     . SER A 1 139 ? 29.430  8.425  38.289  1.00 26.13 ? 245 SER A N     1 
ATOM   920  C  CA    . SER A 1 139 ? 30.233  8.016  37.126  1.00 26.41 ? 245 SER A CA    1 
ATOM   921  C  C     . SER A 1 139 ? 31.457  7.247  37.612  1.00 27.12 ? 245 SER A C     1 
ATOM   922  O  O     . SER A 1 139 ? 31.744  6.142  37.162  1.00 26.98 ? 245 SER A O     1 
ATOM   923  C  CB    . SER A 1 139 ? 30.681  9.237  36.318  1.00 26.18 ? 245 SER A CB    1 
ATOM   924  O  OG    . SER A 1 139 ? 31.478  10.091 37.102  1.00 23.90 ? 245 SER A OG    1 
ATOM   925  N  N     . LYS A 1 140 ? 32.121  7.861  38.593  1.00 27.76 ? 246 LYS A N     1 
ATOM   926  C  CA    . LYS A 1 140 ? 33.311  7.365  39.272  1.00 27.51 ? 246 LYS A CA    1 
ATOM   927  C  C     . LYS A 1 140 ? 33.129  6.129  40.162  1.00 27.40 ? 246 LYS A C     1 
ATOM   928  O  O     . LYS A 1 140 ? 34.060  5.725  40.841  1.00 27.66 ? 246 LYS A O     1 
ATOM   929  C  CB    . LYS A 1 140 ? 33.799  8.507  40.154  1.00 27.45 ? 246 LYS A CB    1 
ATOM   930  C  CG    . LYS A 1 140 ? 34.535  9.580  39.390  1.00 28.29 ? 246 LYS A CG    1 
ATOM   931  C  CD    . LYS A 1 140 ? 36.028  9.529  39.699  1.00 29.51 ? 246 LYS A CD    1 
ATOM   932  C  CE    . LYS A 1 140 ? 36.709  10.840 39.448  1.00 29.96 ? 246 LYS A CE    1 
ATOM   933  N  NZ    . LYS A 1 140 ? 37.691  10.683 38.332  1.00 31.28 ? 246 LYS A NZ    1 
ATOM   934  N  N     . ARG A 1 141 ? 31.926  5.577  40.210  1.00 27.35 ? 247 ARG A N     1 
ATOM   935  C  CA    . ARG A 1 141 ? 31.601  4.379  40.996  1.00 27.53 ? 247 ARG A CA    1 
ATOM   936  C  C     . ARG A 1 141 ? 31.683  4.454  42.536  1.00 28.00 ? 247 ARG A C     1 
ATOM   937  O  O     . ARG A 1 141 ? 31.609  3.414  43.197  1.00 27.97 ? 247 ARG A O     1 
ATOM   938  C  CB    . ARG A 1 141 ? 32.371  3.170  40.482  1.00 27.44 ? 247 ARG A CB    1 
ATOM   939  C  CG    . ARG A 1 141 ? 31.635  2.417  39.383  1.00 27.48 ? 247 ARG A CG    1 
ATOM   940  C  CD    . ARG A 1 141 ? 32.348  1.176  38.934  1.00 27.38 ? 247 ARG A CD    1 
ATOM   941  N  NE    . ARG A 1 141 ? 32.188  0.124  39.928  1.00 27.88 ? 247 ARG A NE    1 
ATOM   942  C  CZ    . ARG A 1 141 ? 31.130  -0.691 40.020  1.00 30.65 ? 247 ARG A CZ    1 
ATOM   943  N  NH1   . ARG A 1 141 ? 30.105  -0.618 39.164  1.00 31.34 ? 247 ARG A NH1   1 
ATOM   944  N  NH2   . ARG A 1 141 ? 31.100  -1.613 40.974  1.00 31.50 ? 247 ARG A NH2   1 
ATOM   945  N  N     . PHE A 1 142 ? 31.768  5.672  43.085  1.00 28.37 ? 248 PHE A N     1 
ATOM   946  C  CA    . PHE A 1 142 ? 31.697  5.939  44.527  1.00 28.84 ? 248 PHE A CA    1 
ATOM   947  C  C     . PHE A 1 142 ? 30.245  6.010  45.060  1.00 29.15 ? 248 PHE A C     1 
ATOM   948  O  O     . PHE A 1 142 ? 29.341  6.438  44.333  1.00 30.15 ? 248 PHE A O     1 
ATOM   949  C  CB    . PHE A 1 142 ? 32.364  7.289  44.832  1.00 29.18 ? 248 PHE A CB    1 
ATOM   950  C  CG    . PHE A 1 142 ? 33.851  7.308  44.578  1.00 30.08 ? 248 PHE A CG    1 
ATOM   951  C  CD1   . PHE A 1 142 ? 34.695  6.401  45.216  1.00 33.72 ? 248 PHE A CD1   1 
ATOM   952  C  CD2   . PHE A 1 142 ? 34.412  8.244  43.729  1.00 29.92 ? 248 PHE A CD2   1 
ATOM   953  C  CE1   . PHE A 1 142 ? 36.106  6.405  44.965  1.00 33.74 ? 248 PHE A CE1   1 
ATOM   954  C  CE2   . PHE A 1 142 ? 35.767  8.250  43.471  1.00 30.90 ? 248 PHE A CE2   1 
ATOM   955  C  CZ    . PHE A 1 142 ? 36.625  7.334  44.093  1.00 32.26 ? 248 PHE A CZ    1 
ATOM   956  N  N     . ILE A 1 143 ? 30.031  5.607  46.319  1.00 28.31 ? 249 ILE A N     1 
ATOM   957  C  CA    . ILE A 1 143 ? 28.768  5.844  47.004  1.00 28.17 ? 249 ILE A CA    1 
ATOM   958  C  C     . ILE A 1 143 ? 29.058  6.739  48.185  1.00 27.98 ? 249 ILE A C     1 
ATOM   959  O  O     . ILE A 1 143 ? 29.988  6.464  48.943  1.00 29.16 ? 249 ILE A O     1 
ATOM   960  C  CB    . ILE A 1 143 ? 28.071  4.565  47.493  1.00 27.89 ? 249 ILE A CB    1 
ATOM   961  C  CG1   . ILE A 1 143 ? 29.077  3.464  47.758  1.00 29.15 ? 249 ILE A CG1   1 
ATOM   962  C  CG2   . ILE A 1 143 ? 27.046  4.103  46.495  1.00 27.92 ? 249 ILE A CG2   1 
ATOM   963  C  CD1   . ILE A 1 143 ? 28.439  2.116  48.081  1.00 29.46 ? 249 ILE A CD1   1 
ATOM   964  N  N     . HIS A 1 144 ? 28.264  7.791  48.341  1.00 26.28 ? 250 HIS A N     1 
ATOM   965  C  CA    . HIS A 1 144 ? 28.525  8.789  49.333  1.00 25.95 ? 250 HIS A CA    1 
ATOM   966  C  C     . HIS A 1 144 ? 28.138  8.347  50.731  1.00 26.24 ? 250 HIS A C     1 
ATOM   967  O  O     . HIS A 1 144 ? 28.858  8.578  51.709  1.00 25.26 ? 250 HIS A O     1 
ATOM   968  C  CB    . HIS A 1 144 ? 27.770  10.082 49.007  1.00 26.18 ? 250 HIS A CB    1 
ATOM   969  C  CG    . HIS A 1 144 ? 28.193  11.214 49.869  1.00 24.29 ? 250 HIS A CG    1 
ATOM   970  N  ND1   . HIS A 1 144 ? 27.661  11.421 51.116  1.00 24.19 ? 250 HIS A ND1   1 
ATOM   971  C  CD2   . HIS A 1 144 ? 29.171  12.131 49.714  1.00 24.41 ? 250 HIS A CD2   1 
ATOM   972  C  CE1   . HIS A 1 144 ? 28.277  12.437 51.689  1.00 26.30 ? 250 HIS A CE1   1 
ATOM   973  N  NE2   . HIS A 1 144 ? 29.179  12.908 50.843  1.00 26.63 ? 250 HIS A NE2   1 
ATOM   974  N  N     . ARG A 1 145 ? 26.917  7.847  50.833  1.00 27.15 ? 251 ARG A N     1 
ATOM   975  C  CA    . ARG A 1 145 ? 26.492  7.102  51.990  1.00 27.36 ? 251 ARG A CA    1 
ATOM   976  C  C     . ARG A 1 145 ? 26.008  7.967  53.184  1.00 27.24 ? 251 ARG A C     1 
ATOM   977  O  O     . ARG A 1 145 ? 25.448  7.401  54.116  1.00 28.11 ? 251 ARG A O     1 
ATOM   978  C  CB    . ARG A 1 145 ? 27.660  6.156  52.391  1.00 27.49 ? 251 ARG A CB    1 
ATOM   979  C  CG    . ARG A 1 145 ? 27.293  4.713  52.401  1.00 28.61 ? 251 ARG A CG    1 
ATOM   980  C  CD    . ARG A 1 145 ? 28.385  3.762  52.028  1.00 30.44 ? 251 ARG A CD    1 
ATOM   981  N  NE    . ARG A 1 145 ? 29.453  3.750  53.030  1.00 32.88 ? 251 ARG A NE    1 
ATOM   982  C  CZ    . ARG A 1 145 ? 29.381  3.179  54.234  1.00 34.08 ? 251 ARG A CZ    1 
ATOM   983  N  NH1   . ARG A 1 145 ? 28.303  2.506  54.647  1.00 32.31 ? 251 ARG A NH1   1 
ATOM   984  N  NH2   . ARG A 1 145 ? 30.432  3.268  55.034  1.00 36.04 ? 251 ARG A NH2   1 
ATOM   985  N  N     . ASP A 1 146 ? 26.216  9.290  53.149  1.00 26.32 ? 252 ASP A N     1 
ATOM   986  C  CA    . ASP A 1 146 ? 25.844  10.232 54.198  1.00 25.98 ? 252 ASP A CA    1 
ATOM   987  C  C     . ASP A 1 146 ? 25.357  11.545 53.517  1.00 27.30 ? 252 ASP A C     1 
ATOM   988  O  O     . ASP A 1 146 ? 25.743  12.701 53.874  1.00 28.49 ? 252 ASP A O     1 
ATOM   989  C  CB    . ASP A 1 146 ? 27.081  10.530 55.053  1.00 26.09 ? 252 ASP A CB    1 
ATOM   990  C  CG    . ASP A 1 146 ? 26.749  10.990 56.492  1.00 25.52 ? 252 ASP A CG    1 
ATOM   991  O  OD1   . ASP A 1 146 ? 25.706  11.590 56.702  1.00 26.71 ? 252 ASP A OD1   1 
ATOM   992  O  OD2   . ASP A 1 146 ? 27.452  10.813 57.490  1.00 23.23 ? 252 ASP A OD2   1 
ATOM   993  N  N     . LEU A 1 147 ? 24.502  11.409 52.515  1.00 27.36 ? 253 LEU A N     1 
ATOM   994  C  CA    . LEU A 1 147 ? 24.012  12.589 51.810  1.00 27.10 ? 253 LEU A CA    1 
ATOM   995  C  C     . LEU A 1 147 ? 22.867  13.176 52.587  1.00 25.62 ? 253 LEU A C     1 
ATOM   996  O  O     . LEU A 1 147 ? 21.888  12.519 52.762  1.00 25.13 ? 253 LEU A O     1 
ATOM   997  C  CB    . LEU A 1 147 ? 23.531  12.222 50.401  1.00 27.72 ? 253 LEU A CB    1 
ATOM   998  C  CG    . LEU A 1 147 ? 23.314  13.484 49.608  1.00 29.98 ? 253 LEU A CG    1 
ATOM   999  C  CD1   . LEU A 1 147 ? 24.610  14.267 49.624  1.00 31.55 ? 253 LEU A CD1   1 
ATOM   1000 C  CD2   . LEU A 1 147 ? 22.860  13.201 48.199  1.00 31.92 ? 253 LEU A CD2   1 
ATOM   1001 N  N     . ALA A 1 148 ? 23.023  14.401 53.052  1.00 25.20 ? 254 ALA A N     1 
ATOM   1002 C  CA    . ALA A 1 148 ? 22.079  15.068 53.954  1.00 24.85 ? 254 ALA A CA    1 
ATOM   1003 C  C     . ALA A 1 148 ? 22.443  16.560 54.119  1.00 24.71 ? 254 ALA A C     1 
ATOM   1004 O  O     . ALA A 1 148 ? 23.621  16.946 54.012  1.00 24.55 ? 254 ALA A O     1 
ATOM   1005 C  CB    . ALA A 1 148 ? 22.095  14.400 55.278  1.00 24.63 ? 254 ALA A CB    1 
ATOM   1006 N  N     . ALA A 1 149 ? 21.468  17.420 54.401  1.00 24.58 ? 255 ALA A N     1 
ATOM   1007 C  CA    . ALA A 1 149 ? 21.762  18.863 54.327  1.00 24.71 ? 255 ALA A CA    1 
ATOM   1008 C  C     . ALA A 1 149 ? 22.804  19.357 55.297  1.00 24.37 ? 255 ALA A C     1 
ATOM   1009 O  O     . ALA A 1 149 ? 23.327  20.422 55.126  1.00 25.52 ? 255 ALA A O     1 
ATOM   1010 C  CB    . ALA A 1 149 ? 20.527  19.693 54.417  1.00 24.55 ? 255 ALA A CB    1 
ATOM   1011 N  N     . ARG A 1 150 ? 23.148  18.605 56.317  1.00 25.32 ? 256 ARG A N     1 
ATOM   1012 C  CA    . ARG A 1 150 ? 24.213  19.075 57.210  1.00 25.32 ? 256 ARG A CA    1 
ATOM   1013 C  C     . ARG A 1 150 ? 25.573  18.852 56.598  1.00 25.37 ? 256 ARG A C     1 
ATOM   1014 O  O     . ARG A 1 150 ? 26.564  19.362 57.102  1.00 26.69 ? 256 ARG A O     1 
ATOM   1015 C  CB    . ARG A 1 150 ? 24.156  18.452 58.570  1.00 24.63 ? 256 ARG A CB    1 
ATOM   1016 C  CG    . ARG A 1 150 ? 24.664  17.068 58.556  1.00 26.67 ? 256 ARG A CG    1 
ATOM   1017 C  CD    . ARG A 1 150 ? 24.173  16.133 59.686  1.00 29.11 ? 256 ARG A CD    1 
ATOM   1018 N  NE    . ARG A 1 150 ? 24.616  14.770 59.338  1.00 30.54 ? 256 ARG A NE    1 
ATOM   1019 C  CZ    . ARG A 1 150 ? 23.871  13.723 58.927  1.00 31.48 ? 256 ARG A CZ    1 
ATOM   1020 N  NH1   . ARG A 1 150 ? 22.515  13.704 58.821  1.00 29.15 ? 256 ARG A NH1   1 
ATOM   1021 N  NH2   . ARG A 1 150 ? 24.554  12.624 58.654  1.00 33.86 ? 256 ARG A NH2   1 
ATOM   1022 N  N     . ASN A 1 151 ? 25.647  18.139 55.500  1.00 25.30 ? 257 ASN A N     1 
ATOM   1023 C  CA    . ASN A 1 151 ? 26.909  18.086 54.766  1.00 25.58 ? 257 ASN A CA    1 
ATOM   1024 C  C     . ASN A 1 151 ? 26.952  18.864 53.455  1.00 25.04 ? 257 ASN A C     1 
ATOM   1025 O  O     . ASN A 1 151 ? 27.804  18.667 52.647  1.00 24.17 ? 257 ASN A O     1 
ATOM   1026 C  CB    . ASN A 1 151 ? 27.260  16.628 54.512  1.00 25.82 ? 257 ASN A CB    1 
ATOM   1027 C  CG    . ASN A 1 151 ? 27.456  15.847 55.805  1.00 25.58 ? 257 ASN A CG    1 
ATOM   1028 O  OD1   . ASN A 1 151 ? 26.993  14.729 55.873  1.00 29.39 ? 257 ASN A OD1   1 
ATOM   1029 N  ND2   . ASN A 1 151 ? 28.152  16.416 56.813  1.00 19.31 ? 257 ASN A ND2   1 
ATOM   1030 N  N     . LEU A 1 152 ? 25.984  19.714 53.222  1.00 25.66 ? 258 LEU A N     1 
ATOM   1031 C  CA    . LEU A 1 152 ? 26.038  20.573 52.074  1.00 25.68 ? 258 LEU A CA    1 
ATOM   1032 C  C     . LEU A 1 152 ? 26.611  21.816 52.694  1.00 26.63 ? 258 LEU A C     1 
ATOM   1033 O  O     . LEU A 1 152 ? 26.277  22.124 53.863  1.00 28.10 ? 258 LEU A O     1 
ATOM   1034 C  CB    . LEU A 1 152 ? 24.634  20.783 51.523  1.00 25.65 ? 258 LEU A CB    1 
ATOM   1035 C  CG    . LEU A 1 152 ? 23.853  19.524 51.078  1.00 23.38 ? 258 LEU A CG    1 
ATOM   1036 C  CD1   . LEU A 1 152 ? 22.468  19.862 50.618  1.00 23.19 ? 258 LEU A CD1   1 
ATOM   1037 C  CD2   . LEU A 1 152 ? 24.515  18.874 49.961  1.00 22.90 ? 258 LEU A CD2   1 
ATOM   1038 N  N     . LEU A 1 153 ? 27.538  22.467 51.993  1.00 26.95 ? 259 LEU A N     1 
ATOM   1039 C  CA    . LEU A 1 153 ? 28.100  23.745 52.432  1.00 27.54 ? 259 LEU A CA    1 
ATOM   1040 C  C     . LEU A 1 153 ? 27.903  24.803 51.312  1.00 28.18 ? 259 LEU A C     1 
ATOM   1041 O  O     . LEU A 1 153 ? 27.780  24.411 50.138  1.00 28.40 ? 259 LEU A O     1 
ATOM   1042 C  CB    . LEU A 1 153 ? 29.594  23.606 52.802  1.00 27.21 ? 259 LEU A CB    1 
ATOM   1043 C  CG    . LEU A 1 153 ? 30.014  22.744 54.013  1.00 27.09 ? 259 LEU A CG    1 
ATOM   1044 C  CD1   . LEU A 1 153 ? 31.167  21.878 53.623  1.00 30.99 ? 259 LEU A CD1   1 
ATOM   1045 C  CD2   . LEU A 1 153 ? 30.482  23.506 55.232  1.00 26.90 ? 259 LEU A CD2   1 
ATOM   1046 N  N     . LEU A 1 154 ? 27.874  26.107 51.674  1.00 28.10 ? 260 LEU A N     1 
ATOM   1047 C  CA    . LEU A 1 154 ? 27.805  27.224 50.719  1.00 28.11 ? 260 LEU A CA    1 
ATOM   1048 C  C     . LEU A 1 154 ? 29.098  27.965 50.589  1.00 27.83 ? 260 LEU A C     1 
ATOM   1049 O  O     . LEU A 1 154 ? 29.533  28.627 51.525  1.00 27.18 ? 260 LEU A O     1 
ATOM   1050 C  CB    . LEU A 1 154 ? 26.756  28.239 51.124  1.00 28.32 ? 260 LEU A CB    1 
ATOM   1051 C  CG    . LEU A 1 154 ? 25.320  27.745 50.991  1.00 30.62 ? 260 LEU A CG    1 
ATOM   1052 C  CD1   . LEU A 1 154 ? 24.390  28.885 51.419  1.00 30.58 ? 260 LEU A CD1   1 
ATOM   1053 C  CD2   . LEU A 1 154 ? 24.956  27.207 49.542  1.00 30.90 ? 260 LEU A CD2   1 
ATOM   1054 N  N     . ALA A 1 155 ? 29.704  27.834 49.411  1.00 28.34 ? 261 ALA A N     1 
ATOM   1055 C  CA    . ALA A 1 155 ? 30.857  28.635 48.997  1.00 28.43 ? 261 ALA A CA    1 
ATOM   1056 C  C     . ALA A 1 155 ? 30.428  30.088 48.692  1.00 28.60 ? 261 ALA A C     1 
ATOM   1057 O  O     . ALA A 1 155 ? 30.916  31.026 49.320  1.00 28.49 ? 261 ALA A O     1 
ATOM   1058 C  CB    . ALA A 1 155 ? 31.519  28.009 47.776  1.00 28.44 ? 261 ALA A CB    1 
ATOM   1059 N  N     . THR A 1 156 ? 29.530  30.262 47.718  1.00 28.45 ? 262 THR A N     1 
ATOM   1060 C  CA    . THR A 1 156 ? 28.828  31.530 47.515  1.00 28.00 ? 262 THR A CA    1 
ATOM   1061 C  C     . THR A 1 156 ? 27.348  31.322 47.818  1.00 28.20 ? 262 THR A C     1 
ATOM   1062 O  O     . THR A 1 156 ? 26.942  30.187 48.152  1.00 29.53 ? 262 THR A O     1 
ATOM   1063 C  CB    . THR A 1 156 ? 29.005  32.058 46.059  1.00 28.09 ? 262 THR A CB    1 
ATOM   1064 O  OG1   . THR A 1 156 ? 28.220  31.293 45.120  1.00 26.49 ? 262 THR A OG1   1 
ATOM   1065 C  CG2   . THR A 1 156 ? 30.459  31.924 45.577  1.00 28.44 ? 262 THR A CG2   1 
ATOM   1066 N  N     . ARG A 1 157 ? 26.539  32.387 47.710  1.00 27.19 ? 263 ARG A N     1 
ATOM   1067 C  CA    . ARG A 1 157 ? 25.085  32.233 47.690  1.00 26.51 ? 263 ARG A CA    1 
ATOM   1068 C  C     . ARG A 1 157 ? 24.629  31.305 46.566  1.00 26.13 ? 263 ARG A C     1 
ATOM   1069 O  O     . ARG A 1 157 ? 23.745  30.520 46.753  1.00 25.35 ? 263 ARG A O     1 
ATOM   1070 C  CB    . ARG A 1 157 ? 24.404  33.572 47.495  1.00 26.51 ? 263 ARG A CB    1 
ATOM   1071 C  CG    . ARG A 1 157 ? 22.940  33.581 47.910  0.01 26.83 ? 263 ARG A CG    1 
ATOM   1072 C  CD    . ARG A 1 157 ? 22.283  34.949 47.841  0.01 27.14 ? 263 ARG A CD    1 
ATOM   1073 N  NE    . ARG A 1 157 ? 20.859  34.890 48.167  0.01 27.36 ? 263 ARG A NE    1 
ATOM   1074 C  CZ    . ARG A 1 157 ? 20.039  35.939 48.181  0.01 27.54 ? 263 ARG A CZ    1 
ATOM   1075 N  NH1   . ARG A 1 157 ? 18.758  35.771 48.491  0.01 27.61 ? 263 ARG A NH1   1 
ATOM   1076 N  NH2   . ARG A 1 157 ? 20.487  37.157 47.889  0.01 27.64 ? 263 ARG A NH2   1 
ATOM   1077 N  N     . ASP A 1 158 ? 25.244  31.429 45.397  1.00 26.62 ? 264 ASP A N     1 
ATOM   1078 C  CA    . ASP A 1 158 ? 24.900  30.656 44.204  1.00 27.19 ? 264 ASP A CA    1 
ATOM   1079 C  C     . ASP A 1 158 ? 25.478  29.264 44.133  1.00 27.92 ? 264 ASP A C     1 
ATOM   1080 O  O     . ASP A 1 158 ? 25.016  28.463 43.312  1.00 28.51 ? 264 ASP A O     1 
ATOM   1081 C  CB    . ASP A 1 158 ? 25.386  31.386 42.955  1.00 27.18 ? 264 ASP A CB    1 
ATOM   1082 C  CG    . ASP A 1 158 ? 24.505  32.581 42.597  1.00 28.15 ? 264 ASP A CG    1 
ATOM   1083 O  OD1   . ASP A 1 158 ? 23.369  32.636 43.172  1.00 25.76 ? 264 ASP A OD1   1 
ATOM   1084 O  OD2   . ASP A 1 158 ? 24.870  33.483 41.756  1.00 27.37 ? 264 ASP A OD2   1 
ATOM   1085 N  N     . LEU A 1 159 ? 26.468  28.979 44.990  1.00 28.19 ? 265 LEU A N     1 
ATOM   1086 C  CA    . LEU A 1 159 ? 27.351  27.833 44.850  1.00 27.41 ? 265 LEU A CA    1 
ATOM   1087 C  C     . LEU A 1 159 ? 27.418  27.047 46.156  1.00 27.24 ? 265 LEU A C     1 
ATOM   1088 O  O     . LEU A 1 159 ? 27.772  27.569 47.226  1.00 26.59 ? 265 LEU A O     1 
ATOM   1089 C  CB    . LEU A 1 159 ? 28.734  28.332 44.463  1.00 27.27 ? 265 LEU A CB    1 
ATOM   1090 C  CG    . LEU A 1 159 ? 29.823  27.314 44.169  1.00 28.35 ? 265 LEU A CG    1 
ATOM   1091 C  CD1   . LEU A 1 159 ? 29.247  26.108 43.399  1.00 30.19 ? 265 LEU A CD1   1 
ATOM   1092 C  CD2   . LEU A 1 159 ? 30.993  27.936 43.398  1.00 27.63 ? 265 LEU A CD2   1 
ATOM   1093 N  N     . VAL A 1 160 ? 27.072  25.773 46.023  1.00 27.25 ? 266 VAL A N     1 
ATOM   1094 C  CA    . VAL A 1 160 ? 26.893  24.820 47.123  1.00 26.65 ? 266 VAL A CA    1 
ATOM   1095 C  C     . VAL A 1 160 ? 27.757  23.616 46.842  1.00 26.70 ? 266 VAL A C     1 
ATOM   1096 O  O     . VAL A 1 160 ? 27.833  23.143 45.696  1.00 27.10 ? 266 VAL A O     1 
ATOM   1097 C  CB    . VAL A 1 160 ? 25.393  24.381 47.277  1.00 26.43 ? 266 VAL A CB    1 
ATOM   1098 C  CG1   . VAL A 1 160 ? 24.925  23.541 46.150  1.00 24.81 ? 266 VAL A CG1   1 
ATOM   1099 C  CG2   . VAL A 1 160 ? 25.138  23.673 48.617  1.00 27.05 ? 266 VAL A CG2   1 
ATOM   1100 N  N     . LYS A 1 161 ? 28.442  23.140 47.875  1.00 26.54 ? 267 LYS A N     1 
ATOM   1101 C  CA    . LYS A 1 161 ? 29.340  22.014 47.728  1.00 26.61 ? 267 LYS A CA    1 
ATOM   1102 C  C     . LYS A 1 161 ? 28.972  20.901 48.679  1.00 26.26 ? 267 LYS A C     1 
ATOM   1103 O  O     . LYS A 1 161 ? 28.571  21.141 49.780  1.00 26.88 ? 267 LYS A O     1 
ATOM   1104 C  CB    . LYS A 1 161 ? 30.757  22.498 47.969  1.00 26.83 ? 267 LYS A CB    1 
ATOM   1105 C  CG    . LYS A 1 161 ? 31.302  23.126 46.729  1.00 27.59 ? 267 LYS A CG    1 
ATOM   1106 C  CD    . LYS A 1 161 ? 32.208  24.289 46.999  1.00 28.28 ? 267 LYS A CD    1 
ATOM   1107 C  CE    . LYS A 1 161 ? 33.031  24.569 45.747  1.00 28.92 ? 267 LYS A CE    1 
ATOM   1108 N  NZ    . LYS A 1 161 ? 34.060  25.586 45.956  1.00 30.23 ? 267 LYS A NZ    1 
ATOM   1109 N  N     . ILE A 1 162 ? 29.078  19.679 48.220  1.00 26.51 ? 268 ILE A N     1 
ATOM   1110 C  CA    . ILE A 1 162 ? 28.871  18.510 49.051  1.00 27.31 ? 268 ILE A CA    1 
ATOM   1111 C  C     . ILE A 1 162 ? 30.167  18.414 49.847  1.00 28.63 ? 268 ILE A C     1 
ATOM   1112 O  O     . ILE A 1 162 ? 31.277  18.714 49.364  1.00 28.74 ? 268 ILE A O     1 
ATOM   1113 C  CB    . ILE A 1 162 ? 28.555  17.230 48.197  1.00 27.13 ? 268 ILE A CB    1 
ATOM   1114 C  CG1   . ILE A 1 162 ? 27.280  17.438 47.394  1.00 26.05 ? 268 ILE A CG1   1 
ATOM   1115 C  CG2   . ILE A 1 162 ? 28.334  15.997 49.071  1.00 26.54 ? 268 ILE A CG2   1 
ATOM   1116 C  CD1   . ILE A 1 162 ? 27.100  16.524 46.351  1.00 26.96 ? 268 ILE A CD1   1 
ATOM   1117 N  N     . GLY A 1 163 ? 30.027  18.012 51.092  1.00 29.60 ? 269 GLY A N     1 
ATOM   1118 C  CA    . GLY A 1 163 ? 30.958  18.479 52.066  1.00 30.36 ? 269 GLY A CA    1 
ATOM   1119 C  C     . GLY A 1 163 ? 31.606  17.440 52.934  1.00 31.42 ? 269 GLY A C     1 
ATOM   1120 O  O     . GLY A 1 163 ? 32.578  17.862 53.629  1.00 33.30 ? 269 GLY A O     1 
ATOM   1121 N  N     . ASP A 1 164 ? 31.165  16.172 52.978  1.00 29.88 ? 270 ASP A N     1 
ATOM   1122 C  CA    . ASP A 1 164 ? 31.763  15.349 54.032  1.00 30.78 ? 270 ASP A CA    1 
ATOM   1123 C  C     . ASP A 1 164 ? 31.900  13.921 53.578  1.00 31.20 ? 270 ASP A C     1 
ATOM   1124 O  O     . ASP A 1 164 ? 30.902  13.165 53.558  1.00 33.31 ? 270 ASP A O     1 
ATOM   1125 C  CB    . ASP A 1 164 ? 30.909  15.511 55.299  1.00 30.91 ? 270 ASP A CB    1 
ATOM   1126 C  CG    . ASP A 1 164 ? 31.263  14.548 56.447  1.00 32.78 ? 270 ASP A CG    1 
ATOM   1127 O  OD1   . ASP A 1 164 ? 31.098  14.979 57.623  1.00 30.99 ? 270 ASP A OD1   1 
ATOM   1128 O  OD2   . ASP A 1 164 ? 31.638  13.344 56.314  1.00 37.22 ? 270 ASP A OD2   1 
ATOM   1129 N  N     . PHE A 1 165 ? 33.127  13.524 53.215  1.00 30.18 ? 271 PHE A N     1 
ATOM   1130 C  CA    . PHE A 1 165 ? 33.330  12.229 52.532  1.00 28.25 ? 271 PHE A CA    1 
ATOM   1131 C  C     . PHE A 1 165 ? 33.869  11.151 53.423  1.00 26.99 ? 271 PHE A C     1 
ATOM   1132 O  O     . PHE A 1 165 ? 34.449  10.208 52.944  1.00 26.81 ? 271 PHE A O     1 
ATOM   1133 C  CB    . PHE A 1 165 ? 34.230  12.432 51.327  1.00 27.97 ? 271 PHE A CB    1 
ATOM   1134 C  CG    . PHE A 1 165 ? 33.719  13.478 50.371  1.00 27.80 ? 271 PHE A CG    1 
ATOM   1135 C  CD1   . PHE A 1 165 ? 34.305  14.717 50.290  1.00 28.63 ? 271 PHE A CD1   1 
ATOM   1136 C  CD2   . PHE A 1 165 ? 32.623  13.224 49.580  1.00 26.40 ? 271 PHE A CD2   1 
ATOM   1137 C  CE1   . PHE A 1 165 ? 33.805  15.664 49.407  1.00 28.07 ? 271 PHE A CE1   1 
ATOM   1138 C  CE2   . PHE A 1 165 ? 32.130  14.154 48.723  1.00 26.13 ? 271 PHE A CE2   1 
ATOM   1139 C  CZ    . PHE A 1 165 ? 32.710  15.367 48.625  1.00 26.78 ? 271 PHE A CZ    1 
ATOM   1140 N  N     . GLY A 1 166 ? 33.655  11.292 54.722  1.00 26.01 ? 272 GLY A N     1 
ATOM   1141 C  CA    . GLY A 1 166 ? 34.013  10.279 55.683  1.00 25.80 ? 272 GLY A CA    1 
ATOM   1142 C  C     . GLY A 1 166 ? 33.439  8.875  55.522  1.00 25.51 ? 272 GLY A C     1 
ATOM   1143 O  O     . GLY A 1 166 ? 34.114  7.900  55.797  1.00 25.16 ? 272 GLY A O     1 
ATOM   1144 N  N     . LEU A 1 167 ? 32.193  8.757  55.095  1.00 26.11 ? 273 LEU A N     1 
ATOM   1145 C  CA    . LEU A 1 167 ? 31.626  7.439  54.823  1.00 26.61 ? 273 LEU A CA    1 
ATOM   1146 C  C     . LEU A 1 167 ? 31.726  7.017  53.341  1.00 26.67 ? 273 LEU A C     1 
ATOM   1147 O  O     . LEU A 1 167 ? 31.330  5.916  52.987  1.00 27.72 ? 273 LEU A O     1 
ATOM   1148 C  CB    . LEU A 1 167 ? 30.194  7.362  55.354  1.00 26.77 ? 273 LEU A CB    1 
ATOM   1149 C  CG    . LEU A 1 167 ? 30.218  7.328  56.902  1.00 26.99 ? 273 LEU A CG    1 
ATOM   1150 C  CD1   . LEU A 1 167 ? 28.912  7.841  57.405  1.00 27.85 ? 273 LEU A CD1   1 
ATOM   1151 C  CD2   . LEU A 1 167 ? 30.509  5.944  57.481  1.00 24.72 ? 273 LEU A CD2   1 
ATOM   1152 N  N     . MET A 1 168 ? 32.328  7.842  52.496  1.00 26.06 ? 274 MET A N     1 
ATOM   1153 C  CA    . MET A 1 168 ? 32.379  7.544  51.100  1.00 25.48 ? 274 MET A CA    1 
ATOM   1154 C  C     . MET A 1 168 ? 33.139  6.297  50.887  1.00 26.45 ? 274 MET A C     1 
ATOM   1155 O  O     . MET A 1 168 ? 34.209  6.090  51.480  1.00 26.15 ? 274 MET A O     1 
ATOM   1156 C  CB    . MET A 1 168 ? 33.074  8.642  50.346  1.00 25.45 ? 274 MET A CB    1 
ATOM   1157 C  CG    . MET A 1 168 ? 32.884  8.470  48.899  1.00 26.21 ? 274 MET A CG    1 
ATOM   1158 S  SD    . MET A 1 168 ? 33.363  9.885  47.913  1.00 27.91 ? 274 MET A SD    1 
ATOM   1159 C  CE    . MET A 1 168 ? 34.723  9.139  47.141  1.00 26.99 ? 274 MET A CE    1 
ATOM   1160 N  N     . ARG A 1 169 ? 32.623  5.492  49.970  1.00 27.41 ? 275 ARG A N     1 
ATOM   1161 C  CA    . ARG A 1 169 ? 33.154  4.157  49.702  1.00 28.03 ? 275 ARG A CA    1 
ATOM   1162 C  C     . ARG A 1 169 ? 33.111  3.871  48.203  1.00 27.51 ? 275 ARG A C     1 
ATOM   1163 O  O     . ARG A 1 169 ? 32.170  4.209  47.546  1.00 27.92 ? 275 ARG A O     1 
ATOM   1164 C  CB    . ARG A 1 169 ? 32.319  3.128  50.497  1.00 28.63 ? 275 ARG A CB    1 
ATOM   1165 C  CG    . ARG A 1 169 ? 33.069  2.176  51.484  1.00 31.44 ? 275 ARG A CG    1 
ATOM   1166 C  CD    . ARG A 1 169 ? 34.189  2.805  52.376  1.00 34.50 ? 275 ARG A CD    1 
ATOM   1167 N  NE    . ARG A 1 169 ? 33.747  3.112  53.750  1.00 37.18 ? 275 ARG A NE    1 
ATOM   1168 C  CZ    . ARG A 1 169 ? 33.956  4.282  54.398  1.00 38.66 ? 275 ARG A CZ    1 
ATOM   1169 N  NH1   . ARG A 1 169 ? 34.578  5.327  53.808  1.00 37.27 ? 275 ARG A NH1   1 
ATOM   1170 N  NH2   . ARG A 1 169 ? 33.520  4.411  55.660  1.00 38.53 ? 275 ARG A NH2   1 
ATOM   1171 N  N     . ALA A 1 170 ? 34.138  3.256  47.648  1.00 27.72 ? 276 ALA A N     1 
ATOM   1172 C  CA    . ALA A 1 170 ? 34.117  2.928  46.226  1.00 27.47 ? 276 ALA A CA    1 
ATOM   1173 C  C     . ALA A 1 170 ? 33.647  1.488  46.086  1.00 27.25 ? 276 ALA A C     1 
ATOM   1174 O  O     . ALA A 1 170 ? 33.993  0.636  46.892  1.00 26.64 ? 276 ALA A O     1 
ATOM   1175 C  CB    . ALA A 1 170 ? 35.488  3.162  45.563  1.00 27.03 ? 276 ALA A CB    1 
ATOM   1176 N  N     . LEU A 1 171 ? 32.808  1.250  45.086  1.00 27.42 ? 277 LEU A N     1 
ATOM   1177 C  CA    . LEU A 1 171 ? 32.213  -0.046 44.879  1.00 27.52 ? 277 LEU A CA    1 
ATOM   1178 C  C     . LEU A 1 171 ? 33.225  -0.776 44.073  1.00 27.42 ? 277 LEU A C     1 
ATOM   1179 O  O     . LEU A 1 171 ? 33.807  -0.209 43.148  1.00 27.68 ? 277 LEU A O     1 
ATOM   1180 C  CB    . LEU A 1 171 ? 30.896  0.059  44.116  1.00 27.83 ? 277 LEU A CB    1 
ATOM   1181 C  CG    . LEU A 1 171 ? 29.657  0.515  44.909  1.00 29.24 ? 277 LEU A CG    1 
ATOM   1182 C  CD1   . LEU A 1 171 ? 28.397  0.391  44.019  1.00 30.26 ? 277 LEU A CD1   1 
ATOM   1183 C  CD2   . LEU A 1 171 ? 29.472  -0.297 46.215  1.00 29.70 ? 277 LEU A CD2   1 
ATOM   1184 N  N     . PRO A 1 172 ? 33.503  -2.015 44.435  1.00 27.32 ? 278 PRO A N     1 
ATOM   1185 C  CA    . PRO A 1 172 ? 34.447  -2.796 43.642  1.00 27.31 ? 278 PRO A CA    1 
ATOM   1186 C  C     . PRO A 1 172 ? 33.784  -3.208 42.332  1.00 27.41 ? 278 PRO A C     1 
ATOM   1187 O  O     . PRO A 1 172 ? 32.575  -3.392 42.302  1.00 27.13 ? 278 PRO A O     1 
ATOM   1188 C  CB    . PRO A 1 172 ? 34.798  -3.986 44.547  1.00 27.53 ? 278 PRO A CB    1 
ATOM   1189 C  CG    . PRO A 1 172 ? 33.765  -4.022 45.614  1.00 27.78 ? 278 PRO A CG    1 
ATOM   1190 C  CD    . PRO A 1 172 ? 32.986  -2.741 45.606  1.00 26.98 ? 278 PRO A CD    1 
ATOM   1191 N  N     . GLN A 1 173 ? 34.573  -3.356 41.268  1.00 27.87 ? 279 GLN A N     1 
ATOM   1192 C  CA    . GLN A 1 173 ? 34.042  -3.575 39.904  1.00 27.79 ? 279 GLN A CA    1 
ATOM   1193 C  C     . GLN A 1 173 ? 33.065  -4.788 39.806  1.00 27.50 ? 279 GLN A C     1 
ATOM   1194 O  O     . GLN A 1 173 ? 32.203  -4.813 38.914  1.00 27.27 ? 279 GLN A O     1 
ATOM   1195 C  CB    . GLN A 1 173 ? 35.210  -3.627 38.866  1.00 27.69 ? 279 GLN A CB    1 
ATOM   1196 C  CG    . GLN A 1 173 ? 34.985  -2.996 37.421  1.00 27.63 ? 279 GLN A CG    1 
ATOM   1197 C  CD    . GLN A 1 173 ? 34.097  -1.732 37.345  1.00 28.06 ? 279 GLN A CD    1 
ATOM   1198 O  OE1   . GLN A 1 173 ? 34.508  -0.636 37.750  1.00 27.66 ? 279 GLN A OE1   1 
ATOM   1199 N  NE2   . GLN A 1 173 ? 32.897  -1.888 36.791  1.00 27.96 ? 279 GLN A NE2   1 
ATOM   1200 N  N     . ASN A 1 174 ? 33.153  -5.740 40.743  1.00 27.10 ? 280 ASN A N     1 
ATOM   1201 C  CA    . ASN A 1 174 ? 32.157  -6.815 40.827  1.00 27.17 ? 280 ASN A CA    1 
ATOM   1202 C  C     . ASN A 1 174 ? 31.157  -6.670 41.971  1.00 27.75 ? 280 ASN A C     1 
ATOM   1203 O  O     . ASN A 1 174 ? 30.925  -7.605 42.728  1.00 27.96 ? 280 ASN A O     1 
ATOM   1204 C  CB    . ASN A 1 174 ? 32.840  -8.191 40.889  1.00 26.49 ? 280 ASN A CB    1 
ATOM   1205 C  CG    . ASN A 1 174 ? 32.873  -8.868 39.556  1.00 24.19 ? 280 ASN A CG    1 
ATOM   1206 O  OD1   . ASN A 1 174 ? 33.889  -9.410 39.173  1.00 23.65 ? 280 ASN A OD1   1 
ATOM   1207 N  ND2   . ASN A 1 174 ? 31.767  -8.831 38.833  1.00 20.01 ? 280 ASN A ND2   1 
ATOM   1208 N  N     . ASP A 1 175 ? 30.526  -5.510 42.048  1.00 28.82 ? 281 ASP A N     1 
ATOM   1209 C  CA    . ASP A 1 175 ? 29.600  -5.166 43.149  1.00 29.52 ? 281 ASP A CA    1 
ATOM   1210 C  C     . ASP A 1 175 ? 28.701  -3.992 42.743  1.00 29.62 ? 281 ASP A C     1 
ATOM   1211 O  O     . ASP A 1 175 ? 29.196  -2.976 42.266  1.00 29.39 ? 281 ASP A O     1 
ATOM   1212 C  CB    . ASP A 1 175 ? 30.406  -4.700 44.394  1.00 29.87 ? 281 ASP A CB    1 
ATOM   1213 C  CG    . ASP A 1 175 ? 30.535  -5.771 45.505  1.00 29.52 ? 281 ASP A CG    1 
ATOM   1214 O  OD1   . ASP A 1 175 ? 30.278  -6.970 45.266  1.00 27.80 ? 281 ASP A OD1   1 
ATOM   1215 O  OD2   . ASP A 1 175 ? 30.899  -5.462 46.670  1.00 28.28 ? 281 ASP A OD2   1 
ATOM   1216 N  N     . ASP A 1 176 ? 27.395  -4.109 42.961  1.00 30.31 ? 282 ASP A N     1 
ATOM   1217 C  CA    . ASP A 1 176 ? 26.518  -2.910 42.997  1.00 30.75 ? 282 ASP A CA    1 
ATOM   1218 C  C     . ASP A 1 176 ? 26.215  -2.467 44.432  1.00 30.61 ? 282 ASP A C     1 
ATOM   1219 O  O     . ASP A 1 176 ? 25.527  -1.487 44.639  1.00 30.96 ? 282 ASP A O     1 
ATOM   1220 C  CB    . ASP A 1 176 ? 25.224  -3.139 42.201  1.00 30.85 ? 282 ASP A CB    1 
ATOM   1221 C  CG    . ASP A 1 176 ? 25.489  -3.256 40.700  1.00 32.41 ? 282 ASP A CG    1 
ATOM   1222 O  OD1   . ASP A 1 176 ? 26.242  -2.398 40.185  1.00 35.69 ? 282 ASP A OD1   1 
ATOM   1223 O  OD2   . ASP A 1 176 ? 25.032  -4.165 39.963  1.00 32.13 ? 282 ASP A OD2   1 
ATOM   1224 N  N     . HIS A 1 177 ? 26.774  -3.173 45.413  1.00 31.06 ? 283 HIS A N     1 
ATOM   1225 C  CA    . HIS A 1 177 ? 26.493  -2.932 46.826  1.00 31.24 ? 283 HIS A CA    1 
ATOM   1226 C  C     . HIS A 1 177 ? 27.770  -2.945 47.698  1.00 31.50 ? 283 HIS A C     1 
ATOM   1227 O  O     . HIS A 1 177 ? 28.780  -3.551 47.358  1.00 30.96 ? 283 HIS A O     1 
ATOM   1228 C  CB    . HIS A 1 177 ? 25.469  -3.965 47.363  1.00 31.42 ? 283 HIS A CB    1 
ATOM   1229 C  CG    . HIS A 1 177 ? 24.426  -4.379 46.360  1.00 30.97 ? 283 HIS A CG    1 
ATOM   1230 N  ND1   . HIS A 1 177 ? 23.308  -3.619 46.090  1.00 28.75 ? 283 HIS A ND1   1 
ATOM   1231 C  CD2   . HIS A 1 177 ? 24.338  -5.470 45.559  1.00 30.56 ? 283 HIS A CD2   1 
ATOM   1232 C  CE1   . HIS A 1 177 ? 22.584  -4.215 45.159  1.00 27.59 ? 283 HIS A CE1   1 
ATOM   1233 N  NE2   . HIS A 1 177 ? 23.182  -5.343 44.827  1.00 29.36 ? 283 HIS A NE2   1 
HETATM 1234 N  N     . PTR A 1 178 ? 27.689  -2.229 48.819  1.00 32.26 ? 284 PTR A N     1 
HETATM 1235 C  CA    . PTR A 1 178 ? 28.707  -2.222 49.870  1.00 32.22 ? 284 PTR A CA    1 
HETATM 1236 C  C     . PTR A 1 178 ? 28.028  -2.524 51.236  1.00 32.37 ? 284 PTR A C     1 
HETATM 1237 O  O     . PTR A 1 178 ? 27.178  -1.737 51.706  1.00 32.31 ? 284 PTR A O     1 
HETATM 1238 C  CB    . PTR A 1 178 ? 29.455  -0.881 49.971  1.00 31.82 ? 284 PTR A CB    1 
HETATM 1239 C  CG    . PTR A 1 178 ? 30.151  -0.791 51.300  1.00 31.66 ? 284 PTR A CG    1 
HETATM 1240 C  CD1   . PTR A 1 178 ? 31.405  -1.363 51.490  1.00 31.18 ? 284 PTR A CD1   1 
HETATM 1241 C  CD2   . PTR A 1 178 ? 29.511  -0.220 52.396  1.00 31.37 ? 284 PTR A CD2   1 
HETATM 1242 C  CE1   . PTR A 1 178 ? 32.028  -1.338 52.724  1.00 31.78 ? 284 PTR A CE1   1 
HETATM 1243 C  CE2   . PTR A 1 178 ? 30.123  -0.178 53.629  1.00 32.00 ? 284 PTR A CE2   1 
HETATM 1244 C  CZ    . PTR A 1 178 ? 31.394  -0.727 53.792  1.00 33.71 ? 284 PTR A CZ    1 
HETATM 1245 O  OH    . PTR A 1 178 ? 31.945  -0.713 54.907  0.70 35.99 ? 284 PTR A OH    1 
HETATM 1246 P  P     . PTR A 1 178 ? 33.020  0.368  55.468  0.70 38.56 ? 284 PTR A P     1 
HETATM 1247 O  O1P   . PTR A 1 178 ? 33.800  -0.315 56.547  0.70 37.51 ? 284 PTR A O1P   1 
HETATM 1248 O  O2P   . PTR A 1 178 ? 32.237  1.571  56.054  0.70 34.35 ? 284 PTR A O2P   1 
HETATM 1249 O  O3P   . PTR A 1 178 ? 34.048  0.785  54.378  0.70 36.43 ? 284 PTR A O3P   1 
ATOM   1250 N  N     . VAL A 1 179 ? 28.409  -3.636 51.866  1.00 32.09 ? 285 VAL A N     1 
ATOM   1251 C  CA    . VAL A 1 179 ? 27.820  -4.024 53.146  1.00 32.14 ? 285 VAL A CA    1 
ATOM   1252 C  C     . VAL A 1 179 ? 28.735  -3.692 54.351  1.00 32.66 ? 285 VAL A C     1 
ATOM   1253 O  O     . VAL A 1 179 ? 29.760  -4.364 54.600  1.00 32.07 ? 285 VAL A O     1 
ATOM   1254 C  CB    . VAL A 1 179 ? 27.423  -5.504 53.134  1.00 31.88 ? 285 VAL A CB    1 
ATOM   1255 C  CG1   . VAL A 1 179 ? 27.008  -5.973 54.521  1.00 32.18 ? 285 VAL A CG1   1 
ATOM   1256 C  CG2   . VAL A 1 179 ? 26.292  -5.724 52.135  1.00 30.99 ? 285 VAL A CG2   1 
ATOM   1257 N  N     . MET A 1 180 ? 28.321  -2.643 55.078  1.00 33.16 ? 286 MET A N     1 
ATOM   1258 C  CA    . MET A 1 180 ? 29.005  -2.107 56.265  1.00 33.51 ? 286 MET A CA    1 
ATOM   1259 C  C     . MET A 1 180 ? 28.540  -2.791 57.549  1.00 33.83 ? 286 MET A C     1 
ATOM   1260 O  O     . MET A 1 180 ? 27.436  -3.372 57.580  1.00 34.34 ? 286 MET A O     1 
ATOM   1261 C  CB    . MET A 1 180 ? 28.726  -0.622 56.352  1.00 33.74 ? 286 MET A CB    1 
ATOM   1262 C  CG    . MET A 1 180 ? 29.093  0.045  57.624  1.00 35.23 ? 286 MET A CG    1 
ATOM   1263 S  SD    . MET A 1 180 ? 27.597  0.348  58.487  1.00 39.64 ? 286 MET A SD    1 
ATOM   1264 C  CE    . MET A 1 180 ? 27.204  2.018  57.805  1.00 38.11 ? 286 MET A CE    1 
ATOM   1265 N  N     . GLN A 1 181 ? 29.389  -2.741 58.594  1.00 34.00 ? 287 GLN A N     1 
ATOM   1266 C  CA    . GLN A 1 181 ? 29.175  -3.508 59.865  1.00 33.71 ? 287 GLN A CA    1 
ATOM   1267 C  C     . GLN A 1 181 ? 28.938  -2.584 61.112  1.00 33.64 ? 287 GLN A C     1 
ATOM   1268 O  O     . GLN A 1 181 ? 28.695  -1.351 60.962  1.00 32.44 ? 287 GLN A O     1 
ATOM   1269 C  CB    . GLN A 1 181 ? 30.291  -4.569 60.109  1.00 32.96 ? 287 GLN A CB    1 
ATOM   1270 C  CG    . GLN A 1 181 ? 30.818  -5.233 58.839  0.01 32.44 ? 287 GLN A CG    1 
ATOM   1271 C  CD    . GLN A 1 181 ? 31.800  -6.358 59.123  0.01 31.62 ? 287 GLN A CD    1 
ATOM   1272 O  OE1   . GLN A 1 181 ? 31.748  -7.407 58.480  0.01 31.25 ? 287 GLN A OE1   1 
ATOM   1273 N  NE2   . GLN A 1 181 ? 32.697  -6.142 60.079  0.01 31.26 ? 287 GLN A NE2   1 
ATOM   1274 N  N     . GLU A 1 182 ? 28.999  -3.204 62.309  1.00 33.63 ? 288 GLU A N     1 
ATOM   1275 C  CA    . GLU A 1 182 ? 28.344  -2.678 63.534  1.00 33.85 ? 288 GLU A CA    1 
ATOM   1276 C  C     . GLU A 1 182 ? 28.692  -1.207 63.854  1.00 34.38 ? 288 GLU A C     1 
ATOM   1277 O  O     . GLU A 1 182 ? 27.871  -0.311 63.590  1.00 34.96 ? 288 GLU A O     1 
ATOM   1278 C  CB    . GLU A 1 182 ? 28.584  -3.613 64.750  1.00 33.41 ? 288 GLU A CB    1 
ATOM   1279 C  CG    . GLU A 1 182 ? 27.929  -4.980 64.611  0.01 32.66 ? 288 GLU A CG    1 
ATOM   1280 C  CD    . GLU A 1 182 ? 27.722  -5.673 65.944  0.01 31.83 ? 288 GLU A CD    1 
ATOM   1281 O  OE1   . GLU A 1 182 ? 28.719  -5.895 66.662  0.01 31.43 ? 288 GLU A OE1   1 
ATOM   1282 O  OE2   . GLU A 1 182 ? 26.561  -5.999 66.273  0.01 31.40 ? 288 GLU A OE2   1 
ATOM   1283 N  N     . HIS A 1 183 ? 29.891  -0.973 64.403  1.00 34.78 ? 289 HIS A N     1 
ATOM   1284 C  CA    . HIS A 1 183 ? 30.480  0.386  64.622  1.00 34.84 ? 289 HIS A CA    1 
ATOM   1285 C  C     . HIS A 1 183 ? 29.797  1.532  63.894  1.00 35.21 ? 289 HIS A C     1 
ATOM   1286 O  O     . HIS A 1 183 ? 29.727  2.655  64.410  1.00 36.25 ? 289 HIS A O     1 
ATOM   1287 C  CB    . HIS A 1 183 ? 31.993  0.391  64.290  1.00 34.76 ? 289 HIS A CB    1 
ATOM   1288 C  CG    . HIS A 1 183 ? 32.718  -0.789 64.864  0.01 33.50 ? 289 HIS A CG    1 
ATOM   1289 N  ND1   . HIS A 1 183 ? 33.117  -0.846 66.182  0.01 32.47 ? 289 HIS A ND1   1 
ATOM   1290 C  CD2   . HIS A 1 183 ? 33.051  -1.983 64.318  0.01 32.47 ? 289 HIS A CD2   1 
ATOM   1291 C  CE1   . HIS A 1 183 ? 33.695  -2.011 66.415  0.01 32.02 ? 289 HIS A CE1   1 
ATOM   1292 N  NE2   . HIS A 1 183 ? 33.666  -2.720 65.301  0.01 32.07 ? 289 HIS A NE2   1 
ATOM   1293 N  N     . ARG A 1 184 ? 29.290  1.285  62.701  1.00 34.97 ? 290 ARG A N     1 
ATOM   1294 C  CA    . ARG A 1 184 ? 28.392  2.263  62.153  1.00 35.11 ? 290 ARG A CA    1 
ATOM   1295 C  C     . ARG A 1 184 ? 26.954  1.807  62.277  1.00 35.34 ? 290 ARG A C     1 
ATOM   1296 O  O     . ARG A 1 184 ? 26.065  2.652  62.458  1.00 36.74 ? 290 ARG A O     1 
ATOM   1297 C  CB    . ARG A 1 184 ? 28.780  2.583  60.705  1.00 35.44 ? 290 ARG A CB    1 
ATOM   1298 C  CG    . ARG A 1 184 ? 29.644  3.841  60.544  1.00 34.58 ? 290 ARG A CG    1 
ATOM   1299 C  CD    . ARG A 1 184 ? 31.098  3.615  60.873  1.00 33.57 ? 290 ARG A CD    1 
ATOM   1300 N  NE    . ARG A 1 184 ? 31.841  3.222  59.685  1.00 33.97 ? 290 ARG A NE    1 
ATOM   1301 C  CZ    . ARG A 1 184 ? 33.135  2.927  59.663  1.00 32.57 ? 290 ARG A CZ    1 
ATOM   1302 N  NH1   . ARG A 1 184 ? 33.873  2.972  60.767  1.00 30.86 ? 290 ARG A NH1   1 
ATOM   1303 N  NH2   . ARG A 1 184 ? 33.689  2.581  58.514  1.00 33.86 ? 290 ARG A NH2   1 
ATOM   1304 N  N     . VAL A 1 186 ? 26.087  5.876  60.824  1.00 35.28 ? 292 VAL A N     1 
ATOM   1305 C  CA    . VAL A 1 186 ? 24.905  6.335  60.060  1.00 35.10 ? 292 VAL A CA    1 
ATOM   1306 C  C     . VAL A 1 186 ? 23.860  6.929  60.941  1.00 34.67 ? 292 VAL A C     1 
ATOM   1307 O  O     . VAL A 1 186 ? 23.438  6.301  61.890  1.00 35.54 ? 292 VAL A O     1 
ATOM   1308 C  CB    . VAL A 1 186 ? 24.147  5.139  59.369  1.00 35.42 ? 292 VAL A CB    1 
ATOM   1309 C  CG1   . VAL A 1 186 ? 24.401  5.114  57.853  1.00 36.11 ? 292 VAL A CG1   1 
ATOM   1310 C  CG2   . VAL A 1 186 ? 24.524  3.772  60.024  1.00 34.93 ? 292 VAL A CG2   1 
ATOM   1311 N  N     . PRO A 1 187 ? 23.409  8.134  60.667  1.00 34.72 ? 293 PRO A N     1 
ATOM   1312 C  CA    . PRO A 1 187 ? 22.023  8.492  61.071  1.00 34.26 ? 293 PRO A CA    1 
ATOM   1313 C  C     . PRO A 1 187 ? 20.915  7.850  60.146  1.00 32.55 ? 293 PRO A C     1 
ATOM   1314 O  O     . PRO A 1 187 ? 20.856  7.970  58.898  1.00 31.43 ? 293 PRO A O     1 
ATOM   1315 C  CB    . PRO A 1 187 ? 22.025  10.056 61.104  1.00 34.22 ? 293 PRO A CB    1 
ATOM   1316 C  CG    . PRO A 1 187 ? 23.553  10.446 60.954  1.00 34.14 ? 293 PRO A CG    1 
ATOM   1317 C  CD    . PRO A 1 187 ? 24.144  9.295  60.123  1.00 35.18 ? 293 PRO A CD    1 
ATOM   1318 N  N     . PHE A 1 188 ? 20.052  7.130  60.851  1.00 30.93 ? 294 PHE A N     1 
ATOM   1319 C  CA    . PHE A 1 188 ? 19.085  6.202  60.280  1.00 29.30 ? 294 PHE A CA    1 
ATOM   1320 C  C     . PHE A 1 188 ? 18.097  6.925  59.370  1.00 28.36 ? 294 PHE A C     1 
ATOM   1321 O  O     . PHE A 1 188 ? 17.954  6.584  58.206  1.00 27.46 ? 294 PHE A O     1 
ATOM   1322 C  CB    . PHE A 1 188 ? 18.378  5.516  61.439  1.00 28.85 ? 294 PHE A CB    1 
ATOM   1323 C  CG    . PHE A 1 188 ? 19.309  4.739  62.336  1.00 28.84 ? 294 PHE A CG    1 
ATOM   1324 C  CD1   . PHE A 1 188 ? 19.609  5.195  63.615  0.01 28.54 ? 294 PHE A CD1   1 
ATOM   1325 C  CD2   . PHE A 1 188 ? 19.906  3.567  61.890  0.01 28.51 ? 294 PHE A CD2   1 
ATOM   1326 C  CE1   . PHE A 1 188 ? 20.476  4.487  64.438  0.01 28.41 ? 294 PHE A CE1   1 
ATOM   1327 C  CE2   . PHE A 1 188 ? 20.774  2.854  62.706  0.01 28.40 ? 294 PHE A CE2   1 
ATOM   1328 C  CZ    . PHE A 1 188 ? 21.061  3.317  63.981  0.01 28.36 ? 294 PHE A CZ    1 
ATOM   1329 N  N     . ALA A 1 189 ? 17.489  7.974  59.919  1.00 27.58 ? 295 ALA A N     1 
ATOM   1330 C  CA    . ALA A 1 189 ? 16.443  8.753  59.270  1.00 26.73 ? 295 ALA A CA    1 
ATOM   1331 C  C     . ALA A 1 189 ? 16.696  9.102  57.792  1.00 26.72 ? 295 ALA A C     1 
ATOM   1332 O  O     . ALA A 1 189 ? 15.742  9.452  57.097  1.00 25.91 ? 295 ALA A O     1 
ATOM   1333 C  CB    . ALA A 1 189 ? 16.191  10.036 60.080  1.00 26.15 ? 295 ALA A CB    1 
ATOM   1334 N  N     . TRP A 1 190 ? 17.953  9.051  57.312  1.00 26.42 ? 296 TRP A N     1 
ATOM   1335 C  CA    . TRP A 1 190 ? 18.233  9.335  55.893  1.00 26.33 ? 296 TRP A CA    1 
ATOM   1336 C  C     . TRP A 1 190 ? 18.324  8.059  54.993  1.00 26.99 ? 296 TRP A C     1 
ATOM   1337 O  O     . TRP A 1 190 ? 18.125  8.113  53.797  1.00 26.05 ? 296 TRP A O     1 
ATOM   1338 C  CB    . TRP A 1 190 ? 19.513  10.176 55.788  1.00 26.14 ? 296 TRP A CB    1 
ATOM   1339 C  CG    . TRP A 1 190 ? 19.339  11.644 56.068  1.00 25.82 ? 296 TRP A CG    1 
ATOM   1340 C  CD1   . TRP A 1 190 ? 19.339  12.634 55.152  1.00 25.78 ? 296 TRP A CD1   1 
ATOM   1341 C  CD2   . TRP A 1 190 ? 19.192  12.296 57.346  1.00 23.85 ? 296 TRP A CD2   1 
ATOM   1342 N  NE1   . TRP A 1 190 ? 19.180  13.856 55.764  1.00 24.80 ? 296 TRP A NE1   1 
ATOM   1343 C  CE2   . TRP A 1 190 ? 19.074  13.668 57.111  1.00 22.70 ? 296 TRP A CE2   1 
ATOM   1344 C  CE3   . TRP A 1 190 ? 19.117  11.856 58.657  1.00 23.52 ? 296 TRP A CE3   1 
ATOM   1345 C  CZ2   . TRP A 1 190 ? 18.874  14.580 58.123  1.00 21.01 ? 296 TRP A CZ2   1 
ATOM   1346 C  CZ3   . TRP A 1 190 ? 18.924  12.794 59.669  1.00 21.07 ? 296 TRP A CZ3   1 
ATOM   1347 C  CH2   . TRP A 1 190 ? 18.802  14.107 59.399  1.00 20.13 ? 296 TRP A CH2   1 
ATOM   1348 N  N     . CYS A 1 191 ? 18.614  6.895  55.557  1.00 28.33 ? 297 CYS A N     1 
ATOM   1349 C  CA    . CYS A 1 191 ? 18.947  5.751  54.701  1.00 29.74 ? 297 CYS A CA    1 
ATOM   1350 C  C     . CYS A 1 191 ? 17.741  4.995  54.159  1.00 30.20 ? 297 CYS A C     1 
ATOM   1351 O  O     . CYS A 1 191 ? 16.658  5.032  54.722  1.00 30.59 ? 297 CYS A O     1 
ATOM   1352 C  CB    . CYS A 1 191 ? 19.891  4.761  55.386  1.00 30.02 ? 297 CYS A CB    1 
ATOM   1353 S  SG    . CYS A 1 191 ? 20.346  5.169  57.057  1.00 32.69 ? 297 CYS A SG    1 
ATOM   1354 N  N     . ALA A 1 192 ? 17.967  4.270  53.068  1.00 30.46 ? 298 ALA A N     1 
ATOM   1355 C  CA    . ALA A 1 192 ? 16.900  3.547  52.423  1.00 30.66 ? 298 ALA A CA    1 
ATOM   1356 C  C     . ALA A 1 192 ? 16.503  2.389  53.324  1.00 30.93 ? 298 ALA A C     1 
ATOM   1357 O  O     . ALA A 1 192 ? 17.215  2.125  54.282  1.00 31.38 ? 298 ALA A O     1 
ATOM   1358 C  CB    . ALA A 1 192 ? 17.366  3.060  51.092  1.00 31.00 ? 298 ALA A CB    1 
ATOM   1359 N  N     . PRO A 1 193 ? 15.358  1.734  53.084  1.00 31.05 ? 299 PRO A N     1 
ATOM   1360 C  CA    . PRO A 1 193 ? 14.980  0.563  53.883  1.00 30.91 ? 299 PRO A CA    1 
ATOM   1361 C  C     . PRO A 1 193 ? 16.107  -0.464 53.940  1.00 31.26 ? 299 PRO A C     1 
ATOM   1362 O  O     . PRO A 1 193 ? 16.607  -0.751 55.034  1.00 32.11 ? 299 PRO A O     1 
ATOM   1363 C  CB    . PRO A 1 193 ? 13.758  0.028  53.146  1.00 30.81 ? 299 PRO A CB    1 
ATOM   1364 C  CG    . PRO A 1 193 ? 13.144  1.259  52.545  1.00 30.32 ? 299 PRO A CG    1 
ATOM   1365 C  CD    . PRO A 1 193 ? 14.294  2.089  52.122  1.00 30.90 ? 299 PRO A CD    1 
ATOM   1366 N  N     . GLU A 1 194 ? 16.533  -0.965 52.780  1.00 30.76 ? 300 GLU A N     1 
ATOM   1367 C  CA    . GLU A 1 194 ? 17.626  -1.933 52.689  1.00 29.86 ? 300 GLU A CA    1 
ATOM   1368 C  C     . GLU A 1 194 ? 18.825  -1.590 53.566  1.00 29.31 ? 300 GLU A C     1 
ATOM   1369 O  O     . GLU A 1 194 ? 19.571  -2.457 53.979  1.00 28.78 ? 300 GLU A O     1 
ATOM   1370 C  CB    . GLU A 1 194 ? 18.099  -2.002 51.259  1.00 29.61 ? 300 GLU A CB    1 
ATOM   1371 C  CG    . GLU A 1 194 ? 18.801  -0.737 50.819  1.00 30.85 ? 300 GLU A CG    1 
ATOM   1372 C  CD    . GLU A 1 194 ? 18.116  -0.093 49.651  1.00 33.64 ? 300 GLU A CD    1 
ATOM   1373 O  OE1   . GLU A 1 194 ? 16.972  0.400  49.815  1.00 34.02 ? 300 GLU A OE1   1 
ATOM   1374 O  OE2   . GLU A 1 194 ? 18.740  -0.093 48.571  1.00 36.29 ? 300 GLU A OE2   1 
ATOM   1375 N  N     . SER A 1 195 ? 19.006  -0.311 53.843  1.00 29.14 ? 301 SER A N     1 
ATOM   1376 C  CA    . SER A 1 195 ? 20.206  0.156  54.502  1.00 29.12 ? 301 SER A CA    1 
ATOM   1377 C  C     . SER A 1 195 ? 20.158  -0.030 55.999  1.00 29.18 ? 301 SER A C     1 
ATOM   1378 O  O     . SER A 1 195 ? 21.186  -0.240 56.631  1.00 29.60 ? 301 SER A O     1 
ATOM   1379 C  CB    . SER A 1 195 ? 20.477  1.613  54.130  1.00 28.76 ? 301 SER A CB    1 
ATOM   1380 O  OG    . SER A 1 195 ? 20.772  1.700  52.753  1.00 27.23 ? 301 SER A OG    1 
ATOM   1381 N  N     . LEU A 1 196 ? 18.977  0.039  56.573  1.00 29.50 ? 302 LEU A N     1 
ATOM   1382 C  CA    . LEU A 1 196 ? 18.866  -0.111 58.020  1.00 30.09 ? 302 LEU A CA    1 
ATOM   1383 C  C     . LEU A 1 196 ? 18.665  -1.578 58.440  1.00 29.89 ? 302 LEU A C     1 
ATOM   1384 O  O     . LEU A 1 196 ? 19.173  -1.974 59.482  1.00 29.83 ? 302 LEU A O     1 
ATOM   1385 C  CB    . LEU A 1 196 ? 17.762  0.790  58.583  1.00 30.49 ? 302 LEU A CB    1 
ATOM   1386 C  CG    . LEU A 1 196 ? 17.525  2.135  57.884  1.00 31.22 ? 302 LEU A CG    1 
ATOM   1387 C  CD1   . LEU A 1 196 ? 16.079  2.286  57.485  1.00 32.61 ? 302 LEU A CD1   1 
ATOM   1388 C  CD2   . LEU A 1 196 ? 17.904  3.261  58.759  1.00 32.21 ? 302 LEU A CD2   1 
ATOM   1389 N  N     . LYS A 1 197 ? 17.957  -2.380 57.639  1.00 29.58 ? 303 LYS A N     1 
ATOM   1390 C  CA    . LYS A 1 197 ? 17.932  -3.842 57.876  1.00 29.82 ? 303 LYS A CA    1 
ATOM   1391 C  C     . LYS A 1 197 ? 19.289  -4.509 57.655  1.00 28.60 ? 303 LYS A C     1 
ATOM   1392 O  O     . LYS A 1 197 ? 19.760  -5.268 58.508  1.00 28.50 ? 303 LYS A O     1 
ATOM   1393 C  CB    . LYS A 1 197 ? 16.870  -4.611 57.035  1.00 30.45 ? 303 LYS A CB    1 
ATOM   1394 C  CG    . LYS A 1 197 ? 16.494  -4.041 55.618  1.00 32.00 ? 303 LYS A CG    1 
ATOM   1395 C  CD    . LYS A 1 197 ? 15.843  -5.168 54.725  1.00 31.89 ? 303 LYS A CD    1 
ATOM   1396 C  CE    . LYS A 1 197 ? 14.546  -4.729 53.995  1.00 31.58 ? 303 LYS A CE    1 
ATOM   1397 N  NZ    . LYS A 1 197 ? 14.772  -3.706 52.905  1.00 31.48 ? 303 LYS A NZ    1 
ATOM   1398 N  N     . THR A 1 198 ? 19.906  -4.225 56.513  1.00 27.23 ? 304 THR A N     1 
ATOM   1399 C  CA    . THR A 1 198 ? 21.044  -5.014 56.057  1.00 26.05 ? 304 THR A CA    1 
ATOM   1400 C  C     . THR A 1 198 ? 22.366  -4.269 55.961  1.00 25.70 ? 304 THR A C     1 
ATOM   1401 O  O     . THR A 1 198 ? 23.359  -4.855 55.585  1.00 24.63 ? 304 THR A O     1 
ATOM   1402 C  CB    . THR A 1 198 ? 20.683  -5.716 54.726  1.00 25.81 ? 304 THR A CB    1 
ATOM   1403 O  OG1   . THR A 1 198 ? 20.670  -4.795 53.640  1.00 24.44 ? 304 THR A OG1   1 
ATOM   1404 C  CG2   . THR A 1 198 ? 19.266  -6.224 54.769  1.00 25.61 ? 304 THR A CG2   1 
ATOM   1405 N  N     . ARG A 1 199 ? 22.381  -2.992 56.345  1.00 25.86 ? 305 ARG A N     1 
ATOM   1406 C  CA    . ARG A 1 199 ? 23.557  -2.148 56.201  1.00 25.77 ? 305 ARG A CA    1 
ATOM   1407 C  C     . ARG A 1 199 ? 24.121  -2.308 54.797  1.00 25.63 ? 305 ARG A C     1 
ATOM   1408 O  O     . ARG A 1 199 ? 25.248  -2.726 54.624  1.00 26.14 ? 305 ARG A O     1 
ATOM   1409 C  CB    . ARG A 1 199 ? 24.602  -2.487 57.267  1.00 25.99 ? 305 ARG A CB    1 
ATOM   1410 C  CG    . ARG A 1 199 ? 24.084  -2.456 58.700  0.01 26.36 ? 305 ARG A CG    1 
ATOM   1411 C  CD    . ARG A 1 199 ? 23.412  -1.148 59.097  0.01 26.85 ? 305 ARG A CD    1 
ATOM   1412 N  NE    . ARG A 1 199 ? 23.420  -0.938 60.544  0.01 27.16 ? 305 ARG A NE    1 
ATOM   1413 C  CZ    . ARG A 1 199 ? 22.879  0.111  61.161  0.01 27.40 ? 305 ARG A CZ    1 
ATOM   1414 N  NH1   . ARG A 1 199 ? 22.944  0.204  62.485  0.01 27.50 ? 305 ARG A NH1   1 
ATOM   1415 N  NH2   . ARG A 1 199 ? 22.273  1.070  60.466  0.01 27.53 ? 305 ARG A NH2   1 
ATOM   1416 N  N     . THR A 1 200 ? 23.313  -1.962 53.806  1.00 25.54 ? 306 THR A N     1 
ATOM   1417 C  CA    . THR A 1 200 ? 23.631  -2.169 52.404  1.00 25.91 ? 306 THR A CA    1 
ATOM   1418 C  C     . THR A 1 200 ? 23.433  -0.933 51.547  1.00 26.65 ? 306 THR A C     1 
ATOM   1419 O  O     . THR A 1 200 ? 22.304  -0.497 51.360  1.00 27.84 ? 306 THR A O     1 
ATOM   1420 C  CB    . THR A 1 200 ? 22.718  -3.199 51.911  1.00 25.61 ? 306 THR A CB    1 
ATOM   1421 O  OG1   . THR A 1 200 ? 23.011  -4.399 52.612  1.00 25.75 ? 306 THR A OG1   1 
ATOM   1422 C  CG2   . THR A 1 200 ? 22.979  -3.513 50.459  1.00 26.36 ? 306 THR A CG2   1 
ATOM   1423 N  N     . PHE A 1 201 ? 24.519  -0.408 50.977  1.00 26.70 ? 307 PHE A N     1 
ATOM   1424 C  CA    . PHE A 1 201 ? 24.498  0.892  50.311  1.00 26.37 ? 307 PHE A CA    1 
ATOM   1425 C  C     . PHE A 1 201 ? 24.745  0.759  48.800  1.00 26.24 ? 307 PHE A C     1 
ATOM   1426 O  O     . PHE A 1 201 ? 25.564  -0.040 48.347  1.00 25.68 ? 307 PHE A O     1 
ATOM   1427 C  CB    . PHE A 1 201 ? 25.484  1.815  51.015  1.00 26.06 ? 307 PHE A CB    1 
ATOM   1428 C  CG    . PHE A 1 201 ? 25.132  2.003  52.449  1.00 27.79 ? 307 PHE A CG    1 
ATOM   1429 C  CD1   . PHE A 1 201 ? 24.579  3.216  52.909  1.00 29.08 ? 307 PHE A CD1   1 
ATOM   1430 C  CD2   . PHE A 1 201 ? 25.234  0.935  53.337  1.00 29.32 ? 307 PHE A CD2   1 
ATOM   1431 C  CE1   . PHE A 1 201 ? 24.206  3.374  54.231  1.00 28.45 ? 307 PHE A CE1   1 
ATOM   1432 C  CE2   . PHE A 1 201 ? 24.842  1.080  54.662  1.00 30.17 ? 307 PHE A CE2   1 
ATOM   1433 C  CZ    . PHE A 1 201 ? 24.328  2.299  55.111  1.00 29.35 ? 307 PHE A CZ    1 
ATOM   1434 N  N     . SER A 1 202 ? 23.947  1.498  48.042  1.00 26.38 ? 308 SER A N     1 
ATOM   1435 C  CA    . SER A 1 202 ? 23.896  1.429  46.586  1.00 26.36 ? 308 SER A CA    1 
ATOM   1436 C  C     . SER A 1 202 ? 24.054  2.857  46.106  1.00 26.47 ? 308 SER A C     1 
ATOM   1437 O  O     . SER A 1 202 ? 24.144  3.768  46.939  1.00 26.42 ? 308 SER A O     1 
ATOM   1438 C  CB    . SER A 1 202 ? 22.518  0.882  46.117  1.00 26.47 ? 308 SER A CB    1 
ATOM   1439 O  OG    . SER A 1 202 ? 21.708  0.305  47.155  1.00 24.77 ? 308 SER A OG    1 
ATOM   1440 N  N     . HIS A 1 203 ? 24.081  3.068  44.786  1.00 26.40 ? 309 HIS A N     1 
ATOM   1441 C  CA    . HIS A 1 203 ? 23.688  4.392  44.241  1.00 26.06 ? 309 HIS A CA    1 
ATOM   1442 C  C     . HIS A 1 203 ? 22.184  4.596  44.368  1.00 25.62 ? 309 HIS A C     1 
ATOM   1443 O  O     . HIS A 1 203 ? 21.753  5.707  44.464  1.00 25.02 ? 309 HIS A O     1 
ATOM   1444 C  CB    . HIS A 1 203 ? 24.030  4.592  42.777  1.00 25.78 ? 309 HIS A CB    1 
ATOM   1445 C  CG    . HIS A 1 203 ? 25.478  4.494  42.482  1.00 25.61 ? 309 HIS A CG    1 
ATOM   1446 N  ND1   . HIS A 1 203 ? 26.336  5.556  42.620  1.00 28.29 ? 309 HIS A ND1   1 
ATOM   1447 C  CD2   . HIS A 1 203 ? 26.226  3.458  42.058  1.00 26.35 ? 309 HIS A CD2   1 
ATOM   1448 C  CE1   . HIS A 1 203 ? 27.556  5.182  42.292  1.00 26.09 ? 309 HIS A CE1   1 
ATOM   1449 N  NE2   . HIS A 1 203 ? 27.516  3.914  41.950  1.00 26.61 ? 309 HIS A NE2   1 
ATOM   1450 N  N     . ALA A 1 204 ? 21.405  3.521  44.337  1.00 25.80 ? 310 ALA A N     1 
ATOM   1451 C  CA    . ALA A 1 204 ? 19.994  3.605  44.665  1.00 26.53 ? 310 ALA A CA    1 
ATOM   1452 C  C     . ALA A 1 204 ? 19.722  4.190  46.078  1.00 27.38 ? 310 ALA A C     1 
ATOM   1453 O  O     . ALA A 1 204 ? 18.966  5.181  46.238  1.00 27.29 ? 310 ALA A O     1 
ATOM   1454 C  CB    . ALA A 1 204 ? 19.374  2.275  44.539  1.00 26.31 ? 310 ALA A CB    1 
ATOM   1455 N  N     . SER A 1 205 ? 20.313  3.557  47.095  1.00 27.88 ? 311 SER A N     1 
ATOM   1456 C  CA    . SER A 1 205 ? 20.309  4.092  48.455  1.00 27.57 ? 311 SER A CA    1 
ATOM   1457 C  C     . SER A 1 205 ? 20.720  5.533  48.445  1.00 27.10 ? 311 SER A C     1 
ATOM   1458 O  O     . SER A 1 205 ? 19.992  6.320  48.940  1.00 27.39 ? 311 SER A O     1 
ATOM   1459 C  CB    . SER A 1 205 ? 21.233  3.312  49.367  1.00 27.56 ? 311 SER A CB    1 
ATOM   1460 O  OG    . SER A 1 205 ? 22.572  3.666  49.096  1.00 28.74 ? 311 SER A OG    1 
ATOM   1461 N  N     . ASP A 1 206 ? 21.845  5.901  47.843  1.00 27.46 ? 312 ASP A N     1 
ATOM   1462 C  CA    . ASP A 1 206 ? 22.260  7.328  47.807  1.00 28.04 ? 312 ASP A CA    1 
ATOM   1463 C  C     . ASP A 1 206 ? 21.184  8.301  47.243  1.00 28.13 ? 312 ASP A C     1 
ATOM   1464 O  O     . ASP A 1 206 ? 21.140  9.460  47.589  1.00 28.13 ? 312 ASP A O     1 
ATOM   1465 C  CB    . ASP A 1 206 ? 23.536  7.501  46.965  1.00 28.28 ? 312 ASP A CB    1 
ATOM   1466 C  CG    . ASP A 1 206 ? 24.777  7.793  47.799  1.00 28.69 ? 312 ASP A CG    1 
ATOM   1467 O  OD1   . ASP A 1 206 ? 24.664  8.066  49.018  1.00 29.91 ? 312 ASP A OD1   1 
ATOM   1468 O  OD2   . ASP A 1 206 ? 25.921  7.790  47.293  1.00 28.02 ? 312 ASP A OD2   1 
ATOM   1469 N  N     . THR A 1 207 ? 20.340  7.793  46.357  1.00 28.43 ? 313 THR A N     1 
ATOM   1470 C  CA    . THR A 1 207 ? 19.263  8.524  45.709  1.00 28.29 ? 313 THR A CA    1 
ATOM   1471 C  C     . THR A 1 207 ? 18.035  8.668  46.617  1.00 28.61 ? 313 THR A C     1 
ATOM   1472 O  O     . THR A 1 207 ? 17.336  9.698  46.628  1.00 28.62 ? 313 THR A O     1 
ATOM   1473 C  CB    . THR A 1 207 ? 18.925  7.784  44.401  1.00 27.77 ? 313 THR A CB    1 
ATOM   1474 O  OG1   . THR A 1 207 ? 19.767  8.299  43.367  1.00 28.38 ? 313 THR A OG1   1 
ATOM   1475 C  CG2   . THR A 1 207 ? 17.527  8.072  43.910  1.00 28.32 ? 313 THR A CG2   1 
ATOM   1476 N  N     . TRP A 1 208 ? 17.766  7.614  47.375  1.00 28.65 ? 314 TRP A N     1 
ATOM   1477 C  CA    . TRP A 1 208 ? 16.870  7.713  48.520  1.00 28.13 ? 314 TRP A CA    1 
ATOM   1478 C  C     . TRP A 1 208 ? 17.365  8.887  49.371  1.00 27.49 ? 314 TRP A C     1 
ATOM   1479 O  O     . TRP A 1 208 ? 16.648  9.856  49.564  1.00 26.61 ? 314 TRP A O     1 
ATOM   1480 C  CB    . TRP A 1 208 ? 16.849  6.375  49.267  1.00 28.29 ? 314 TRP A CB    1 
ATOM   1481 C  CG    . TRP A 1 208 ? 15.974  6.367  50.412  1.00 28.65 ? 314 TRP A CG    1 
ATOM   1482 C  CD1   . TRP A 1 208 ? 16.257  6.871  51.616  1.00 29.99 ? 314 TRP A CD1   1 
ATOM   1483 C  CD2   . TRP A 1 208 ? 14.663  5.801  50.502  1.00 30.38 ? 314 TRP A CD2   1 
ATOM   1484 N  NE1   . TRP A 1 208 ? 15.205  6.684  52.474  1.00 32.03 ? 314 TRP A NE1   1 
ATOM   1485 C  CE2   . TRP A 1 208 ? 14.203  6.026  51.804  1.00 32.14 ? 314 TRP A CE2   1 
ATOM   1486 C  CE3   . TRP A 1 208 ? 13.822  5.119  49.614  1.00 29.11 ? 314 TRP A CE3   1 
ATOM   1487 C  CZ2   . TRP A 1 208 ? 12.929  5.589  52.244  1.00 30.61 ? 314 TRP A CZ2   1 
ATOM   1488 C  CZ3   . TRP A 1 208 ? 12.555  4.729  50.049  1.00 28.04 ? 314 TRP A CZ3   1 
ATOM   1489 C  CH2   . TRP A 1 208 ? 12.127  4.961  51.342  1.00 27.27 ? 314 TRP A CH2   1 
ATOM   1490 N  N     . MET A 1 209 ? 18.631  8.852  49.784  1.00 27.50 ? 315 MET A N     1 
ATOM   1491 C  CA    . MET A 1 209 ? 19.182  9.913  50.652  1.00 27.59 ? 315 MET A CA    1 
ATOM   1492 C  C     . MET A 1 209 ? 19.055  11.303 50.104  1.00 27.61 ? 315 MET A C     1 
ATOM   1493 O  O     . MET A 1 209 ? 18.946  12.217 50.891  1.00 27.98 ? 315 MET A O     1 
ATOM   1494 C  CB    . MET A 1 209 ? 20.642  9.712  50.944  1.00 27.61 ? 315 MET A CB    1 
ATOM   1495 C  CG    . MET A 1 209 ? 20.925  8.445  51.654  1.00 28.04 ? 315 MET A CG    1 
ATOM   1496 S  SD    . MET A 1 209 ? 22.636  8.420  52.177  1.00 26.90 ? 315 MET A SD    1 
ATOM   1497 C  CE    . MET A 1 209 ? 22.354  8.098  53.855  1.00 27.59 ? 315 MET A CE    1 
ATOM   1498 N  N     . PHE A 1 210 ? 19.098  11.455 48.772  1.00 27.56 ? 316 PHE A N     1 
ATOM   1499 C  CA    . PHE A 1 210 ? 18.996  12.758 48.086  1.00 27.15 ? 316 PHE A CA    1 
ATOM   1500 C  C     . PHE A 1 210 ? 17.552  13.294 48.195  1.00 27.79 ? 316 PHE A C     1 
ATOM   1501 O  O     . PHE A 1 210 ? 17.303  14.421 48.637  1.00 26.53 ? 316 PHE A O     1 
ATOM   1502 C  CB    . PHE A 1 210 ? 19.398  12.569 46.618  1.00 27.16 ? 316 PHE A CB    1 
ATOM   1503 C  CG    . PHE A 1 210 ? 19.182  13.763 45.765  1.00 25.50 ? 316 PHE A CG    1 
ATOM   1504 C  CD1   . PHE A 1 210 ? 20.141  14.727 45.661  1.00 27.06 ? 316 PHE A CD1   1 
ATOM   1505 C  CD2   . PHE A 1 210 ? 18.051  13.890 45.031  1.00 26.29 ? 316 PHE A CD2   1 
ATOM   1506 C  CE1   . PHE A 1 210 ? 19.938  15.889 44.881  1.00 29.93 ? 316 PHE A CE1   1 
ATOM   1507 C  CE2   . PHE A 1 210 ? 17.849  15.008 44.222  1.00 30.28 ? 316 PHE A CE2   1 
ATOM   1508 C  CZ    . PHE A 1 210 ? 18.809  16.026 44.161  1.00 29.96 ? 316 PHE A CZ    1 
ATOM   1509 N  N     . GLY A 1 211 ? 16.596  12.450 47.794  1.00 28.35 ? 317 GLY A N     1 
ATOM   1510 C  CA    . GLY A 1 211 ? 15.198  12.653 48.124  1.00 28.24 ? 317 GLY A CA    1 
ATOM   1511 C  C     . GLY A 1 211 ? 15.032  13.301 49.480  1.00 28.30 ? 317 GLY A C     1 
ATOM   1512 O  O     . GLY A 1 211 ? 14.441  14.360 49.559  1.00 29.29 ? 317 GLY A O     1 
ATOM   1513 N  N     . VAL A 1 212 ? 15.588  12.695 50.528  1.00 27.72 ? 318 VAL A N     1 
ATOM   1514 C  CA    . VAL A 1 212 ? 15.424  13.164 51.892  1.00 26.94 ? 318 VAL A CA    1 
ATOM   1515 C  C     . VAL A 1 212 ? 16.134  14.483 52.091  1.00 27.11 ? 318 VAL A C     1 
ATOM   1516 O  O     . VAL A 1 212 ? 15.615  15.391 52.778  1.00 27.77 ? 318 VAL A O     1 
ATOM   1517 C  CB    . VAL A 1 212 ? 16.036  12.181 52.870  1.00 27.51 ? 318 VAL A CB    1 
ATOM   1518 C  CG1   . VAL A 1 212 ? 16.112  12.754 54.306  1.00 27.48 ? 318 VAL A CG1   1 
ATOM   1519 C  CG2   . VAL A 1 212 ? 15.289  10.830 52.834  1.00 27.70 ? 318 VAL A CG2   1 
ATOM   1520 N  N     . THR A 1 213 ? 17.340  14.592 51.538  1.00 26.47 ? 319 THR A N     1 
ATOM   1521 C  CA    . THR A 1 213 ? 18.095  15.847 51.580  1.00 25.59 ? 319 THR A CA    1 
ATOM   1522 C  C     . THR A 1 213 ? 17.316  17.015 50.995  1.00 25.98 ? 319 THR A C     1 
ATOM   1523 O  O     . THR A 1 213 ? 17.159  18.061 51.628  1.00 23.89 ? 319 THR A O     1 
ATOM   1524 C  CB    . THR A 1 213 ? 19.332  15.704 50.789  1.00 25.16 ? 319 THR A CB    1 
ATOM   1525 O  OG1   . THR A 1 213 ? 20.057  14.604 51.314  1.00 22.70 ? 319 THR A OG1   1 
ATOM   1526 C  CG2   . THR A 1 213 ? 20.214  16.923 50.967  1.00 24.26 ? 319 THR A CG2   1 
ATOM   1527 N  N     . LEU A 1 214 ? 16.867  16.816 49.753  1.00 27.51 ? 320 LEU A N     1 
ATOM   1528 C  CA    . LEU A 1 214 ? 15.822  17.640 49.125  1.00 28.30 ? 320 LEU A CA    1 
ATOM   1529 C  C     . LEU A 1 214 ? 14.754  17.973 50.137  1.00 28.28 ? 320 LEU A C     1 
ATOM   1530 O  O     . LEU A 1 214 ? 14.468  19.135 50.369  1.00 28.65 ? 320 LEU A O     1 
ATOM   1531 C  CB    . LEU A 1 214 ? 15.154  16.911 47.944  1.00 28.68 ? 320 LEU A CB    1 
ATOM   1532 C  CG    . LEU A 1 214 ? 15.385  17.400 46.499  1.00 29.86 ? 320 LEU A CG    1 
ATOM   1533 C  CD1   . LEU A 1 214 ? 14.357  16.797 45.563  1.00 29.93 ? 320 LEU A CD1   1 
ATOM   1534 C  CD2   . LEU A 1 214 ? 15.306  18.943 46.411  1.00 32.01 ? 320 LEU A CD2   1 
ATOM   1535 N  N     . TRP A 1 215 ? 14.177  16.957 50.756  1.00 28.05 ? 321 TRP A N     1 
ATOM   1536 C  CA    . TRP A 1 215 ? 13.059  17.211 51.619  1.00 28.36 ? 321 TRP A CA    1 
ATOM   1537 C  C     . TRP A 1 215 ? 13.429  18.218 52.727  1.00 28.33 ? 321 TRP A C     1 
ATOM   1538 O  O     . TRP A 1 215 ? 12.645  19.112 53.031  1.00 29.00 ? 321 TRP A O     1 
ATOM   1539 C  CB    . TRP A 1 215 ? 12.458  15.907 52.124  1.00 28.36 ? 321 TRP A CB    1 
ATOM   1540 C  CG    . TRP A 1 215 ? 11.268  16.064 53.077  1.00 29.89 ? 321 TRP A CG    1 
ATOM   1541 C  CD1   . TRP A 1 215 ? 9.928   16.092 52.750  1.00 30.97 ? 321 TRP A CD1   1 
ATOM   1542 C  CD2   . TRP A 1 215 ? 11.320  16.220 54.509  1.00 29.21 ? 321 TRP A CD2   1 
ATOM   1543 N  NE1   . TRP A 1 215 ? 9.157   16.251 53.882  1.00 28.66 ? 321 TRP A NE1   1 
ATOM   1544 C  CE2   . TRP A 1 215 ? 9.980   16.327 54.974  1.00 27.52 ? 321 TRP A CE2   1 
ATOM   1545 C  CE3   . TRP A 1 215 ? 12.362  16.297 55.445  1.00 26.83 ? 321 TRP A CE3   1 
ATOM   1546 C  CZ2   . TRP A 1 215 ? 9.666   16.465 56.309  1.00 23.57 ? 321 TRP A CZ2   1 
ATOM   1547 C  CZ3   . TRP A 1 215 ? 12.047  16.454 56.757  1.00 26.21 ? 321 TRP A CZ3   1 
ATOM   1548 C  CH2   . TRP A 1 215 ? 10.697  16.542 57.181  1.00 24.85 ? 321 TRP A CH2   1 
ATOM   1549 N  N     . GLU A 1 216 ? 14.627  18.161 53.283  1.00 28.72 ? 322 GLU A N     1 
ATOM   1550 C  CA    . GLU A 1 216 ? 15.001  19.136 54.351  1.00 28.59 ? 322 GLU A CA    1 
ATOM   1551 C  C     . GLU A 1 216 ? 15.163  20.557 53.819  1.00 28.67 ? 322 GLU A C     1 
ATOM   1552 O  O     . GLU A 1 216 ? 14.989  21.536 54.535  1.00 28.13 ? 322 GLU A O     1 
ATOM   1553 C  CB    . GLU A 1 216 ? 16.335  18.814 55.005  1.00 28.16 ? 322 GLU A CB    1 
ATOM   1554 C  CG    . GLU A 1 216 ? 16.558  17.413 55.498  1.00 29.51 ? 322 GLU A CG    1 
ATOM   1555 C  CD    . GLU A 1 216 ? 18.013  17.228 55.941  1.00 32.14 ? 322 GLU A CD    1 
ATOM   1556 O  OE1   . GLU A 1 216 ? 18.761  16.589 55.147  1.00 31.20 ? 322 GLU A OE1   1 
ATOM   1557 O  OE2   . GLU A 1 216 ? 18.395  17.741 57.055  1.00 29.73 ? 322 GLU A OE2   1 
ATOM   1558 N  N     . MET A 1 217 ? 15.602  20.645 52.576  1.00 29.07 ? 323 MET A N     1 
ATOM   1559 C  CA    . MET A 1 217 ? 15.867  21.917 51.960  1.00 29.25 ? 323 MET A CA    1 
ATOM   1560 C  C     . MET A 1 217 ? 14.609  22.731 51.858  1.00 29.06 ? 323 MET A C     1 
ATOM   1561 O  O     . MET A 1 217 ? 14.666  23.921 52.128  1.00 29.57 ? 323 MET A O     1 
ATOM   1562 C  CB    . MET A 1 217 ? 16.418  21.727 50.561  1.00 29.70 ? 323 MET A CB    1 
ATOM   1563 C  CG    . MET A 1 217 ? 17.858  21.282 50.498  1.00 29.32 ? 323 MET A CG    1 
ATOM   1564 S  SD    . MET A 1 217 ? 18.356  21.535 48.770  1.00 30.30 ? 323 MET A SD    1 
ATOM   1565 C  CE    . MET A 1 217 ? 19.564  20.427 48.663  1.00 30.24 ? 323 MET A CE    1 
ATOM   1566 N  N     . PHE A 1 218 ? 13.500  22.094 51.467  1.00 28.93 ? 324 PHE A N     1 
ATOM   1567 C  CA    . PHE A 1 218 ? 12.197  22.758 51.321  1.00 29.26 ? 324 PHE A CA    1 
ATOM   1568 C  C     . PHE A 1 218 ? 11.327  22.645 52.585  1.00 29.33 ? 324 PHE A C     1 
ATOM   1569 O  O     . PHE A 1 218 ? 10.159  23.028 52.570  1.00 30.97 ? 324 PHE A O     1 
ATOM   1570 C  CB    . PHE A 1 218 ? 11.408  22.162 50.134  1.00 29.64 ? 324 PHE A CB    1 
ATOM   1571 C  CG    . PHE A 1 218 ? 12.025  22.429 48.769  1.00 29.68 ? 324 PHE A CG    1 
ATOM   1572 C  CD1   . PHE A 1 218 ? 11.621  23.493 48.015  1.00 28.55 ? 324 PHE A CD1   1 
ATOM   1573 C  CD2   . PHE A 1 218 ? 13.000  21.598 48.239  1.00 29.08 ? 324 PHE A CD2   1 
ATOM   1574 C  CE1   . PHE A 1 218 ? 12.190  23.729 46.781  1.00 27.60 ? 324 PHE A CE1   1 
ATOM   1575 C  CE2   . PHE A 1 218 ? 13.556  21.863 47.005  1.00 26.87 ? 324 PHE A CE2   1 
ATOM   1576 C  CZ    . PHE A 1 218 ? 13.153  22.920 46.292  1.00 25.07 ? 324 PHE A CZ    1 
ATOM   1577 N  N     . THR A 1 219 ? 11.837  22.069 53.664  1.00 28.58 ? 325 THR A N     1 
ATOM   1578 C  CA    . THR A 1 219 ? 11.184  22.248 54.963  1.00 27.50 ? 325 THR A CA    1 
ATOM   1579 C  C     . THR A 1 219 ? 11.958  23.284 55.764  1.00 27.08 ? 325 THR A C     1 
ATOM   1580 O  O     . THR A 1 219 ? 11.535  23.688 56.820  1.00 27.79 ? 325 THR A O     1 
ATOM   1581 C  CB    . THR A 1 219 ? 11.047  20.907 55.752  1.00 27.43 ? 325 THR A CB    1 
ATOM   1582 O  OG1   . THR A 1 219 ? 12.254  20.141 55.671  1.00 25.51 ? 325 THR A OG1   1 
ATOM   1583 C  CG2   . THR A 1 219 ? 9.973   19.980 55.147  1.00 26.57 ? 325 THR A CG2   1 
ATOM   1584 N  N     . TYR A 1 220 ? 13.088  23.717 55.223  1.00 26.92 ? 326 TYR A N     1 
ATOM   1585 C  CA    . TYR A 1 220 ? 13.987  24.725 55.805  1.00 26.38 ? 326 TYR A CA    1 
ATOM   1586 C  C     . TYR A 1 220 ? 14.689  24.218 57.005  1.00 25.08 ? 326 TYR A C     1 
ATOM   1587 O  O     . TYR A 1 220 ? 14.830  24.912 58.004  1.00 24.66 ? 326 TYR A O     1 
ATOM   1588 C  CB    . TYR A 1 220 ? 13.277  26.044 56.076  1.00 27.03 ? 326 TYR A CB    1 
ATOM   1589 C  CG    . TYR A 1 220 ? 12.708  26.649 54.808  1.00 28.29 ? 326 TYR A CG    1 
ATOM   1590 C  CD1   . TYR A 1 220 ? 13.529  27.286 53.901  1.00 28.18 ? 326 TYR A CD1   1 
ATOM   1591 C  CD2   . TYR A 1 220 ? 11.356  26.534 54.508  1.00 29.74 ? 326 TYR A CD2   1 
ATOM   1592 C  CE1   . TYR A 1 220 ? 13.024  27.811 52.720  1.00 30.34 ? 326 TYR A CE1   1 
ATOM   1593 C  CE2   . TYR A 1 220 ? 10.822  27.077 53.325  1.00 31.64 ? 326 TYR A CE2   1 
ATOM   1594 C  CZ    . TYR A 1 220 ? 11.667  27.714 52.422  1.00 31.96 ? 326 TYR A CZ    1 
ATOM   1595 O  OH    . TYR A 1 220 ? 11.161  28.268 51.233  1.00 33.74 ? 326 TYR A OH    1 
ATOM   1596 N  N     . GLY A 1 221 ? 15.159  22.987 56.867  1.00 23.91 ? 327 GLY A N     1 
ATOM   1597 C  CA    . GLY A 1 221 ? 15.885  22.325 57.924  1.00 23.85 ? 327 GLY A CA    1 
ATOM   1598 C  C     . GLY A 1 221 ? 15.039  21.512 58.896  1.00 23.36 ? 327 GLY A C     1 
ATOM   1599 O  O     . GLY A 1 221 ? 15.363  21.397 60.082  1.00 23.81 ? 327 GLY A O     1 
ATOM   1600 N  N     . GLN A 1 222 ? 13.960  20.935 58.421  1.00 22.63 ? 328 GLN A N     1 
ATOM   1601 C  CA    . GLN A 1 222 ? 13.148  20.202 59.300  1.00 23.47 ? 328 GLN A CA    1 
ATOM   1602 C  C     . GLN A 1 222 ? 13.884  18.862 59.486  1.00 24.95 ? 328 GLN A C     1 
ATOM   1603 O  O     . GLN A 1 222 ? 14.579  18.392 58.580  1.00 25.82 ? 328 GLN A O     1 
ATOM   1604 C  CB    . GLN A 1 222 ? 11.771  20.098 58.693  1.00 23.77 ? 328 GLN A CB    1 
ATOM   1605 C  CG    . GLN A 1 222 ? 10.785  19.263 59.432  1.00 23.83 ? 328 GLN A CG    1 
ATOM   1606 C  CD    . GLN A 1 222 ? 9.377   19.831 59.446  1.00 24.80 ? 328 GLN A CD    1 
ATOM   1607 O  OE1   . GLN A 1 222 ? 8.453   19.116 59.801  1.00 29.40 ? 328 GLN A OE1   1 
ATOM   1608 N  NE2   . GLN A 1 222 ? 9.214   21.090 59.126  1.00 23.56 ? 328 GLN A NE2   1 
ATOM   1609 N  N     . GLU A 1 223 ? 13.831  18.288 60.685  1.00 25.79 ? 329 GLU A N     1 
ATOM   1610 C  CA    . GLU A 1 223 ? 14.409  16.959 60.908  1.00 26.75 ? 329 GLU A CA    1 
ATOM   1611 C  C     . GLU A 1 223 ? 13.474  15.780 60.504  1.00 27.03 ? 329 GLU A C     1 
ATOM   1612 O  O     . GLU A 1 223 ? 12.304  15.695 60.964  1.00 26.40 ? 329 GLU A O     1 
ATOM   1613 C  CB    . GLU A 1 223 ? 14.830  16.794 62.368  1.00 27.19 ? 329 GLU A CB    1 
ATOM   1614 C  CG    . GLU A 1 223 ? 16.133  16.054 62.540  1.00 28.59 ? 329 GLU A CG    1 
ATOM   1615 C  CD    . GLU A 1 223 ? 16.059  14.973 63.567  1.00 29.72 ? 329 GLU A CD    1 
ATOM   1616 O  OE1   . GLU A 1 223 ? 15.988  15.357 64.758  1.00 31.77 ? 329 GLU A OE1   1 
ATOM   1617 O  OE2   . GLU A 1 223 ? 16.087  13.769 63.186  1.00 29.50 ? 329 GLU A OE2   1 
ATOM   1618 N  N     . PRO A 1 224 ? 13.989  14.857 59.680  1.00 26.93 ? 330 PRO A N     1 
ATOM   1619 C  CA    . PRO A 1 224 ? 13.177  13.728 59.240  1.00 26.82 ? 330 PRO A CA    1 
ATOM   1620 C  C     . PRO A 1 224 ? 13.055  12.729 60.369  1.00 26.82 ? 330 PRO A C     1 
ATOM   1621 O  O     . PRO A 1 224 ? 14.028  12.384 61.054  1.00 28.31 ? 330 PRO A O     1 
ATOM   1622 C  CB    . PRO A 1 224 ? 13.973  13.135 58.061  1.00 26.48 ? 330 PRO A CB    1 
ATOM   1623 C  CG    . PRO A 1 224 ? 15.342  13.660 58.178  1.00 25.35 ? 330 PRO A CG    1 
ATOM   1624 C  CD    . PRO A 1 224 ? 15.351  14.762 59.142  1.00 26.10 ? 330 PRO A CD    1 
ATOM   1625 N  N     . TRP A 1 225 ? 11.834  12.277 60.563  1.00 26.30 ? 331 TRP A N     1 
ATOM   1626 C  CA    . TRP A 1 225 ? 11.500  11.332 61.589  1.00 25.21 ? 331 TRP A CA    1 
ATOM   1627 C  C     . TRP A 1 225 ? 12.012  11.707 62.989  1.00 24.96 ? 331 TRP A C     1 
ATOM   1628 O  O     . TRP A 1 225 ? 12.290  10.846 63.781  1.00 25.54 ? 331 TRP A O     1 
ATOM   1629 C  CB    . TRP A 1 225 ? 11.988  9.987  61.159  1.00 24.75 ? 331 TRP A CB    1 
ATOM   1630 C  CG    . TRP A 1 225 ? 11.575  9.526  59.769  1.00 24.89 ? 331 TRP A CG    1 
ATOM   1631 C  CD1   . TRP A 1 225 ? 12.409  9.134  58.774  1.00 25.68 ? 331 TRP A CD1   1 
ATOM   1632 C  CD2   . TRP A 1 225 ? 10.258  9.253  59.291  1.00 25.24 ? 331 TRP A CD2   1 
ATOM   1633 N  NE1   . TRP A 1 225 ? 11.699  8.677  57.692  1.00 23.80 ? 331 TRP A NE1   1 
ATOM   1634 C  CE2   . TRP A 1 225 ? 10.373  8.758  57.987  1.00 24.61 ? 331 TRP A CE2   1 
ATOM   1635 C  CE3   . TRP A 1 225 ? 8.983   9.391  59.832  1.00 28.00 ? 331 TRP A CE3   1 
ATOM   1636 C  CZ2   . TRP A 1 225 ? 9.287   8.433  57.224  1.00 27.03 ? 331 TRP A CZ2   1 
ATOM   1637 C  CZ3   . TRP A 1 225 ? 7.907   9.081  59.069  1.00 28.29 ? 331 TRP A CZ3   1 
ATOM   1638 C  CH2   . TRP A 1 225 ? 8.061   8.611  57.779  1.00 29.17 ? 331 TRP A CH2   1 
ATOM   1639 N  N     . ILE A 1 226 ? 12.106  13.001 63.280  1.00 24.86 ? 332 ILE A N     1 
ATOM   1640 C  CA    . ILE A 1 226 ? 12.322  13.536 64.620  1.00 24.92 ? 332 ILE A CA    1 
ATOM   1641 C  C     . ILE A 1 226 ? 11.702  12.616 65.651  1.00 25.56 ? 332 ILE A C     1 
ATOM   1642 O  O     . ILE A 1 226 ? 10.663  12.013 65.406  1.00 25.44 ? 332 ILE A O     1 
ATOM   1643 C  CB    . ILE A 1 226 ? 11.704  14.985 64.734  1.00 25.05 ? 332 ILE A CB    1 
ATOM   1644 C  CG1   . ILE A 1 226 ? 11.951  15.603 66.089  1.00 26.35 ? 332 ILE A CG1   1 
ATOM   1645 C  CG2   . ILE A 1 226 ? 10.218  15.007 64.585  1.00 23.92 ? 332 ILE A CG2   1 
ATOM   1646 C  CD1   . ILE A 1 226 ? 12.193  17.075 66.022  1.00 27.91 ? 332 ILE A CD1   1 
ATOM   1647 N  N     . GLY A 1 227 ? 12.367  12.504 66.800  1.00 26.50 ? 333 GLY A N     1 
ATOM   1648 C  CA    . GLY A 1 227 ? 11.927  11.704 67.951  1.00 26.62 ? 333 GLY A CA    1 
ATOM   1649 C  C     . GLY A 1 227 ? 11.854  10.182 67.855  1.00 26.46 ? 333 GLY A C     1 
ATOM   1650 O  O     . GLY A 1 227 ? 11.475  9.514  68.824  1.00 26.28 ? 333 GLY A O     1 
ATOM   1651 N  N     . LEU A 1 228 ? 12.202  9.638  66.697  1.00 26.36 ? 334 LEU A N     1 
ATOM   1652 C  CA    . LEU A 1 228 ? 11.996  8.239  66.430  1.00 26.59 ? 334 LEU A CA    1 
ATOM   1653 C  C     . LEU A 1 228 ? 13.305  7.531  66.593  1.00 27.15 ? 334 LEU A C     1 
ATOM   1654 O  O     . LEU A 1 228 ? 14.326  7.982  66.068  1.00 28.51 ? 334 LEU A O     1 
ATOM   1655 C  CB    . LEU A 1 228 ? 11.462  8.026  65.006  1.00 26.50 ? 334 LEU A CB    1 
ATOM   1656 C  CG    . LEU A 1 228 ? 9.937   8.179  64.728  1.00 26.06 ? 334 LEU A CG    1 
ATOM   1657 C  CD1   . LEU A 1 228 ? 9.476   7.239  63.638  1.00 25.25 ? 334 LEU A CD1   1 
ATOM   1658 C  CD2   . LEU A 1 228 ? 9.077   7.970  65.953  1.00 24.61 ? 334 LEU A CD2   1 
ATOM   1659 N  N     . ASN A 1 229 ? 13.277  6.436  67.344  1.00 27.50 ? 335 ASN A N     1 
ATOM   1660 C  CA    . ASN A 1 229 ? 14.381  5.453  67.403  1.00 27.31 ? 335 ASN A CA    1 
ATOM   1661 C  C     . ASN A 1 229 ? 14.653  4.884  66.004  1.00 26.90 ? 335 ASN A C     1 
ATOM   1662 O  O     . ASN A 1 229 ? 14.064  5.314  65.017  1.00 26.58 ? 335 ASN A O     1 
ATOM   1663 C  CB    . ASN A 1 229 ? 14.076  4.339  68.455  1.00 26.90 ? 335 ASN A CB    1 
ATOM   1664 C  CG    . ASN A 1 229 ? 14.179  4.843  69.883  0.01 27.20 ? 335 ASN A CG    1 
ATOM   1665 O  OD1   . ASN A 1 229 ? 15.238  5.293  70.320  0.01 27.17 ? 335 ASN A OD1   1 
ATOM   1666 N  ND2   . ASN A 1 229 ? 13.075  4.771  70.618  0.01 27.19 ? 335 ASN A ND2   1 
ATOM   1667 N  N     . GLY A 1 230 ? 15.549  3.925  65.898  1.00 26.98 ? 336 GLY A N     1 
ATOM   1668 C  CA    . GLY A 1 230 ? 15.999  3.501  64.582  1.00 27.07 ? 336 GLY A CA    1 
ATOM   1669 C  C     . GLY A 1 230 ? 15.077  2.507  63.898  1.00 26.84 ? 336 GLY A C     1 
ATOM   1670 O  O     . GLY A 1 230 ? 14.855  2.647  62.686  1.00 27.19 ? 336 GLY A O     1 
ATOM   1671 N  N     . SER A 1 231 ? 14.571  1.513  64.655  1.00 25.90 ? 337 SER A N     1 
ATOM   1672 C  CA    . SER A 1 231 ? 13.712  0.455  64.086  1.00 25.25 ? 337 SER A CA    1 
ATOM   1673 C  C     . SER A 1 231 ? 12.288  0.970  63.864  1.00 24.26 ? 337 SER A C     1 
ATOM   1674 O  O     . SER A 1 231 ? 11.612  0.567  62.916  1.00 22.46 ? 337 SER A O     1 
ATOM   1675 C  CB    . SER A 1 231 ? 13.696  -0.816 64.960  1.00 25.21 ? 337 SER A CB    1 
ATOM   1676 O  OG    . SER A 1 231 ? 13.330  -1.952 64.197  0.01 25.37 ? 337 SER A OG    1 
ATOM   1677 N  N     . GLN A 1 232 ? 11.863  1.877  64.740  1.00 23.97 ? 338 GLN A N     1 
ATOM   1678 C  CA    . GLN A 1 232 ? 10.634  2.638  64.527  1.00 24.09 ? 338 GLN A CA    1 
ATOM   1679 C  C     . GLN A 1 232 ? 10.580  3.204  63.110  1.00 24.43 ? 338 GLN A C     1 
ATOM   1680 O  O     . GLN A 1 232 ? 9.526   3.134  62.477  1.00 24.02 ? 338 GLN A O     1 
ATOM   1681 C  CB    . GLN A 1 232 ? 10.498  3.795  65.525  1.00 24.00 ? 338 GLN A CB    1 
ATOM   1682 C  CG    . GLN A 1 232 ? 10.804  3.459  66.951  1.00 22.75 ? 338 GLN A CG    1 
ATOM   1683 C  CD    . GLN A 1 232 ? 10.227  4.463  67.882  1.00 21.69 ? 338 GLN A CD    1 
ATOM   1684 O  OE1   . GLN A 1 232 ? 10.843  5.481  68.155  1.00 19.12 ? 338 GLN A OE1   1 
ATOM   1685 N  NE2   . GLN A 1 232 ? 9.014   4.190  68.375  1.00 23.42 ? 338 GLN A NE2   1 
ATOM   1686 N  N     . ILE A 1 233 ? 11.703  3.752  62.619  1.00 25.02 ? 339 ILE A N     1 
ATOM   1687 C  CA    . ILE A 1 233 ? 11.739  4.379  61.284  1.00 26.02 ? 339 ILE A CA    1 
ATOM   1688 C  C     . ILE A 1 233 ? 11.522  3.377  60.181  1.00 26.22 ? 339 ILE A C     1 
ATOM   1689 O  O     . ILE A 1 233 ? 10.871  3.689  59.183  1.00 26.40 ? 339 ILE A O     1 
ATOM   1690 C  CB    . ILE A 1 233 ? 13.072  5.156  60.990  1.00 26.49 ? 339 ILE A CB    1 
ATOM   1691 C  CG1   . ILE A 1 233 ? 13.161  6.468  61.802  1.00 27.51 ? 339 ILE A CG1   1 
ATOM   1692 C  CG2   . ILE A 1 233 ? 13.170  5.522  59.499  1.00 26.04 ? 339 ILE A CG2   1 
ATOM   1693 C  CD1   . ILE A 1 233 ? 14.596  6.802  62.323  1.00 29.06 ? 339 ILE A CD1   1 
ATOM   1694 N  N     . LEU A 1 234 ? 12.091  2.184  60.368  1.00 26.64 ? 340 LEU A N     1 
ATOM   1695 C  CA    . LEU A 1 234 ? 12.115  1.131  59.349  1.00 26.02 ? 340 LEU A CA    1 
ATOM   1696 C  C     . LEU A 1 234 ? 10.768  0.490  59.149  1.00 25.75 ? 340 LEU A C     1 
ATOM   1697 O  O     . LEU A 1 234 ? 10.386  0.191  58.019  1.00 25.04 ? 340 LEU A O     1 
ATOM   1698 C  CB    . LEU A 1 234 ? 13.161  0.075  59.688  1.00 25.63 ? 340 LEU A CB    1 
ATOM   1699 C  CG    . LEU A 1 234 ? 13.121  -1.211 58.862  1.00 25.15 ? 340 LEU A CG    1 
ATOM   1700 C  CD1   . LEU A 1 234 ? 13.892  -1.054 57.580  1.00 25.42 ? 340 LEU A CD1   1 
ATOM   1701 C  CD2   . LEU A 1 234 ? 13.610  -2.390 59.720  1.00 24.09 ? 340 LEU A CD2   1 
ATOM   1702 N  N     . HIS A 1 235 ? 10.057  0.240  60.244  1.00 26.47 ? 341 HIS A N     1 
ATOM   1703 C  CA    . HIS A 1 235 ? 8.703   -0.338 60.141  1.00 26.91 ? 341 HIS A CA    1 
ATOM   1704 C  C     . HIS A 1 235 ? 7.881   0.673  59.322  1.00 27.14 ? 341 HIS A C     1 
ATOM   1705 O  O     . HIS A 1 235 ? 7.236   0.313  58.337  1.00 26.60 ? 341 HIS A O     1 
ATOM   1706 C  CB    . HIS A 1 235 ? 8.085   -0.614 61.510  1.00 26.29 ? 341 HIS A CB    1 
ATOM   1707 C  CG    . HIS A 1 235 ? 6.613   -0.870 61.444  1.00 28.49 ? 341 HIS A CG    1 
ATOM   1708 N  ND1   . HIS A 1 235 ? 6.070   -2.144 61.447  1.00 29.56 ? 341 HIS A ND1   1 
ATOM   1709 C  CD2   . HIS A 1 235 ? 5.567   -0.012 61.337  1.00 28.44 ? 341 HIS A CD2   1 
ATOM   1710 C  CE1   . HIS A 1 235 ? 4.753   -2.051 61.356  1.00 28.98 ? 341 HIS A CE1   1 
ATOM   1711 N  NE2   . HIS A 1 235 ? 4.423   -0.771 61.287  1.00 26.90 ? 341 HIS A NE2   1 
ATOM   1712 N  N     . LYS A 1 236 ? 7.993   1.941  59.714  1.00 27.48 ? 342 LYS A N     1 
ATOM   1713 C  CA    . LYS A 1 236 ? 7.479   3.063  58.952  1.00 28.43 ? 342 LYS A CA    1 
ATOM   1714 C  C     . LYS A 1 236 ? 7.811   3.040  57.467  1.00 29.15 ? 342 LYS A C     1 
ATOM   1715 O  O     . LYS A 1 236 ? 6.913   2.966  56.665  1.00 30.24 ? 342 LYS A O     1 
ATOM   1716 C  CB    . LYS A 1 236 ? 7.962   4.385  59.550  1.00 28.72 ? 342 LYS A CB    1 
ATOM   1717 C  CG    . LYS A 1 236 ? 7.178   4.845  60.776  1.00 29.25 ? 342 LYS A CG    1 
ATOM   1718 C  CD    . LYS A 1 236 ? 5.910   5.549  60.378  1.00 31.03 ? 342 LYS A CD    1 
ATOM   1719 C  CE    . LYS A 1 236 ? 5.471   6.625  61.381  1.00 32.16 ? 342 LYS A CE    1 
ATOM   1720 N  NZ    . LYS A 1 236 ? 3.968   6.649  61.455  1.00 33.08 ? 342 LYS A NZ    1 
ATOM   1721 N  N     . ILE A 1 237 ? 9.072   3.118  57.072  1.00 29.93 ? 343 ILE A N     1 
ATOM   1722 C  CA    . ILE A 1 237 ? 9.380   3.181  55.632  1.00 30.49 ? 343 ILE A CA    1 
ATOM   1723 C  C     . ILE A 1 237 ? 9.250   1.850  54.895  1.00 30.82 ? 343 ILE A C     1 
ATOM   1724 O  O     . ILE A 1 237 ? 9.180   1.811  53.671  1.00 31.48 ? 343 ILE A O     1 
ATOM   1725 C  CB    . ILE A 1 237 ? 10.781  3.762  55.371  1.00 30.82 ? 343 ILE A CB    1 
ATOM   1726 C  CG1   . ILE A 1 237 ? 11.859  3.011  56.161  1.00 31.38 ? 343 ILE A CG1   1 
ATOM   1727 C  CG2   . ILE A 1 237 ? 10.822  5.257  55.707  1.00 31.18 ? 343 ILE A CG2   1 
ATOM   1728 C  CD1   . ILE A 1 237 ? 13.266  3.698  56.088  1.00 31.01 ? 343 ILE A CD1   1 
ATOM   1729 N  N     . ASP A 1 238 ? 9.193   0.750  55.622  1.00 30.71 ? 344 ASP A N     1 
ATOM   1730 C  CA    . ASP A 1 238 ? 9.176   -0.535 54.971  1.00 30.64 ? 344 ASP A CA    1 
ATOM   1731 C  C     . ASP A 1 238 ? 7.731   -1.121 55.056  1.00 30.76 ? 344 ASP A C     1 
ATOM   1732 O  O     . ASP A 1 238 ? 6.864   -0.766 54.236  1.00 31.18 ? 344 ASP A O     1 
ATOM   1733 C  CB    . ASP A 1 238 ? 10.277  -1.401 55.574  1.00 30.58 ? 344 ASP A CB    1 
ATOM   1734 C  CG    . ASP A 1 238 ? 10.582  -2.604 54.740  1.00 31.02 ? 344 ASP A CG    1 
ATOM   1735 O  OD1   . ASP A 1 238 ? 11.319  -2.443 53.746  1.00 30.34 ? 344 ASP A OD1   1 
ATOM   1736 O  OD2   . ASP A 1 238 ? 10.114  -3.736 55.007  1.00 29.17 ? 344 ASP A OD2   1 
ATOM   1737 N  N     . LYS A 1 239 ? 7.440   -1.962 56.046  1.00 30.06 ? 345 LYS A N     1 
ATOM   1738 C  CA    . LYS A 1 239 ? 6.076   -2.477 56.230  1.00 29.33 ? 345 LYS A CA    1 
ATOM   1739 C  C     . LYS A 1 239 ? 4.961   -1.495 55.832  1.00 28.38 ? 345 LYS A C     1 
ATOM   1740 O  O     . LYS A 1 239 ? 4.164   -1.795 54.955  1.00 27.80 ? 345 LYS A O     1 
ATOM   1741 C  CB    . LYS A 1 239 ? 5.878   -2.964 57.677  1.00 29.44 ? 345 LYS A CB    1 
ATOM   1742 C  CG    . LYS A 1 239 ? 6.397   -4.379 57.923  0.01 29.09 ? 345 LYS A CG    1 
ATOM   1743 C  CD    . LYS A 1 239 ? 6.978   -4.547 59.320  0.01 28.82 ? 345 LYS A CD    1 
ATOM   1744 C  CE    . LYS A 1 239 ? 7.669   -5.894 59.470  0.01 28.68 ? 345 LYS A CE    1 
ATOM   1745 N  NZ    . LYS A 1 239 ? 8.062   -6.172 60.879  0.01 28.59 ? 345 LYS A NZ    1 
ATOM   1746 N  N     . GLU A 1 240 ? 4.938   -0.319 56.453  1.00 28.06 ? 346 GLU A N     1 
ATOM   1747 C  CA    . GLU A 1 240 ? 3.835   0.665  56.295  1.00 27.51 ? 346 GLU A CA    1 
ATOM   1748 C  C     . GLU A 1 240 ? 3.811   1.386  54.936  1.00 26.77 ? 346 GLU A C     1 
ATOM   1749 O  O     . GLU A 1 240 ? 2.739   1.666  54.388  1.00 26.01 ? 346 GLU A O     1 
ATOM   1750 C  CB    . GLU A 1 240 ? 3.892   1.724  57.404  1.00 27.41 ? 346 GLU A CB    1 
ATOM   1751 C  CG    . GLU A 1 240 ? 4.143   1.176  58.804  1.00 27.82 ? 346 GLU A CG    1 
ATOM   1752 C  CD    . GLU A 1 240 ? 3.207   1.725  59.879  1.00 29.09 ? 346 GLU A CD    1 
ATOM   1753 O  OE1   . GLU A 1 240 ? 3.068   2.992  60.061  1.00 25.96 ? 346 GLU A OE1   1 
ATOM   1754 O  OE2   . GLU A 1 240 ? 2.619   0.844  60.560  1.00 29.45 ? 346 GLU A OE2   1 
ATOM   1755 N  N     . GLY A 1 241 ? 4.992   1.669  54.398  1.00 26.26 ? 347 GLY A N     1 
ATOM   1756 C  CA    . GLY A 1 241 ? 5.114   2.382  53.138  1.00 26.19 ? 347 GLY A CA    1 
ATOM   1757 C  C     . GLY A 1 241 ? 4.858   3.872  53.307  1.00 25.96 ? 347 GLY A C     1 
ATOM   1758 O  O     . GLY A 1 241 ? 4.543   4.567  52.339  1.00 25.18 ? 347 GLY A O     1 
ATOM   1759 N  N     . GLU A 1 242 ? 4.989   4.354  54.540  1.00 25.84 ? 348 GLU A N     1 
ATOM   1760 C  CA    . GLU A 1 242 ? 4.885   5.761  54.800  1.00 26.73 ? 348 GLU A CA    1 
ATOM   1761 C  C     . GLU A 1 242 ? 6.103   6.521  54.301  1.00 26.82 ? 348 GLU A C     1 
ATOM   1762 O  O     . GLU A 1 242 ? 7.231   6.282  54.714  1.00 27.82 ? 348 GLU A O     1 
ATOM   1763 C  CB    . GLU A 1 242 ? 4.692   6.060  56.289  1.00 27.18 ? 348 GLU A CB    1 
ATOM   1764 C  CG    . GLU A 1 242 ? 4.017   7.428  56.477  1.00 30.08 ? 348 GLU A CG    1 
ATOM   1765 C  CD    . GLU A 1 242 ? 4.191   8.033  57.861  1.00 33.81 ? 348 GLU A CD    1 
ATOM   1766 O  OE1   . GLU A 1 242 ? 3.911   7.304  58.840  1.00 37.81 ? 348 GLU A OE1   1 
ATOM   1767 O  OE2   . GLU A 1 242 ? 4.577   9.233  57.973  1.00 34.26 ? 348 GLU A OE2   1 
ATOM   1768 N  N     . ARG A 1 243 ? 5.868   7.456  53.414  1.00 26.37 ? 349 ARG A N     1 
ATOM   1769 C  CA    . ARG A 1 243 ? 6.890   8.379  53.022  1.00 26.53 ? 349 ARG A CA    1 
ATOM   1770 C  C     . ARG A 1 243 ? 6.774   9.689  53.839  1.00 26.75 ? 349 ARG A C     1 
ATOM   1771 O  O     . ARG A 1 243 ? 5.869   9.826  54.663  1.00 26.85 ? 349 ARG A O     1 
ATOM   1772 C  CB    . ARG A 1 243 ? 6.743   8.623  51.532  1.00 26.70 ? 349 ARG A CB    1 
ATOM   1773 C  CG    . ARG A 1 243 ? 6.798   7.352  50.727  1.00 26.22 ? 349 ARG A CG    1 
ATOM   1774 C  CD    . ARG A 1 243 ? 8.194   6.954  50.395  1.00 26.44 ? 349 ARG A CD    1 
ATOM   1775 N  NE    . ARG A 1 243 ? 8.350   5.587  49.932  1.00 27.27 ? 349 ARG A NE    1 
ATOM   1776 C  CZ    . ARG A 1 243 ? 8.475   4.511  50.724  1.00 29.86 ? 349 ARG A CZ    1 
ATOM   1777 N  NH1   . ARG A 1 243 ? 8.439   4.622  52.056  1.00 29.34 ? 349 ARG A NH1   1 
ATOM   1778 N  NH2   . ARG A 1 243 ? 8.626   3.294  50.172  1.00 31.22 ? 349 ARG A NH2   1 
ATOM   1779 N  N     . LEU A 1 244 ? 7.689   10.643 53.636  1.00 27.05 ? 350 LEU A N     1 
ATOM   1780 C  CA    . LEU A 1 244 ? 7.556   11.965 54.287  1.00 27.17 ? 350 LEU A CA    1 
ATOM   1781 C  C     . LEU A 1 244 ? 6.523   12.837 53.613  1.00 27.67 ? 350 LEU A C     1 
ATOM   1782 O  O     . LEU A 1 244 ? 6.274   12.718 52.414  1.00 28.17 ? 350 LEU A O     1 
ATOM   1783 C  CB    . LEU A 1 244 ? 8.876   12.708 54.320  1.00 27.18 ? 350 LEU A CB    1 
ATOM   1784 C  CG    . LEU A 1 244 ? 9.969   11.994 55.150  1.00 27.72 ? 350 LEU A CG    1 
ATOM   1785 C  CD1   . LEU A 1 244 ? 11.290  12.625 54.892  1.00 28.68 ? 350 LEU A CD1   1 
ATOM   1786 C  CD2   . LEU A 1 244 ? 9.707   12.017 56.633  1.00 27.40 ? 350 LEU A CD2   1 
ATOM   1787 N  N     . PRO A 1 245 ? 5.926   13.758 54.360  1.00 28.39 ? 351 PRO A N     1 
ATOM   1788 C  CA    . PRO A 1 245 ? 4.813   14.524 53.807  1.00 28.06 ? 351 PRO A CA    1 
ATOM   1789 C  C     . PRO A 1 245 ? 5.314   15.659 52.914  1.00 28.72 ? 351 PRO A C     1 
ATOM   1790 O  O     . PRO A 1 245 ? 6.470   16.107 53.025  1.00 27.90 ? 351 PRO A O     1 
ATOM   1791 C  CB    . PRO A 1 245 ? 4.090   15.036 55.052  1.00 27.98 ? 351 PRO A CB    1 
ATOM   1792 C  CG    . PRO A 1 245 ? 5.093   15.015 56.168  1.00 27.80 ? 351 PRO A CG    1 
ATOM   1793 C  CD    . PRO A 1 245 ? 6.270   14.216 55.723  1.00 28.24 ? 351 PRO A CD    1 
ATOM   1794 N  N     . ARG A 1 246 ? 4.425   16.126 52.030  1.00 29.56 ? 352 ARG A N     1 
ATOM   1795 C  CA    . ARG A 1 246 ? 4.745   17.249 51.142  1.00 29.38 ? 352 ARG A CA    1 
ATOM   1796 C  C     . ARG A 1 246 ? 5.019   18.476 51.991  1.00 28.81 ? 352 ARG A C     1 
ATOM   1797 O  O     . ARG A 1 246 ? 4.239   18.767 52.873  1.00 28.10 ? 352 ARG A O     1 
ATOM   1798 C  CB    . ARG A 1 246 ? 3.623   17.520 50.134  1.00 29.12 ? 352 ARG A CB    1 
ATOM   1799 C  CG    . ARG A 1 246 ? 4.139   18.136 48.786  1.00 30.17 ? 352 ARG A CG    1 
ATOM   1800 C  CD    . ARG A 1 246 ? 3.529   19.533 48.374  1.00 30.58 ? 352 ARG A CD    1 
ATOM   1801 N  NE    . ARG A 1 246 ? 2.079   19.539 48.530  1.00 30.07 ? 352 ARG A NE    1 
ATOM   1802 C  CZ    . ARG A 1 246 ? 1.392   20.379 49.299  1.00 32.80 ? 352 ARG A CZ    1 
ATOM   1803 N  NH1   . ARG A 1 246 ? 2.018   21.359 49.971  1.00 33.85 ? 352 ARG A NH1   1 
ATOM   1804 N  NH2   . ARG A 1 246 ? 0.047   20.265 49.370  1.00 32.27 ? 352 ARG A NH2   1 
ATOM   1805 N  N     . PRO A 1 247 ? 6.147   19.142 51.774  1.00 28.91 ? 353 PRO A N     1 
ATOM   1806 C  CA    . PRO A 1 247 ? 6.444   20.377 52.503  1.00 29.62 ? 353 PRO A CA    1 
ATOM   1807 C  C     . PRO A 1 247 ? 5.614   21.550 52.004  1.00 30.11 ? 353 PRO A C     1 
ATOM   1808 O  O     . PRO A 1 247 ? 5.935   22.123 50.964  1.00 30.03 ? 353 PRO A O     1 
ATOM   1809 C  CB    . PRO A 1 247 ? 7.948   20.624 52.228  1.00 29.72 ? 353 PRO A CB    1 
ATOM   1810 C  CG    . PRO A 1 247 ? 8.432   19.414 51.496  1.00 29.54 ? 353 PRO A CG    1 
ATOM   1811 C  CD    . PRO A 1 247 ? 7.241   18.773 50.865  1.00 28.85 ? 353 PRO A CD    1 
ATOM   1812 N  N     . GLU A 1 248 ? 4.555   21.873 52.739  1.00 30.55 ? 354 GLU A N     1 
ATOM   1813 C  CA    . GLU A 1 248 ? 3.893   23.184 52.657  1.00 31.42 ? 354 GLU A CA    1 
ATOM   1814 C  C     . GLU A 1 248 ? 4.501   24.091 51.592  1.00 30.77 ? 354 GLU A C     1 
ATOM   1815 O  O     . GLU A 1 248 ? 5.660   24.507 51.703  1.00 29.81 ? 354 GLU A O     1 
ATOM   1816 C  CB    . GLU A 1 248 ? 3.910   23.917 54.021  1.00 31.82 ? 354 GLU A CB    1 
ATOM   1817 C  CG    . GLU A 1 248 ? 3.449   23.056 55.215  1.00 34.79 ? 354 GLU A CG    1 
ATOM   1818 C  CD    . GLU A 1 248 ? 2.099   23.462 55.828  1.00 36.91 ? 354 GLU A CD    1 
ATOM   1819 O  OE1   . GLU A 1 248 ? 1.833   24.689 55.938  1.00 34.15 ? 354 GLU A OE1   1 
ATOM   1820 O  OE2   . GLU A 1 248 ? 1.325   22.533 56.234  1.00 38.75 ? 354 GLU A OE2   1 
ATOM   1821 N  N     . ASP A 1 249 ? 3.704   24.379 50.563  1.00 30.60 ? 355 ASP A N     1 
ATOM   1822 C  CA    . ASP A 1 249 ? 4.149   25.212 49.460  1.00 30.76 ? 355 ASP A CA    1 
ATOM   1823 C  C     . ASP A 1 249 ? 5.492   24.760 48.915  1.00 30.77 ? 355 ASP A C     1 
ATOM   1824 O  O     . ASP A 1 249 ? 6.440   25.556 48.870  1.00 30.50 ? 355 ASP A O     1 
ATOM   1825 C  CB    . ASP A 1 249 ? 4.275   26.675 49.917  1.00 31.32 ? 355 ASP A CB    1 
ATOM   1826 C  CG    . ASP A 1 249 ? 2.933   27.325 50.230  1.00 30.35 ? 355 ASP A CG    1 
ATOM   1827 O  OD1   . ASP A 1 249 ? 1.877   26.837 49.754  1.00 29.61 ? 355 ASP A OD1   1 
ATOM   1828 O  OD2   . ASP A 1 249 ? 2.878   28.356 50.934  1.00 28.49 ? 355 ASP A OD2   1 
ATOM   1829 N  N     . CYS A 1 250 ? 5.577   23.470 48.573  1.00 30.76 ? 356 CYS A N     1 
ATOM   1830 C  CA    . CYS A 1 250 ? 6.646   22.909 47.733  1.00 30.11 ? 356 CYS A CA    1 
ATOM   1831 C  C     . CYS A 1 250 ? 5.942   22.571 46.442  1.00 29.73 ? 356 CYS A C     1 
ATOM   1832 O  O     . CYS A 1 250 ? 4.966   21.847 46.454  1.00 30.23 ? 356 CYS A O     1 
ATOM   1833 C  CB    . CYS A 1 250 ? 7.225   21.630 48.320  1.00 30.24 ? 356 CYS A CB    1 
ATOM   1834 S  SG    . CYS A 1 250 ? 8.387   20.678 47.253  1.00 30.33 ? 356 CYS A SG    1 
ATOM   1835 N  N     . PRO A 1 251 ? 6.414   23.063 45.320  1.00 29.16 ? 357 PRO A N     1 
ATOM   1836 C  CA    . PRO A 1 251 ? 5.659   22.903 44.091  1.00 29.01 ? 357 PRO A CA    1 
ATOM   1837 C  C     . PRO A 1 251 ? 5.537   21.431 43.828  1.00 28.76 ? 357 PRO A C     1 
ATOM   1838 O  O     . PRO A 1 251 ? 6.529   20.759 44.029  1.00 29.54 ? 357 PRO A O     1 
ATOM   1839 C  CB    . PRO A 1 251 ? 6.548   23.561 43.045  1.00 29.10 ? 357 PRO A CB    1 
ATOM   1840 C  CG    . PRO A 1 251 ? 7.460   24.396 43.796  1.00 29.84 ? 357 PRO A CG    1 
ATOM   1841 C  CD    . PRO A 1 251 ? 7.717   23.696 45.089  1.00 29.71 ? 357 PRO A CD    1 
ATOM   1842 N  N     . GLN A 1 252 ? 4.379   20.933 43.407  1.00 28.53 ? 358 GLN A N     1 
ATOM   1843 C  CA    . GLN A 1 252 ? 4.211   19.496 43.214  1.00 28.12 ? 358 GLN A CA    1 
ATOM   1844 C  C     . GLN A 1 252 ? 5.384   18.864 42.461  1.00 27.96 ? 358 GLN A C     1 
ATOM   1845 O  O     . GLN A 1 252 ? 5.897   17.834 42.910  1.00 27.89 ? 358 GLN A O     1 
ATOM   1846 C  CB    . GLN A 1 252 ? 2.899   19.189 42.475  1.00 28.18 ? 358 GLN A CB    1 
ATOM   1847 C  CG    . GLN A 1 252 ? 2.532   17.681 42.408  1.00 26.74 ? 358 GLN A CG    1 
ATOM   1848 C  CD    . GLN A 1 252 ? 2.073   17.101 43.747  1.00 24.64 ? 358 GLN A CD    1 
ATOM   1849 O  OE1   . GLN A 1 252 ? 1.590   17.831 44.642  1.00 19.98 ? 358 GLN A OE1   1 
ATOM   1850 N  NE2   . GLN A 1 252 ? 2.228   15.782 43.888  1.00 22.79 ? 358 GLN A NE2   1 
ATOM   1851 N  N     . ASP A 1 253 ? 5.809   19.484 41.347  1.00 27.63 ? 359 ASP A N     1 
ATOM   1852 C  CA    . ASP A 1 253 ? 6.825   18.878 40.457  1.00 27.68 ? 359 ASP A CA    1 
ATOM   1853 C  C     . ASP A 1 253 ? 8.216   18.676 41.103  1.00 27.47 ? 359 ASP A C     1 
ATOM   1854 O  O     . ASP A 1 253 ? 8.904   17.697 40.808  1.00 26.94 ? 359 ASP A O     1 
ATOM   1855 C  CB    . ASP A 1 253 ? 6.852   19.500 39.010  1.00 27.80 ? 359 ASP A CB    1 
ATOM   1856 C  CG    . ASP A 1 253 ? 7.497   20.895 38.915  1.00 28.29 ? 359 ASP A CG    1 
ATOM   1857 O  OD1   . ASP A 1 253 ? 8.108   21.378 39.894  1.00 29.64 ? 359 ASP A OD1   1 
ATOM   1858 O  OD2   . ASP A 1 253 ? 7.432   21.586 37.859  1.00 27.21 ? 359 ASP A OD2   1 
ATOM   1859 N  N     . ILE A 1 254 ? 8.593   19.567 42.020  1.00 27.49 ? 360 ILE A N     1 
ATOM   1860 C  CA    . ILE A 1 254 ? 9.775   19.354 42.852  1.00 27.27 ? 360 ILE A CA    1 
ATOM   1861 C  C     . ILE A 1 254 ? 9.485   18.222 43.865  1.00 27.10 ? 360 ILE A C     1 
ATOM   1862 O  O     . ILE A 1 254 ? 10.321  17.336 44.028  1.00 27.47 ? 360 ILE A O     1 
ATOM   1863 C  CB    . ILE A 1 254 ? 10.277  20.707 43.522  1.00 27.47 ? 360 ILE A CB    1 
ATOM   1864 C  CG1   . ILE A 1 254 ? 11.263  21.460 42.596  1.00 27.97 ? 360 ILE A CG1   1 
ATOM   1865 C  CG2   . ILE A 1 254 ? 10.980  20.466 44.846  1.00 26.98 ? 360 ILE A CG2   1 
ATOM   1866 C  CD1   . ILE A 1 254 ? 10.993  22.975 42.418  1.00 28.02 ? 360 ILE A CD1   1 
ATOM   1867 N  N     . TYR A 1 255 ? 8.317   18.197 44.514  1.00 26.50 ? 361 TYR A N     1 
ATOM   1868 C  CA    . TYR A 1 255 ? 8.013   17.062 45.401  1.00 26.32 ? 361 TYR A CA    1 
ATOM   1869 C  C     . TYR A 1 255 ? 8.035   15.756 44.644  1.00 26.06 ? 361 TYR A C     1 
ATOM   1870 O  O     . TYR A 1 255 ? 8.252   14.703 45.237  1.00 26.00 ? 361 TYR A O     1 
ATOM   1871 C  CB    . TYR A 1 255 ? 6.657   17.194 46.067  1.00 26.54 ? 361 TYR A CB    1 
ATOM   1872 C  CG    . TYR A 1 255 ? 6.242   16.076 47.045  1.00 26.95 ? 361 TYR A CG    1 
ATOM   1873 C  CD1   . TYR A 1 255 ? 6.944   15.837 48.212  1.00 28.03 ? 361 TYR A CD1   1 
ATOM   1874 C  CD2   . TYR A 1 255 ? 5.083   15.323 46.825  1.00 27.44 ? 361 TYR A CD2   1 
ATOM   1875 C  CE1   . TYR A 1 255 ? 6.535   14.862 49.124  1.00 29.14 ? 361 TYR A CE1   1 
ATOM   1876 C  CE2   . TYR A 1 255 ? 4.657   14.355 47.724  1.00 27.03 ? 361 TYR A CE2   1 
ATOM   1877 C  CZ    . TYR A 1 255 ? 5.383   14.125 48.866  1.00 29.36 ? 361 TYR A CZ    1 
ATOM   1878 O  OH    . TYR A 1 255 ? 4.960   13.154 49.749  1.00 31.05 ? 361 TYR A OH    1 
ATOM   1879 N  N     . ASN A 1 256 ? 7.811   15.810 43.335  1.00 25.71 ? 362 ASN A N     1 
ATOM   1880 C  CA    . ASN A 1 256 ? 7.686   14.572 42.571  1.00 25.56 ? 362 ASN A CA    1 
ATOM   1881 C  C     . ASN A 1 256 ? 9.012   13.876 42.390  1.00 25.13 ? 362 ASN A C     1 
ATOM   1882 O  O     . ASN A 1 256 ? 9.103   12.679 42.549  1.00 24.57 ? 362 ASN A O     1 
ATOM   1883 C  CB    . ASN A 1 256 ? 6.973   14.809 41.239  1.00 25.12 ? 362 ASN A CB    1 
ATOM   1884 C  CG    . ASN A 1 256 ? 5.494   14.835 41.408  1.00 24.46 ? 362 ASN A CG    1 
ATOM   1885 O  OD1   . ASN A 1 256 ? 4.970   14.210 42.329  1.00 23.27 ? 362 ASN A OD1   1 
ATOM   1886 N  ND2   . ASN A 1 256 ? 4.800   15.574 40.548  1.00 24.00 ? 362 ASN A ND2   1 
ATOM   1887 N  N     . VAL A 1 257 ? 10.018  14.655 42.053  1.00 25.29 ? 363 VAL A N     1 
ATOM   1888 C  CA    . VAL A 1 257 ? 11.392  14.204 42.071  1.00 26.03 ? 363 VAL A CA    1 
ATOM   1889 C  C     . VAL A 1 257 ? 11.661  13.480 43.389  1.00 26.33 ? 363 VAL A C     1 
ATOM   1890 O  O     . VAL A 1 257 ? 12.249  12.403 43.435  1.00 25.30 ? 363 VAL A O     1 
ATOM   1891 C  CB    . VAL A 1 257 ? 12.366  15.418 41.978  1.00 26.29 ? 363 VAL A CB    1 
ATOM   1892 C  CG1   . VAL A 1 257 ? 13.846  14.930 41.822  1.00 27.50 ? 363 VAL A CG1   1 
ATOM   1893 C  CG2   . VAL A 1 257 ? 11.955  16.382 40.845  1.00 25.34 ? 363 VAL A CG2   1 
ATOM   1894 N  N     . MET A 1 258 ? 11.224  14.129 44.459  1.00 27.28 ? 364 MET A N     1 
ATOM   1895 C  CA    . MET A 1 258 ? 11.377  13.638 45.826  1.00 27.96 ? 364 MET A CA    1 
ATOM   1896 C  C     . MET A 1 258 ? 10.775  12.250 45.938  1.00 27.86 ? 364 MET A C     1 
ATOM   1897 O  O     . MET A 1 258 ? 11.427  11.305 46.305  1.00 28.04 ? 364 MET A O     1 
ATOM   1898 C  CB    . MET A 1 258 ? 10.616  14.580 46.785  1.00 28.18 ? 364 MET A CB    1 
ATOM   1899 C  CG    . MET A 1 258 ? 11.336  14.961 47.973  1.00 28.54 ? 364 MET A CG    1 
ATOM   1900 S  SD    . MET A 1 258 ? 10.387  16.129 48.916  1.00 29.00 ? 364 MET A SD    1 
ATOM   1901 C  CE    . MET A 1 258 ? 11.163  17.510 48.418  1.00 29.15 ? 364 MET A CE    1 
ATOM   1902 N  N     . VAL A 1 259 ? 9.501   12.173 45.596  1.00 27.83 ? 365 VAL A N     1 
ATOM   1903 C  CA    . VAL A 1 259 ? 8.699   11.005 45.800  1.00 27.85 ? 365 VAL A CA    1 
ATOM   1904 C  C     . VAL A 1 259 ? 9.312   9.819  45.010  1.00 28.61 ? 365 VAL A C     1 
ATOM   1905 O  O     . VAL A 1 259 ? 9.247   8.659  45.429  1.00 29.83 ? 365 VAL A O     1 
ATOM   1906 C  CB    . VAL A 1 259 ? 7.258   11.358 45.358  1.00 27.86 ? 365 VAL A CB    1 
ATOM   1907 C  CG1   . VAL A 1 259 ? 6.709   10.358 44.364  1.00 28.00 ? 365 VAL A CG1   1 
ATOM   1908 C  CG2   . VAL A 1 259 ? 6.343   11.526 46.570  1.00 27.55 ? 365 VAL A CG2   1 
ATOM   1909 N  N     . GLN A 1 260 ? 9.926   10.106 43.870  1.00 28.48 ? 366 GLN A N     1 
ATOM   1910 C  CA    . GLN A 1 260 ? 10.578  9.083  43.075  1.00 28.11 ? 366 GLN A CA    1 
ATOM   1911 C  C     . GLN A 1 260 ? 11.786  8.557  43.808  1.00 28.14 ? 366 GLN A C     1 
ATOM   1912 O  O     . GLN A 1 260 ? 11.995  7.352  43.916  1.00 28.71 ? 366 GLN A O     1 
ATOM   1913 C  CB    . GLN A 1 260 ? 11.021  9.663  41.746  1.00 28.05 ? 366 GLN A CB    1 
ATOM   1914 C  CG    . GLN A 1 260 ? 10.146  9.269  40.614  1.00 28.69 ? 366 GLN A CG    1 
ATOM   1915 C  CD    . GLN A 1 260 ? 10.532  9.974  39.357  1.00 30.22 ? 366 GLN A CD    1 
ATOM   1916 O  OE1   . GLN A 1 260 ? 10.426  11.194 39.289  1.00 33.13 ? 366 GLN A OE1   1 
ATOM   1917 N  NE2   . GLN A 1 260 ? 11.007  9.228  38.360  1.00 29.93 ? 366 GLN A NE2   1 
ATOM   1918 N  N     . CYS A 1 261 ? 12.594  9.468  44.325  1.00 27.89 ? 367 CYS A N     1 
ATOM   1919 C  CA    . CYS A 1 261 ? 13.777  9.073  45.074  1.00 27.31 ? 367 CYS A CA    1 
ATOM   1920 C  C     . CYS A 1 261 ? 13.398  7.976  46.057  1.00 27.16 ? 367 CYS A C     1 
ATOM   1921 O  O     . CYS A 1 261 ? 14.172  7.080  46.297  1.00 26.74 ? 367 CYS A O     1 
ATOM   1922 C  CB    . CYS A 1 261 ? 14.416  10.291 45.744  1.00 27.06 ? 367 CYS A CB    1 
ATOM   1923 S  SG    . CYS A 1 261 ? 15.125  11.469 44.533  1.00 25.37 ? 367 CYS A SG    1 
ATOM   1924 N  N     . TRP A 1 262 ? 12.168  8.004  46.556  1.00 27.43 ? 368 TRP A N     1 
ATOM   1925 C  CA    . TRP A 1 262 ? 11.700  6.977  47.498  1.00 27.64 ? 368 TRP A CA    1 
ATOM   1926 C  C     . TRP A 1 262 ? 10.979  5.771  46.916  1.00 27.53 ? 368 TRP A C     1 
ATOM   1927 O  O     . TRP A 1 262 ? 10.531  4.904  47.661  1.00 27.92 ? 368 TRP A O     1 
ATOM   1928 C  CB    . TRP A 1 262 ? 10.852  7.618  48.602  1.00 27.47 ? 368 TRP A CB    1 
ATOM   1929 C  CG    . TRP A 1 262 ? 11.549  8.777  49.174  1.00 26.57 ? 368 TRP A CG    1 
ATOM   1930 C  CD1   . TRP A 1 262 ? 12.901  8.898  49.395  1.00 25.20 ? 368 TRP A CD1   1 
ATOM   1931 C  CD2   . TRP A 1 262 ? 10.963  9.985  49.587  1.00 26.31 ? 368 TRP A CD2   1 
ATOM   1932 N  NE1   . TRP A 1 262 ? 13.180  10.130 49.921  1.00 24.84 ? 368 TRP A NE1   1 
ATOM   1933 C  CE2   . TRP A 1 262 ? 12.001  10.824 50.043  1.00 28.24 ? 368 TRP A CE2   1 
ATOM   1934 C  CE3   . TRP A 1 262 ? 9.661   10.460 49.629  1.00 27.92 ? 368 TRP A CE3   1 
ATOM   1935 C  CZ2   . TRP A 1 262 ? 11.760  12.127 50.526  1.00 29.58 ? 368 TRP A CZ2   1 
ATOM   1936 C  CZ3   . TRP A 1 262 ? 9.424   11.758 50.092  1.00 29.23 ? 368 TRP A CZ3   1 
ATOM   1937 C  CH2   . TRP A 1 262 ? 10.462  12.570 50.532  1.00 29.09 ? 368 TRP A CH2   1 
ATOM   1938 N  N     . ALA A 1 263 ? 10.876  5.663  45.610  1.00 27.33 ? 369 ALA A N     1 
ATOM   1939 C  CA    . ALA A 1 263 ? 10.404  4.410  45.067  1.00 27.95 ? 369 ALA A CA    1 
ATOM   1940 C  C     . ALA A 1 263 ? 11.016  3.242  45.854  1.00 28.24 ? 369 ALA A C     1 
ATOM   1941 O  O     . ALA A 1 263 ? 12.224  3.040  45.820  1.00 27.92 ? 369 ALA A O     1 
ATOM   1942 C  CB    . ALA A 1 263 ? 10.754  4.294  43.576  1.00 28.14 ? 369 ALA A CB    1 
ATOM   1943 N  N     . HIS A 1 264 ? 10.181  2.459  46.538  1.00 29.12 ? 370 HIS A N     1 
ATOM   1944 C  CA    . HIS A 1 264 ? 10.661  1.267  47.271  1.00 29.58 ? 370 HIS A CA    1 
ATOM   1945 C  C     . HIS A 1 264 ? 11.625  0.340  46.523  1.00 29.28 ? 370 HIS A C     1 
ATOM   1946 O  O     . HIS A 1 264 ? 12.462  -0.317 47.154  1.00 28.52 ? 370 HIS A O     1 
ATOM   1947 C  CB    . HIS A 1 264 ? 9.516   0.378  47.759  1.00 29.65 ? 370 HIS A CB    1 
ATOM   1948 C  CG    . HIS A 1 264 ? 10.006  -0.746 48.614  1.00 31.04 ? 370 HIS A CG    1 
ATOM   1949 N  ND1   . HIS A 1 264 ? 10.398  -1.964 48.092  1.00 32.52 ? 370 HIS A ND1   1 
ATOM   1950 C  CD2   . HIS A 1 264 ? 10.271  -0.801 49.942  1.00 32.13 ? 370 HIS A CD2   1 
ATOM   1951 C  CE1   . HIS A 1 264 ? 10.833  -2.739 49.069  1.00 32.46 ? 370 HIS A CE1   1 
ATOM   1952 N  NE2   . HIS A 1 264 ? 10.754  -2.062 50.204  1.00 33.96 ? 370 HIS A NE2   1 
ATOM   1953 N  N     . LYS A 1 265 ? 11.462  0.240  45.203  1.00 29.54 ? 371 LYS A N     1 
ATOM   1954 C  CA    . LYS A 1 265 ? 12.384  -0.543 44.370  1.00 29.85 ? 371 LYS A CA    1 
ATOM   1955 C  C     . LYS A 1 265 ? 13.611  0.300  43.983  1.00 30.12 ? 371 LYS A C     1 
ATOM   1956 O  O     . LYS A 1 265 ? 13.459  1.258  43.204  1.00 30.71 ? 371 LYS A O     1 
ATOM   1957 C  CB    . LYS A 1 265 ? 11.674  -1.042 43.109  0.01 29.70 ? 371 LYS A CB    1 
ATOM   1958 C  CG    . LYS A 1 265 ? 10.677  -2.161 43.364  0.01 29.37 ? 371 LYS A CG    1 
ATOM   1959 C  CD    . LYS A 1 265 ? 10.003  -2.612 42.078  0.01 28.98 ? 371 LYS A CD    1 
ATOM   1960 C  CE    . LYS A 1 265 ? 8.982   -3.707 42.338  0.01 28.79 ? 371 LYS A CE    1 
ATOM   1961 N  NZ    . LYS A 1 265 ? 8.072   -3.907 41.178  0.01 28.69 ? 371 LYS A NZ    1 
ATOM   1962 N  N     . PRO A 1 266 ? 14.803  -0.019 44.532  1.00 30.05 ? 372 PRO A N     1 
ATOM   1963 C  CA    . PRO A 1 266 ? 16.057  0.653  44.146  1.00 29.86 ? 372 PRO A CA    1 
ATOM   1964 C  C     . PRO A 1 266 ? 16.180  0.851  42.646  1.00 30.24 ? 372 PRO A C     1 
ATOM   1965 O  O     . PRO A 1 266 ? 16.602  1.920  42.200  1.00 29.75 ? 372 PRO A O     1 
ATOM   1966 C  CB    . PRO A 1 266 ? 17.139  -0.332 44.624  1.00 29.56 ? 372 PRO A CB    1 
ATOM   1967 C  CG    . PRO A 1 266 ? 16.570  -0.981 45.791  1.00 29.36 ? 372 PRO A CG    1 
ATOM   1968 C  CD    . PRO A 1 266 ? 15.062  -1.017 45.587  1.00 29.89 ? 372 PRO A CD    1 
ATOM   1969 N  N     . GLU A 1 267 ? 15.762  -0.170 41.892  1.00 30.61 ? 373 GLU A N     1 
ATOM   1970 C  CA    . GLU A 1 267 ? 16.040  -0.259 40.464  1.00 31.04 ? 373 GLU A CA    1 
ATOM   1971 C  C     . GLU A 1 267 ? 15.266  0.793  39.679  1.00 31.04 ? 373 GLU A C     1 
ATOM   1972 O  O     . GLU A 1 267 ? 15.667  1.129  38.561  1.00 31.56 ? 373 GLU A O     1 
ATOM   1973 C  CB    . GLU A 1 267 ? 15.730  -1.661 39.933  1.00 31.06 ? 373 GLU A CB    1 
ATOM   1974 C  CG    . GLU A 1 267 ? 16.508  -2.770 40.640  1.00 32.63 ? 373 GLU A CG    1 
ATOM   1975 C  CD    . GLU A 1 267 ? 15.900  -3.187 41.978  1.00 34.92 ? 373 GLU A CD    1 
ATOM   1976 O  OE1   . GLU A 1 267 ? 14.807  -2.702 42.323  1.00 36.77 ? 373 GLU A OE1   1 
ATOM   1977 O  OE2   . GLU A 1 267 ? 16.507  -4.006 42.697  1.00 36.64 ? 373 GLU A OE2   1 
ATOM   1978 N  N     . ASP A 1 268 ? 14.168  1.294  40.263  1.00 30.64 ? 374 ASP A N     1 
ATOM   1979 C  CA    . ASP A 1 268 ? 13.346  2.352  39.649  1.00 30.23 ? 374 ASP A CA    1 
ATOM   1980 C  C     . ASP A 1 268 ? 13.510  3.695  40.302  1.00 29.88 ? 374 ASP A C     1 
ATOM   1981 O  O     . ASP A 1 268 ? 12.646  4.560  40.115  1.00 29.84 ? 374 ASP A O     1 
ATOM   1982 C  CB    . ASP A 1 268 ? 11.850  2.044  39.722  1.00 30.17 ? 374 ASP A CB    1 
ATOM   1983 C  CG    . ASP A 1 268 ? 11.550  0.594  39.629  1.00 29.28 ? 374 ASP A CG    1 
ATOM   1984 O  OD1   . ASP A 1 268 ? 12.318  -0.143 38.964  1.00 27.89 ? 374 ASP A OD1   1 
ATOM   1985 O  OD2   . ASP A 1 268 ? 10.557  0.124  40.208  1.00 27.63 ? 374 ASP A OD2   1 
ATOM   1986 N  N     . ARG A 1 269 ? 14.566  3.845  41.103  1.00 29.36 ? 375 ARG A N     1 
ATOM   1987 C  CA    . ARG A 1 269 ? 14.958  5.142  41.633  1.00 28.90 ? 375 ARG A CA    1 
ATOM   1988 C  C     . ARG A 1 269 ? 15.797  5.728  40.504  1.00 28.82 ? 375 ARG A C     1 
ATOM   1989 O  O     . ARG A 1 269 ? 16.505  4.976  39.863  1.00 29.50 ? 375 ARG A O     1 
ATOM   1990 C  CB    . ARG A 1 269 ? 15.761  5.000  42.950  1.00 28.51 ? 375 ARG A CB    1 
ATOM   1991 C  CG    . ARG A 1 269 ? 14.894  4.689  44.229  1.00 27.69 ? 375 ARG A CG    1 
ATOM   1992 C  CD    . ARG A 1 269 ? 15.672  4.513  45.601  1.00 25.83 ? 375 ARG A CD    1 
ATOM   1993 N  NE    . ARG A 1 269 ? 15.014  3.515  46.474  1.00 25.62 ? 375 ARG A NE    1 
ATOM   1994 C  CZ    . ARG A 1 269 ? 15.632  2.610  47.259  1.00 25.05 ? 375 ARG A CZ    1 
ATOM   1995 N  NH1   . ARG A 1 269 ? 16.970  2.557  47.392  1.00 26.09 ? 375 ARG A NH1   1 
ATOM   1996 N  NH2   . ARG A 1 269 ? 14.897  1.763  47.952  1.00 22.73 ? 375 ARG A NH2   1 
ATOM   1997 N  N     . PRO A 1 270 ? 15.724  7.028  40.223  1.00 28.68 ? 376 PRO A N     1 
ATOM   1998 C  CA    . PRO A 1 270 ? 16.396  7.578  39.038  1.00 28.51 ? 376 PRO A CA    1 
ATOM   1999 C  C     . PRO A 1 270 ? 17.883  7.858  39.268  1.00 28.44 ? 376 PRO A C     1 
ATOM   2000 O  O     . PRO A 1 270 ? 18.189  8.208  40.378  1.00 28.75 ? 376 PRO A O     1 
ATOM   2001 C  CB    . PRO A 1 270 ? 15.649  8.906  38.804  1.00 28.42 ? 376 PRO A CB    1 
ATOM   2002 C  CG    . PRO A 1 270 ? 14.655  9.050  39.924  1.00 27.90 ? 376 PRO A CG    1 
ATOM   2003 C  CD    . PRO A 1 270 ? 15.035  8.087  40.987  1.00 28.67 ? 376 PRO A CD    1 
ATOM   2004 N  N     . THR A 1 271 ? 18.758  7.745  38.263  1.00 28.52 ? 377 THR A N     1 
ATOM   2005 C  CA    . THR A 1 271 ? 20.157  8.199  38.383  1.00 28.58 ? 377 THR A CA    1 
ATOM   2006 C  C     . THR A 1 271 ? 20.218  9.695  38.589  1.00 28.35 ? 377 THR A C     1 
ATOM   2007 O  O     . THR A 1 271 ? 19.306  10.407 38.200  1.00 28.17 ? 377 THR A O     1 
ATOM   2008 C  CB    . THR A 1 271 ? 20.987  7.953  37.096  1.00 28.90 ? 377 THR A CB    1 
ATOM   2009 O  OG1   . THR A 1 271 ? 20.644  8.937  36.099  1.00 28.80 ? 377 THR A OG1   1 
ATOM   2010 C  CG2   . THR A 1 271 ? 20.721  6.595  36.446  1.00 29.19 ? 377 THR A CG2   1 
ATOM   2011 N  N     . PHE A 1 272 ? 21.330  10.192 39.100  1.00 28.21 ? 378 PHE A N     1 
ATOM   2012 C  CA    . PHE A 1 272 ? 21.456  11.643 39.220  1.00 28.66 ? 378 PHE A CA    1 
ATOM   2013 C  C     . PHE A 1 272 ? 21.262  12.323 37.865  1.00 28.57 ? 378 PHE A C     1 
ATOM   2014 O  O     . PHE A 1 272 ? 20.560  13.325 37.786  1.00 28.69 ? 378 PHE A O     1 
ATOM   2015 C  CB    . PHE A 1 272 ? 22.742  12.067 39.980  1.00 28.96 ? 378 PHE A CB    1 
ATOM   2016 C  CG    . PHE A 1 272 ? 22.764  11.530 41.396  1.00 29.51 ? 378 PHE A CG    1 
ATOM   2017 C  CD1   . PHE A 1 272 ? 21.907  12.028 42.339  1.00 30.03 ? 378 PHE A CD1   1 
ATOM   2018 C  CD2   . PHE A 1 272 ? 23.499  10.425 41.721  1.00 31.47 ? 378 PHE A CD2   1 
ATOM   2019 C  CE1   . PHE A 1 272 ? 21.848  11.500 43.591  1.00 30.83 ? 378 PHE A CE1   1 
ATOM   2020 C  CE2   . PHE A 1 272 ? 23.425  9.893  42.967  1.00 32.08 ? 378 PHE A CE2   1 
ATOM   2021 C  CZ    . PHE A 1 272 ? 22.604  10.446 43.904  1.00 32.62 ? 378 PHE A CZ    1 
ATOM   2022 N  N     . VAL A 1 273 ? 21.791  11.757 36.782  1.00 28.50 ? 379 VAL A N     1 
ATOM   2023 C  CA    . VAL A 1 273 ? 21.601  12.394 35.476  1.00 27.95 ? 379 VAL A CA    1 
ATOM   2024 C  C     . VAL A 1 273 ? 20.144  12.783 35.284  1.00 27.63 ? 379 VAL A C     1 
ATOM   2025 O  O     . VAL A 1 273 ? 19.853  13.905 34.884  1.00 27.48 ? 379 VAL A O     1 
ATOM   2026 C  CB    . VAL A 1 273 ? 22.056  11.529 34.331  1.00 27.81 ? 379 VAL A CB    1 
ATOM   2027 C  CG1   . VAL A 1 273 ? 21.378  11.961 33.016  1.00 28.27 ? 379 VAL A CG1   1 
ATOM   2028 C  CG2   . VAL A 1 273 ? 23.538  11.641 34.204  1.00 27.58 ? 379 VAL A CG2   1 
ATOM   2029 N  N     . ALA A 1 274 ? 19.239  11.858 35.582  1.00 27.18 ? 380 ALA A N     1 
ATOM   2030 C  CA    . ALA A 1 274 ? 17.817  12.147 35.499  1.00 27.06 ? 380 ALA A CA    1 
ATOM   2031 C  C     . ALA A 1 274 ? 17.437  13.282 36.470  1.00 27.13 ? 380 ALA A C     1 
ATOM   2032 O  O     . ALA A 1 274 ? 16.824  14.273 36.089  1.00 27.00 ? 380 ALA A O     1 
ATOM   2033 C  CB    . ALA A 1 274 ? 16.998  10.891 35.777  1.00 26.66 ? 380 ALA A CB    1 
ATOM   2034 N  N     . LEU A 1 275 ? 17.814  13.139 37.728  1.00 27.03 ? 381 LEU A N     1 
ATOM   2035 C  CA    . LEU A 1 275 ? 17.451  14.130 38.721  1.00 26.76 ? 381 LEU A CA    1 
ATOM   2036 C  C     . LEU A 1 275 ? 17.847  15.499 38.179  1.00 26.63 ? 381 LEU A C     1 
ATOM   2037 O  O     . LEU A 1 275 ? 16.985  16.309 37.946  1.00 27.19 ? 381 LEU A O     1 
ATOM   2038 C  CB    . LEU A 1 275 ? 18.091  13.781 40.072  1.00 26.55 ? 381 LEU A CB    1 
ATOM   2039 C  CG    . LEU A 1 275 ? 17.574  12.434 40.583  1.00 25.72 ? 381 LEU A CG    1 
ATOM   2040 C  CD1   . LEU A 1 275 ? 18.377  11.930 41.752  1.00 25.40 ? 381 LEU A CD1   1 
ATOM   2041 C  CD2   . LEU A 1 275 ? 16.084  12.544 40.953  1.00 26.41 ? 381 LEU A CD2   1 
ATOM   2042 N  N     . ARG A 1 276 ? 19.132  15.715 37.912  1.00 26.78 ? 382 ARG A N     1 
ATOM   2043 C  CA    . ARG A 1 276 ? 19.617  16.890 37.162  1.00 26.89 ? 382 ARG A CA    1 
ATOM   2044 C  C     . ARG A 1 276 ? 18.590  17.391 36.158  1.00 26.96 ? 382 ARG A C     1 
ATOM   2045 O  O     . ARG A 1 276 ? 18.155  18.533 36.239  1.00 27.17 ? 382 ARG A O     1 
ATOM   2046 C  CB    . ARG A 1 276 ? 20.945  16.596 36.428  1.00 26.67 ? 382 ARG A CB    1 
ATOM   2047 C  CG    . ARG A 1 276 ? 21.665  17.814 35.769  1.00 26.14 ? 382 ARG A CG    1 
ATOM   2048 C  CD    . ARG A 1 276 ? 22.304  17.508 34.359  1.00 25.68 ? 382 ARG A CD    1 
ATOM   2049 N  NE    . ARG A 1 276 ? 22.855  18.710 33.735  0.01 26.43 ? 382 ARG A NE    1 
ATOM   2050 C  CZ    . ARG A 1 276 ? 23.529  18.730 32.585  0.01 26.83 ? 382 ARG A CZ    1 
ATOM   2051 N  NH1   . ARG A 1 276 ? 23.986  19.883 32.109  0.01 27.00 ? 382 ARG A NH1   1 
ATOM   2052 N  NH2   . ARG A 1 276 ? 23.750  17.607 31.906  0.01 27.00 ? 382 ARG A NH2   1 
ATOM   2053 N  N     . ASP A 1 277 ? 18.206  16.548 35.207  1.00 27.20 ? 383 ASP A N     1 
ATOM   2054 C  CA    . ASP A 1 277 ? 17.270  16.965 34.174  1.00 27.07 ? 383 ASP A CA    1 
ATOM   2055 C  C     . ASP A 1 277 ? 15.948  17.414 34.795  1.00 27.61 ? 383 ASP A C     1 
ATOM   2056 O  O     . ASP A 1 277 ? 15.516  18.539 34.538  1.00 27.52 ? 383 ASP A O     1 
ATOM   2057 C  CB    . ASP A 1 277 ? 17.053  15.839 33.169  1.00 27.13 ? 383 ASP A CB    1 
ATOM   2058 C  CG    . ASP A 1 277 ? 18.298  15.540 32.336  1.00 26.58 ? 383 ASP A CG    1 
ATOM   2059 O  OD1   . ASP A 1 277 ? 19.282  16.304 32.421  1.00 26.13 ? 383 ASP A OD1   1 
ATOM   2060 O  OD2   . ASP A 1 277 ? 18.385  14.558 31.568  1.00 24.47 ? 383 ASP A OD2   1 
ATOM   2061 N  N     . PHE A 1 278 ? 15.345  16.549 35.632  1.00 28.36 ? 384 PHE A N     1 
ATOM   2062 C  CA    . PHE A 1 278 ? 14.033  16.790 36.306  1.00 28.80 ? 384 PHE A CA    1 
ATOM   2063 C  C     . PHE A 1 278 ? 13.980  18.145 36.983  1.00 28.97 ? 384 PHE A C     1 
ATOM   2064 O  O     . PHE A 1 278 ? 13.097  19.010 36.693  1.00 29.03 ? 384 PHE A O     1 
ATOM   2065 C  CB    . PHE A 1 278 ? 13.712  15.723 37.392  1.00 28.63 ? 384 PHE A CB    1 
ATOM   2066 C  CG    . PHE A 1 278 ? 13.210  14.387 36.846  1.00 28.15 ? 384 PHE A CG    1 
ATOM   2067 C  CD1   . PHE A 1 278 ? 12.529  14.290 35.644  1.00 26.69 ? 384 PHE A CD1   1 
ATOM   2068 C  CD2   . PHE A 1 278 ? 13.426  13.215 37.566  1.00 28.15 ? 384 PHE A CD2   1 
ATOM   2069 C  CE1   . PHE A 1 278 ? 12.085  13.068 35.183  1.00 26.48 ? 384 PHE A CE1   1 
ATOM   2070 C  CE2   . PHE A 1 278 ? 12.974  11.985 37.089  1.00 27.03 ? 384 PHE A CE2   1 
ATOM   2071 C  CZ    . PHE A 1 278 ? 12.317  11.918 35.908  1.00 26.00 ? 384 PHE A CZ    1 
ATOM   2072 N  N     . LEU A 1 279 ? 14.937  18.301 37.889  1.00 28.51 ? 385 LEU A N     1 
ATOM   2073 C  CA    . LEU A 1 279 ? 15.148  19.548 38.599  1.00 28.67 ? 385 LEU A CA    1 
ATOM   2074 C  C     . LEU A 1 279 ? 15.137  20.784 37.661  1.00 29.46 ? 385 LEU A C     1 
ATOM   2075 O  O     . LEU A 1 279 ? 14.397  21.754 37.887  1.00 29.40 ? 385 LEU A O     1 
ATOM   2076 C  CB    . LEU A 1 279 ? 16.453  19.439 39.358  1.00 27.99 ? 385 LEU A CB    1 
ATOM   2077 C  CG    . LEU A 1 279 ? 16.465  18.326 40.398  1.00 26.18 ? 385 LEU A CG    1 
ATOM   2078 C  CD1   . LEU A 1 279 ? 17.691  18.492 41.154  1.00 25.80 ? 385 LEU A CD1   1 
ATOM   2079 C  CD2   . LEU A 1 279 ? 15.258  18.391 41.348  1.00 26.42 ? 385 LEU A CD2   1 
ATOM   2080 N  N     . LEU A 1 280 ? 15.919  20.705 36.584  1.00 29.93 ? 386 LEU A N     1 
ATOM   2081 C  CA    . LEU A 1 280 ? 16.007  21.781 35.605  1.00 30.11 ? 386 LEU A CA    1 
ATOM   2082 C  C     . LEU A 1 280 ? 14.672  22.013 34.911  1.00 30.60 ? 386 LEU A C     1 
ATOM   2083 O  O     . LEU A 1 280 ? 14.467  23.075 34.310  1.00 30.79 ? 386 LEU A O     1 
ATOM   2084 C  CB    . LEU A 1 280 ? 17.089  21.488 34.554  1.00 30.00 ? 386 LEU A CB    1 
ATOM   2085 C  CG    . LEU A 1 280 ? 18.543  21.701 35.012  1.00 29.88 ? 386 LEU A CG    1 
ATOM   2086 C  CD1   . LEU A 1 280 ? 19.511  20.992 34.077  1.00 29.80 ? 386 LEU A CD1   1 
ATOM   2087 C  CD2   . LEU A 1 280 ? 18.931  23.179 35.116  1.00 29.83 ? 386 LEU A CD2   1 
ATOM   2088 N  N     . GLU A 1 281 ? 13.774  21.027 34.972  1.00 30.81 ? 387 GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 281 ? 12.441  21.172 34.365  1.00 31.06 ? 387 GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 281 ? 11.385  21.622 35.383  1.00 30.93 ? 387 GLU A C     1 
ATOM   2091 O  O     . GLU A 1 281 ? 10.197  21.345 35.208  1.00 30.98 ? 387 GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 281 ? 12.015  19.872 33.657  1.00 31.19 ? 387 GLU A CB    1 
ATOM   2093 C  CG    . GLU A 1 281 ? 12.868  19.526 32.447  0.01 30.60 ? 387 GLU A CG    1 
ATOM   2094 C  CD    . GLU A 1 281 ? 12.405  18.264 31.745  0.01 30.20 ? 387 GLU A CD    1 
ATOM   2095 O  OE1   . GLU A 1 281 ? 12.347  17.204 32.402  0.01 29.96 ? 387 GLU A OE1   1 
ATOM   2096 O  OE2   . GLU A 1 281 ? 12.101  18.332 30.535  0.01 29.98 ? 387 GLU A OE2   1 
ATOM   2097 N  N     . ALA A 1 282 ? 11.831  22.351 36.413  1.00 30.76 ? 388 ALA A N     1 
ATOM   2098 C  CA    . ALA A 1 282 ? 10.966  22.862 37.477  1.00 30.35 ? 388 ALA A CA    1 
ATOM   2099 C  C     . ALA A 1 282 ? 11.389  24.294 37.884  1.00 30.49 ? 388 ALA A C     1 
ATOM   2100 O  O     . ALA A 1 282 ? 11.748  24.546 39.033  1.00 30.41 ? 388 ALA A O     1 
ATOM   2101 C  CB    . ALA A 1 282 ? 11.003  21.909 38.659  1.00 30.12 ? 388 ALA A CB    1 
ATOM   2102 N  N     . GLN A 1 283 ? 11.335  25.215 36.911  1.00 31.25 ? 389 GLN A N     1 
ATOM   2103 C  CA    . GLN A 1 283 ? 11.678  26.660 37.060  1.00 31.47 ? 389 GLN A CA    1 
ATOM   2104 C  C     . GLN A 1 283 ? 12.879  27.009 38.005  1.00 32.10 ? 389 GLN A C     1 
ATOM   2105 O  O     . GLN A 1 283 ? 12.666  27.400 39.167  1.00 32.00 ? 389 GLN A O     1 
ATOM   2106 C  CB    . GLN A 1 283 ? 10.418  27.457 37.456  1.00 31.13 ? 389 GLN A CB    1 
ATOM   2107 C  CG    . GLN A 1 283 ? 10.597  28.972 37.592  1.00 30.99 ? 389 GLN A CG    1 
ATOM   2108 C  CD    . GLN A 1 283 ? 9.284   29.700 37.955  1.00 31.80 ? 389 GLN A CD    1 
ATOM   2109 O  OE1   . GLN A 1 283 ? 8.871   30.667 37.283  1.00 29.11 ? 389 GLN A OE1   1 
ATOM   2110 N  NE2   . GLN A 1 283 ? 8.637   29.238 39.029  1.00 33.06 ? 389 GLN A NE2   1 
ATOM   2111 N  N     . PRO A 1 284 ? 14.127  26.832 37.520  1.00 32.46 ? 390 PRO A N     1 
ATOM   2112 C  CA    . PRO A 1 284 ? 15.283  27.577 38.057  1.00 32.30 ? 390 PRO A CA    1 
ATOM   2113 C  C     . PRO A 1 284 ? 15.558  28.826 37.185  1.00 31.68 ? 390 PRO A C     1 
ATOM   2114 O  O     . PRO A 1 284 ? 14.575  29.442 36.747  1.00 30.32 ? 390 PRO A O     1 
ATOM   2115 C  CB    . PRO A 1 284 ? 16.443  26.537 38.005  1.00 32.34 ? 390 PRO A CB    1 
ATOM   2116 C  CG    . PRO A 1 284 ? 16.049  25.565 36.870  1.00 32.77 ? 390 PRO A CG    1 
ATOM   2117 C  CD    . PRO A 1 284 ? 14.569  25.876 36.477  1.00 32.46 ? 390 PRO A CD    1 
ATOM   2118 N  N     . LEU B 2 11  ? 26.339  41.122 93.369  1.00 31.10 ? 117 LEU B N     1 
ATOM   2119 C  CA    . LEU B 2 11  ? 27.576  40.736 94.114  1.00 31.44 ? 117 LEU B CA    1 
ATOM   2120 C  C     . LEU B 2 11  ? 27.880  39.221 94.030  1.00 30.82 ? 117 LEU B C     1 
ATOM   2121 O  O     . LEU B 2 11  ? 27.939  38.510 95.059  1.00 31.03 ? 117 LEU B O     1 
ATOM   2122 C  CB    . LEU B 2 11  ? 27.439  41.170 95.573  1.00 31.88 ? 117 LEU B CB    1 
ATOM   2123 C  CG    . LEU B 2 11  ? 28.701  40.973 96.441  1.00 33.69 ? 117 LEU B CG    1 
ATOM   2124 C  CD1   . LEU B 2 11  ? 29.905  41.786 95.873  1.00 34.04 ? 117 LEU B CD1   1 
ATOM   2125 C  CD2   . LEU B 2 11  ? 28.393  41.310 97.962  1.00 34.46 ? 117 LEU B CD2   1 
ATOM   2126 N  N     . THR B 2 12  ? 28.075  38.737 92.803  1.00 29.77 ? 118 THR B N     1 
ATOM   2127 C  CA    . THR B 2 12  ? 28.530  37.350 92.557  1.00 28.96 ? 118 THR B CA    1 
ATOM   2128 C  C     . THR B 2 12  ? 30.020  37.186 92.854  1.00 28.15 ? 118 THR B C     1 
ATOM   2129 O  O     . THR B 2 12  ? 30.783  38.131 92.637  1.00 27.65 ? 118 THR B O     1 
ATOM   2130 C  CB    . THR B 2 12  ? 28.334  36.999 91.085  1.00 28.72 ? 118 THR B CB    1 
ATOM   2131 O  OG1   . THR B 2 12  ? 27.503  37.988 90.464  1.00 29.68 ? 118 THR B OG1   1 
ATOM   2132 C  CG2   . THR B 2 12  ? 27.589  35.717 90.937  1.00 27.37 ? 118 THR B CG2   1 
ATOM   2133 N  N     . CYS B 2 13  ? 30.458  36.012 93.309  1.00 27.34 ? 119 CYS B N     1 
ATOM   2134 C  CA    . CYS B 2 13  ? 31.908  35.843 93.460  1.00 27.68 ? 119 CYS B CA    1 
ATOM   2135 C  C     . CYS B 2 13  ? 32.584  34.561 93.125  1.00 26.43 ? 119 CYS B C     1 
ATOM   2136 O  O     . CYS B 2 13  ? 31.961  33.577 92.751  1.00 25.67 ? 119 CYS B O     1 
ATOM   2137 C  CB    . CYS B 2 13  ? 32.444  36.264 94.829  1.00 27.87 ? 119 CYS B CB    1 
ATOM   2138 S  SG    . CYS B 2 13  ? 31.250  36.652 96.048  1.00 31.05 ? 119 CYS B SG    1 
ATOM   2139 N  N     . LEU B 2 14  ? 33.914  34.686 93.195  1.00 25.55 ? 120 LEU B N     1 
ATOM   2140 C  CA    . LEU B 2 14  ? 34.826  33.580 93.183  1.00 25.13 ? 120 LEU B CA    1 
ATOM   2141 C  C     . LEU B 2 14  ? 34.953  33.078 94.586  1.00 24.70 ? 120 LEU B C     1 
ATOM   2142 O  O     . LEU B 2 14  ? 35.447  33.780 95.463  1.00 22.85 ? 120 LEU B O     1 
ATOM   2143 C  CB    . LEU B 2 14  ? 36.183  34.009 92.680  1.00 25.43 ? 120 LEU B CB    1 
ATOM   2144 C  CG    . LEU B 2 14  ? 36.372  34.425 91.229  1.00 25.97 ? 120 LEU B CG    1 
ATOM   2145 C  CD1   . LEU B 2 14  ? 37.856  34.420 90.932  1.00 27.33 ? 120 LEU B CD1   1 
ATOM   2146 C  CD2   . LEU B 2 14  ? 35.645  33.544 90.273  1.00 26.91 ? 120 LEU B CD2   1 
ATOM   2147 N  N     . ILE B 2 15  ? 34.486  31.842 94.748  1.00 25.73 ? 121 ILE B N     1 
ATOM   2148 C  CA    . ILE B 2 15  ? 34.448  31.107 96.008  1.00 26.85 ? 121 ILE B CA    1 
ATOM   2149 C  C     . ILE B 2 15  ? 35.580  30.065 96.062  1.00 27.20 ? 121 ILE B C     1 
ATOM   2150 O  O     . ILE B 2 15  ? 35.942  29.422 95.052  1.00 27.64 ? 121 ILE B O     1 
ATOM   2151 C  CB    . ILE B 2 15  ? 33.016  30.464 96.188  1.00 27.41 ? 121 ILE B CB    1 
ATOM   2152 C  CG1   . ILE B 2 15  ? 32.013  31.560 96.588  1.00 28.06 ? 121 ILE B CG1   1 
ATOM   2153 C  CG2   . ILE B 2 15  ? 32.988  29.338 97.222  1.00 26.55 ? 121 ILE B CG2   1 
ATOM   2154 C  CD1   . ILE B 2 15  ? 30.814  31.605 95.758  1.00 28.93 ? 121 ILE B CD1   1 
ATOM   2155 N  N     . GLY B 2 16  ? 36.180  29.962 97.238  1.00 27.23 ? 122 GLY B N     1 
ATOM   2156 C  CA    . GLY B 2 16  ? 37.214  28.986 97.480  1.00 27.01 ? 122 GLY B CA    1 
ATOM   2157 C  C     . GLY B 2 16  ? 36.643  27.676 97.996  1.00 26.99 ? 122 GLY B C     1 
ATOM   2158 O  O     . GLY B 2 16  ? 35.811  27.659 98.898  1.00 26.39 ? 122 GLY B O     1 
ATOM   2159 N  N     . GLU B 2 17  ? 37.139  26.565 97.456  1.00 27.28 ? 123 GLU B N     1 
ATOM   2160 C  CA    . GLU B 2 17  ? 36.777  25.252 97.947  1.00 27.48 ? 123 GLU B CA    1 
ATOM   2161 C  C     . GLU B 2 17  ? 36.903  25.171 99.476  1.00 27.35 ? 123 GLU B C     1 
ATOM   2162 O  O     . GLU B 2 17  ? 36.317  24.300 100.099 1.00 27.46 ? 123 GLU B O     1 
ATOM   2163 C  CB    . GLU B 2 17  ? 37.609  24.157 97.253  1.00 27.81 ? 123 GLU B CB    1 
ATOM   2164 C  CG    . GLU B 2 17  ? 37.117  22.719 97.484  1.00 30.10 ? 123 GLU B CG    1 
ATOM   2165 C  CD    . GLU B 2 17  ? 35.611  22.533 97.176  1.00 34.73 ? 123 GLU B CD    1 
ATOM   2166 O  OE1   . GLU B 2 17  ? 35.342  22.274 95.963  1.00 38.25 ? 123 GLU B OE1   1 
ATOM   2167 O  OE2   . GLU B 2 17  ? 34.700  22.642 98.106  1.00 32.14 ? 123 GLU B OE2   1 
ATOM   2168 N  N     . LYS B 2 18  ? 37.647  26.077 100.095 1.00 27.44 ? 124 LYS B N     1 
ATOM   2169 C  CA    . LYS B 2 18  ? 37.690  26.127 101.565 1.00 27.51 ? 124 LYS B CA    1 
ATOM   2170 C  C     . LYS B 2 18  ? 36.553  26.949 102.278 1.00 26.99 ? 124 LYS B C     1 
ATOM   2171 O  O     . LYS B 2 18  ? 36.292  26.743 103.466 1.00 26.31 ? 124 LYS B O     1 
ATOM   2172 C  CB    . LYS B 2 18  ? 39.088  26.576 102.010 1.00 27.63 ? 124 LYS B CB    1 
ATOM   2173 C  CG    . LYS B 2 18  ? 40.158  25.420 102.215 1.00 28.62 ? 124 LYS B CG    1 
ATOM   2174 C  CD    . LYS B 2 18  ? 39.725  23.996 101.783 1.00 28.19 ? 124 LYS B CD    1 
ATOM   2175 C  CE    . LYS B 2 18  ? 40.784  22.978 102.220 1.00 28.72 ? 124 LYS B CE    1 
ATOM   2176 N  NZ    . LYS B 2 18  ? 40.237  21.901 103.124 1.00 28.30 ? 124 LYS B NZ    1 
ATOM   2177 N  N     . ASP B 2 19  ? 35.886  27.853 101.553 1.00 26.47 ? 125 ASP B N     1 
ATOM   2178 C  CA    . ASP B 2 19  ? 34.728  28.566 102.080 1.00 26.25 ? 125 ASP B CA    1 
ATOM   2179 C  C     . ASP B 2 19  ? 33.441  27.797 101.753 1.00 25.89 ? 125 ASP B C     1 
ATOM   2180 O  O     . ASP B 2 19  ? 32.354  28.247 102.079 1.00 25.17 ? 125 ASP B O     1 
ATOM   2181 C  CB    . ASP B 2 19  ? 34.645  30.011 101.539 1.00 26.41 ? 125 ASP B CB    1 
ATOM   2182 C  CG    . ASP B 2 19  ? 36.043  30.674 101.323 1.00 27.32 ? 125 ASP B CG    1 
ATOM   2183 O  OD1   . ASP B 2 19  ? 36.843  30.767 102.281 1.00 25.38 ? 125 ASP B OD1   1 
ATOM   2184 O  OD2   . ASP B 2 19  ? 36.422  31.155 100.217 1.00 28.13 ? 125 ASP B OD2   1 
ATOM   2185 N  N     . LEU B 2 20  ? 33.571  26.621 101.144 1.00 25.75 ? 126 LEU B N     1 
ATOM   2186 C  CA    . LEU B 2 20  ? 32.417  25.867 100.682 1.00 26.15 ? 126 LEU B CA    1 
ATOM   2187 C  C     . LEU B 2 20  ? 32.441  24.390 101.087 1.00 26.23 ? 126 LEU B C     1 
ATOM   2188 O  O     . LEU B 2 20  ? 33.265  23.594 100.619 1.00 26.34 ? 126 LEU B O     1 
ATOM   2189 C  CB    . LEU B 2 20  ? 32.306  25.976 99.156  0.01 26.20 ? 126 LEU B CB    1 
ATOM   2190 C  CG    . LEU B 2 20  ? 31.062  25.376 98.489  0.01 26.52 ? 126 LEU B CG    1 
ATOM   2191 C  CD1   . LEU B 2 20  ? 29.799  26.110 98.913  0.01 26.71 ? 126 LEU B CD1   1 
ATOM   2192 C  CD2   . LEU B 2 20  ? 31.211  25.401 96.977  0.01 26.71 ? 126 LEU B CD2   1 
ATOM   2193 N  N     . ARG B 2 21  ? 31.485  24.016 101.919 1.00 26.58 ? 127 ARG B N     1 
ATOM   2194 C  CA    . ARG B 2 21  ? 31.311  22.626 102.307 1.00 26.87 ? 127 ARG B CA    1 
ATOM   2195 C  C     . ARG B 2 21  ? 30.005  22.051 101.728 1.00 26.66 ? 127 ARG B C     1 
ATOM   2196 O  O     . ARG B 2 21  ? 28.925  22.633 101.879 1.00 25.81 ? 127 ARG B O     1 
ATOM   2197 C  CB    . ARG B 2 21  ? 31.358  22.504 103.835 1.00 27.20 ? 127 ARG B CB    1 
ATOM   2198 C  CG    . ARG B 2 21  ? 32.753  22.785 104.406 0.01 27.35 ? 127 ARG B CG    1 
ATOM   2199 C  CD    . ARG B 2 21  ? 32.854  22.720 105.922 0.01 27.74 ? 127 ARG B CD    1 
ATOM   2200 N  NE    . ARG B 2 21  ? 31.602  23.102 106.564 0.01 28.07 ? 127 ARG B NE    1 
ATOM   2201 C  CZ    . ARG B 2 21  ? 31.147  24.348 106.681 1.00 28.37 ? 127 ARG B CZ    1 
ATOM   2202 N  NH1   . ARG B 2 21  ? 31.823  25.399 106.220 1.00 27.29 ? 127 ARG B NH1   1 
ATOM   2203 N  NH2   . ARG B 2 21  ? 29.982  24.553 107.278 1.00 30.30 ? 127 ARG B NH2   1 
ATOM   2204 N  N     . LEU B 2 22  ? 30.147  20.911 101.050 1.00 26.45 ? 128 LEU B N     1 
ATOM   2205 C  CA    . LEU B 2 22  ? 29.046  20.222 100.403 1.00 26.03 ? 128 LEU B CA    1 
ATOM   2206 C  C     . LEU B 2 22  ? 28.410  19.184 101.332 1.00 25.79 ? 128 LEU B C     1 
ATOM   2207 O  O     . LEU B 2 22  ? 29.074  18.653 102.214 1.00 25.50 ? 128 LEU B O     1 
ATOM   2208 C  CB    . LEU B 2 22  ? 29.554  19.532 99.142  1.00 26.26 ? 128 LEU B CB    1 
ATOM   2209 C  CG    . LEU B 2 22  ? 30.068  20.389 97.987  1.00 26.69 ? 128 LEU B CG    1 
ATOM   2210 C  CD1   . LEU B 2 22  ? 30.837  19.553 97.053  1.00 27.04 ? 128 LEU B CD1   1 
ATOM   2211 C  CD2   . LEU B 2 22  ? 28.942  21.027 97.201  1.00 28.66 ? 128 LEU B CD2   1 
ATOM   2212 N  N     . LEU B 2 23  ? 27.135  18.885 101.073 1.00 25.82 ? 129 LEU B N     1 
ATOM   2213 C  CA    . LEU B 2 23  ? 26.256  18.080 101.934 1.00 26.06 ? 129 LEU B CA    1 
ATOM   2214 C  C     . LEU B 2 23  ? 25.352  17.132 101.094 1.00 25.74 ? 129 LEU B C     1 
ATOM   2215 O  O     . LEU B 2 23  ? 25.714  16.774 99.984  1.00 25.58 ? 129 LEU B O     1 
ATOM   2216 C  CB    . LEU B 2 23  ? 25.389  19.010 102.789 1.00 26.51 ? 129 LEU B CB    1 
ATOM   2217 C  CG    . LEU B 2 23  ? 26.051  20.000 103.756 1.00 27.37 ? 129 LEU B CG    1 
ATOM   2218 C  CD1   . LEU B 2 23  ? 25.039  21.102 104.171 1.00 27.70 ? 129 LEU B CD1   1 
ATOM   2219 C  CD2   . LEU B 2 23  ? 26.631  19.272 104.966 1.00 26.43 ? 129 LEU B CD2   1 
ATOM   2220 N  N     . GLU B 2 24  ? 24.181  16.748 101.596 1.00 25.40 ? 130 GLU B N     1 
ATOM   2221 C  CA    . GLU B 2 24  ? 23.361  15.721 100.940 1.00 25.93 ? 130 GLU B CA    1 
ATOM   2222 C  C     . GLU B 2 24  ? 22.989  15.985 99.445  1.00 26.11 ? 130 GLU B C     1 
ATOM   2223 O  O     . GLU B 2 24  ? 22.963  17.121 98.978  1.00 24.77 ? 130 GLU B O     1 
ATOM   2224 C  CB    . GLU B 2 24  ? 22.101  15.447 101.788 1.00 26.18 ? 130 GLU B CB    1 
ATOM   2225 C  CG    . GLU B 2 24  ? 20.935  16.445 101.623 1.00 27.33 ? 130 GLU B CG    1 
ATOM   2226 C  CD    . GLU B 2 24  ? 20.897  17.590 102.632 1.00 26.85 ? 130 GLU B CD    1 
ATOM   2227 O  OE1   . GLU B 2 24  ? 21.831  17.715 103.440 1.00 27.31 ? 130 GLU B OE1   1 
ATOM   2228 O  OE2   . GLU B 2 24  ? 19.923  18.388 102.602 1.00 26.25 ? 130 GLU B OE2   1 
ATOM   2229 N  N     . LYS B 2 25  ? 22.693  14.915 98.701  1.00 26.62 ? 131 LYS B N     1 
ATOM   2230 C  CA    . LYS B 2 25  ? 22.265  15.067 97.298  1.00 26.75 ? 131 LYS B CA    1 
ATOM   2231 C  C     . LYS B 2 25  ? 20.913  15.759 97.231  1.00 26.54 ? 131 LYS B C     1 
ATOM   2232 O  O     . LYS B 2 25  ? 20.025  15.442 98.011  1.00 26.81 ? 131 LYS B O     1 
ATOM   2233 C  CB    . LYS B 2 25  ? 22.184  13.714 96.581  1.00 26.47 ? 131 LYS B CB    1 
ATOM   2234 C  CG    . LYS B 2 25  ? 23.538  13.043 96.393  0.01 26.95 ? 131 LYS B CG    1 
ATOM   2235 C  CD    . LYS B 2 25  ? 23.412  11.696 95.700  0.01 27.20 ? 131 LYS B CD    1 
ATOM   2236 C  CE    . LYS B 2 25  ? 24.740  10.954 95.687  0.01 27.32 ? 131 LYS B CE    1 
ATOM   2237 N  NZ    . LYS B 2 25  ? 24.622  9.602  95.075  0.01 27.38 ? 131 LYS B NZ    1 
ATOM   2238 N  N     . LEU B 2 26  ? 20.779  16.702 96.307  1.00 26.33 ? 132 LEU B N     1 
ATOM   2239 C  CA    . LEU B 2 26  ? 19.502  17.358 96.001  1.00 26.46 ? 132 LEU B CA    1 
ATOM   2240 C  C     . LEU B 2 26  ? 18.913  16.920 94.635  1.00 27.22 ? 132 LEU B C     1 
ATOM   2241 O  O     . LEU B 2 26  ? 17.672  16.907 94.432  1.00 26.83 ? 132 LEU B O     1 
ATOM   2242 C  CB    . LEU B 2 26  ? 19.686  18.890 95.981  1.00 26.13 ? 132 LEU B CB    1 
ATOM   2243 C  CG    . LEU B 2 26  ? 19.927  19.702 97.256  1.00 24.22 ? 132 LEU B CG    1 
ATOM   2244 C  CD1   . LEU B 2 26  ? 19.924  21.159 96.964  1.00 23.15 ? 132 LEU B CD1   1 
ATOM   2245 C  CD2   . LEU B 2 26  ? 18.898  19.426 98.283  1.00 25.22 ? 132 LEU B CD2   1 
ATOM   2246 N  N     . GLY B 2 27  ? 19.814  16.575 93.707  1.00 28.11 ? 133 GLY B N     1 
ATOM   2247 C  CA    . GLY B 2 27  ? 19.479  16.409 92.290  1.00 28.71 ? 133 GLY B CA    1 
ATOM   2248 C  C     . GLY B 2 27  ? 20.615  15.881 91.407  1.00 28.94 ? 133 GLY B C     1 
ATOM   2249 O  O     . GLY B 2 27  ? 21.770  15.837 91.841  1.00 29.27 ? 133 GLY B O     1 
ATOM   2250 N  N     . ASP B 2 28  ? 20.283  15.504 90.164  1.00 29.25 ? 134 ASP B N     1 
ATOM   2251 C  CA    . ASP B 2 28  ? 21.186  14.728 89.290  1.00 29.17 ? 134 ASP B CA    1 
ATOM   2252 C  C     . ASP B 2 28  ? 21.282  15.341 87.901  1.00 28.87 ? 134 ASP B C     1 
ATOM   2253 O  O     . ASP B 2 28  ? 20.314  15.290 87.158  1.00 29.31 ? 134 ASP B O     1 
ATOM   2254 C  CB    . ASP B 2 28  ? 20.715  13.254 89.200  1.00 29.04 ? 134 ASP B CB    1 
ATOM   2255 C  CG    . ASP B 2 28  ? 21.092  12.445 90.427  0.01 29.01 ? 134 ASP B CG    1 
ATOM   2256 O  OD1   . ASP B 2 28  ? 22.302  12.232 90.652  0.01 28.89 ? 134 ASP B OD1   1 
ATOM   2257 O  OD2   . ASP B 2 28  ? 20.248  11.983 91.224  0.01 28.85 ? 134 ASP B OD2   1 
ATOM   2258 N  N     . GLY B 2 32  ? 27.523  17.589 85.722  1.00 28.16 ? 138 GLY B N     1 
ATOM   2259 C  CA    . GLY B 2 32  ? 27.626  16.788 86.934  1.00 28.74 ? 138 GLY B CA    1 
ATOM   2260 C  C     . GLY B 2 32  ? 26.366  16.694 87.826  1.00 29.22 ? 138 GLY B C     1 
ATOM   2261 O  O     . GLY B 2 32  ? 25.269  16.275 87.379  1.00 29.39 ? 138 GLY B O     1 
ATOM   2262 N  N     . VAL B 2 33  ? 26.521  17.086 89.101  1.00 29.26 ? 139 VAL B N     1 
ATOM   2263 C  CA    . VAL B 2 33  ? 25.596  16.691 90.188  1.00 28.50 ? 139 VAL B CA    1 
ATOM   2264 C  C     . VAL B 2 33  ? 25.222  17.894 91.057  1.00 27.92 ? 139 VAL B C     1 
ATOM   2265 O  O     . VAL B 2 33  ? 25.983  18.881 91.152  1.00 27.51 ? 139 VAL B O     1 
ATOM   2266 C  CB    . VAL B 2 33  ? 26.233  15.515 91.027  1.00 28.55 ? 139 VAL B CB    1 
ATOM   2267 C  CG1   . VAL B 2 33  ? 25.860  15.525 92.500  1.00 28.04 ? 139 VAL B CG1   1 
ATOM   2268 C  CG2   . VAL B 2 33  ? 25.847  14.188 90.412  1.00 29.06 ? 139 VAL B CG2   1 
ATOM   2269 N  N     . VAL B 2 34  ? 24.047  17.798 91.683  1.00 27.06 ? 140 VAL B N     1 
ATOM   2270 C  CA    . VAL B 2 34  ? 23.462  18.914 92.431  1.00 26.75 ? 140 VAL B CA    1 
ATOM   2271 C  C     . VAL B 2 34  ? 23.376  18.601 93.938  1.00 25.92 ? 140 VAL B C     1 
ATOM   2272 O  O     . VAL B 2 34  ? 22.620  17.744 94.346  1.00 25.74 ? 140 VAL B O     1 
ATOM   2273 C  CB    . VAL B 2 34  ? 22.082  19.286 91.834  1.00 26.67 ? 140 VAL B CB    1 
ATOM   2274 C  CG1   . VAL B 2 34  ? 21.699  20.705 92.167  1.00 26.55 ? 140 VAL B CG1   1 
ATOM   2275 C  CG2   . VAL B 2 34  ? 22.138  19.147 90.362  1.00 27.14 ? 140 VAL B CG2   1 
ATOM   2276 N  N     . ARG B 2 35  ? 24.175  19.284 94.744  1.00 25.06 ? 141 ARG B N     1 
ATOM   2277 C  CA    . ARG B 2 35  ? 24.263  18.990 96.152  1.00 25.11 ? 141 ARG B CA    1 
ATOM   2278 C  C     . ARG B 2 35  ? 23.843  20.189 96.997  1.00 25.18 ? 141 ARG B C     1 
ATOM   2279 O  O     . ARG B 2 35  ? 23.990  21.336 96.598  1.00 25.88 ? 141 ARG B O     1 
ATOM   2280 C  CB    . ARG B 2 35  ? 25.696  18.544 96.497  1.00 25.13 ? 141 ARG B CB    1 
ATOM   2281 C  CG    . ARG B 2 35  ? 26.151  17.260 95.754  1.00 25.00 ? 141 ARG B CG    1 
ATOM   2282 C  CD    . ARG B 2 35  ? 27.430  16.557 96.282  1.00 24.83 ? 141 ARG B CD    1 
ATOM   2283 N  NE    . ARG B 2 35  ? 27.462  16.469 97.745  1.00 25.56 ? 141 ARG B NE    1 
ATOM   2284 C  CZ    . ARG B 2 35  ? 28.544  16.174 98.472  1.00 25.87 ? 141 ARG B CZ    1 
ATOM   2285 N  NH1   . ARG B 2 35  ? 29.708  15.902 97.897  1.00 28.01 ? 141 ARG B NH1   1 
ATOM   2286 N  NH2   . ARG B 2 35  ? 28.472  16.149 99.791  1.00 25.05 ? 141 ARG B NH2   1 
ATOM   2287 N  N     . ARG B 2 36  ? 23.299  19.945 98.174  1.00 25.16 ? 142 ARG B N     1 
ATOM   2288 C  CA    . ARG B 2 36  ? 23.019  21.040 99.067  1.00 25.72 ? 142 ARG B CA    1 
ATOM   2289 C  C     . ARG B 2 36  ? 24.363  21.440 99.651  1.00 26.03 ? 142 ARG B C     1 
ATOM   2290 O  O     . ARG B 2 36  ? 25.276  20.645 99.645  1.00 26.05 ? 142 ARG B O     1 
ATOM   2291 C  CB    . ARG B 2 36  ? 22.025  20.634 100.159 1.00 25.71 ? 142 ARG B CB    1 
ATOM   2292 C  CG    . ARG B 2 36  ? 21.843  21.719 101.231 1.00 27.72 ? 142 ARG B CG    1 
ATOM   2293 C  CD    . ARG B 2 36  ? 21.076  21.314 102.451 1.00 29.38 ? 142 ARG B CD    1 
ATOM   2294 N  NE    . ARG B 2 36  ? 20.673  22.485 103.222 1.00 31.41 ? 142 ARG B NE    1 
ATOM   2295 C  CZ    . ARG B 2 36  ? 19.966  22.432 104.365 1.00 33.95 ? 142 ARG B CZ    1 
ATOM   2296 N  NH1   . ARG B 2 36  ? 19.635  23.570 104.995 1.00 34.53 ? 142 ARG B NH1   1 
ATOM   2297 N  NH2   . ARG B 2 36  ? 19.602  21.251 104.899 1.00 33.49 ? 142 ARG B NH2   1 
ATOM   2298 N  N     . GLY B 2 37  ? 24.481  22.678 100.130 1.00 26.61 ? 143 GLY B N     1 
ATOM   2299 C  CA    . GLY B 2 37  ? 25.637  23.117 100.888 1.00 26.69 ? 143 GLY B CA    1 
ATOM   2300 C  C     . GLY B 2 37  ? 25.442  24.364 101.750 1.00 26.87 ? 143 GLY B C     1 
ATOM   2301 O  O     . GLY B 2 37  ? 24.378  24.988 101.775 1.00 26.53 ? 143 GLY B O     1 
ATOM   2302 N  N     . GLU B 2 38  ? 26.511  24.689 102.481 1.00 26.77 ? 144 GLU B N     1 
ATOM   2303 C  CA    . GLU B 2 38  ? 26.652  25.909 103.263 1.00 26.27 ? 144 GLU B CA    1 
ATOM   2304 C  C     . GLU B 2 38  ? 27.894  26.604 102.781 1.00 25.82 ? 144 GLU B C     1 
ATOM   2305 O  O     . GLU B 2 38  ? 28.909  25.976 102.524 1.00 25.17 ? 144 GLU B O     1 
ATOM   2306 C  CB    . GLU B 2 38  ? 26.849  25.587 104.750 1.00 26.72 ? 144 GLU B CB    1 
ATOM   2307 C  CG    . GLU B 2 38  ? 25.642  24.939 105.411 0.01 26.66 ? 144 GLU B CG    1 
ATOM   2308 C  CD    . GLU B 2 38  ? 25.505  25.313 106.875 0.01 26.83 ? 144 GLU B CD    1 
ATOM   2309 O  OE1   . GLU B 2 38  ? 26.494  25.164 107.624 0.01 26.86 ? 144 GLU B OE1   1 
ATOM   2310 O  OE2   . GLU B 2 38  ? 24.409  25.757 107.277 0.01 26.87 ? 144 GLU B OE2   1 
ATOM   2311 N  N     . TRP B 2 39  ? 27.826  27.910 102.705 1.00 25.96 ? 145 TRP B N     1 
ATOM   2312 C  CA    . TRP B 2 39  ? 28.896  28.680 102.120 1.00 26.73 ? 145 TRP B CA    1 
ATOM   2313 C  C     . TRP B 2 39  ? 29.213  29.823 103.057 1.00 26.99 ? 145 TRP B C     1 
ATOM   2314 O  O     . TRP B 2 39  ? 28.312  30.581 103.430 1.00 27.33 ? 145 TRP B O     1 
ATOM   2315 C  CB    . TRP B 2 39  ? 28.474  29.213 100.752 1.00 26.73 ? 145 TRP B CB    1 
ATOM   2316 C  CG    . TRP B 2 39  ? 29.283  30.346 100.271 1.00 26.36 ? 145 TRP B CG    1 
ATOM   2317 C  CD1   . TRP B 2 39  ? 30.604  30.371 100.152 1.00 27.75 ? 145 TRP B CD1   1 
ATOM   2318 C  CD2   . TRP B 2 39  ? 28.812  31.623 99.840  1.00 26.86 ? 145 TRP B CD2   1 
ATOM   2319 N  NE1   . TRP B 2 39  ? 31.016  31.585 99.671  1.00 27.32 ? 145 TRP B NE1   1 
ATOM   2320 C  CE2   . TRP B 2 39  ? 29.928  32.373 99.464  1.00 25.71 ? 145 TRP B CE2   1 
ATOM   2321 C  CE3   . TRP B 2 39  ? 27.541  32.209 99.719  1.00 28.38 ? 145 TRP B CE3   1 
ATOM   2322 C  CZ2   . TRP B 2 39  ? 29.844  33.684 98.985  1.00 27.04 ? 145 TRP B CZ2   1 
ATOM   2323 C  CZ3   . TRP B 2 39  ? 27.451  33.525 99.233  1.00 28.10 ? 145 TRP B CZ3   1 
ATOM   2324 C  CH2   . TRP B 2 39  ? 28.610  34.244 98.872  1.00 27.23 ? 145 TRP B CH2   1 
ATOM   2325 N  N     . ASP B 2 40  ? 30.481  29.937 103.437 1.00 26.77 ? 146 ASP B N     1 
ATOM   2326 C  CA    . ASP B 2 40  ? 30.887  31.003 104.312 1.00 27.41 ? 146 ASP B CA    1 
ATOM   2327 C  C     . ASP B 2 40  ? 31.060  32.207 103.413 1.00 27.75 ? 146 ASP B C     1 
ATOM   2328 O  O     . ASP B 2 40  ? 32.079  32.368 102.748 1.00 28.67 ? 146 ASP B O     1 
ATOM   2329 C  CB    . ASP B 2 40  ? 32.178  30.677 105.080 1.00 27.32 ? 146 ASP B CB    1 
ATOM   2330 C  CG    . ASP B 2 40  ? 32.129  29.324 105.804 1.00 27.52 ? 146 ASP B CG    1 
ATOM   2331 O  OD1   . ASP B 2 40  ? 31.160  29.025 106.553 1.00 25.09 ? 146 ASP B OD1   1 
ATOM   2332 O  OD2   . ASP B 2 40  ? 33.055  28.491 105.672 1.00 29.27 ? 146 ASP B OD2   1 
ATOM   2333 N  N     . ALA B 2 41  ? 30.022  33.025 103.355 1.00 27.95 ? 147 ALA B N     1 
ATOM   2334 C  CA    . ALA B 2 41  ? 30.059  34.242 102.571 1.00 27.61 ? 147 ALA B CA    1 
ATOM   2335 C  C     . ALA B 2 41  ? 31.046  35.116 103.297 1.00 27.27 ? 147 ALA B C     1 
ATOM   2336 O  O     . ALA B 2 41  ? 31.282  34.905 104.488 1.00 26.40 ? 147 ALA B O     1 
ATOM   2337 C  CB    . ALA B 2 41  ? 28.655  34.908 102.490 1.00 27.28 ? 147 ALA B CB    1 
ATOM   2338 N  N     . PRO B 2 42  ? 31.646  36.052 102.566 1.00 27.85 ? 148 PRO B N     1 
ATOM   2339 C  CA    . PRO B 2 42  ? 32.712  36.919 103.101 1.00 28.25 ? 148 PRO B CA    1 
ATOM   2340 C  C     . PRO B 2 42  ? 32.251  38.066 104.030 1.00 28.40 ? 148 PRO B C     1 
ATOM   2341 O  O     . PRO B 2 42  ? 33.044  38.471 104.897 1.00 27.43 ? 148 PRO B O     1 
ATOM   2342 C  CB    . PRO B 2 42  ? 33.398  37.462 101.834 1.00 28.10 ? 148 PRO B CB    1 
ATOM   2343 C  CG    . PRO B 2 42  ? 32.398  37.417 100.774 1.00 28.03 ? 148 PRO B CG    1 
ATOM   2344 C  CD    . PRO B 2 42  ? 31.388  36.325 101.138 1.00 28.35 ? 148 PRO B CD    1 
ATOM   2345 N  N     . SER B 2 43  ? 31.011  38.556 103.864 1.00 28.79 ? 149 SER B N     1 
ATOM   2346 C  CA    . SER B 2 43  ? 30.423  39.519 104.820 1.00 28.96 ? 149 SER B CA    1 
ATOM   2347 C  C     . SER B 2 43  ? 30.491  38.929 106.234 1.00 29.15 ? 149 SER B C     1 
ATOM   2348 O  O     . SER B 2 43  ? 30.586  39.674 107.231 1.00 28.72 ? 149 SER B O     1 
ATOM   2349 C  CB    . SER B 2 43  ? 28.975  39.901 104.446 1.00 29.10 ? 149 SER B CB    1 
ATOM   2350 O  OG    . SER B 2 43  ? 28.053  38.829 104.591 1.00 28.54 ? 149 SER B OG    1 
ATOM   2351 N  N     . GLY B 2 44  ? 30.477  37.585 106.284 1.00 28.94 ? 150 GLY B N     1 
ATOM   2352 C  CA    . GLY B 2 44  ? 30.539  36.820 107.517 1.00 28.53 ? 150 GLY B CA    1 
ATOM   2353 C  C     . GLY B 2 44  ? 29.330  35.924 107.694 1.00 28.18 ? 150 GLY B C     1 
ATOM   2354 O  O     . GLY B 2 44  ? 29.270  35.188 108.685 1.00 28.22 ? 150 GLY B O     1 
ATOM   2355 N  N     . LYS B 2 45  ? 28.380  35.998 106.751 1.00 27.64 ? 151 LYS B N     1 
ATOM   2356 C  CA    . LYS B 2 45  ? 27.150  35.188 106.760 1.00 27.50 ? 151 LYS B CA    1 
ATOM   2357 C  C     . LYS B 2 45  ? 27.368  33.756 106.220 1.00 27.70 ? 151 LYS B C     1 
ATOM   2358 O  O     . LYS B 2 45  ? 27.719  33.563 105.028 1.00 27.67 ? 151 LYS B O     1 
ATOM   2359 C  CB    . LYS B 2 45  ? 26.051  35.884 105.928 1.00 27.38 ? 151 LYS B CB    1 
ATOM   2360 C  CG    . LYS B 2 45  ? 24.860  36.378 106.717 0.01 27.52 ? 151 LYS B CG    1 
ATOM   2361 C  CD    . LYS B 2 45  ? 23.652  36.628 105.823 0.01 27.59 ? 151 LYS B CD    1 
ATOM   2362 C  CE    . LYS B 2 45  ? 22.792  37.766 106.353 0.01 27.65 ? 151 LYS B CE    1 
ATOM   2363 N  NZ    . LYS B 2 45  ? 21.561  37.962 105.540 0.01 27.69 ? 151 LYS B NZ    1 
ATOM   2364 N  N     . THR B 2 46  ? 27.176  32.748 107.077 1.00 27.46 ? 152 THR B N     1 
ATOM   2365 C  CA    . THR B 2 46  ? 27.119  31.378 106.581 1.00 27.52 ? 152 THR B CA    1 
ATOM   2366 C  C     . THR B 2 46  ? 25.753  31.222 105.949 1.00 26.86 ? 152 THR B C     1 
ATOM   2367 O  O     . THR B 2 46  ? 24.747  31.228 106.617 1.00 25.88 ? 152 THR B O     1 
ATOM   2368 C  CB    . THR B 2 46  ? 27.373  30.321 107.642 1.00 27.26 ? 152 THR B CB    1 
ATOM   2369 O  OG1   . THR B 2 46  ? 26.517  30.526 108.767 1.00 29.83 ? 152 THR B OG1   1 
ATOM   2370 C  CG2   . THR B 2 46  ? 28.726  30.490 108.220 1.00 28.61 ? 152 THR B CG2   1 
ATOM   2371 N  N     . VAL B 2 47  ? 25.774  31.111 104.629 1.00 27.23 ? 153 VAL B N     1 
ATOM   2372 C  CA    . VAL B 2 47  ? 24.600  31.094 103.794 1.00 27.62 ? 153 VAL B CA    1 
ATOM   2373 C  C     . VAL B 2 47  ? 24.291  29.661 103.331 1.00 27.70 ? 153 VAL B C     1 
ATOM   2374 O  O     . VAL B 2 47  ? 25.205  28.851 103.178 1.00 27.57 ? 153 VAL B O     1 
ATOM   2375 C  CB    . VAL B 2 47  ? 24.848  32.013 102.591 1.00 27.84 ? 153 VAL B CB    1 
ATOM   2376 C  CG1   . VAL B 2 47  ? 23.813  31.767 101.468 1.00 28.11 ? 153 VAL B CG1   1 
ATOM   2377 C  CG2   . VAL B 2 47  ? 24.858  33.475 103.047 1.00 26.96 ? 153 VAL B CG2   1 
ATOM   2378 N  N     . SER B 2 48  ? 23.004  29.360 103.142 1.00 27.47 ? 154 SER B N     1 
ATOM   2379 C  CA    . SER B 2 48  ? 22.573  28.046 102.704 1.00 27.87 ? 154 SER B CA    1 
ATOM   2380 C  C     . SER B 2 48  ? 22.414  28.061 101.186 1.00 28.41 ? 154 SER B C     1 
ATOM   2381 O  O     . SER B 2 48  ? 21.959  29.055 100.628 1.00 29.78 ? 154 SER B O     1 
ATOM   2382 C  CB    . SER B 2 48  ? 21.278  27.639 103.397 1.00 27.30 ? 154 SER B CB    1 
ATOM   2383 O  OG    . SER B 2 48  ? 21.377  26.301 103.867 1.00 27.59 ? 154 SER B OG    1 
ATOM   2384 N  N     . VAL B 2 49  ? 22.760  26.960 100.521 1.00 28.48 ? 155 VAL B N     1 
ATOM   2385 C  CA    . VAL B 2 49  ? 22.935  26.965 99.067  1.00 28.44 ? 155 VAL B CA    1 
ATOM   2386 C  C     . VAL B 2 49  ? 22.713  25.598 98.412  1.00 28.57 ? 155 VAL B C     1 
ATOM   2387 O  O     . VAL B 2 49  ? 22.781  24.539 99.045  1.00 28.35 ? 155 VAL B O     1 
ATOM   2388 C  CB    . VAL B 2 49  ? 24.372  27.493 98.609  1.00 28.71 ? 155 VAL B CB    1 
ATOM   2389 C  CG1   . VAL B 2 49  ? 24.603  28.962 98.994  1.00 27.93 ? 155 VAL B CG1   1 
ATOM   2390 C  CG2   . VAL B 2 49  ? 25.531  26.589 99.126  1.00 28.15 ? 155 VAL B CG2   1 
ATOM   2391 N  N     . ALA B 2 50  ? 22.415  25.673 97.123  1.00 28.26 ? 156 ALA B N     1 
ATOM   2392 C  CA    . ALA B 2 50  ? 22.358  24.537 96.245  1.00 28.31 ? 156 ALA B CA    1 
ATOM   2393 C  C     . ALA B 2 50  ? 23.642  24.676 95.482  1.00 28.06 ? 156 ALA B C     1 
ATOM   2394 O  O     . ALA B 2 50  ? 24.082  25.800 95.315  1.00 29.07 ? 156 ALA B O     1 
ATOM   2395 C  CB    . ALA B 2 50  ? 21.165  24.689 95.315  1.00 28.39 ? 156 ALA B CB    1 
ATOM   2396 N  N     . VAL B 2 51  ? 24.233  23.573 95.015  1.00 26.92 ? 157 VAL B N     1 
ATOM   2397 C  CA    . VAL B 2 51  ? 25.523  23.593 94.360  1.00 25.93 ? 157 VAL B CA    1 
ATOM   2398 C  C     . VAL B 2 51  ? 25.442  22.614 93.223  1.00 26.44 ? 157 VAL B C     1 
ATOM   2399 O  O     . VAL B 2 51  ? 25.146  21.454 93.430  1.00 26.91 ? 157 VAL B O     1 
ATOM   2400 C  CB    . VAL B 2 51  ? 26.644  23.128 95.307  1.00 25.93 ? 157 VAL B CB    1 
ATOM   2401 C  CG1   . VAL B 2 51  ? 28.007  23.243 94.660  1.00 26.67 ? 157 VAL B CG1   1 
ATOM   2402 C  CG2   . VAL B 2 51  ? 26.636  23.893 96.579  1.00 25.46 ? 157 VAL B CG2   1 
ATOM   2403 N  N     . LYS B 2 52  ? 25.762  23.072 92.020  1.00 27.05 ? 158 LYS B N     1 
ATOM   2404 C  CA    . LYS B 2 52  ? 25.652  22.301 90.769  1.00 26.84 ? 158 LYS B CA    1 
ATOM   2405 C  C     . LYS B 2 52  ? 27.033  22.187 90.152  1.00 26.88 ? 158 LYS B C     1 
ATOM   2406 O  O     . LYS B 2 52  ? 27.670  23.216 89.981  1.00 26.60 ? 158 LYS B O     1 
ATOM   2407 C  CB    . LYS B 2 52  ? 24.710  23.097 89.856  1.00 27.10 ? 158 LYS B CB    1 
ATOM   2408 C  CG    . LYS B 2 52  ? 24.799  22.839 88.365  1.00 27.70 ? 158 LYS B CG    1 
ATOM   2409 C  CD    . LYS B 2 52  ? 23.423  23.157 87.635  1.00 27.51 ? 158 LYS B CD    1 
ATOM   2410 C  CE    . LYS B 2 52  ? 23.052  22.034 86.601  1.00 27.67 ? 158 LYS B CE    1 
ATOM   2411 N  NZ    . LYS B 2 52  ? 22.769  22.487 85.191  1.00 26.51 ? 158 LYS B NZ    1 
ATOM   2412 N  N     . CYS B 2 53  ? 27.482  20.965 89.803  1.00 27.49 ? 159 CYS B N     1 
ATOM   2413 C  CA    . CYS B 2 53  ? 28.923  20.631 89.596  1.00 27.57 ? 159 CYS B CA    1 
ATOM   2414 C  C     . CYS B 2 53  ? 29.444  20.222 88.193  1.00 28.15 ? 159 CYS B C     1 
ATOM   2415 O  O     . CYS B 2 53  ? 28.699  19.894 87.290  1.00 28.06 ? 159 CYS B O     1 
ATOM   2416 C  CB    . CYS B 2 53  ? 29.303  19.533 90.570  1.00 27.17 ? 159 CYS B CB    1 
ATOM   2417 S  SG    . CYS B 2 53  ? 29.009  20.023 92.279  1.00 30.45 ? 159 CYS B SG    1 
ATOM   2418 N  N     . LEU B 2 54  ? 30.768  20.223 88.048  1.00 29.80 ? 160 LEU B N     1 
ATOM   2419 C  CA    . LEU B 2 54  ? 31.474  19.860 86.801  1.00 30.46 ? 160 LEU B CA    1 
ATOM   2420 C  C     . LEU B 2 54  ? 31.030  20.644 85.514  1.00 30.86 ? 160 LEU B C     1 
ATOM   2421 O  O     . LEU B 2 54  ? 31.861  21.298 84.821  1.00 30.70 ? 160 LEU B O     1 
ATOM   2422 C  CB    . LEU B 2 54  ? 31.404  18.332 86.581  1.00 30.46 ? 160 LEU B CB    1 
ATOM   2423 C  CG    . LEU B 2 54  ? 32.161  17.485 87.610  0.01 29.91 ? 160 LEU B CG    1 
ATOM   2424 C  CD1   . LEU B 2 54  ? 31.675  16.044 87.590  0.01 29.61 ? 160 LEU B CD1   1 
ATOM   2425 C  CD2   . LEU B 2 54  ? 33.665  17.547 87.372  0.01 29.63 ? 160 LEU B CD2   1 
ATOM   2426 N  N     . GLU B 2 63  ? 34.247  17.701 77.383  1.00 29.57 ? 169 GLU B N     1 
ATOM   2427 C  CA    . GLU B 2 63  ? 35.096  18.900 77.314  1.00 29.47 ? 169 GLU B CA    1 
ATOM   2428 C  C     . GLU B 2 63  ? 34.229  20.194 77.326  1.00 29.50 ? 169 GLU B C     1 
ATOM   2429 O  O     . GLU B 2 63  ? 34.761  21.282 77.587  1.00 29.34 ? 169 GLU B O     1 
ATOM   2430 C  CB    . GLU B 2 63  ? 36.053  18.840 76.097  1.00 29.07 ? 169 GLU B CB    1 
ATOM   2431 C  CG    . GLU B 2 63  ? 37.145  17.784 76.218  0.01 29.07 ? 169 GLU B CG    1 
ATOM   2432 C  CD    . GLU B 2 63  ? 38.498  18.275 75.736  0.01 28.83 ? 169 GLU B CD    1 
ATOM   2433 O  OE1   . GLU B 2 63  ? 38.973  17.786 74.689  0.01 28.72 ? 169 GLU B OE1   1 
ATOM   2434 O  OE2   . GLU B 2 63  ? 39.087  19.149 76.406  0.01 28.73 ? 169 GLU B OE2   1 
ATOM   2435 N  N     . ALA B 2 64  ? 32.915  20.057 77.056  1.00 29.17 ? 170 ALA B N     1 
ATOM   2436 C  CA    . ALA B 2 64  ? 31.898  21.115 77.315  1.00 28.85 ? 170 ALA B CA    1 
ATOM   2437 C  C     . ALA B 2 64  ? 31.823  21.672 78.783  1.00 28.35 ? 170 ALA B C     1 
ATOM   2438 O  O     . ALA B 2 64  ? 30.897  21.401 79.554  1.00 26.89 ? 170 ALA B O     1 
ATOM   2439 C  CB    . ALA B 2 64  ? 30.501  20.658 76.836  1.00 28.78 ? 170 ALA B CB    1 
ATOM   2440 N  N     . MET B 2 65  ? 32.838  22.477 79.111  1.00 28.32 ? 171 MET B N     1 
ATOM   2441 C  CA    . MET B 2 65  ? 32.847  23.376 80.253  1.00 28.18 ? 171 MET B CA    1 
ATOM   2442 C  C     . MET B 2 65  ? 32.162  24.692 79.895  1.00 27.91 ? 171 MET B C     1 
ATOM   2443 O  O     . MET B 2 65  ? 31.959  25.514 80.775  1.00 28.14 ? 171 MET B O     1 
ATOM   2444 C  CB    . MET B 2 65  ? 34.303  23.669 80.690  1.00 28.10 ? 171 MET B CB    1 
ATOM   2445 C  CG    . MET B 2 65  ? 34.524  23.675 82.180  0.01 28.04 ? 171 MET B CG    1 
ATOM   2446 S  SD    . MET B 2 65  ? 36.039  24.534 82.557  0.01 27.87 ? 171 MET B SD    1 
ATOM   2447 C  CE    . MET B 2 65  ? 35.468  26.200 82.435  0.01 27.85 ? 171 MET B CE    1 
ATOM   2448 N  N     . ASP B 2 66  ? 31.845  24.900 78.610  1.00 27.85 ? 172 ASP B N     1 
ATOM   2449 C  CA    . ASP B 2 66  ? 31.231  26.148 78.132  1.00 27.96 ? 172 ASP B CA    1 
ATOM   2450 C  C     . ASP B 2 66  ? 29.701  26.213 78.347  1.00 27.46 ? 172 ASP B C     1 
ATOM   2451 O  O     . ASP B 2 66  ? 29.142  27.289 78.307  1.00 26.68 ? 172 ASP B O     1 
ATOM   2452 C  CB    . ASP B 2 66  ? 31.589  26.400 76.664  1.00 27.94 ? 172 ASP B CB    1 
ATOM   2453 C  CG    . ASP B 2 66  ? 33.093  26.717 76.461  1.00 30.43 ? 172 ASP B CG    1 
ATOM   2454 O  OD1   . ASP B 2 66  ? 33.582  26.522 75.314  1.00 32.77 ? 172 ASP B OD1   1 
ATOM   2455 O  OD2   . ASP B 2 66  ? 33.873  27.172 77.361  1.00 32.05 ? 172 ASP B OD2   1 
ATOM   2456 N  N     . ASP B 2 67  ? 29.038  25.073 78.559  1.00 27.31 ? 173 ASP B N     1 
ATOM   2457 C  CA    . ASP B 2 67  ? 27.665  25.065 79.075  1.00 27.55 ? 173 ASP B CA    1 
ATOM   2458 C  C     . ASP B 2 67  ? 27.705  25.634 80.500  1.00 27.51 ? 173 ASP B C     1 
ATOM   2459 O  O     . ASP B 2 67  ? 26.806  26.378 80.923  1.00 27.21 ? 173 ASP B O     1 
ATOM   2460 C  CB    . ASP B 2 67  ? 27.032  23.647 79.148  1.00 27.55 ? 173 ASP B CB    1 
ATOM   2461 C  CG    . ASP B 2 67  ? 26.773  23.007 77.776  1.00 28.08 ? 173 ASP B CG    1 
ATOM   2462 O  OD1   . ASP B 2 67  ? 26.832  23.687 76.729  1.00 29.41 ? 173 ASP B OD1   1 
ATOM   2463 O  OD2   . ASP B 2 67  ? 26.516  21.791 77.652  1.00 28.07 ? 173 ASP B OD2   1 
ATOM   2464 N  N     . PHE B 2 68  ? 28.743  25.260 81.241  1.00 27.20 ? 174 PHE B N     1 
ATOM   2465 C  CA    . PHE B 2 68  ? 28.853  25.645 82.639  1.00 27.17 ? 174 PHE B CA    1 
ATOM   2466 C  C     . PHE B 2 68  ? 29.109  27.148 82.721  1.00 27.50 ? 174 PHE B C     1 
ATOM   2467 O  O     . PHE B 2 68  ? 28.452  27.862 83.492  1.00 27.60 ? 174 PHE B O     1 
ATOM   2468 C  CB    . PHE B 2 68  ? 29.977  24.862 83.331  1.00 27.15 ? 174 PHE B CB    1 
ATOM   2469 C  CG    . PHE B 2 68  ? 30.357  25.399 84.658  1.00 26.37 ? 174 PHE B CG    1 
ATOM   2470 C  CD1   . PHE B 2 68  ? 31.351  26.351 84.767  1.00 26.49 ? 174 PHE B CD1   1 
ATOM   2471 C  CD2   . PHE B 2 68  ? 29.706  24.961 85.804  1.00 25.77 ? 174 PHE B CD2   1 
ATOM   2472 C  CE1   . PHE B 2 68  ? 31.700  26.865 86.007  1.00 27.41 ? 174 PHE B CE1   1 
ATOM   2473 C  CE2   . PHE B 2 68  ? 30.026  25.460 87.044  1.00 26.32 ? 174 PHE B CE2   1 
ATOM   2474 C  CZ    . PHE B 2 68  ? 31.028  26.418 87.153  1.00 28.14 ? 174 PHE B CZ    1 
ATOM   2475 N  N     . ILE B 2 69  ? 30.064  27.638 81.935  1.00 27.10 ? 175 ILE B N     1 
ATOM   2476 C  CA    . ILE B 2 69  ? 30.363  29.060 81.982  1.00 26.98 ? 175 ILE B CA    1 
ATOM   2477 C  C     . ILE B 2 69  ? 29.216  29.854 81.380  1.00 26.92 ? 175 ILE B C     1 
ATOM   2478 O  O     . ILE B 2 69  ? 28.992  31.022 81.702  1.00 26.66 ? 175 ILE B O     1 
ATOM   2479 C  CB    . ILE B 2 69  ? 31.702  29.351 81.327  1.00 26.42 ? 175 ILE B CB    1 
ATOM   2480 C  CG1   . ILE B 2 69  ? 32.747  29.126 82.389  1.00 26.89 ? 175 ILE B CG1   1 
ATOM   2481 C  CG2   . ILE B 2 69  ? 31.796  30.789 80.823  1.00 25.87 ? 175 ILE B CG2   1 
ATOM   2482 C  CD1   . ILE B 2 69  ? 34.135  29.084 81.850  1.00 29.99 ? 175 ILE B CD1   1 
ATOM   2483 N  N     . ARG B 2 70  ? 28.462  29.193 80.527  1.00 26.78 ? 176 ARG B N     1 
ATOM   2484 C  CA    . ARG B 2 70  ? 27.315  29.836 79.927  1.00 26.87 ? 176 ARG B CA    1 
ATOM   2485 C  C     . ARG B 2 70  ? 26.189  29.990 80.984  1.00 25.83 ? 176 ARG B C     1 
ATOM   2486 O  O     . ARG B 2 70  ? 25.680  31.086 81.202  1.00 24.85 ? 176 ARG B O     1 
ATOM   2487 C  CB    . ARG B 2 70  ? 26.897  29.095 78.616  1.00 26.98 ? 176 ARG B CB    1 
ATOM   2488 C  CG    . ARG B 2 70  ? 25.939  29.862 77.715  1.00 26.97 ? 176 ARG B CG    1 
ATOM   2489 C  CD    . ARG B 2 70  ? 26.445  30.201 76.333  1.00 26.07 ? 176 ARG B CD    1 
ATOM   2490 N  NE    . ARG B 2 70  ? 27.102  29.100 75.641  1.00 26.01 ? 176 ARG B NE    1 
ATOM   2491 C  CZ    . ARG B 2 70  ? 27.541  29.175 74.367  1.00 28.72 ? 176 ARG B CZ    1 
ATOM   2492 N  NH1   . ARG B 2 70  ? 27.346  30.281 73.640  1.00 29.64 ? 176 ARG B NH1   1 
ATOM   2493 N  NH2   . ARG B 2 70  ? 28.165  28.136 73.800  1.00 28.41 ? 176 ARG B NH2   1 
ATOM   2494 N  N     . GLU B 2 71  ? 25.869  28.910 81.678  1.00 25.25 ? 177 GLU B N     1 
ATOM   2495 C  CA    . GLU B 2 71  ? 24.758  28.927 82.608  1.00 24.98 ? 177 GLU B CA    1 
ATOM   2496 C  C     . GLU B 2 71  ? 24.976  30.036 83.635  1.00 25.84 ? 177 GLU B C     1 
ATOM   2497 O  O     . GLU B 2 71  ? 24.046  30.784 83.959  1.00 26.24 ? 177 GLU B O     1 
ATOM   2498 C  CB    . GLU B 2 71  ? 24.604  27.574 83.268  1.00 23.80 ? 177 GLU B CB    1 
ATOM   2499 C  CG    . GLU B 2 71  ? 23.419  27.529 84.202  1.00 23.80 ? 177 GLU B CG    1 
ATOM   2500 C  CD    . GLU B 2 71  ? 23.016  26.126 84.612  1.00 21.77 ? 177 GLU B CD    1 
ATOM   2501 O  OE1   . GLU B 2 71  ? 22.026  25.992 85.378  1.00 18.54 ? 177 GLU B OE1   1 
ATOM   2502 O  OE2   . GLU B 2 71  ? 23.690  25.175 84.166  1.00 21.19 ? 177 GLU B OE2   1 
ATOM   2503 N  N     . VAL B 2 72  ? 26.220  30.091 84.121  1.00 26.80 ? 178 VAL B N     1 
ATOM   2504 C  CA    . VAL B 2 72  ? 26.795  31.074 85.044  1.00 26.82 ? 178 VAL B CA    1 
ATOM   2505 C  C     . VAL B 2 72  ? 26.561  32.458 84.528  1.00 26.64 ? 178 VAL B C     1 
ATOM   2506 O  O     . VAL B 2 72  ? 25.996  33.284 85.220  1.00 27.83 ? 178 VAL B O     1 
ATOM   2507 C  CB    . VAL B 2 72  ? 28.380  30.858 85.174  1.00 27.47 ? 178 VAL B CB    1 
ATOM   2508 C  CG1   . VAL B 2 72  ? 29.100  32.094 85.657  1.00 26.57 ? 178 VAL B CG1   1 
ATOM   2509 C  CG2   . VAL B 2 72  ? 28.717  29.673 86.116  1.00 28.50 ? 178 VAL B CG2   1 
ATOM   2510 N  N     . ASN B 2 73  ? 27.000  32.723 83.311  1.00 26.35 ? 179 ASN B N     1 
ATOM   2511 C  CA    . ASN B 2 73  ? 26.982  34.082 82.782  1.00 25.98 ? 179 ASN B CA    1 
ATOM   2512 C  C     . ASN B 2 73  ? 25.580  34.617 82.681  1.00 25.93 ? 179 ASN B C     1 
ATOM   2513 O  O     . ASN B 2 73  ? 25.280  35.748 83.077  1.00 25.74 ? 179 ASN B O     1 
ATOM   2514 C  CB    . ASN B 2 73  ? 27.622  34.102 81.416  1.00 26.08 ? 179 ASN B CB    1 
ATOM   2515 C  CG    . ASN B 2 73  ? 29.132  34.325 81.482  1.00 25.22 ? 179 ASN B CG    1 
ATOM   2516 O  OD1   . ASN B 2 73  ? 29.639  34.958 82.413  1.00 22.95 ? 179 ASN B OD1   1 
ATOM   2517 N  ND2   . ASN B 2 73  ? 29.844  33.844 80.465  1.00 22.43 ? 179 ASN B ND2   1 
ATOM   2518 N  N     . ALA B 2 74  ? 24.738  33.761 82.125  1.00 26.19 ? 180 ALA B N     1 
ATOM   2519 C  CA    . ALA B 2 74  ? 23.281  33.874 82.133  1.00 25.72 ? 180 ALA B CA    1 
ATOM   2520 C  C     . ALA B 2 74  ? 22.771  34.263 83.478  1.00 25.76 ? 180 ALA B C     1 
ATOM   2521 O  O     . ALA B 2 74  ? 22.168  35.317 83.622  1.00 24.95 ? 180 ALA B O     1 
ATOM   2522 C  CB    . ALA B 2 74  ? 22.673  32.532 81.742  1.00 26.08 ? 180 ALA B CB    1 
ATOM   2523 N  N     . MET B 2 75  ? 23.018  33.393 84.457  1.00 26.17 ? 181 MET B N     1 
ATOM   2524 C  CA    . MET B 2 75  ? 22.648  33.646 85.845  1.00 26.78 ? 181 MET B CA    1 
ATOM   2525 C  C     . MET B 2 75  ? 23.265  34.952 86.342  1.00 27.59 ? 181 MET B C     1 
ATOM   2526 O  O     . MET B 2 75  ? 22.604  35.767 87.002  1.00 26.85 ? 181 MET B O     1 
ATOM   2527 C  CB    . MET B 2 75  ? 23.012  32.448 86.747  1.00 26.59 ? 181 MET B CB    1 
ATOM   2528 C  CG    . MET B 2 75  ? 21.896  31.402 86.746  1.00 27.80 ? 181 MET B CG    1 
ATOM   2529 S  SD    . MET B 2 75  ? 21.886  29.980 87.930  1.00 30.74 ? 181 MET B SD    1 
ATOM   2530 C  CE    . MET B 2 75  ? 21.312  30.604 89.348  1.00 29.86 ? 181 MET B CE    1 
ATOM   2531 N  N     . HIS B 2 76  ? 24.513  35.217 85.975  1.00 28.88 ? 182 HIS B N     1 
ATOM   2532 C  CA    . HIS B 2 76  ? 25.123  36.496 86.401  1.00 30.19 ? 182 HIS B CA    1 
ATOM   2533 C  C     . HIS B 2 76  ? 24.219  37.740 86.051  1.00 30.18 ? 182 HIS B C     1 
ATOM   2534 O  O     . HIS B 2 76  ? 24.082  38.661 86.833  1.00 29.84 ? 182 HIS B O     1 
ATOM   2535 C  CB    . HIS B 2 76  ? 26.552  36.598 85.861  1.00 30.08 ? 182 HIS B CB    1 
ATOM   2536 C  CG    . HIS B 2 76  ? 27.340  37.757 86.399  1.00 31.00 ? 182 HIS B CG    1 
ATOM   2537 N  ND1   . HIS B 2 76  ? 27.417  38.053 87.740  1.00 30.07 ? 182 HIS B ND1   1 
ATOM   2538 C  CD2   . HIS B 2 76  ? 28.119  38.672 85.764  1.00 31.39 ? 182 HIS B CD2   1 
ATOM   2539 C  CE1   . HIS B 2 76  ? 28.198  39.108 87.907  1.00 31.13 ? 182 HIS B CE1   1 
ATOM   2540 N  NE2   . HIS B 2 76  ? 28.638  39.499 86.725  1.00 31.23 ? 182 HIS B NE2   1 
ATOM   2541 N  N     . SER B 2 77  ? 23.546  37.691 84.913  1.00 30.85 ? 183 SER B N     1 
ATOM   2542 C  CA    . SER B 2 77  ? 22.598  38.764 84.494  1.00 31.63 ? 183 SER B CA    1 
ATOM   2543 C  C     . SER B 2 77  ? 21.348  38.981 85.399  1.00 31.47 ? 183 SER B C     1 
ATOM   2544 O  O     . SER B 2 77  ? 20.908  40.123 85.658  1.00 31.77 ? 183 SER B O     1 
ATOM   2545 C  CB    . SER B 2 77  ? 22.097  38.521 83.043  1.00 31.50 ? 183 SER B CB    1 
ATOM   2546 O  OG    . SER B 2 77  ? 22.540  37.260 82.548  1.00 31.77 ? 183 SER B OG    1 
ATOM   2547 N  N     . LEU B 2 78  ? 20.793  37.877 85.864  1.00 30.31 ? 184 LEU B N     1 
ATOM   2548 C  CA    . LEU B 2 78  ? 19.492  37.896 86.442  1.00 29.55 ? 184 LEU B CA    1 
ATOM   2549 C  C     . LEU B 2 78  ? 19.575  38.372 87.870  1.00 29.42 ? 184 LEU B C     1 
ATOM   2550 O  O     . LEU B 2 78  ? 20.609  38.229 88.506  1.00 30.37 ? 184 LEU B O     1 
ATOM   2551 C  CB    . LEU B 2 78  ? 18.928  36.506 86.390  1.00 29.70 ? 184 LEU B CB    1 
ATOM   2552 C  CG    . LEU B 2 78  ? 19.054  35.848 85.017  1.00 29.98 ? 184 LEU B CG    1 
ATOM   2553 C  CD1   . LEU B 2 78  ? 18.373  34.516 85.082  1.00 31.29 ? 184 LEU B CD1   1 
ATOM   2554 C  CD2   . LEU B 2 78  ? 18.498  36.699 83.905  1.00 29.02 ? 184 LEU B CD2   1 
ATOM   2555 N  N     . ASP B 2 79  ? 18.477  38.970 88.339  1.00 28.79 ? 185 ASP B N     1 
ATOM   2556 C  CA    . ASP B 2 79  ? 18.316  39.517 89.695  1.00 27.58 ? 185 ASP B CA    1 
ATOM   2557 C  C     . ASP B 2 79  ? 16.811  39.900 89.819  1.00 26.99 ? 185 ASP B C     1 
ATOM   2558 O  O     . ASP B 2 79  ? 16.420  41.061 89.648  1.00 25.65 ? 185 ASP B O     1 
ATOM   2559 C  CB    . ASP B 2 79  ? 19.242  40.723 89.961  1.00 27.19 ? 185 ASP B CB    1 
ATOM   2560 C  CG    . ASP B 2 79  ? 19.108  41.259 91.389  1.00 28.07 ? 185 ASP B CG    1 
ATOM   2561 O  OD1   . ASP B 2 79  ? 19.479  40.516 92.293  1.00 30.51 ? 185 ASP B OD1   1 
ATOM   2562 O  OD2   . ASP B 2 79  ? 18.636  42.374 91.743  1.00 28.74 ? 185 ASP B OD2   1 
ATOM   2563 N  N     . HIS B 2 80  ? 15.983  38.887 90.082  1.00 26.24 ? 186 HIS B N     1 
ATOM   2564 C  CA    . HIS B 2 80  ? 14.562  39.074 90.325  1.00 25.98 ? 186 HIS B CA    1 
ATOM   2565 C  C     . HIS B 2 80  ? 14.078  38.175 91.469  1.00 26.21 ? 186 HIS B C     1 
ATOM   2566 O  O     . HIS B 2 80  ? 14.606  37.087 91.660  1.00 27.34 ? 186 HIS B O     1 
ATOM   2567 C  CB    . HIS B 2 80  ? 13.768  38.754 89.067  1.00 25.50 ? 186 HIS B CB    1 
ATOM   2568 C  CG    . HIS B 2 80  ? 12.306  39.030 89.210  1.00 24.41 ? 186 HIS B CG    1 
ATOM   2569 N  ND1   . HIS B 2 80  ? 11.381  38.043 89.457  1.00 21.02 ? 186 HIS B ND1   1 
ATOM   2570 C  CD2   . HIS B 2 80  ? 11.617  40.192 89.178  1.00 23.09 ? 186 HIS B CD2   1 
ATOM   2571 C  CE1   . HIS B 2 80  ? 10.182  38.580 89.548  1.00 21.16 ? 186 HIS B CE1   1 
ATOM   2572 N  NE2   . HIS B 2 80  ? 10.296  39.883 89.374  1.00 22.70 ? 186 HIS B NE2   1 
ATOM   2573 N  N     . ARG B 2 81  ? 13.075  38.601 92.226  1.00 25.53 ? 187 ARG B N     1 
ATOM   2574 C  CA    . ARG B 2 81  ? 12.544  37.755 93.285  1.00 25.84 ? 187 ARG B CA    1 
ATOM   2575 C  C     . ARG B 2 81  ? 12.157  36.321 92.883  1.00 25.83 ? 187 ARG B C     1 
ATOM   2576 O  O     . ARG B 2 81  ? 11.896  35.495 93.754  1.00 26.06 ? 187 ARG B O     1 
ATOM   2577 C  CB    . ARG B 2 81  ? 11.323  38.427 93.967  1.00 26.69 ? 187 ARG B CB    1 
ATOM   2578 C  CG    . ARG B 2 81  ? 10.270  38.943 93.020  1.00 28.11 ? 187 ARG B CG    1 
ATOM   2579 C  CD    . ARG B 2 81  ? 9.230   39.899 93.602  1.00 30.28 ? 187 ARG B CD    1 
ATOM   2580 N  NE    . ARG B 2 81  ? 8.616   39.489 94.868  1.00 33.66 ? 187 ARG B NE    1 
ATOM   2581 C  CZ    . ARG B 2 81  ? 8.096   38.276 95.180  1.00 33.82 ? 187 ARG B CZ    1 
ATOM   2582 N  NH1   . ARG B 2 81  ? 8.094   37.235 94.340  1.00 32.94 ? 187 ARG B NH1   1 
ATOM   2583 N  NH2   . ARG B 2 81  ? 7.565   38.114 96.387  1.00 33.07 ? 187 ARG B NH2   1 
ATOM   2584 N  N     . ASN B 2 82  ? 12.074  36.005 91.595  1.00 25.90 ? 188 ASN B N     1 
ATOM   2585 C  CA    . ASN B 2 82  ? 11.489  34.714 91.166  1.00 25.71 ? 188 ASN B CA    1 
ATOM   2586 C  C     . ASN B 2 82  ? 12.419  33.860 90.299  1.00 25.26 ? 188 ASN B C     1 
ATOM   2587 O  O     . ASN B 2 82  ? 12.012  32.885 89.672  1.00 25.14 ? 188 ASN B O     1 
ATOM   2588 C  CB    . ASN B 2 82  ? 10.154  34.946 90.446  1.00 25.46 ? 188 ASN B CB    1 
ATOM   2589 C  CG    . ASN B 2 82  ? 8.984   35.030 91.396  1.00 24.29 ? 188 ASN B CG    1 
ATOM   2590 O  OD1   . ASN B 2 82  ? 8.385   36.076 91.555  1.00 25.37 ? 188 ASN B OD1   1 
ATOM   2591 N  ND2   . ASN B 2 82  ? 8.632   33.918 91.996  1.00 23.14 ? 188 ASN B ND2   1 
ATOM   2592 N  N     . LEU B 2 83  ? 13.665  34.272 90.276  1.00 25.08 ? 189 LEU B N     1 
ATOM   2593 C  CA    . LEU B 2 83  ? 14.738  33.544 89.664  1.00 25.34 ? 189 LEU B CA    1 
ATOM   2594 C  C     . LEU B 2 83  ? 15.755  33.154 90.767  1.00 25.71 ? 189 LEU B C     1 
ATOM   2595 O  O     . LEU B 2 83  ? 16.115  33.960 91.633  1.00 24.83 ? 189 LEU B O     1 
ATOM   2596 C  CB    . LEU B 2 83  ? 15.352  34.436 88.594  1.00 25.12 ? 189 LEU B CB    1 
ATOM   2597 C  CG    . LEU B 2 83  ? 14.336  35.159 87.684  1.00 26.24 ? 189 LEU B CG    1 
ATOM   2598 C  CD1   . LEU B 2 83  ? 14.967  36.191 86.766  1.00 27.26 ? 189 LEU B CD1   1 
ATOM   2599 C  CD2   . LEU B 2 83  ? 13.631  34.175 86.816  1.00 27.23 ? 189 LEU B CD2   1 
ATOM   2600 N  N     . ILE B 2 84  ? 16.174  31.892 90.761  1.00 26.79 ? 190 ILE B N     1 
ATOM   2601 C  CA    . ILE B 2 84  ? 17.312  31.443 91.603  1.00 27.59 ? 190 ILE B CA    1 
ATOM   2602 C  C     . ILE B 2 84  ? 18.588  32.310 91.443  1.00 27.33 ? 190 ILE B C     1 
ATOM   2603 O  O     . ILE B 2 84  ? 19.230  32.284 90.382  1.00 26.74 ? 190 ILE B O     1 
ATOM   2604 C  CB    . ILE B 2 84  ? 17.698  29.961 91.323  1.00 27.40 ? 190 ILE B CB    1 
ATOM   2605 C  CG1   . ILE B 2 84  ? 16.503  29.020 91.570  1.00 28.64 ? 190 ILE B CG1   1 
ATOM   2606 C  CG2   . ILE B 2 84  ? 18.849  29.578 92.209  1.00 28.02 ? 190 ILE B CG2   1 
ATOM   2607 C  CD1   . ILE B 2 84  ? 15.785  29.238 92.893  1.00 29.08 ? 190 ILE B CD1   1 
ATOM   2608 N  N     . ARG B 2 85  ? 18.907  33.065 92.507  1.00 26.80 ? 191 ARG B N     1 
ATOM   2609 C  CA    . ARG B 2 85  ? 20.095  33.894 92.600  1.00 26.41 ? 191 ARG B CA    1 
ATOM   2610 C  C     . ARG B 2 85  ? 21.308  33.022 92.435  1.00 26.35 ? 191 ARG B C     1 
ATOM   2611 O  O     . ARG B 2 85  ? 21.313  31.839 92.811  1.00 26.19 ? 191 ARG B O     1 
ATOM   2612 C  CB    . ARG B 2 85  ? 20.163  34.571 93.965  1.00 26.44 ? 191 ARG B CB    1 
ATOM   2613 C  CG    . ARG B 2 85  ? 19.122  35.653 94.204  0.01 26.74 ? 191 ARG B CG    1 
ATOM   2614 C  CD    . ARG B 2 85  ? 18.981  36.037 95.671  0.01 27.06 ? 191 ARG B CD    1 
ATOM   2615 N  NE    . ARG B 2 85  ? 18.076  37.166 95.874  0.01 27.25 ? 191 ARG B NE    1 
ATOM   2616 C  CZ    . ARG B 2 85  ? 17.787  37.702 97.059  0.01 27.41 ? 191 ARG B CZ    1 
ATOM   2617 N  NH1   . ARG B 2 85  ? 16.949  38.730 97.133  0.01 27.51 ? 191 ARG B NH1   1 
ATOM   2618 N  NH2   . ARG B 2 85  ? 18.330  37.219 98.174  0.01 27.42 ? 191 ARG B NH2   1 
ATOM   2619 N  N     . LEU B 2 86  ? 22.330  33.586 91.835  1.00 26.35 ? 192 LEU B N     1 
ATOM   2620 C  CA    . LEU B 2 86  ? 23.608  32.902 91.748  1.00 26.51 ? 192 LEU B CA    1 
ATOM   2621 C  C     . LEU B 2 86  ? 24.536  33.676 92.638  1.00 25.82 ? 192 LEU B C     1 
ATOM   2622 O  O     . LEU B 2 86  ? 24.985  34.724 92.240  1.00 25.65 ? 192 LEU B O     1 
ATOM   2623 C  CB    . LEU B 2 86  ? 24.172  32.902 90.321  1.00 26.38 ? 192 LEU B CB    1 
ATOM   2624 C  CG    . LEU B 2 86  ? 25.677  32.499 90.237  1.00 28.18 ? 192 LEU B CG    1 
ATOM   2625 C  CD1   . LEU B 2 86  ? 25.960  30.990 90.445  1.00 28.31 ? 192 LEU B CD1   1 
ATOM   2626 C  CD2   . LEU B 2 86  ? 26.273  32.927 88.913  1.00 29.49 ? 192 LEU B CD2   1 
ATOM   2627 N  N     . TYR B 2 87  ? 24.808  33.167 93.826  1.00 25.61 ? 193 TYR B N     1 
ATOM   2628 C  CA    . TYR B 2 87  ? 25.775  33.784 94.735  1.00 26.40 ? 193 TYR B CA    1 
ATOM   2629 C  C     . TYR B 2 87  ? 27.244  33.802 94.233  1.00 26.60 ? 193 TYR B C     1 
ATOM   2630 O  O     . TYR B 2 87  ? 27.992  34.701 94.599  1.00 26.76 ? 193 TYR B O     1 
ATOM   2631 C  CB    . TYR B 2 87  ? 25.756  33.087 96.100  1.00 26.77 ? 193 TYR B CB    1 
ATOM   2632 C  CG    . TYR B 2 87  ? 24.418  33.071 96.792  1.00 27.59 ? 193 TYR B CG    1 
ATOM   2633 C  CD1   . TYR B 2 87  ? 23.750  31.868 97.020  1.00 28.49 ? 193 TYR B CD1   1 
ATOM   2634 C  CD2   . TYR B 2 87  ? 23.816  34.265 97.219  1.00 27.91 ? 193 TYR B CD2   1 
ATOM   2635 C  CE1   . TYR B 2 87  ? 22.521  31.845 97.656  1.00 29.34 ? 193 TYR B CE1   1 
ATOM   2636 C  CE2   . TYR B 2 87  ? 22.574  34.259 97.842  1.00 29.49 ? 193 TYR B CE2   1 
ATOM   2637 C  CZ    . TYR B 2 87  ? 21.926  33.035 98.072  1.00 31.25 ? 193 TYR B CZ    1 
ATOM   2638 O  OH    . TYR B 2 87  ? 20.679  33.003 98.695  1.00 31.85 ? 193 TYR B OH    1 
ATOM   2639 N  N     . GLY B 2 88  ? 27.643  32.829 93.407  1.00 26.54 ? 194 GLY B N     1 
ATOM   2640 C  CA    . GLY B 2 88  ? 29.019  32.730 92.936  1.00 26.09 ? 194 GLY B CA    1 
ATOM   2641 C  C     . GLY B 2 88  ? 29.453  31.357 92.421  1.00 25.97 ? 194 GLY B C     1 
ATOM   2642 O  O     . GLY B 2 88  ? 28.690  30.413 92.320  1.00 25.47 ? 194 GLY B O     1 
ATOM   2643 N  N     . VAL B 2 89  ? 30.725  31.250 92.110  1.00 26.05 ? 195 VAL B N     1 
ATOM   2644 C  CA    . VAL B 2 89  ? 31.210  30.123 91.344  1.00 26.45 ? 195 VAL B CA    1 
ATOM   2645 C  C     . VAL B 2 89  ? 32.653  29.794 91.699  1.00 26.00 ? 195 VAL B C     1 
ATOM   2646 O  O     . VAL B 2 89  ? 33.414  30.685 92.015  1.00 26.07 ? 195 VAL B O     1 
ATOM   2647 C  CB    . VAL B 2 89  ? 31.057  30.395 89.857  1.00 26.75 ? 195 VAL B CB    1 
ATOM   2648 C  CG1   . VAL B 2 89  ? 31.749  31.678 89.473  1.00 27.26 ? 195 VAL B CG1   1 
ATOM   2649 C  CG2   . VAL B 2 89  ? 31.589  29.249 89.057  1.00 27.46 ? 195 VAL B CG2   1 
ATOM   2650 N  N     . VAL B 2 90  ? 32.968  28.500 91.668  1.00 25.55 ? 196 VAL B N     1 
ATOM   2651 C  CA    . VAL B 2 90  ? 34.234  27.931 92.076  1.00 25.76 ? 196 VAL B CA    1 
ATOM   2652 C  C     . VAL B 2 90  ? 34.947  27.382 90.843  1.00 25.69 ? 196 VAL B C     1 
ATOM   2653 O  O     . VAL B 2 90  ? 34.396  26.527 90.130  1.00 24.86 ? 196 VAL B O     1 
ATOM   2654 C  CB    . VAL B 2 90  ? 33.977  26.790 93.093  1.00 26.34 ? 196 VAL B CB    1 
ATOM   2655 C  CG1   . VAL B 2 90  ? 35.294  26.100 93.564  1.00 24.80 ? 196 VAL B CG1   1 
ATOM   2656 C  CG2   . VAL B 2 90  ? 33.177  27.345 94.266  1.00 26.02 ? 196 VAL B CG2   1 
ATOM   2657 N  N     . LEU B 2 91  ? 36.166  27.865 90.588  1.00 25.63 ? 197 LEU B N     1 
ATOM   2658 C  CA    . LEU B 2 91  ? 36.835  27.526 89.339  1.00 25.84 ? 197 LEU B CA    1 
ATOM   2659 C  C     . LEU B 2 91  ? 37.851  26.429 89.463  1.00 26.12 ? 197 LEU B C     1 
ATOM   2660 O  O     . LEU B 2 91  ? 38.377  25.971 88.455  1.00 26.08 ? 197 LEU B O     1 
ATOM   2661 C  CB    . LEU B 2 91  ? 37.536  28.723 88.788  1.00 25.64 ? 197 LEU B CB    1 
ATOM   2662 C  CG    . LEU B 2 91  ? 36.633  29.881 88.511  1.00 25.99 ? 197 LEU B CG    1 
ATOM   2663 C  CD1   . LEU B 2 91  ? 37.563  30.992 88.065  1.00 27.04 ? 197 LEU B CD1   1 
ATOM   2664 C  CD2   . LEU B 2 91  ? 35.584  29.526 87.468  1.00 25.88 ? 197 LEU B CD2   1 
ATOM   2665 N  N     . THR B 2 92  ? 38.162  26.038 90.691  1.00 26.67 ? 198 THR B N     1 
ATOM   2666 C  CA    . THR B 2 92  ? 39.053  24.909 90.905  1.00 27.10 ? 198 THR B CA    1 
ATOM   2667 C  C     . THR B 2 92  ? 38.272  23.660 90.563  1.00 27.28 ? 198 THR B C     1 
ATOM   2668 O  O     . THR B 2 92  ? 37.217  23.446 91.121  1.00 27.24 ? 198 THR B O     1 
ATOM   2669 C  CB    . THR B 2 92  ? 39.575  24.849 92.368  1.00 27.26 ? 198 THR B CB    1 
ATOM   2670 O  OG1   . THR B 2 92  ? 38.508  25.008 93.316  1.00 27.14 ? 198 THR B OG1   1 
ATOM   2671 C  CG2   . THR B 2 92  ? 40.512  26.027 92.668  1.00 28.01 ? 198 THR B CG2   1 
ATOM   2672 N  N     . PRO B 2 93  ? 38.757  22.850 89.630  1.00 28.04 ? 199 PRO B N     1 
ATOM   2673 C  CA    . PRO B 2 93  ? 38.094  21.578 89.322  1.00 28.13 ? 199 PRO B CA    1 
ATOM   2674 C  C     . PRO B 2 93  ? 38.022  20.630 90.544  1.00 28.13 ? 199 PRO B C     1 
ATOM   2675 O  O     . PRO B 2 93  ? 39.037  20.468 91.232  1.00 28.00 ? 199 PRO B O     1 
ATOM   2676 C  CB    . PRO B 2 93  ? 38.977  20.984 88.223  1.00 28.27 ? 199 PRO B CB    1 
ATOM   2677 C  CG    . PRO B 2 93  ? 40.379  21.660 88.420  1.00 28.95 ? 199 PRO B CG    1 
ATOM   2678 C  CD    . PRO B 2 93  ? 39.969  23.057 88.804  1.00 28.71 ? 199 PRO B CD    1 
ATOM   2679 N  N     . PRO B 2 94  ? 36.868  20.013 90.821  1.00 28.37 ? 200 PRO B N     1 
ATOM   2680 C  CA    . PRO B 2 94  ? 35.631  20.164 90.026  1.00 28.29 ? 200 PRO B CA    1 
ATOM   2681 C  C     . PRO B 2 94  ? 34.906  21.526 90.192  1.00 27.70 ? 200 PRO B C     1 
ATOM   2682 O  O     . PRO B 2 94  ? 34.661  21.982 91.325  1.00 26.99 ? 200 PRO B O     1 
ATOM   2683 C  CB    . PRO B 2 94  ? 34.744  18.996 90.526  1.00 28.45 ? 200 PRO B CB    1 
ATOM   2684 C  CG    . PRO B 2 94  ? 35.268  18.621 91.900  1.00 28.31 ? 200 PRO B CG    1 
ATOM   2685 C  CD    . PRO B 2 94  ? 36.695  19.078 91.950  1.00 28.72 ? 200 PRO B CD    1 
ATOM   2686 N  N     . MET B 2 95  ? 34.553  22.142 89.069  1.00 27.08 ? 201 MET B N     1 
ATOM   2687 C  CA    . MET B 2 95  ? 33.882  23.419 89.122  1.00 27.74 ? 201 MET B CA    1 
ATOM   2688 C  C     . MET B 2 95  ? 32.408  23.321 89.546  1.00 27.47 ? 201 MET B C     1 
ATOM   2689 O  O     . MET B 2 95  ? 31.743  22.326 89.298  1.00 26.84 ? 201 MET B O     1 
ATOM   2690 C  CB    . MET B 2 95  ? 33.918  24.112 87.783  1.00 28.27 ? 201 MET B CB    1 
ATOM   2691 C  CG    . MET B 2 95  ? 35.253  24.389 87.245  1.00 29.69 ? 201 MET B CG    1 
ATOM   2692 S  SD    . MET B 2 95  ? 35.090  25.492 85.793  1.00 32.89 ? 201 MET B SD    1 
ATOM   2693 C  CE    . MET B 2 95  ? 36.825  25.631 85.570  1.00 32.86 ? 201 MET B CE    1 
ATOM   2694 N  N     . LYS B 2 96  ? 31.908  24.416 90.121  1.00 27.11 ? 202 LYS B N     1 
ATOM   2695 C  CA    . LYS B 2 96  ? 30.603  24.454 90.740  1.00 27.04 ? 202 LYS B CA    1 
ATOM   2696 C  C     . LYS B 2 96  ? 29.967  25.850 90.698  1.00 26.43 ? 202 LYS B C     1 
ATOM   2697 O  O     . LYS B 2 96  ? 30.599  26.827 91.021  1.00 24.87 ? 202 LYS B O     1 
ATOM   2698 C  CB    . LYS B 2 96  ? 30.708  24.079 92.238  1.00 27.31 ? 202 LYS B CB    1 
ATOM   2699 C  CG    . LYS B 2 96  ? 31.364  22.777 92.595  1.00 27.62 ? 202 LYS B CG    1 
ATOM   2700 C  CD    . LYS B 2 96  ? 32.196  22.913 93.890  1.00 27.70 ? 202 LYS B CD    1 
ATOM   2701 C  CE    . LYS B 2 96  ? 32.822  21.569 94.343  1.00 27.54 ? 202 LYS B CE    1 
ATOM   2702 N  NZ    . LYS B 2 96  ? 32.284  20.344 93.648  1.00 26.14 ? 202 LYS B NZ    1 
ATOM   2703 N  N     . MET B 2 97  ? 28.674  25.901 90.399  1.00 26.66 ? 203 MET B N     1 
ATOM   2704 C  CA    . MET B 2 97  ? 27.860  27.099 90.622  1.00 26.42 ? 203 MET B CA    1 
ATOM   2705 C  C     . MET B 2 97  ? 27.245  27.081 91.984  1.00 25.43 ? 203 MET B C     1 
ATOM   2706 O  O     . MET B 2 97  ? 26.630  26.117 92.344  1.00 25.11 ? 203 MET B O     1 
ATOM   2707 C  CB    . MET B 2 97  ? 26.702  27.121 89.657  1.00 26.88 ? 203 MET B CB    1 
ATOM   2708 C  CG    . MET B 2 97  ? 27.009  27.736 88.347  1.00 28.84 ? 203 MET B CG    1 
ATOM   2709 S  SD    . MET B 2 97  ? 25.635  27.347 87.312  1.00 30.61 ? 203 MET B SD    1 
ATOM   2710 C  CE    . MET B 2 97  ? 26.462  26.371 86.137  1.00 29.60 ? 203 MET B CE    1 
ATOM   2711 N  N     . VAL B 2 98  ? 27.369  28.169 92.716  1.00 25.53 ? 204 VAL B N     1 
ATOM   2712 C  CA    . VAL B 2 98  ? 26.775  28.300 94.035  1.00 25.82 ? 204 VAL B CA    1 
ATOM   2713 C  C     . VAL B 2 98  ? 25.590  29.202 93.878  1.00 26.31 ? 204 VAL B C     1 
ATOM   2714 O  O     . VAL B 2 98  ? 25.738  30.374 93.444  1.00 25.59 ? 204 VAL B O     1 
ATOM   2715 C  CB    . VAL B 2 98  ? 27.694  28.996 95.010  1.00 26.16 ? 204 VAL B CB    1 
ATOM   2716 C  CG1   . VAL B 2 98  ? 27.126  28.863 96.418  1.00 26.95 ? 204 VAL B CG1   1 
ATOM   2717 C  CG2   . VAL B 2 98  ? 29.119  28.450 94.904  1.00 26.33 ? 204 VAL B CG2   1 
ATOM   2718 N  N     . THR B 2 99  ? 24.424  28.637 94.203  1.00 26.38 ? 205 THR B N     1 
ATOM   2719 C  CA    . THR B 2 99  ? 23.146  29.252 93.937  1.00 26.37 ? 205 THR B CA    1 
ATOM   2720 C  C     . THR B 2 99  ? 22.259  29.112 95.147  1.00 26.97 ? 205 THR B C     1 
ATOM   2721 O  O     . THR B 2 99  ? 22.545  28.350 96.067  1.00 27.34 ? 205 THR B O     1 
ATOM   2722 C  CB    . THR B 2 99  ? 22.434  28.582 92.803  1.00 26.03 ? 205 THR B CB    1 
ATOM   2723 O  OG1   . THR B 2 99  ? 21.702  27.499 93.338  1.00 26.63 ? 205 THR B OG1   1 
ATOM   2724 C  CG2   . THR B 2 99  ? 23.360  27.920 91.796  1.00 25.35 ? 205 THR B CG2   1 
ATOM   2725 N  N     . GLU B 2 100 ? 21.148  29.834 95.110  1.00 27.19 ? 206 GLU B N     1 
ATOM   2726 C  CA    . GLU B 2 100 ? 20.241  29.944 96.249  1.00 27.01 ? 206 GLU B CA    1 
ATOM   2727 C  C     . GLU B 2 100 ? 19.494  28.666 96.353  1.00 26.21 ? 206 GLU B C     1 
ATOM   2728 O  O     . GLU B 2 100 ? 19.219  28.064 95.323  1.00 26.43 ? 206 GLU B O     1 
ATOM   2729 C  CB    . GLU B 2 100 ? 19.294  31.164 96.065  1.00 27.63 ? 206 GLU B CB    1 
ATOM   2730 C  CG    . GLU B 2 100 ? 17.851  31.077 96.548  1.00 26.96 ? 206 GLU B CG    1 
ATOM   2731 C  CD    . GLU B 2 100 ? 17.056  32.350 96.194  1.00 29.34 ? 206 GLU B CD    1 
ATOM   2732 O  OE1   . GLU B 2 100 ? 17.034  32.709 95.015  1.00 31.97 ? 206 GLU B OE1   1 
ATOM   2733 O  OE2   . GLU B 2 100 ? 16.448  33.027 97.057  1.00 28.45 ? 206 GLU B OE2   1 
ATOM   2734 N  N     . LEU B 2 101 ? 19.194  28.258 97.594  1.00 25.48 ? 207 LEU B N     1 
ATOM   2735 C  CA    . LEU B 2 101 ? 18.505  27.001 97.902  1.00 24.36 ? 207 LEU B CA    1 
ATOM   2736 C  C     . LEU B 2 101 ? 17.005  27.215 97.961  1.00 23.77 ? 207 LEU B C     1 
ATOM   2737 O  O     . LEU B 2 101 ? 16.527  28.232 98.443  1.00 22.49 ? 207 LEU B O     1 
ATOM   2738 C  CB    . LEU B 2 101 ? 18.997  26.427 99.233  1.00 23.94 ? 207 LEU B CB    1 
ATOM   2739 C  CG    . LEU B 2 101 ? 18.430  25.070 99.657  1.00 23.82 ? 207 LEU B CG    1 
ATOM   2740 C  CD1   . LEU B 2 101 ? 19.045  23.990 98.813  1.00 23.97 ? 207 LEU B CD1   1 
ATOM   2741 C  CD2   . LEU B 2 101 ? 18.627  24.779 101.171 1.00 23.48 ? 207 LEU B CD2   1 
ATOM   2742 N  N     . ALA B 2 102 ? 16.269  26.243 97.433  1.00 23.98 ? 208 ALA B N     1 
ATOM   2743 C  CA    . ALA B 2 102 ? 14.835  26.124 97.683  1.00 23.85 ? 208 ALA B CA    1 
ATOM   2744 C  C     . ALA B 2 102 ? 14.625  24.889 98.575  1.00 23.52 ? 208 ALA B C     1 
ATOM   2745 O  O     . ALA B 2 102 ? 14.727  23.752 98.099  1.00 22.95 ? 208 ALA B O     1 
ATOM   2746 C  CB    . ALA B 2 102 ? 14.093  25.988 96.392  1.00 23.86 ? 208 ALA B CB    1 
ATOM   2747 N  N     . PRO B 2 103 ? 14.391  25.105 99.877  1.00 23.54 ? 209 PRO B N     1 
ATOM   2748 C  CA    . PRO B 2 103 ? 14.256  24.005 100.831 1.00 23.57 ? 209 PRO B CA    1 
ATOM   2749 C  C     . PRO B 2 103 ? 13.343  22.926 100.286 1.00 24.18 ? 209 PRO B C     1 
ATOM   2750 O  O     . PRO B 2 103 ? 13.700  21.756 100.246 1.00 24.34 ? 209 PRO B O     1 
ATOM   2751 C  CB    . PRO B 2 103 ? 13.620  24.682 102.026 1.00 23.41 ? 209 PRO B CB    1 
ATOM   2752 C  CG    . PRO B 2 103 ? 14.019  26.082 101.941 1.00 22.88 ? 209 PRO B CG    1 
ATOM   2753 C  CD    . PRO B 2 103 ? 14.247  26.410 100.542 1.00 23.29 ? 209 PRO B CD    1 
ATOM   2754 N  N     . LEU B 2 104 ? 12.175  23.346 99.815  1.00 25.03 ? 210 LEU B N     1 
ATOM   2755 C  CA    . LEU B 2 104 ? 11.138  22.422 99.390  1.00 25.33 ? 210 LEU B CA    1 
ATOM   2756 C  C     . LEU B 2 104 ? 11.398  21.677 98.076  1.00 25.57 ? 210 LEU B C     1 
ATOM   2757 O  O     . LEU B 2 104 ? 10.793  20.632 97.844  1.00 26.04 ? 210 LEU B O     1 
ATOM   2758 C  CB    . LEU B 2 104 ? 9.812   23.148 99.316  1.00 25.37 ? 210 LEU B CB    1 
ATOM   2759 C  CG    . LEU B 2 104 ? 9.005   23.170 100.596 1.00 26.25 ? 210 LEU B CG    1 
ATOM   2760 C  CD1   . LEU B 2 104 ? 7.720   23.925 100.337 1.00 25.39 ? 210 LEU B CD1   1 
ATOM   2761 C  CD2   . LEU B 2 104 ? 8.718   21.717 101.102 1.00 27.82 ? 210 LEU B CD2   1 
ATOM   2762 N  N     . GLY B 2 105 ? 12.252  22.197 97.200  1.00 25.69 ? 211 GLY B N     1 
ATOM   2763 C  CA    . GLY B 2 105 ? 12.712  21.408 96.065  1.00 25.52 ? 211 GLY B CA    1 
ATOM   2764 C  C     . GLY B 2 105 ? 11.846  21.588 94.848  1.00 25.72 ? 211 GLY B C     1 
ATOM   2765 O  O     . GLY B 2 105 ? 11.153  22.602 94.712  1.00 25.09 ? 211 GLY B O     1 
ATOM   2766 N  N     . SER B 2 106 ? 11.878  20.606 93.961  1.00 26.20 ? 212 SER B N     1 
ATOM   2767 C  CA    . SER B 2 106 ? 11.290  20.790 92.647  1.00 27.30 ? 212 SER B CA    1 
ATOM   2768 C  C     . SER B 2 106 ? 9.801   20.751 92.767  1.00 27.46 ? 212 SER B C     1 
ATOM   2769 O  O     . SER B 2 106 ? 9.261   19.814 93.323  1.00 28.14 ? 212 SER B O     1 
ATOM   2770 C  CB    . SER B 2 106 ? 11.709  19.703 91.664  1.00 28.16 ? 212 SER B CB    1 
ATOM   2771 O  OG    . SER B 2 106 ? 10.670  18.745 91.502  1.00 29.39 ? 212 SER B OG    1 
ATOM   2772 N  N     . LEU B 2 107 ? 9.133   21.749 92.220  1.00 27.30 ? 213 LEU B N     1 
ATOM   2773 C  CA    . LEU B 2 107 ? 7.716   21.878 92.429  1.00 27.37 ? 213 LEU B CA    1 
ATOM   2774 C  C     . LEU B 2 107 ? 6.967   20.658 91.869  1.00 27.12 ? 213 LEU B C     1 
ATOM   2775 O  O     . LEU B 2 107 ? 5.902   20.317 92.370  1.00 27.27 ? 213 LEU B O     1 
ATOM   2776 C  CB    . LEU B 2 107 ? 7.216   23.194 91.822  1.00 27.73 ? 213 LEU B CB    1 
ATOM   2777 C  CG    . LEU B 2 107 ? 5.710   23.390 91.623  1.00 27.40 ? 213 LEU B CG    1 
ATOM   2778 C  CD1   . LEU B 2 107 ? 5.062   24.021 92.865  1.00 28.09 ? 213 LEU B CD1   1 
ATOM   2779 C  CD2   . LEU B 2 107 ? 5.490   24.230 90.413  1.00 26.56 ? 213 LEU B CD2   1 
ATOM   2780 N  N     . LEU B 2 108 ? 7.554   19.980 90.888  1.00 26.58 ? 214 LEU B N     1 
ATOM   2781 C  CA    . LEU B 2 108 ? 6.864   18.931 90.164  1.00 26.33 ? 214 LEU B CA    1 
ATOM   2782 C  C     . LEU B 2 108 ? 6.863   17.688 90.992  1.00 26.84 ? 214 LEU B C     1 
ATOM   2783 O  O     . LEU B 2 108 ? 5.829   17.046 91.158  1.00 27.95 ? 214 LEU B O     1 
ATOM   2784 C  CB    . LEU B 2 108 ? 7.511   18.683 88.804  1.00 26.11 ? 214 LEU B CB    1 
ATOM   2785 C  CG    . LEU B 2 108 ? 7.138   17.377 88.130  1.00 26.47 ? 214 LEU B CG    1 
ATOM   2786 C  CD1   . LEU B 2 108 ? 5.639   17.441 87.792  1.00 28.68 ? 214 LEU B CD1   1 
ATOM   2787 C  CD2   . LEU B 2 108 ? 8.003   17.079 86.900  1.00 23.97 ? 214 LEU B CD2   1 
ATOM   2788 N  N     . ASP B 2 109 ? 8.018   17.339 91.530  1.00 27.16 ? 215 ASP B N     1 
ATOM   2789 C  CA    . ASP B 2 109 ? 8.095   16.334 92.581  1.00 27.45 ? 215 ASP B CA    1 
ATOM   2790 C  C     . ASP B 2 109 ? 6.935   16.477 93.602  1.00 26.99 ? 215 ASP B C     1 
ATOM   2791 O  O     . ASP B 2 109 ? 6.423   15.467 94.082  1.00 27.51 ? 215 ASP B O     1 
ATOM   2792 C  CB    . ASP B 2 109 ? 9.434   16.473 93.340  1.00 28.24 ? 215 ASP B CB    1 
ATOM   2793 C  CG    . ASP B 2 109 ? 10.574  15.643 92.742  1.00 29.69 ? 215 ASP B CG    1 
ATOM   2794 O  OD1   . ASP B 2 109 ? 10.622  15.509 91.508  1.00 30.79 ? 215 ASP B OD1   1 
ATOM   2795 O  OD2   . ASP B 2 109 ? 11.482  15.113 93.452  1.00 32.52 ? 215 ASP B OD2   1 
ATOM   2796 N  N     . ARG B 2 110 ? 6.555   17.716 93.947  1.00 26.14 ? 216 ARG B N     1 
ATOM   2797 C  CA    . ARG B 2 110 ? 5.620   17.987 95.043  1.00 25.74 ? 216 ARG B CA    1 
ATOM   2798 C  C     . ARG B 2 110 ? 4.156   17.847 94.635  1.00 25.73 ? 216 ARG B C     1 
ATOM   2799 O  O     . ARG B 2 110 ? 3.356   17.279 95.384  1.00 25.88 ? 216 ARG B O     1 
ATOM   2800 C  CB    . ARG B 2 110 ? 5.861   19.377 95.637  1.00 25.48 ? 216 ARG B CB    1 
ATOM   2801 C  CG    . ARG B 2 110 ? 5.551   19.471 97.125  0.01 26.15 ? 216 ARG B CG    1 
ATOM   2802 C  CD    . ARG B 2 110 ? 5.441   20.896 97.656  0.01 26.64 ? 216 ARG B CD    1 
ATOM   2803 N  NE    . ARG B 2 110 ? 4.585   20.979 98.841  0.01 26.99 ? 216 ARG B NE    1 
ATOM   2804 C  CZ    . ARG B 2 110 ? 4.221   22.112 99.439  0.01 27.28 ? 216 ARG B CZ    1 
ATOM   2805 N  NH1   . ARG B 2 110 ? 3.438   22.069 100.511 0.01 27.37 ? 216 ARG B NH1   1 
ATOM   2806 N  NH2   . ARG B 2 110 ? 4.632   23.290 98.977  0.01 27.41 ? 216 ARG B NH2   1 
ATOM   2807 N  N     . LEU B 2 111 ? 3.801   18.370 93.465  1.00 25.50 ? 217 LEU B N     1 
ATOM   2808 C  CA    . LEU B 2 111 ? 2.468   18.161 92.888  1.00 25.26 ? 217 LEU B CA    1 
ATOM   2809 C  C     . LEU B 2 111 ? 2.226   16.660 92.802  1.00 25.66 ? 217 LEU B C     1 
ATOM   2810 O  O     . LEU B 2 111 ? 1.179   16.152 93.182  1.00 25.53 ? 217 LEU B O     1 
ATOM   2811 C  CB    . LEU B 2 111 ? 2.334   18.816 91.493  1.00 24.66 ? 217 LEU B CB    1 
ATOM   2812 C  CG    . LEU B 2 111 ? 2.743   20.290 91.353  1.00 23.54 ? 217 LEU B CG    1 
ATOM   2813 C  CD1   . LEU B 2 111 ? 2.747   20.728 89.949  1.00 23.37 ? 217 LEU B CD1   1 
ATOM   2814 C  CD2   . LEU B 2 111 ? 1.875   21.209 92.135  1.00 24.13 ? 217 LEU B CD2   1 
ATOM   2815 N  N     . ARG B 2 112 ? 3.238   15.948 92.332  1.00 26.30 ? 218 ARG B N     1 
ATOM   2816 C  CA    . ARG B 2 112 ? 3.153   14.501 92.185  1.00 26.76 ? 218 ARG B CA    1 
ATOM   2817 C  C     . ARG B 2 112 ? 2.973   13.765 93.503  1.00 26.93 ? 218 ARG B C     1 
ATOM   2818 O  O     . ARG B 2 112 ? 2.334   12.731 93.514  1.00 26.35 ? 218 ARG B O     1 
ATOM   2819 C  CB    . ARG B 2 112 ? 4.383   13.973 91.454  1.00 26.68 ? 218 ARG B CB    1 
ATOM   2820 C  CG    . ARG B 2 112 ? 4.415   14.402 89.999  1.00 26.82 ? 218 ARG B CG    1 
ATOM   2821 C  CD    . ARG B 2 112 ? 4.242   13.278 89.014  1.00 26.80 ? 218 ARG B CD    1 
ATOM   2822 N  NE    . ARG B 2 112 ? 5.177   13.433 87.897  1.00 26.85 ? 218 ARG B NE    1 
ATOM   2823 C  CZ    . ARG B 2 112 ? 6.470   13.151 87.953  1.00 25.06 ? 218 ARG B CZ    1 
ATOM   2824 N  NH1   . ARG B 2 112 ? 7.038   12.686 89.074  1.00 26.33 ? 218 ARG B NH1   1 
ATOM   2825 N  NH2   . ARG B 2 112 ? 7.201   13.317 86.873  1.00 23.03 ? 218 ARG B NH2   1 
ATOM   2826 N  N     . LYS B 2 113 ? 3.562   14.286 94.584  1.00 27.84 ? 219 LYS B N     1 
ATOM   2827 C  CA    . LYS B 2 113 ? 3.319   13.787 95.943  1.00 28.68 ? 219 LYS B CA    1 
ATOM   2828 C  C     . LYS B 2 113 ? 1.954   14.326 96.339  1.00 29.49 ? 219 LYS B C     1 
ATOM   2829 O  O     . LYS B 2 113 ? 1.046   14.368 95.512  1.00 29.91 ? 219 LYS B O     1 
ATOM   2830 C  CB    . LYS B 2 113 ? 4.413   14.222 96.937  1.00 28.51 ? 219 LYS B CB    1 
ATOM   2831 C  CG    . LYS B 2 113 ? 5.789   13.638 96.646  0.01 28.47 ? 219 LYS B CG    1 
ATOM   2832 C  CD    . LYS B 2 113 ? 6.904   14.552 97.138  0.01 28.32 ? 219 LYS B CD    1 
ATOM   2833 C  CE    . LYS B 2 113 ? 8.276   13.999 96.786  0.01 28.27 ? 219 LYS B CE    1 
ATOM   2834 N  NZ    . LYS B 2 113 ? 9.347   14.570 97.649  0.01 28.21 ? 219 LYS B NZ    1 
ATOM   2835 N  N     . HIS B 2 114 ? 1.785   14.771 97.573  1.00 30.23 ? 220 HIS B N     1 
ATOM   2836 C  CA    . HIS B 2 114 ? 0.450   15.143 98.013  1.00 30.63 ? 220 HIS B CA    1 
ATOM   2837 C  C     . HIS B 2 114 ? -0.172  16.151 97.027  1.00 31.19 ? 220 HIS B C     1 
ATOM   2838 O  O     . HIS B 2 114 ? 0.411   17.188 96.711  1.00 30.37 ? 220 HIS B O     1 
ATOM   2839 C  CB    . HIS B 2 114 ? 0.479   15.619 99.471  1.00 30.66 ? 220 HIS B CB    1 
ATOM   2840 C  CG    . HIS B 2 114 ? 0.981   14.568 100.413 0.01 30.14 ? 220 HIS B CG    1 
ATOM   2841 N  ND1   . HIS B 2 114 ? 0.180   13.551 100.886 0.01 29.74 ? 220 HIS B ND1   1 
ATOM   2842 C  CD2   . HIS B 2 114 ? 2.216   14.341 100.920 0.01 29.76 ? 220 HIS B CD2   1 
ATOM   2843 C  CE1   . HIS B 2 114 ? 0.894   12.760 101.667 0.01 29.57 ? 220 HIS B CE1   1 
ATOM   2844 N  NE2   . HIS B 2 114 ? 2.132   13.217 101.704 0.01 29.59 ? 220 HIS B NE2   1 
ATOM   2845 N  N     . GLN B 2 115 ? -1.329  15.752 96.494  1.00 32.25 ? 221 GLN B N     1 
ATOM   2846 C  CA    . GLN B 2 115 ? -2.151  16.544 95.551  1.00 32.78 ? 221 GLN B CA    1 
ATOM   2847 C  C     . GLN B 2 115 ? -3.612  16.659 96.044  1.00 33.59 ? 221 GLN B C     1 
ATOM   2848 O  O     . GLN B 2 115 ? -4.459  17.180 95.306  1.00 34.20 ? 221 GLN B O     1 
ATOM   2849 C  CB    . GLN B 2 115 ? -2.144  15.934 94.123  1.00 32.54 ? 221 GLN B CB    1 
ATOM   2850 C  CG    . GLN B 2 115 ? -1.979  14.400 94.067  1.00 31.97 ? 221 GLN B CG    1 
ATOM   2851 C  CD    . GLN B 2 115 ? -1.470  13.859 92.733  1.00 32.01 ? 221 GLN B CD    1 
ATOM   2852 O  OE1   . GLN B 2 115 ? -1.821  12.728 92.381  1.00 33.06 ? 221 GLN B OE1   1 
ATOM   2853 N  NE2   . GLN B 2 115 ? -0.632  14.634 92.005  1.00 29.13 ? 221 GLN B NE2   1 
ATOM   2854 N  N     . GLY B 2 116 ? -3.908  16.159 97.261  1.00 34.03 ? 222 GLY B N     1 
ATOM   2855 C  CA    . GLY B 2 116 ? -5.188  16.393 97.934  1.00 34.22 ? 222 GLY B CA    1 
ATOM   2856 C  C     . GLY B 2 116 ? -5.004  17.653 98.763  1.00 34.53 ? 222 GLY B C     1 
ATOM   2857 O  O     . GLY B 2 116 ? -5.410  17.740 99.928  1.00 34.30 ? 222 GLY B O     1 
ATOM   2858 N  N     . HIS B 2 117 ? -4.376  18.629 98.103  1.00 35.04 ? 223 HIS B N     1 
ATOM   2859 C  CA    . HIS B 2 117 ? -3.832  19.841 98.689  1.00 35.55 ? 223 HIS B CA    1 
ATOM   2860 C  C     . HIS B 2 117 ? -3.890  20.945 97.613  1.00 34.71 ? 223 HIS B C     1 
ATOM   2861 O  O     . HIS B 2 117 ? -4.975  21.454 97.319  1.00 35.02 ? 223 HIS B O     1 
ATOM   2862 C  CB    . HIS B 2 117 ? -2.403  19.567 99.164  1.00 36.20 ? 223 HIS B CB    1 
ATOM   2863 C  CG    . HIS B 2 117 ? -1.679  20.775 99.684  1.00 41.21 ? 223 HIS B CG    1 
ATOM   2864 N  ND1   . HIS B 2 117 ? -2.075  22.068 99.398  1.00 46.27 ? 223 HIS B ND1   1 
ATOM   2865 C  CD2   . HIS B 2 117 ? -0.568  20.883 100.463 1.00 45.08 ? 223 HIS B CD2   1 
ATOM   2866 C  CE1   . HIS B 2 117 ? -1.238  22.918 99.977  1.00 48.18 ? 223 HIS B CE1   1 
ATOM   2867 N  NE2   . HIS B 2 117 ? -0.313  22.226 100.627 1.00 46.84 ? 223 HIS B NE2   1 
ATOM   2868 N  N     . PHE B 2 118 ? -2.762  21.266 96.982  1.00 33.69 ? 224 PHE B N     1 
ATOM   2869 C  CA    . PHE B 2 118 ? -2.647  22.500 96.217  1.00 33.12 ? 224 PHE B CA    1 
ATOM   2870 C  C     . PHE B 2 118 ? -4.020  22.947 95.713  1.00 32.61 ? 224 PHE B C     1 
ATOM   2871 O  O     . PHE B 2 118 ? -4.552  22.365 94.761  1.00 32.72 ? 224 PHE B O     1 
ATOM   2872 C  CB    . PHE B 2 118 ? -1.709  22.317 95.025  1.00 33.33 ? 224 PHE B CB    1 
ATOM   2873 C  CG    . PHE B 2 118 ? -0.358  21.779 95.384  1.00 34.81 ? 224 PHE B CG    1 
ATOM   2874 C  CD1   . PHE B 2 118 ? 0.587   22.588 96.016  1.00 36.51 ? 224 PHE B CD1   1 
ATOM   2875 C  CD2   . PHE B 2 118 ? -0.018  20.455 95.099  1.00 36.44 ? 224 PHE B CD2   1 
ATOM   2876 C  CE1   . PHE B 2 118 ? 1.865   22.082 96.378  1.00 35.83 ? 224 PHE B CE1   1 
ATOM   2877 C  CE2   . PHE B 2 118 ? 1.261   19.948 95.462  1.00 36.79 ? 224 PHE B CE2   1 
ATOM   2878 C  CZ    . PHE B 2 118 ? 2.189   20.762 96.100  1.00 35.59 ? 224 PHE B CZ    1 
ATOM   2879 N  N     . LEU B 2 119 ? -4.607  23.960 96.361  1.00 31.82 ? 225 LEU B N     1 
ATOM   2880 C  CA    . LEU B 2 119 ? -5.892  24.537 95.912  1.00 30.84 ? 225 LEU B CA    1 
ATOM   2881 C  C     . LEU B 2 119 ? -5.640  25.497 94.722  1.00 30.15 ? 225 LEU B C     1 
ATOM   2882 O  O     . LEU B 2 119 ? -4.497  25.887 94.438  1.00 29.56 ? 225 LEU B O     1 
ATOM   2883 C  CB    . LEU B 2 119 ? -6.603  25.268 97.058  1.00 30.62 ? 225 LEU B CB    1 
ATOM   2884 C  CG    . LEU B 2 119 ? -6.540  24.590 98.439  1.00 31.10 ? 225 LEU B CG    1 
ATOM   2885 C  CD1   . LEU B 2 119 ? -6.818  25.555 99.613  1.00 30.49 ? 225 LEU B CD1   1 
ATOM   2886 C  CD2   . LEU B 2 119 ? -7.509  23.407 98.483  1.00 31.79 ? 225 LEU B CD2   1 
ATOM   2887 N  N     . LEU B 2 120 ? -6.710  25.895 94.042  1.00 29.36 ? 226 LEU B N     1 
ATOM   2888 C  CA    . LEU B 2 120 ? -6.580  26.680 92.807  1.00 28.85 ? 226 LEU B CA    1 
ATOM   2889 C  C     . LEU B 2 120 ? -5.907  28.047 93.027  1.00 28.51 ? 226 LEU B C     1 
ATOM   2890 O  O     . LEU B 2 120 ? -5.274  28.575 92.128  1.00 28.69 ? 226 LEU B O     1 
ATOM   2891 C  CB    . LEU B 2 120 ? -7.953  26.836 92.110  1.00 28.63 ? 226 LEU B CB    1 
ATOM   2892 C  CG    . LEU B 2 120 ? -8.556  25.489 91.663  1.00 27.98 ? 226 LEU B CG    1 
ATOM   2893 C  CD1   . LEU B 2 120 ? -10.060 25.557 91.383  1.00 27.35 ? 226 LEU B CD1   1 
ATOM   2894 C  CD2   . LEU B 2 120 ? -7.784  24.904 90.466  1.00 26.77 ? 226 LEU B CD2   1 
ATOM   2895 N  N     . GLY B 2 121 ? -6.048  28.620 94.216  1.00 28.02 ? 227 GLY B N     1 
ATOM   2896 C  CA    . GLY B 2 121 ? -5.512  29.939 94.490  1.00 27.47 ? 227 GLY B CA    1 
ATOM   2897 C  C     . GLY B 2 121 ? -4.028  29.832 94.653  1.00 27.12 ? 227 GLY B C     1 
ATOM   2898 O  O     . GLY B 2 121 ? -3.292  30.742 94.296  1.00 26.55 ? 227 GLY B O     1 
ATOM   2899 N  N     . THR B 2 122 ? -3.601  28.710 95.219  1.00 27.11 ? 228 THR B N     1 
ATOM   2900 C  CA    . THR B 2 122 ? -2.186  28.433 95.404  1.00 27.58 ? 228 THR B CA    1 
ATOM   2901 C  C     . THR B 2 122 ? -1.501  28.438 94.046  1.00 27.57 ? 228 THR B C     1 
ATOM   2902 O  O     . THR B 2 122 ? -0.499  29.154 93.825  1.00 27.23 ? 228 THR B O     1 
ATOM   2903 C  CB    . THR B 2 122 ? -1.976  27.057 96.130  1.00 27.98 ? 228 THR B CB    1 
ATOM   2904 O  OG1   . THR B 2 122 ? -2.509  27.106 97.484  1.00 29.58 ? 228 THR B OG1   1 
ATOM   2905 C  CG2   . THR B 2 122 ? -0.470  26.711 96.292  1.00 26.35 ? 228 THR B CG2   1 
ATOM   2906 N  N     . LEU B 2 123 ? -2.084  27.665 93.124  1.00 27.55 ? 229 LEU B N     1 
ATOM   2907 C  CA    . LEU B 2 123 ? -1.502  27.469 91.798  1.00 26.99 ? 229 LEU B CA    1 
ATOM   2908 C  C     . LEU B 2 123 ? -1.543  28.760 90.978  1.00 26.46 ? 229 LEU B C     1 
ATOM   2909 O  O     . LEU B 2 123 ? -0.594  29.075 90.308  1.00 25.91 ? 229 LEU B O     1 
ATOM   2910 C  CB    . LEU B 2 123 ? -2.186  26.290 91.087  1.00 26.95 ? 229 LEU B CB    1 
ATOM   2911 C  CG    . LEU B 2 123 ? -1.933  24.904 91.697  1.00 26.74 ? 229 LEU B CG    1 
ATOM   2912 C  CD1   . LEU B 2 123 ? -2.466  23.759 90.873  1.00 27.52 ? 229 LEU B CD1   1 
ATOM   2913 C  CD2   . LEU B 2 123 ? -0.470  24.725 91.866  1.00 27.44 ? 229 LEU B CD2   1 
ATOM   2914 N  N     . SER B 2 124 ? -2.621  29.523 91.075  1.00 26.38 ? 230 SER B N     1 
ATOM   2915 C  CA    . SER B 2 124 ? -2.715  30.797 90.376  1.00 26.66 ? 230 SER B CA    1 
ATOM   2916 C  C     . SER B 2 124 ? -1.610  31.724 90.790  1.00 26.65 ? 230 SER B C     1 
ATOM   2917 O  O     . SER B 2 124 ? -1.082  32.455 89.959  1.00 26.78 ? 230 SER B O     1 
ATOM   2918 C  CB    . SER B 2 124 ? -4.043  31.479 90.657  1.00 26.42 ? 230 SER B CB    1 
ATOM   2919 O  OG    . SER B 2 124 ? -5.057  30.770 89.987  1.00 28.14 ? 230 SER B OG    1 
ATOM   2920 N  N     . ARG B 2 125 ? -1.277  31.708 92.074  1.00 26.63 ? 231 ARG B N     1 
ATOM   2921 C  CA    . ARG B 2 125 ? -0.224  32.568 92.585  1.00 26.82 ? 231 ARG B CA    1 
ATOM   2922 C  C     . ARG B 2 125 ? 1.139   32.109 92.033  1.00 26.31 ? 231 ARG B C     1 
ATOM   2923 O  O     . ARG B 2 125 ? 1.935   32.938 91.602  1.00 26.33 ? 231 ARG B O     1 
ATOM   2924 C  CB    . ARG B 2 125 ? -0.274  32.655 94.115  1.00 27.09 ? 231 ARG B CB    1 
ATOM   2925 C  CG    . ARG B 2 125 ? -1.380  33.560 94.633  0.01 27.16 ? 231 ARG B CG    1 
ATOM   2926 C  CD    . ARG B 2 125 ? -1.584  33.503 96.137  0.01 27.41 ? 231 ARG B CD    1 
ATOM   2927 N  NE    . ARG B 2 125 ? -2.741  34.292 96.559  0.01 27.55 ? 231 ARG B NE    1 
ATOM   2928 C  CZ    . ARG B 2 125 ? -3.143  34.439 97.820  0.01 27.66 ? 231 ARG B CZ    1 
ATOM   2929 N  NH1   . ARG B 2 125 ? -4.211  35.182 98.089  0.01 27.71 ? 231 ARG B NH1   1 
ATOM   2930 N  NH2   . ARG B 2 125 ? -2.487  33.850 98.817  0.01 27.69 ? 231 ARG B NH2   1 
ATOM   2931 N  N     . TYR B 2 126 ? 1.361   30.800 91.954  1.00 25.90 ? 232 TYR B N     1 
ATOM   2932 C  CA    . TYR B 2 126 ? 2.549   30.242 91.270  1.00 25.56 ? 232 TYR B CA    1 
ATOM   2933 C  C     . TYR B 2 126 ? 2.584   30.480 89.750  1.00 25.85 ? 232 TYR B C     1 
ATOM   2934 O  O     . TYR B 2 126 ? 3.631   30.548 89.131  1.00 26.60 ? 232 TYR B O     1 
ATOM   2935 C  CB    . TYR B 2 126 ? 2.617   28.736 91.499  1.00 25.23 ? 232 TYR B CB    1 
ATOM   2936 C  CG    . TYR B 2 126 ? 2.734   28.305 92.932  1.00 24.99 ? 232 TYR B CG    1 
ATOM   2937 C  CD1   . TYR B 2 126 ? 3.014   29.218 93.939  1.00 24.83 ? 232 TYR B CD1   1 
ATOM   2938 C  CD2   . TYR B 2 126 ? 2.571   26.971 93.285  1.00 25.25 ? 232 TYR B CD2   1 
ATOM   2939 C  CE1   . TYR B 2 126 ? 3.126   28.825 95.224  1.00 24.74 ? 232 TYR B CE1   1 
ATOM   2940 C  CE2   . TYR B 2 126 ? 2.698   26.563 94.587  1.00 23.85 ? 232 TYR B CE2   1 
ATOM   2941 C  CZ    . TYR B 2 126 ? 2.967   27.503 95.554  1.00 25.60 ? 232 TYR B CZ    1 
ATOM   2942 O  OH    . TYR B 2 126 ? 3.095   27.146 96.887  1.00 29.94 ? 232 TYR B OH    1 
ATOM   2943 N  N     . ALA B 2 127 ? 1.428   30.570 89.134  1.00 26.23 ? 233 ALA B N     1 
ATOM   2944 C  CA    . ALA B 2 127 ? 1.345   30.816 87.715  1.00 26.02 ? 233 ALA B CA    1 
ATOM   2945 C  C     . ALA B 2 127 ? 1.712   32.278 87.453  1.00 26.12 ? 233 ALA B C     1 
ATOM   2946 O  O     . ALA B 2 127 ? 2.375   32.587 86.479  1.00 26.16 ? 233 ALA B O     1 
ATOM   2947 C  CB    . ALA B 2 127 ? -0.044  30.504 87.235  1.00 25.85 ? 233 ALA B CB    1 
ATOM   2948 N  N     . VAL B 2 128 ? 1.292   33.174 88.342  1.00 26.30 ? 234 VAL B N     1 
ATOM   2949 C  CA    . VAL B 2 128 ? 1.648   34.585 88.227  1.00 26.14 ? 234 VAL B CA    1 
ATOM   2950 C  C     . VAL B 2 128 ? 3.134   34.729 88.578  1.00 26.31 ? 234 VAL B C     1 
ATOM   2951 O  O     . VAL B 2 128 ? 3.846   35.567 88.025  1.00 26.21 ? 234 VAL B O     1 
ATOM   2952 C  CB    . VAL B 2 128 ? 0.738   35.504 89.131  1.00 25.73 ? 234 VAL B CB    1 
ATOM   2953 C  CG1   . VAL B 2 128 ? 1.323   36.917 89.299  1.00 23.85 ? 234 VAL B CG1   1 
ATOM   2954 C  CG2   . VAL B 2 128 ? -0.668  35.586 88.532  1.00 26.23 ? 234 VAL B CG2   1 
ATOM   2955 N  N     . GLN B 2 129 ? 3.608   33.914 89.498  1.00 26.04 ? 235 GLN B N     1 
ATOM   2956 C  CA    . GLN B 2 129 ? 4.932   34.155 89.991  1.00 26.53 ? 235 GLN B CA    1 
ATOM   2957 C  C     . GLN B 2 129 ? 5.920   33.814 88.874  1.00 27.12 ? 235 GLN B C     1 
ATOM   2958 O  O     . GLN B 2 129 ? 6.887   34.558 88.636  1.00 27.37 ? 235 GLN B O     1 
ATOM   2959 C  CB    . GLN B 2 129 ? 5.197   33.373 91.273  1.00 26.35 ? 235 GLN B CB    1 
ATOM   2960 C  CG    . GLN B 2 129 ? 4.960   34.212 92.528  1.00 25.66 ? 235 GLN B CG    1 
ATOM   2961 C  CD    . GLN B 2 129 ? 4.812   33.369 93.794  1.00 23.98 ? 235 GLN B CD    1 
ATOM   2962 O  OE1   . GLN B 2 129 ? 4.474   33.890 94.880  1.00 19.21 ? 235 GLN B OE1   1 
ATOM   2963 N  NE2   . GLN B 2 129 ? 5.062   32.067 93.659  1.00 22.62 ? 235 GLN B NE2   1 
ATOM   2964 N  N     . VAL B 2 130 ? 5.649   32.718 88.166  1.00 27.15 ? 236 VAL B N     1 
ATOM   2965 C  CA    . VAL B 2 130 ? 6.517   32.274 87.093  1.00 26.81 ? 236 VAL B CA    1 
ATOM   2966 C  C     . VAL B 2 130 ? 6.418   33.325 86.044  1.00 26.72 ? 236 VAL B C     1 
ATOM   2967 O  O     . VAL B 2 130 ? 7.397   33.931 85.670  1.00 26.51 ? 236 VAL B O     1 
ATOM   2968 C  CB    . VAL B 2 130 ? 6.059   30.941 86.509  1.00 26.73 ? 236 VAL B CB    1 
ATOM   2969 C  CG1   . VAL B 2 130 ? 6.658   30.724 85.143  1.00 26.54 ? 236 VAL B CG1   1 
ATOM   2970 C  CG2   . VAL B 2 130 ? 6.429   29.825 87.435  1.00 26.52 ? 236 VAL B CG2   1 
ATOM   2971 N  N     . ALA B 2 131 ? 5.200   33.557 85.591  1.00 27.06 ? 237 ALA B N     1 
ATOM   2972 C  CA    . ALA B 2 131 ? 4.952   34.603 84.612  1.00 27.41 ? 237 ALA B CA    1 
ATOM   2973 C  C     . ALA B 2 131 ? 5.825   35.829 84.903  1.00 27.33 ? 237 ALA B C     1 
ATOM   2974 O  O     . ALA B 2 131 ? 6.473   36.347 83.987  1.00 27.64 ? 237 ALA B O     1 
ATOM   2975 C  CB    . ALA B 2 131 ? 3.466   34.980 84.562  1.00 26.99 ? 237 ALA B CB    1 
ATOM   2976 N  N     . GLU B 2 132 ? 5.876   36.258 86.165  1.00 27.21 ? 238 GLU B N     1 
ATOM   2977 C  CA    . GLU B 2 132 ? 6.592   37.488 86.525  1.00 27.39 ? 238 GLU B CA    1 
ATOM   2978 C  C     . GLU B 2 132 ? 8.079   37.295 86.325  1.00 26.94 ? 238 GLU B C     1 
ATOM   2979 O  O     . GLU B 2 132 ? 8.738   38.158 85.758  1.00 26.93 ? 238 GLU B O     1 
ATOM   2980 C  CB    . GLU B 2 132 ? 6.330   37.931 87.977  1.00 27.85 ? 238 GLU B CB    1 
ATOM   2981 C  CG    . GLU B 2 132 ? 5.176   38.919 88.191  1.00 27.04 ? 238 GLU B CG    1 
ATOM   2982 C  CD    . GLU B 2 132 ? 4.626   38.845 89.620  1.00 27.60 ? 238 GLU B CD    1 
ATOM   2983 O  OE1   . GLU B 2 132 ? 4.673   37.759 90.240  1.00 26.87 ? 238 GLU B OE1   1 
ATOM   2984 O  OE2   . GLU B 2 132 ? 4.136   39.862 90.150  1.00 28.94 ? 238 GLU B OE2   1 
ATOM   2985 N  N     . GLY B 2 133 ? 8.599   36.165 86.791  1.00 26.61 ? 239 GLY B N     1 
ATOM   2986 C  CA    . GLY B 2 133 ? 9.986   35.797 86.547  1.00 26.11 ? 239 GLY B CA    1 
ATOM   2987 C  C     . GLY B 2 133 ? 10.309  35.968 85.089  1.00 25.68 ? 239 GLY B C     1 
ATOM   2988 O  O     . GLY B 2 133 ? 11.122  36.798 84.723  1.00 25.25 ? 239 GLY B O     1 
ATOM   2989 N  N     . MET B 2 134 ? 9.600   35.194 84.274  1.00 25.74 ? 240 MET B N     1 
ATOM   2990 C  CA    . MET B 2 134 ? 9.671   35.226 82.803  1.00 25.60 ? 240 MET B CA    1 
ATOM   2991 C  C     . MET B 2 134 ? 9.537   36.586 82.186  1.00 25.18 ? 240 MET B C     1 
ATOM   2992 O  O     . MET B 2 134 ? 10.071  36.820 81.131  1.00 24.94 ? 240 MET B O     1 
ATOM   2993 C  CB    . MET B 2 134 ? 8.536   34.389 82.204  1.00 25.37 ? 240 MET B CB    1 
ATOM   2994 C  CG    . MET B 2 134 ? 8.712   32.906 82.273  1.00 24.75 ? 240 MET B CG    1 
ATOM   2995 S  SD    . MET B 2 134 ? 10.375  32.386 82.068  1.00 24.54 ? 240 MET B SD    1 
ATOM   2996 C  CE    . MET B 2 134 ? 10.460  32.297 80.417  1.00 28.01 ? 240 MET B CE    1 
ATOM   2997 N  N     . GLY B 2 135 ? 8.764   37.449 82.821  1.00 25.08 ? 241 GLY B N     1 
ATOM   2998 C  CA    . GLY B 2 135 ? 8.541   38.783 82.325  1.00 24.96 ? 241 GLY B CA    1 
ATOM   2999 C  C     . GLY B 2 135 ? 9.839   39.545 82.322  1.00 24.61 ? 241 GLY B C     1 
ATOM   3000 O  O     . GLY B 2 135 ? 10.327  39.929 81.278  1.00 24.07 ? 241 GLY B O     1 
ATOM   3001 N  N     . TYR B 2 136 ? 10.370  39.776 83.514  1.00 24.84 ? 242 TYR B N     1 
ATOM   3002 C  CA    . TYR B 2 136 ? 11.765  40.156 83.695  1.00 24.81 ? 242 TYR B CA    1 
ATOM   3003 C  C     . TYR B 2 136 ? 12.703  39.647 82.564  1.00 24.67 ? 242 TYR B C     1 
ATOM   3004 O  O     . TYR B 2 136 ? 13.346  40.460 81.903  1.00 24.64 ? 242 TYR B O     1 
ATOM   3005 C  CB    . TYR B 2 136 ? 12.253  39.678 85.059  1.00 24.72 ? 242 TYR B CB    1 
ATOM   3006 C  CG    . TYR B 2 136 ? 13.625  40.190 85.450  1.00 24.93 ? 242 TYR B CG    1 
ATOM   3007 C  CD1   . TYR B 2 136 ? 13.788  41.463 85.988  1.00 22.98 ? 242 TYR B CD1   1 
ATOM   3008 C  CD2   . TYR B 2 136 ? 14.759  39.390 85.289  1.00 26.19 ? 242 TYR B CD2   1 
ATOM   3009 C  CE1   . TYR B 2 136 ? 15.015  41.930 86.346  1.00 24.56 ? 242 TYR B CE1   1 
ATOM   3010 C  CE2   . TYR B 2 136 ? 16.030  39.855 85.652  1.00 26.88 ? 242 TYR B CE2   1 
ATOM   3011 C  CZ    . TYR B 2 136 ? 16.150  41.123 86.192  1.00 26.93 ? 242 TYR B CZ    1 
ATOM   3012 O  OH    . TYR B 2 136 ? 17.392  41.617 86.549  1.00 26.36 ? 242 TYR B OH    1 
ATOM   3013 N  N     . LEU B 2 137 ? 12.783  38.350 82.296  1.00 24.04 ? 243 LEU B N     1 
ATOM   3014 C  CA    . LEU B 2 137 ? 13.734  37.955 81.293  1.00 24.30 ? 243 LEU B CA    1 
ATOM   3015 C  C     . LEU B 2 137 ? 13.317  38.633 80.031  1.00 24.92 ? 243 LEU B C     1 
ATOM   3016 O  O     . LEU B 2 137 ? 14.151  39.193 79.354  1.00 25.58 ? 243 LEU B O     1 
ATOM   3017 C  CB    . LEU B 2 137 ? 13.828  36.463 81.029  1.00 24.17 ? 243 LEU B CB    1 
ATOM   3018 C  CG    . LEU B 2 137 ? 14.000  35.443 82.128  1.00 24.66 ? 243 LEU B CG    1 
ATOM   3019 C  CD1   . LEU B 2 137 ? 14.034  34.046 81.517  1.00 25.85 ? 243 LEU B CD1   1 
ATOM   3020 C  CD2   . LEU B 2 137 ? 15.232  35.714 82.875  1.00 25.91 ? 243 LEU B CD2   1 
ATOM   3021 N  N     . GLU B 2 138 ? 12.035  38.584 79.694  1.00 25.64 ? 244 GLU B N     1 
ATOM   3022 C  CA    . GLU B 2 138 ? 11.566  39.227 78.444  1.00 26.37 ? 244 GLU B CA    1 
ATOM   3023 C  C     . GLU B 2 138 ? 12.085  40.676 78.289  1.00 26.40 ? 244 GLU B C     1 
ATOM   3024 O  O     . GLU B 2 138 ? 12.525  41.041 77.205  1.00 27.42 ? 244 GLU B O     1 
ATOM   3025 C  CB    . GLU B 2 138 ? 10.024  39.190 78.260  1.00 26.24 ? 244 GLU B CB    1 
ATOM   3026 C  CG    . GLU B 2 138 ? 9.534   38.892 76.842  1.00 26.22 ? 244 GLU B CG    1 
ATOM   3027 C  CD    . GLU B 2 138 ? 7.998   38.745 76.727  1.00 29.84 ? 244 GLU B CD    1 
ATOM   3028 O  OE1   . GLU B 2 138 ? 7.246   39.349 77.541  1.00 29.69 ? 244 GLU B OE1   1 
ATOM   3029 O  OE2   . GLU B 2 138 ? 7.505   38.036 75.798  1.00 31.63 ? 244 GLU B OE2   1 
ATOM   3030 N  N     . SER B 2 139 ? 12.040  41.485 79.352  1.00 25.86 ? 245 SER B N     1 
ATOM   3031 C  CA    . SER B 2 139 ? 12.498  42.877 79.288  1.00 25.10 ? 245 SER B CA    1 
ATOM   3032 C  C     . SER B 2 139 ? 14.015  42.971 79.045  1.00 25.48 ? 245 SER B C     1 
ATOM   3033 O  O     . SER B 2 139 ? 14.514  43.911 78.418  1.00 25.23 ? 245 SER B O     1 
ATOM   3034 C  CB    . SER B 2 139 ? 12.152  43.613 80.574  1.00 24.50 ? 245 SER B CB    1 
ATOM   3035 O  OG    . SER B 2 139 ? 12.431  42.815 81.689  1.00 21.82 ? 245 SER B OG    1 
ATOM   3036 N  N     . LYS B 2 140 ? 14.739  42.001 79.584  1.00 25.36 ? 246 LYS B N     1 
ATOM   3037 C  CA    . LYS B 2 140 ? 16.175  42.007 79.528  1.00 25.38 ? 246 LYS B CA    1 
ATOM   3038 C  C     . LYS B 2 140 ? 16.534  41.419 78.193  1.00 25.31 ? 246 LYS B C     1 
ATOM   3039 O  O     . LYS B 2 140 ? 17.664  41.560 77.729  1.00 24.88 ? 246 LYS B O     1 
ATOM   3040 C  CB    . LYS B 2 140 ? 16.770  41.189 80.681  1.00 25.37 ? 246 LYS B CB    1 
ATOM   3041 C  CG    . LYS B 2 140 ? 16.810  41.920 82.039  1.00 27.13 ? 246 LYS B CG    1 
ATOM   3042 C  CD    . LYS B 2 140 ? 17.897  41.375 83.009  1.00 29.14 ? 246 LYS B CD    1 
ATOM   3043 C  CE    . LYS B 2 140 ? 18.897  42.481 83.496  1.00 31.68 ? 246 LYS B CE    1 
ATOM   3044 N  NZ    . LYS B 2 140 ? 20.395  42.175 83.230  1.00 32.82 ? 246 LYS B NZ    1 
ATOM   3045 N  N     . ARG B 2 141 ? 15.548  40.763 77.582  1.00 25.55 ? 247 ARG B N     1 
ATOM   3046 C  CA    . ARG B 2 141 ? 15.667  40.142 76.268  1.00 25.66 ? 247 ARG B CA    1 
ATOM   3047 C  C     . ARG B 2 141 ? 16.276  38.715 76.234  1.00 25.23 ? 247 ARG B C     1 
ATOM   3048 O  O     . ARG B 2 141 ? 16.612  38.215 75.188  1.00 24.30 ? 247 ARG B O     1 
ATOM   3049 C  CB    . ARG B 2 141 ? 16.402  41.085 75.320  1.00 25.92 ? 247 ARG B CB    1 
ATOM   3050 C  CG    . ARG B 2 141 ? 15.560  41.363 74.133  1.00 27.99 ? 247 ARG B CG    1 
ATOM   3051 C  CD    . ARG B 2 141 ? 15.872  42.624 73.315  1.00 27.66 ? 247 ARG B CD    1 
ATOM   3052 N  NE    . ARG B 2 141 ? 15.318  42.339 71.992  1.00 26.99 ? 247 ARG B NE    1 
ATOM   3053 C  CZ    . ARG B 2 141 ? 15.948  41.705 71.006  1.00 26.07 ? 247 ARG B CZ    1 
ATOM   3054 N  NH1   . ARG B 2 141 ? 17.233  41.351 71.077  1.00 25.33 ? 247 ARG B NH1   1 
ATOM   3055 N  NH2   . ARG B 2 141 ? 15.277  41.452 69.907  1.00 27.48 ? 247 ARG B NH2   1 
ATOM   3056 N  N     . PHE B 2 142 ? 16.397  38.075 77.386  1.00 25.40 ? 248 PHE B N     1 
ATOM   3057 C  CA    . PHE B 2 142 ? 16.805  36.672 77.478  1.00 25.94 ? 248 PHE B CA    1 
ATOM   3058 C  C     . PHE B 2 142 ? 15.611  35.728 77.144  1.00 25.18 ? 248 PHE B C     1 
ATOM   3059 O  O     . PHE B 2 142 ? 14.509  36.024 77.507  1.00 25.19 ? 248 PHE B O     1 
ATOM   3060 C  CB    . PHE B 2 142 ? 17.316  36.368 78.909  1.00 26.04 ? 248 PHE B CB    1 
ATOM   3061 C  CG    . PHE B 2 142 ? 18.612  37.047 79.249  1.00 28.26 ? 248 PHE B CG    1 
ATOM   3062 C  CD1   . PHE B 2 142 ? 18.638  38.355 79.642  1.00 27.09 ? 248 PHE B CD1   1 
ATOM   3063 C  CD2   . PHE B 2 142 ? 19.822  36.364 79.143  1.00 32.38 ? 248 PHE B CD2   1 
ATOM   3064 C  CE1   . PHE B 2 142 ? 19.796  38.981 79.914  1.00 26.52 ? 248 PHE B CE1   1 
ATOM   3065 C  CE2   . PHE B 2 142 ? 21.023  36.992 79.430  1.00 31.43 ? 248 PHE B CE2   1 
ATOM   3066 C  CZ    . PHE B 2 142 ? 20.994  38.317 79.826  1.00 30.10 ? 248 PHE B CZ    1 
ATOM   3067 N  N     . ILE B 2 143 ? 15.856  34.632 76.439  1.00 24.89 ? 249 ILE B N     1 
ATOM   3068 C  CA    . ILE B 2 143 ? 14.934  33.528 76.312  1.00 25.46 ? 249 ILE B CA    1 
ATOM   3069 C  C     . ILE B 2 143 ? 15.497  32.357 77.094  1.00 25.50 ? 249 ILE B C     1 
ATOM   3070 O  O     . ILE B 2 143 ? 16.700  32.257 77.263  1.00 26.30 ? 249 ILE B O     1 
ATOM   3071 C  CB    . ILE B 2 143 ? 14.683  33.090 74.816  1.00 26.00 ? 249 ILE B CB    1 
ATOM   3072 C  CG1   . ILE B 2 143 ? 15.939  33.098 73.950  1.00 27.80 ? 249 ILE B CG1   1 
ATOM   3073 C  CG2   . ILE B 2 143 ? 13.714  33.984 74.122  1.00 25.97 ? 249 ILE B CG2   1 
ATOM   3074 C  CD1   . ILE B 2 143 ? 15.636  32.603 72.500  1.00 28.84 ? 249 ILE B CD1   1 
ATOM   3075 N  N     . HIS B 2 144 ? 14.629  31.448 77.518  1.00 25.21 ? 250 HIS B N     1 
ATOM   3076 C  CA    . HIS B 2 144 ? 14.962  30.417 78.479  1.00 25.40 ? 250 HIS B CA    1 
ATOM   3077 C  C     . HIS B 2 144 ? 14.998  29.071 77.822  1.00 26.00 ? 250 HIS B C     1 
ATOM   3078 O  O     . HIS B 2 144 ? 15.861  28.295 78.099  1.00 27.92 ? 250 HIS B O     1 
ATOM   3079 C  CB    . HIS B 2 144 ? 13.932  30.421 79.582  1.00 25.35 ? 250 HIS B CB    1 
ATOM   3080 C  CG    . HIS B 2 144 ? 14.188  29.455 80.680  1.00 23.75 ? 250 HIS B CG    1 
ATOM   3081 N  ND1   . HIS B 2 144 ? 13.733  28.166 80.653  1.00 26.68 ? 250 HIS B ND1   1 
ATOM   3082 C  CD2   . HIS B 2 144 ? 14.825  29.597 81.863  1.00 26.00 ? 250 HIS B CD2   1 
ATOM   3083 C  CE1   . HIS B 2 144 ? 14.080  27.546 81.773  1.00 27.23 ? 250 HIS B CE1   1 
ATOM   3084 N  NE2   . HIS B 2 144 ? 14.752  28.393 82.524  1.00 24.61 ? 250 HIS B NE2   1 
ATOM   3085 N  N     . ARG B 2 145 ? 14.056  28.761 76.959  1.00 26.28 ? 251 ARG B N     1 
ATOM   3086 C  CA    . ARG B 2 145 ? 14.150  27.573 76.113  1.00 25.86 ? 251 ARG B CA    1 
ATOM   3087 C  C     . ARG B 2 145 ? 14.129  26.271 76.887  1.00 26.71 ? 251 ARG B C     1 
ATOM   3088 O  O     . ARG B 2 145 ? 14.487  25.250 76.319  1.00 27.79 ? 251 ARG B O     1 
ATOM   3089 C  CB    . ARG B 2 145 ? 15.421  27.574 75.236  1.00 25.44 ? 251 ARG B CB    1 
ATOM   3090 C  CG    . ARG B 2 145 ? 15.970  28.932 74.725  1.00 25.04 ? 251 ARG B CG    1 
ATOM   3091 C  CD    . ARG B 2 145 ? 17.058  28.838 73.607  1.00 23.72 ? 251 ARG B CD    1 
ATOM   3092 N  NE    . ARG B 2 145 ? 18.301  28.184 74.012  1.00 24.52 ? 251 ARG B NE    1 
ATOM   3093 C  CZ    . ARG B 2 145 ? 19.297  27.799 73.171  1.00 27.93 ? 251 ARG B CZ    1 
ATOM   3094 N  NH1   . ARG B 2 145 ? 19.198  27.980 71.861  1.00 30.30 ? 251 ARG B NH1   1 
ATOM   3095 N  NH2   . ARG B 2 145 ? 20.417  27.222 73.635  1.00 26.02 ? 251 ARG B NH2   1 
ATOM   3096 N  N     . ASP B 2 146 ? 13.773  26.265 78.171  1.00 27.31 ? 252 ASP B N     1 
ATOM   3097 C  CA    . ASP B 2 146 ? 13.680  24.989 78.885  1.00 27.80 ? 252 ASP B CA    1 
ATOM   3098 C  C     . ASP B 2 146 ? 12.668  25.041 79.982  1.00 27.46 ? 252 ASP B C     1 
ATOM   3099 O  O     . ASP B 2 146 ? 12.789  24.327 80.950  1.00 27.08 ? 252 ASP B O     1 
ATOM   3100 C  CB    . ASP B 2 146 ? 15.043  24.566 79.456  1.00 28.78 ? 252 ASP B CB    1 
ATOM   3101 C  CG    . ASP B 2 146 ? 15.133  23.031 79.738  1.00 31.45 ? 252 ASP B CG    1 
ATOM   3102 O  OD1   . ASP B 2 146 ? 14.767  22.228 78.837  1.00 35.55 ? 252 ASP B OD1   1 
ATOM   3103 O  OD2   . ASP B 2 146 ? 15.523  22.529 80.830  1.00 32.84 ? 252 ASP B OD2   1 
ATOM   3104 N  N     . LEU B 2 147 ? 11.631  25.863 79.807  1.00 27.37 ? 253 LEU B N     1 
ATOM   3105 C  CA    . LEU B 2 147 ? 10.776  26.227 80.915  1.00 26.48 ? 253 LEU B CA    1 
ATOM   3106 C  C     . LEU B 2 147 ? 9.818   25.100 81.124  1.00 26.57 ? 253 LEU B C     1 
ATOM   3107 O  O     . LEU B 2 147 ? 8.976   24.797 80.306  1.00 26.83 ? 253 LEU B O     1 
ATOM   3108 C  CB    . LEU B 2 147 ? 10.055  27.521 80.622  1.00 26.10 ? 253 LEU B CB    1 
ATOM   3109 C  CG    . LEU B 2 147 ? 9.055   27.979 81.682  1.00 27.14 ? 253 LEU B CG    1 
ATOM   3110 C  CD1   . LEU B 2 147 ? 9.622   28.093 83.089  1.00 27.00 ? 253 LEU B CD1   1 
ATOM   3111 C  CD2   . LEU B 2 147 ? 8.528   29.315 81.250  1.00 28.64 ? 253 LEU B CD2   1 
ATOM   3112 N  N     . ALA B 2 148 ? 9.999   24.410 82.216  1.00 26.91 ? 254 ALA B N     1 
ATOM   3113 C  CA    . ALA B 2 148 ? 9.131   23.296 82.540  1.00 26.97 ? 254 ALA B CA    1 
ATOM   3114 C  C     . ALA B 2 148 ? 8.988   23.294 84.068  1.00 27.32 ? 254 ALA B C     1 
ATOM   3115 O  O     . ALA B 2 148 ? 9.590   24.138 84.765  1.00 27.63 ? 254 ALA B O     1 
ATOM   3116 C  CB    . ALA B 2 148 ? 9.726   21.999 82.020  1.00 26.61 ? 254 ALA B CB    1 
ATOM   3117 N  N     . ALA B 2 149 ? 8.182   22.377 84.592  1.00 27.37 ? 255 ALA B N     1 
ATOM   3118 C  CA    . ALA B 2 149 ? 7.827   22.417 86.003  1.00 27.25 ? 255 ALA B CA    1 
ATOM   3119 C  C     . ALA B 2 149 ? 8.903   21.672 86.760  1.00 27.13 ? 255 ALA B C     1 
ATOM   3120 O  O     . ALA B 2 149 ? 9.043   21.826 87.975  1.00 26.26 ? 255 ALA B O     1 
ATOM   3121 C  CB    . ALA B 2 149 ? 6.398   21.793 86.240  1.00 27.28 ? 255 ALA B CB    1 
ATOM   3122 N  N     . ARG B 2 150 ? 9.668   20.866 86.017  1.00 27.42 ? 256 ARG B N     1 
ATOM   3123 C  CA    . ARG B 2 150 ? 10.841  20.165 86.575  1.00 27.47 ? 256 ARG B CA    1 
ATOM   3124 C  C     . ARG B 2 150 ? 11.934  21.159 86.883  1.00 26.65 ? 256 ARG B C     1 
ATOM   3125 O  O     . ARG B 2 150 ? 12.815  20.857 87.691  1.00 26.55 ? 256 ARG B O     1 
ATOM   3126 C  CB    . ARG B 2 150 ? 11.385  19.098 85.602  1.00 27.49 ? 256 ARG B CB    1 
ATOM   3127 C  CG    . ARG B 2 150 ? 12.045  19.675 84.343  1.00 27.75 ? 256 ARG B CG    1 
ATOM   3128 C  CD    . ARG B 2 150 ? 12.450  18.614 83.314  1.00 28.00 ? 256 ARG B CD    1 
ATOM   3129 N  NE    . ARG B 2 150 ? 12.866  19.182 82.021  1.00 27.59 ? 256 ARG B NE    1 
ATOM   3130 C  CZ    . ARG B 2 150 ? 12.063  19.445 80.973  1.00 26.15 ? 256 ARG B CZ    1 
ATOM   3131 N  NH1   . ARG B 2 150 ? 10.764  19.258 81.025  1.00 25.95 ? 256 ARG B NH1   1 
ATOM   3132 N  NH2   . ARG B 2 150 ? 12.572  19.940 79.854  1.00 27.53 ? 256 ARG B NH2   1 
ATOM   3133 N  N     . ASN B 2 151 ? 11.866  22.312 86.210  1.00 25.79 ? 257 ASN B N     1 
ATOM   3134 C  CA    . ASN B 2 151 ? 12.780  23.430 86.434  1.00 25.76 ? 257 ASN B CA    1 
ATOM   3135 C  C     . ASN B 2 151 ? 12.197  24.589 87.241  1.00 26.16 ? 257 ASN B C     1 
ATOM   3136 O  O     . ASN B 2 151 ? 12.786  25.664 87.296  1.00 26.81 ? 257 ASN B O     1 
ATOM   3137 C  CB    . ASN B 2 151 ? 13.374  23.905 85.092  1.00 24.85 ? 257 ASN B CB    1 
ATOM   3138 C  CG    . ASN B 2 151 ? 14.246  22.840 84.455  1.00 22.89 ? 257 ASN B CG    1 
ATOM   3139 O  OD1   . ASN B 2 151 ? 14.720  21.921 85.138  1.00 20.82 ? 257 ASN B OD1   1 
ATOM   3140 N  ND2   . ASN B 2 151 ? 14.457  22.938 83.157  1.00 20.04 ? 257 ASN B ND2   1 
ATOM   3141 N  N     . LEU B 2 152 ? 11.055  24.355 87.871  1.00 26.57 ? 258 LEU B N     1 
ATOM   3142 C  CA    . LEU B 2 152 ? 10.495  25.265 88.898  1.00 27.20 ? 258 LEU B CA    1 
ATOM   3143 C  C     . LEU B 2 152 ? 10.779  24.754 90.349  1.00 26.56 ? 258 LEU B C     1 
ATOM   3144 O  O     . LEU B 2 152 ? 10.799  23.565 90.591  1.00 25.74 ? 258 LEU B O     1 
ATOM   3145 C  CB    . LEU B 2 152 ? 8.961   25.433 88.712  1.00 27.57 ? 258 LEU B CB    1 
ATOM   3146 C  CG    . LEU B 2 152 ? 8.414   26.046 87.400  1.00 28.15 ? 258 LEU B CG    1 
ATOM   3147 C  CD1   . LEU B 2 152 ? 6.854   26.101 87.392  1.00 25.43 ? 258 LEU B CD1   1 
ATOM   3148 C  CD2   . LEU B 2 152 ? 9.047   27.437 87.112  1.00 26.90 ? 258 LEU B CD2   1 
ATOM   3149 N  N     . LEU B 2 153 ? 10.976  25.667 91.295  1.00 26.28 ? 259 LEU B N     1 
ATOM   3150 C  CA    . LEU B 2 153 ? 11.356  25.300 92.665  1.00 26.36 ? 259 LEU B CA    1 
ATOM   3151 C  C     . LEU B 2 153 ? 10.491  26.033 93.710  1.00 25.99 ? 259 LEU B C     1 
ATOM   3152 O  O     . LEU B 2 153 ? 10.092  27.178 93.491  1.00 25.02 ? 259 LEU B O     1 
ATOM   3153 C  CB    . LEU B 2 153 ? 12.854  25.580 92.932  1.00 26.16 ? 259 LEU B CB    1 
ATOM   3154 C  CG    . LEU B 2 153 ? 13.903  24.764 92.161  1.00 26.60 ? 259 LEU B CG    1 
ATOM   3155 C  CD1   . LEU B 2 153 ? 14.953  25.701 91.655  1.00 28.21 ? 259 LEU B CD1   1 
ATOM   3156 C  CD2   . LEU B 2 153 ? 14.579  23.644 92.991  1.00 26.80 ? 259 LEU B CD2   1 
ATOM   3157 N  N     . LEU B 2 154 ? 10.211  25.364 94.835  1.00 25.66 ? 260 LEU B N     1 
ATOM   3158 C  CA    . LEU B 2 154 ? 9.415   25.965 95.905  1.00 25.58 ? 260 LEU B CA    1 
ATOM   3159 C  C     . LEU B 2 154 ? 10.397  26.399 96.980  1.00 25.62 ? 260 LEU B C     1 
ATOM   3160 O  O     . LEU B 2 154 ? 11.028  25.562 97.627  1.00 25.77 ? 260 LEU B O     1 
ATOM   3161 C  CB    . LEU B 2 154 ? 8.329   25.010 96.475  1.00 25.49 ? 260 LEU B CB    1 
ATOM   3162 C  CG    . LEU B 2 154 ? 6.823   25.095 96.104  1.00 24.88 ? 260 LEU B CG    1 
ATOM   3163 C  CD1   . LEU B 2 154 ? 6.047   23.999 96.830  0.01 25.54 ? 260 LEU B CD1   1 
ATOM   3164 C  CD2   . LEU B 2 154 ? 6.194   26.451 96.358  0.01 25.54 ? 260 LEU B CD2   1 
ATOM   3165 N  N     . ALA B 2 155 ? 10.556  27.717 97.110  1.00 25.50 ? 261 ALA B N     1 
ATOM   3166 C  CA    . ALA B 2 155 ? 11.325  28.348 98.181  1.00 25.23 ? 261 ALA B CA    1 
ATOM   3167 C  C     . ALA B 2 155 ? 10.615  28.222 99.538  1.00 25.14 ? 261 ALA B C     1 
ATOM   3168 O  O     . ALA B 2 155 ? 11.135  27.614 100.460 1.00 25.06 ? 261 ALA B O     1 
ATOM   3169 C  CB    . ALA B 2 155 ? 11.551  29.808 97.824  1.00 25.23 ? 261 ALA B CB    1 
ATOM   3170 N  N     . THR B 2 156 ? 9.430   28.840 99.633  1.00 25.61 ? 262 THR B N     1 
ATOM   3171 C  CA    . THR B 2 156 ? 8.412   28.608 100.677 1.00 24.89 ? 262 THR B CA    1 
ATOM   3172 C  C     . THR B 2 156 ? 7.178   28.001 100.019 1.00 25.37 ? 262 THR B C     1 
ATOM   3173 O  O     . THR B 2 156 ? 7.109   27.871 98.788  1.00 24.92 ? 262 THR B O     1 
ATOM   3174 C  CB    . THR B 2 156 ? 7.950   29.935 101.347 1.00 24.84 ? 262 THR B CB    1 
ATOM   3175 O  OG1   . THR B 2 156 ? 7.003   30.620 100.508 1.00 21.80 ? 262 THR B OG1   1 
ATOM   3176 C  CG2   . THR B 2 156 ? 9.095   30.934 101.511 1.00 25.11 ? 262 THR B CG2   1 
ATOM   3177 N  N     . ARG B 2 157 ? 6.187   27.681 100.853 1.00 26.14 ? 263 ARG B N     1 
ATOM   3178 C  CA    . ARG B 2 157 ? 4.847   27.245 100.408 1.00 26.35 ? 263 ARG B CA    1 
ATOM   3179 C  C     . ARG B 2 157 ? 4.126   28.338 99.554  1.00 26.62 ? 263 ARG B C     1 
ATOM   3180 O  O     . ARG B 2 157 ? 3.340   28.014 98.659  1.00 26.09 ? 263 ARG B O     1 
ATOM   3181 C  CB    . ARG B 2 157 ? 4.004   26.806 101.626 1.00 26.18 ? 263 ARG B CB    1 
ATOM   3182 C  CG    . ARG B 2 157 ? 2.570   26.405 101.304 0.01 26.70 ? 263 ARG B CG    1 
ATOM   3183 C  CD    . ARG B 2 157 ? 1.853   25.712 102.455 0.01 27.08 ? 263 ARG B CD    1 
ATOM   3184 N  NE    . ARG B 2 157 ? 0.401   25.879 102.392 0.01 27.37 ? 263 ARG B NE    1 
ATOM   3185 C  CZ    . ARG B 2 157 ? -0.456  25.418 103.301 0.01 27.56 ? 263 ARG B CZ    1 
ATOM   3186 N  NH1   . ARG B 2 157 ? -1.759  25.627 103.146 0.01 27.62 ? 263 ARG B NH1   1 
ATOM   3187 N  NH2   . ARG B 2 157 ? -0.023  24.747 104.366 0.01 27.63 ? 263 ARG B NH2   1 
ATOM   3188 N  N     . ASP B 2 158 ? 4.422   29.617 99.833  1.00 26.91 ? 264 ASP B N     1 
ATOM   3189 C  CA    . ASP B 2 158 ? 3.903   30.776 99.065  1.00 26.79 ? 264 ASP B CA    1 
ATOM   3190 C  C     . ASP B 2 158 ? 4.650   31.087 97.746  1.00 26.36 ? 264 ASP B C     1 
ATOM   3191 O  O     . ASP B 2 158 ? 4.041   31.497 96.787  1.00 26.25 ? 264 ASP B O     1 
ATOM   3192 C  CB    . ASP B 2 158 ? 3.934   32.061 99.931  1.00 26.73 ? 264 ASP B CB    1 
ATOM   3193 C  CG    . ASP B 2 158 ? 2.991   32.011 101.129 1.00 25.13 ? 264 ASP B CG    1 
ATOM   3194 O  OD1   . ASP B 2 158 ? 3.340   31.363 102.144 1.00 24.04 ? 264 ASP B OD1   1 
ATOM   3195 O  OD2   . ASP B 2 158 ? 1.914   32.641 101.163 1.00 22.30 ? 264 ASP B OD2   1 
ATOM   3196 N  N     . LEU B 2 159 ? 5.960   30.888 97.726  1.00 26.47 ? 265 LEU B N     1 
ATOM   3197 C  CA    . LEU B 2 159 ? 6.849   31.434 96.706  1.00 26.29 ? 265 LEU B CA    1 
ATOM   3198 C  C     . LEU B 2 159 ? 7.501   30.341 95.861  1.00 26.32 ? 265 LEU B C     1 
ATOM   3199 O  O     . LEU B 2 159 ? 7.990   29.353 96.408  1.00 25.66 ? 265 LEU B O     1 
ATOM   3200 C  CB    . LEU B 2 159 ? 7.947   32.220 97.397  1.00 26.29 ? 265 LEU B CB    1 
ATOM   3201 C  CG    . LEU B 2 159 ? 8.978   32.862 96.490  1.00 27.25 ? 265 LEU B CG    1 
ATOM   3202 C  CD1   . LEU B 2 159 ? 8.382   34.073 95.760  1.00 28.24 ? 265 LEU B CD1   1 
ATOM   3203 C  CD2   . LEU B 2 159 ? 10.189  33.242 97.292  1.00 27.92 ? 265 LEU B CD2   1 
ATOM   3204 N  N     . VAL B 2 160 ? 7.534   30.567 94.539  1.00 26.37 ? 266 VAL B N     1 
ATOM   3205 C  CA    . VAL B 2 160 ? 8.041   29.611 93.545  1.00 26.30 ? 266 VAL B CA    1 
ATOM   3206 C  C     . VAL B 2 160 ? 9.113   30.282 92.704  1.00 25.31 ? 266 VAL B C     1 
ATOM   3207 O  O     . VAL B 2 160 ? 9.097   31.490 92.573  1.00 24.38 ? 266 VAL B O     1 
ATOM   3208 C  CB    . VAL B 2 160 ? 6.884   29.082 92.630  1.00 27.03 ? 266 VAL B CB    1 
ATOM   3209 C  CG1   . VAL B 2 160 ? 6.424   30.136 91.604  1.00 28.24 ? 266 VAL B CG1   1 
ATOM   3210 C  CG2   . VAL B 2 160 ? 7.276   27.801 91.899  1.00 28.19 ? 266 VAL B CG2   1 
ATOM   3211 N  N     . LYS B 2 161 ? 10.028  29.500 92.126  1.00 25.31 ? 267 LYS B N     1 
ATOM   3212 C  CA    . LYS B 2 161 ? 11.246  30.046 91.511  1.00 24.98 ? 267 LYS B CA    1 
ATOM   3213 C  C     . LYS B 2 161 ? 11.765  29.186 90.368  1.00 24.79 ? 267 LYS B C     1 
ATOM   3214 O  O     . LYS B 2 161 ? 11.913  27.991 90.494  1.00 23.62 ? 267 LYS B O     1 
ATOM   3215 C  CB    . LYS B 2 161 ? 12.344  30.282 92.563  1.00 25.19 ? 267 LYS B CB    1 
ATOM   3216 C  CG    . LYS B 2 161 ? 12.028  31.459 93.569  1.00 25.32 ? 267 LYS B CG    1 
ATOM   3217 C  CD    . LYS B 2 161 ? 13.231  32.265 94.006  1.00 25.02 ? 267 LYS B CD    1 
ATOM   3218 C  CE    . LYS B 2 161 ? 13.040  32.892 95.405  1.00 25.57 ? 267 LYS B CE    1 
ATOM   3219 N  NZ    . LYS B 2 161 ? 14.264  33.659 95.933  1.00 23.07 ? 267 LYS B NZ    1 
ATOM   3220 N  N     . ILE B 2 162 ? 11.987  29.842 89.234  1.00 25.57 ? 268 ILE B N     1 
ATOM   3221 C  CA    . ILE B 2 162 ? 12.550  29.256 88.029  1.00 26.37 ? 268 ILE B CA    1 
ATOM   3222 C  C     . ILE B 2 162 ? 14.063  29.029 88.246  1.00 27.10 ? 268 ILE B C     1 
ATOM   3223 O  O     . ILE B 2 162 ? 14.807  29.949 88.666  1.00 26.62 ? 268 ILE B O     1 
ATOM   3224 C  CB    . ILE B 2 162 ? 12.369  30.237 86.798  1.00 26.69 ? 268 ILE B CB    1 
ATOM   3225 C  CG1   . ILE B 2 162 ? 10.916  30.662 86.568  1.00 26.41 ? 268 ILE B CG1   1 
ATOM   3226 C  CG2   . ILE B 2 162 ? 12.879  29.603 85.524  1.00 27.30 ? 268 ILE B CG2   1 
ATOM   3227 C  CD1   . ILE B 2 162 ? 10.690  32.099 86.805  1.00 27.18 ? 268 ILE B CD1   1 
ATOM   3228 N  N     . GLY B 2 163 ? 14.493  27.811 87.936  1.00 27.35 ? 269 GLY B N     1 
ATOM   3229 C  CA    . GLY B 2 163 ? 15.886  27.398 88.011  1.00 27.95 ? 269 GLY B CA    1 
ATOM   3230 C  C     . GLY B 2 163 ? 16.400  26.935 86.635  1.00 28.14 ? 269 GLY B C     1 
ATOM   3231 O  O     . GLY B 2 163 ? 15.879  27.333 85.598  1.00 27.83 ? 269 GLY B O     1 
ATOM   3232 N  N     . ASP B 2 164 ? 17.419  26.089 86.641  1.00 28.26 ? 270 ASP B N     1 
ATOM   3233 C  CA    . ASP B 2 164 ? 18.067  25.633 85.419  1.00 29.13 ? 270 ASP B CA    1 
ATOM   3234 C  C     . ASP B 2 164 ? 18.016  26.590 84.222  1.00 29.39 ? 270 ASP B C     1 
ATOM   3235 O  O     . ASP B 2 164 ? 17.125  26.437 83.356  1.00 31.59 ? 270 ASP B O     1 
ATOM   3236 C  CB    . ASP B 2 164 ? 17.493  24.290 84.979  1.00 29.13 ? 270 ASP B CB    1 
ATOM   3237 C  CG    . ASP B 2 164 ? 18.485  23.484 84.114  1.00 31.03 ? 270 ASP B CG    1 
ATOM   3238 O  OD1   . ASP B 2 164 ? 18.155  22.291 83.774  1.00 28.60 ? 270 ASP B OD1   1 
ATOM   3239 O  OD2   . ASP B 2 164 ? 19.610  23.969 83.740  1.00 30.42 ? 270 ASP B OD2   1 
ATOM   3240 N  N     . PHE B 2 165 ? 18.966  27.532 84.139  1.00 28.02 ? 271 PHE B N     1 
ATOM   3241 C  CA    . PHE B 2 165 ? 19.051  28.438 83.004  1.00 27.15 ? 271 PHE B CA    1 
ATOM   3242 C  C     . PHE B 2 165 ? 20.187  27.996 82.132  1.00 26.92 ? 271 PHE B C     1 
ATOM   3243 O  O     . PHE B 2 165 ? 20.954  28.812 81.566  1.00 26.49 ? 271 PHE B O     1 
ATOM   3244 C  CB    . PHE B 2 165 ? 19.284  29.883 83.470  1.00 27.64 ? 271 PHE B CB    1 
ATOM   3245 C  CG    . PHE B 2 165 ? 18.341  30.327 84.527  1.00 25.52 ? 271 PHE B CG    1 
ATOM   3246 C  CD1   . PHE B 2 165 ? 18.664  30.210 85.843  1.00 24.95 ? 271 PHE B CD1   1 
ATOM   3247 C  CD2   . PHE B 2 165 ? 17.131  30.826 84.197  1.00 25.33 ? 271 PHE B CD2   1 
ATOM   3248 C  CE1   . PHE B 2 165 ? 17.791  30.605 86.803  1.00 26.73 ? 271 PHE B CE1   1 
ATOM   3249 C  CE2   . PHE B 2 165 ? 16.239  31.235 85.167  1.00 26.99 ? 271 PHE B CE2   1 
ATOM   3250 C  CZ    . PHE B 2 165 ? 16.564  31.122 86.461  1.00 26.78 ? 271 PHE B CZ    1 
ATOM   3251 N  N     . GLY B 2 166 ? 20.298  26.680 82.026  1.00 27.05 ? 272 GLY B N     1 
ATOM   3252 C  CA    . GLY B 2 166 ? 21.386  26.057 81.303  1.00 26.91 ? 272 GLY B CA    1 
ATOM   3253 C  C     . GLY B 2 166 ? 21.312  26.315 79.815  1.00 26.78 ? 272 GLY B C     1 
ATOM   3254 O  O     . GLY B 2 166 ? 22.365  26.329 79.186  1.00 27.25 ? 272 GLY B O     1 
ATOM   3255 N  N     . LEU B 2 167 ? 20.090  26.507 79.284  1.00 26.58 ? 273 LEU B N     1 
ATOM   3256 C  CA    . LEU B 2 167 ? 19.833  26.749 77.856  1.00 26.23 ? 273 LEU B CA    1 
ATOM   3257 C  C     . LEU B 2 167 ? 19.514  28.192 77.504  1.00 26.53 ? 273 LEU B C     1 
ATOM   3258 O  O     . LEU B 2 167 ? 19.358  28.534 76.343  1.00 25.52 ? 273 LEU B O     1 
ATOM   3259 C  CB    . LEU B 2 167 ? 18.688  25.865 77.403  1.00 25.98 ? 273 LEU B CB    1 
ATOM   3260 C  CG    . LEU B 2 167 ? 19.023  24.376 77.516  1.00 24.87 ? 273 LEU B CG    1 
ATOM   3261 C  CD1   . LEU B 2 167 ? 17.878  23.592 76.970  1.00 26.81 ? 273 LEU B CD1   1 
ATOM   3262 C  CD2   . LEU B 2 167 ? 20.185  24.059 76.733  1.00 23.44 ? 273 LEU B CD2   1 
ATOM   3263 N  N     . MET B 2 168 ? 19.450  29.041 78.521  1.00 27.28 ? 274 MET B N     1 
ATOM   3264 C  CA    . MET B 2 168 ? 18.971  30.393 78.366  1.00 27.49 ? 274 MET B CA    1 
ATOM   3265 C  C     . MET B 2 168 ? 20.038  31.138 77.572  1.00 27.54 ? 274 MET B C     1 
ATOM   3266 O  O     . MET B 2 168 ? 21.231  31.094 77.903  1.00 28.49 ? 274 MET B O     1 
ATOM   3267 C  CB    . MET B 2 168 ? 18.753  31.012 79.767  1.00 28.17 ? 274 MET B CB    1 
ATOM   3268 C  CG    . MET B 2 168 ? 17.938  32.364 79.806  1.00 29.98 ? 274 MET B CG    1 
ATOM   3269 S  SD    . MET B 2 168 ? 18.236  33.561 81.187  1.00 29.06 ? 274 MET B SD    1 
ATOM   3270 C  CE    . MET B 2 168 ? 19.830  33.802 80.957  1.00 28.54 ? 274 MET B CE    1 
ATOM   3271 N  N     . ARG B 2 169 ? 19.625  31.775 76.497  1.00 26.80 ? 275 ARG B N     1 
ATOM   3272 C  CA    . ARG B 2 169 ? 20.502  32.635 75.719  1.00 26.60 ? 275 ARG B CA    1 
ATOM   3273 C  C     . ARG B 2 169 ? 19.954  34.071 75.640  1.00 26.31 ? 275 ARG B C     1 
ATOM   3274 O  O     . ARG B 2 169 ? 18.818  34.331 75.967  1.00 25.88 ? 275 ARG B O     1 
ATOM   3275 C  CB    . ARG B 2 169 ? 20.650  32.069 74.298  1.00 26.72 ? 275 ARG B CB    1 
ATOM   3276 C  CG    . ARG B 2 169 ? 21.135  30.609 74.204  1.00 27.32 ? 275 ARG B CG    1 
ATOM   3277 C  CD    . ARG B 2 169 ? 22.554  30.335 74.737  1.00 28.39 ? 275 ARG B CD    1 
ATOM   3278 N  NE    . ARG B 2 169 ? 22.924  28.910 74.604  1.00 31.02 ? 275 ARG B NE    1 
ATOM   3279 C  CZ    . ARG B 2 169 ? 23.112  28.037 75.617  1.00 30.72 ? 275 ARG B CZ    1 
ATOM   3280 N  NH1   . ARG B 2 169 ? 22.970  28.425 76.889  1.00 32.55 ? 275 ARG B NH1   1 
ATOM   3281 N  NH2   . ARG B 2 169 ? 23.457  26.771 75.360  1.00 28.36 ? 275 ARG B NH2   1 
ATOM   3282 N  N     . ALA B 2 170 ? 20.772  35.002 75.205  1.00 26.52 ? 276 ALA B N     1 
ATOM   3283 C  CA    . ALA B 2 170 ? 20.316  36.347 74.963  1.00 27.25 ? 276 ALA B CA    1 
ATOM   3284 C  C     . ALA B 2 170 ? 20.046  36.501 73.457  1.00 28.43 ? 276 ALA B C     1 
ATOM   3285 O  O     . ALA B 2 170 ? 20.875  36.143 72.605  1.00 28.66 ? 276 ALA B O     1 
ATOM   3286 C  CB    . ALA B 2 170 ? 21.321  37.357 75.454  1.00 26.63 ? 276 ALA B CB    1 
ATOM   3287 N  N     . LEU B 2 171 ? 18.851  36.991 73.125  1.00 29.16 ? 277 LEU B N     1 
ATOM   3288 C  CA    . LEU B 2 171 ? 18.587  37.436 71.786  1.00 29.45 ? 277 LEU B CA    1 
ATOM   3289 C  C     . LEU B 2 171 ? 19.515  38.641 71.575  1.00 30.67 ? 277 LEU B C     1 
ATOM   3290 O  O     . LEU B 2 171 ? 19.499  39.573 72.397  1.00 32.30 ? 277 LEU B O     1 
ATOM   3291 C  CB    . LEU B 2 171 ? 17.138  37.855 71.684  1.00 29.11 ? 277 LEU B CB    1 
ATOM   3292 C  CG    . LEU B 2 171 ? 16.081  36.757 71.859  1.00 28.97 ? 277 LEU B CG    1 
ATOM   3293 C  CD1   . LEU B 2 171 ? 14.679  37.325 71.765  1.00 27.69 ? 277 LEU B CD1   1 
ATOM   3294 C  CD2   . LEU B 2 171 ? 16.254  35.708 70.812  1.00 30.27 ? 277 LEU B CD2   1 
ATOM   3295 N  N     . PRO B 2 172 ? 20.322  38.651 70.515  1.00 31.27 ? 278 PRO B N     1 
ATOM   3296 C  CA    . PRO B 2 172 ? 21.130  39.847 70.172  1.00 31.99 ? 278 PRO B CA    1 
ATOM   3297 C  C     . PRO B 2 172 ? 20.224  40.939 69.604  1.00 32.02 ? 278 PRO B C     1 
ATOM   3298 O  O     . PRO B 2 172 ? 19.111  40.621 69.160  1.00 32.71 ? 278 PRO B O     1 
ATOM   3299 C  CB    . PRO B 2 172 ? 22.082  39.354 69.078  1.00 32.12 ? 278 PRO B CB    1 
ATOM   3300 C  CG    . PRO B 2 172 ? 21.319  38.165 68.445  1.00 32.70 ? 278 PRO B CG    1 
ATOM   3301 C  CD    . PRO B 2 172 ? 20.454  37.574 69.522  1.00 31.61 ? 278 PRO B CD    1 
ATOM   3302 N  N     . GLN B 2 173 ? 20.693  42.180 69.574  1.00 31.55 ? 279 GLN B N     1 
ATOM   3303 C  CA    . GLN B 2 173 ? 19.770  43.343 69.473  1.00 30.83 ? 279 GLN B CA    1 
ATOM   3304 C  C     . GLN B 2 173 ? 18.725  43.286 68.314  1.00 30.02 ? 279 GLN B C     1 
ATOM   3305 O  O     . GLN B 2 173 ? 17.582  43.790 68.471  1.00 29.42 ? 279 GLN B O     1 
ATOM   3306 C  CB    . GLN B 2 173 ? 20.549  44.673 69.422  1.00 30.75 ? 279 GLN B CB    1 
ATOM   3307 C  CG    . GLN B 2 173 ? 21.736  44.767 70.402  1.00 30.82 ? 279 GLN B CG    1 
ATOM   3308 C  CD    . GLN B 2 173 ? 23.087  44.685 69.710  0.01 30.24 ? 279 GLN B CD    1 
ATOM   3309 O  OE1   . GLN B 2 173 ? 23.818  43.709 69.879  0.01 30.01 ? 279 GLN B OE1   1 
ATOM   3310 N  NE2   . GLN B 2 173 ? 23.420  45.710 68.934  0.01 30.05 ? 279 GLN B NE2   1 
ATOM   3311 N  N     . ASN B 2 174 ? 19.095  42.660 67.188  1.00 28.81 ? 280 ASN B N     1 
ATOM   3312 C  CA    . ASN B 2 174 ? 18.255  42.691 65.998  1.00 28.58 ? 280 ASN B CA    1 
ATOM   3313 C  C     . ASN B 2 174 ? 17.894  41.318 65.404  1.00 28.58 ? 280 ASN B C     1 
ATOM   3314 O  O     . ASN B 2 174 ? 18.000  41.079 64.198  1.00 27.98 ? 280 ASN B O     1 
ATOM   3315 C  CB    . ASN B 2 174 ? 18.917  43.576 64.947  1.00 28.87 ? 280 ASN B CB    1 
ATOM   3316 C  CG    . ASN B 2 174 ? 19.533  44.842 65.533  0.01 28.54 ? 280 ASN B CG    1 
ATOM   3317 O  OD1   . ASN B 2 174 ? 20.712  45.125 65.319  0.01 28.48 ? 280 ASN B OD1   1 
ATOM   3318 N  ND2   . ASN B 2 174 ? 18.738  45.606 66.273  0.01 28.44 ? 280 ASN B ND2   1 
ATOM   3319 N  N     . ASP B 2 175 ? 17.460  40.417 66.273  1.00 28.99 ? 281 ASP B N     1 
ATOM   3320 C  CA    . ASP B 2 175 ? 16.792  39.191 65.852  1.00 29.43 ? 281 ASP B CA    1 
ATOM   3321 C  C     . ASP B 2 175 ? 15.676  38.852 66.826  1.00 29.71 ? 281 ASP B C     1 
ATOM   3322 O  O     . ASP B 2 175 ? 15.773  39.130 68.024  1.00 29.12 ? 281 ASP B O     1 
ATOM   3323 C  CB    . ASP B 2 175 ? 17.796  38.023 65.769  1.00 29.93 ? 281 ASP B CB    1 
ATOM   3324 C  CG    . ASP B 2 175 ? 18.412  37.878 64.389  0.01 29.39 ? 281 ASP B CG    1 
ATOM   3325 O  OD1   . ASP B 2 175 ? 17.817  37.177 63.542  0.01 29.25 ? 281 ASP B OD1   1 
ATOM   3326 O  OD2   . ASP B 2 175 ? 19.486  38.425 64.060  0.01 29.21 ? 281 ASP B OD2   1 
ATOM   3327 N  N     . ASP B 2 176 ? 14.611  38.254 66.308  1.00 30.41 ? 282 ASP B N     1 
ATOM   3328 C  CA    . ASP B 2 176 ? 13.505  37.780 67.163  1.00 31.29 ? 282 ASP B CA    1 
ATOM   3329 C  C     . ASP B 2 176 ? 13.723  36.319 67.635  1.00 30.81 ? 282 ASP B C     1 
ATOM   3330 O  O     . ASP B 2 176 ? 13.025  35.843 68.532  1.00 30.10 ? 282 ASP B O     1 
ATOM   3331 C  CB    . ASP B 2 176 ? 12.130  37.912 66.424  1.00 31.79 ? 282 ASP B CB    1 
ATOM   3332 C  CG    . ASP B 2 176 ? 11.848  36.739 65.416  1.00 32.97 ? 282 ASP B CG    1 
ATOM   3333 O  OD1   . ASP B 2 176 ? 11.906  35.524 65.807  1.00 34.39 ? 282 ASP B OD1   1 
ATOM   3334 O  OD2   . ASP B 2 176 ? 11.556  36.960 64.214  1.00 31.15 ? 282 ASP B OD2   1 
ATOM   3335 N  N     . HIS B 2 177 ? 14.673  35.630 67.000  1.00 30.57 ? 283 HIS B N     1 
ATOM   3336 C  CA    . HIS B 2 177 ? 14.791  34.179 67.136  1.00 30.61 ? 283 HIS B CA    1 
ATOM   3337 C  C     . HIS B 2 177 ? 16.242  33.663 67.310  1.00 28.83 ? 283 HIS B C     1 
ATOM   3338 O  O     . HIS B 2 177 ? 17.222  34.360 67.063  1.00 28.37 ? 283 HIS B O     1 
ATOM   3339 C  CB    . HIS B 2 177 ? 14.005  33.490 65.975  1.00 31.34 ? 283 HIS B CB    1 
ATOM   3340 C  CG    . HIS B 2 177 ? 14.817  33.150 64.751  1.00 34.68 ? 283 HIS B CG    1 
ATOM   3341 N  ND1   . HIS B 2 177 ? 15.909  33.892 64.328  1.00 39.24 ? 283 HIS B ND1   1 
ATOM   3342 C  CD2   . HIS B 2 177 ? 14.670  32.153 63.836  1.00 36.35 ? 283 HIS B CD2   1 
ATOM   3343 C  CE1   . HIS B 2 177 ? 16.403  33.364 63.218  1.00 38.00 ? 283 HIS B CE1   1 
ATOM   3344 N  NE2   . HIS B 2 177 ? 15.671  32.304 62.903  1.00 38.55 ? 283 HIS B NE2   1 
ATOM   3345 N  N     . TYR B 2 178 ? 16.340  32.436 67.771  1.00 27.28 ? 284 TYR B N     1 
ATOM   3346 C  CA    . TYR B 2 178 ? 17.599  31.795 68.075  1.00 26.28 ? 284 TYR B CA    1 
ATOM   3347 C  C     . TYR B 2 178 ? 17.408  30.397 67.625  1.00 26.02 ? 284 TYR B C     1 
ATOM   3348 O  O     . TYR B 2 178 ? 16.447  29.765 67.995  1.00 26.32 ? 284 TYR B O     1 
ATOM   3349 C  CB    . TYR B 2 178 ? 17.860  31.809 69.583  1.00 25.95 ? 284 TYR B CB    1 
ATOM   3350 C  CG    . TYR B 2 178 ? 19.297  31.633 69.929  1.00 26.81 ? 284 TYR B CG    1 
ATOM   3351 C  CD1   . TYR B 2 178 ? 19.879  30.380 69.854  1.00 28.69 ? 284 TYR B CD1   1 
ATOM   3352 C  CD2   . TYR B 2 178 ? 20.112  32.728 70.299  1.00 26.09 ? 284 TYR B CD2   1 
ATOM   3353 C  CE1   . TYR B 2 178 ? 21.236  30.200 70.136  1.00 28.80 ? 284 TYR B CE1   1 
ATOM   3354 C  CE2   . TYR B 2 178 ? 21.461  32.557 70.586  1.00 25.02 ? 284 TYR B CE2   1 
ATOM   3355 C  CZ    . TYR B 2 178 ? 22.014  31.284 70.502  1.00 27.75 ? 284 TYR B CZ    1 
ATOM   3356 O  OH    . TYR B 2 178 ? 23.335  31.021 70.786  1.00 27.99 ? 284 TYR B OH    1 
ATOM   3357 N  N     . VAL B 2 179 ? 18.294  29.879 66.804  1.00 26.63 ? 285 VAL B N     1 
ATOM   3358 C  CA    . VAL B 2 179 ? 18.212  28.449 66.460  1.00 26.58 ? 285 VAL B CA    1 
ATOM   3359 C  C     . VAL B 2 179 ? 18.968  27.601 67.492  1.00 26.67 ? 285 VAL B C     1 
ATOM   3360 O  O     . VAL B 2 179 ? 20.117  27.897 67.758  1.00 27.75 ? 285 VAL B O     1 
ATOM   3361 C  CB    . VAL B 2 179 ? 18.687  28.213 65.006  1.00 25.96 ? 285 VAL B CB    1 
ATOM   3362 C  CG1   . VAL B 2 179 ? 18.696  26.751 64.709  1.00 25.38 ? 285 VAL B CG1   1 
ATOM   3363 C  CG2   . VAL B 2 179 ? 17.717  28.944 64.019  1.00 24.55 ? 285 VAL B CG2   1 
ATOM   3364 N  N     . MET B 2 180 ? 18.354  26.585 68.089  1.00 26.39 ? 286 MET B N     1 
ATOM   3365 C  CA    . MET B 2 180 ? 19.111  25.677 68.990  1.00 27.13 ? 286 MET B CA    1 
ATOM   3366 C  C     . MET B 2 180 ? 20.154  24.876 68.224  1.00 27.19 ? 286 MET B C     1 
ATOM   3367 O  O     . MET B 2 180 ? 19.892  24.516 67.129  1.00 28.65 ? 286 MET B O     1 
ATOM   3368 C  CB    . MET B 2 180 ? 18.158  24.708 69.684  1.00 26.78 ? 286 MET B CB    1 
ATOM   3369 C  CG    . MET B 2 180 ? 18.739  24.006 70.899  1.00 27.11 ? 286 MET B CG    1 
ATOM   3370 S  SD    . MET B 2 180 ? 17.441  23.449 72.047  1.00 28.45 ? 286 MET B SD    1 
ATOM   3371 C  CE    . MET B 2 180 ? 17.387  24.866 73.136  1.00 29.88 ? 286 MET B CE    1 
ATOM   3372 N  N     . GLN B 2 181 ? 21.329  24.591 68.758  1.00 27.98 ? 287 GLN B N     1 
ATOM   3373 C  CA    . GLN B 2 181 ? 22.365  23.823 67.979  1.00 28.89 ? 287 GLN B CA    1 
ATOM   3374 C  C     . GLN B 2 181 ? 22.045  22.322 67.813  1.00 29.23 ? 287 GLN B C     1 
ATOM   3375 O  O     . GLN B 2 181 ? 21.345  21.768 68.648  1.00 29.78 ? 287 GLN B O     1 
ATOM   3376 C  CB    . GLN B 2 181 ? 23.722  23.937 68.639  1.00 28.97 ? 287 GLN B CB    1 
ATOM   3377 C  CG    . GLN B 2 181 ? 24.271  25.364 68.750  1.00 29.04 ? 287 GLN B CG    1 
ATOM   3378 C  CD    . GLN B 2 181 ? 25.631  25.344 69.429  1.00 29.94 ? 287 GLN B CD    1 
ATOM   3379 O  OE1   . GLN B 2 181 ? 25.768  24.798 70.536  1.00 28.25 ? 287 GLN B OE1   1 
ATOM   3380 N  NE2   . GLN B 2 181 ? 26.644  25.903 68.766  1.00 30.26 ? 287 GLN B NE2   1 
ATOM   3381 N  N     . GLU B 2 182 ? 22.540  21.648 66.766  1.00 29.59 ? 288 GLU B N     1 
ATOM   3382 C  CA    . GLU B 2 182 ? 21.977  20.280 66.421  1.00 29.61 ? 288 GLU B CA    1 
ATOM   3383 C  C     . GLU B 2 182 ? 22.045  19.282 67.615  1.00 29.16 ? 288 GLU B C     1 
ATOM   3384 O  O     . GLU B 2 182 ? 21.175  18.442 67.802  1.00 28.66 ? 288 GLU B O     1 
ATOM   3385 C  CB    . GLU B 2 182 ? 22.600  19.695 65.114  1.00 29.40 ? 288 GLU B CB    1 
ATOM   3386 C  CG    . GLU B 2 182 ? 21.640  19.181 64.010  1.00 29.25 ? 288 GLU B CG    1 
ATOM   3387 C  CD    . GLU B 2 182 ? 22.367  18.511 62.778  1.00 33.39 ? 288 GLU B CD    1 
ATOM   3388 O  OE1   . GLU B 2 182 ? 23.662  18.366 62.731  1.00 35.18 ? 288 GLU B OE1   1 
ATOM   3389 O  OE2   . GLU B 2 182 ? 21.648  18.066 61.824  1.00 32.71 ? 288 GLU B OE2   1 
ATOM   3390 N  N     . HIS B 2 183 ? 23.055  19.465 68.455  1.00 30.01 ? 289 HIS B N     1 
ATOM   3391 C  CA    . HIS B 2 183 ? 23.438  18.504 69.491  1.00 30.53 ? 289 HIS B CA    1 
ATOM   3392 C  C     . HIS B 2 183 ? 22.750  18.701 70.858  1.00 30.95 ? 289 HIS B C     1 
ATOM   3393 O  O     . HIS B 2 183 ? 22.938  17.912 71.778  1.00 32.18 ? 289 HIS B O     1 
ATOM   3394 C  CB    . HIS B 2 183 ? 24.953  18.544 69.684  1.00 29.97 ? 289 HIS B CB    1 
ATOM   3395 C  CG    . HIS B 2 183 ? 25.418  19.724 70.464  1.00 31.67 ? 289 HIS B CG    1 
ATOM   3396 N  ND1   . HIS B 2 183 ? 25.278  21.018 70.004  1.00 35.44 ? 289 HIS B ND1   1 
ATOM   3397 C  CD2   . HIS B 2 183 ? 26.000  19.819 71.683  1.00 32.83 ? 289 HIS B CD2   1 
ATOM   3398 C  CE1   . HIS B 2 183 ? 25.765  21.858 70.904  1.00 34.59 ? 289 HIS B CE1   1 
ATOM   3399 N  NE2   . HIS B 2 183 ? 26.217  21.158 71.928  1.00 32.86 ? 289 HIS B NE2   1 
ATOM   3400 N  N     . ARG B 2 184 ? 21.974  19.738 71.043  1.00 30.47 ? 290 ARG B N     1 
ATOM   3401 C  CA    . ARG B 2 184 ? 21.269  19.785 72.283  1.00 30.65 ? 290 ARG B CA    1 
ATOM   3402 C  C     . ARG B 2 184 ? 19.969  19.039 72.069  1.00 31.92 ? 290 ARG B C     1 
ATOM   3403 O  O     . ARG B 2 184 ? 19.704  18.530 70.964  1.00 32.47 ? 290 ARG B O     1 
ATOM   3404 C  CB    . ARG B 2 184 ? 21.066  21.218 72.723  1.00 30.49 ? 290 ARG B CB    1 
ATOM   3405 C  CG    . ARG B 2 184 ? 22.341  21.795 73.275  1.00 30.09 ? 290 ARG B CG    1 
ATOM   3406 C  CD    . ARG B 2 184 ? 22.322  23.293 73.339  1.00 30.27 ? 290 ARG B CD    1 
ATOM   3407 N  NE    . ARG B 2 184 ? 23.616  23.879 73.019  1.00 29.77 ? 290 ARG B NE    1 
ATOM   3408 C  CZ    . ARG B 2 184 ? 24.580  24.101 73.893  1.00 28.85 ? 290 ARG B CZ    1 
ATOM   3409 N  NH1   . ARG B 2 184 ? 24.398  23.800 75.157  1.00 29.84 ? 290 ARG B NH1   1 
ATOM   3410 N  NH2   . ARG B 2 184 ? 25.735  24.644 73.506  1.00 28.34 ? 290 ARG B NH2   1 
ATOM   3411 N  N     . LYS B 2 185 ? 19.193  18.933 73.147  1.00 32.36 ? 291 LYS B N     1 
ATOM   3412 C  CA    . LYS B 2 185 ? 17.933  18.201 73.186  1.00 32.28 ? 291 LYS B CA    1 
ATOM   3413 C  C     . LYS B 2 185 ? 17.048  18.872 74.225  1.00 32.21 ? 291 LYS B C     1 
ATOM   3414 O  O     . LYS B 2 185 ? 17.481  19.203 75.295  1.00 33.16 ? 291 LYS B O     1 
ATOM   3415 C  CB    . LYS B 2 185 ? 18.149  16.751 73.590  1.00 31.89 ? 291 LYS B CB    1 
ATOM   3416 C  CG    . LYS B 2 185 ? 19.283  16.034 72.828  1.00 33.31 ? 291 LYS B CG    1 
ATOM   3417 C  CD    . LYS B 2 185 ? 18.794  14.825 71.981  1.00 34.35 ? 291 LYS B CD    1 
ATOM   3418 C  CE    . LYS B 2 185 ? 19.642  14.640 70.661  1.00 35.77 ? 291 LYS B CE    1 
ATOM   3419 N  NZ    . LYS B 2 185 ? 19.191  15.566 69.497  1.00 37.70 ? 291 LYS B NZ    1 
ATOM   3420 N  N     . VAL B 2 186 ? 15.810  19.123 73.896  1.00 31.65 ? 292 VAL B N     1 
ATOM   3421 C  CA    . VAL B 2 186 ? 14.877  19.563 74.887  1.00 31.34 ? 292 VAL B CA    1 
ATOM   3422 C  C     . VAL B 2 186 ? 13.736  18.556 74.707  1.00 31.08 ? 292 VAL B C     1 
ATOM   3423 O  O     . VAL B 2 186 ? 13.337  18.272 73.572  1.00 31.40 ? 292 VAL B O     1 
ATOM   3424 C  CB    . VAL B 2 186 ? 14.492  21.060 74.669  1.00 31.80 ? 292 VAL B CB    1 
ATOM   3425 C  CG1   . VAL B 2 186 ? 13.592  21.585 75.787  1.00 31.35 ? 292 VAL B CG1   1 
ATOM   3426 C  CG2   . VAL B 2 186 ? 15.772  21.939 74.558  1.00 32.24 ? 292 VAL B CG2   1 
ATOM   3427 N  N     . PRO B 2 187 ? 13.279  17.923 75.784  1.00 30.02 ? 293 PRO B N     1 
ATOM   3428 C  CA    . PRO B 2 187 ? 12.140  17.029 75.662  1.00 29.47 ? 293 PRO B CA    1 
ATOM   3429 C  C     . PRO B 2 187 ? 11.077  17.682 74.768  1.00 28.58 ? 293 PRO B C     1 
ATOM   3430 O  O     . PRO B 2 187 ? 10.732  18.863 74.949  1.00 29.19 ? 293 PRO B O     1 
ATOM   3431 C  CB    . PRO B 2 187 ? 11.685  16.846 77.123  1.00 29.68 ? 293 PRO B CB    1 
ATOM   3432 C  CG    . PRO B 2 187 ? 12.901  16.962 77.907  1.00 29.67 ? 293 PRO B CG    1 
ATOM   3433 C  CD    . PRO B 2 187 ? 13.797  17.940 77.161  1.00 30.18 ? 293 PRO B CD    1 
ATOM   3434 N  N     . PHE B 2 188 ? 10.616  16.913 73.795  1.00 27.10 ? 294 PHE B N     1 
ATOM   3435 C  CA    . PHE B 2 188 ? 9.838   17.422 72.705  1.00 26.28 ? 294 PHE B CA    1 
ATOM   3436 C  C     . PHE B 2 188 ? 8.512   18.023 73.167  1.00 26.66 ? 294 PHE B C     1 
ATOM   3437 O  O     . PHE B 2 188 ? 8.079   19.074 72.660  1.00 27.00 ? 294 PHE B O     1 
ATOM   3438 C  CB    . PHE B 2 188 ? 9.553   16.302 71.707  1.00 25.87 ? 294 PHE B CB    1 
ATOM   3439 C  CG    . PHE B 2 188 ? 10.773  15.721 71.062  1.00 24.12 ? 294 PHE B CG    1 
ATOM   3440 C  CD1   . PHE B 2 188 ? 11.735  16.529 70.467  1.00 24.24 ? 294 PHE B CD1   1 
ATOM   3441 C  CD2   . PHE B 2 188 ? 10.960  14.357 71.036  1.00 23.40 ? 294 PHE B CD2   1 
ATOM   3442 C  CE1   . PHE B 2 188 ? 12.876  15.972 69.846  1.00 23.32 ? 294 PHE B CE1   1 
ATOM   3443 C  CE2   . PHE B 2 188 ? 12.061  13.793 70.410  1.00 22.78 ? 294 PHE B CE2   1 
ATOM   3444 C  CZ    . PHE B 2 188 ? 13.029  14.603 69.816  1.00 21.97 ? 294 PHE B CZ    1 
ATOM   3445 N  N     . ALA B 2 189 ? 7.877   17.372 74.143  1.00 26.28 ? 295 ALA B N     1 
ATOM   3446 C  CA    . ALA B 2 189 ? 6.476   17.636 74.449  1.00 25.20 ? 295 ALA B CA    1 
ATOM   3447 C  C     . ALA B 2 189 ? 6.247   18.992 75.081  1.00 25.02 ? 295 ALA B C     1 
ATOM   3448 O  O     . ALA B 2 189 ? 5.078   19.383 75.248  1.00 25.29 ? 295 ALA B O     1 
ATOM   3449 C  CB    . ALA B 2 189 ? 5.936   16.568 75.311  1.00 24.99 ? 295 ALA B CB    1 
ATOM   3450 N  N     . TRP B 2 190 ? 7.315   19.729 75.413  1.00 24.04 ? 296 TRP B N     1 
ATOM   3451 C  CA    . TRP B 2 190 ? 7.132   21.124 75.832  1.00 24.12 ? 296 TRP B CA    1 
ATOM   3452 C  C     . TRP B 2 190 ? 7.523   22.115 74.759  1.00 24.62 ? 296 TRP B C     1 
ATOM   3453 O  O     . TRP B 2 190 ? 7.455   23.293 75.017  1.00 24.94 ? 296 TRP B O     1 
ATOM   3454 C  CB    . TRP B 2 190 ? 7.951   21.502 77.055  1.00 23.90 ? 296 TRP B CB    1 
ATOM   3455 C  CG    . TRP B 2 190 ? 7.573   20.905 78.360  1.00 23.73 ? 296 TRP B CG    1 
ATOM   3456 C  CD1   . TRP B 2 190 ? 7.179   21.584 79.447  1.00 22.07 ? 296 TRP B CD1   1 
ATOM   3457 C  CD2   . TRP B 2 190 ? 7.693   19.510 78.765  1.00 22.56 ? 296 TRP B CD2   1 
ATOM   3458 N  NE1   . TRP B 2 190 ? 6.993   20.712 80.488  1.00 24.10 ? 296 TRP B NE1   1 
ATOM   3459 C  CE2   . TRP B 2 190 ? 7.285   19.433 80.085  1.00 21.93 ? 296 TRP B CE2   1 
ATOM   3460 C  CE3   . TRP B 2 190 ? 8.077   18.326 78.121  1.00 20.67 ? 296 TRP B CE3   1 
ATOM   3461 C  CZ2   . TRP B 2 190 ? 7.202   18.228 80.766  1.00 20.66 ? 296 TRP B CZ2   1 
ATOM   3462 C  CZ3   . TRP B 2 190 ? 8.026   17.152 78.807  1.00 18.98 ? 296 TRP B CZ3   1 
ATOM   3463 C  CH2   . TRP B 2 190 ? 7.590   17.104 80.105  1.00 18.84 ? 296 TRP B CH2   1 
ATOM   3464 N  N     . CYS B 2 191 ? 7.950   21.656 73.587  1.00 25.04 ? 297 CYS B N     1 
ATOM   3465 C  CA    . CYS B 2 191 ? 8.460   22.525 72.532  1.00 25.58 ? 297 CYS B CA    1 
ATOM   3466 C  C     . CYS B 2 191 ? 7.381   23.112 71.588  1.00 26.16 ? 297 CYS B C     1 
ATOM   3467 O  O     . CYS B 2 191 ? 6.484   22.403 71.158  1.00 26.72 ? 297 CYS B O     1 
ATOM   3468 C  CB    . CYS B 2 191 ? 9.434   21.735 71.692  1.00 25.72 ? 297 CYS B CB    1 
ATOM   3469 S  SG    . CYS B 2 191 ? 10.975  21.384 72.526  1.00 25.89 ? 297 CYS B SG    1 
ATOM   3470 N  N     . ALA B 2 192 ? 7.488   24.390 71.230  1.00 25.95 ? 298 ALA B N     1 
ATOM   3471 C  CA    . ALA B 2 192 ? 6.487   24.948 70.360  1.00 26.16 ? 298 ALA B CA    1 
ATOM   3472 C  C     . ALA B 2 192 ? 6.705   24.302 69.042  1.00 26.12 ? 298 ALA B C     1 
ATOM   3473 O  O     . ALA B 2 192 ? 7.821   23.838 68.786  1.00 25.83 ? 298 ALA B O     1 
ATOM   3474 C  CB    . ALA B 2 192 ? 6.625   26.420 70.212  1.00 27.07 ? 298 ALA B CB    1 
ATOM   3475 N  N     . PRO B 2 193 ? 5.650   24.259 68.202  1.00 25.99 ? 299 PRO B N     1 
ATOM   3476 C  CA    . PRO B 2 193 ? 5.735   23.592 66.891  1.00 25.22 ? 299 PRO B CA    1 
ATOM   3477 C  C     . PRO B 2 193 ? 6.909   24.107 66.058  1.00 24.33 ? 299 PRO B C     1 
ATOM   3478 O  O     . PRO B 2 193 ? 7.616   23.295 65.482  1.00 23.84 ? 299 PRO B O     1 
ATOM   3479 C  CB    . PRO B 2 193 ? 4.387   23.894 66.252  1.00 25.05 ? 299 PRO B CB    1 
ATOM   3480 C  CG    . PRO B 2 193 ? 3.527   24.245 67.357  1.00 25.11 ? 299 PRO B CG    1 
ATOM   3481 C  CD    . PRO B 2 193 ? 4.319   24.846 68.417  1.00 25.11 ? 299 PRO B CD    1 
ATOM   3482 N  N     . GLU B 2 194 ? 7.139   25.411 66.038  1.00 23.64 ? 300 GLU B N     1 
ATOM   3483 C  CA    . GLU B 2 194 ? 8.307   25.926 65.347  1.00 24.14 ? 300 GLU B CA    1 
ATOM   3484 C  C     . GLU B 2 194 ? 9.655   25.395 65.867  1.00 24.03 ? 300 GLU B C     1 
ATOM   3485 O  O     . GLU B 2 194 ? 10.503  25.092 65.077  1.00 24.19 ? 300 GLU B O     1 
ATOM   3486 C  CB    . GLU B 2 194 ? 8.270   27.445 65.271  1.00 24.52 ? 300 GLU B CB    1 
ATOM   3487 C  CG    . GLU B 2 194 ? 8.650   28.267 66.488  1.00 28.03 ? 300 GLU B CG    1 
ATOM   3488 C  CD    . GLU B 2 194 ? 7.495   28.580 67.446  1.00 32.49 ? 300 GLU B CD    1 
ATOM   3489 O  OE1   . GLU B 2 194 ? 6.497   27.827 67.509  1.00 32.93 ? 300 GLU B OE1   1 
ATOM   3490 O  OE2   . GLU B 2 194 ? 7.620   29.589 68.185  1.00 36.57 ? 300 GLU B OE2   1 
ATOM   3491 N  N     . SER B 2 195 ? 9.840   25.262 67.183  1.00 24.02 ? 301 SER B N     1 
ATOM   3492 C  CA    . SER B 2 195 ? 11.031  24.654 67.758  1.00 23.90 ? 301 SER B CA    1 
ATOM   3493 C  C     . SER B 2 195 ? 11.257  23.218 67.289  1.00 24.80 ? 301 SER B C     1 
ATOM   3494 O  O     . SER B 2 195 ? 12.376  22.836 67.014  1.00 24.06 ? 301 SER B O     1 
ATOM   3495 C  CB    . SER B 2 195 ? 10.954  24.635 69.261  1.00 23.67 ? 301 SER B CB    1 
ATOM   3496 O  OG    . SER B 2 195 ? 10.617  25.903 69.812  1.00 25.63 ? 301 SER B OG    1 
ATOM   3497 N  N     . LEU B 2 196 ? 10.208  22.403 67.210  1.00 26.25 ? 302 LEU B N     1 
ATOM   3498 C  CA    . LEU B 2 196 ? 10.354  21.037 66.655  1.00 26.67 ? 302 LEU B CA    1 
ATOM   3499 C  C     . LEU B 2 196 ? 10.632  21.003 65.141  1.00 27.27 ? 302 LEU B C     1 
ATOM   3500 O  O     . LEU B 2 196 ? 11.272  20.045 64.631  1.00 27.80 ? 302 LEU B O     1 
ATOM   3501 C  CB    . LEU B 2 196 ? 9.109   20.207 66.924  1.00 26.29 ? 302 LEU B CB    1 
ATOM   3502 C  CG    . LEU B 2 196 ? 8.821   19.941 68.394  1.00 26.78 ? 302 LEU B CG    1 
ATOM   3503 C  CD1   . LEU B 2 196 ? 7.498   19.250 68.511  1.00 26.94 ? 302 LEU B CD1   1 
ATOM   3504 C  CD2   . LEU B 2 196 ? 9.912   19.114 69.038  1.00 25.10 ? 302 LEU B CD2   1 
ATOM   3505 N  N     . LYS B 2 197 ? 10.149  22.024 64.424  1.00 27.42 ? 303 LYS B N     1 
ATOM   3506 C  CA    . LYS B 2 197 ? 10.265  22.057 62.962  1.00 27.54 ? 303 LYS B CA    1 
ATOM   3507 C  C     . LYS B 2 197 ? 11.623  22.591 62.497  1.00 27.10 ? 303 LYS B C     1 
ATOM   3508 O  O     . LYS B 2 197 ? 12.256  21.973 61.661  1.00 28.05 ? 303 LYS B O     1 
ATOM   3509 C  CB    . LYS B 2 197 ? 9.144   22.890 62.341  1.00 27.64 ? 303 LYS B CB    1 
ATOM   3510 C  CG    . LYS B 2 197 ? 7.810   22.170 62.278  1.00 28.15 ? 303 LYS B CG    1 
ATOM   3511 C  CD    . LYS B 2 197 ? 6.778   22.932 61.438  1.00 27.20 ? 303 LYS B CD    1 
ATOM   3512 C  CE    . LYS B 2 197 ? 6.045   23.927 62.295  1.00 27.22 ? 303 LYS B CE    1 
ATOM   3513 N  NZ    . LYS B 2 197 ? 5.033   24.671 61.511  1.00 29.84 ? 303 LYS B NZ    1 
ATOM   3514 N  N     . THR B 2 198 ? 12.066  23.723 63.031  1.00 25.90 ? 304 THR B N     1 
ATOM   3515 C  CA    . THR B 2 198 ? 13.342  24.288 62.627  1.00 25.00 ? 304 THR B CA    1 
ATOM   3516 C  C     . THR B 2 198 ? 14.287  24.686 63.767  1.00 24.62 ? 304 THR B C     1 
ATOM   3517 O  O     . THR B 2 198 ? 15.258  25.373 63.518  1.00 24.37 ? 304 THR B O     1 
ATOM   3518 C  CB    . THR B 2 198 ? 13.115  25.506 61.704  1.00 25.13 ? 304 THR B CB    1 
ATOM   3519 O  OG1   . THR B 2 198 ? 12.124  26.349 62.270  1.00 22.65 ? 304 THR B OG1   1 
ATOM   3520 C  CG2   . THR B 2 198 ? 12.584  25.092 60.344  1.00 24.01 ? 304 THR B CG2   1 
ATOM   3521 N  N     . ARG B 2 199 ? 14.039  24.219 64.986  1.00 24.17 ? 305 ARG B N     1 
ATOM   3522 C  CA    . ARG B 2 199 ? 14.878  24.513 66.139  1.00 23.94 ? 305 ARG B CA    1 
ATOM   3523 C  C     . ARG B 2 199 ? 14.803  25.973 66.536  1.00 23.43 ? 305 ARG B C     1 
ATOM   3524 O  O     . ARG B 2 199 ? 15.684  26.510 67.176  1.00 23.41 ? 305 ARG B O     1 
ATOM   3525 C  CB    . ARG B 2 199 ? 16.340  24.083 65.902  1.00 24.15 ? 305 ARG B CB    1 
ATOM   3526 C  CG    . ARG B 2 199 ? 16.533  22.581 65.719  1.00 26.38 ? 305 ARG B CG    1 
ATOM   3527 C  CD    . ARG B 2 199 ? 17.887  21.964 66.286  1.00 30.59 ? 305 ARG B CD    1 
ATOM   3528 N  NE    . ARG B 2 199 ? 17.606  20.685 66.987  1.00 32.78 ? 305 ARG B NE    1 
ATOM   3529 C  CZ    . ARG B 2 199 ? 18.096  20.292 68.172  1.00 31.73 ? 305 ARG B CZ    1 
ATOM   3530 N  NH1   . ARG B 2 199 ? 18.979  21.032 68.854  1.00 32.75 ? 305 ARG B NH1   1 
ATOM   3531 N  NH2   . ARG B 2 199 ? 17.710  19.119 68.668  1.00 32.01 ? 305 ARG B NH2   1 
ATOM   3532 N  N     . THR B 2 200 ? 13.730  26.637 66.171  1.00 24.16 ? 306 THR B N     1 
ATOM   3533 C  CA    . THR B 2 200 ? 13.612  28.069 66.446  1.00 23.97 ? 306 THR B CA    1 
ATOM   3534 C  C     . THR B 2 200 ? 13.022  28.241 67.792  1.00 23.71 ? 306 THR B C     1 
ATOM   3535 O  O     . THR B 2 200 ? 12.035  27.582 68.091  1.00 24.11 ? 306 THR B O     1 
ATOM   3536 C  CB    . THR B 2 200 ? 12.707  28.752 65.447  1.00 23.58 ? 306 THR B CB    1 
ATOM   3537 O  OG1   . THR B 2 200 ? 13.306  28.667 64.152  1.00 22.72 ? 306 THR B OG1   1 
ATOM   3538 C  CG2   . THR B 2 200 ? 12.661  30.235 65.748  1.00 23.07 ? 306 THR B CG2   1 
ATOM   3539 N  N     . PHE B 2 201 ? 13.629  29.119 68.585  1.00 23.83 ? 307 PHE B N     1 
ATOM   3540 C  CA    . PHE B 2 201 ? 13.140  29.472 69.919  1.00 24.37 ? 307 PHE B CA    1 
ATOM   3541 C  C     . PHE B 2 201 ? 13.071  30.969 70.039  1.00 24.40 ? 307 PHE B C     1 
ATOM   3542 O  O     . PHE B 2 201 ? 13.783  31.714 69.342  1.00 25.44 ? 307 PHE B O     1 
ATOM   3543 C  CB    . PHE B 2 201 ? 14.053  28.951 71.006  1.00 24.70 ? 307 PHE B CB    1 
ATOM   3544 C  CG    . PHE B 2 201 ? 13.991  27.471 71.184  1.00 24.29 ? 307 PHE B CG    1 
ATOM   3545 C  CD1   . PHE B 2 201 ? 13.344  26.920 72.254  1.00 24.11 ? 307 PHE B CD1   1 
ATOM   3546 C  CD2   . PHE B 2 201 ? 14.621  26.618 70.291  1.00 23.93 ? 307 PHE B CD2   1 
ATOM   3547 C  CE1   . PHE B 2 201 ? 13.326  25.510 72.424  1.00 23.68 ? 307 PHE B CE1   1 
ATOM   3548 C  CE2   . PHE B 2 201 ? 14.550  25.213 70.450  1.00 22.04 ? 307 PHE B CE2   1 
ATOM   3549 C  CZ    . PHE B 2 201 ? 13.916  24.684 71.514  1.00 20.64 ? 307 PHE B CZ    1 
ATOM   3550 N  N     . SER B 2 202 ? 12.214  31.419 70.931  1.00 23.74 ? 308 SER B N     1 
ATOM   3551 C  CA    . SER B 2 202 ? 11.933  32.832 71.031  1.00 23.36 ? 308 SER B CA    1 
ATOM   3552 C  C     . SER B 2 202 ? 11.080  33.089 72.237  1.00 23.52 ? 308 SER B C     1 
ATOM   3553 O  O     . SER B 2 202 ? 10.554  32.169 72.867  1.00 23.66 ? 308 SER B O     1 
ATOM   3554 C  CB    . SER B 2 202 ? 11.195  33.303 69.797  1.00 23.16 ? 308 SER B CB    1 
ATOM   3555 O  OG    . SER B 2 202 ? 10.098  32.455 69.509  1.00 23.13 ? 308 SER B OG    1 
ATOM   3556 N  N     . HIS B 2 203 ? 10.966  34.367 72.561  1.00 23.47 ? 309 HIS B N     1 
ATOM   3557 C  CA    . HIS B 2 203 ? 10.022  34.840 73.559  1.00 23.20 ? 309 HIS B CA    1 
ATOM   3558 C  C     . HIS B 2 203 ? 8.626   34.195 73.428  1.00 23.12 ? 309 HIS B C     1 
ATOM   3559 O  O     . HIS B 2 203 ? 7.961   33.903 74.421  1.00 22.47 ? 309 HIS B O     1 
ATOM   3560 C  CB    . HIS B 2 203 ? 9.889   36.323 73.396  1.00 22.77 ? 309 HIS B CB    1 
ATOM   3561 C  CG    . HIS B 2 203 ? 11.055  37.107 73.889  1.00 24.23 ? 309 HIS B CG    1 
ATOM   3562 N  ND1   . HIS B 2 203 ? 11.423  37.146 75.216  1.00 25.92 ? 309 HIS B ND1   1 
ATOM   3563 C  CD2   . HIS B 2 203 ? 11.887  37.958 73.245  1.00 26.41 ? 309 HIS B CD2   1 
ATOM   3564 C  CE1   . HIS B 2 203 ? 12.434  37.983 75.370  1.00 25.61 ? 309 HIS B CE1   1 
ATOM   3565 N  NE2   . HIS B 2 203 ? 12.735  38.490 74.189  1.00 26.80 ? 309 HIS B NE2   1 
ATOM   3566 N  N     . ALA B 2 204 ? 8.192   34.004 72.188  1.00 23.72 ? 310 ALA B N     1 
ATOM   3567 C  CA    . ALA B 2 204 ? 6.907   33.425 71.912  1.00 24.51 ? 310 ALA B CA    1 
ATOM   3568 C  C     . ALA B 2 204 ? 6.985   31.946 72.113  1.00 25.22 ? 310 ALA B C     1 
ATOM   3569 O  O     . ALA B 2 204 ? 6.046   31.371 72.607  1.00 25.36 ? 310 ALA B O     1 
ATOM   3570 C  CB    . ALA B 2 204 ? 6.448   33.728 70.508  1.00 24.66 ? 310 ALA B CB    1 
ATOM   3571 N  N     . SER B 2 205 ? 8.092   31.307 71.744  1.00 26.19 ? 311 SER B N     1 
ATOM   3572 C  CA    . SER B 2 205 ? 8.216   29.876 72.070  1.00 26.45 ? 311 SER B CA    1 
ATOM   3573 C  C     . SER B 2 205 ? 8.342   29.641 73.539  1.00 26.40 ? 311 SER B C     1 
ATOM   3574 O  O     . SER B 2 205 ? 7.953   28.606 73.967  1.00 27.42 ? 311 SER B O     1 
ATOM   3575 C  CB    . SER B 2 205 ? 9.370   29.203 71.396  1.00 26.03 ? 311 SER B CB    1 
ATOM   3576 O  OG    . SER B 2 205 ? 10.456  29.338 72.217  1.00 27.74 ? 311 SER B OG    1 
ATOM   3577 N  N     . ASP B 2 206 ? 8.840   30.598 74.312  1.00 27.02 ? 312 ASP B N     1 
ATOM   3578 C  CA    . ASP B 2 206 ? 8.937   30.464 75.770  1.00 27.57 ? 312 ASP B CA    1 
ATOM   3579 C  C     . ASP B 2 206 ? 7.555   30.478 76.396  1.00 28.05 ? 312 ASP B C     1 
ATOM   3580 O  O     . ASP B 2 206 ? 7.281   29.766 77.356  1.00 29.10 ? 312 ASP B O     1 
ATOM   3581 C  CB    . ASP B 2 206 ? 9.666   31.658 76.367  1.00 27.82 ? 312 ASP B CB    1 
ATOM   3582 C  CG    . ASP B 2 206 ? 11.165  31.418 76.604  1.00 28.39 ? 312 ASP B CG    1 
ATOM   3583 O  OD1   . ASP B 2 206 ? 11.745  30.388 76.152  1.00 25.69 ? 312 ASP B OD1   1 
ATOM   3584 O  OD2   . ASP B 2 206 ? 11.818  32.296 77.226  1.00 25.36 ? 312 ASP B OD2   1 
ATOM   3585 N  N     . THR B 2 207 ? 6.713   31.362 75.881  1.00 27.64 ? 313 THR B N     1 
ATOM   3586 C  CA    . THR B 2 207 ? 5.308   31.438 76.229  1.00 26.92 ? 313 THR B CA    1 
ATOM   3587 C  C     . THR B 2 207 ? 4.627   30.121 75.992  1.00 26.45 ? 313 THR B C     1 
ATOM   3588 O  O     . THR B 2 207 ? 3.818   29.668 76.806  1.00 26.42 ? 313 THR B O     1 
ATOM   3589 C  CB    . THR B 2 207 ? 4.652   32.466 75.320  1.00 27.04 ? 313 THR B CB    1 
ATOM   3590 O  OG1   . THR B 2 207 ? 4.902   33.778 75.822  1.00 27.79 ? 313 THR B OG1   1 
ATOM   3591 C  CG2   . THR B 2 207 ? 3.159   32.362 75.342  1.00 27.88 ? 313 THR B CG2   1 
ATOM   3592 N  N     . TRP B 2 208 ? 4.926   29.519 74.849  1.00 26.05 ? 314 TRP B N     1 
ATOM   3593 C  CA    . TRP B 2 208 ? 4.359   28.227 74.515  1.00 26.10 ? 314 TRP B CA    1 
ATOM   3594 C  C     . TRP B 2 208 ? 4.724   27.196 75.606  1.00 25.68 ? 314 TRP B C     1 
ATOM   3595 O  O     . TRP B 2 208 ? 3.847   26.507 76.111  1.00 24.58 ? 314 TRP B O     1 
ATOM   3596 C  CB    . TRP B 2 208 ? 4.743   27.783 73.086  1.00 26.11 ? 314 TRP B CB    1 
ATOM   3597 C  CG    . TRP B 2 208 ? 4.246   26.408 72.772  1.00 27.83 ? 314 TRP B CG    1 
ATOM   3598 C  CD1   . TRP B 2 208 ? 4.654   25.262 73.377  1.00 29.41 ? 314 TRP B CD1   1 
ATOM   3599 C  CD2   . TRP B 2 208 ? 3.212   26.016 71.822  1.00 26.89 ? 314 TRP B CD2   1 
ATOM   3600 N  NE1   . TRP B 2 208 ? 3.964   24.188 72.865  1.00 30.80 ? 314 TRP B NE1   1 
ATOM   3601 C  CE2   . TRP B 2 208 ? 3.069   24.617 71.917  1.00 26.57 ? 314 TRP B CE2   1 
ATOM   3602 C  CE3   . TRP B 2 208 ? 2.425   26.699 70.890  1.00 26.29 ? 314 TRP B CE3   1 
ATOM   3603 C  CZ2   . TRP B 2 208 ? 2.174   23.889 71.128  1.00 22.69 ? 314 TRP B CZ2   1 
ATOM   3604 C  CZ3   . TRP B 2 208 ? 1.536   25.970 70.098  1.00 24.71 ? 314 TRP B CZ3   1 
ATOM   3605 C  CH2   . TRP B 2 208 ? 1.425   24.576 70.232  1.00 23.36 ? 314 TRP B CH2   1 
ATOM   3606 N  N     . MET B 2 209 ? 5.990   27.141 76.005  1.00 25.91 ? 315 MET B N     1 
ATOM   3607 C  CA    . MET B 2 209 ? 6.401   26.206 77.047  1.00 26.66 ? 315 MET B CA    1 
ATOM   3608 C  C     . MET B 2 209 ? 5.849   26.606 78.433  1.00 27.62 ? 315 MET B C     1 
ATOM   3609 O  O     . MET B 2 209 ? 5.705   25.747 79.343  1.00 28.03 ? 315 MET B O     1 
ATOM   3610 C  CB    . MET B 2 209 ? 7.912   26.090 77.139  1.00 27.11 ? 315 MET B CB    1 
ATOM   3611 C  CG    . MET B 2 209 ? 8.713   26.090 75.819  1.00 27.02 ? 315 MET B CG    1 
ATOM   3612 S  SD    . MET B 2 209 ? 10.499  25.761 76.079  1.00 26.76 ? 315 MET B SD    1 
ATOM   3613 C  CE    . MET B 2 209 ? 10.565  23.935 76.125  1.00 23.13 ? 315 MET B CE    1 
ATOM   3614 N  N     . PHE B 2 210 ? 5.536   27.894 78.606  1.00 27.68 ? 316 PHE B N     1 
ATOM   3615 C  CA    . PHE B 2 210 ? 4.853   28.347 79.811  1.00 27.82 ? 316 PHE B CA    1 
ATOM   3616 C  C     . PHE B 2 210 ? 3.391   27.869 79.859  1.00 28.04 ? 316 PHE B C     1 
ATOM   3617 O  O     . PHE B 2 210 ? 2.847   27.686 80.942  1.00 28.35 ? 316 PHE B O     1 
ATOM   3618 C  CB    . PHE B 2 210 ? 4.920   29.865 79.942  1.00 28.01 ? 316 PHE B CB    1 
ATOM   3619 C  CG    . PHE B 2 210 ? 4.060   30.399 81.028  1.00 28.47 ? 316 PHE B CG    1 
ATOM   3620 C  CD1   . PHE B 2 210 ? 4.437   30.244 82.361  1.00 29.28 ? 316 PHE B CD1   1 
ATOM   3621 C  CD2   . PHE B 2 210 ? 2.859   31.010 80.732  1.00 30.17 ? 316 PHE B CD2   1 
ATOM   3622 C  CE1   . PHE B 2 210 ? 3.640   30.705 83.394  1.00 29.44 ? 316 PHE B CE1   1 
ATOM   3623 C  CE2   . PHE B 2 210 ? 2.017   31.472 81.767  1.00 31.75 ? 316 PHE B CE2   1 
ATOM   3624 C  CZ    . PHE B 2 210 ? 2.429   31.329 83.111  1.00 30.97 ? 316 PHE B CZ    1 
ATOM   3625 N  N     . GLY B 2 211 ? 2.755   27.662 78.702  1.00 27.99 ? 317 GLY B N     1 
ATOM   3626 C  CA    . GLY B 2 211 ? 1.430   27.051 78.666  1.00 27.82 ? 317 GLY B CA    1 
ATOM   3627 C  C     . GLY B 2 211 ? 1.421   25.585 79.119  1.00 27.66 ? 317 GLY B C     1 
ATOM   3628 O  O     . GLY B 2 211 ? 0.554   25.142 79.912  1.00 26.43 ? 317 GLY B O     1 
ATOM   3629 N  N     . VAL B 2 212 ? 2.395   24.830 78.601  1.00 27.47 ? 318 VAL B N     1 
ATOM   3630 C  CA    . VAL B 2 212 ? 2.627   23.435 79.010  1.00 27.21 ? 318 VAL B CA    1 
ATOM   3631 C  C     . VAL B 2 212 ? 2.936   23.329 80.507  1.00 27.91 ? 318 VAL B C     1 
ATOM   3632 O  O     . VAL B 2 212 ? 2.611   22.311 81.124  1.00 27.95 ? 318 VAL B O     1 
ATOM   3633 C  CB    . VAL B 2 212 ? 3.783   22.791 78.207  1.00 26.47 ? 318 VAL B CB    1 
ATOM   3634 C  CG1   . VAL B 2 212 ? 4.017   21.350 78.610  1.00 25.19 ? 318 VAL B CG1   1 
ATOM   3635 C  CG2   . VAL B 2 212 ? 3.496   22.879 76.709  1.00 26.19 ? 318 VAL B CG2   1 
ATOM   3636 N  N     . THR B 2 213 ? 3.558   24.375 81.074  1.00 28.20 ? 319 THR B N     1 
ATOM   3637 C  CA    . THR B 2 213 ? 3.980   24.378 82.479  1.00 28.11 ? 319 THR B CA    1 
ATOM   3638 C  C     . THR B 2 213 ? 2.773   24.587 83.386  1.00 27.70 ? 319 THR B C     1 
ATOM   3639 O  O     . THR B 2 213 ? 2.686   23.981 84.452  1.00 27.39 ? 319 THR B O     1 
ATOM   3640 C  CB    . THR B 2 213 ? 5.072   25.480 82.737  1.00 28.57 ? 319 THR B CB    1 
ATOM   3641 O  OG1   . THR B 2 213 ? 6.293   25.164 82.043  1.00 28.75 ? 319 THR B OG1   1 
ATOM   3642 C  CG2   . THR B 2 213 ? 5.500   25.525 84.206  1.00 27.70 ? 319 THR B CG2   1 
ATOM   3643 N  N     . LEU B 2 214 ? 1.843   25.435 82.966  1.00 27.68 ? 320 LEU B N     1 
ATOM   3644 C  CA    . LEU B 2 214 ? 0.553   25.553 83.670  1.00 28.13 ? 320 LEU B CA    1 
ATOM   3645 C  C     . LEU B 2 214 ? -0.246  24.254 83.660  1.00 27.83 ? 320 LEU B C     1 
ATOM   3646 O  O     . LEU B 2 214 ? -0.766  23.855 84.704  1.00 28.91 ? 320 LEU B O     1 
ATOM   3647 C  CB    . LEU B 2 214 ? -0.318  26.686 83.115  1.00 28.23 ? 320 LEU B CB    1 
ATOM   3648 C  CG    . LEU B 2 214 ? 0.277   28.102 83.238  1.00 29.49 ? 320 LEU B CG    1 
ATOM   3649 C  CD1   . LEU B 2 214 ? -0.575  29.144 82.515  1.00 30.37 ? 320 LEU B CD1   1 
ATOM   3650 C  CD2   . LEU B 2 214 ? 0.490   28.506 84.689  1.00 29.91 ? 320 LEU B CD2   1 
ATOM   3651 N  N     . TRP B 2 215 ? -0.319  23.581 82.519  1.00 27.04 ? 321 TRP B N     1 
ATOM   3652 C  CA    . TRP B 2 215 ? -1.033  22.305 82.416  1.00 26.93 ? 321 TRP B CA    1 
ATOM   3653 C  C     . TRP B 2 215 ? -0.486  21.304 83.418  1.00 26.76 ? 321 TRP B C     1 
ATOM   3654 O  O     . TRP B 2 215 ? -1.229  20.659 84.153  1.00 25.98 ? 321 TRP B O     1 
ATOM   3655 C  CB    . TRP B 2 215 ? -0.886  21.757 81.001  1.00 27.29 ? 321 TRP B CB    1 
ATOM   3656 C  CG    . TRP B 2 215 ? -1.683  20.549 80.709  1.00 27.77 ? 321 TRP B CG    1 
ATOM   3657 C  CD1   . TRP B 2 215 ? -2.997  20.502 80.347  1.00 29.41 ? 321 TRP B CD1   1 
ATOM   3658 C  CD2   . TRP B 2 215 ? -1.219  19.197 80.707  1.00 28.57 ? 321 TRP B CD2   1 
ATOM   3659 N  NE1   . TRP B 2 215 ? -3.385  19.200 80.134  1.00 28.77 ? 321 TRP B NE1   1 
ATOM   3660 C  CE2   . TRP B 2 215 ? -2.315  18.376 80.354  1.00 27.37 ? 321 TRP B CE2   1 
ATOM   3661 C  CE3   . TRP B 2 215 ? 0.013   18.589 80.976  1.00 28.86 ? 321 TRP B CE3   1 
ATOM   3662 C  CZ2   . TRP B 2 215 ? -2.225  16.990 80.276  1.00 27.04 ? 321 TRP B CZ2   1 
ATOM   3663 C  CZ3   . TRP B 2 215 ? 0.103   17.195 80.891  1.00 29.36 ? 321 TRP B CZ3   1 
ATOM   3664 C  CH2   . TRP B 2 215 ? -1.018  16.416 80.547  1.00 27.96 ? 321 TRP B CH2   1 
ATOM   3665 N  N     . GLU B 2 216 ? 0.837   21.207 83.464  1.00 26.83 ? 322 GLU B N     1 
ATOM   3666 C  CA    . GLU B 2 216 ? 1.512   20.397 84.481  1.00 26.83 ? 322 GLU B CA    1 
ATOM   3667 C  C     . GLU B 2 216 ? 1.083   20.774 85.919  1.00 26.86 ? 322 GLU B C     1 
ATOM   3668 O  O     . GLU B 2 216 ? 0.670   19.924 86.720  1.00 26.76 ? 322 GLU B O     1 
ATOM   3669 C  CB    . GLU B 2 216 ? 3.009   20.553 84.343  1.00 26.27 ? 322 GLU B CB    1 
ATOM   3670 C  CG    . GLU B 2 216 ? 3.603   19.734 83.220  1.00 26.78 ? 322 GLU B CG    1 
ATOM   3671 C  CD    . GLU B 2 216 ? 5.028   19.321 83.533  1.00 28.20 ? 322 GLU B CD    1 
ATOM   3672 O  OE1   . GLU B 2 216 ? 5.938   20.110 83.136  1.00 26.19 ? 322 GLU B OE1   1 
ATOM   3673 O  OE2   . GLU B 2 216 ? 5.207   18.241 84.210  1.00 26.44 ? 322 GLU B OE2   1 
ATOM   3674 N  N     . MET B 2 217 ? 1.190   22.057 86.227  1.00 26.29 ? 323 MET B N     1 
ATOM   3675 C  CA    . MET B 2 217 ? 0.755   22.573 87.494  1.00 25.77 ? 323 MET B CA    1 
ATOM   3676 C  C     . MET B 2 217 ? -0.685  22.118 87.829  1.00 25.46 ? 323 MET B C     1 
ATOM   3677 O  O     . MET B 2 217 ? -0.972  21.684 88.951  1.00 24.04 ? 323 MET B O     1 
ATOM   3678 C  CB    . MET B 2 217 ? 0.838   24.097 87.447  1.00 26.03 ? 323 MET B CB    1 
ATOM   3679 C  CG    . MET B 2 217 ? 2.189   24.655 87.741  1.00 26.82 ? 323 MET B CG    1 
ATOM   3680 S  SD    . MET B 2 217 ? 2.337   26.412 87.298  1.00 29.19 ? 323 MET B SD    1 
ATOM   3681 C  CE    . MET B 2 217 ? 1.616   27.140 88.687  1.00 28.71 ? 323 MET B CE    1 
ATOM   3682 N  N     . PHE B 2 218 ? -1.585  22.200 86.850  1.00 25.41 ? 324 PHE B N     1 
ATOM   3683 C  CA    . PHE B 2 218 ? -3.023  22.044 87.141  1.00 25.43 ? 324 PHE B CA    1 
ATOM   3684 C  C     . PHE B 2 218 ? -3.543  20.617 87.044  1.00 25.83 ? 324 PHE B C     1 
ATOM   3685 O  O     . PHE B 2 218 ? -4.553  20.302 87.674  1.00 26.17 ? 324 PHE B O     1 
ATOM   3686 C  CB    . PHE B 2 218 ? -3.870  22.961 86.268  1.00 24.99 ? 324 PHE B CB    1 
ATOM   3687 C  CG    . PHE B 2 218 ? -3.935  24.334 86.772  1.00 22.92 ? 324 PHE B CG    1 
ATOM   3688 C  CD1   . PHE B 2 218 ? -4.902  24.701 87.653  1.00 22.52 ? 324 PHE B CD1   1 
ATOM   3689 C  CD2   . PHE B 2 218 ? -2.997  25.252 86.396  1.00 22.29 ? 324 PHE B CD2   1 
ATOM   3690 C  CE1   . PHE B 2 218 ? -4.951  25.980 88.137  1.00 22.98 ? 324 PHE B CE1   1 
ATOM   3691 C  CE2   . PHE B 2 218 ? -3.043  26.530 86.862  1.00 22.34 ? 324 PHE B CE2   1 
ATOM   3692 C  CZ    . PHE B 2 218 ? -4.024  26.900 87.735  1.00 22.15 ? 324 PHE B CZ    1 
ATOM   3693 N  N     . THR B 2 219 ? -2.869  19.765 86.270  1.00 26.32 ? 325 THR B N     1 
ATOM   3694 C  CA    . THR B 2 219 ? -3.128  18.329 86.319  1.00 26.74 ? 325 THR B CA    1 
ATOM   3695 C  C     . THR B 2 219 ? -2.415  17.723 87.511  1.00 27.25 ? 325 THR B C     1 
ATOM   3696 O  O     . THR B 2 219 ? -2.590  16.548 87.784  1.00 27.89 ? 325 THR B O     1 
ATOM   3697 C  CB    . THR B 2 219 ? -2.677  17.577 85.047  1.00 26.97 ? 325 THR B CB    1 
ATOM   3698 O  OG1   . THR B 2 219 ? -1.245  17.603 84.926  1.00 27.08 ? 325 THR B OG1   1 
ATOM   3699 C  CG2   . THR B 2 219 ? -3.208  18.234 83.773  1.00 26.85 ? 325 THR B CG2   1 
ATOM   3700 N  N     . TYR B 2 220 ? -1.622  18.530 88.222  1.00 27.66 ? 326 TYR B N     1 
ATOM   3701 C  CA    . TYR B 2 220 ? -0.847  18.087 89.381  1.00 27.39 ? 326 TYR B CA    1 
ATOM   3702 C  C     . TYR B 2 220 ? 0.171   17.015 88.964  1.00 27.05 ? 326 TYR B C     1 
ATOM   3703 O  O     . TYR B 2 220 ? 0.226   15.911 89.522  1.00 26.87 ? 326 TYR B O     1 
ATOM   3704 C  CB    . TYR B 2 220 ? -1.755  17.608 90.521  1.00 27.15 ? 326 TYR B CB    1 
ATOM   3705 C  CG    . TYR B 2 220 ? -2.883  18.560 90.902  1.00 27.83 ? 326 TYR B CG    1 
ATOM   3706 C  CD1   . TYR B 2 220 ? -2.719  19.528 91.903  1.00 27.82 ? 326 TYR B CD1   1 
ATOM   3707 C  CD2   . TYR B 2 220 ? -4.135  18.458 90.310  1.00 28.87 ? 326 TYR B CD2   1 
ATOM   3708 C  CE1   . TYR B 2 220 ? -3.774  20.387 92.285  1.00 26.55 ? 326 TYR B CE1   1 
ATOM   3709 C  CE2   . TYR B 2 220 ? -5.202  19.315 90.698  1.00 29.65 ? 326 TYR B CE2   1 
ATOM   3710 C  CZ    . TYR B 2 220 ? -5.006  20.279 91.681  1.00 27.75 ? 326 TYR B CZ    1 
ATOM   3711 O  OH    . TYR B 2 220 ? -6.058  21.117 92.016  1.00 24.97 ? 326 TYR B OH    1 
ATOM   3712 N  N     . GLY B 2 221 ? 0.922   17.358 87.922  1.00 26.92 ? 327 GLY B N     1 
ATOM   3713 C  CA    . GLY B 2 221 ? 2.197   16.731 87.612  1.00 27.14 ? 327 GLY B CA    1 
ATOM   3714 C  C     . GLY B 2 221 ? 2.190   15.641 86.569  1.00 27.10 ? 327 GLY B C     1 
ATOM   3715 O  O     . GLY B 2 221 ? 3.059   14.792 86.563  1.00 26.97 ? 327 GLY B O     1 
ATOM   3716 N  N     . GLN B 2 222 ? 1.209   15.668 85.682  1.00 27.69 ? 328 GLN B N     1 
ATOM   3717 C  CA    . GLN B 2 222 ? 1.031   14.597 84.712  1.00 27.96 ? 328 GLN B CA    1 
ATOM   3718 C  C     . GLN B 2 222 ? 1.997   14.877 83.604  1.00 28.25 ? 328 GLN B C     1 
ATOM   3719 O  O     . GLN B 2 222 ? 2.503   16.005 83.495  1.00 28.99 ? 328 GLN B O     1 
ATOM   3720 C  CB    . GLN B 2 222 ? -0.397  14.578 84.194  1.00 27.99 ? 328 GLN B CB    1 
ATOM   3721 C  CG    . GLN B 2 222 ? -1.431  14.233 85.258  0.01 27.92 ? 328 GLN B CG    1 
ATOM   3722 C  CD    . GLN B 2 222 ? -2.767  13.807 84.672  0.01 27.83 ? 328 GLN B CD    1 
ATOM   3723 O  OE1   . GLN B 2 222 ? -3.452  12.956 85.238  0.01 27.78 ? 328 GLN B OE1   1 
ATOM   3724 N  NE2   . GLN B 2 222 ? -3.141  14.398 83.542  0.01 27.76 ? 328 GLN B NE2   1 
ATOM   3725 N  N     . GLU B 2 223 ? 2.287   13.882 82.782  1.00 28.18 ? 329 GLU B N     1 
ATOM   3726 C  CA    . GLU B 2 223 ? 3.322   14.073 81.758  1.00 28.21 ? 329 GLU B CA    1 
ATOM   3727 C  C     . GLU B 2 223 ? 2.697   14.342 80.383  1.00 27.06 ? 329 GLU B C     1 
ATOM   3728 O  O     . GLU B 2 223 ? 2.103   13.465 79.823  1.00 26.88 ? 329 GLU B O     1 
ATOM   3729 C  CB    . GLU B 2 223 ? 4.258   12.849 81.728  1.00 28.71 ? 329 GLU B CB    1 
ATOM   3730 C  CG    . GLU B 2 223 ? 5.693   13.171 81.308  1.00 30.73 ? 329 GLU B CG    1 
ATOM   3731 C  CD    . GLU B 2 223 ? 6.344   12.044 80.512  1.00 32.73 ? 329 GLU B CD    1 
ATOM   3732 O  OE1   . GLU B 2 223 ? 6.438   10.906 81.038  1.00 32.73 ? 329 GLU B OE1   1 
ATOM   3733 O  OE2   . GLU B 2 223 ? 6.755   12.312 79.355  1.00 34.55 ? 329 GLU B OE2   1 
ATOM   3734 N  N     . PRO B 2 224 ? 2.886   15.515 79.801  1.00 26.34 ? 330 PRO B N     1 
ATOM   3735 C  CA    . PRO B 2 224 ? 2.161   15.854 78.583  1.00 25.95 ? 330 PRO B CA    1 
ATOM   3736 C  C     . PRO B 2 224 ? 2.643   14.986 77.436  1.00 25.65 ? 330 PRO B C     1 
ATOM   3737 O  O     . PRO B 2 224 ? 3.823   14.696 77.328  1.00 26.94 ? 330 PRO B O     1 
ATOM   3738 C  CB    . PRO B 2 224 ? 2.535   17.322 78.348  1.00 25.79 ? 330 PRO B CB    1 
ATOM   3739 C  CG    . PRO B 2 224 ? 3.897   17.488 78.972  1.00 25.69 ? 330 PRO B CG    1 
ATOM   3740 C  CD    . PRO B 2 224 ? 3.874   16.558 80.145  1.00 26.85 ? 330 PRO B CD    1 
ATOM   3741 N  N     . TRP B 2 225 ? 1.718   14.573 76.595  1.00 25.04 ? 331 TRP B N     1 
ATOM   3742 C  CA    . TRP B 2 225 ? 1.991   13.706 75.477  1.00 24.04 ? 331 TRP B CA    1 
ATOM   3743 C  C     . TRP B 2 225 ? 2.727   12.428 75.894  1.00 23.14 ? 331 TRP B C     1 
ATOM   3744 O  O     . TRP B 2 225 ? 3.390   11.791 75.086  1.00 21.83 ? 331 TRP B O     1 
ATOM   3745 C  CB    . TRP B 2 225 ? 2.692   14.495 74.399  1.00 24.17 ? 331 TRP B CB    1 
ATOM   3746 C  CG    . TRP B 2 225 ? 1.913   15.749 73.915  1.00 25.25 ? 331 TRP B CG    1 
ATOM   3747 C  CD1   . TRP B 2 225 ? 2.371   17.067 73.864  1.00 25.71 ? 331 TRP B CD1   1 
ATOM   3748 C  CD2   . TRP B 2 225 ? 0.591   15.786 73.363  1.00 26.45 ? 331 TRP B CD2   1 
ATOM   3749 N  NE1   . TRP B 2 225 ? 1.414   17.894 73.325  1.00 24.72 ? 331 TRP B NE1   1 
ATOM   3750 C  CE2   . TRP B 2 225 ? 0.310   17.137 73.008  1.00 26.05 ? 331 TRP B CE2   1 
ATOM   3751 C  CE3   . TRP B 2 225 ? -0.393  14.815 73.111  1.00 25.23 ? 331 TRP B CE3   1 
ATOM   3752 C  CZ2   . TRP B 2 225 ? -0.906  17.514 72.443  1.00 24.35 ? 331 TRP B CZ2   1 
ATOM   3753 C  CZ3   . TRP B 2 225 ? -1.580  15.203 72.539  1.00 23.48 ? 331 TRP B CZ3   1 
ATOM   3754 C  CH2   . TRP B 2 225 ? -1.831  16.532 72.221  1.00 23.48 ? 331 TRP B CH2   1 
ATOM   3755 N  N     . ILE B 2 226 ? 2.529   12.033 77.151  1.00 22.89 ? 332 ILE B N     1 
ATOM   3756 C  CA    . ILE B 2 226 ? 2.954   10.731 77.673  1.00 23.75 ? 332 ILE B CA    1 
ATOM   3757 C  C     . ILE B 2 226 ? 2.909   9.657  76.577  1.00 24.09 ? 332 ILE B C     1 
ATOM   3758 O  O     . ILE B 2 226 ? 1.913   9.505  75.883  1.00 24.92 ? 332 ILE B O     1 
ATOM   3759 C  CB    . ILE B 2 226 ? 2.039   10.337 78.909  1.00 23.85 ? 332 ILE B CB    1 
ATOM   3760 C  CG1   . ILE B 2 226 ? 2.788   9.523  79.949  1.00 24.26 ? 332 ILE B CG1   1 
ATOM   3761 C  CG2   . ILE B 2 226 ? 0.790   9.580  78.498  1.00 23.98 ? 332 ILE B CG2   1 
ATOM   3762 C  CD1   . ILE B 2 226 ? 2.108   9.556  81.301  1.00 25.23 ? 332 ILE B CD1   1 
ATOM   3763 N  N     . GLY B 2 227 ? 3.982   8.914  76.389  1.00 24.61 ? 333 GLY B N     1 
ATOM   3764 C  CA    . GLY B 2 227 ? 3.961   7.834  75.409  1.00 25.21 ? 333 GLY B CA    1 
ATOM   3765 C  C     . GLY B 2 227 ? 4.228   8.167  73.943  1.00 25.37 ? 333 GLY B C     1 
ATOM   3766 O  O     . GLY B 2 227 ? 4.549   7.287  73.161  1.00 25.15 ? 333 GLY B O     1 
ATOM   3767 N  N     . LEU B 2 228 ? 4.125   9.431  73.570  1.00 25.69 ? 334 LEU B N     1 
ATOM   3768 C  CA    . LEU B 2 228 ? 4.357   9.812  72.197  1.00 25.77 ? 334 LEU B CA    1 
ATOM   3769 C  C     . LEU B 2 228 ? 5.765   10.304 71.996  1.00 25.96 ? 334 LEU B C     1 
ATOM   3770 O  O     . LEU B 2 228 ? 6.309   11.042 72.827  1.00 26.63 ? 334 LEU B O     1 
ATOM   3771 C  CB    . LEU B 2 228 ? 3.358   10.872 71.769  1.00 25.86 ? 334 LEU B CB    1 
ATOM   3772 C  CG    . LEU B 2 228 ? 1.920   10.479 72.134  1.00 26.51 ? 334 LEU B CG    1 
ATOM   3773 C  CD1   . LEU B 2 228 ? 0.916   11.444 71.556  1.00 26.15 ? 334 LEU B CD1   1 
ATOM   3774 C  CD2   . LEU B 2 228 ? 1.604   9.043  71.693  1.00 26.87 ? 334 LEU B CD2   1 
ATOM   3775 N  N     . ASN B 2 229 ? 6.360   9.868  70.887  1.00 25.99 ? 335 ASN B N     1 
ATOM   3776 C  CA    . ASN B 2 229 ? 7.611   10.438 70.372  1.00 25.72 ? 335 ASN B CA    1 
ATOM   3777 C  C     . ASN B 2 229 ? 7.404   11.712 69.567  1.00 25.48 ? 335 ASN B C     1 
ATOM   3778 O  O     . ASN B 2 229 ? 6.368   11.929 68.956  1.00 25.85 ? 335 ASN B O     1 
ATOM   3779 C  CB    . ASN B 2 229 ? 8.335   9.443  69.475  1.00 25.56 ? 335 ASN B CB    1 
ATOM   3780 C  CG    . ASN B 2 229 ? 7.417   8.787  68.470  1.00 24.71 ? 335 ASN B CG    1 
ATOM   3781 O  OD1   . ASN B 2 229 ? 7.233   7.560  68.470  1.00 23.28 ? 335 ASN B OD1   1 
ATOM   3782 N  ND2   . ASN B 2 229 ? 6.838   9.596  67.606  1.00 23.06 ? 335 ASN B ND2   1 
ATOM   3783 N  N     . GLY B 2 230 ? 8.440   12.512 69.528  1.00 24.74 ? 336 GLY B N     1 
ATOM   3784 C  CA    . GLY B 2 230 ? 8.455   13.728 68.756  1.00 24.53 ? 336 GLY B CA    1 
ATOM   3785 C  C     . GLY B 2 230 ? 7.753   13.746 67.420  1.00 24.15 ? 336 GLY B C     1 
ATOM   3786 O  O     . GLY B 2 230 ? 7.159   14.743 67.076  1.00 23.50 ? 336 GLY B O     1 
ATOM   3787 N  N     . SER B 2 231 ? 7.833   12.698 66.628  1.00 24.58 ? 337 SER B N     1 
ATOM   3788 C  CA    . SER B 2 231 ? 7.155   12.782 65.330  1.00 25.11 ? 337 SER B CA    1 
ATOM   3789 C  C     . SER B 2 231 ? 5.597   12.726 65.517  1.00 25.86 ? 337 SER B C     1 
ATOM   3790 O  O     . SER B 2 231 ? 4.862   13.523 64.903  1.00 25.45 ? 337 SER B O     1 
ATOM   3791 C  CB    . SER B 2 231 ? 7.716   11.758 64.321  1.00 25.09 ? 337 SER B CB    1 
ATOM   3792 O  OG    . SER B 2 231 ? 8.604   12.383 63.378  1.00 24.06 ? 337 SER B OG    1 
ATOM   3793 N  N     . GLN B 2 232 ? 5.125   11.810 66.389  1.00 26.52 ? 338 GLN B N     1 
ATOM   3794 C  CA    . GLN B 2 232 ? 3.719   11.722 66.857  1.00 26.22 ? 338 GLN B CA    1 
ATOM   3795 C  C     . GLN B 2 232 ? 3.195   13.014 67.462  1.00 26.34 ? 338 GLN B C     1 
ATOM   3796 O  O     . GLN B 2 232 ? 2.060   13.383 67.233  1.00 26.38 ? 338 GLN B O     1 
ATOM   3797 C  CB    . GLN B 2 232 ? 3.580   10.633 67.919  1.00 26.36 ? 338 GLN B CB    1 
ATOM   3798 C  CG    . GLN B 2 232 ? 3.388   9.245  67.340  1.00 26.67 ? 338 GLN B CG    1 
ATOM   3799 C  CD    . GLN B 2 232 ? 3.622   8.136  68.334  1.00 25.60 ? 338 GLN B CD    1 
ATOM   3800 O  OE1   . GLN B 2 232 ? 4.129   8.368  69.410  1.00 23.93 ? 338 GLN B OE1   1 
ATOM   3801 N  NE2   . GLN B 2 232 ? 3.244   6.923  67.966  1.00 27.51 ? 338 GLN B NE2   1 
ATOM   3802 N  N     . ILE B 2 233 ? 4.027   13.697 68.237  1.00 26.42 ? 339 ILE B N     1 
ATOM   3803 C  CA    . ILE B 2 233 ? 3.651   14.973 68.828  1.00 26.24 ? 339 ILE B CA    1 
ATOM   3804 C  C     . ILE B 2 233 ? 3.519   16.017 67.761  1.00 26.63 ? 339 ILE B C     1 
ATOM   3805 O  O     . ILE B 2 233 ? 2.477   16.661 67.647  1.00 26.33 ? 339 ILE B O     1 
ATOM   3806 C  CB    . ILE B 2 233 ? 4.686   15.417 69.853  1.00 25.93 ? 339 ILE B CB    1 
ATOM   3807 C  CG1   . ILE B 2 233 ? 4.732   14.347 70.972  1.00 27.21 ? 339 ILE B CG1   1 
ATOM   3808 C  CG2   . ILE B 2 233 ? 4.362   16.826 70.333  1.00 24.74 ? 339 ILE B CG2   1 
ATOM   3809 C  CD1   . ILE B 2 233 ? 5.563   14.640 72.160  1.00 26.96 ? 339 ILE B CD1   1 
ATOM   3810 N  N     . LEU B 2 234 ? 4.573   16.175 66.961  1.00 27.26 ? 340 LEU B N     1 
ATOM   3811 C  CA    . LEU B 2 234 ? 4.632   17.267 65.966  1.00 27.81 ? 340 LEU B CA    1 
ATOM   3812 C  C     . LEU B 2 234 ? 3.344   17.276 65.094  1.00 27.95 ? 340 LEU B C     1 
ATOM   3813 O  O     . LEU B 2 234 ? 2.741   18.329 64.859  1.00 27.53 ? 340 LEU B O     1 
ATOM   3814 C  CB    . LEU B 2 234 ? 5.927   17.208 65.137  1.00 27.38 ? 340 LEU B CB    1 
ATOM   3815 C  CG    . LEU B 2 234 ? 6.003   18.128 63.919  1.00 27.69 ? 340 LEU B CG    1 
ATOM   3816 C  CD1   . LEU B 2 234 ? 5.810   19.599 64.249  1.00 28.41 ? 340 LEU B CD1   1 
ATOM   3817 C  CD2   . LEU B 2 234 ? 7.320   17.944 63.246  1.00 26.73 ? 340 LEU B CD2   1 
ATOM   3818 N  N     . HIS B 2 235 ? 2.910   16.072 64.724  1.00 28.27 ? 341 HIS B N     1 
ATOM   3819 C  CA    . HIS B 2 235 ? 1.669   15.831 63.999  1.00 28.63 ? 341 HIS B CA    1 
ATOM   3820 C  C     . HIS B 2 235 ? 0.454   16.468 64.674  1.00 29.23 ? 341 HIS B C     1 
ATOM   3821 O  O     . HIS B 2 235 ? -0.319  17.201 64.039  1.00 29.51 ? 341 HIS B O     1 
ATOM   3822 C  CB    . HIS B 2 235 ? 1.436   14.323 63.894  1.00 28.57 ? 341 HIS B CB    1 
ATOM   3823 C  CG    . HIS B 2 235 ? 0.538   13.929 62.772  1.00 28.95 ? 341 HIS B CG    1 
ATOM   3824 N  ND1   . HIS B 2 235 ? 0.920   14.017 61.447  1.00 29.77 ? 341 HIS B ND1   1 
ATOM   3825 C  CD2   . HIS B 2 235 ? -0.722  13.438 62.772  1.00 26.93 ? 341 HIS B CD2   1 
ATOM   3826 C  CE1   . HIS B 2 235 ? -0.073  13.599 60.683  1.00 27.90 ? 341 HIS B CE1   1 
ATOM   3827 N  NE2   . HIS B 2 235 ? -1.076  13.235 61.464  1.00 26.89 ? 341 HIS B NE2   1 
ATOM   3828 N  N     . LYS B 2 236 ? 0.281   16.163 65.962  1.00 29.49 ? 342 LYS B N     1 
ATOM   3829 C  CA    . LYS B 2 236 ? -0.892  16.601 66.719  1.00 29.12 ? 342 LYS B CA    1 
ATOM   3830 C  C     . LYS B 2 236 ? -0.920  18.095 66.736  1.00 29.91 ? 342 LYS B C     1 
ATOM   3831 O  O     . LYS B 2 236 ? -1.903  18.683 66.318  1.00 30.98 ? 342 LYS B O     1 
ATOM   3832 C  CB    . LYS B 2 236 ? -0.888  16.039 68.142  1.00 28.54 ? 342 LYS B CB    1 
ATOM   3833 C  CG    . LYS B 2 236 ? -1.026  14.509 68.170  1.00 28.19 ? 342 LYS B CG    1 
ATOM   3834 C  CD    . LYS B 2 236 ? -1.553  13.952 69.476  1.00 27.89 ? 342 LYS B CD    1 
ATOM   3835 C  CE    . LYS B 2 236 ? -2.289  12.608 69.247  1.00 28.71 ? 342 LYS B CE    1 
ATOM   3836 N  NZ    . LYS B 2 236 ? -3.758  12.605 69.684  1.00 27.73 ? 342 LYS B NZ    1 
ATOM   3837 N  N     . ILE B 2 237 ? 0.191   18.712 67.115  1.00 30.48 ? 343 ILE B N     1 
ATOM   3838 C  CA    . ILE B 2 237 ? 0.213   20.144 67.367  1.00 30.72 ? 343 ILE B CA    1 
ATOM   3839 C  C     . ILE B 2 237 ? 0.286   21.025 66.099  1.00 30.76 ? 343 ILE B C     1 
ATOM   3840 O  O     . ILE B 2 237 ? -0.087  22.211 66.163  1.00 30.63 ? 343 ILE B O     1 
ATOM   3841 C  CB    . ILE B 2 237 ? 1.386   20.481 68.323  1.00 30.97 ? 343 ILE B CB    1 
ATOM   3842 C  CG1   . ILE B 2 237 ? 2.734   20.369 67.631  1.00 32.25 ? 343 ILE B CG1   1 
ATOM   3843 C  CG2   . ILE B 2 237 ? 1.404   19.567 69.505  1.00 30.84 ? 343 ILE B CG2   1 
ATOM   3844 C  CD1   . ILE B 2 237 ? 3.886   21.009 68.469  1.00 33.36 ? 343 ILE B CD1   1 
ATOM   3845 N  N     . ASP B 2 238 ? 0.750   20.445 64.975  1.00 30.64 ? 344 ASP B N     1 
ATOM   3846 C  CA    . ASP B 2 238 ? 1.018   21.166 63.703  1.00 30.30 ? 344 ASP B CA    1 
ATOM   3847 C  C     . ASP B 2 238 ? 0.270   20.616 62.484  1.00 30.56 ? 344 ASP B C     1 
ATOM   3848 O  O     . ASP B 2 238 ? -0.135  21.378 61.608  1.00 30.76 ? 344 ASP B O     1 
ATOM   3849 C  CB    . ASP B 2 238 ? 2.512   21.091 63.371  1.00 30.40 ? 344 ASP B CB    1 
ATOM   3850 C  CG    . ASP B 2 238 ? 2.934   22.123 62.344  1.00 30.01 ? 344 ASP B CG    1 
ATOM   3851 O  OD1   . ASP B 2 238 ? 2.938   23.298 62.709  1.00 32.30 ? 344 ASP B OD1   1 
ATOM   3852 O  OD2   . ASP B 2 238 ? 3.267   21.886 61.173  1.00 26.07 ? 344 ASP B OD2   1 
ATOM   3853 N  N     . LYS B 2 239 ? 0.168   19.292 62.394  1.00 30.51 ? 345 LYS B N     1 
ATOM   3854 C  CA    . LYS B 2 239 ? -0.634  18.624 61.357  1.00 30.51 ? 345 LYS B CA    1 
ATOM   3855 C  C     . LYS B 2 239 ? -2.142  18.572 61.677  1.00 29.72 ? 345 LYS B C     1 
ATOM   3856 O  O     . LYS B 2 239 ? -2.989  18.609 60.772  1.00 30.10 ? 345 LYS B O     1 
ATOM   3857 C  CB    . LYS B 2 239 ? -0.141  17.182 61.133  1.00 30.54 ? 345 LYS B CB    1 
ATOM   3858 C  CG    . LYS B 2 239 ? 0.333   16.889 59.723  1.00 32.02 ? 345 LYS B CG    1 
ATOM   3859 C  CD    . LYS B 2 239 ? 1.852   17.196 59.535  1.00 33.54 ? 345 LYS B CD    1 
ATOM   3860 C  CE    . LYS B 2 239 ? 2.131   18.618 58.977  1.00 34.04 ? 345 LYS B CE    1 
ATOM   3861 N  NZ    . LYS B 2 239 ? 2.831   19.441 60.011  1.00 36.09 ? 345 LYS B NZ    1 
ATOM   3862 N  N     . GLU B 2 240 ? -2.475  18.431 62.947  1.00 28.35 ? 346 GLU B N     1 
ATOM   3863 C  CA    . GLU B 2 240 ? -3.854  18.185 63.324  1.00 27.41 ? 346 GLU B CA    1 
ATOM   3864 C  C     . GLU B 2 240 ? -4.366  19.351 64.175  1.00 26.48 ? 346 GLU B C     1 
ATOM   3865 O  O     . GLU B 2 240 ? -5.559  19.473 64.344  1.00 26.69 ? 346 GLU B O     1 
ATOM   3866 C  CB    . GLU B 2 240 ? -3.992  16.860 64.107  1.00 27.61 ? 346 GLU B CB    1 
ATOM   3867 C  CG    . GLU B 2 240 ? -3.926  15.536 63.318  1.00 27.51 ? 346 GLU B CG    1 
ATOM   3868 C  CD    . GLU B 2 240 ? -4.042  14.262 64.212  1.00 27.73 ? 346 GLU B CD    1 
ATOM   3869 O  OE1   . GLU B 2 240 ? -4.263  14.368 65.445  1.00 27.01 ? 346 GLU B OE1   1 
ATOM   3870 O  OE2   . GLU B 2 240 ? -3.911  13.123 63.695  1.00 26.15 ? 346 GLU B OE2   1 
ATOM   3871 N  N     . GLY B 2 241 ? -3.486  20.200 64.708  1.00 25.29 ? 347 GLY B N     1 
ATOM   3872 C  CA    . GLY B 2 241 ? -3.892  21.315 65.561  1.00 24.37 ? 347 GLY B CA    1 
ATOM   3873 C  C     . GLY B 2 241 ? -4.351  20.970 66.986  1.00 23.70 ? 347 GLY B C     1 
ATOM   3874 O  O     . GLY B 2 241 ? -4.835  21.848 67.716  1.00 22.38 ? 347 GLY B O     1 
ATOM   3875 N  N     . GLU B 2 242 ? -4.207  19.699 67.366  1.00 23.07 ? 348 GLU B N     1 
ATOM   3876 C  CA    . GLU B 2 242 ? -4.529  19.216 68.704  1.00 23.15 ? 348 GLU B CA    1 
ATOM   3877 C  C     . GLU B 2 242 ? -3.715  19.890 69.775  1.00 23.31 ? 348 GLU B C     1 
ATOM   3878 O  O     . GLU B 2 242 ? -2.564  20.233 69.561  1.00 24.27 ? 348 GLU B O     1 
ATOM   3879 C  CB    . GLU B 2 242 ? -4.257  17.718 68.806  1.00 23.06 ? 348 GLU B CB    1 
ATOM   3880 C  CG    . GLU B 2 242 ? -5.107  16.959 69.816  1.00 23.81 ? 348 GLU B CG    1 
ATOM   3881 C  CD    . GLU B 2 242 ? -4.973  15.425 69.687  1.00 25.86 ? 348 GLU B CD    1 
ATOM   3882 O  OE1   . GLU B 2 242 ? -4.746  14.927 68.541  1.00 24.97 ? 348 GLU B OE1   1 
ATOM   3883 O  OE2   . GLU B 2 242 ? -5.110  14.695 70.726  1.00 25.91 ? 348 GLU B OE2   1 
ATOM   3884 N  N     . ARG B 2 243 ? -4.336  20.021 70.942  1.00 23.49 ? 349 ARG B N     1 
ATOM   3885 C  CA    . ARG B 2 243 ? -3.759  20.556 72.160  1.00 22.90 ? 349 ARG B CA    1 
ATOM   3886 C  C     . ARG B 2 243 ? -3.938  19.563 73.374  1.00 23.39 ? 349 ARG B C     1 
ATOM   3887 O  O     . ARG B 2 243 ? -4.542  18.462 73.279  1.00 22.28 ? 349 ARG B O     1 
ATOM   3888 C  CB    . ARG B 2 243 ? -4.442  21.894 72.485  1.00 22.71 ? 349 ARG B CB    1 
ATOM   3889 C  CG    . ARG B 2 243 ? -3.892  23.156 71.847  1.00 21.57 ? 349 ARG B CG    1 
ATOM   3890 C  CD    . ARG B 2 243 ? -2.983  22.917 70.697  1.00 21.61 ? 349 ARG B CD    1 
ATOM   3891 N  NE    . ARG B 2 243 ? -2.398  24.133 70.142  1.00 18.88 ? 349 ARG B NE    1 
ATOM   3892 C  CZ    . ARG B 2 243 ? -1.878  24.196 68.937  1.00 17.26 ? 349 ARG B CZ    1 
ATOM   3893 N  NH1   . ARG B 2 243 ? -1.836  23.125 68.149  1.00 18.30 ? 349 ARG B NH1   1 
ATOM   3894 N  NH2   . ARG B 2 243 ? -1.391  25.337 68.500  1.00 18.49 ? 349 ARG B NH2   1 
ATOM   3895 N  N     . LEU B 2 244 ? -3.373  19.973 74.515  1.00 23.75 ? 350 LEU B N     1 
ATOM   3896 C  CA    . LEU B 2 244 ? -3.466  19.212 75.738  1.00 23.64 ? 350 LEU B CA    1 
ATOM   3897 C  C     . LEU B 2 244 ? -4.802  19.581 76.279  1.00 23.75 ? 350 LEU B C     1 
ATOM   3898 O  O     . LEU B 2 244 ? -5.149  20.766 76.248  1.00 23.79 ? 350 LEU B O     1 
ATOM   3899 C  CB    . LEU B 2 244 ? -2.365  19.582 76.734  1.00 23.63 ? 350 LEU B CB    1 
ATOM   3900 C  CG    . LEU B 2 244 ? -0.934  19.146 76.381  1.00 23.30 ? 350 LEU B CG    1 
ATOM   3901 C  CD1   . LEU B 2 244 ? 0.106   20.045 77.115  1.00 22.35 ? 350 LEU B CD1   1 
ATOM   3902 C  CD2   . LEU B 2 244 ? -0.742  17.675 76.687  1.00 22.16 ? 350 LEU B CD2   1 
ATOM   3903 N  N     . PRO B 2 245 ? -5.533  18.578 76.783  1.00 23.93 ? 351 PRO B N     1 
ATOM   3904 C  CA    . PRO B 2 245 ? -6.941  18.731 77.154  1.00 24.00 ? 351 PRO B CA    1 
ATOM   3905 C  C     . PRO B 2 245 ? -7.022  19.493 78.429  1.00 24.26 ? 351 PRO B C     1 
ATOM   3906 O  O     . PRO B 2 245 ? -6.050  19.403 79.187  1.00 25.39 ? 351 PRO B O     1 
ATOM   3907 C  CB    . PRO B 2 245 ? -7.381  17.295 77.420  1.00 24.13 ? 351 PRO B CB    1 
ATOM   3908 C  CG    . PRO B 2 245 ? -6.128  16.614 77.881  1.00 24.12 ? 351 PRO B CG    1 
ATOM   3909 C  CD    . PRO B 2 245 ? -5.034  17.219 77.089  1.00 23.66 ? 351 PRO B CD    1 
ATOM   3910 N  N     . ARG B 2 246 ? -8.117  20.203 78.684  1.00 23.98 ? 352 ARG B N     1 
ATOM   3911 C  CA    . ARG B 2 246 ? -8.286  20.940 79.931  1.00 23.49 ? 352 ARG B CA    1 
ATOM   3912 C  C     . ARG B 2 246 ? -8.189  20.002 81.107  1.00 23.30 ? 352 ARG B C     1 
ATOM   3913 O  O     . ARG B 2 246 ? -8.831  18.965 81.099  1.00 22.44 ? 352 ARG B O     1 
ATOM   3914 C  CB    . ARG B 2 246 ? -9.620  21.622 79.950  1.00 23.76 ? 352 ARG B CB    1 
ATOM   3915 C  CG    . ARG B 2 246 ? -9.925  22.357 81.188  1.00 24.10 ? 352 ARG B CG    1 
ATOM   3916 C  CD    . ARG B 2 246 ? -11.075 21.723 81.933  1.00 25.85 ? 352 ARG B CD    1 
ATOM   3917 N  NE    . ARG B 2 246 ? -12.340 22.149 81.367  1.00 25.37 ? 352 ARG B NE    1 
ATOM   3918 C  CZ    . ARG B 2 246 ? -13.360 22.641 82.062  1.00 26.57 ? 352 ARG B CZ    1 
ATOM   3919 N  NH1   . ARG B 2 246 ? -13.317 22.764 83.380  1.00 26.95 ? 352 ARG B NH1   1 
ATOM   3920 N  NH2   . ARG B 2 246 ? -14.461 23.007 81.428  1.00 28.61 ? 352 ARG B NH2   1 
ATOM   3921 N  N     . PRO B 2 247 ? -7.299  20.317 82.057  1.00 23.71 ? 353 PRO B N     1 
ATOM   3922 C  CA    . PRO B 2 247 ? -7.262  19.630 83.347  1.00 23.72 ? 353 PRO B CA    1 
ATOM   3923 C  C     . PRO B 2 247 ? -8.593  19.607 84.101  1.00 23.72 ? 353 PRO B C     1 
ATOM   3924 O  O     . PRO B 2 247 ? -9.276  20.611 84.316  1.00 22.61 ? 353 PRO B O     1 
ATOM   3925 C  CB    . PRO B 2 247 ? -6.209  20.416 84.155  1.00 23.68 ? 353 PRO B CB    1 
ATOM   3926 C  CG    . PRO B 2 247 ? -5.820  21.578 83.316  1.00 23.90 ? 353 PRO B CG    1 
ATOM   3927 C  CD    . PRO B 2 247 ? -6.187  21.282 81.932  1.00 23.56 ? 353 PRO B CD    1 
ATOM   3928 N  N     . GLU B 2 248 ? -8.936  18.387 84.483  1.00 24.28 ? 354 GLU B N     1 
ATOM   3929 C  CA    . GLU B 2 248 ? -9.953  18.103 85.456  1.00 24.79 ? 354 GLU B CA    1 
ATOM   3930 C  C     . GLU B 2 248 ? -9.907  19.202 86.495  1.00 24.96 ? 354 GLU B C     1 
ATOM   3931 O  O     . GLU B 2 248 ? -8.846  19.538 86.978  1.00 24.93 ? 354 GLU B O     1 
ATOM   3932 C  CB    . GLU B 2 248 ? -9.644  16.741 86.073  1.00 24.89 ? 354 GLU B CB    1 
ATOM   3933 C  CG    . GLU B 2 248 ? -10.588 16.256 87.164  1.00 26.81 ? 354 GLU B CG    1 
ATOM   3934 C  CD    . GLU B 2 248 ? -11.064 14.830 86.937  1.00 29.01 ? 354 GLU B CD    1 
ATOM   3935 O  OE1   . GLU B 2 248 ? -12.220 14.513 87.319  1.00 30.31 ? 354 GLU B OE1   1 
ATOM   3936 O  OE2   . GLU B 2 248 ? -10.286 14.028 86.361  1.00 29.76 ? 354 GLU B OE2   1 
ATOM   3937 N  N     . ASP B 2 249 ? -11.063 19.793 86.790  1.00 25.73 ? 355 ASP B N     1 
ATOM   3938 C  CA    . ASP B 2 249 ? -11.201 20.754 87.877  1.00 25.78 ? 355 ASP B CA    1 
ATOM   3939 C  C     . ASP B 2 249 ? -10.528 22.120 87.633  1.00 25.21 ? 355 ASP B C     1 
ATOM   3940 O  O     . ASP B 2 249 ? -10.694 23.031 88.439  1.00 24.45 ? 355 ASP B O     1 
ATOM   3941 C  CB    . ASP B 2 249 ? -10.683 20.139 89.199  1.00 26.26 ? 355 ASP B CB    1 
ATOM   3942 C  CG    . ASP B 2 249 ? -11.342 18.776 89.532  1.00 27.32 ? 355 ASP B CG    1 
ATOM   3943 O  OD1   . ASP B 2 249 ? -12.546 18.613 89.266  1.00 25.62 ? 355 ASP B OD1   1 
ATOM   3944 O  OD2   . ASP B 2 249 ? -10.729 17.816 90.060  1.00 29.41 ? 355 ASP B OD2   1 
ATOM   3945 N  N     . CYS B 2 250 ? -9.795  22.287 86.535  1.00 24.92 ? 356 CYS B N     1 
ATOM   3946 C  CA    . CYS B 2 250 ? -9.127  23.563 86.283  1.00 24.89 ? 356 CYS B CA    1 
ATOM   3947 C  C     . CYS B 2 250 ? -10.135 24.452 85.611  1.00 25.11 ? 356 CYS B C     1 
ATOM   3948 O  O     . CYS B 2 250 ? -10.633 24.077 84.572  1.00 24.78 ? 356 CYS B O     1 
ATOM   3949 C  CB    . CYS B 2 250 ? -7.908  23.411 85.377  1.00 24.85 ? 356 CYS B CB    1 
ATOM   3950 S  SG    . CYS B 2 250 ? -7.684  24.759 84.186  1.00 23.03 ? 356 CYS B SG    1 
ATOM   3951 N  N     . PRO B 2 251 ? -10.445 25.613 86.189  1.00 25.76 ? 357 PRO B N     1 
ATOM   3952 C  CA    . PRO B 2 251 ? -11.413 26.547 85.590  1.00 25.99 ? 357 PRO B CA    1 
ATOM   3953 C  C     . PRO B 2 251 ? -11.214 26.786 84.084  1.00 26.25 ? 357 PRO B C     1 
ATOM   3954 O  O     . PRO B 2 251 ? -10.204 26.431 83.510  1.00 26.05 ? 357 PRO B O     1 
ATOM   3955 C  CB    . PRO B 2 251 ? -11.216 27.853 86.382  1.00 25.89 ? 357 PRO B CB    1 
ATOM   3956 C  CG    . PRO B 2 251 ? -10.410 27.513 87.610  1.00 26.12 ? 357 PRO B CG    1 
ATOM   3957 C  CD    . PRO B 2 251 ? -9.919  26.111 87.474  1.00 26.09 ? 357 PRO B CD    1 
ATOM   3958 N  N     . GLN B 2 252 ? -12.216 27.376 83.449  1.00 26.97 ? 358 GLN B N     1 
ATOM   3959 C  CA    . GLN B 2 252 ? -12.230 27.493 82.000  1.00 27.03 ? 358 GLN B CA    1 
ATOM   3960 C  C     . GLN B 2 252 ? -11.351 28.656 81.558  1.00 27.39 ? 358 GLN B C     1 
ATOM   3961 O  O     . GLN B 2 252 ? -10.627 28.545 80.560  1.00 27.52 ? 358 GLN B O     1 
ATOM   3962 C  CB    . GLN B 2 252 ? -13.672 27.670 81.506  1.00 26.60 ? 358 GLN B CB    1 
ATOM   3963 C  CG    . GLN B 2 252 ? -13.838 27.564 80.017  1.00 26.34 ? 358 GLN B CG    1 
ATOM   3964 C  CD    . GLN B 2 252 ? -13.210 26.298 79.400  1.00 25.78 ? 358 GLN B CD    1 
ATOM   3965 O  OE1   . GLN B 2 252 ? -13.438 25.195 79.880  1.00 26.40 ? 358 GLN B OE1   1 
ATOM   3966 N  NE2   . GLN B 2 252 ? -12.443 26.467 78.326  1.00 24.14 ? 358 GLN B NE2   1 
ATOM   3967 N  N     . ASP B 2 253 ? -11.408 29.762 82.309  1.00 27.73 ? 359 ASP B N     1 
ATOM   3968 C  CA    . ASP B 2 253 ? -10.740 31.007 81.907  1.00 27.97 ? 359 ASP B CA    1 
ATOM   3969 C  C     . ASP B 2 253 ? -9.311  31.045 82.403  1.00 28.07 ? 359 ASP B C     1 
ATOM   3970 O  O     . ASP B 2 253 ? -8.625  32.048 82.193  1.00 28.06 ? 359 ASP B O     1 
ATOM   3971 C  CB    . ASP B 2 253 ? -11.499 32.269 82.356  1.00 28.06 ? 359 ASP B CB    1 
ATOM   3972 C  CG    . ASP B 2 253 ? -11.442 32.478 83.830  1.00 27.73 ? 359 ASP B CG    1 
ATOM   3973 O  OD1   . ASP B 2 253 ? -10.933 31.566 84.494  1.00 27.62 ? 359 ASP B OD1   1 
ATOM   3974 O  OD2   . ASP B 2 253 ? -11.894 33.486 84.416  1.00 28.72 ? 359 ASP B OD2   1 
ATOM   3975 N  N     . ILE B 2 254 ? -8.905  29.973 83.091  1.00 27.89 ? 360 ILE B N     1 
ATOM   3976 C  CA    . ILE B 2 254 ? -7.493  29.589 83.195  1.00 27.88 ? 360 ILE B CA    1 
ATOM   3977 C  C     . ILE B 2 254 ? -7.027  28.582 82.114  1.00 27.43 ? 360 ILE B C     1 
ATOM   3978 O  O     . ILE B 2 254 ? -5.927  28.727 81.609  1.00 27.40 ? 360 ILE B O     1 
ATOM   3979 C  CB    . ILE B 2 254 ? -7.154  29.042 84.594  1.00 27.97 ? 360 ILE B CB    1 
ATOM   3980 C  CG1   . ILE B 2 254 ? -7.500  30.111 85.645  1.00 28.59 ? 360 ILE B CG1   1 
ATOM   3981 C  CG2   . ILE B 2 254 ? -5.657  28.614 84.635  1.00 27.44 ? 360 ILE B CG2   1 
ATOM   3982 C  CD1   . ILE B 2 254 ? -6.974  29.847 87.078  1.00 28.91 ? 360 ILE B CD1   1 
ATOM   3983 N  N     . TYR B 2 255 ? -7.836  27.576 81.771  1.00 26.96 ? 361 TYR B N     1 
ATOM   3984 C  CA    . TYR B 2 255 ? -7.484  26.649 80.704  1.00 26.46 ? 361 TYR B CA    1 
ATOM   3985 C  C     . TYR B 2 255 ? -7.394  27.421 79.427  1.00 26.22 ? 361 TYR B C     1 
ATOM   3986 O  O     . TYR B 2 255 ? -6.781  26.973 78.465  1.00 25.85 ? 361 TYR B O     1 
ATOM   3987 C  CB    . TYR B 2 255 ? -8.523  25.554 80.510  1.00 26.72 ? 361 TYR B CB    1 
ATOM   3988 C  CG    . TYR B 2 255 ? -8.233  24.683 79.282  1.00 26.86 ? 361 TYR B CG    1 
ATOM   3989 C  CD1   . TYR B 2 255 ? -7.011  24.035 79.152  1.00 26.43 ? 361 TYR B CD1   1 
ATOM   3990 C  CD2   . TYR B 2 255 ? -9.171  24.533 78.246  1.00 25.61 ? 361 TYR B CD2   1 
ATOM   3991 C  CE1   . TYR B 2 255 ? -6.722  23.237 78.047  1.00 27.19 ? 361 TYR B CE1   1 
ATOM   3992 C  CE2   . TYR B 2 255 ? -8.900  23.728 77.135  1.00 25.58 ? 361 TYR B CE2   1 
ATOM   3993 C  CZ    . TYR B 2 255 ? -7.660  23.082 77.037  1.00 27.12 ? 361 TYR B CZ    1 
ATOM   3994 O  OH    . TYR B 2 255 ? -7.325  22.289 75.952  1.00 25.32 ? 361 TYR B OH    1 
ATOM   3995 N  N     . ASN B 2 256 ? -8.022  28.586 79.412  1.00 26.07 ? 362 ASN B N     1 
ATOM   3996 C  CA    . ASN B 2 256 ? -7.906  29.471 78.269  1.00 26.31 ? 362 ASN B CA    1 
ATOM   3997 C  C     . ASN B 2 256 ? -6.580  30.254 78.206  1.00 26.36 ? 362 ASN B C     1 
ATOM   3998 O  O     . ASN B 2 256 ? -6.139  30.637 77.146  1.00 27.10 ? 362 ASN B O     1 
ATOM   3999 C  CB    . ASN B 2 256 ? -9.094  30.421 78.228  1.00 26.15 ? 362 ASN B CB    1 
ATOM   4000 C  CG    . ASN B 2 256 ? -9.119  31.235 76.978  1.00 25.75 ? 362 ASN B CG    1 
ATOM   4001 O  OD1   . ASN B 2 256 ? -8.934  30.717 75.864  1.00 26.18 ? 362 ASN B OD1   1 
ATOM   4002 N  ND2   . ASN B 2 256 ? -9.302  32.526 77.142  1.00 25.48 ? 362 ASN B ND2   1 
ATOM   4003 N  N     . VAL B 2 257 ? -5.951  30.517 79.337  1.00 26.25 ? 363 VAL B N     1 
ATOM   4004 C  CA    . VAL B 2 257 ? -4.680  31.211 79.331  1.00 25.61 ? 363 VAL B CA    1 
ATOM   4005 C  C     . VAL B 2 257 ? -3.683  30.272 78.676  1.00 25.48 ? 363 VAL B C     1 
ATOM   4006 O  O     . VAL B 2 257 ? -2.887  30.664 77.821  1.00 25.28 ? 363 VAL B O     1 
ATOM   4007 C  CB    . VAL B 2 257 ? -4.297  31.631 80.758  1.00 25.66 ? 363 VAL B CB    1 
ATOM   4008 C  CG1   . VAL B 2 257 ? -2.859  32.104 80.835  1.00 26.13 ? 363 VAL B CG1   1 
ATOM   4009 C  CG2   . VAL B 2 257 ? -5.227  32.739 81.232  1.00 24.18 ? 363 VAL B CG2   1 
ATOM   4010 N  N     . MET B 2 258 ? -3.757  29.007 79.034  1.00 25.67 ? 364 MET B N     1 
ATOM   4011 C  CA    . MET B 2 258 ? -2.902  28.030 78.391  1.00 25.81 ? 364 MET B CA    1 
ATOM   4012 C  C     . MET B 2 258 ? -3.190  28.037 76.910  1.00 26.40 ? 364 MET B C     1 
ATOM   4013 O  O     . MET B 2 258 ? -2.261  27.928 76.099  1.00 27.20 ? 364 MET B O     1 
ATOM   4014 C  CB    . MET B 2 258 ? -3.151  26.623 78.899  1.00 25.55 ? 364 MET B CB    1 
ATOM   4015 C  CG    . MET B 2 258 ? -3.232  26.473 80.391  1.00 24.47 ? 364 MET B CG    1 
ATOM   4016 S  SD    . MET B 2 258 ? -3.517  24.758 80.642  1.00 23.96 ? 364 MET B SD    1 
ATOM   4017 C  CE    . MET B 2 258 ? -3.947  24.747 82.451  1.00 23.55 ? 364 MET B CE    1 
ATOM   4018 N  N     . VAL B 2 259 ? -4.469  28.165 76.537  1.00 26.18 ? 365 VAL B N     1 
ATOM   4019 C  CA    . VAL B 2 259 ? -4.836  27.988 75.124  1.00 25.77 ? 365 VAL B CA    1 
ATOM   4020 C  C     . VAL B 2 259 ? -4.144  29.032 74.301  1.00 25.48 ? 365 VAL B C     1 
ATOM   4021 O  O     . VAL B 2 259 ? -3.645  28.757 73.220  1.00 26.24 ? 365 VAL B O     1 
ATOM   4022 C  CB    . VAL B 2 259 ? -6.346  28.021 74.874  1.00 25.89 ? 365 VAL B CB    1 
ATOM   4023 C  CG1   . VAL B 2 259 ? -6.635  28.136 73.363  1.00 26.04 ? 365 VAL B CG1   1 
ATOM   4024 C  CG2   . VAL B 2 259 ? -7.016  26.780 75.482  1.00 24.59 ? 365 VAL B CG2   1 
ATOM   4025 N  N     . GLN B 2 260 ? -4.032  30.221 74.841  1.00 24.94 ? 366 GLN B N     1 
ATOM   4026 C  CA    . GLN B 2 260 ? -3.451  31.281 74.068  1.00 24.90 ? 366 GLN B CA    1 
ATOM   4027 C  C     . GLN B 2 260 ? -1.964  31.204 73.986  1.00 24.89 ? 366 GLN B C     1 
ATOM   4028 O  O     . GLN B 2 260 ? -1.396  31.657 72.988  1.00 24.20 ? 366 GLN B O     1 
ATOM   4029 C  CB    . GLN B 2 260 ? -3.904  32.573 74.618  1.00 24.66 ? 366 GLN B CB    1 
ATOM   4030 C  CG    . GLN B 2 260 ? -5.357  32.534 74.641  1.00 25.16 ? 366 GLN B CG    1 
ATOM   4031 C  CD    . GLN B 2 260 ? -5.870  33.865 74.664  1.00 27.36 ? 366 GLN B CD    1 
ATOM   4032 O  OE1   . GLN B 2 260 ? -6.557  34.286 73.723  1.00 28.62 ? 366 GLN B OE1   1 
ATOM   4033 N  NE2   . GLN B 2 260 ? -5.519  34.603 75.725  1.00 26.49 ? 366 GLN B NE2   1 
ATOM   4034 N  N     . CYS B 2 261 ? -1.331  30.612 75.001  1.00 25.22 ? 367 CYS B N     1 
ATOM   4035 C  CA    . CYS B 2 261 ? 0.111   30.317 74.913  1.00 25.50 ? 367 CYS B CA    1 
ATOM   4036 C  C     . CYS B 2 261 ? 0.390   29.472 73.736  1.00 25.45 ? 367 CYS B C     1 
ATOM   4037 O  O     . CYS B 2 261 ? 1.499   29.440 73.288  1.00 24.60 ? 367 CYS B O     1 
ATOM   4038 C  CB    . CYS B 2 261 ? 0.622   29.535 76.108  1.00 25.82 ? 367 CYS B CB    1 
ATOM   4039 S  SG    . CYS B 2 261 ? 0.599   30.492 77.623  1.00 26.52 ? 367 CYS B SG    1 
ATOM   4040 N  N     . TRP B 2 262 ? -0.648  28.774 73.266  1.00 26.48 ? 368 TRP B N     1 
ATOM   4041 C  CA    . TRP B 2 262 ? -0.547  27.797 72.185  1.00 26.50 ? 368 TRP B CA    1 
ATOM   4042 C  C     . TRP B 2 262 ? -1.075  28.246 70.840  1.00 26.70 ? 368 TRP B C     1 
ATOM   4043 O  O     . TRP B 2 262 ? -1.326  27.424 69.982  1.00 26.80 ? 368 TRP B O     1 
ATOM   4044 C  CB    . TRP B 2 262 ? -1.247  26.511 72.608  1.00 26.18 ? 368 TRP B CB    1 
ATOM   4045 C  CG    . TRP B 2 262 ? -0.643  25.904 73.862  1.00 26.32 ? 368 TRP B CG    1 
ATOM   4046 C  CD1   . TRP B 2 262 ? 0.664   25.925 74.228  1.00 27.61 ? 368 TRP B CD1   1 
ATOM   4047 C  CD2   . TRP B 2 262 ? -1.334  25.207 74.901  1.00 27.33 ? 368 TRP B CD2   1 
ATOM   4048 N  NE1   . TRP B 2 262 ? 0.839   25.284 75.435  1.00 28.71 ? 368 TRP B NE1   1 
ATOM   4049 C  CE2   . TRP B 2 262 ? -0.370  24.826 75.866  1.00 27.12 ? 368 TRP B CE2   1 
ATOM   4050 C  CE3   . TRP B 2 262 ? -2.689  24.895 75.138  1.00 28.17 ? 368 TRP B CE3   1 
ATOM   4051 C  CZ2   . TRP B 2 262 ? -0.694  24.122 77.013  1.00 26.97 ? 368 TRP B CZ2   1 
ATOM   4052 C  CZ3   . TRP B 2 262 ? -3.021  24.206 76.275  1.00 28.87 ? 368 TRP B CZ3   1 
ATOM   4053 C  CH2   . TRP B 2 262 ? -2.019  23.823 77.212  1.00 29.36 ? 368 TRP B CH2   1 
ATOM   4054 N  N     . ALA B 2 263 ? -1.214  29.547 70.626  1.00 27.32 ? 369 ALA B N     1 
ATOM   4055 C  CA    . ALA B 2 263 ? -1.638  30.053 69.317  1.00 27.08 ? 369 ALA B CA    1 
ATOM   4056 C  C     . ALA B 2 263 ? -0.598  29.586 68.331  1.00 27.25 ? 369 ALA B C     1 
ATOM   4057 O  O     . ALA B 2 263 ? 0.573   29.941 68.447  1.00 26.81 ? 369 ALA B O     1 
ATOM   4058 C  CB    . ALA B 2 263 ? -1.732  31.606 69.308  1.00 26.77 ? 369 ALA B CB    1 
ATOM   4059 N  N     . HIS B 2 264 ? -1.008  28.785 67.358  1.00 27.61 ? 370 HIS B N     1 
ATOM   4060 C  CA    . HIS B 2 264 ? -0.040  28.258 66.383  1.00 27.52 ? 370 HIS B CA    1 
ATOM   4061 C  C     . HIS B 2 264 ? 0.952   29.311 65.880  1.00 27.66 ? 370 HIS B C     1 
ATOM   4062 O  O     . HIS B 2 264 ? 2.155   29.036 65.856  1.00 28.69 ? 370 HIS B O     1 
ATOM   4063 C  CB    . HIS B 2 264 ? -0.731  27.585 65.195  1.00 27.09 ? 370 HIS B CB    1 
ATOM   4064 C  CG    . HIS B 2 264 ? 0.225   27.089 64.156  1.00 26.79 ? 370 HIS B CG    1 
ATOM   4065 N  ND1   . HIS B 2 264 ? 0.863   27.927 63.264  1.00 23.88 ? 370 HIS B ND1   1 
ATOM   4066 C  CD2   . HIS B 2 264 ? 0.669   25.842 63.880  1.00 26.03 ? 370 HIS B CD2   1 
ATOM   4067 C  CE1   . HIS B 2 264 ? 1.643   27.215 62.479  1.00 22.13 ? 370 HIS B CE1   1 
ATOM   4068 N  NE2   . HIS B 2 264 ? 1.528   25.945 62.817  1.00 23.34 ? 370 HIS B NE2   1 
ATOM   4069 N  N     . LYS B 2 265 ? 0.463   30.473 65.442  1.00 27.90 ? 371 LYS B N     1 
ATOM   4070 C  CA    . LYS B 2 265 ? 1.335   31.559 64.968  1.00 27.93 ? 371 LYS B CA    1 
ATOM   4071 C  C     . LYS B 2 265 ? 2.035   32.164 66.193  1.00 27.59 ? 371 LYS B C     1 
ATOM   4072 O  O     . LYS B 2 265 ? 1.359   32.630 67.107  1.00 27.76 ? 371 LYS B O     1 
ATOM   4073 C  CB    . LYS B 2 265 ? 0.547   32.691 64.249  1.00 28.26 ? 371 LYS B CB    1 
ATOM   4074 C  CG    . LYS B 2 265 ? -0.170  32.302 62.930  1.00 28.80 ? 371 LYS B CG    1 
ATOM   4075 C  CD    . LYS B 2 265 ? 0.090   33.277 61.728  1.00 29.32 ? 371 LYS B CD    1 
ATOM   4076 C  CE    . LYS B 2 265 ? 0.615   32.511 60.408  1.00 29.42 ? 371 LYS B CE    1 
ATOM   4077 N  NZ    . LYS B 2 265 ? 0.163   33.072 59.057  1.00 27.14 ? 371 LYS B NZ    1 
ATOM   4078 N  N     . PRO B 2 266 ? 3.366   32.172 66.210  1.00 26.86 ? 372 PRO B N     1 
ATOM   4079 C  CA    . PRO B 2 266 ? 4.123   32.794 67.292  1.00 26.78 ? 372 PRO B CA    1 
ATOM   4080 C  C     . PRO B 2 266 ? 3.733   34.244 67.558  1.00 26.85 ? 372 PRO B C     1 
ATOM   4081 O  O     . PRO B 2 266 ? 3.709   34.653 68.702  1.00 27.76 ? 372 PRO B O     1 
ATOM   4082 C  CB    . PRO B 2 266 ? 5.557   32.744 66.773  1.00 26.94 ? 372 PRO B CB    1 
ATOM   4083 C  CG    . PRO B 2 266 ? 5.575   31.618 65.826  1.00 26.46 ? 372 PRO B CG    1 
ATOM   4084 C  CD    . PRO B 2 266 ? 4.248   31.575 65.198  1.00 26.72 ? 372 PRO B CD    1 
ATOM   4085 N  N     . GLU B 2 267 ? 3.461   35.017 66.518  1.00 26.86 ? 373 GLU B N     1 
ATOM   4086 C  CA    . GLU B 2 267 ? 3.228   36.458 66.659  1.00 26.80 ? 373 GLU B CA    1 
ATOM   4087 C  C     . GLU B 2 267 ? 2.003   36.720 67.475  1.00 25.90 ? 373 GLU B C     1 
ATOM   4088 O  O     . GLU B 2 267 ? 1.932   37.719 68.146  1.00 25.34 ? 373 GLU B O     1 
ATOM   4089 C  CB    . GLU B 2 267 ? 3.068   37.117 65.288  1.00 27.17 ? 373 GLU B CB    1 
ATOM   4090 C  CG    . GLU B 2 267 ? 4.364   37.210 64.512  1.00 30.27 ? 373 GLU B CG    1 
ATOM   4091 C  CD    . GLU B 2 267 ? 4.529   36.111 63.440  1.00 35.44 ? 373 GLU B CD    1 
ATOM   4092 O  OE1   . GLU B 2 267 ? 3.870   36.248 62.365  1.00 37.10 ? 373 GLU B OE1   1 
ATOM   4093 O  OE2   . GLU B 2 267 ? 5.333   35.139 63.652  1.00 35.04 ? 373 GLU B OE2   1 
ATOM   4094 N  N     . ASP B 2 268 ? 1.051   35.801 67.411  1.00 25.84 ? 374 ASP B N     1 
ATOM   4095 C  CA    . ASP B 2 268 ? -0.236  35.908 68.104  1.00 25.89 ? 374 ASP B CA    1 
ATOM   4096 C  C     . ASP B 2 268 ? -0.240  35.527 69.578  1.00 25.49 ? 374 ASP B C     1 
ATOM   4097 O  O     . ASP B 2 268 ? -1.251  35.730 70.286  1.00 24.60 ? 374 ASP B O     1 
ATOM   4098 C  CB    . ASP B 2 268 ? -1.249  35.008 67.407  1.00 26.41 ? 374 ASP B CB    1 
ATOM   4099 C  CG    . ASP B 2 268 ? -1.507  35.418 65.973  1.00 27.22 ? 374 ASP B CG    1 
ATOM   4100 O  OD1   . ASP B 2 268 ? -1.384  36.627 65.635  1.00 26.47 ? 374 ASP B OD1   1 
ATOM   4101 O  OD2   . ASP B 2 268 ? -1.846  34.573 65.121  1.00 29.08 ? 374 ASP B OD2   1 
ATOM   4102 N  N     . ARG B 2 269 ? 0.876   34.967 70.041  1.00 25.52 ? 375 ARG B N     1 
ATOM   4103 C  CA    . ARG B 2 269 ? 0.992   34.548 71.437  1.00 25.55 ? 375 ARG B CA    1 
ATOM   4104 C  C     . ARG B 2 269 ? 1.239   35.758 72.310  1.00 25.56 ? 375 ARG B C     1 
ATOM   4105 O  O     . ARG B 2 269 ? 1.890   36.711 71.876  1.00 26.32 ? 375 ARG B O     1 
ATOM   4106 C  CB    . ARG B 2 269 ? 2.092   33.547 71.587  1.00 25.59 ? 375 ARG B CB    1 
ATOM   4107 C  CG    . ARG B 2 269 ? 1.993   32.453 70.565  1.00 26.12 ? 375 ARG B CG    1 
ATOM   4108 C  CD    . ARG B 2 269 ? 2.305   31.104 71.096  1.00 26.90 ? 375 ARG B CD    1 
ATOM   4109 N  NE    . ARG B 2 269 ? 2.476   30.120 70.027  1.00 26.84 ? 375 ARG B NE    1 
ATOM   4110 C  CZ    . ARG B 2 269 ? 3.638   29.683 69.590  1.00 25.93 ? 375 ARG B CZ    1 
ATOM   4111 N  NH1   . ARG B 2 269 ? 4.767   30.111 70.150  1.00 29.38 ? 375 ARG B NH1   1 
ATOM   4112 N  NH2   . ARG B 2 269 ? 3.676   28.789 68.609  1.00 24.05 ? 375 ARG B NH2   1 
ATOM   4113 N  N     . PRO B 2 270 ? 0.692   35.765 73.522  1.00 25.15 ? 376 PRO B N     1 
ATOM   4114 C  CA    . PRO B 2 270 ? 0.746   36.977 74.349  1.00 24.51 ? 376 PRO B CA    1 
ATOM   4115 C  C     . PRO B 2 270 ? 2.069   37.063 75.109  1.00 24.29 ? 376 PRO B C     1 
ATOM   4116 O  O     . PRO B 2 270 ? 2.686   36.059 75.482  1.00 23.35 ? 376 PRO B O     1 
ATOM   4117 C  CB    . PRO B 2 270 ? -0.426  36.815 75.318  1.00 23.77 ? 376 PRO B CB    1 
ATOM   4118 C  CG    . PRO B 2 270 ? -0.716  35.349 75.371  1.00 23.93 ? 376 PRO B CG    1 
ATOM   4119 C  CD    . PRO B 2 270 ? 0.014   34.658 74.221  1.00 25.13 ? 376 PRO B CD    1 
ATOM   4120 N  N     . THR B 2 271 ? 2.476   38.299 75.337  1.00 23.88 ? 377 THR B N     1 
ATOM   4121 C  CA    . THR B 2 271 ? 3.664   38.587 76.071  1.00 23.75 ? 377 THR B CA    1 
ATOM   4122 C  C     . THR B 2 271 ? 3.454   38.223 77.488  1.00 23.78 ? 377 THR B C     1 
ATOM   4123 O  O     . THR B 2 271 ? 2.392   37.832 77.863  1.00 23.78 ? 377 THR B O     1 
ATOM   4124 C  CB    . THR B 2 271 ? 4.013   40.038 75.946  1.00 23.68 ? 377 THR B CB    1 
ATOM   4125 O  OG1   . THR B 2 271 ? 3.018   40.849 76.571  1.00 25.72 ? 377 THR B OG1   1 
ATOM   4126 C  CG2   . THR B 2 271 ? 3.996   40.457 74.494  1.00 23.12 ? 377 THR B CG2   1 
ATOM   4127 N  N     . PHE B 2 272 ? 4.506   38.308 78.275  1.00 24.99 ? 378 PHE B N     1 
ATOM   4128 C  CA    . PHE B 2 272 ? 4.480   37.798 79.630  1.00 25.31 ? 378 PHE B CA    1 
ATOM   4129 C  C     . PHE B 2 272 ? 3.883   38.834 80.560  1.00 25.64 ? 378 PHE B C     1 
ATOM   4130 O  O     . PHE B 2 272 ? 3.406   38.480 81.617  1.00 26.22 ? 378 PHE B O     1 
ATOM   4131 C  CB    . PHE B 2 272 ? 5.896   37.398 80.083  1.00 25.87 ? 378 PHE B CB    1 
ATOM   4132 C  CG    . PHE B 2 272 ? 6.229   35.971 79.797  1.00 25.77 ? 378 PHE B CG    1 
ATOM   4133 C  CD1   . PHE B 2 272 ? 5.500   34.945 80.421  1.00 25.10 ? 378 PHE B CD1   1 
ATOM   4134 C  CD2   . PHE B 2 272 ? 7.241   35.647 78.915  1.00 26.21 ? 378 PHE B CD2   1 
ATOM   4135 C  CE1   . PHE B 2 272 ? 5.745   33.636 80.170  1.00 23.61 ? 378 PHE B CE1   1 
ATOM   4136 C  CE2   . PHE B 2 272 ? 7.525   34.306 78.648  1.00 26.83 ? 378 PHE B CE2   1 
ATOM   4137 C  CZ    . PHE B 2 272 ? 6.767   33.298 79.279  1.00 26.85 ? 378 PHE B CZ    1 
ATOM   4138 N  N     . VAL B 2 273 ? 3.911   40.115 80.201  1.00 25.79 ? 379 VAL B N     1 
ATOM   4139 C  CA    . VAL B 2 273 ? 3.068   41.067 80.911  1.00 25.99 ? 379 VAL B CA    1 
ATOM   4140 C  C     . VAL B 2 273 ? 1.607   40.680 80.608  1.00 26.75 ? 379 VAL B C     1 
ATOM   4141 O  O     . VAL B 2 273 ? 0.761   40.662 81.501  1.00 25.80 ? 379 VAL B O     1 
ATOM   4142 C  CB    . VAL B 2 273 ? 3.281   42.527 80.463  1.00 26.06 ? 379 VAL B CB    1 
ATOM   4143 C  CG1   . VAL B 2 273 ? 2.256   43.430 81.141  1.00 26.24 ? 379 VAL B CG1   1 
ATOM   4144 C  CG2   . VAL B 2 273 ? 4.685   43.006 80.757  1.00 25.57 ? 379 VAL B CG2   1 
ATOM   4145 N  N     . ALA B 2 274 ? 1.321   40.381 79.336  1.00 27.48 ? 380 ALA B N     1 
ATOM   4146 C  CA    . ALA B 2 274 ? -0.026  39.982 78.948  1.00 28.44 ? 380 ALA B CA    1 
ATOM   4147 C  C     . ALA B 2 274 ? -0.483  38.705 79.687  1.00 29.04 ? 380 ALA B C     1 
ATOM   4148 O  O     . ALA B 2 274 ? -1.662  38.586 80.089  1.00 30.53 ? 380 ALA B O     1 
ATOM   4149 C  CB    . ALA B 2 274 ? -0.163  39.840 77.421  1.00 28.32 ? 380 ALA B CB    1 
ATOM   4150 N  N     . LEU B 2 275 ? 0.438   37.788 79.916  1.00 28.66 ? 381 LEU B N     1 
ATOM   4151 C  CA    . LEU B 2 275 ? 0.121   36.581 80.666  1.00 28.99 ? 381 LEU B CA    1 
ATOM   4152 C  C     . LEU B 2 275 ? -0.170  36.867 82.165  1.00 28.46 ? 381 LEU B C     1 
ATOM   4153 O  O     . LEU B 2 275 ? -1.126  36.330 82.720  1.00 29.36 ? 381 LEU B O     1 
ATOM   4154 C  CB    . LEU B 2 275 ? 1.239   35.527 80.482  1.00 29.20 ? 381 LEU B CB    1 
ATOM   4155 C  CG    . LEU B 2 275 ? 1.180   34.909 79.083  1.00 29.57 ? 381 LEU B CG    1 
ATOM   4156 C  CD1   . LEU B 2 275 ? 2.475   34.351 78.643  1.00 29.57 ? 381 LEU B CD1   1 
ATOM   4157 C  CD2   . LEU B 2 275 ? 0.096   33.827 79.005  1.00 31.18 ? 381 LEU B CD2   1 
ATOM   4158 N  N     . ARG B 2 276 ? 0.615   37.724 82.804  1.00 27.52 ? 382 ARG B N     1 
ATOM   4159 C  CA    . ARG B 2 276 ? 0.344   38.113 84.198  1.00 27.17 ? 382 ARG B CA    1 
ATOM   4160 C  C     . ARG B 2 276 ? -1.106  38.554 84.417  1.00 26.35 ? 382 ARG B C     1 
ATOM   4161 O  O     . ARG B 2 276 ? -1.775  38.072 85.302  1.00 26.39 ? 382 ARG B O     1 
ATOM   4162 C  CB    . ARG B 2 276 ? 1.250   39.256 84.630  1.00 26.87 ? 382 ARG B CB    1 
ATOM   4163 C  CG    . ARG B 2 276 ? 1.461   39.282 86.102  1.00 28.54 ? 382 ARG B CG    1 
ATOM   4164 C  CD    . ARG B 2 276 ? 1.908   40.627 86.686  1.00 30.49 ? 382 ARG B CD    1 
ATOM   4165 N  NE    . ARG B 2 276 ? 2.232   41.613 85.649  1.00 31.16 ? 382 ARG B NE    1 
ATOM   4166 C  CZ    . ARG B 2 276 ? 2.030   42.919 85.766  1.00 32.38 ? 382 ARG B CZ    1 
ATOM   4167 N  NH1   . ARG B 2 276 ? 1.491   43.421 86.883  1.00 34.26 ? 382 ARG B NH1   1 
ATOM   4168 N  NH2   . ARG B 2 276 ? 2.362   43.733 84.765  1.00 31.36 ? 382 ARG B NH2   1 
ATOM   4169 N  N     . ASP B 2 277 ? -1.570  39.464 83.576  1.00 25.66 ? 383 ASP B N     1 
ATOM   4170 C  CA    . ASP B 2 277 ? -2.870  40.098 83.717  1.00 25.01 ? 383 ASP B CA    1 
ATOM   4171 C  C     . ASP B 2 277 ? -4.053  39.136 83.508  1.00 25.33 ? 383 ASP B C     1 
ATOM   4172 O  O     . ASP B 2 277 ? -5.078  39.239 84.195  1.00 24.89 ? 383 ASP B O     1 
ATOM   4173 C  CB    . ASP B 2 277 ? -2.992  41.232 82.698  1.00 24.43 ? 383 ASP B CB    1 
ATOM   4174 C  CG    . ASP B 2 277 ? -2.031  42.368 82.943  1.00 22.58 ? 383 ASP B CG    1 
ATOM   4175 O  OD1   . ASP B 2 277 ? -1.508  42.509 84.057  1.00 21.69 ? 383 ASP B OD1   1 
ATOM   4176 O  OD2   . ASP B 2 277 ? -1.736  43.191 82.059  1.00 21.54 ? 383 ASP B OD2   1 
ATOM   4177 N  N     . PHE B 2 278 ? -3.919  38.230 82.538  1.00 25.66 ? 384 PHE B N     1 
ATOM   4178 C  CA    . PHE B 2 278 ? -5.006  37.309 82.188  1.00 25.63 ? 384 PHE B CA    1 
ATOM   4179 C  C     . PHE B 2 278 ? -5.185  36.375 83.349  1.00 25.47 ? 384 PHE B C     1 
ATOM   4180 O  O     . PHE B 2 278 ? -6.305  36.115 83.798  1.00 24.42 ? 384 PHE B O     1 
ATOM   4181 C  CB    . PHE B 2 278 ? -4.654  36.486 80.937  1.00 25.75 ? 384 PHE B CB    1 
ATOM   4182 C  CG    . PHE B 2 278 ? -4.668  37.269 79.634  1.00 25.47 ? 384 PHE B CG    1 
ATOM   4183 C  CD1   . PHE B 2 278 ? -4.943  38.631 79.598  1.00 24.78 ? 384 PHE B CD1   1 
ATOM   4184 C  CD2   . PHE B 2 278 ? -4.378  36.615 78.433  1.00 26.46 ? 384 PHE B CD2   1 
ATOM   4185 C  CE1   . PHE B 2 278 ? -4.952  39.319 78.406  1.00 25.84 ? 384 PHE B CE1   1 
ATOM   4186 C  CE2   . PHE B 2 278 ? -4.371  37.304 77.229  1.00 26.92 ? 384 PHE B CE2   1 
ATOM   4187 C  CZ    . PHE B 2 278 ? -4.671  38.666 77.218  1.00 26.93 ? 384 PHE B CZ    1 
ATOM   4188 N  N     . LEU B 2 279 ? -4.036  35.877 83.814  1.00 25.60 ? 385 LEU B N     1 
ATOM   4189 C  CA    . LEU B 2 279 ? -3.940  35.122 85.057  1.00 25.43 ? 385 LEU B CA    1 
ATOM   4190 C  C     . LEU B 2 279 ? -4.470  35.857 86.284  1.00 25.48 ? 385 LEU B C     1 
ATOM   4191 O  O     . LEU B 2 279 ? -4.914  35.216 87.227  1.00 25.80 ? 385 LEU B O     1 
ATOM   4192 C  CB    . LEU B 2 279 ? -2.501  34.751 85.325  1.00 25.14 ? 385 LEU B CB    1 
ATOM   4193 C  CG    . LEU B 2 279 ? -1.930  33.640 84.478  1.00 25.38 ? 385 LEU B CG    1 
ATOM   4194 C  CD1   . LEU B 2 279 ? -0.456  33.548 84.818  1.00 27.14 ? 385 LEU B CD1   1 
ATOM   4195 C  CD2   . LEU B 2 279 ? -2.608  32.300 84.717  1.00 24.68 ? 385 LEU B CD2   1 
ATOM   4196 N  N     . LEU B 2 280 ? -4.411  37.185 86.294  1.00 25.35 ? 386 LEU B N     1 
ATOM   4197 C  CA    . LEU B 2 280 ? -4.876  37.928 87.449  1.00 25.41 ? 386 LEU B CA    1 
ATOM   4198 C  C     . LEU B 2 280 ? -6.367  38.209 87.329  1.00 25.92 ? 386 LEU B C     1 
ATOM   4199 O  O     . LEU B 2 280 ? -7.077  38.214 88.347  1.00 26.14 ? 386 LEU B O     1 
ATOM   4200 C  CB    . LEU B 2 280 ? -4.048  39.200 87.660  1.00 25.16 ? 386 LEU B CB    1 
ATOM   4201 C  CG    . LEU B 2 280 ? -2.786  38.879 88.483  1.00 25.99 ? 386 LEU B CG    1 
ATOM   4202 C  CD1   . LEU B 2 280 ? -1.624  39.879 88.268  1.00 25.59 ? 386 LEU B CD1   1 
ATOM   4203 C  CD2   . LEU B 2 280 ? -3.139  38.738 89.963  1.00 25.43 ? 386 LEU B CD2   1 
ATOM   4204 N  N     . GLU B 2 281 ? -6.850  38.404 86.095  1.00 26.01 ? 387 GLU B N     1 
ATOM   4205 C  CA    . GLU B 2 281 ? -8.284  38.613 85.846  1.00 26.17 ? 387 GLU B CA    1 
ATOM   4206 C  C     . GLU B 2 281 ? -9.055  37.304 86.040  1.00 26.12 ? 387 GLU B C     1 
ATOM   4207 O  O     . GLU B 2 281 ? -10.272 37.312 86.137  1.00 26.36 ? 387 GLU B O     1 
ATOM   4208 C  CB    . GLU B 2 281 ? -8.546  39.192 84.431  1.00 25.94 ? 387 GLU B CB    1 
ATOM   4209 C  CG    . GLU B 2 281 ? -8.060  40.623 84.246  0.01 26.36 ? 387 GLU B CG    1 
ATOM   4210 C  CD    . GLU B 2 281 ? -7.738  40.955 82.800  0.01 26.52 ? 387 GLU B CD    1 
ATOM   4211 O  OE1   . GLU B 2 281 ? -8.534  40.587 81.910  0.01 26.64 ? 387 GLU B OE1   1 
ATOM   4212 O  OE2   . GLU B 2 281 ? -6.688  41.585 82.552  0.01 26.61 ? 387 GLU B OE2   1 
ATOM   4213 N  N     . ALA B 2 282 ? -8.334  36.188 86.109  1.00 26.29 ? 388 ALA B N     1 
ATOM   4214 C  CA    . ALA B 2 282 ? -8.932  34.867 86.131  1.00 26.26 ? 388 ALA B CA    1 
ATOM   4215 C  C     . ALA B 2 282 ? -8.586  34.157 87.428  1.00 26.24 ? 388 ALA B C     1 
ATOM   4216 O  O     . ALA B 2 282 ? -9.378  33.352 87.905  1.00 26.41 ? 388 ALA B O     1 
ATOM   4217 C  CB    . ALA B 2 282 ? -8.432  34.059 84.926  1.00 26.31 ? 388 ALA B CB    1 
HETATM 4218 MG MG    . MG  C 3 .   ? 31.336  13.346 59.394  1.00 48.63 ? 398 MG  A MG    1 
HETATM 4219 MG MG    . MG  D 3 .   ? 29.568  15.718 59.256  1.00 48.01 ? 399 MG  A MG    1 
HETATM 4220 P  PG    . ACP E 4 .   ? 30.040  14.372 61.856  1.00 56.85 ? 101 ACP A PG    1 
HETATM 4221 O  O1G   . ACP E 4 .   ? 30.067  15.939 61.743  1.00 43.54 ? 101 ACP A O1G   1 
HETATM 4222 O  O2G   . ACP E 4 .   ? 29.628  13.555 60.573  1.00 49.78 ? 101 ACP A O2G   1 
HETATM 4223 O  O3G   . ACP E 4 .   ? 29.412  13.817 63.153  1.00 48.96 ? 101 ACP A O3G   1 
HETATM 4224 P  PB    . ACP E 4 .   ? 32.570  15.529 61.000  1.00 56.14 ? 101 ACP A PB    1 
HETATM 4225 O  O1B   . ACP E 4 .   ? 33.164  16.620 61.922  1.00 57.44 ? 101 ACP A O1B   1 
HETATM 4226 O  O2B   . ACP E 4 .   ? 33.269  14.768 59.832  1.00 51.52 ? 101 ACP A O2B   1 
HETATM 4227 C  C3B   . ACP E 4 .   ? 31.888  14.145 62.031  1.00 53.13 ? 101 ACP A C3B   1 
HETATM 4228 P  PA    . ACP E 4 .   ? 31.815  17.710 59.283  1.00 54.36 ? 101 ACP A PA    1 
HETATM 4229 O  O1A   . ACP E 4 .   ? 32.912  17.327 58.303  1.00 51.48 ? 101 ACP A O1A   1 
HETATM 4230 O  O2A   . ACP E 4 .   ? 30.477  18.119 58.624  1.00 56.00 ? 101 ACP A O2A   1 
HETATM 4231 O  O3A   . ACP E 4 .   ? 31.438  16.541 60.381  1.00 50.28 ? 101 ACP A O3A   1 
HETATM 4232 O  "O5'" . ACP E 4 .   ? 32.292  19.018 60.188  1.00 53.46 ? 101 ACP A "O5'" 1 
HETATM 4233 C  "C5'" . ACP E 4 .   ? 31.377  19.676 61.104  1.00 50.64 ? 101 ACP A "C5'" 1 
HETATM 4234 C  "C4'" . ACP E 4 .   ? 31.203  21.221 60.829  1.00 51.55 ? 101 ACP A "C4'" 1 
HETATM 4235 O  "O4'" . ACP E 4 .   ? 32.384  22.050 60.575  1.00 49.82 ? 101 ACP A "O4'" 1 
HETATM 4236 C  "C3'" . ACP E 4 .   ? 30.242  21.448 59.656  1.00 50.44 ? 101 ACP A "C3'" 1 
HETATM 4237 O  "O3'" . ACP E 4 .   ? 29.009  21.961 60.133  1.00 51.18 ? 101 ACP A "O3'" 1 
HETATM 4238 C  "C2'" . ACP E 4 .   ? 30.871  22.495 58.767  1.00 51.93 ? 101 ACP A "C2'" 1 
HETATM 4239 O  "O2'" . ACP E 4 .   ? 30.062  23.654 58.583  1.00 55.11 ? 101 ACP A "O2'" 1 
HETATM 4240 C  "C1'" . ACP E 4 .   ? 32.216  22.877 59.390  1.00 51.78 ? 101 ACP A "C1'" 1 
HETATM 4241 N  N9    . ACP E 4 .   ? 32.991  22.567 58.149  1.00 53.73 ? 101 ACP A N9    1 
HETATM 4242 C  C8    . ACP E 4 .   ? 33.402  21.311 57.681  1.00 55.75 ? 101 ACP A C8    1 
HETATM 4243 N  N7    . ACP E 4 .   ? 34.060  21.398 56.429  1.00 53.91 ? 101 ACP A N7    1 
HETATM 4244 C  C5    . ACP E 4 .   ? 34.041  22.687 56.089  1.00 50.88 ? 101 ACP A C5    1 
HETATM 4245 C  C6    . ACP E 4 .   ? 34.472  23.498 54.961  1.00 51.39 ? 101 ACP A C6    1 
HETATM 4246 N  N6    . ACP E 4 .   ? 35.113  22.921 53.922  1.00 51.00 ? 101 ACP A N6    1 
HETATM 4247 N  N1    . ACP E 4 .   ? 34.190  24.827 54.988  1.00 52.75 ? 101 ACP A N1    1 
HETATM 4248 C  C2    . ACP E 4 .   ? 33.567  25.438 56.028  1.00 54.27 ? 101 ACP A C2    1 
HETATM 4249 N  N3    . ACP E 4 .   ? 33.116  24.788 57.133  1.00 52.96 ? 101 ACP A N3    1 
HETATM 4250 C  C4    . ACP E 4 .   ? 33.339  23.391 57.172  1.00 51.60 ? 101 ACP A C4    1 
HETATM 4251 MG MG    . MG  F 3 .   ? 19.689  22.301 81.678  1.00 57.50 ? 398 MG  B MG    1 
HETATM 4252 MG MG    . MG  G 3 .   ? 16.471  20.492 84.091  1.00 55.56 ? 399 MG  B MG    1 
HETATM 4253 P  PG    . ACP H 4 .   ? 18.214  18.542 83.589  1.00 59.42 ? 400 ACP B PG    1 
HETATM 4254 O  O1G   . ACP H 4 .   ? 18.692  19.777 82.699  1.00 52.24 ? 400 ACP B O1G   1 
HETATM 4255 O  O2G   . ACP H 4 .   ? 18.446  17.225 82.829  1.00 58.22 ? 400 ACP B O2G   1 
HETATM 4256 O  O3G   . ACP H 4 .   ? 16.738  18.604 84.126  1.00 54.22 ? 400 ACP B O3G   1 
HETATM 4257 P  PB    . ACP H 4 .   ? 20.507  19.771 85.287  1.00 58.55 ? 400 ACP B PB    1 
HETATM 4258 O  O1B   . ACP H 4 .   ? 21.964  19.159 85.220  1.00 54.97 ? 400 ACP B O1B   1 
HETATM 4259 O  O2B   . ACP H 4 .   ? 20.156  20.861 84.241  1.00 54.74 ? 400 ACP B O2B   1 
HETATM 4260 C  C3B   . ACP H 4 .   ? 19.261  18.394 85.112  1.00 53.16 ? 400 ACP B C3B   1 
HETATM 4261 P  PA    . ACP H 4 .   ? 18.940  21.195 87.225  1.00 53.27 ? 400 ACP B PA    1 
HETATM 4262 O  O1A   . ACP H 4 .   ? 18.881  22.684 87.700  1.00 48.16 ? 400 ACP B O1A   1 
HETATM 4263 O  O2A   . ACP H 4 .   ? 17.863  20.671 86.238  1.00 47.51 ? 400 ACP B O2A   1 
HETATM 4264 O  O3A   . ACP H 4 .   ? 20.393  20.604 86.729  1.00 51.01 ? 400 ACP B O3A   1 
HETATM 4265 O  "O5'" . ACP H 4 .   ? 18.866  20.428 88.670  1.00 47.59 ? 400 ACP B "O5'" 1 
HETATM 4266 C  "C5'" . ACP H 4 .   ? 18.613  19.032 88.813  1.00 49.22 ? 400 ACP B "C5'" 1 
HETATM 4267 C  "C4'" . ACP H 4 .   ? 17.744  18.921 90.076  1.00 49.96 ? 400 ACP B "C4'" 1 
HETATM 4268 O  "O4'" . ACP H 4 .   ? 18.420  19.501 91.216  1.00 47.74 ? 400 ACP B "O4'" 1 
HETATM 4269 C  "C3'" . ACP H 4 .   ? 16.433  19.719 90.002  1.00 50.37 ? 400 ACP B "C3'" 1 
HETATM 4270 O  "O3'" . ACP H 4 .   ? 15.363  19.142 89.259  1.00 53.62 ? 400 ACP B "O3'" 1 
HETATM 4271 C  "C2'" . ACP H 4 .   ? 16.040  19.828 91.463  1.00 48.76 ? 400 ACP B "C2'" 1 
HETATM 4272 O  "O2'" . ACP H 4 .   ? 15.175  18.705 91.701  1.00 48.29 ? 400 ACP B "O2'" 1 
HETATM 4273 C  "C1'" . ACP H 4 .   ? 17.418  19.910 92.156  1.00 47.14 ? 400 ACP B "C1'" 1 
HETATM 4274 N  N9    . ACP H 4 .   ? 17.725  21.342 92.423  1.00 47.12 ? 400 ACP B N9    1 
HETATM 4275 C  C8    . ACP H 4 .   ? 18.256  22.215 91.489  1.00 46.57 ? 400 ACP B C8    1 
HETATM 4276 N  N7    . ACP H 4 .   ? 18.424  23.475 92.014  1.00 45.25 ? 400 ACP B N7    1 
HETATM 4277 C  C5    . ACP H 4 .   ? 18.014  23.412 93.282  1.00 42.02 ? 400 ACP B C5    1 
HETATM 4278 C  C6    . ACP H 4 .   ? 17.921  24.355 94.367  1.00 42.53 ? 400 ACP B C6    1 
HETATM 4279 N  N6    . ACP H 4 .   ? 18.327  25.628 94.103  1.00 43.16 ? 400 ACP B N6    1 
HETATM 4280 N  N1    . ACP H 4 .   ? 17.436  23.920 95.556  1.00 43.34 ? 400 ACP B N1    1 
HETATM 4281 C  C2    . ACP H 4 .   ? 17.040  22.625 95.773  1.00 46.12 ? 400 ACP B C2    1 
HETATM 4282 N  N3    . ACP H 4 .   ? 17.076  21.639 94.836  1.00 44.48 ? 400 ACP B N3    1 
HETATM 4283 C  C4    . ACP H 4 .   ? 17.585  22.054 93.550  1.00 45.00 ? 400 ACP B C4    1 
HETATM 4284 O  O     . HOH I 5 .   ? 35.403  22.420 44.384  1.00 34.42 ? 5   HOH A O     1 
HETATM 4285 O  O     . HOH I 5 .   ? 31.507  -4.725 51.696  1.00 43.96 ? 6   HOH A O     1 
HETATM 4286 O  O     . HOH I 5 .   ? 45.721  8.282  47.700  1.00 46.08 ? 10  HOH A O     1 
HETATM 4287 O  O     . HOH I 5 .   ? 7.780   23.605 54.286  1.00 52.57 ? 11  HOH A O     1 
HETATM 4288 O  O     . HOH I 5 .   ? 27.482  27.152 60.032  1.00 49.96 ? 12  HOH A O     1 
HETATM 4289 O  O     . HOH I 5 .   ? 1.573   24.199 59.083  1.00 45.84 ? 13  HOH A O     1 
HETATM 4290 O  O     . HOH J 5 .   ? -12.254 29.226 78.079  1.00 46.66 ? 1   HOH B O     1 
HETATM 4291 O  O     . HOH J 5 .   ? 22.062  26.415 71.426  1.00 21.97 ? 7   HOH B O     1 
HETATM 4292 O  O     . HOH J 5 .   ? 21.009  27.558 86.787  1.00 40.57 ? 8   HOH B O     1 
HETATM 4293 O  O     . HOH J 5 .   ? 14.107  20.642 69.760  1.00 36.89 ? 9   HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   107 ?   ?   ?   A . n 
A 1 2   SER 2   108 ?   ?   ?   A . n 
A 1 3   ALA 3   109 ?   ?   ?   A . n 
A 1 4   GLY 4   110 ?   ?   ?   A . n 
A 1 5   GLU 5   111 ?   ?   ?   A . n 
A 1 6   GLY 6   112 ?   ?   ?   A . n 
A 1 7   PRO 7   113 ?   ?   ?   A . n 
A 1 8   LEU 8   114 ?   ?   ?   A . n 
A 1 9   GLN 9   115 115 GLN GLN A . n 
A 1 10  SER 10  116 116 SER SER A . n 
A 1 11  LEU 11  117 117 LEU LEU A . n 
A 1 12  THR 12  118 118 THR THR A . n 
A 1 13  CYS 13  119 119 CYS CYS A . n 
A 1 14  LEU 14  120 120 LEU LEU A . n 
A 1 15  ILE 15  121 121 ILE ILE A . n 
A 1 16  GLY 16  122 122 GLY GLY A . n 
A 1 17  GLU 17  123 123 GLU GLU A . n 
A 1 18  LYS 18  124 124 LYS LYS A . n 
A 1 19  ASP 19  125 125 ASP ASP A . n 
A 1 20  LEU 20  126 126 LEU LEU A . n 
A 1 21  ARG 21  127 127 ARG ARG A . n 
A 1 22  LEU 22  128 128 LEU LEU A . n 
A 1 23  LEU 23  129 129 LEU LEU A . n 
A 1 24  GLU 24  130 130 GLU GLU A . n 
A 1 25  LYS 25  131 131 LYS LYS A . n 
A 1 26  LEU 26  132 132 LEU LEU A . n 
A 1 27  GLY 27  133 133 GLY GLY A . n 
A 1 28  ASP 28  134 134 ASP ASP A . n 
A 1 29  GLY 29  135 ?   ?   ?   A . n 
A 1 30  SER 30  136 ?   ?   ?   A . n 
A 1 31  PHE 31  137 ?   ?   ?   A . n 
A 1 32  GLY 32  138 138 GLY GLY A . n 
A 1 33  VAL 33  139 139 VAL VAL A . n 
A 1 34  VAL 34  140 140 VAL VAL A . n 
A 1 35  ARG 35  141 141 ARG ARG A . n 
A 1 36  ARG 36  142 142 ARG ARG A . n 
A 1 37  GLY 37  143 143 GLY GLY A . n 
A 1 38  GLU 38  144 144 GLU GLU A . n 
A 1 39  TRP 39  145 145 TRP TRP A . n 
A 1 40  ASP 40  146 146 ASP ASP A . n 
A 1 41  ALA 41  147 147 ALA ALA A . n 
A 1 42  PRO 42  148 148 PRO PRO A . n 
A 1 43  SER 43  149 149 SER SER A . n 
A 1 44  GLY 44  150 150 GLY GLY A . n 
A 1 45  LYS 45  151 151 LYS LYS A . n 
A 1 46  THR 46  152 152 THR THR A . n 
A 1 47  VAL 47  153 153 VAL VAL A . n 
A 1 48  SER 48  154 154 SER SER A . n 
A 1 49  VAL 49  155 155 VAL VAL A . n 
A 1 50  ALA 50  156 156 ALA ALA A . n 
A 1 51  VAL 51  157 157 VAL VAL A . n 
A 1 52  LYS 52  158 158 LYS LYS A . n 
A 1 53  CYS 53  159 159 CYS CYS A . n 
A 1 54  LEU 54  160 160 LEU LEU A . n 
A 1 55  LYS 55  161 ?   ?   ?   A . n 
A 1 56  PRO 56  162 ?   ?   ?   A . n 
A 1 57  ASP 57  163 ?   ?   ?   A . n 
A 1 58  VAL 58  164 ?   ?   ?   A . n 
A 1 59  LEU 59  165 ?   ?   ?   A . n 
A 1 60  SER 60  166 ?   ?   ?   A . n 
A 1 61  GLN 61  167 ?   ?   ?   A . n 
A 1 62  PRO 62  168 ?   ?   ?   A . n 
A 1 63  GLU 63  169 ?   ?   ?   A . n 
A 1 64  ALA 64  170 170 ALA ALA A . n 
A 1 65  MET 65  171 171 MET MET A . n 
A 1 66  ASP 66  172 172 ASP ASP A . n 
A 1 67  ASP 67  173 173 ASP ASP A . n 
A 1 68  PHE 68  174 174 PHE PHE A . n 
A 1 69  ILE 69  175 175 ILE ILE A . n 
A 1 70  ARG 70  176 176 ARG ARG A . n 
A 1 71  GLU 71  177 177 GLU GLU A . n 
A 1 72  VAL 72  178 178 VAL VAL A . n 
A 1 73  ASN 73  179 179 ASN ASN A . n 
A 1 74  ALA 74  180 180 ALA ALA A . n 
A 1 75  MET 75  181 181 MET MET A . n 
A 1 76  HIS 76  182 182 HIS HIS A . n 
A 1 77  SER 77  183 183 SER SER A . n 
A 1 78  LEU 78  184 184 LEU LEU A . n 
A 1 79  ASP 79  185 185 ASP ASP A . n 
A 1 80  HIS 80  186 186 HIS HIS A . n 
A 1 81  ARG 81  187 187 ARG ARG A . n 
A 1 82  ASN 82  188 188 ASN ASN A . n 
A 1 83  LEU 83  189 189 LEU LEU A . n 
A 1 84  ILE 84  190 190 ILE ILE A . n 
A 1 85  ARG 85  191 191 ARG ARG A . n 
A 1 86  LEU 86  192 192 LEU LEU A . n 
A 1 87  TYR 87  193 193 TYR TYR A . n 
A 1 88  GLY 88  194 194 GLY GLY A . n 
A 1 89  VAL 89  195 195 VAL VAL A . n 
A 1 90  VAL 90  196 196 VAL VAL A . n 
A 1 91  LEU 91  197 197 LEU LEU A . n 
A 1 92  THR 92  198 198 THR THR A . n 
A 1 93  PRO 93  199 199 PRO PRO A . n 
A 1 94  PRO 94  200 200 PRO PRO A . n 
A 1 95  MET 95  201 201 MET MET A . n 
A 1 96  LYS 96  202 202 LYS LYS A . n 
A 1 97  MET 97  203 203 MET MET A . n 
A 1 98  VAL 98  204 204 VAL VAL A . n 
A 1 99  THR 99  205 205 THR THR A . n 
A 1 100 GLU 100 206 206 GLU GLU A . n 
A 1 101 LEU 101 207 207 LEU LEU A . n 
A 1 102 ALA 102 208 208 ALA ALA A . n 
A 1 103 PRO 103 209 209 PRO PRO A . n 
A 1 104 LEU 104 210 210 LEU LEU A . n 
A 1 105 GLY 105 211 211 GLY GLY A . n 
A 1 106 SER 106 212 212 SER SER A . n 
A 1 107 LEU 107 213 213 LEU LEU A . n 
A 1 108 LEU 108 214 214 LEU LEU A . n 
A 1 109 ASP 109 215 215 ASP ASP A . n 
A 1 110 ARG 110 216 216 ARG ARG A . n 
A 1 111 LEU 111 217 217 LEU LEU A . n 
A 1 112 ARG 112 218 218 ARG ARG A . n 
A 1 113 LYS 113 219 219 LYS LYS A . n 
A 1 114 HIS 114 220 220 HIS HIS A . n 
A 1 115 GLN 115 221 221 GLN GLN A . n 
A 1 116 GLY 116 222 222 GLY GLY A . n 
A 1 117 HIS 117 223 223 HIS HIS A . n 
A 1 118 PHE 118 224 224 PHE PHE A . n 
A 1 119 LEU 119 225 225 LEU LEU A . n 
A 1 120 LEU 120 226 226 LEU LEU A . n 
A 1 121 GLY 121 227 227 GLY GLY A . n 
A 1 122 THR 122 228 228 THR THR A . n 
A 1 123 LEU 123 229 229 LEU LEU A . n 
A 1 124 SER 124 230 230 SER SER A . n 
A 1 125 ARG 125 231 231 ARG ARG A . n 
A 1 126 TYR 126 232 232 TYR TYR A . n 
A 1 127 ALA 127 233 233 ALA ALA A . n 
A 1 128 VAL 128 234 234 VAL VAL A . n 
A 1 129 GLN 129 235 235 GLN GLN A . n 
A 1 130 VAL 130 236 236 VAL VAL A . n 
A 1 131 ALA 131 237 237 ALA ALA A . n 
A 1 132 GLU 132 238 238 GLU GLU A . n 
A 1 133 GLY 133 239 239 GLY GLY A . n 
A 1 134 MET 134 240 240 MET MET A . n 
A 1 135 GLY 135 241 241 GLY GLY A . n 
A 1 136 TYR 136 242 242 TYR TYR A . n 
A 1 137 LEU 137 243 243 LEU LEU A . n 
A 1 138 GLU 138 244 244 GLU GLU A . n 
A 1 139 SER 139 245 245 SER SER A . n 
A 1 140 LYS 140 246 246 LYS LYS A . n 
A 1 141 ARG 141 247 247 ARG ARG A . n 
A 1 142 PHE 142 248 248 PHE PHE A . n 
A 1 143 ILE 143 249 249 ILE ILE A . n 
A 1 144 HIS 144 250 250 HIS HIS A . n 
A 1 145 ARG 145 251 251 ARG ARG A . n 
A 1 146 ASP 146 252 252 ASP ASP A . n 
A 1 147 LEU 147 253 253 LEU LEU A . n 
A 1 148 ALA 148 254 254 ALA ALA A . n 
A 1 149 ALA 149 255 255 ALA ALA A . n 
A 1 150 ARG 150 256 256 ARG ARG A . n 
A 1 151 ASN 151 257 257 ASN ASN A . n 
A 1 152 LEU 152 258 258 LEU LEU A . n 
A 1 153 LEU 153 259 259 LEU LEU A . n 
A 1 154 LEU 154 260 260 LEU LEU A . n 
A 1 155 ALA 155 261 261 ALA ALA A . n 
A 1 156 THR 156 262 262 THR THR A . n 
A 1 157 ARG 157 263 263 ARG ARG A . n 
A 1 158 ASP 158 264 264 ASP ASP A . n 
A 1 159 LEU 159 265 265 LEU LEU A . n 
A 1 160 VAL 160 266 266 VAL VAL A . n 
A 1 161 LYS 161 267 267 LYS LYS A . n 
A 1 162 ILE 162 268 268 ILE ILE A . n 
A 1 163 GLY 163 269 269 GLY GLY A . n 
A 1 164 ASP 164 270 270 ASP ASP A . n 
A 1 165 PHE 165 271 271 PHE PHE A . n 
A 1 166 GLY 166 272 272 GLY GLY A . n 
A 1 167 LEU 167 273 273 LEU LEU A . n 
A 1 168 MET 168 274 274 MET MET A . n 
A 1 169 ARG 169 275 275 ARG ARG A . n 
A 1 170 ALA 170 276 276 ALA ALA A . n 
A 1 171 LEU 171 277 277 LEU LEU A . n 
A 1 172 PRO 172 278 278 PRO PRO A . n 
A 1 173 GLN 173 279 279 GLN GLN A . n 
A 1 174 ASN 174 280 280 ASN ASN A . n 
A 1 175 ASP 175 281 281 ASP ASP A . n 
A 1 176 ASP 176 282 282 ASP ASP A . n 
A 1 177 HIS 177 283 283 HIS HIS A . n 
A 1 178 PTR 178 284 284 PTR PTR A . n 
A 1 179 VAL 179 285 285 VAL VAL A . n 
A 1 180 MET 180 286 286 MET MET A . n 
A 1 181 GLN 181 287 287 GLN GLN A . n 
A 1 182 GLU 182 288 288 GLU GLU A . n 
A 1 183 HIS 183 289 289 HIS HIS A . n 
A 1 184 ARG 184 290 290 ARG ARG A . n 
A 1 185 LYS 185 291 ?   ?   ?   A . n 
A 1 186 VAL 186 292 292 VAL VAL A . n 
A 1 187 PRO 187 293 293 PRO PRO A . n 
A 1 188 PHE 188 294 294 PHE PHE A . n 
A 1 189 ALA 189 295 295 ALA ALA A . n 
A 1 190 TRP 190 296 296 TRP TRP A . n 
A 1 191 CYS 191 297 297 CYS CYS A . n 
A 1 192 ALA 192 298 298 ALA ALA A . n 
A 1 193 PRO 193 299 299 PRO PRO A . n 
A 1 194 GLU 194 300 300 GLU GLU A . n 
A 1 195 SER 195 301 301 SER SER A . n 
A 1 196 LEU 196 302 302 LEU LEU A . n 
A 1 197 LYS 197 303 303 LYS LYS A . n 
A 1 198 THR 198 304 304 THR THR A . n 
A 1 199 ARG 199 305 305 ARG ARG A . n 
A 1 200 THR 200 306 306 THR THR A . n 
A 1 201 PHE 201 307 307 PHE PHE A . n 
A 1 202 SER 202 308 308 SER SER A . n 
A 1 203 HIS 203 309 309 HIS HIS A . n 
A 1 204 ALA 204 310 310 ALA ALA A . n 
A 1 205 SER 205 311 311 SER SER A . n 
A 1 206 ASP 206 312 312 ASP ASP A . n 
A 1 207 THR 207 313 313 THR THR A . n 
A 1 208 TRP 208 314 314 TRP TRP A . n 
A 1 209 MET 209 315 315 MET MET A . n 
A 1 210 PHE 210 316 316 PHE PHE A . n 
A 1 211 GLY 211 317 317 GLY GLY A . n 
A 1 212 VAL 212 318 318 VAL VAL A . n 
A 1 213 THR 213 319 319 THR THR A . n 
A 1 214 LEU 214 320 320 LEU LEU A . n 
A 1 215 TRP 215 321 321 TRP TRP A . n 
A 1 216 GLU 216 322 322 GLU GLU A . n 
A 1 217 MET 217 323 323 MET MET A . n 
A 1 218 PHE 218 324 324 PHE PHE A . n 
A 1 219 THR 219 325 325 THR THR A . n 
A 1 220 TYR 220 326 326 TYR TYR A . n 
A 1 221 GLY 221 327 327 GLY GLY A . n 
A 1 222 GLN 222 328 328 GLN GLN A . n 
A 1 223 GLU 223 329 329 GLU GLU A . n 
A 1 224 PRO 224 330 330 PRO PRO A . n 
A 1 225 TRP 225 331 331 TRP TRP A . n 
A 1 226 ILE 226 332 332 ILE ILE A . n 
A 1 227 GLY 227 333 333 GLY GLY A . n 
A 1 228 LEU 228 334 334 LEU LEU A . n 
A 1 229 ASN 229 335 335 ASN ASN A . n 
A 1 230 GLY 230 336 336 GLY GLY A . n 
A 1 231 SER 231 337 337 SER SER A . n 
A 1 232 GLN 232 338 338 GLN GLN A . n 
A 1 233 ILE 233 339 339 ILE ILE A . n 
A 1 234 LEU 234 340 340 LEU LEU A . n 
A 1 235 HIS 235 341 341 HIS HIS A . n 
A 1 236 LYS 236 342 342 LYS LYS A . n 
A 1 237 ILE 237 343 343 ILE ILE A . n 
A 1 238 ASP 238 344 344 ASP ASP A . n 
A 1 239 LYS 239 345 345 LYS LYS A . n 
A 1 240 GLU 240 346 346 GLU GLU A . n 
A 1 241 GLY 241 347 347 GLY GLY A . n 
A 1 242 GLU 242 348 348 GLU GLU A . n 
A 1 243 ARG 243 349 349 ARG ARG A . n 
A 1 244 LEU 244 350 350 LEU LEU A . n 
A 1 245 PRO 245 351 351 PRO PRO A . n 
A 1 246 ARG 246 352 352 ARG ARG A . n 
A 1 247 PRO 247 353 353 PRO PRO A . n 
A 1 248 GLU 248 354 354 GLU GLU A . n 
A 1 249 ASP 249 355 355 ASP ASP A . n 
A 1 250 CYS 250 356 356 CYS CYS A . n 
A 1 251 PRO 251 357 357 PRO PRO A . n 
A 1 252 GLN 252 358 358 GLN GLN A . n 
A 1 253 ASP 253 359 359 ASP ASP A . n 
A 1 254 ILE 254 360 360 ILE ILE A . n 
A 1 255 TYR 255 361 361 TYR TYR A . n 
A 1 256 ASN 256 362 362 ASN ASN A . n 
A 1 257 VAL 257 363 363 VAL VAL A . n 
A 1 258 MET 258 364 364 MET MET A . n 
A 1 259 VAL 259 365 365 VAL VAL A . n 
A 1 260 GLN 260 366 366 GLN GLN A . n 
A 1 261 CYS 261 367 367 CYS CYS A . n 
A 1 262 TRP 262 368 368 TRP TRP A . n 
A 1 263 ALA 263 369 369 ALA ALA A . n 
A 1 264 HIS 264 370 370 HIS HIS A . n 
A 1 265 LYS 265 371 371 LYS LYS A . n 
A 1 266 PRO 266 372 372 PRO PRO A . n 
A 1 267 GLU 267 373 373 GLU GLU A . n 
A 1 268 ASP 268 374 374 ASP ASP A . n 
A 1 269 ARG 269 375 375 ARG ARG A . n 
A 1 270 PRO 270 376 376 PRO PRO A . n 
A 1 271 THR 271 377 377 THR THR A . n 
A 1 272 PHE 272 378 378 PHE PHE A . n 
A 1 273 VAL 273 379 379 VAL VAL A . n 
A 1 274 ALA 274 380 380 ALA ALA A . n 
A 1 275 LEU 275 381 381 LEU LEU A . n 
A 1 276 ARG 276 382 382 ARG ARG A . n 
A 1 277 ASP 277 383 383 ASP ASP A . n 
A 1 278 PHE 278 384 384 PHE PHE A . n 
A 1 279 LEU 279 385 385 LEU LEU A . n 
A 1 280 LEU 280 386 386 LEU LEU A . n 
A 1 281 GLU 281 387 387 GLU GLU A . n 
A 1 282 ALA 282 388 388 ALA ALA A . n 
A 1 283 GLN 283 389 389 GLN GLN A . n 
A 1 284 PRO 284 390 390 PRO PRO A . n 
A 1 285 THR 285 391 ?   ?   ?   A . n 
A 1 286 ASP 286 392 ?   ?   ?   A . n 
A 1 287 MET 287 393 ?   ?   ?   A . n 
A 1 288 ARG 288 394 ?   ?   ?   A . n 
A 1 289 ALA 289 395 ?   ?   ?   A . n 
A 1 290 GLU 290 396 ?   ?   ?   A . n 
A 1 291 PHE 291 397 ?   ?   ?   A . n 
B 2 1   GLY 1   107 ?   ?   ?   B . n 
B 2 2   SER 2   108 ?   ?   ?   B . n 
B 2 3   ALA 3   109 ?   ?   ?   B . n 
B 2 4   GLY 4   110 ?   ?   ?   B . n 
B 2 5   GLU 5   111 ?   ?   ?   B . n 
B 2 6   GLY 6   112 ?   ?   ?   B . n 
B 2 7   PRO 7   113 ?   ?   ?   B . n 
B 2 8   LEU 8   114 ?   ?   ?   B . n 
B 2 9   GLN 9   115 ?   ?   ?   B . n 
B 2 10  SER 10  116 ?   ?   ?   B . n 
B 2 11  LEU 11  117 117 LEU LEU B . n 
B 2 12  THR 12  118 118 THR THR B . n 
B 2 13  CYS 13  119 119 CYS CYS B . n 
B 2 14  LEU 14  120 120 LEU LEU B . n 
B 2 15  ILE 15  121 121 ILE ILE B . n 
B 2 16  GLY 16  122 122 GLY GLY B . n 
B 2 17  GLU 17  123 123 GLU GLU B . n 
B 2 18  LYS 18  124 124 LYS LYS B . n 
B 2 19  ASP 19  125 125 ASP ASP B . n 
B 2 20  LEU 20  126 126 LEU LEU B . n 
B 2 21  ARG 21  127 127 ARG ARG B . n 
B 2 22  LEU 22  128 128 LEU LEU B . n 
B 2 23  LEU 23  129 129 LEU LEU B . n 
B 2 24  GLU 24  130 130 GLU GLU B . n 
B 2 25  LYS 25  131 131 LYS LYS B . n 
B 2 26  LEU 26  132 132 LEU LEU B . n 
B 2 27  GLY 27  133 133 GLY GLY B . n 
B 2 28  ASP 28  134 134 ASP ASP B . n 
B 2 29  GLY 29  135 ?   ?   ?   B . n 
B 2 30  SER 30  136 ?   ?   ?   B . n 
B 2 31  PHE 31  137 ?   ?   ?   B . n 
B 2 32  GLY 32  138 138 GLY GLY B . n 
B 2 33  VAL 33  139 139 VAL VAL B . n 
B 2 34  VAL 34  140 140 VAL VAL B . n 
B 2 35  ARG 35  141 141 ARG ARG B . n 
B 2 36  ARG 36  142 142 ARG ARG B . n 
B 2 37  GLY 37  143 143 GLY GLY B . n 
B 2 38  GLU 38  144 144 GLU GLU B . n 
B 2 39  TRP 39  145 145 TRP TRP B . n 
B 2 40  ASP 40  146 146 ASP ASP B . n 
B 2 41  ALA 41  147 147 ALA ALA B . n 
B 2 42  PRO 42  148 148 PRO PRO B . n 
B 2 43  SER 43  149 149 SER SER B . n 
B 2 44  GLY 44  150 150 GLY GLY B . n 
B 2 45  LYS 45  151 151 LYS LYS B . n 
B 2 46  THR 46  152 152 THR THR B . n 
B 2 47  VAL 47  153 153 VAL VAL B . n 
B 2 48  SER 48  154 154 SER SER B . n 
B 2 49  VAL 49  155 155 VAL VAL B . n 
B 2 50  ALA 50  156 156 ALA ALA B . n 
B 2 51  VAL 51  157 157 VAL VAL B . n 
B 2 52  LYS 52  158 158 LYS LYS B . n 
B 2 53  CYS 53  159 159 CYS CYS B . n 
B 2 54  LEU 54  160 160 LEU LEU B . n 
B 2 55  LYS 55  161 ?   ?   ?   B . n 
B 2 56  PRO 56  162 ?   ?   ?   B . n 
B 2 57  ASP 57  163 ?   ?   ?   B . n 
B 2 58  VAL 58  164 ?   ?   ?   B . n 
B 2 59  LEU 59  165 ?   ?   ?   B . n 
B 2 60  SER 60  166 ?   ?   ?   B . n 
B 2 61  GLN 61  167 ?   ?   ?   B . n 
B 2 62  PRO 62  168 ?   ?   ?   B . n 
B 2 63  GLU 63  169 169 GLU GLU B . n 
B 2 64  ALA 64  170 170 ALA ALA B . n 
B 2 65  MET 65  171 171 MET MET B . n 
B 2 66  ASP 66  172 172 ASP ASP B . n 
B 2 67  ASP 67  173 173 ASP ASP B . n 
B 2 68  PHE 68  174 174 PHE PHE B . n 
B 2 69  ILE 69  175 175 ILE ILE B . n 
B 2 70  ARG 70  176 176 ARG ARG B . n 
B 2 71  GLU 71  177 177 GLU GLU B . n 
B 2 72  VAL 72  178 178 VAL VAL B . n 
B 2 73  ASN 73  179 179 ASN ASN B . n 
B 2 74  ALA 74  180 180 ALA ALA B . n 
B 2 75  MET 75  181 181 MET MET B . n 
B 2 76  HIS 76  182 182 HIS HIS B . n 
B 2 77  SER 77  183 183 SER SER B . n 
B 2 78  LEU 78  184 184 LEU LEU B . n 
B 2 79  ASP 79  185 185 ASP ASP B . n 
B 2 80  HIS 80  186 186 HIS HIS B . n 
B 2 81  ARG 81  187 187 ARG ARG B . n 
B 2 82  ASN 82  188 188 ASN ASN B . n 
B 2 83  LEU 83  189 189 LEU LEU B . n 
B 2 84  ILE 84  190 190 ILE ILE B . n 
B 2 85  ARG 85  191 191 ARG ARG B . n 
B 2 86  LEU 86  192 192 LEU LEU B . n 
B 2 87  TYR 87  193 193 TYR TYR B . n 
B 2 88  GLY 88  194 194 GLY GLY B . n 
B 2 89  VAL 89  195 195 VAL VAL B . n 
B 2 90  VAL 90  196 196 VAL VAL B . n 
B 2 91  LEU 91  197 197 LEU LEU B . n 
B 2 92  THR 92  198 198 THR THR B . n 
B 2 93  PRO 93  199 199 PRO PRO B . n 
B 2 94  PRO 94  200 200 PRO PRO B . n 
B 2 95  MET 95  201 201 MET MET B . n 
B 2 96  LYS 96  202 202 LYS LYS B . n 
B 2 97  MET 97  203 203 MET MET B . n 
B 2 98  VAL 98  204 204 VAL VAL B . n 
B 2 99  THR 99  205 205 THR THR B . n 
B 2 100 GLU 100 206 206 GLU GLU B . n 
B 2 101 LEU 101 207 207 LEU LEU B . n 
B 2 102 ALA 102 208 208 ALA ALA B . n 
B 2 103 PRO 103 209 209 PRO PRO B . n 
B 2 104 LEU 104 210 210 LEU LEU B . n 
B 2 105 GLY 105 211 211 GLY GLY B . n 
B 2 106 SER 106 212 212 SER SER B . n 
B 2 107 LEU 107 213 213 LEU LEU B . n 
B 2 108 LEU 108 214 214 LEU LEU B . n 
B 2 109 ASP 109 215 215 ASP ASP B . n 
B 2 110 ARG 110 216 216 ARG ARG B . n 
B 2 111 LEU 111 217 217 LEU LEU B . n 
B 2 112 ARG 112 218 218 ARG ARG B . n 
B 2 113 LYS 113 219 219 LYS LYS B . n 
B 2 114 HIS 114 220 220 HIS HIS B . n 
B 2 115 GLN 115 221 221 GLN GLN B . n 
B 2 116 GLY 116 222 222 GLY GLY B . n 
B 2 117 HIS 117 223 223 HIS HIS B . n 
B 2 118 PHE 118 224 224 PHE PHE B . n 
B 2 119 LEU 119 225 225 LEU LEU B . n 
B 2 120 LEU 120 226 226 LEU LEU B . n 
B 2 121 GLY 121 227 227 GLY GLY B . n 
B 2 122 THR 122 228 228 THR THR B . n 
B 2 123 LEU 123 229 229 LEU LEU B . n 
B 2 124 SER 124 230 230 SER SER B . n 
B 2 125 ARG 125 231 231 ARG ARG B . n 
B 2 126 TYR 126 232 232 TYR TYR B . n 
B 2 127 ALA 127 233 233 ALA ALA B . n 
B 2 128 VAL 128 234 234 VAL VAL B . n 
B 2 129 GLN 129 235 235 GLN GLN B . n 
B 2 130 VAL 130 236 236 VAL VAL B . n 
B 2 131 ALA 131 237 237 ALA ALA B . n 
B 2 132 GLU 132 238 238 GLU GLU B . n 
B 2 133 GLY 133 239 239 GLY GLY B . n 
B 2 134 MET 134 240 240 MET MET B . n 
B 2 135 GLY 135 241 241 GLY GLY B . n 
B 2 136 TYR 136 242 242 TYR TYR B . n 
B 2 137 LEU 137 243 243 LEU LEU B . n 
B 2 138 GLU 138 244 244 GLU GLU B . n 
B 2 139 SER 139 245 245 SER SER B . n 
B 2 140 LYS 140 246 246 LYS LYS B . n 
B 2 141 ARG 141 247 247 ARG ARG B . n 
B 2 142 PHE 142 248 248 PHE PHE B . n 
B 2 143 ILE 143 249 249 ILE ILE B . n 
B 2 144 HIS 144 250 250 HIS HIS B . n 
B 2 145 ARG 145 251 251 ARG ARG B . n 
B 2 146 ASP 146 252 252 ASP ASP B . n 
B 2 147 LEU 147 253 253 LEU LEU B . n 
B 2 148 ALA 148 254 254 ALA ALA B . n 
B 2 149 ALA 149 255 255 ALA ALA B . n 
B 2 150 ARG 150 256 256 ARG ARG B . n 
B 2 151 ASN 151 257 257 ASN ASN B . n 
B 2 152 LEU 152 258 258 LEU LEU B . n 
B 2 153 LEU 153 259 259 LEU LEU B . n 
B 2 154 LEU 154 260 260 LEU LEU B . n 
B 2 155 ALA 155 261 261 ALA ALA B . n 
B 2 156 THR 156 262 262 THR THR B . n 
B 2 157 ARG 157 263 263 ARG ARG B . n 
B 2 158 ASP 158 264 264 ASP ASP B . n 
B 2 159 LEU 159 265 265 LEU LEU B . n 
B 2 160 VAL 160 266 266 VAL VAL B . n 
B 2 161 LYS 161 267 267 LYS LYS B . n 
B 2 162 ILE 162 268 268 ILE ILE B . n 
B 2 163 GLY 163 269 269 GLY GLY B . n 
B 2 164 ASP 164 270 270 ASP ASP B . n 
B 2 165 PHE 165 271 271 PHE PHE B . n 
B 2 166 GLY 166 272 272 GLY GLY B . n 
B 2 167 LEU 167 273 273 LEU LEU B . n 
B 2 168 MET 168 274 274 MET MET B . n 
B 2 169 ARG 169 275 275 ARG ARG B . n 
B 2 170 ALA 170 276 276 ALA ALA B . n 
B 2 171 LEU 171 277 277 LEU LEU B . n 
B 2 172 PRO 172 278 278 PRO PRO B . n 
B 2 173 GLN 173 279 279 GLN GLN B . n 
B 2 174 ASN 174 280 280 ASN ASN B . n 
B 2 175 ASP 175 281 281 ASP ASP B . n 
B 2 176 ASP 176 282 282 ASP ASP B . n 
B 2 177 HIS 177 283 283 HIS HIS B . n 
B 2 178 TYR 178 284 284 TYR TYR B . n 
B 2 179 VAL 179 285 285 VAL VAL B . n 
B 2 180 MET 180 286 286 MET MET B . n 
B 2 181 GLN 181 287 287 GLN GLN B . n 
B 2 182 GLU 182 288 288 GLU GLU B . n 
B 2 183 HIS 183 289 289 HIS HIS B . n 
B 2 184 ARG 184 290 290 ARG ARG B . n 
B 2 185 LYS 185 291 291 LYS LYS B . n 
B 2 186 VAL 186 292 292 VAL VAL B . n 
B 2 187 PRO 187 293 293 PRO PRO B . n 
B 2 188 PHE 188 294 294 PHE PHE B . n 
B 2 189 ALA 189 295 295 ALA ALA B . n 
B 2 190 TRP 190 296 296 TRP TRP B . n 
B 2 191 CYS 191 297 297 CYS CYS B . n 
B 2 192 ALA 192 298 298 ALA ALA B . n 
B 2 193 PRO 193 299 299 PRO PRO B . n 
B 2 194 GLU 194 300 300 GLU GLU B . n 
B 2 195 SER 195 301 301 SER SER B . n 
B 2 196 LEU 196 302 302 LEU LEU B . n 
B 2 197 LYS 197 303 303 LYS LYS B . n 
B 2 198 THR 198 304 304 THR THR B . n 
B 2 199 ARG 199 305 305 ARG ARG B . n 
B 2 200 THR 200 306 306 THR THR B . n 
B 2 201 PHE 201 307 307 PHE PHE B . n 
B 2 202 SER 202 308 308 SER SER B . n 
B 2 203 HIS 203 309 309 HIS HIS B . n 
B 2 204 ALA 204 310 310 ALA ALA B . n 
B 2 205 SER 205 311 311 SER SER B . n 
B 2 206 ASP 206 312 312 ASP ASP B . n 
B 2 207 THR 207 313 313 THR THR B . n 
B 2 208 TRP 208 314 314 TRP TRP B . n 
B 2 209 MET 209 315 315 MET MET B . n 
B 2 210 PHE 210 316 316 PHE PHE B . n 
B 2 211 GLY 211 317 317 GLY GLY B . n 
B 2 212 VAL 212 318 318 VAL VAL B . n 
B 2 213 THR 213 319 319 THR THR B . n 
B 2 214 LEU 214 320 320 LEU LEU B . n 
B 2 215 TRP 215 321 321 TRP TRP B . n 
B 2 216 GLU 216 322 322 GLU GLU B . n 
B 2 217 MET 217 323 323 MET MET B . n 
B 2 218 PHE 218 324 324 PHE PHE B . n 
B 2 219 THR 219 325 325 THR THR B . n 
B 2 220 TYR 220 326 326 TYR TYR B . n 
B 2 221 GLY 221 327 327 GLY GLY B . n 
B 2 222 GLN 222 328 328 GLN GLN B . n 
B 2 223 GLU 223 329 329 GLU GLU B . n 
B 2 224 PRO 224 330 330 PRO PRO B . n 
B 2 225 TRP 225 331 331 TRP TRP B . n 
B 2 226 ILE 226 332 332 ILE ILE B . n 
B 2 227 GLY 227 333 333 GLY GLY B . n 
B 2 228 LEU 228 334 334 LEU LEU B . n 
B 2 229 ASN 229 335 335 ASN ASN B . n 
B 2 230 GLY 230 336 336 GLY GLY B . n 
B 2 231 SER 231 337 337 SER SER B . n 
B 2 232 GLN 232 338 338 GLN GLN B . n 
B 2 233 ILE 233 339 339 ILE ILE B . n 
B 2 234 LEU 234 340 340 LEU LEU B . n 
B 2 235 HIS 235 341 341 HIS HIS B . n 
B 2 236 LYS 236 342 342 LYS LYS B . n 
B 2 237 ILE 237 343 343 ILE ILE B . n 
B 2 238 ASP 238 344 344 ASP ASP B . n 
B 2 239 LYS 239 345 345 LYS LYS B . n 
B 2 240 GLU 240 346 346 GLU GLU B . n 
B 2 241 GLY 241 347 347 GLY GLY B . n 
B 2 242 GLU 242 348 348 GLU GLU B . n 
B 2 243 ARG 243 349 349 ARG ARG B . n 
B 2 244 LEU 244 350 350 LEU LEU B . n 
B 2 245 PRO 245 351 351 PRO PRO B . n 
B 2 246 ARG 246 352 352 ARG ARG B . n 
B 2 247 PRO 247 353 353 PRO PRO B . n 
B 2 248 GLU 248 354 354 GLU GLU B . n 
B 2 249 ASP 249 355 355 ASP ASP B . n 
B 2 250 CYS 250 356 356 CYS CYS B . n 
B 2 251 PRO 251 357 357 PRO PRO B . n 
B 2 252 GLN 252 358 358 GLN GLN B . n 
B 2 253 ASP 253 359 359 ASP ASP B . n 
B 2 254 ILE 254 360 360 ILE ILE B . n 
B 2 255 TYR 255 361 361 TYR TYR B . n 
B 2 256 ASN 256 362 362 ASN ASN B . n 
B 2 257 VAL 257 363 363 VAL VAL B . n 
B 2 258 MET 258 364 364 MET MET B . n 
B 2 259 VAL 259 365 365 VAL VAL B . n 
B 2 260 GLN 260 366 366 GLN GLN B . n 
B 2 261 CYS 261 367 367 CYS CYS B . n 
B 2 262 TRP 262 368 368 TRP TRP B . n 
B 2 263 ALA 263 369 369 ALA ALA B . n 
B 2 264 HIS 264 370 370 HIS HIS B . n 
B 2 265 LYS 265 371 371 LYS LYS B . n 
B 2 266 PRO 266 372 372 PRO PRO B . n 
B 2 267 GLU 267 373 373 GLU GLU B . n 
B 2 268 ASP 268 374 374 ASP ASP B . n 
B 2 269 ARG 269 375 375 ARG ARG B . n 
B 2 270 PRO 270 376 376 PRO PRO B . n 
B 2 271 THR 271 377 377 THR THR B . n 
B 2 272 PHE 272 378 378 PHE PHE B . n 
B 2 273 VAL 273 379 379 VAL VAL B . n 
B 2 274 ALA 274 380 380 ALA ALA B . n 
B 2 275 LEU 275 381 381 LEU LEU B . n 
B 2 276 ARG 276 382 382 ARG ARG B . n 
B 2 277 ASP 277 383 383 ASP ASP B . n 
B 2 278 PHE 278 384 384 PHE PHE B . n 
B 2 279 LEU 279 385 385 LEU LEU B . n 
B 2 280 LEU 280 386 386 LEU LEU B . n 
B 2 281 GLU 281 387 387 GLU GLU B . n 
B 2 282 ALA 282 388 388 ALA ALA B . n 
B 2 283 GLN 283 389 ?   ?   ?   B . n 
B 2 284 PRO 284 390 ?   ?   ?   B . n 
B 2 285 THR 285 391 ?   ?   ?   B . n 
B 2 286 ASP 286 392 ?   ?   ?   B . n 
B 2 287 MET 287 393 ?   ?   ?   B . n 
B 2 288 ARG 288 394 ?   ?   ?   B . n 
B 2 289 ALA 289 395 ?   ?   ?   B . n 
B 2 290 GLU 290 396 ?   ?   ?   B . n 
B 2 291 PHE 291 397 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MG  1 398 1  MG  MG  A . 
D 3 MG  1 399 2  MG  MG  A . 
E 4 ACP 1 101 1  ACP ACP A . 
F 3 MG  1 398 3  MG  MG  B . 
G 3 MG  1 399 4  MG  MG  B . 
H 4 ACP 1 400 1  ACP ACP B . 
I 5 HOH 1 5   5  HOH HOH A . 
I 5 HOH 2 6   6  HOH HOH A . 
I 5 HOH 3 10  10 HOH HOH A . 
I 5 HOH 4 11  11 HOH HOH A . 
I 5 HOH 5 12  12 HOH HOH A . 
I 5 HOH 6 13  13 HOH HOH A . 
J 5 HOH 1 1   1  HOH HOH B . 
J 5 HOH 2 7   7  HOH HOH B . 
J 5 HOH 3 8   8  HOH HOH B . 
J 5 HOH 4 9   9  HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     178 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      284 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          O-PHOSPHOTYROSINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,I 
2 1 B,F,G,H,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  MG  ? D MG  .   ? A MG  399 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 O2G ? E ACP .   ? A ACP 101 ? 1_555 57.1  ? 
2  MG  ? D MG  .   ? A MG  399 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 OD1 ? A ASP 164 ? A ASP 270 ? 1_555 50.7  ? 
3  O2G ? E ACP .   ? A ACP 101 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 OD1 ? A ASP 164 ? A ASP 270 ? 1_555 105.4 ? 
4  MG  ? D MG  .   ? A MG  399 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 OD2 ? A ASP 164 ? A ASP 270 ? 1_555 90.7  ? 
5  O2G ? E ACP .   ? A ACP 101 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 OD2 ? A ASP 164 ? A ASP 270 ? 1_555 130.0 ? 
6  OD1 ? A ASP 164 ? A ASP 270 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 OD2 ? A ASP 164 ? A ASP 270 ? 1_555 44.1  ? 
7  MG  ? D MG  .   ? A MG  399 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 O2B ? E ACP .   ? A ACP 101 ? 1_555 90.8  ? 
8  O2G ? E ACP .   ? A ACP 101 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 O2B ? E ACP .   ? A ACP 101 ? 1_555 119.3 ? 
9  OD1 ? A ASP 164 ? A ASP 270 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 O2B ? E ACP .   ? A ACP 101 ? 1_555 79.4  ? 
10 OD2 ? A ASP 164 ? A ASP 270 ? 1_555 MG ? C MG . ? A MG 398 ? 1_555 O2B ? E ACP .   ? A ACP 101 ? 1_555 95.8  ? 
11 ND2 ? A ASN 151 ? A ASN 257 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O1G ? E ACP .   ? A ACP 101 ? 1_555 153.5 ? 
12 ND2 ? A ASN 151 ? A ASN 257 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O2G ? E ACP .   ? A ACP 101 ? 1_555 130.8 ? 
13 O1G ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O2G ? E ACP .   ? A ACP 101 ? 1_555 64.0  ? 
14 ND2 ? A ASN 151 ? A ASN 257 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 OD1 ? A ASP 164 ? A ASP 270 ? 1_555 79.0  ? 
15 O1G ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 OD1 ? A ASP 164 ? A ASP 270 ? 1_555 125.2 ? 
16 O2G ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 OD1 ? A ASP 164 ? A ASP 270 ? 1_555 94.4  ? 
17 ND2 ? A ASN 151 ? A ASN 257 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O3A ? E ACP .   ? A ACP 101 ? 1_555 135.3 ? 
18 O1G ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O3A ? E ACP .   ? A ACP 101 ? 1_555 48.8  ? 
19 O2G ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O3A ? E ACP .   ? A ACP 101 ? 1_555 91.8  ? 
20 OD1 ? A ASP 164 ? A ASP 270 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O3A ? E ACP .   ? A ACP 101 ? 1_555 85.7  ? 
21 ND2 ? A ASN 151 ? A ASN 257 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O2A ? E ACP .   ? A ACP 101 ? 1_555 75.4  ? 
22 O1G ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O2A ? E ACP .   ? A ACP 101 ? 1_555 95.0  ? 
23 O2G ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O2A ? E ACP .   ? A ACP 101 ? 1_555 153.1 ? 
24 OD1 ? A ASP 164 ? A ASP 270 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O2A ? E ACP .   ? A ACP 101 ? 1_555 84.0  ? 
25 O3A ? E ACP .   ? A ACP 101 ? 1_555 MG ? D MG . ? A MG 399 ? 1_555 O2A ? E ACP .   ? A ACP 101 ? 1_555 61.3  ? 
26 O1G ? H ACP .   ? B ACP 400 ? 1_555 MG ? F MG . ? B MG 398 ? 1_555 O2B ? H ACP .   ? B ACP 400 ? 1_555 47.9  ? 
27 O1G ? H ACP .   ? B ACP 400 ? 1_555 MG ? F MG . ? B MG 398 ? 1_555 OD2 ? B ASP 164 ? B ASP 270 ? 1_555 105.3 ? 
28 O2B ? H ACP .   ? B ACP 400 ? 1_555 MG ? F MG . ? B MG 398 ? 1_555 OD2 ? B ASP 164 ? B ASP 270 ? 1_555 68.9  ? 
29 O1G ? H ACP .   ? B ACP 400 ? 1_555 MG ? F MG . ? B MG 398 ? 1_555 OD1 ? B ASP 164 ? B ASP 270 ? 1_555 60.6  ? 
30 O2B ? H ACP .   ? B ACP 400 ? 1_555 MG ? F MG . ? B MG 398 ? 1_555 OD1 ? B ASP 164 ? B ASP 270 ? 1_555 52.8  ? 
31 OD2 ? B ASP 164 ? B ASP 270 ? 1_555 MG ? F MG . ? B MG 398 ? 1_555 OD1 ? B ASP 164 ? B ASP 270 ? 1_555 50.0  ? 
32 O3G ? H ACP .   ? B ACP 400 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 OD1 ? B ASN 151 ? B ASN 257 ? 1_555 131.2 ? 
33 O3G ? H ACP .   ? B ACP 400 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 O2A ? H ACP .   ? B ACP 400 ? 1_555 88.7  ? 
34 OD1 ? B ASN 151 ? B ASN 257 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 O2A ? H ACP .   ? B ACP 400 ? 1_555 89.4  ? 
35 O3G ? H ACP .   ? B ACP 400 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 O1G ? H ACP .   ? B ACP 400 ? 1_555 68.6  ? 
36 OD1 ? B ASN 151 ? B ASN 257 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 O1G ? H ACP .   ? B ACP 400 ? 1_555 160.2 ? 
37 O2A ? H ACP .   ? B ACP 400 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 O1G ? H ACP .   ? B ACP 400 ? 1_555 90.2  ? 
38 O3G ? H ACP .   ? B ACP 400 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 OD1 ? B ASP 164 ? B ASP 270 ? 1_555 128.6 ? 
39 OD1 ? B ASN 151 ? B ASN 257 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 OD1 ? B ASP 164 ? B ASP 270 ? 1_555 96.6  ? 
40 O2A ? H ACP .   ? B ACP 400 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 OD1 ? B ASP 164 ? B ASP 270 ? 1_555 71.8  ? 
41 O1G ? H ACP .   ? B ACP 400 ? 1_555 MG ? G MG . ? B MG 399 ? 1_555 OD1 ? B ASP 164 ? B ASP 270 ? 1_555 64.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-31 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 43.1440 19.3540 54.4370 0.2199 0.3688 0.6564 -0.0574 0.0723  -0.0633 9.8823 4.8958 5.2570 -1.1209 1.8999  0.3639  
0.1521 -0.7446 0.6433  0.0656  0.2137  -0.9306 -0.1506 0.3833  -0.3658 'X-RAY DIFFRACTION' 
2 ? refined 19.5530 13.3040 49.9290 0.2561 0.0209 0.4304 0.0575  -0.0799 -0.0749 8.8949 3.8855 5.0280 -0.9118 -3.2358 1.1326  
0.0200 0.7420  -0.8754 -0.3559 -0.2574 0.5727  0.1127  -0.1279 0.2374  'X-RAY DIFFRACTION' 
3 ? refined 26.9060 28.1630 93.0120 0.1949 0.3768 0.4001 0.0080  -0.0158 -0.0389 8.8796 3.1795 6.6911 -1.1285 1.3913  -0.2162 
0.0494 -0.0769 -0.2407 0.2841  0.0597  -0.3102 0.2214  0.1714  -0.1091 'X-RAY DIFFRACTION' 
4 ? refined 5.7930  26.5440 79.8130 0.1195 0.6913 0.2785 0.0865  0.0074  0.1034  3.5665 2.5804 5.8874 -0.0512 0.1824  1.5878  
0.0766 -0.3748 -0.0688 0.1874  -0.1848 -0.0841 -0.0726 -1.3655 0.1082  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 9   115 A 100 206 ? A A 'X-RAY DIFFRACTION' ? 
2 2 A 101 207 A 284 390 ? A A 'X-RAY DIFFRACTION' ? 
3 3 B 11  117 B 100 206 ? B B 'X-RAY DIFFRACTION' ? 
4 4 B 101 207 B 282 388 ? B B 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.1.24 ? 1 
d*TREK 'data reduction' .      ? 2 
d*TREK 'data scaling'   .      ? 3 
MOLREP phasing          .      ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    232 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    263 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.99 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 185 ? ? CG A ASP 185 ? ? OD2 A ASP 185 ? ? 123.99 118.30 5.69  0.90 N 
2  1 CB A ASP 252 ? ? CG A ASP 252 ? ? OD2 A ASP 252 ? ? 125.99 118.30 7.69  0.90 N 
3  1 NE A ARG 256 ? ? CZ A ARG 256 ? ? NH1 A ARG 256 ? ? 125.81 120.30 5.51  0.50 N 
4  1 NE A ARG 256 ? ? CZ A ARG 256 ? ? NH2 A ARG 256 ? ? 115.00 120.30 -5.30 0.50 N 
5  1 CB A ASP 270 ? ? CG A ASP 270 ? ? OD2 A ASP 270 ? ? 125.71 118.30 7.41  0.90 N 
6  1 CB A ASP 282 ? ? CG A ASP 282 ? ? OD2 A ASP 282 ? ? 124.63 118.30 6.33  0.90 N 
7  1 CB B ASP 172 ? ? CG B ASP 172 ? ? OD2 B ASP 172 ? ? 125.03 118.30 6.73  0.90 N 
8  1 CB B ASP 185 ? ? CG B ASP 185 ? ? OD2 B ASP 185 ? ? 127.15 118.30 8.85  0.90 N 
9  1 NE B ARG 187 ? ? CZ B ARG 187 ? ? NH1 B ARG 187 ? ? 123.52 120.30 3.22  0.50 N 
10 1 CB B ASP 252 ? ? CG B ASP 252 ? ? OD2 B ASP 252 ? ? 124.32 118.30 6.02  0.90 N 
11 1 CB B ASP 344 ? ? CG B ASP 344 ? ? OD2 B ASP 344 ? ? 125.75 118.30 7.45  0.90 N 
12 1 CB B ASP 355 ? ? CG B ASP 355 ? ? OD2 B ASP 355 ? ? 123.72 118.30 5.42  0.90 N 
13 1 CB B ASP 359 ? ? CG B ASP 359 ? ? OD2 B ASP 359 ? ? 124.26 118.30 5.96  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 116 ? ? 111.73  -21.23  
2  1 GLU A 123 ? ? -59.27  -8.64   
3  1 LEU A 129 ? ? -142.77 -141.76 
4  1 PRO A 148 ? ? -67.19  30.85   
5  1 HIS A 186 ? ? -170.87 141.69  
6  1 GLN A 221 ? ? -30.83  -80.09  
7  1 LYS A 246 ? ? -68.12  2.43    
8  1 ARG A 251 ? ? 83.51   -10.59  
9  1 ASP A 252 ? ? -142.65 46.63   
10 1 ASN A 280 ? ? -104.76 52.32   
11 1 GLN A 287 ? ? -115.17 -167.69 
12 1 GLU A 288 ? ? -52.18  -77.23  
13 1 HIS A 289 ? ? -13.93  -34.46  
14 1 ALA A 295 ? ? -43.90  -19.78  
15 1 ILE A 332 ? ? -30.61  144.22  
16 1 ASN A 335 ? ? -58.94  -175.48 
17 1 ASP A 344 ? ? -105.78 -95.25  
18 1 GLU A 354 ? ? 3.21    113.94  
19 1 ARG A 382 ? ? -29.77  -60.21  
20 1 GLN A 389 ? ? 36.98   78.39   
21 1 GLU B 123 ? ? -48.84  -18.98  
22 1 LEU B 129 ? ? -140.40 -153.37 
23 1 ALA B 170 ? ? -55.02  73.70   
24 1 ASP B 185 ? ? -171.48 80.16   
25 1 LYS B 219 ? ? -76.18  -139.34 
26 1 HIS B 223 ? ? -150.70 -102.72 
27 1 PHE B 224 ? ? -26.57  103.38  
28 1 TYR B 242 ? ? -26.91  -57.56  
29 1 ARG B 247 ? ? 84.04   12.74   
30 1 ASP B 252 ? ? -150.86 29.91   
31 1 ASP B 270 ? ? 27.84   85.75   
32 1 ILE B 332 ? ? -31.52  128.87  
33 1 GLU B 354 ? ? -34.87  129.54  
34 1 ASP B 355 ? ? 70.83   -5.48   
35 1 PRO B 357 ? ? -46.02  165.84  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ILE 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    268 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    269 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -149.98 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 107 ? A GLY 1   
2  1 Y 1 A SER 108 ? A SER 2   
3  1 Y 1 A ALA 109 ? A ALA 3   
4  1 Y 1 A GLY 110 ? A GLY 4   
5  1 Y 1 A GLU 111 ? A GLU 5   
6  1 Y 1 A GLY 112 ? A GLY 6   
7  1 Y 1 A PRO 113 ? A PRO 7   
8  1 Y 1 A LEU 114 ? A LEU 8   
9  1 Y 1 A GLY 135 ? A GLY 29  
10 1 Y 1 A SER 136 ? A SER 30  
11 1 Y 1 A PHE 137 ? A PHE 31  
12 1 Y 1 A LYS 161 ? A LYS 55  
13 1 Y 1 A PRO 162 ? A PRO 56  
14 1 Y 1 A ASP 163 ? A ASP 57  
15 1 Y 1 A VAL 164 ? A VAL 58  
16 1 Y 1 A LEU 165 ? A LEU 59  
17 1 Y 1 A SER 166 ? A SER 60  
18 1 Y 1 A GLN 167 ? A GLN 61  
19 1 Y 1 A PRO 168 ? A PRO 62  
20 1 Y 1 A GLU 169 ? A GLU 63  
21 1 Y 1 A LYS 291 ? A LYS 185 
22 1 Y 1 A THR 391 ? A THR 285 
23 1 Y 1 A ASP 392 ? A ASP 286 
24 1 Y 1 A MET 393 ? A MET 287 
25 1 Y 1 A ARG 394 ? A ARG 288 
26 1 Y 1 A ALA 395 ? A ALA 289 
27 1 Y 1 A GLU 396 ? A GLU 290 
28 1 Y 1 A PHE 397 ? A PHE 291 
29 1 Y 1 B GLY 107 ? B GLY 1   
30 1 Y 1 B SER 108 ? B SER 2   
31 1 Y 1 B ALA 109 ? B ALA 3   
32 1 Y 1 B GLY 110 ? B GLY 4   
33 1 Y 1 B GLU 111 ? B GLU 5   
34 1 Y 1 B GLY 112 ? B GLY 6   
35 1 Y 1 B PRO 113 ? B PRO 7   
36 1 Y 1 B LEU 114 ? B LEU 8   
37 1 Y 1 B GLN 115 ? B GLN 9   
38 1 Y 1 B SER 116 ? B SER 10  
39 1 Y 1 B GLY 135 ? B GLY 29  
40 1 Y 1 B SER 136 ? B SER 30  
41 1 Y 1 B PHE 137 ? B PHE 31  
42 1 Y 1 B LYS 161 ? B LYS 55  
43 1 Y 1 B PRO 162 ? B PRO 56  
44 1 Y 1 B ASP 163 ? B ASP 57  
45 1 Y 1 B VAL 164 ? B VAL 58  
46 1 Y 1 B LEU 165 ? B LEU 59  
47 1 Y 1 B SER 166 ? B SER 60  
48 1 Y 1 B GLN 167 ? B GLN 61  
49 1 Y 1 B PRO 168 ? B PRO 62  
50 1 Y 1 B GLN 389 ? B GLN 283 
51 1 Y 1 B PRO 390 ? B PRO 284 
52 1 Y 1 B THR 391 ? B THR 285 
53 1 Y 1 B ASP 392 ? B ASP 286 
54 1 Y 1 B MET 393 ? B MET 287 
55 1 Y 1 B ARG 394 ? B ARG 288 
56 1 Y 1 B ALA 395 ? B ALA 289 
57 1 Y 1 B GLU 396 ? B GLU 290 
58 1 Y 1 B PHE 397 ? B PHE 291 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION'                                MG  
4 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' ACP 
5 water                                          HOH 
#