data_1UFU
# 
_entry.id   1UFU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UFU         
RCSB  RCSB005781   
WWPDB D_1000005781 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1G0X 
_pdbx_database_related.details        'The structure from the different form of crystal (P21212) of the same protein.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UFU 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-10 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shiroishi, M.' 1 
'Amano, K.'     2 
'Rasubala, L.'  3 
'Tsumoto, K.'   4 
'Kumagai, I.'   5 
'Kohda, D.'     6 
'Maenaka, K.'   7 
# 
_citation.id                        primary 
_citation.title                     
'Kinetic and thermodynamic properties of the interaction between Immunoglobulin like transcript (ILT) and MHC class I' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shiroishi, M.' 1 
primary 'Amano, K.'     2 
primary 'Rasubala, L.'  3 
primary 'Tsumoto, K.'   4 
primary 'Kumagai, I.'   5 
primary 'Kohda, D.'     6 
primary 'Maenaka, K.'   7 
# 
_cell.entry_id           1UFU 
_cell.length_a           36.220 
_cell.length_b           104.400 
_cell.length_c           53.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UFU 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Immunoglobulin-like transcript 2' 
_entity.formula_weight             21998.645 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Ligand binding domain (domain1 and 2)' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ILT2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDT
AGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSV
GPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDT
AGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSV
GPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   LEU n 
1 3   PRO n 
1 4   LYS n 
1 5   PRO n 
1 6   THR n 
1 7   LEU n 
1 8   TRP n 
1 9   ALA n 
1 10  GLU n 
1 11  PRO n 
1 12  GLY n 
1 13  SER n 
1 14  VAL n 
1 15  ILE n 
1 16  THR n 
1 17  GLN n 
1 18  GLY n 
1 19  SER n 
1 20  PRO n 
1 21  VAL n 
1 22  THR n 
1 23  LEU n 
1 24  ARG n 
1 25  CYS n 
1 26  GLN n 
1 27  GLY n 
1 28  GLY n 
1 29  GLN n 
1 30  GLU n 
1 31  THR n 
1 32  GLN n 
1 33  GLU n 
1 34  TYR n 
1 35  ARG n 
1 36  LEU n 
1 37  TYR n 
1 38  ARG n 
1 39  GLU n 
1 40  LYS n 
1 41  LYS n 
1 42  THR n 
1 43  ALA n 
1 44  PRO n 
1 45  TRP n 
1 46  ILE n 
1 47  THR n 
1 48  ARG n 
1 49  ILE n 
1 50  PRO n 
1 51  GLN n 
1 52  GLU n 
1 53  LEU n 
1 54  VAL n 
1 55  LYS n 
1 56  LYS n 
1 57  GLY n 
1 58  GLN n 
1 59  PHE n 
1 60  PRO n 
1 61  ILE n 
1 62  PRO n 
1 63  SER n 
1 64  ILE n 
1 65  THR n 
1 66  TRP n 
1 67  GLU n 
1 68  HIS n 
1 69  ALA n 
1 70  GLY n 
1 71  ARG n 
1 72  TYR n 
1 73  ARG n 
1 74  CYS n 
1 75  TYR n 
1 76  TYR n 
1 77  GLY n 
1 78  SER n 
1 79  ASP n 
1 80  THR n 
1 81  ALA n 
1 82  GLY n 
1 83  ARG n 
1 84  SER n 
1 85  GLU n 
1 86  SER n 
1 87  SER n 
1 88  ASP n 
1 89  PRO n 
1 90  LEU n 
1 91  GLU n 
1 92  LEU n 
1 93  VAL n 
1 94  VAL n 
1 95  THR n 
1 96  GLY n 
1 97  ALA n 
1 98  TYR n 
1 99  ILE n 
1 100 LYS n 
1 101 PRO n 
1 102 THR n 
1 103 LEU n 
1 104 SER n 
1 105 ALA n 
1 106 GLN n 
1 107 PRO n 
1 108 SER n 
1 109 PRO n 
1 110 VAL n 
1 111 VAL n 
1 112 ASN n 
1 113 SER n 
1 114 GLY n 
1 115 GLY n 
1 116 ASN n 
1 117 VAL n 
1 118 THR n 
1 119 LEU n 
1 120 GLN n 
1 121 CYS n 
1 122 ASP n 
1 123 SER n 
1 124 GLN n 
1 125 VAL n 
1 126 ALA n 
1 127 PHE n 
1 128 ASP n 
1 129 GLY n 
1 130 PHE n 
1 131 ILE n 
1 132 LEU n 
1 133 CYS n 
1 134 LYS n 
1 135 GLU n 
1 136 GLY n 
1 137 GLU n 
1 138 ASP n 
1 139 GLU n 
1 140 HIS n 
1 141 PRO n 
1 142 GLN n 
1 143 CYS n 
1 144 LEU n 
1 145 ASN n 
1 146 SER n 
1 147 GLN n 
1 148 PRO n 
1 149 HIS n 
1 150 ALA n 
1 151 ARG n 
1 152 GLY n 
1 153 SER n 
1 154 SER n 
1 155 ARG n 
1 156 ALA n 
1 157 ILE n 
1 158 PHE n 
1 159 SER n 
1 160 VAL n 
1 161 GLY n 
1 162 PRO n 
1 163 VAL n 
1 164 SER n 
1 165 PRO n 
1 166 SER n 
1 167 ARG n 
1 168 ARG n 
1 169 TRP n 
1 170 TRP n 
1 171 TYR n 
1 172 ARG n 
1 173 CYS n 
1 174 TYR n 
1 175 ALA n 
1 176 TYR n 
1 177 ASP n 
1 178 SER n 
1 179 ASN n 
1 180 SER n 
1 181 PRO n 
1 182 TYR n 
1 183 GLU n 
1 184 TRP n 
1 185 SER n 
1 186 LEU n 
1 187 PRO n 
1 188 SER n 
1 189 ASP n 
1 190 LEU n 
1 191 LEU n 
1 192 GLU n 
1 193 LEU n 
1 194 LEU n 
1 195 VAL n 
1 196 LEU n 
1 197 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGMT7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LIRB1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;HLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDT
AGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSV
GPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLG
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_accession          Q8NHL6 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UFU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 197 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8NHL6 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  221 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       198 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UFU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_percent_sol   53.47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
'1.6M Sodium Formate, 0.08M Na-acetate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1UFU 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            3.0 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   ? 
_reflns.number_obs                   4406 
_reflns.percent_possible_obs         88.8 
_reflns.pdbx_Rmerge_I_obs            0.126 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.7 
_reflns.B_iso_Wilson_estimate        41.9 
_reflns.pdbx_redundancy              12.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.344 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.6 
_reflns_shell.pdbx_redundancy        11.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      411 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1UFU 
_refine.ls_d_res_high                            3.0 
_refine.ls_d_res_low                             8.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     3607 
_refine.ls_number_reflns_R_free                  339 
_refine.ls_percent_reflns_obs                    87.5 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.3 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1G0X' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               37.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1UFU 
_refine_analyze.Luzzati_coordinate_error_obs    0.41 
_refine_analyze.Luzzati_sigma_a_obs             0.42 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.57 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1355 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1355 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.9  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.02  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.18 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.309 
_refine_ls_shell.percent_reflns_obs               97 
_refine_ls_shell.R_factor_R_free                  0.343 
_refine_ls_shell.R_factor_R_free_error            0.042 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1UFU 
_struct.title                     'Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ILT2; LIR-1)' 
_struct.pdbx_descriptor           'Immunoglobulin-like transcript 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UFU 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'Immunoglobulin-like folds, IMMUNE SYSTEM' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 43 ? ILE A 49 ? ALA A 44 ILE A 50 5 ? 7 
HELX_P HELX_P2 2 PRO A 50 ? LYS A 55 ? PRO A 51 LYS A 56 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 74  SG ? ? A CYS 26  A CYS 75  1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf2 disulf ? ? A CYS 121 SG ? ? ? 1_555 A CYS 173 SG ? ? A CYS 122 A CYS 174 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf3 disulf ? ? A CYS 133 SG ? ? ? 1_555 A CYS 143 SG ? ? A CYS 134 A CYS 144 1_555 ? ? ? ? ? ? ? 2.032 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 10  A . ? GLU 11  A PRO 11  A ? PRO 12  A 1 2.36 
2 GLN 106 A . ? GLN 107 A PRO 107 A ? PRO 108 A 1 1.68 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 6   ? GLU A 10  ? THR A 7   GLU A 11  
A 2 VAL A 21  ? GLN A 26  ? VAL A 22  GLN A 27  
A 3 GLN A 58  ? ILE A 61  ? GLN A 59  ILE A 62  
B 1 VAL A 14  ? THR A 16  ? VAL A 15  THR A 17  
B 2 LEU A 90  ? THR A 95  ? LEU A 91  THR A 96  
B 3 GLY A 70  ? SER A 78  ? GLY A 71  SER A 79  
B 4 GLY A 82  ? ARG A 83  ? GLY A 83  ARG A 84  
C 1 TYR A 34  ? ARG A 38  ? TYR A 35  ARG A 39  
C 2 GLY A 70  ? SER A 78  ? GLY A 71  SER A 79  
C 3 LEU A 90  ? THR A 95  ? LEU A 91  THR A 96  
C 4 GLU A 183 ? TRP A 184 ? GLU A 184 TRP A 185 
D 1 THR A 102 ? GLN A 106 ? THR A 103 GLN A 107 
D 2 VAL A 117 ? ASP A 122 ? VAL A 118 ASP A 123 
D 3 ARG A 155 ? VAL A 160 ? ARG A 156 VAL A 161 
E 1 LEU A 144 ? ASN A 145 ? LEU A 145 ASN A 146 
E 2 PHE A 130 ? CYS A 133 ? PHE A 131 CYS A 134 
E 3 TRP A 170 ? ALA A 175 ? TRP A 171 ALA A 176 
E 4 LEU A 191 ? GLU A 192 ? LEU A 192 GLU A 193 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP A 8   ? N TRP A 9   O ARG A 24  ? O ARG A 25  
A 2 3 N VAL A 21  ? N VAL A 22  O ILE A 61  ? O ILE A 62  
B 1 2 N ILE A 15  ? N ILE A 16  O VAL A 93  ? O VAL A 94  
B 2 3 O LEU A 90  ? O LEU A 91  N TYR A 72  ? N TYR A 73  
B 3 4 N SER A 78  ? N SER A 79  O GLY A 82  ? O GLY A 83  
C 1 2 N ARG A 35  ? N ARG A 36  O TYR A 75  ? O TYR A 76  
C 2 3 N TYR A 72  ? N TYR A 73  O LEU A 90  ? O LEU A 91  
C 3 4 N VAL A 94  ? N VAL A 95  O TRP A 184 ? O TRP A 185 
D 1 2 N GLN A 106 ? N GLN A 107 O THR A 118 ? O THR A 119 
D 2 3 N LEU A 119 ? N LEU A 120 O PHE A 158 ? O PHE A 159 
E 1 2 O LEU A 144 ? O LEU A 145 N LEU A 132 ? N LEU A 133 
E 2 3 N CYS A 133 ? N CYS A 134 O ARG A 172 ? O ARG A 173 
E 3 4 N TYR A 171 ? N TYR A 172 O LEU A 191 ? O LEU A 192 
# 
_database_PDB_matrix.entry_id          1UFU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UFU 
_atom_sites.fract_transf_matrix[1][1]   0.027609 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009579 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018706 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . HIS A 1 1   ? 10.055  53.414 12.818  1.00 103.17 ? 2   HIS A N   1 
ATOM 2    C CA  . HIS A 1 1   ? 9.746   54.827 12.482  1.00 103.17 ? 2   HIS A CA  1 
ATOM 3    C C   . HIS A 1 1   ? 9.354   54.921 11.016  1.00 103.17 ? 2   HIS A C   1 
ATOM 4    O O   . HIS A 1 1   ? 9.238   56.008 10.452  1.00 103.17 ? 2   HIS A O   1 
ATOM 5    C CB  . HIS A 1 1   ? 10.955  55.707 12.798  1.00 76.96  ? 2   HIS A CB  1 
ATOM 6    C CG  . HIS A 1 1   ? 11.333  55.697 14.247  1.00 76.96  ? 2   HIS A CG  1 
ATOM 7    N ND1 . HIS A 1 1   ? 12.452  56.341 14.734  1.00 76.96  ? 2   HIS A ND1 1 
ATOM 8    C CD2 . HIS A 1 1   ? 10.735  55.123 15.318  1.00 76.96  ? 2   HIS A CD2 1 
ATOM 9    C CE1 . HIS A 1 1   ? 12.525  56.163 16.041  1.00 76.96  ? 2   HIS A CE1 1 
ATOM 10   N NE2 . HIS A 1 1   ? 11.495  55.427 16.421  1.00 76.96  ? 2   HIS A NE2 1 
ATOM 11   N N   . LEU A 1 2   ? 9.167   53.749 10.411  1.00 64.37  ? 3   LEU A N   1 
ATOM 12   C CA  . LEU A 1 2   ? 8.752   53.618 9.022   1.00 64.37  ? 3   LEU A CA  1 
ATOM 13   C C   . LEU A 1 2   ? 8.612   52.155 8.586   1.00 64.37  ? 3   LEU A C   1 
ATOM 14   O O   . LEU A 1 2   ? 7.521   51.598 8.673   1.00 64.37  ? 3   LEU A O   1 
ATOM 15   C CB  . LEU A 1 2   ? 9.707   54.355 8.070   1.00 61.75  ? 3   LEU A CB  1 
ATOM 16   C CG  . LEU A 1 2   ? 9.389   55.766 7.574   1.00 61.75  ? 3   LEU A CG  1 
ATOM 17   C CD1 . LEU A 1 2   ? 9.912   55.884 6.137   1.00 61.75  ? 3   LEU A CD1 1 
ATOM 18   C CD2 . LEU A 1 2   ? 7.881   56.027 7.621   1.00 61.75  ? 3   LEU A CD2 1 
ATOM 19   N N   . PRO A 1 3   ? 9.721   51.507 8.146   1.00 35.85  ? 4   PRO A N   1 
ATOM 20   C CA  . PRO A 1 3   ? 9.679   50.104 7.698   1.00 35.85  ? 4   PRO A CA  1 
ATOM 21   C C   . PRO A 1 3   ? 9.055   49.082 8.656   1.00 35.85  ? 4   PRO A C   1 
ATOM 22   O O   . PRO A 1 3   ? 9.433   48.998 9.830   1.00 35.85  ? 4   PRO A O   1 
ATOM 23   C CB  . PRO A 1 3   ? 11.151  49.788 7.405   1.00 35.02  ? 4   PRO A CB  1 
ATOM 24   C CG  . PRO A 1 3   ? 11.749  51.117 7.121   1.00 35.02  ? 4   PRO A CG  1 
ATOM 25   C CD  . PRO A 1 3   ? 11.123  51.962 8.196   1.00 35.02  ? 4   PRO A CD  1 
ATOM 26   N N   . LYS A 1 4   ? 8.112   48.293 8.144   1.00 35.44  ? 5   LYS A N   1 
ATOM 27   C CA  . LYS A 1 4   ? 7.460   47.302 8.986   1.00 35.44  ? 5   LYS A CA  1 
ATOM 28   C C   . LYS A 1 4   ? 8.364   46.103 9.254   1.00 35.44  ? 5   LYS A C   1 
ATOM 29   O O   . LYS A 1 4   ? 9.066   45.623 8.364   1.00 35.44  ? 5   LYS A O   1 
ATOM 30   C CB  . LYS A 1 4   ? 6.112   46.870 8.385   1.00 25.33  ? 5   LYS A CB  1 
ATOM 31   C CG  . LYS A 1 4   ? 6.112   45.817 7.300   1.00 25.33  ? 5   LYS A CG  1 
ATOM 32   C CD  . LYS A 1 4   ? 4.654   45.581 6.940   1.00 25.33  ? 5   LYS A CD  1 
ATOM 33   C CE  . LYS A 1 4   ? 4.428   44.344 6.094   1.00 25.33  ? 5   LYS A CE  1 
ATOM 34   N NZ  . LYS A 1 4   ? 2.956   44.123 5.923   1.00 25.33  ? 5   LYS A NZ  1 
ATOM 35   N N   . PRO A 1 5   ? 8.369   45.622 10.506  1.00 13.28  ? 6   PRO A N   1 
ATOM 36   C CA  . PRO A 1 5   ? 9.169   44.493 10.970  1.00 13.28  ? 6   PRO A CA  1 
ATOM 37   C C   . PRO A 1 5   ? 8.696   43.126 10.519  1.00 13.28  ? 6   PRO A C   1 
ATOM 38   O O   . PRO A 1 5   ? 7.555   42.929 10.107  1.00 13.28  ? 6   PRO A O   1 
ATOM 39   C CB  . PRO A 1 5   ? 9.095   44.602 12.495  1.00 30.71  ? 6   PRO A CB  1 
ATOM 40   C CG  . PRO A 1 5   ? 8.624   45.976 12.750  1.00 30.71  ? 6   PRO A CG  1 
ATOM 41   C CD  . PRO A 1 5   ? 7.667   46.236 11.639  1.00 30.71  ? 6   PRO A CD  1 
ATOM 42   N N   . THR A 1 6   ? 9.601   42.173 10.640  1.00 24.14  ? 7   THR A N   1 
ATOM 43   C CA  . THR A 1 6   ? 9.327   40.811 10.284  1.00 24.14  ? 7   THR A CA  1 
ATOM 44   C C   . THR A 1 6   ? 9.133   40.103 11.615  1.00 24.14  ? 7   THR A C   1 
ATOM 45   O O   . THR A 1 6   ? 9.873   40.348 12.563  1.00 24.14  ? 7   THR A O   1 
ATOM 46   C CB  . THR A 1 6   ? 10.525  40.233 9.511   1.00 24.93  ? 7   THR A CB  1 
ATOM 47   O OG1 . THR A 1 6   ? 10.658  40.939 8.273   1.00 24.93  ? 7   THR A OG1 1 
ATOM 48   C CG2 . THR A 1 6   ? 10.338  38.751 9.220   1.00 24.93  ? 7   THR A CG2 1 
ATOM 49   N N   . LEU A 1 7   ? 8.108   39.262 11.695  1.00 16.86  ? 8   LEU A N   1 
ATOM 50   C CA  . LEU A 1 7   ? 7.821   38.504 12.906  1.00 16.86  ? 8   LEU A CA  1 
ATOM 51   C C   . LEU A 1 7   ? 7.730   37.030 12.558  1.00 16.86  ? 8   LEU A C   1 
ATOM 52   O O   . LEU A 1 7   ? 6.796   36.602 11.884  1.00 16.86  ? 8   LEU A O   1 
ATOM 53   C CB  . LEU A 1 7   ? 6.498   38.953 13.533  1.00 18.26  ? 8   LEU A CB  1 
ATOM 54   C CG  . LEU A 1 7   ? 6.106   38.224 14.826  1.00 18.26  ? 8   LEU A CG  1 
ATOM 55   C CD1 . LEU A 1 7   ? 7.182   38.465 15.878  1.00 18.26  ? 8   LEU A CD1 1 
ATOM 56   C CD2 . LEU A 1 7   ? 4.741   38.694 15.319  1.00 18.26  ? 8   LEU A CD2 1 
ATOM 57   N N   . TRP A 1 8   ? 8.706   36.257 13.026  1.00 24.84  ? 9   TRP A N   1 
ATOM 58   C CA  . TRP A 1 8   ? 8.747   34.821 12.778  1.00 24.84  ? 9   TRP A CA  1 
ATOM 59   C C   . TRP A 1 8   ? 8.903   34.031 14.077  1.00 24.84  ? 9   TRP A C   1 
ATOM 60   O O   . TRP A 1 8   ? 9.166   34.593 15.133  1.00 24.84  ? 9   TRP A O   1 
ATOM 61   C CB  . TRP A 1 8   ? 9.907   34.500 11.849  1.00 40.93  ? 9   TRP A CB  1 
ATOM 62   C CG  . TRP A 1 8   ? 11.211  34.503 12.534  1.00 40.93  ? 9   TRP A CG  1 
ATOM 63   C CD1 . TRP A 1 8   ? 11.773  33.475 13.226  1.00 40.93  ? 9   TRP A CD1 1 
ATOM 64   C CD2 . TRP A 1 8   ? 12.131  35.590 12.610  1.00 40.93  ? 9   TRP A CD2 1 
ATOM 65   N NE1 . TRP A 1 8   ? 12.993  33.850 13.727  1.00 40.93  ? 9   TRP A NE1 1 
ATOM 66   C CE2 . TRP A 1 8   ? 13.239  35.146 13.362  1.00 40.93  ? 9   TRP A CE2 1 
ATOM 67   C CE3 . TRP A 1 8   ? 12.129  36.898 12.114  1.00 40.93  ? 9   TRP A CE3 1 
ATOM 68   C CZ2 . TRP A 1 8   ? 14.338  35.961 13.631  1.00 40.93  ? 9   TRP A CZ2 1 
ATOM 69   C CZ3 . TRP A 1 8   ? 13.225  37.714 12.382  1.00 40.93  ? 9   TRP A CZ3 1 
ATOM 70   C CH2 . TRP A 1 8   ? 14.315  37.238 13.134  1.00 40.93  ? 9   TRP A CH2 1 
ATOM 71   N N   . ALA A 1 9   ? 8.736   32.716 13.981  1.00 18.04  ? 10  ALA A N   1 
ATOM 72   C CA  . ALA A 1 9   ? 8.864   31.814 15.132  1.00 18.04  ? 10  ALA A CA  1 
ATOM 73   C C   . ALA A 1 9   ? 10.117  30.948 14.974  1.00 18.04  ? 10  ALA A C   1 
ATOM 74   O O   . ALA A 1 9   ? 10.606  30.740 13.864  1.00 18.04  ? 10  ALA A O   1 
ATOM 75   C CB  . ALA A 1 9   ? 7.615   30.929 15.250  1.00 9.53   ? 10  ALA A CB  1 
ATOM 76   N N   . GLU A 1 10  ? 10.651  30.464 16.085  1.00 50.36  ? 11  GLU A N   1 
ATOM 77   C CA  . GLU A 1 10  ? 11.846  29.630 16.035  1.00 50.36  ? 11  GLU A CA  1 
ATOM 78   C C   . GLU A 1 10  ? 11.797  28.586 17.136  1.00 50.36  ? 11  GLU A C   1 
ATOM 79   O O   . GLU A 1 10  ? 11.741  28.910 18.328  1.00 50.36  ? 11  GLU A O   1 
ATOM 80   C CB  . GLU A 1 10  ? 13.127  30.472 16.187  1.00 40.56  ? 11  GLU A CB  1 
ATOM 81   C CG  . GLU A 1 10  ? 13.547  31.236 14.929  1.00 40.56  ? 11  GLU A CG  1 
ATOM 82   C CD  . GLU A 1 10  ? 14.840  32.028 15.117  1.00 40.56  ? 11  GLU A CD  1 
ATOM 83   O OE1 . GLU A 1 10  ? 15.376  32.035 16.247  1.00 40.56  ? 11  GLU A OE1 1 
ATOM 84   O OE2 . GLU A 1 10  ? 15.319  32.646 14.136  1.00 40.56  ? 11  GLU A OE2 1 
ATOM 85   N N   . PRO A 1 11  ? 11.807  27.308 16.752  1.00 23.47  ? 12  PRO A N   1 
ATOM 86   C CA  . PRO A 1 11  ? 11.904  26.698 15.417  1.00 23.47  ? 12  PRO A CA  1 
ATOM 87   C C   . PRO A 1 11  ? 10.768  26.915 14.398  1.00 23.47  ? 12  PRO A C   1 
ATOM 88   O O   . PRO A 1 11  ? 11.011  26.880 13.193  1.00 23.47  ? 12  PRO A O   1 
ATOM 89   C CB  . PRO A 1 11  ? 12.088  25.227 15.740  1.00 6.96   ? 12  PRO A CB  1 
ATOM 90   C CG  . PRO A 1 11  ? 11.334  25.090 17.038  1.00 6.96   ? 12  PRO A CG  1 
ATOM 91   C CD  . PRO A 1 11  ? 11.808  26.274 17.795  1.00 6.96   ? 12  PRO A CD  1 
ATOM 92   N N   . GLY A 1 12  ? 9.542   27.122 14.865  1.00 7.53   ? 13  GLY A N   1 
ATOM 93   C CA  . GLY A 1 12  ? 8.437   27.315 13.937  1.00 7.53   ? 13  GLY A CA  1 
ATOM 94   C C   . GLY A 1 12  ? 7.207   27.876 14.622  1.00 7.53   ? 13  GLY A C   1 
ATOM 95   O O   . GLY A 1 12  ? 7.217   28.064 15.829  1.00 7.53   ? 13  GLY A O   1 
ATOM 96   N N   . SER A 1 13  ? 6.144   28.143 13.874  1.00 18.18  ? 14  SER A N   1 
ATOM 97   C CA  . SER A 1 13  ? 4.950   28.701 14.481  1.00 18.18  ? 14  SER A CA  1 
ATOM 98   C C   . SER A 1 13  ? 3.997   27.612 14.954  1.00 18.18  ? 14  SER A C   1 
ATOM 99   O O   . SER A 1 13  ? 2.911   27.900 15.468  1.00 18.18  ? 14  SER A O   1 
ATOM 100  C CB  . SER A 1 13  ? 4.242   29.618 13.492  1.00 42.00  ? 14  SER A CB  1 
ATOM 101  O OG  . SER A 1 13  ? 3.839   28.899 12.343  1.00 42.00  ? 14  SER A OG  1 
ATOM 102  N N   . VAL A 1 14  ? 4.393   26.358 14.771  1.00 23.03  ? 15  VAL A N   1 
ATOM 103  C CA  . VAL A 1 14  ? 3.573   25.238 15.213  1.00 23.03  ? 15  VAL A CA  1 
ATOM 104  C C   . VAL A 1 14  ? 4.426   24.524 16.239  1.00 23.03  ? 15  VAL A C   1 
ATOM 105  O O   . VAL A 1 14  ? 5.413   23.893 15.896  1.00 23.03  ? 15  VAL A O   1 
ATOM 106  C CB  . VAL A 1 14  ? 3.230   24.311 14.045  1.00 26.30  ? 15  VAL A CB  1 
ATOM 107  C CG1 . VAL A 1 14  ? 2.348   23.159 14.535  1.00 26.30  ? 15  VAL A CG1 1 
ATOM 108  C CG2 . VAL A 1 14  ? 2.493   25.109 12.958  1.00 26.30  ? 15  VAL A CG2 1 
ATOM 109  N N   . ILE A 1 15  ? 4.032   24.653 17.501  1.00 27.24  ? 16  ILE A N   1 
ATOM 110  C CA  . ILE A 1 15  ? 4.757   24.101 18.649  1.00 27.24  ? 16  ILE A CA  1 
ATOM 111  C C   . ILE A 1 15  ? 3.962   23.060 19.452  1.00 27.24  ? 16  ILE A C   1 
ATOM 112  O O   . ILE A 1 15  ? 2.808   23.298 19.796  1.00 27.24  ? 16  ILE A O   1 
ATOM 113  C CB  . ILE A 1 15  ? 5.142   25.264 19.600  1.00 23.21  ? 16  ILE A CB  1 
ATOM 114  C CG1 . ILE A 1 15  ? 5.941   26.303 18.824  1.00 23.21  ? 16  ILE A CG1 1 
ATOM 115  C CG2 . ILE A 1 15  ? 5.943   24.756 20.787  1.00 23.21  ? 16  ILE A CG2 1 
ATOM 116  C CD1 . ILE A 1 15  ? 7.157   25.709 18.144  1.00 23.21  ? 16  ILE A CD1 1 
ATOM 117  N N   . THR A 1 16  ? 4.557   21.916 19.770  1.00 25.64  ? 17  THR A N   1 
ATOM 118  C CA  . THR A 1 16  ? 3.801   20.945 20.544  1.00 25.64  ? 17  THR A CA  1 
ATOM 119  C C   . THR A 1 16  ? 3.742   21.332 22.023  1.00 25.64  ? 17  THR A C   1 
ATOM 120  O O   . THR A 1 16  ? 4.708   21.847 22.587  1.00 25.64  ? 17  THR A O   1 
ATOM 121  C CB  . THR A 1 16  ? 4.352   19.508 20.369  1.00 25.23  ? 17  THR A CB  1 
ATOM 122  O OG1 . THR A 1 16  ? 5.763   19.481 20.604  1.00 25.23  ? 17  THR A OG1 1 
ATOM 123  C CG2 . THR A 1 16  ? 4.078   19.023 18.965  1.00 25.23  ? 17  THR A CG2 1 
ATOM 124  N N   . GLN A 1 17  ? 2.584   21.098 22.631  1.00 19.10  ? 18  GLN A N   1 
ATOM 125  C CA  . GLN A 1 17  ? 2.339   21.424 24.029  1.00 19.10  ? 18  GLN A CA  1 
ATOM 126  C C   . GLN A 1 17  ? 3.524   21.116 24.922  1.00 19.10  ? 18  GLN A C   1 
ATOM 127  O O   . GLN A 1 17  ? 4.035   19.992 24.914  1.00 19.10  ? 18  GLN A O   1 
ATOM 128  C CB  . GLN A 1 17  ? 1.110   20.657 24.526  1.00 12.59  ? 18  GLN A CB  1 
ATOM 129  C CG  . GLN A 1 17  ? 0.328   21.352 25.635  1.00 12.59  ? 18  GLN A CG  1 
ATOM 130  C CD  . GLN A 1 17  ? 0.978   21.219 26.979  1.00 12.59  ? 18  GLN A CD  1 
ATOM 131  O OE1 . GLN A 1 17  ? 2.100   20.740 27.088  1.00 12.59  ? 18  GLN A OE1 1 
ATOM 132  N NE2 . GLN A 1 17  ? 0.279   21.648 28.020  1.00 12.59  ? 18  GLN A NE2 1 
ATOM 133  N N   . GLY A 1 18  ? 3.963   22.117 25.682  1.00 8.02   ? 19  GLY A N   1 
ATOM 134  C CA  . GLY A 1 18  ? 5.072   21.930 26.602  1.00 8.02   ? 19  GLY A CA  1 
ATOM 135  C C   . GLY A 1 18  ? 6.461   22.137 26.037  1.00 8.02   ? 19  GLY A C   1 
ATOM 136  O O   . GLY A 1 18  ? 7.451   22.053 26.769  1.00 8.02   ? 19  GLY A O   1 
ATOM 137  N N   . SER A 1 19  ? 6.546   22.407 24.741  1.00 15.53  ? 20  SER A N   1 
ATOM 138  C CA  . SER A 1 19  ? 7.833   22.630 24.103  1.00 15.53  ? 20  SER A CA  1 
ATOM 139  C C   . SER A 1 19  ? 8.183   24.111 24.082  1.00 15.53  ? 20  SER A C   1 
ATOM 140  O O   . SER A 1 19  ? 7.314   24.972 24.254  1.00 15.53  ? 20  SER A O   1 
ATOM 141  C CB  . SER A 1 19  ? 7.799   22.098 22.677  1.00 57.36  ? 20  SER A CB  1 
ATOM 142  O OG  . SER A 1 19  ? 7.462   20.724 22.676  1.00 57.36  ? 20  SER A OG  1 
ATOM 143  N N   . PRO A 1 20  ? 9.468   24.430 23.880  1.00 20.74  ? 21  PRO A N   1 
ATOM 144  C CA  . PRO A 1 20  ? 9.908   25.825 23.837  1.00 20.74  ? 21  PRO A CA  1 
ATOM 145  C C   . PRO A 1 20  ? 9.688   26.479 22.469  1.00 20.74  ? 21  PRO A C   1 
ATOM 146  O O   . PRO A 1 20  ? 9.534   25.797 21.451  1.00 20.74  ? 21  PRO A O   1 
ATOM 147  C CB  . PRO A 1 20  ? 11.384  25.722 24.185  1.00 10.31  ? 21  PRO A CB  1 
ATOM 148  C CG  . PRO A 1 20  ? 11.767  24.449 23.508  1.00 10.31  ? 21  PRO A CG  1 
ATOM 149  C CD  . PRO A 1 20  ? 10.629  23.526 23.903  1.00 10.31  ? 21  PRO A CD  1 
ATOM 150  N N   . VAL A 1 21  ? 9.671   27.808 22.466  1.00 7.56   ? 22  VAL A N   1 
ATOM 151  C CA  . VAL A 1 21  ? 9.495   28.587 21.251  1.00 7.56   ? 22  VAL A CA  1 
ATOM 152  C C   . VAL A 1 21  ? 9.861   30.031 21.525  1.00 7.56   ? 22  VAL A C   1 
ATOM 153  O O   . VAL A 1 21  ? 9.571   30.568 22.594  1.00 7.56   ? 22  VAL A O   1 
ATOM 154  C CB  . VAL A 1 21  ? 8.033   28.575 20.727  1.00 13.01  ? 22  VAL A CB  1 
ATOM 155  C CG1 . VAL A 1 21  ? 7.101   29.299 21.699  1.00 13.01  ? 22  VAL A CG1 1 
ATOM 156  C CG2 . VAL A 1 21  ? 7.975   29.257 19.382  1.00 13.01  ? 22  VAL A CG2 1 
ATOM 157  N N   . THR A 1 22  ? 10.494  30.656 20.545  1.00 18.30  ? 23  THR A N   1 
ATOM 158  C CA  . THR A 1 22  ? 10.890  32.051 20.654  1.00 18.30  ? 23  THR A CA  1 
ATOM 159  C C   . THR A 1 22  ? 10.376  32.837 19.434  1.00 18.30  ? 23  THR A C   1 
ATOM 160  O O   . THR A 1 22  ? 10.756  32.545 18.305  1.00 18.30  ? 23  THR A O   1 
ATOM 161  C CB  . THR A 1 22  ? 12.435  32.167 20.746  1.00 22.80  ? 23  THR A CB  1 
ATOM 162  O OG1 . THR A 1 22  ? 12.883  31.619 21.996  1.00 22.80  ? 23  THR A OG1 1 
ATOM 163  C CG2 . THR A 1 22  ? 12.877  33.624 20.633  1.00 22.80  ? 23  THR A CG2 1 
ATOM 164  N N   . LEU A 1 23  ? 9.488   33.806 19.668  1.00 2.78   ? 24  LEU A N   1 
ATOM 165  C CA  . LEU A 1 23  ? 8.972   34.628 18.584  1.00 2.78   ? 24  LEU A CA  1 
ATOM 166  C C   . LEU A 1 23  ? 10.039  35.691 18.400  1.00 2.78   ? 24  LEU A C   1 
ATOM 167  O O   . LEU A 1 23  ? 10.634  36.156 19.363  1.00 2.78   ? 24  LEU A O   1 
ATOM 168  C CB  . LEU A 1 23  ? 7.647   35.279 18.962  1.00 12.96  ? 24  LEU A CB  1 
ATOM 169  C CG  . LEU A 1 23  ? 6.611   34.391 19.641  1.00 12.96  ? 24  LEU A CG  1 
ATOM 170  C CD1 . LEU A 1 23  ? 5.317   35.185 19.801  1.00 12.96  ? 24  LEU A CD1 1 
ATOM 171  C CD2 . LEU A 1 23  ? 6.364   33.122 18.829  1.00 12.96  ? 24  LEU A CD2 1 
ATOM 172  N N   . ARG A 1 24  ? 10.302  36.063 17.159  1.00 28.44  ? 25  ARG A N   1 
ATOM 173  C CA  . ARG A 1 24  ? 11.324  37.041 16.915  1.00 28.44  ? 25  ARG A CA  1 
ATOM 174  C C   . ARG A 1 24  ? 10.878  38.134 15.990  1.00 28.44  ? 25  ARG A C   1 
ATOM 175  O O   . ARG A 1 24  ? 10.180  37.910 15.002  1.00 28.44  ? 25  ARG A O   1 
ATOM 176  C CB  . ARG A 1 24  ? 12.555  36.347 16.355  1.00 37.35  ? 25  ARG A CB  1 
ATOM 177  C CG  . ARG A 1 24  ? 13.070  35.258 17.272  1.00 37.35  ? 25  ARG A CG  1 
ATOM 178  C CD  . ARG A 1 24  ? 14.504  34.920 16.953  1.00 37.35  ? 25  ARG A CD  1 
ATOM 179  N NE  . ARG A 1 24  ? 15.298  36.135 16.847  1.00 37.35  ? 25  ARG A NE  1 
ATOM 180  C CZ  . ARG A 1 24  ? 16.408  36.228 16.130  1.00 37.35  ? 25  ARG A CZ  1 
ATOM 181  N NH1 . ARG A 1 24  ? 16.847  35.166 15.470  1.00 37.35  ? 25  ARG A NH1 1 
ATOM 182  N NH2 . ARG A 1 24  ? 17.046  37.386 16.028  1.00 37.35  ? 25  ARG A NH2 1 
ATOM 183  N N   . CYS A 1 25  ? 11.297  39.342 16.327  1.00 36.92  ? 26  CYS A N   1 
ATOM 184  C CA  . CYS A 1 25  ? 10.956  40.491 15.510  1.00 36.92  ? 26  CYS A CA  1 
ATOM 185  C C   . CYS A 1 25  ? 12.208  41.220 15.027  1.00 36.92  ? 26  CYS A C   1 
ATOM 186  O O   . CYS A 1 25  ? 13.132  41.491 15.800  1.00 36.92  ? 26  CYS A O   1 
ATOM 187  C CB  . CYS A 1 25  ? 10.052  41.437 16.291  1.00 41.71  ? 26  CYS A CB  1 
ATOM 188  S SG  . CYS A 1 25  ? 9.232   42.626 15.235  1.00 41.71  ? 26  CYS A SG  1 
ATOM 189  N N   . GLN A 1 26  ? 12.280  41.498 13.733  1.00 39.89  ? 27  GLN A N   1 
ATOM 190  C CA  . GLN A 1 26  ? 13.442  42.208 13.223  1.00 39.89  ? 27  GLN A CA  1 
ATOM 191  C C   . GLN A 1 26  ? 13.030  43.369 12.332  1.00 39.89  ? 27  GLN A C   1 
ATOM 192  O O   . GLN A 1 26  ? 12.090  43.265 11.547  1.00 39.89  ? 27  GLN A O   1 
ATOM 193  C CB  . GLN A 1 26  ? 14.383  41.300 12.427  1.00 101.36 ? 27  GLN A CB  1 
ATOM 194  C CG  . GLN A 1 26  ? 15.415  42.108 11.686  1.00 101.36 ? 27  GLN A CG  1 
ATOM 195  C CD  . GLN A 1 26  ? 16.490  41.242 11.032  1.00 101.36 ? 27  GLN A CD  1 
ATOM 196  O OE1 . GLN A 1 26  ? 17.147  40.456 11.691  1.00 101.36 ? 27  GLN A OE1 1 
ATOM 197  N NE2 . GLN A 1 26  ? 16.646  41.435 9.741   1.00 101.36 ? 27  GLN A NE2 1 
ATOM 198  N N   . GLY A 1 27  ? 13.751  44.475 12.467  1.00 51.19  ? 28  GLY A N   1 
ATOM 199  C CA  . GLY A 1 27  ? 13.479  45.665 11.680  1.00 51.19  ? 28  GLY A CA  1 
ATOM 200  C C   . GLY A 1 27  ? 14.752  46.488 11.517  1.00 51.19  ? 28  GLY A C   1 
ATOM 201  O O   . GLY A 1 27  ? 15.022  47.407 12.298  1.00 51.19  ? 28  GLY A O   1 
ATOM 202  N N   . THR A 1 31  ? 15.099  48.899 15.600  1.00 37.92  ? 32  THR A N   1 
ATOM 203  C CA  . THR A 1 31  ? 16.420  48.501 16.082  1.00 37.92  ? 32  THR A CA  1 
ATOM 204  C C   . THR A 1 31  ? 16.416  48.245 17.601  1.00 37.92  ? 32  THR A C   1 
ATOM 205  O O   . THR A 1 31  ? 17.219  47.447 18.095  1.00 37.92  ? 32  THR A O   1 
ATOM 206  C CB  . THR A 1 31  ? 17.515  49.585 15.747  1.00 26.03  ? 32  THR A CB  1 
ATOM 207  O OG1 . THR A 1 31  ? 18.770  48.955 15.433  1.00 26.03  ? 32  THR A OG1 1 
ATOM 208  C CG2 . THR A 1 31  ? 17.728  50.513 16.938  1.00 26.03  ? 32  THR A CG2 1 
ATOM 209  N N   . GLN A 1 32  ? 15.535  48.915 18.349  1.00 29.45  ? 33  GLN A N   1 
ATOM 210  C CA  . GLN A 1 32  ? 15.503  48.687 19.798  1.00 29.45  ? 33  GLN A CA  1 
ATOM 211  C C   . GLN A 1 32  ? 14.175  48.750 20.555  1.00 29.45  ? 33  GLN A C   1 
ATOM 212  O O   . GLN A 1 32  ? 13.967  47.977 21.486  1.00 29.45  ? 33  GLN A O   1 
ATOM 213  C CB  . GLN A 1 32  ? 16.507  49.593 20.489  1.00 63.24  ? 33  GLN A CB  1 
ATOM 214  C CG  . GLN A 1 32  ? 17.933  49.183 20.223  1.00 63.24  ? 33  GLN A CG  1 
ATOM 215  C CD  . GLN A 1 32  ? 18.751  49.130 21.490  1.00 63.24  ? 33  GLN A CD  1 
ATOM 216  O OE1 . GLN A 1 32  ? 18.773  50.094 22.257  1.00 63.24  ? 33  GLN A OE1 1 
ATOM 217  N NE2 . GLN A 1 32  ? 19.432  48.005 21.722  1.00 63.24  ? 33  GLN A NE2 1 
ATOM 218  N N   . GLU A 1 33  ? 13.278  49.651 20.175  1.00 38.69  ? 34  GLU A N   1 
ATOM 219  C CA  . GLU A 1 33  ? 11.989  49.773 20.856  1.00 38.69  ? 34  GLU A CA  1 
ATOM 220  C C   . GLU A 1 33  ? 10.940  48.797 20.279  1.00 38.69  ? 34  GLU A C   1 
ATOM 221  O O   . GLU A 1 33  ? 9.983   49.218 19.628  1.00 38.69  ? 34  GLU A O   1 
ATOM 222  C CB  . GLU A 1 33  ? 11.515  51.222 20.732  1.00 73.36  ? 34  GLU A CB  1 
ATOM 223  C CG  . GLU A 1 33  ? 10.190  51.541 21.382  1.00 73.36  ? 34  GLU A CG  1 
ATOM 224  C CD  . GLU A 1 33  ? 10.187  51.280 22.871  1.00 73.36  ? 34  GLU A CD  1 
ATOM 225  O OE1 . GLU A 1 33  ? 11.150  51.717 23.542  1.00 73.36  ? 34  GLU A OE1 1 
ATOM 226  O OE2 . GLU A 1 33  ? 9.218   50.649 23.367  1.00 73.36  ? 34  GLU A OE2 1 
ATOM 227  N N   . TYR A 1 34  ? 11.126  47.497 20.525  1.00 27.73  ? 35  TYR A N   1 
ATOM 228  C CA  . TYR A 1 34  ? 10.218  46.449 20.025  1.00 27.73  ? 35  TYR A CA  1 
ATOM 229  C C   . TYR A 1 34  ? 9.002   46.163 20.887  1.00 27.73  ? 35  TYR A C   1 
ATOM 230  O O   . TYR A 1 34  ? 9.108   46.009 22.101  1.00 27.73  ? 35  TYR A O   1 
ATOM 231  C CB  . TYR A 1 34  ? 10.938  45.109 19.871  1.00 10.37  ? 35  TYR A CB  1 
ATOM 232  C CG  . TYR A 1 34  ? 11.876  45.015 18.710  1.00 10.37  ? 35  TYR A CG  1 
ATOM 233  C CD1 . TYR A 1 34  ? 13.255  45.166 18.886  1.00 10.37  ? 35  TYR A CD1 1 
ATOM 234  C CD2 . TYR A 1 34  ? 11.391  44.779 17.428  1.00 10.37  ? 35  TYR A CD2 1 
ATOM 235  C CE1 . TYR A 1 34  ? 14.130  45.082 17.803  1.00 10.37  ? 35  TYR A CE1 1 
ATOM 236  C CE2 . TYR A 1 34  ? 12.246  44.695 16.341  1.00 10.37  ? 35  TYR A CE2 1 
ATOM 237  C CZ  . TYR A 1 34  ? 13.615  44.847 16.528  1.00 10.37  ? 35  TYR A CZ  1 
ATOM 238  O OH  . TYR A 1 34  ? 14.451  44.775 15.431  1.00 10.37  ? 35  TYR A OH  1 
ATOM 239  N N   . ARG A 1 35  ? 7.849   46.051 20.248  1.00 42.64  ? 36  ARG A N   1 
ATOM 240  C CA  . ARG A 1 35  ? 6.629   45.736 20.968  1.00 42.64  ? 36  ARG A CA  1 
ATOM 241  C C   . ARG A 1 35  ? 5.902   44.599 20.283  1.00 42.64  ? 36  ARG A C   1 
ATOM 242  O O   . ARG A 1 35  ? 5.655   44.633 19.077  1.00 42.64  ? 36  ARG A O   1 
ATOM 243  C CB  . ARG A 1 35  ? 5.710   46.949 21.067  1.00 43.14  ? 36  ARG A CB  1 
ATOM 244  C CG  . ARG A 1 35  ? 6.068   47.896 22.194  1.00 43.14  ? 36  ARG A CG  1 
ATOM 245  C CD  . ARG A 1 35  ? 4.966   48.923 22.419  1.00 43.14  ? 36  ARG A CD  1 
ATOM 246  N NE  . ARG A 1 35  ? 4.316   48.759 23.721  1.00 43.14  ? 36  ARG A NE  1 
ATOM 247  C CZ  . ARG A 1 35  ? 3.691   47.655 24.135  1.00 43.14  ? 36  ARG A CZ  1 
ATOM 248  N NH1 . ARG A 1 35  ? 3.612   46.581 23.353  1.00 43.14  ? 36  ARG A NH1 1 
ATOM 249  N NH2 . ARG A 1 35  ? 3.149   47.620 25.346  1.00 43.14  ? 36  ARG A NH2 1 
ATOM 250  N N   . LEU A 1 36  ? 5.578   43.585 21.068  1.00 11.58  ? 37  LEU A N   1 
ATOM 251  C CA  . LEU A 1 36  ? 4.876   42.421 20.578  1.00 11.58  ? 37  LEU A CA  1 
ATOM 252  C C   . LEU A 1 36  ? 3.503   42.441 21.224  1.00 11.58  ? 37  LEU A C   1 
ATOM 253  O O   . LEU A 1 36  ? 3.351   42.904 22.349  1.00 11.58  ? 37  LEU A O   1 
ATOM 254  C CB  . LEU A 1 36  ? 5.629   41.147 20.984  1.00 10.42  ? 37  LEU A CB  1 
ATOM 255  C CG  . LEU A 1 36  ? 4.977   39.828 20.571  1.00 10.42  ? 37  LEU A CG  1 
ATOM 256  C CD1 . LEU A 1 36  ? 4.917   39.740 19.049  1.00 10.42  ? 37  LEU A CD1 1 
ATOM 257  C CD2 . LEU A 1 36  ? 5.754   38.679 21.151  1.00 10.42  ? 37  LEU A CD2 1 
ATOM 258  N N   . TYR A 1 37  ? 2.495   41.943 20.524  1.00 43.13  ? 38  TYR A N   1 
ATOM 259  C CA  . TYR A 1 37  ? 1.169   41.929 21.104  1.00 43.13  ? 38  TYR A CA  1 
ATOM 260  C C   . TYR A 1 37  ? 0.253   40.977 20.358  1.00 43.13  ? 38  TYR A C   1 
ATOM 261  O O   . TYR A 1 37  ? 0.377   40.806 19.151  1.00 43.13  ? 38  TYR A O   1 
ATOM 262  C CB  . TYR A 1 37  ? 0.600   43.345 21.102  1.00 12.72  ? 38  TYR A CB  1 
ATOM 263  C CG  . TYR A 1 37  ? 0.067   43.812 19.775  1.00 12.72  ? 38  TYR A CG  1 
ATOM 264  C CD1 . TYR A 1 37  ? -1.204  43.437 19.354  1.00 12.72  ? 38  TYR A CD1 1 
ATOM 265  C CD2 . TYR A 1 37  ? 0.819   44.633 18.945  1.00 12.72  ? 38  TYR A CD2 1 
ATOM 266  C CE1 . TYR A 1 37  ? -1.721  43.869 18.137  1.00 12.72  ? 38  TYR A CE1 1 
ATOM 267  C CE2 . TYR A 1 37  ? 0.316   45.076 17.723  1.00 12.72  ? 38  TYR A CE2 1 
ATOM 268  C CZ  . TYR A 1 37  ? -0.963  44.691 17.321  1.00 12.72  ? 38  TYR A CZ  1 
ATOM 269  O OH  . TYR A 1 37  ? -1.502  45.128 16.124  1.00 12.72  ? 38  TYR A OH  1 
ATOM 270  N N   . ARG A 1 38  ? -0.658  40.346 21.088  1.00 23.01  ? 39  ARG A N   1 
ATOM 271  C CA  . ARG A 1 38  ? -1.611  39.419 20.493  1.00 23.01  ? 39  ARG A CA  1 
ATOM 272  C C   . ARG A 1 38  ? -2.919  40.148 20.192  1.00 23.01  ? 39  ARG A C   1 
ATOM 273  O O   . ARG A 1 38  ? -3.309  41.046 20.938  1.00 23.01  ? 39  ARG A O   1 
ATOM 274  C CB  . ARG A 1 38  ? -1.882  38.253 21.454  1.00 34.02  ? 39  ARG A CB  1 
ATOM 275  C CG  . ARG A 1 38  ? -2.915  37.261 20.928  1.00 34.02  ? 39  ARG A CG  1 
ATOM 276  C CD  . ARG A 1 38  ? -2.972  35.988 21.755  1.00 34.02  ? 39  ARG A CD  1 
ATOM 277  N NE  . ARG A 1 38  ? -3.401  36.270 23.112  1.00 34.02  ? 39  ARG A NE  1 
ATOM 278  C CZ  . ARG A 1 38  ? -3.555  35.336 24.036  1.00 34.02  ? 39  ARG A CZ  1 
ATOM 279  N NH1 . ARG A 1 38  ? -3.308  34.076 23.727  1.00 34.02  ? 39  ARG A NH1 1 
ATOM 280  N NH2 . ARG A 1 38  ? -3.955  35.660 25.257  1.00 34.02  ? 39  ARG A NH2 1 
ATOM 281  N N   . GLU A 1 39  ? -3.592  39.753 19.114  1.00 15.35  ? 40  GLU A N   1 
ATOM 282  C CA  . GLU A 1 39  ? -4.846  40.382 18.734  1.00 15.35  ? 40  GLU A CA  1 
ATOM 283  C C   . GLU A 1 39  ? -5.969  39.866 19.634  1.00 15.35  ? 40  GLU A C   1 
ATOM 284  O O   . GLU A 1 39  ? -5.775  38.912 20.366  1.00 15.35  ? 40  GLU A O   1 
ATOM 285  C CB  . GLU A 1 39  ? -5.185  40.063 17.274  1.00 26.49  ? 40  GLU A CB  1 
ATOM 286  C CG  . GLU A 1 39  ? -4.043  40.346 16.298  1.00 26.49  ? 40  GLU A CG  1 
ATOM 287  C CD  . GLU A 1 39  ? -4.446  40.197 14.813  1.00 26.49  ? 40  GLU A CD  1 
ATOM 288  O OE1 . GLU A 1 39  ? -5.407  39.454 14.531  1.00 26.49  ? 40  GLU A OE1 1 
ATOM 289  O OE2 . GLU A 1 39  ? -3.803  40.819 13.931  1.00 26.49  ? 40  GLU A OE2 1 
ATOM 290  N N   . LYS A 1 40  ? -7.124  40.530 19.589  1.00 18.70  ? 41  LYS A N   1 
ATOM 291  C CA  . LYS A 1 40  ? -8.329  40.147 20.340  1.00 18.70  ? 41  LYS A CA  1 
ATOM 292  C C   . LYS A 1 40  ? -8.248  39.799 21.830  1.00 18.70  ? 41  LYS A C   1 
ATOM 293  O O   . LYS A 1 40  ? -9.219  39.984 22.556  1.00 18.70  ? 41  LYS A O   1 
ATOM 294  C CB  . LYS A 1 40  ? -9.007  38.991 19.616  1.00 34.75  ? 41  LYS A CB  1 
ATOM 295  C CG  . LYS A 1 40  ? -8.999  39.138 18.108  1.00 34.75  ? 41  LYS A CG  1 
ATOM 296  C CD  . LYS A 1 40  ? -9.784  40.355 17.684  1.00 34.75  ? 41  LYS A CD  1 
ATOM 297  C CE  . LYS A 1 40  ? -9.699  40.587 16.187  1.00 34.75  ? 41  LYS A CE  1 
ATOM 298  N NZ  . LYS A 1 40  ? -10.556 41.735 15.745  1.00 34.75  ? 41  LYS A NZ  1 
ATOM 299  N N   . LYS A 1 41  ? -7.114  39.283 22.285  1.00 21.16  ? 42  LYS A N   1 
ATOM 300  C CA  . LYS A 1 41  ? -6.961  38.941 23.699  1.00 21.16  ? 42  LYS A CA  1 
ATOM 301  C C   . LYS A 1 41  ? -5.529  39.170 24.171  1.00 21.16  ? 42  LYS A C   1 
ATOM 302  O O   . LYS A 1 41  ? -4.589  38.571 23.656  1.00 21.16  ? 42  LYS A O   1 
ATOM 303  C CB  . LYS A 1 41  ? -7.362  37.486 23.955  1.00 54.55  ? 42  LYS A CB  1 
ATOM 304  C CG  . LYS A 1 41  ? -7.274  37.110 25.425  1.00 54.55  ? 42  LYS A CG  1 
ATOM 305  C CD  . LYS A 1 41  ? -7.889  35.748 25.727  1.00 54.55  ? 42  LYS A CD  1 
ATOM 306  C CE  . LYS A 1 41  ? -7.971  35.521 27.238  1.00 54.55  ? 42  LYS A CE  1 
ATOM 307  N NZ  . LYS A 1 41  ? -8.595  34.215 27.565  1.00 54.55  ? 42  LYS A NZ  1 
ATOM 308  N N   . THR A 1 42  ? -5.373  40.044 25.155  1.00 31.82  ? 43  THR A N   1 
ATOM 309  C CA  . THR A 1 42  ? -4.057  40.368 25.691  1.00 31.82  ? 43  THR A CA  1 
ATOM 310  C C   . THR A 1 42  ? -3.312  39.146 26.239  1.00 31.82  ? 43  THR A C   1 
ATOM 311  O O   . THR A 1 42  ? -3.879  38.331 26.969  1.00 31.82  ? 43  THR A O   1 
ATOM 312  C CB  . THR A 1 42  ? -4.180  41.430 26.788  1.00 34.48  ? 43  THR A CB  1 
ATOM 313  O OG1 . THR A 1 42  ? -5.269  41.086 27.652  1.00 34.48  ? 43  THR A OG1 1 
ATOM 314  C CG2 . THR A 1 42  ? -4.449  42.796 26.183  1.00 34.48  ? 43  THR A CG2 1 
ATOM 315  N N   . ALA A 1 43  ? -2.038  39.025 25.874  1.00 18.28  ? 44  ALA A N   1 
ATOM 316  C CA  . ALA A 1 43  ? -1.207  37.910 26.312  1.00 18.28  ? 44  ALA A CA  1 
ATOM 317  C C   . ALA A 1 43  ? -0.211  38.345 27.386  1.00 18.28  ? 44  ALA A C   1 
ATOM 318  O O   . ALA A 1 43  ? 0.854   38.902 27.099  1.00 18.28  ? 44  ALA A O   1 
ATOM 319  C CB  . ALA A 1 43  ? -0.470  37.308 25.122  1.00 19.29  ? 44  ALA A CB  1 
ATOM 320  N N   . PRO A 1 44  ? -0.550  38.083 28.649  1.00 20.32  ? 45  PRO A N   1 
ATOM 321  C CA  . PRO A 1 44  ? 0.292   38.438 29.794  1.00 20.32  ? 45  PRO A CA  1 
ATOM 322  C C   . PRO A 1 44  ? 1.723   37.924 29.655  1.00 20.32  ? 45  PRO A C   1 
ATOM 323  O O   . PRO A 1 44  ? 2.677   38.603 30.046  1.00 20.32  ? 45  PRO A O   1 
ATOM 324  C CB  . PRO A 1 44  ? -0.425  37.780 30.969  1.00 21.03  ? 45  PRO A CB  1 
ATOM 325  C CG  . PRO A 1 44  ? -1.865  37.715 30.515  1.00 21.03  ? 45  PRO A CG  1 
ATOM 326  C CD  . PRO A 1 44  ? -1.734  37.316 29.072  1.00 21.03  ? 45  PRO A CD  1 
ATOM 327  N N   . TRP A 1 45  ? 1.871   36.729 29.088  1.00 11.25  ? 46  TRP A N   1 
ATOM 328  C CA  . TRP A 1 45  ? 3.190   36.126 28.943  1.00 11.25  ? 46  TRP A CA  1 
ATOM 329  C C   . TRP A 1 45  ? 4.259   37.049 28.362  1.00 11.25  ? 46  TRP A C   1 
ATOM 330  O O   . TRP A 1 45  ? 5.454   36.826 28.557  1.00 11.25  ? 46  TRP A O   1 
ATOM 331  C CB  . TRP A 1 45  ? 3.106   34.846 28.107  1.00 3.10   ? 46  TRP A CB  1 
ATOM 332  C CG  . TRP A 1 45  ? 3.011   35.019 26.614  1.00 3.10   ? 46  TRP A CG  1 
ATOM 333  C CD1 . TRP A 1 45  ? 1.889   34.916 25.850  1.00 3.10   ? 46  TRP A CD1 1 
ATOM 334  C CD2 . TRP A 1 45  ? 4.099   35.222 25.700  1.00 3.10   ? 46  TRP A CD2 1 
ATOM 335  N NE1 . TRP A 1 45  ? 2.206   35.029 24.513  1.00 3.10   ? 46  TRP A NE1 1 
ATOM 336  C CE2 . TRP A 1 45  ? 3.556   35.214 24.395  1.00 3.10   ? 46  TRP A CE2 1 
ATOM 337  C CE3 . TRP A 1 45  ? 5.482   35.400 25.857  1.00 3.10   ? 46  TRP A CE3 1 
ATOM 338  C CZ2 . TRP A 1 45  ? 4.338   35.379 23.261  1.00 3.10   ? 46  TRP A CZ2 1 
ATOM 339  C CZ3 . TRP A 1 45  ? 6.266   35.562 24.731  1.00 3.10   ? 46  TRP A CZ3 1 
ATOM 340  C CH2 . TRP A 1 45  ? 5.694   35.548 23.446  1.00 3.10   ? 46  TRP A CH2 1 
ATOM 341  N N   . ILE A 1 46  ? 3.822   38.089 27.661  1.00 30.00  ? 47  ILE A N   1 
ATOM 342  C CA  . ILE A 1 46  ? 4.734   39.037 27.030  1.00 30.00  ? 47  ILE A CA  1 
ATOM 343  C C   . ILE A 1 46  ? 5.277   40.076 28.019  1.00 30.00  ? 47  ILE A C   1 
ATOM 344  O O   . ILE A 1 46  ? 6.428   40.519 27.910  1.00 30.00  ? 47  ILE A O   1 
ATOM 345  C CB  . ILE A 1 46  ? 4.020   39.762 25.853  1.00 8.06   ? 47  ILE A CB  1 
ATOM 346  C CG1 . ILE A 1 46  ? 3.373   38.724 24.934  1.00 8.06   ? 47  ILE A CG1 1 
ATOM 347  C CG2 . ILE A 1 46  ? 5.017   40.608 25.060  1.00 8.06   ? 47  ILE A CG2 1 
ATOM 348  C CD1 . ILE A 1 46  ? 2.552   39.318 23.811  1.00 8.06   ? 47  ILE A CD1 1 
ATOM 349  N N   . THR A 1 47  ? 4.448   40.449 28.989  1.00 21.83  ? 48  THR A N   1 
ATOM 350  C CA  . THR A 1 47  ? 4.832   41.446 29.976  1.00 21.83  ? 48  THR A CA  1 
ATOM 351  C C   . THR A 1 47  ? 5.688   40.857 31.091  1.00 21.83  ? 48  THR A C   1 
ATOM 352  O O   . THR A 1 47  ? 5.725   41.377 32.208  1.00 21.83  ? 48  THR A O   1 
ATOM 353  C CB  . THR A 1 47  ? 3.613   42.089 30.604  1.00 4.41   ? 48  THR A CB  1 
ATOM 354  O OG1 . THR A 1 47  ? 3.050   41.194 31.563  1.00 4.41   ? 48  THR A OG1 1 
ATOM 355  C CG2 . THR A 1 47  ? 2.579   42.364 29.557  1.00 4.41   ? 48  THR A CG2 1 
ATOM 356  N N   . ARG A 1 48  ? 6.365   39.760 30.789  1.00 34.57  ? 49  ARG A N   1 
ATOM 357  C CA  . ARG A 1 48  ? 7.236   39.129 31.760  1.00 34.57  ? 49  ARG A CA  1 
ATOM 358  C C   . ARG A 1 48  ? 8.587   38.976 31.091  1.00 34.57  ? 49  ARG A C   1 
ATOM 359  O O   . ARG A 1 48  ? 9.573   38.576 31.716  1.00 34.57  ? 49  ARG A O   1 
ATOM 360  C CB  . ARG A 1 48  ? 6.680   37.766 32.174  1.00 77.62  ? 49  ARG A CB  1 
ATOM 361  C CG  . ARG A 1 48  ? 5.810   37.823 33.419  1.00 77.62  ? 49  ARG A CG  1 
ATOM 362  C CD  . ARG A 1 48  ? 5.325   36.446 33.825  1.00 77.62  ? 49  ARG A CD  1 
ATOM 363  N NE  . ARG A 1 48  ? 4.158   36.039 33.064  1.00 77.62  ? 49  ARG A NE  1 
ATOM 364  C CZ  . ARG A 1 48  ? 3.808   34.775 32.863  1.00 77.62  ? 49  ARG A CZ  1 
ATOM 365  N NH1 . ARG A 1 48  ? 4.548   33.800 33.370  1.00 77.62  ? 49  ARG A NH1 1 
ATOM 366  N NH2 . ARG A 1 48  ? 2.722   34.488 32.154  1.00 77.62  ? 49  ARG A NH2 1 
ATOM 367  N N   . ILE A 1 49  ? 8.621   39.322 29.811  1.00 16.56  ? 50  ILE A N   1 
ATOM 368  C CA  . ILE A 1 49  ? 9.830   39.223 29.022  1.00 16.56  ? 50  ILE A CA  1 
ATOM 369  C C   . ILE A 1 49  ? 10.885  40.229 29.450  1.00 16.56  ? 50  ILE A C   1 
ATOM 370  O O   . ILE A 1 49  ? 10.636  41.440 29.472  1.00 16.56  ? 50  ILE A O   1 
ATOM 371  C CB  . ILE A 1 49  ? 9.515   39.429 27.529  1.00 16.70  ? 50  ILE A CB  1 
ATOM 372  C CG1 . ILE A 1 49  ? 8.615   38.307 27.044  1.00 16.70  ? 50  ILE A CG1 1 
ATOM 373  C CG2 . ILE A 1 49  ? 10.786  39.423 26.703  1.00 16.70  ? 50  ILE A CG2 1 
ATOM 374  C CD1 . ILE A 1 49  ? 9.256   36.957 27.164  1.00 16.70  ? 50  ILE A CD1 1 
ATOM 375  N N   . PRO A 1 50  ? 12.089  39.735 29.788  1.00 16.86  ? 51  PRO A N   1 
ATOM 376  C CA  . PRO A 1 50  ? 13.201  40.596 30.215  1.00 16.86  ? 51  PRO A CA  1 
ATOM 377  C C   . PRO A 1 50  ? 13.362  41.743 29.211  1.00 16.86  ? 51  PRO A C   1 
ATOM 378  O O   . PRO A 1 50  ? 13.215  41.531 27.999  1.00 16.86  ? 51  PRO A O   1 
ATOM 379  C CB  . PRO A 1 50  ? 14.405  39.655 30.171  1.00 65.53  ? 51  PRO A CB  1 
ATOM 380  C CG  . PRO A 1 50  ? 13.809  38.307 30.417  1.00 65.53  ? 51  PRO A CG  1 
ATOM 381  C CD  . PRO A 1 50  ? 12.535  38.340 29.616  1.00 65.53  ? 51  PRO A CD  1 
ATOM 382  N N   . GLN A 1 51  ? 13.664  42.945 29.694  1.00 34.86  ? 52  GLN A N   1 
ATOM 383  C CA  . GLN A 1 51  ? 13.841  44.082 28.788  1.00 34.86  ? 52  GLN A CA  1 
ATOM 384  C C   . GLN A 1 51  ? 15.115  43.879 27.941  1.00 34.86  ? 52  GLN A C   1 
ATOM 385  O O   . GLN A 1 51  ? 15.219  44.351 26.798  1.00 34.86  ? 52  GLN A O   1 
ATOM 386  C CB  . GLN A 1 51  ? 13.914  45.388 29.592  1.00 44.82  ? 52  GLN A CB  1 
ATOM 387  C CG  . GLN A 1 51  ? 13.672  46.661 28.767  1.00 44.82  ? 52  GLN A CG  1 
ATOM 388  C CD  . GLN A 1 51  ? 12.383  46.614 27.941  1.00 44.82  ? 52  GLN A CD  1 
ATOM 389  O OE1 . GLN A 1 51  ? 11.337  46.154 28.409  1.00 44.82  ? 52  GLN A OE1 1 
ATOM 390  N NE2 . GLN A 1 51  ? 12.456  47.106 26.710  1.00 44.82  ? 52  GLN A NE2 1 
ATOM 391  N N   . GLU A 1 52  ? 16.074  43.157 28.511  1.00 49.21  ? 53  GLU A N   1 
ATOM 392  C CA  . GLU A 1 52  ? 17.308  42.871 27.810  1.00 49.21  ? 53  GLU A CA  1 
ATOM 393  C C   . GLU A 1 52  ? 16.984  42.143 26.518  1.00 49.21  ? 53  GLU A C   1 
ATOM 394  O O   . GLU A 1 52  ? 17.620  42.375 25.494  1.00 49.21  ? 53  GLU A O   1 
ATOM 395  C CB  . GLU A 1 52  ? 18.219  42.013 28.684  1.00 115.97 ? 53  GLU A CB  1 
ATOM 396  C CG  . GLU A 1 52  ? 18.990  42.812 29.704  1.00 115.97 ? 53  GLU A CG  1 
ATOM 397  C CD  . GLU A 1 52  ? 19.871  43.856 29.047  1.00 115.97 ? 53  GLU A CD  1 
ATOM 398  O OE1 . GLU A 1 52  ? 19.330  44.787 28.412  1.00 115.97 ? 53  GLU A OE1 1 
ATOM 399  O OE2 . GLU A 1 52  ? 21.108  43.742 29.156  1.00 115.97 ? 53  GLU A OE2 1 
ATOM 400  N N   . LEU A 1 53  ? 15.984  41.265 26.570  1.00 55.03  ? 54  LEU A N   1 
ATOM 401  C CA  . LEU A 1 53  ? 15.566  40.496 25.398  1.00 55.03  ? 54  LEU A CA  1 
ATOM 402  C C   . LEU A 1 53  ? 14.696  41.318 24.455  1.00 55.03  ? 54  LEU A C   1 
ATOM 403  O O   . LEU A 1 53  ? 14.890  41.304 23.236  1.00 55.03  ? 54  LEU A O   1 
ATOM 404  C CB  . LEU A 1 53  ? 14.811  39.228 25.833  1.00 18.15  ? 54  LEU A CB  1 
ATOM 405  C CG  . LEU A 1 53  ? 15.729  38.139 26.395  1.00 18.15  ? 54  LEU A CG  1 
ATOM 406  C CD1 . LEU A 1 53  ? 14.950  36.888 26.789  1.00 18.15  ? 54  LEU A CD1 1 
ATOM 407  C CD2 . LEU A 1 53  ? 16.756  37.816 25.337  1.00 18.15  ? 54  LEU A CD2 1 
ATOM 408  N N   . VAL A 1 54  ? 13.743  42.041 25.029  1.00 28.50  ? 55  VAL A N   1 
ATOM 409  C CA  . VAL A 1 54  ? 12.839  42.869 24.246  1.00 28.50  ? 55  VAL A CA  1 
ATOM 410  C C   . VAL A 1 54  ? 13.583  43.829 23.303  1.00 28.50  ? 55  VAL A C   1 
ATOM 411  O O   . VAL A 1 54  ? 13.135  44.076 22.176  1.00 28.50  ? 55  VAL A O   1 
ATOM 412  C CB  . VAL A 1 54  ? 11.897  43.673 25.175  1.00 12.96  ? 55  VAL A CB  1 
ATOM 413  C CG1 . VAL A 1 54  ? 10.895  44.477 24.342  1.00 12.96  ? 55  VAL A CG1 1 
ATOM 414  C CG2 . VAL A 1 54  ? 11.160  42.711 26.105  1.00 12.96  ? 55  VAL A CG2 1 
ATOM 415  N N   . LYS A 1 55  ? 14.714  44.368 23.759  1.00 51.25  ? 56  LYS A N   1 
ATOM 416  C CA  . LYS A 1 55  ? 15.509  45.283 22.935  1.00 51.25  ? 56  LYS A CA  1 
ATOM 417  C C   . LYS A 1 55  ? 16.090  44.553 21.718  1.00 51.25  ? 56  LYS A C   1 
ATOM 418  O O   . LYS A 1 55  ? 16.316  45.160 20.668  1.00 51.25  ? 56  LYS A O   1 
ATOM 419  C CB  . LYS A 1 55  ? 16.640  45.903 23.767  1.00 56.71  ? 56  LYS A CB  1 
ATOM 420  C CG  . LYS A 1 55  ? 16.154  46.833 24.873  1.00 56.71  ? 56  LYS A CG  1 
ATOM 421  C CD  . LYS A 1 55  ? 17.254  47.170 25.873  1.00 56.71  ? 56  LYS A CD  1 
ATOM 422  C CE  . LYS A 1 55  ? 16.660  47.828 27.118  1.00 56.71  ? 56  LYS A CE  1 
ATOM 423  N NZ  . LYS A 1 55  ? 17.587  47.827 28.289  1.00 56.71  ? 56  LYS A NZ  1 
ATOM 424  N N   . LYS A 1 56  ? 16.322  43.248 21.868  1.00 37.44  ? 57  LYS A N   1 
ATOM 425  C CA  . LYS A 1 56  ? 16.864  42.420 20.788  1.00 37.44  ? 57  LYS A CA  1 
ATOM 426  C C   . LYS A 1 56  ? 15.794  41.685 19.981  1.00 37.44  ? 57  LYS A C   1 
ATOM 427  O O   . LYS A 1 56  ? 16.114  40.798 19.190  1.00 37.44  ? 57  LYS A O   1 
ATOM 428  C CB  . LYS A 1 56  ? 17.851  41.393 21.342  1.00 25.39  ? 57  LYS A CB  1 
ATOM 429  C CG  . LYS A 1 56  ? 19.275  41.895 21.507  1.00 25.39  ? 57  LYS A CG  1 
ATOM 430  C CD  . LYS A 1 56  ? 20.228  40.722 21.650  1.00 25.39  ? 57  LYS A CD  1 
ATOM 431  C CE  . LYS A 1 56  ? 19.821  39.814 22.815  1.00 25.39  ? 57  LYS A CE  1 
ATOM 432  N NZ  . LYS A 1 56  ? 20.212  38.376 22.594  1.00 25.39  ? 57  LYS A NZ  1 
ATOM 433  N N   . GLY A 1 57  ? 14.531  42.048 20.194  1.00 22.84  ? 58  GLY A N   1 
ATOM 434  C CA  . GLY A 1 57  ? 13.432  41.430 19.473  1.00 22.84  ? 58  GLY A CA  1 
ATOM 435  C C   . GLY A 1 57  ? 13.206  39.973 19.819  1.00 22.84  ? 58  GLY A C   1 
ATOM 436  O O   . GLY A 1 57  ? 12.678  39.209 19.017  1.00 22.84  ? 58  GLY A O   1 
ATOM 437  N N   . GLN A 1 58  ? 13.598  39.583 21.023  1.00 40.18  ? 59  GLN A N   1 
ATOM 438  C CA  . GLN A 1 58  ? 13.445  38.202 21.457  1.00 40.18  ? 59  GLN A CA  1 
ATOM 439  C C   . GLN A 1 58  ? 12.445  38.048 22.603  1.00 40.18  ? 59  GLN A C   1 
ATOM 440  O O   . GLN A 1 58  ? 12.598  38.641 23.668  1.00 40.18  ? 59  GLN A O   1 
ATOM 441  C CB  . GLN A 1 58  ? 14.810  37.638 21.856  1.00 28.64  ? 59  GLN A CB  1 
ATOM 442  C CG  . GLN A 1 58  ? 15.737  37.394 20.672  1.00 28.64  ? 59  GLN A CG  1 
ATOM 443  C CD  . GLN A 1 58  ? 17.162  37.057 21.098  1.00 28.64  ? 59  GLN A CD  1 
ATOM 444  O OE1 . GLN A 1 58  ? 17.379  36.388 22.107  1.00 28.64  ? 59  GLN A OE1 1 
ATOM 445  N NE2 . GLN A 1 58  ? 18.140  37.514 20.316  1.00 28.64  ? 59  GLN A NE2 1 
ATOM 446  N N   . PHE A 1 59  ? 11.421  37.237 22.360  1.00 37.27  ? 60  PHE A N   1 
ATOM 447  C CA  . PHE A 1 59  ? 10.361  36.983 23.321  1.00 37.27  ? 60  PHE A CA  1 
ATOM 448  C C   . PHE A 1 59  ? 10.215  35.482 23.428  1.00 37.27  ? 60  PHE A C   1 
ATOM 449  O O   . PHE A 1 59  ? 9.317   34.892 22.822  1.00 37.27  ? 60  PHE A O   1 
ATOM 450  C CB  . PHE A 1 59  ? 9.058   37.589 22.816  1.00 23.28  ? 60  PHE A CB  1 
ATOM 451  C CG  . PHE A 1 59  ? 9.170   39.043 22.469  1.00 23.28  ? 60  PHE A CG  1 
ATOM 452  C CD1 . PHE A 1 59  ? 9.890   39.456 21.348  1.00 23.28  ? 60  PHE A CD1 1 
ATOM 453  C CD2 . PHE A 1 59  ? 8.598   40.013 23.293  1.00 23.28  ? 60  PHE A CD2 1 
ATOM 454  C CE1 . PHE A 1 59  ? 10.040  40.801 21.057  1.00 23.28  ? 60  PHE A CE1 1 
ATOM 455  C CE2 . PHE A 1 59  ? 8.745   41.362 23.006  1.00 23.28  ? 60  PHE A CE2 1 
ATOM 456  C CZ  . PHE A 1 59  ? 9.469   41.756 21.888  1.00 23.28  ? 60  PHE A CZ  1 
ATOM 457  N N   . PRO A 1 60  ? 11.093  34.841 24.213  1.00 20.99  ? 61  PRO A N   1 
ATOM 458  C CA  . PRO A 1 60  ? 11.086  33.392 24.407  1.00 20.99  ? 61  PRO A CA  1 
ATOM 459  C C   . PRO A 1 60  ? 10.051  32.831 25.374  1.00 20.99  ? 61  PRO A C   1 
ATOM 460  O O   . PRO A 1 60  ? 9.720   33.438 26.397  1.00 20.99  ? 61  PRO A O   1 
ATOM 461  C CB  . PRO A 1 60  ? 12.500  33.119 24.870  1.00 5.86   ? 61  PRO A CB  1 
ATOM 462  C CG  . PRO A 1 60  ? 12.749  34.294 25.768  1.00 5.86   ? 61  PRO A CG  1 
ATOM 463  C CD  . PRO A 1 60  ? 12.212  35.458 24.948  1.00 5.86   ? 61  PRO A CD  1 
ATOM 464  N N   . ILE A 1 61  ? 9.552   31.653 25.020  1.00 16.89  ? 62  ILE A N   1 
ATOM 465  C CA  . ILE A 1 61  ? 8.571   30.918 25.805  1.00 16.89  ? 62  ILE A CA  1 
ATOM 466  C C   . ILE A 1 61  ? 9.243   29.574 26.083  1.00 16.89  ? 62  ILE A C   1 
ATOM 467  O O   . ILE A 1 61  ? 9.377   28.744 25.189  1.00 16.89  ? 62  ILE A O   1 
ATOM 468  C CB  . ILE A 1 61  ? 7.281   30.702 24.997  1.00 1.04   ? 62  ILE A CB  1 
ATOM 469  C CG1 . ILE A 1 61  ? 6.594   32.053 24.757  1.00 1.04   ? 62  ILE A CG1 1 
ATOM 470  C CG2 . ILE A 1 61  ? 6.371   29.730 25.723  1.00 1.04   ? 62  ILE A CG2 1 
ATOM 471  C CD1 . ILE A 1 61  ? 5.311   31.989 23.945  1.00 1.04   ? 62  ILE A CD1 1 
ATOM 472  N N   . PRO A 1 62  ? 9.701   29.353 27.322  1.00 43.28  ? 63  PRO A N   1 
ATOM 473  C CA  . PRO A 1 62  ? 10.369  28.102 27.686  1.00 43.28  ? 63  PRO A CA  1 
ATOM 474  C C   . PRO A 1 62  ? 9.522   26.835 27.604  1.00 43.28  ? 63  PRO A C   1 
ATOM 475  O O   . PRO A 1 62  ? 10.055  25.749 27.387  1.00 43.28  ? 63  PRO A O   1 
ATOM 476  C CB  . PRO A 1 62  ? 10.853  28.375 29.108  1.00 50.13  ? 63  PRO A CB  1 
ATOM 477  C CG  . PRO A 1 62  ? 11.068  29.845 29.107  1.00 50.13  ? 63  PRO A CG  1 
ATOM 478  C CD  . PRO A 1 62  ? 9.824   30.329 28.412  1.00 50.13  ? 63  PRO A CD  1 
ATOM 479  N N   . SER A 1 63  ? 8.212   26.980 27.780  1.00 30.72  ? 64  SER A N   1 
ATOM 480  C CA  . SER A 1 63  ? 7.284   25.850 27.749  1.00 30.72  ? 64  SER A CA  1 
ATOM 481  C C   . SER A 1 63  ? 5.900   26.350 27.353  1.00 30.72  ? 64  SER A C   1 
ATOM 482  O O   . SER A 1 63  ? 5.169   26.900 28.174  1.00 30.72  ? 64  SER A O   1 
ATOM 483  C CB  . SER A 1 63  ? 7.226   25.195 29.128  1.00 42.16  ? 64  SER A CB  1 
ATOM 484  O OG  . SER A 1 63  ? 6.147   24.285 29.213  1.00 42.16  ? 64  SER A OG  1 
ATOM 485  N N   . ILE A 1 64  ? 5.532   26.134 26.097  1.00 18.19  ? 65  ILE A N   1 
ATOM 486  C CA  . ILE A 1 64  ? 4.257   26.623 25.587  1.00 18.19  ? 65  ILE A CA  1 
ATOM 487  C C   . ILE A 1 64  ? 3.000   25.925 26.116  1.00 18.19  ? 65  ILE A C   1 
ATOM 488  O O   . ILE A 1 64  ? 2.938   24.697 26.198  1.00 18.19  ? 65  ILE A O   1 
ATOM 489  C CB  . ILE A 1 64  ? 4.259   26.601 24.029  1.00 26.92  ? 65  ILE A CB  1 
ATOM 490  C CG1 . ILE A 1 64  ? 3.379   27.733 23.496  1.00 26.92  ? 65  ILE A CG1 1 
ATOM 491  C CG2 . ILE A 1 64  ? 3.766   25.259 23.505  1.00 26.92  ? 65  ILE A CG2 1 
ATOM 492  C CD1 . ILE A 1 64  ? 3.299   27.781 21.982  1.00 26.92  ? 65  ILE A CD1 1 
ATOM 493  N N   . THR A 1 65  ? 2.002   26.734 26.478  1.00 10.23  ? 66  THR A N   1 
ATOM 494  C CA  . THR A 1 65  ? 0.720   26.239 26.989  1.00 10.23  ? 66  THR A CA  1 
ATOM 495  C C   . THR A 1 65  ? -0.456  26.605 26.048  1.00 10.23  ? 66  THR A C   1 
ATOM 496  O O   . THR A 1 65  ? -0.292  27.330 25.060  1.00 10.23  ? 66  THR A O   1 
ATOM 497  C CB  . THR A 1 65  ? 0.424   26.823 28.371  1.00 24.63  ? 66  THR A CB  1 
ATOM 498  O OG1 . THR A 1 65  ? 0.085   28.208 28.231  1.00 24.63  ? 66  THR A OG1 1 
ATOM 499  C CG2 . THR A 1 65  ? 1.638   26.676 29.282  1.00 24.63  ? 66  THR A CG2 1 
ATOM 500  N N   . TRP A 1 66  ? -1.648  26.108 26.351  1.00 17.44  ? 67  TRP A N   1 
ATOM 501  C CA  . TRP A 1 66  ? -2.787  26.406 25.504  1.00 17.44  ? 67  TRP A CA  1 
ATOM 502  C C   . TRP A 1 66  ? -3.125  27.891 25.560  1.00 17.44  ? 67  TRP A C   1 
ATOM 503  O O   . TRP A 1 66  ? -3.919  28.383 24.763  1.00 17.44  ? 67  TRP A O   1 
ATOM 504  C CB  . TRP A 1 66  ? -4.007  25.591 25.936  1.00 37.74  ? 67  TRP A CB  1 
ATOM 505  C CG  . TRP A 1 66  ? -3.705  24.163 26.245  1.00 37.74  ? 67  TRP A CG  1 
ATOM 506  C CD1 . TRP A 1 66  ? -3.556  23.607 27.481  1.00 37.74  ? 67  TRP A CD1 1 
ATOM 507  C CD2 . TRP A 1 66  ? -3.453  23.124 25.304  1.00 37.74  ? 67  TRP A CD2 1 
ATOM 508  N NE1 . TRP A 1 66  ? -3.222  22.282 27.367  1.00 37.74  ? 67  TRP A NE1 1 
ATOM 509  C CE2 . TRP A 1 66  ? -3.149  21.960 26.036  1.00 37.74  ? 67  TRP A CE2 1 
ATOM 510  C CE3 . TRP A 1 66  ? -3.447  23.061 23.905  1.00 37.74  ? 67  TRP A CE3 1 
ATOM 511  C CZ2 . TRP A 1 66  ? -2.841  20.745 25.420  1.00 37.74  ? 67  TRP A CZ2 1 
ATOM 512  C CZ3 . TRP A 1 66  ? -3.138  21.850 23.289  1.00 37.74  ? 67  TRP A CZ3 1 
ATOM 513  C CH2 . TRP A 1 66  ? -2.840  20.711 24.047  1.00 37.74  ? 67  TRP A CH2 1 
ATOM 514  N N   . GLU A 1 67  ? -2.528  28.605 26.506  1.00 38.12  ? 68  GLU A N   1 
ATOM 515  C CA  . GLU A 1 67  ? -2.797  30.030 26.636  1.00 38.12  ? 68  GLU A CA  1 
ATOM 516  C C   . GLU A 1 67  ? -2.028  30.859 25.610  1.00 38.12  ? 68  GLU A C   1 
ATOM 517  O O   . GLU A 1 67  ? -2.481  31.922 25.181  1.00 38.12  ? 68  GLU A O   1 
ATOM 518  C CB  . GLU A 1 67  ? -2.424  30.518 28.035  1.00 109.93 ? 68  GLU A CB  1 
ATOM 519  C CG  . GLU A 1 67  ? -3.207  31.741 28.465  1.00 109.93 ? 68  GLU A CG  1 
ATOM 520  C CD  . GLU A 1 67  ? -4.393  31.377 29.338  1.00 109.93 ? 68  GLU A CD  1 
ATOM 521  O OE1 . GLU A 1 67  ? -4.269  31.475 30.576  1.00 109.93 ? 68  GLU A OE1 1 
ATOM 522  O OE2 . GLU A 1 67  ? -5.443  30.974 28.797  1.00 109.93 ? 68  GLU A OE2 1 
ATOM 523  N N   . HIS A 1 68  ? -0.861  30.369 25.225  1.00 19.09  ? 69  HIS A N   1 
ATOM 524  C CA  . HIS A 1 68  ? -0.020  31.088 24.290  1.00 19.09  ? 69  HIS A CA  1 
ATOM 525  C C   . HIS A 1 68  ? -0.550  31.059 22.870  1.00 19.09  ? 69  HIS A C   1 
ATOM 526  O O   . HIS A 1 68  ? -0.067  31.782 22.006  1.00 19.09  ? 69  HIS A O   1 
ATOM 527  C CB  . HIS A 1 68  ? 1.406   30.520 24.342  1.00 57.71  ? 69  HIS A CB  1 
ATOM 528  C CG  . HIS A 1 68  ? 2.070   30.675 25.679  1.00 57.71  ? 69  HIS A CG  1 
ATOM 529  N ND1 . HIS A 1 68  ? 3.202   31.443 25.865  1.00 57.71  ? 69  HIS A ND1 1 
ATOM 530  C CD2 . HIS A 1 68  ? 1.742   30.191 26.901  1.00 57.71  ? 69  HIS A CD2 1 
ATOM 531  C CE1 . HIS A 1 68  ? 3.538   31.427 27.142  1.00 57.71  ? 69  HIS A CE1 1 
ATOM 532  N NE2 . HIS A 1 68  ? 2.668   30.675 27.793  1.00 57.71  ? 69  HIS A NE2 1 
ATOM 533  N N   . ALA A 1 69  ? -1.557  30.243 22.614  1.00 27.34  ? 70  ALA A N   1 
ATOM 534  C CA  . ALA A 1 69  ? -2.084  30.169 21.256  1.00 27.34  ? 70  ALA A CA  1 
ATOM 535  C C   . ALA A 1 69  ? -2.708  31.486 20.817  1.00 27.34  ? 70  ALA A C   1 
ATOM 536  O O   . ALA A 1 69  ? -3.416  32.138 21.591  1.00 27.34  ? 70  ALA A O   1 
ATOM 537  C CB  . ALA A 1 69  ? -3.110  29.031 21.144  1.00 26.97  ? 70  ALA A CB  1 
ATOM 538  N N   . GLY A 1 70  ? -2.439  31.881 19.576  1.00 17.88  ? 71  GLY A N   1 
ATOM 539  C CA  . GLY A 1 70  ? -3.020  33.112 19.079  1.00 17.88  ? 71  GLY A CA  1 
ATOM 540  C C   . GLY A 1 70  ? -2.352  33.807 17.907  1.00 17.88  ? 71  GLY A C   1 
ATOM 541  O O   . GLY A 1 70  ? -1.331  33.362 17.391  1.00 17.88  ? 71  GLY A O   1 
ATOM 542  N N   . ARG A 1 71  ? -2.952  34.919 17.491  1.00 34.53  ? 72  ARG A N   1 
ATOM 543  C CA  . ARG A 1 71  ? -2.448  35.730 16.387  1.00 34.53  ? 72  ARG A CA  1 
ATOM 544  C C   . ARG A 1 71  ? -1.640  36.891 16.969  1.00 34.53  ? 72  ARG A C   1 
ATOM 545  O O   . ARG A 1 71  ? -2.179  37.737 17.684  1.00 34.53  ? 72  ARG A O   1 
ATOM 546  C CB  . ARG A 1 71  ? -3.617  36.269 15.575  1.00 52.72  ? 72  ARG A CB  1 
ATOM 547  C CG  . ARG A 1 71  ? -3.595  35.860 14.134  1.00 52.72  ? 72  ARG A CG  1 
ATOM 548  C CD  . ARG A 1 71  ? -4.780  36.433 13.405  1.00 52.72  ? 72  ARG A CD  1 
ATOM 549  N NE  . ARG A 1 71  ? -4.561  36.422 11.966  1.00 52.72  ? 72  ARG A NE  1 
ATOM 550  C CZ  . ARG A 1 71  ? -4.865  37.436 11.163  1.00 52.72  ? 72  ARG A CZ  1 
ATOM 551  N NH1 . ARG A 1 71  ? -5.405  38.546 11.659  1.00 52.72  ? 72  ARG A NH1 1 
ATOM 552  N NH2 . ARG A 1 71  ? -4.611  37.349 9.864   1.00 52.72  ? 72  ARG A NH2 1 
ATOM 553  N N   . TYR A 1 72  ? -0.350  36.931 16.654  1.00 9.58   ? 73  TYR A N   1 
ATOM 554  C CA  . TYR A 1 72  ? 0.541   37.961 17.174  1.00 9.58   ? 73  TYR A CA  1 
ATOM 555  C C   . TYR A 1 72  ? 1.065   38.876 16.098  1.00 9.58   ? 73  TYR A C   1 
ATOM 556  O O   . TYR A 1 72  ? 1.356   38.428 14.997  1.00 9.58   ? 73  TYR A O   1 
ATOM 557  C CB  . TYR A 1 72  ? 1.737   37.302 17.864  1.00 14.89  ? 73  TYR A CB  1 
ATOM 558  C CG  . TYR A 1 72  ? 1.396   36.505 19.098  1.00 14.89  ? 73  TYR A CG  1 
ATOM 559  C CD1 . TYR A 1 72  ? 0.650   35.337 19.022  1.00 14.89  ? 73  TYR A CD1 1 
ATOM 560  C CD2 . TYR A 1 72  ? 1.816   36.930 20.350  1.00 14.89  ? 73  TYR A CD2 1 
ATOM 561  C CE1 . TYR A 1 72  ? 0.327   34.609 20.181  1.00 14.89  ? 73  TYR A CE1 1 
ATOM 562  C CE2 . TYR A 1 72  ? 1.504   36.215 21.510  1.00 14.89  ? 73  TYR A CE2 1 
ATOM 563  C CZ  . TYR A 1 72  ? 0.758   35.059 21.423  1.00 14.89  ? 73  TYR A CZ  1 
ATOM 564  O OH  . TYR A 1 72  ? 0.426   34.382 22.576  1.00 14.89  ? 73  TYR A OH  1 
ATOM 565  N N   . ARG A 1 73  ? 1.195   40.158 16.414  1.00 31.40  ? 74  ARG A N   1 
ATOM 566  C CA  . ARG A 1 73  ? 1.733   41.130 15.467  1.00 31.40  ? 74  ARG A CA  1 
ATOM 567  C C   . ARG A 1 73  ? 2.835   41.871 16.181  1.00 31.40  ? 74  ARG A C   1 
ATOM 568  O O   . ARG A 1 73  ? 2.819   42.005 17.405  1.00 31.40  ? 74  ARG A O   1 
ATOM 569  C CB  . ARG A 1 73  ? 0.669   42.137 15.022  1.00 28.20  ? 74  ARG A CB  1 
ATOM 570  C CG  . ARG A 1 73  ? -0.258  41.640 13.929  1.00 28.20  ? 74  ARG A CG  1 
ATOM 571  C CD  . ARG A 1 73  ? -1.379  42.632 13.627  1.00 28.20  ? 74  ARG A CD  1 
ATOM 572  N NE  . ARG A 1 73  ? -2.263  42.099 12.600  1.00 28.20  ? 74  ARG A NE  1 
ATOM 573  C CZ  . ARG A 1 73  ? -1.866  41.806 11.365  1.00 28.20  ? 74  ARG A CZ  1 
ATOM 574  N NH1 . ARG A 1 73  ? -0.602  42.009 11.017  1.00 28.20  ? 74  ARG A NH1 1 
ATOM 575  N NH2 . ARG A 1 73  ? -2.717  41.283 10.489  1.00 28.20  ? 74  ARG A NH2 1 
ATOM 576  N N   . CYS A 1 74  ? 3.801   42.362 15.429  1.00 46.71  ? 75  CYS A N   1 
ATOM 577  C CA  . CYS A 1 74  ? 4.877   43.083 16.074  1.00 46.71  ? 75  CYS A CA  1 
ATOM 578  C C   . CYS A 1 74  ? 5.137   44.461 15.430  1.00 46.71  ? 75  CYS A C   1 
ATOM 579  O O   . CYS A 1 74  ? 4.706   44.717 14.309  1.00 46.71  ? 75  CYS A O   1 
ATOM 580  C CB  . CYS A 1 74  ? 6.144   42.181 16.092  1.00 89.42  ? 75  CYS A CB  1 
ATOM 581  S SG  . CYS A 1 74  ? 7.655   43.173 16.434  1.00 89.42  ? 75  CYS A SG  1 
ATOM 582  N N   . TYR A 1 75  ? 5.818   45.350 16.148  1.00 32.76  ? 76  TYR A N   1 
ATOM 583  C CA  . TYR A 1 75  ? 6.134   46.672 15.622  1.00 32.76  ? 76  TYR A CA  1 
ATOM 584  C C   . TYR A 1 75  ? 7.081   47.352 16.589  1.00 32.76  ? 76  TYR A C   1 
ATOM 585  O O   . TYR A 1 75  ? 7.101   47.005 17.773  1.00 32.76  ? 76  TYR A O   1 
ATOM 586  C CB  . TYR A 1 75  ? 4.854   47.505 15.445  1.00 18.68  ? 76  TYR A CB  1 
ATOM 587  C CG  . TYR A 1 75  ? 4.259   48.101 16.708  1.00 18.68  ? 76  TYR A CG  1 
ATOM 588  C CD1 . TYR A 1 75  ? 4.860   49.182 17.342  1.00 18.68  ? 76  TYR A CD1 1 
ATOM 589  C CD2 . TYR A 1 75  ? 3.081   47.596 17.249  1.00 18.68  ? 76  TYR A CD2 1 
ATOM 590  C CE1 . TYR A 1 75  ? 4.304   49.747 18.482  1.00 18.68  ? 76  TYR A CE1 1 
ATOM 591  C CE2 . TYR A 1 75  ? 2.518   48.154 18.388  1.00 18.68  ? 76  TYR A CE2 1 
ATOM 592  C CZ  . TYR A 1 75  ? 3.133   49.228 18.999  1.00 18.68  ? 76  TYR A CZ  1 
ATOM 593  O OH  . TYR A 1 75  ? 2.571   49.770 20.129  1.00 18.68  ? 76  TYR A OH  1 
ATOM 594  N N   . TYR A 1 76  ? 7.855   48.318 16.095  1.00 26.27  ? 77  TYR A N   1 
ATOM 595  C CA  . TYR A 1 76  ? 8.807   49.026 16.939  1.00 26.27  ? 77  TYR A CA  1 
ATOM 596  C C   . TYR A 1 76  ? 8.575   50.532 17.051  1.00 26.27  ? 77  TYR A C   1 
ATOM 597  O O   . TYR A 1 76  ? 8.049   51.159 16.130  1.00 26.27  ? 77  TYR A O   1 
ATOM 598  C CB  . TYR A 1 76  ? 10.215  48.748 16.445  1.00 22.45  ? 77  TYR A CB  1 
ATOM 599  C CG  . TYR A 1 76  ? 10.454  49.140 15.013  1.00 22.45  ? 77  TYR A CG  1 
ATOM 600  C CD1 . TYR A 1 76  ? 10.833  50.435 14.679  1.00 22.45  ? 77  TYR A CD1 1 
ATOM 601  C CD2 . TYR A 1 76  ? 10.360  48.200 13.994  1.00 22.45  ? 77  TYR A CD2 1 
ATOM 602  C CE1 . TYR A 1 76  ? 11.127  50.784 13.360  1.00 22.45  ? 77  TYR A CE1 1 
ATOM 603  C CE2 . TYR A 1 76  ? 10.646  48.531 12.667  1.00 22.45  ? 77  TYR A CE2 1 
ATOM 604  C CZ  . TYR A 1 76  ? 11.033  49.825 12.355  1.00 22.45  ? 77  TYR A CZ  1 
ATOM 605  O OH  . TYR A 1 76  ? 11.337  50.162 11.048  1.00 22.45  ? 77  TYR A OH  1 
ATOM 606  N N   . GLY A 1 77  ? 8.980   51.101 18.190  1.00 9.71   ? 78  GLY A N   1 
ATOM 607  C CA  . GLY A 1 77  ? 8.800   52.522 18.442  1.00 9.71   ? 78  GLY A CA  1 
ATOM 608  C C   . GLY A 1 77  ? 7.641   52.819 19.393  1.00 9.71   ? 78  GLY A C   1 
ATOM 609  O O   . GLY A 1 77  ? 7.169   51.942 20.132  1.00 9.71   ? 78  GLY A O   1 
ATOM 610  N N   . SER A 1 78  ? 7.167   54.059 19.379  1.00 20.22  ? 79  SER A N   1 
ATOM 611  C CA  . SER A 1 78  ? 6.064   54.456 20.254  1.00 20.22  ? 79  SER A CA  1 
ATOM 612  C C   . SER A 1 78  ? 5.149   55.420 19.525  1.00 20.22  ? 79  SER A C   1 
ATOM 613  O O   . SER A 1 78  ? 5.470   55.860 18.424  1.00 20.22  ? 79  SER A O   1 
ATOM 614  C CB  . SER A 1 78  ? 6.615   55.142 21.503  1.00 16.24  ? 79  SER A CB  1 
ATOM 615  O OG  . SER A 1 78  ? 7.420   56.262 21.165  1.00 16.24  ? 79  SER A OG  1 
ATOM 616  N N   . ASP A 1 79  ? 4.006   55.741 20.128  1.00 35.73  ? 80  ASP A N   1 
ATOM 617  C CA  . ASP A 1 79  ? 3.082   56.701 19.523  1.00 35.73  ? 80  ASP A CA  1 
ATOM 618  C C   . ASP A 1 79  ? 3.847   58.018 19.399  1.00 35.73  ? 80  ASP A C   1 
ATOM 619  O O   . ASP A 1 79  ? 3.990   58.582 18.313  1.00 35.73  ? 80  ASP A O   1 
ATOM 620  C CB  . ASP A 1 79  ? 1.864   56.933 20.425  1.00 47.47  ? 80  ASP A CB  1 
ATOM 621  C CG  . ASP A 1 79  ? 0.627   56.210 19.941  1.00 47.47  ? 80  ASP A CG  1 
ATOM 622  O OD1 . ASP A 1 79  ? 0.542   55.931 18.726  1.00 47.47  ? 80  ASP A OD1 1 
ATOM 623  O OD2 . ASP A 1 79  ? -0.268  55.942 20.775  1.00 47.47  ? 80  ASP A OD2 1 
ATOM 624  N N   . THR A 1 80  ? 4.351   58.464 20.548  1.00 20.64  ? 81  THR A N   1 
ATOM 625  C CA  . THR A 1 80  ? 5.092   59.699 20.713  1.00 20.64  ? 81  THR A CA  1 
ATOM 626  C C   . THR A 1 80  ? 6.353   59.889 19.882  1.00 20.64  ? 81  THR A C   1 
ATOM 627  O O   . THR A 1 80  ? 6.478   60.898 19.187  1.00 20.64  ? 81  THR A O   1 
ATOM 628  C CB  . THR A 1 80  ? 5.411   59.908 22.212  1.00 30.50  ? 81  THR A CB  1 
ATOM 629  O OG1 . THR A 1 80  ? 4.344   60.647 22.815  1.00 30.50  ? 81  THR A OG1 1 
ATOM 630  C CG2 . THR A 1 80  ? 6.708   60.653 22.412  1.00 30.50  ? 81  THR A CG2 1 
ATOM 631  N N   . ALA A 1 81  ? 7.300   58.957 19.942  1.00 22.91  ? 82  ALA A N   1 
ATOM 632  C CA  . ALA A 1 81  ? 8.533   59.131 19.165  1.00 22.91  ? 82  ALA A CA  1 
ATOM 633  C C   . ALA A 1 81  ? 8.384   58.567 17.774  1.00 22.91  ? 82  ALA A C   1 
ATOM 634  O O   . ALA A 1 81  ? 9.294   58.676 16.957  1.00 22.91  ? 82  ALA A O   1 
ATOM 635  C CB  . ALA A 1 81  ? 9.718   58.470 19.865  1.00 2.87   ? 82  ALA A CB  1 
ATOM 636  N N   . GLY A 1 82  ? 7.232   57.958 17.516  1.00 31.22  ? 83  GLY A N   1 
ATOM 637  C CA  . GLY A 1 82  ? 6.975   57.372 16.213  1.00 31.22  ? 83  GLY A CA  1 
ATOM 638  C C   . GLY A 1 82  ? 7.106   55.858 16.180  1.00 31.22  ? 83  GLY A C   1 
ATOM 639  O O   . GLY A 1 82  ? 7.997   55.276 16.798  1.00 31.22  ? 83  GLY A O   1 
ATOM 640  N N   . ARG A 1 83  ? 6.208   55.209 15.456  1.00 40.74  ? 84  ARG A N   1 
ATOM 641  C CA  . ARG A 1 83  ? 6.258   53.764 15.358  1.00 40.74  ? 84  ARG A CA  1 
ATOM 642  C C   . ARG A 1 83  ? 6.081   53.294 13.904  1.00 40.74  ? 84  ARG A C   1 
ATOM 643  O O   . ARG A 1 83  ? 5.785   54.093 13.013  1.00 40.74  ? 84  ARG A O   1 
ATOM 644  C CB  . ARG A 1 83  ? 5.200   53.137 16.297  1.00 33.00  ? 84  ARG A CB  1 
ATOM 645  C CG  . ARG A 1 83  ? 3.720   53.273 15.911  1.00 33.00  ? 84  ARG A CG  1 
ATOM 646  C CD  . ARG A 1 83  ? 2.861   52.783 17.090  1.00 33.00  ? 84  ARG A CD  1 
ATOM 647  N NE  . ARG A 1 83  ? 1.766   51.847 16.780  1.00 33.00  ? 84  ARG A NE  1 
ATOM 648  C CZ  . ARG A 1 83  ? 1.875   50.748 16.035  1.00 33.00  ? 84  ARG A CZ  1 
ATOM 649  N NH1 . ARG A 1 83  ? 3.029   50.419 15.478  1.00 33.00  ? 84  ARG A NH1 1 
ATOM 650  N NH2 . ARG A 1 83  ? 0.834   49.942 15.894  1.00 33.00  ? 84  ARG A NH2 1 
ATOM 651  N N   . SER A 1 84  ? 6.298   52.002 13.671  1.00 24.43  ? 85  SER A N   1 
ATOM 652  C CA  . SER A 1 84  ? 6.149   51.412 12.347  1.00 24.43  ? 85  SER A CA  1 
ATOM 653  C C   . SER A 1 84  ? 4.747   50.814 12.256  1.00 24.43  ? 85  SER A C   1 
ATOM 654  O O   . SER A 1 84  ? 3.909   51.046 13.123  1.00 24.43  ? 85  SER A O   1 
ATOM 655  C CB  . SER A 1 84  ? 7.177   50.301 12.164  1.00 27.57  ? 85  SER A CB  1 
ATOM 656  O OG  . SER A 1 84  ? 6.981   49.277 13.126  1.00 27.57  ? 85  SER A OG  1 
ATOM 657  N N   . GLU A 1 85  ? 4.483   50.058 11.197  1.00 19.44  ? 86  GLU A N   1 
ATOM 658  C CA  . GLU A 1 85  ? 3.190   49.401 11.058  1.00 19.44  ? 86  GLU A CA  1 
ATOM 659  C C   . GLU A 1 85  ? 3.378   48.087 11.795  1.00 19.44  ? 86  GLU A C   1 
ATOM 660  O O   . GLU A 1 85  ? 4.509   47.686 12.065  1.00 19.44  ? 86  GLU A O   1 
ATOM 661  C CB  . GLU A 1 85  ? 2.899   49.076 9.598   1.00 76.58  ? 86  GLU A CB  1 
ATOM 662  C CG  . GLU A 1 85  ? 2.877   50.252 8.658   1.00 76.58  ? 86  GLU A CG  1 
ATOM 663  C CD  . GLU A 1 85  ? 3.017   49.821 7.200   1.00 76.58  ? 86  GLU A CD  1 
ATOM 664  O OE1 . GLU A 1 85  ? 2.329   48.859 6.774   1.00 76.58  ? 86  GLU A OE1 1 
ATOM 665  O OE2 . GLU A 1 85  ? 3.817   50.456 6.478   1.00 76.58  ? 86  GLU A OE2 1 
ATOM 666  N N   . SER A 1 86  ? 2.292   47.410 12.130  1.00 21.89  ? 87  SER A N   1 
ATOM 667  C CA  . SER A 1 86  ? 2.449   46.126 12.783  1.00 21.89  ? 87  SER A CA  1 
ATOM 668  C C   . SER A 1 86  ? 2.989   45.179 11.713  1.00 21.89  ? 87  SER A C   1 
ATOM 669  O O   . SER A 1 86  ? 2.921   45.482 10.533  1.00 21.89  ? 87  SER A O   1 
ATOM 670  C CB  . SER A 1 86  ? 1.108   45.633 13.321  1.00 71.23  ? 87  SER A CB  1 
ATOM 671  O OG  . SER A 1 86  ? 0.662   46.482 14.365  1.00 71.23  ? 87  SER A OG  1 
ATOM 672  N N   . SER A 1 87  ? 3.547   44.047 12.121  1.00 27.91  ? 88  SER A N   1 
ATOM 673  C CA  . SER A 1 87  ? 4.101   43.069 11.183  1.00 27.91  ? 88  SER A CA  1 
ATOM 674  C C   . SER A 1 87  ? 3.010   42.110 10.681  1.00 27.91  ? 88  SER A C   1 
ATOM 675  O O   . SER A 1 87  ? 1.966   41.958 11.326  1.00 27.91  ? 88  SER A O   1 
ATOM 676  C CB  . SER A 1 87  ? 5.234   42.279 11.865  1.00 31.70  ? 88  SER A CB  1 
ATOM 677  O OG  . SER A 1 87  ? 4.788   41.620 13.041  1.00 31.70  ? 88  SER A OG  1 
ATOM 678  N N   . ASP A 1 88  ? 3.228   41.482 9.526   1.00 18.81  ? 89  ASP A N   1 
ATOM 679  C CA  . ASP A 1 88  ? 2.231   40.544 9.024   1.00 18.81  ? 89  ASP A CA  1 
ATOM 680  C C   . ASP A 1 88  ? 2.040   39.533 10.137  1.00 18.81  ? 89  ASP A C   1 
ATOM 681  O O   . ASP A 1 88  ? 2.994   38.905 10.584  1.00 18.81  ? 89  ASP A O   1 
ATOM 682  C CB  . ASP A 1 88  ? 2.704   39.858 7.742   1.00 43.79  ? 89  ASP A CB  1 
ATOM 683  C CG  . ASP A 1 88  ? 2.796   40.822 6.565   1.00 43.79  ? 89  ASP A CG  1 
ATOM 684  O OD1 . ASP A 1 88  ? 1.997   41.789 6.534   1.00 43.79  ? 89  ASP A OD1 1 
ATOM 685  O OD2 . ASP A 1 88  ? 3.651   40.603 5.671   1.00 43.79  ? 89  ASP A OD2 1 
ATOM 686  N N   . PRO A 1 89  ? 0.792   39.350 10.583  1.00 21.23  ? 90  PRO A N   1 
ATOM 687  C CA  . PRO A 1 89  ? 0.398   38.441 11.660  1.00 21.23  ? 90  PRO A CA  1 
ATOM 688  C C   . PRO A 1 89  ? 1.064   37.089 11.658  1.00 21.23  ? 90  PRO A C   1 
ATOM 689  O O   . PRO A 1 89  ? 1.276   36.498 10.607  1.00 21.23  ? 90  PRO A O   1 
ATOM 690  C CB  . PRO A 1 89  ? -1.107  38.317 11.472  1.00 20.81  ? 90  PRO A CB  1 
ATOM 691  C CG  . PRO A 1 89  ? -1.251  38.390 10.005  1.00 20.81  ? 90  PRO A CG  1 
ATOM 692  C CD  . PRO A 1 89  ? -0.350  39.569 9.677   1.00 20.81  ? 90  PRO A CD  1 
ATOM 693  N N   . LEU A 1 90  ? 1.397   36.621 12.856  1.00 21.35  ? 91  LEU A N   1 
ATOM 694  C CA  . LEU A 1 90  ? 1.992   35.314 13.051  1.00 21.35  ? 91  LEU A CA  1 
ATOM 695  C C   . LEU A 1 90  ? 0.979   34.511 13.858  1.00 21.35  ? 91  LEU A C   1 
ATOM 696  O O   . LEU A 1 90  ? 0.453   34.990 14.866  1.00 21.35  ? 91  LEU A O   1 
ATOM 697  C CB  . LEU A 1 90  ? 3.306   35.422 13.827  1.00 13.09  ? 91  LEU A CB  1 
ATOM 698  C CG  . LEU A 1 90  ? 3.923   34.078 14.260  1.00 13.09  ? 91  LEU A CG  1 
ATOM 699  C CD1 . LEU A 1 90  ? 4.046   33.138 13.063  1.00 13.09  ? 91  LEU A CD1 1 
ATOM 700  C CD2 . LEU A 1 90  ? 5.290   34.304 14.880  1.00 13.09  ? 91  LEU A CD2 1 
ATOM 701  N N   . GLU A 1 91  ? 0.693   33.294 13.413  1.00 14.98  ? 92  GLU A N   1 
ATOM 702  C CA  . GLU A 1 91  ? -0.265  32.465 14.124  1.00 14.98  ? 92  GLU A CA  1 
ATOM 703  C C   . GLU A 1 91  ? 0.432   31.375 14.920  1.00 14.98  ? 92  GLU A C   1 
ATOM 704  O O   . GLU A 1 91  ? 0.826   30.357 14.375  1.00 14.98  ? 92  GLU A O   1 
ATOM 705  C CB  . GLU A 1 91  ? -1.258  31.863 13.136  1.00 106.35 ? 92  GLU A CB  1 
ATOM 706  C CG  . GLU A 1 91  ? -1.868  32.914 12.231  1.00 106.35 ? 92  GLU A CG  1 
ATOM 707  C CD  . GLU A 1 91  ? -2.995  32.386 11.375  1.00 106.35 ? 92  GLU A CD  1 
ATOM 708  O OE1 . GLU A 1 91  ? -2.750  31.458 10.572  1.00 106.35 ? 92  GLU A OE1 1 
ATOM 709  O OE2 . GLU A 1 91  ? -4.127  32.906 11.504  1.00 106.35 ? 92  GLU A OE2 1 
ATOM 710  N N   . LEU A 1 92  ? 0.598   31.604 16.217  1.00 17.27  ? 93  LEU A N   1 
ATOM 711  C CA  . LEU A 1 92  ? 1.234   30.626 17.084  1.00 17.27  ? 93  LEU A CA  1 
ATOM 712  C C   . LEU A 1 92  ? 0.239   29.516 17.397  1.00 17.27  ? 93  LEU A C   1 
ATOM 713  O O   . LEU A 1 92  ? -0.753  29.740 18.085  1.00 17.27  ? 93  LEU A O   1 
ATOM 714  C CB  . LEU A 1 92  ? 1.694   31.283 18.388  1.00 24.03  ? 93  LEU A CB  1 
ATOM 715  C CG  . LEU A 1 92  ? 2.509   30.407 19.346  1.00 24.03  ? 93  LEU A CG  1 
ATOM 716  C CD1 . LEU A 1 92  ? 3.558   29.637 18.556  1.00 24.03  ? 93  LEU A CD1 1 
ATOM 717  C CD2 . LEU A 1 92  ? 3.177   31.273 20.405  1.00 24.03  ? 93  LEU A CD2 1 
ATOM 718  N N   . VAL A 1 93  ? 0.511   28.321 16.888  1.00 29.45  ? 94  VAL A N   1 
ATOM 719  C CA  . VAL A 1 93  ? -0.361  27.174 17.105  1.00 29.45  ? 94  VAL A CA  1 
ATOM 720  C C   . VAL A 1 93  ? 0.249   26.211 18.106  1.00 29.45  ? 94  VAL A C   1 
ATOM 721  O O   . VAL A 1 93  ? 1.440   25.940 18.056  1.00 29.45  ? 94  VAL A O   1 
ATOM 722  C CB  . VAL A 1 93  ? -0.570  26.390 15.809  1.00 18.36  ? 94  VAL A CB  1 
ATOM 723  C CG1 . VAL A 1 93  ? -1.575  25.293 16.033  1.00 18.36  ? 94  VAL A CG1 1 
ATOM 724  C CG2 . VAL A 1 93  ? -1.026  27.309 14.723  1.00 18.36  ? 94  VAL A CG2 1 
ATOM 725  N N   . VAL A 1 94  ? -0.566  25.690 19.010  1.00 9.89   ? 95  VAL A N   1 
ATOM 726  C CA  . VAL A 1 94  ? -0.079  24.729 19.987  1.00 9.89   ? 95  VAL A CA  1 
ATOM 727  C C   . VAL A 1 94  ? -0.780  23.411 19.675  1.00 9.89   ? 95  VAL A C   1 
ATOM 728  O O   . VAL A 1 94  ? -2.009  23.361 19.601  1.00 9.89   ? 95  VAL A O   1 
ATOM 729  C CB  . VAL A 1 94  ? -0.423  25.182 21.402  1.00 20.15  ? 95  VAL A CB  1 
ATOM 730  C CG1 . VAL A 1 94  ? 0.076   24.165 22.421  1.00 20.15  ? 95  VAL A CG1 1 
ATOM 731  C CG2 . VAL A 1 94  ? 0.181   26.552 21.644  1.00 20.15  ? 95  VAL A CG2 1 
ATOM 732  N N   . THR A 1 95  ? -0.005  22.348 19.489  1.00 16.58  ? 96  THR A N   1 
ATOM 733  C CA  . THR A 1 95  ? -0.579  21.050 19.141  1.00 16.58  ? 96  THR A CA  1 
ATOM 734  C C   . THR A 1 95  ? -0.498  19.990 20.233  1.00 16.58  ? 96  THR A C   1 
ATOM 735  O O   . THR A 1 95  ? 0.248   20.128 21.197  1.00 16.58  ? 96  THR A O   1 
ATOM 736  C CB  . THR A 1 95  ? 0.086   20.475 17.861  1.00 20.51  ? 96  THR A CB  1 
ATOM 737  O OG1 . THR A 1 95  ? 1.424   20.048 18.145  1.00 20.51  ? 96  THR A OG1 1 
ATOM 738  C CG2 . THR A 1 95  ? 0.139   21.532 16.788  1.00 20.51  ? 96  THR A CG2 1 
ATOM 739  N N   . GLY A 1 96  ? -1.283  18.932 20.072  1.00 26.51  ? 97  GLY A N   1 
ATOM 740  C CA  . GLY A 1 96  ? -1.267  17.851 21.039  1.00 26.51  ? 97  GLY A CA  1 
ATOM 741  C C   . GLY A 1 96  ? -2.536  17.701 21.850  1.00 26.51  ? 97  GLY A C   1 
ATOM 742  O O   . GLY A 1 96  ? -2.595  16.896 22.776  1.00 26.51  ? 97  GLY A O   1 
ATOM 743  N N   . ALA A 1 97  ? -3.561  18.454 21.477  1.00 12.97  ? 98  ALA A N   1 
ATOM 744  C CA  . ALA A 1 97  ? -4.822  18.434 22.184  1.00 12.97  ? 98  ALA A CA  1 
ATOM 745  C C   . ALA A 1 97  ? -5.828  17.360 21.812  1.00 12.97  ? 98  ALA A C   1 
ATOM 746  O O   . ALA A 1 97  ? -6.757  17.132 22.569  1.00 12.97  ? 98  ALA A O   1 
ATOM 747  C CB  . ALA A 1 97  ? -5.477  19.779 22.058  1.00 38.67  ? 98  ALA A CB  1 
ATOM 748  N N   . TYR A 1 98  ? -5.690  16.687 20.677  1.00 43.06  ? 99  TYR A N   1 
ATOM 749  C CA  . TYR A 1 98  ? -6.714  15.696 20.361  1.00 43.06  ? 99  TYR A CA  1 
ATOM 750  C C   . TYR A 1 98  ? -6.258  14.308 19.934  1.00 43.06  ? 99  TYR A C   1 
ATOM 751  O O   . TYR A 1 98  ? -5.654  13.596 20.724  1.00 43.06  ? 99  TYR A O   1 
ATOM 752  C CB  . TYR A 1 98  ? -7.674  16.286 19.336  1.00 36.58  ? 99  TYR A CB  1 
ATOM 753  C CG  . TYR A 1 98  ? -8.124  17.671 19.727  1.00 36.58  ? 99  TYR A CG  1 
ATOM 754  C CD1 . TYR A 1 98  ? -7.602  18.792 19.098  1.00 36.58  ? 99  TYR A CD1 1 
ATOM 755  C CD2 . TYR A 1 98  ? -9.027  17.863 20.772  1.00 36.58  ? 99  TYR A CD2 1 
ATOM 756  C CE1 . TYR A 1 98  ? -7.967  20.066 19.498  1.00 36.58  ? 99  TYR A CE1 1 
ATOM 757  C CE2 . TYR A 1 98  ? -9.393  19.137 21.180  1.00 36.58  ? 99  TYR A CE2 1 
ATOM 758  C CZ  . TYR A 1 98  ? -8.860  20.228 20.538  1.00 36.58  ? 99  TYR A CZ  1 
ATOM 759  O OH  . TYR A 1 98  ? -9.222  21.490 20.930  1.00 36.58  ? 99  TYR A OH  1 
ATOM 760  N N   . ILE A 1 99  ? -6.573  13.898 18.708  1.00 35.20  ? 100 ILE A N   1 
ATOM 761  C CA  . ILE A 1 99  ? -6.172  12.569 18.237  1.00 35.20  ? 100 ILE A CA  1 
ATOM 762  C C   . ILE A 1 99  ? -5.407  12.682 16.926  1.00 35.20  ? 100 ILE A C   1 
ATOM 763  O O   . ILE A 1 99  ? -5.775  13.464 16.051  1.00 35.20  ? 100 ILE A O   1 
ATOM 764  C CB  . ILE A 1 99  ? -7.405  11.634 18.022  1.00 70.32  ? 100 ILE A CB  1 
ATOM 765  C CG1 . ILE A 1 99  ? -8.118  11.966 16.702  1.00 70.32  ? 100 ILE A CG1 1 
ATOM 766  C CG2 . ILE A 1 99  ? -8.354  11.741 19.202  1.00 70.32  ? 100 ILE A CG2 1 
ATOM 767  C CD1 . ILE A 1 99  ? -8.358  13.447 16.458  1.00 70.32  ? 100 ILE A CD1 1 
ATOM 768  N N   . LYS A 1 100 ? -4.331  11.925 16.778  1.00 30.11  ? 101 LYS A N   1 
ATOM 769  C CA  . LYS A 1 100 ? -3.602  12.017 15.530  1.00 30.11  ? 101 LYS A CA  1 
ATOM 770  C C   . LYS A 1 100 ? -4.526  11.449 14.483  1.00 30.11  ? 101 LYS A C   1 
ATOM 771  O O   . LYS A 1 100 ? -4.940  10.305 14.566  1.00 30.11  ? 101 LYS A O   1 
ATOM 772  C CB  . LYS A 1 100 ? -2.292  11.223 15.586  1.00 37.51  ? 101 LYS A CB  1 
ATOM 773  C CG  . LYS A 1 100 ? -2.435  9.787  16.046  1.00 37.51  ? 101 LYS A CG  1 
ATOM 774  C CD  . LYS A 1 100 ? -1.103  9.089  16.029  1.00 37.51  ? 101 LYS A CD  1 
ATOM 775  C CE  . LYS A 1 100 ? -0.580  9.005  14.613  1.00 37.51  ? 101 LYS A CE  1 
ATOM 776  N NZ  . LYS A 1 100 ? 0.713   8.293  14.591  1.00 37.51  ? 101 LYS A NZ  1 
ATOM 777  N N   . PRO A 1 101 ? -4.911  12.265 13.507  1.00 30.20  ? 102 PRO A N   1 
ATOM 778  C CA  . PRO A 1 101 ? -5.800  11.769 12.459  1.00 30.20  ? 102 PRO A CA  1 
ATOM 779  C C   . PRO A 1 101 ? -4.952  10.868 11.552  1.00 30.20  ? 102 PRO A C   1 
ATOM 780  O O   . PRO A 1 101 ? -3.799  10.559 11.871  1.00 30.20  ? 102 PRO A O   1 
ATOM 781  C CB  . PRO A 1 101 ? -6.229  13.048 11.734  1.00 22.41  ? 102 PRO A CB  1 
ATOM 782  C CG  . PRO A 1 101 ? -5.892  14.166 12.688  1.00 22.41  ? 102 PRO A CG  1 
ATOM 783  C CD  . PRO A 1 101 ? -4.627  13.694 13.321  1.00 22.41  ? 102 PRO A CD  1 
ATOM 784  N N   . THR A 1 102 ? -5.499  10.445 10.421  1.00 33.64  ? 103 THR A N   1 
ATOM 785  C CA  . THR A 1 102 ? -4.707  9.632  9.514   1.00 33.64  ? 103 THR A CA  1 
ATOM 786  C C   . THR A 1 102 ? -4.678  10.327 8.167   1.00 33.64  ? 103 THR A C   1 
ATOM 787  O O   . THR A 1 102 ? -5.683  10.884 7.732   1.00 33.64  ? 103 THR A O   1 
ATOM 788  C CB  . THR A 1 102 ? -5.277  8.210  9.388   1.00 32.08  ? 103 THR A CB  1 
ATOM 789  O OG1 . THR A 1 102 ? -5.048  7.501  10.613  1.00 32.08  ? 103 THR A OG1 1 
ATOM 790  C CG2 . THR A 1 102 ? -4.599  7.463  8.262   1.00 32.08  ? 103 THR A CG2 1 
ATOM 791  N N   . LEU A 1 103 ? -3.515  10.323 7.525   1.00 33.28  ? 104 LEU A N   1 
ATOM 792  C CA  . LEU A 1 103 ? -3.364  10.974 6.230   1.00 33.28  ? 104 LEU A CA  1 
ATOM 793  C C   . LEU A 1 103 ? -2.867  10.019 5.148   1.00 33.28  ? 104 LEU A C   1 
ATOM 794  O O   . LEU A 1 103 ? -1.740  9.527  5.201   1.00 33.28  ? 104 LEU A O   1 
ATOM 795  C CB  . LEU A 1 103 ? -2.393  12.150 6.336   1.00 12.90  ? 104 LEU A CB  1 
ATOM 796  C CG  . LEU A 1 103 ? -2.187  12.857 5.004   1.00 12.90  ? 104 LEU A CG  1 
ATOM 797  C CD1 . LEU A 1 103 ? -3.439  13.650 4.699   1.00 12.90  ? 104 LEU A CD1 1 
ATOM 798  C CD2 . LEU A 1 103 ? -0.959  13.740 5.048   1.00 12.90  ? 104 LEU A CD2 1 
ATOM 799  N N   . SER A 1 104 ? -3.703  9.795  4.144   1.00 29.93  ? 105 SER A N   1 
ATOM 800  C CA  . SER A 1 104 ? -3.356  8.888  3.061   1.00 29.93  ? 105 SER A CA  1 
ATOM 801  C C   . SER A 1 104 ? -3.561  9.503  1.682   1.00 29.93  ? 105 SER A C   1 
ATOM 802  O O   . SER A 1 104 ? -4.475  10.303 1.487   1.00 29.93  ? 105 SER A O   1 
ATOM 803  C CB  . SER A 1 104 ? -4.223  7.636  3.171   1.00 40.11  ? 105 SER A CB  1 
ATOM 804  O OG  . SER A 1 104 ? -5.595  7.997  3.111   1.00 40.11  ? 105 SER A OG  1 
ATOM 805  N N   . ALA A 1 105 ? -2.722  9.101  0.728   1.00 41.99  ? 106 ALA A N   1 
ATOM 806  C CA  . ALA A 1 105 ? -2.822  9.582  -0.649  1.00 41.99  ? 106 ALA A CA  1 
ATOM 807  C C   . ALA A 1 105 ? -3.872  8.765  -1.388  1.00 41.99  ? 106 ALA A C   1 
ATOM 808  O O   . ALA A 1 105 ? -3.900  7.546  -1.284  1.00 41.99  ? 106 ALA A O   1 
ATOM 809  C CB  . ALA A 1 105 ? -1.475  9.453  -1.354  1.00 20.73  ? 106 ALA A CB  1 
ATOM 810  N N   . GLN A 1 106 ? -4.739  9.436  -2.134  1.00 47.96  ? 107 GLN A N   1 
ATOM 811  C CA  . GLN A 1 106 ? -5.791  8.745  -2.885  1.00 47.96  ? 107 GLN A CA  1 
ATOM 812  C C   . GLN A 1 106 ? -5.579  8.914  -4.395  1.00 47.96  ? 107 GLN A C   1 
ATOM 813  O O   . GLN A 1 106 ? -5.615  10.048 -4.914  1.00 47.96  ? 107 GLN A O   1 
ATOM 814  C CB  . GLN A 1 106 ? -7.175  9.293  -2.476  1.00 58.18  ? 107 GLN A CB  1 
ATOM 815  C CG  . GLN A 1 106 ? -8.089  8.263  -1.817  1.00 58.18  ? 107 GLN A CG  1 
ATOM 816  C CD  . GLN A 1 106 ? -7.341  7.368  -0.834  1.00 58.18  ? 107 GLN A CD  1 
ATOM 817  O OE1 . GLN A 1 106 ? -6.749  7.852  0.143   1.00 58.18  ? 107 GLN A OE1 1 
ATOM 818  N NE2 . GLN A 1 106 ? -7.350  6.055  -1.096  1.00 58.18  ? 107 GLN A NE2 1 
ATOM 819  N N   . PRO A 1 107 ? -5.350  7.796  -5.123  1.00 50.22  ? 108 PRO A N   1 
ATOM 820  C CA  . PRO A 1 107 ? -5.290  6.372  -4.744  1.00 50.22  ? 108 PRO A CA  1 
ATOM 821  C C   . PRO A 1 107 ? -4.027  5.831  -4.075  1.00 50.22  ? 108 PRO A C   1 
ATOM 822  O O   . PRO A 1 107 ? -4.093  4.851  -3.333  1.00 50.22  ? 108 PRO A O   1 
ATOM 823  C CB  . PRO A 1 107 ? -5.528  5.662  -6.070  1.00 81.59  ? 108 PRO A CB  1 
ATOM 824  C CG  . PRO A 1 107 ? -4.765  6.546  -7.028  1.00 81.59  ? 108 PRO A CG  1 
ATOM 825  C CD  . PRO A 1 107 ? -5.242  7.935  -6.591  1.00 81.59  ? 108 PRO A CD  1 
ATOM 826  N N   . SER A 1 108 ? -2.876  6.430  -4.365  1.00 26.63  ? 109 SER A N   1 
ATOM 827  C CA  . SER A 1 108 ? -1.616  5.945  -3.789  1.00 26.63  ? 109 SER A CA  1 
ATOM 828  C C   . SER A 1 108 ? -0.607  7.045  -3.498  1.00 26.63  ? 109 SER A C   1 
ATOM 829  O O   . SER A 1 108 ? -0.768  8.170  -3.958  1.00 26.63  ? 109 SER A O   1 
ATOM 830  C CB  . SER A 1 108 ? -0.983  4.929  -4.738  1.00 52.11  ? 109 SER A CB  1 
ATOM 831  O OG  . SER A 1 108 ? 0.419   5.076  -4.780  1.00 52.11  ? 109 SER A OG  1 
ATOM 832  N N   . PRO A 1 109 ? 0.437   6.736  -2.708  1.00 71.59  ? 110 PRO A N   1 
ATOM 833  C CA  . PRO A 1 109 ? 1.479   7.713  -2.366  1.00 71.59  ? 110 PRO A CA  1 
ATOM 834  C C   . PRO A 1 109 ? 2.317   7.909  -3.619  1.00 71.59  ? 110 PRO A C   1 
ATOM 835  O O   . PRO A 1 109 ? 3.115   8.843  -3.729  1.00 71.59  ? 110 PRO A O   1 
ATOM 836  C CB  . PRO A 1 109 ? 2.289   7.004  -1.280  1.00 65.06  ? 110 PRO A CB  1 
ATOM 837  C CG  . PRO A 1 109 ? 1.329   5.998  -0.693  1.00 65.06  ? 110 PRO A CG  1 
ATOM 838  C CD  . PRO A 1 109 ? 0.607   5.494  -1.932  1.00 65.06  ? 110 PRO A CD  1 
ATOM 839  N N   . VAL A 1 110 ? 2.118   6.983  -4.551  1.00 71.25  ? 111 VAL A N   1 
ATOM 840  C CA  . VAL A 1 110 ? 2.812   6.944  -5.828  1.00 71.25  ? 111 VAL A CA  1 
ATOM 841  C C   . VAL A 1 110 ? 2.027   7.667  -6.904  1.00 71.25  ? 111 VAL A C   1 
ATOM 842  O O   . VAL A 1 110 ? 0.987   7.185  -7.340  1.00 71.25  ? 111 VAL A O   1 
ATOM 843  C CB  . VAL A 1 110 ? 2.987   5.491  -6.270  1.00 23.24  ? 111 VAL A CB  1 
ATOM 844  C CG1 . VAL A 1 110 ? 3.683   5.408  -7.632  1.00 23.24  ? 111 VAL A CG1 1 
ATOM 845  C CG2 . VAL A 1 110 ? 3.746   4.740  -5.194  1.00 23.24  ? 111 VAL A CG2 1 
ATOM 846  N N   . VAL A 1 111 ? 2.515   8.820  -7.337  1.00 48.06  ? 112 VAL A N   1 
ATOM 847  C CA  . VAL A 1 111 ? 1.816   9.541  -8.387  1.00 48.06  ? 112 VAL A CA  1 
ATOM 848  C C   . VAL A 1 111 ? 2.779   9.938  -9.488  1.00 48.06  ? 112 VAL A C   1 
ATOM 849  O O   . VAL A 1 111 ? 3.959   10.214 -9.239  1.00 48.06  ? 112 VAL A O   1 
ATOM 850  C CB  . VAL A 1 111 ? 1.121   10.803 -7.856  1.00 42.49  ? 112 VAL A CB  1 
ATOM 851  C CG1 . VAL A 1 111 ? 0.122   10.419 -6.757  1.00 42.49  ? 112 VAL A CG1 1 
ATOM 852  C CG2 . VAL A 1 111 ? 2.159   11.787 -7.344  1.00 42.49  ? 112 VAL A CG2 1 
ATOM 853  N N   . ASN A 1 112 ? 2.261   9.952  -10.711 1.00 39.97  ? 113 ASN A N   1 
ATOM 854  C CA  . ASN A 1 112 ? 3.049   10.312 -11.871 1.00 39.97  ? 113 ASN A CA  1 
ATOM 855  C C   . ASN A 1 112 ? 3.439   11.769 -11.834 1.00 39.97  ? 113 ASN A C   1 
ATOM 856  O O   . ASN A 1 112 ? 2.684   12.623 -11.374 1.00 39.97  ? 113 ASN A O   1 
ATOM 857  C CB  . ASN A 1 112 ? 2.274   10.015 -13.149 1.00 62.06  ? 113 ASN A CB  1 
ATOM 858  C CG  . ASN A 1 112 ? 2.803   8.805  -13.865 1.00 62.06  ? 113 ASN A CG  1 
ATOM 859  O OD1 . ASN A 1 112 ? 3.950   8.787  -14.304 1.00 62.06  ? 113 ASN A OD1 1 
ATOM 860  N ND2 . ASN A 1 112 ? 1.977   7.778  -13.982 1.00 62.06  ? 113 ASN A ND2 1 
ATOM 861  N N   . SER A 1 113 ? 4.642   12.040 -12.314 1.00 30.75  ? 114 SER A N   1 
ATOM 862  C CA  . SER A 1 113 ? 5.165   13.388 -12.355 1.00 30.75  ? 114 SER A CA  1 
ATOM 863  C C   . SER A 1 113 ? 4.138   14.288 -13.042 1.00 30.75  ? 114 SER A C   1 
ATOM 864  O O   . SER A 1 113 ? 3.250   13.805 -13.746 1.00 30.75  ? 114 SER A O   1 
ATOM 865  C CB  . SER A 1 113 ? 6.489   13.380 -13.125 1.00 41.30  ? 114 SER A CB  1 
ATOM 866  O OG  . SER A 1 113 ? 7.080   14.663 -13.177 1.00 41.30  ? 114 SER A OG  1 
ATOM 867  N N   . GLY A 1 114 ? 4.254   15.594 -12.822 1.00 48.99  ? 115 GLY A N   1 
ATOM 868  C CA  . GLY A 1 114 ? 3.346   16.544 -13.442 1.00 48.99  ? 115 GLY A CA  1 
ATOM 869  C C   . GLY A 1 114 ? 1.863   16.253 -13.282 1.00 48.99  ? 115 GLY A C   1 
ATOM 870  O O   . GLY A 1 114 ? 1.026   16.966 -13.834 1.00 48.99  ? 115 GLY A O   1 
ATOM 871  N N   . GLY A 1 115 ? 1.526   15.209 -12.534 1.00 52.60  ? 116 GLY A N   1 
ATOM 872  C CA  . GLY A 1 115 ? 0.127   14.878 -12.328 1.00 52.60  ? 116 GLY A CA  1 
ATOM 873  C C   . GLY A 1 115 ? -0.304  15.433 -10.990 1.00 52.60  ? 116 GLY A C   1 
ATOM 874  O O   . GLY A 1 115 ? 0.435   16.205 -10.380 1.00 52.60  ? 116 GLY A O   1 
ATOM 875  N N   . ASN A 1 116 ? -1.491  15.060 -10.529 1.00 72.22  ? 117 ASN A N   1 
ATOM 876  C CA  . ASN A 1 116 ? -1.974  15.534 -9.235  1.00 72.22  ? 117 ASN A CA  1 
ATOM 877  C C   . ASN A 1 116 ? -2.410  14.377 -8.349  1.00 72.22  ? 117 ASN A C   1 
ATOM 878  O O   . ASN A 1 116 ? -2.552  13.249 -8.812  1.00 72.22  ? 117 ASN A O   1 
ATOM 879  C CB  . ASN A 1 116 ? -3.135  16.526 -9.411  1.00 92.91  ? 117 ASN A CB  1 
ATOM 880  C CG  . ASN A 1 116 ? -2.661  17.910 -9.847  1.00 92.91  ? 117 ASN A CG  1 
ATOM 881  O OD1 . ASN A 1 116 ? -1.786  18.512 -9.212  1.00 92.91  ? 117 ASN A OD1 1 
ATOM 882  N ND2 . ASN A 1 116 ? -3.241  18.421 -10.932 1.00 92.91  ? 117 ASN A ND2 1 
ATOM 883  N N   . VAL A 1 117 ? -2.621  14.660 -7.071  1.00 51.42  ? 118 VAL A N   1 
ATOM 884  C CA  . VAL A 1 117 ? -3.035  13.628 -6.128  1.00 51.42  ? 118 VAL A CA  1 
ATOM 885  C C   . VAL A 1 117 ? -3.980  14.179 -5.057  1.00 51.42  ? 118 VAL A C   1 
ATOM 886  O O   . VAL A 1 117 ? -3.967  15.371 -4.763  1.00 51.42  ? 118 VAL A O   1 
ATOM 887  C CB  . VAL A 1 117 ? -1.778  12.968 -5.467  1.00 46.31  ? 118 VAL A CB  1 
ATOM 888  C CG1 . VAL A 1 117 ? -0.716  14.021 -5.194  1.00 46.31  ? 118 VAL A CG1 1 
ATOM 889  C CG2 . VAL A 1 117 ? -2.159  12.256 -4.169  1.00 46.31  ? 118 VAL A CG2 1 
ATOM 890  N N   . THR A 1 118 ? -4.816  13.308 -4.494  1.00 84.13  ? 119 THR A N   1 
ATOM 891  C CA  . THR A 1 118 ? -5.754  13.710 -3.446  1.00 84.13  ? 119 THR A CA  1 
ATOM 892  C C   . THR A 1 118 ? -5.274  13.205 -2.085  1.00 84.13  ? 119 THR A C   1 
ATOM 893  O O   . THR A 1 118 ? -4.937  12.031 -1.926  1.00 84.13  ? 119 THR A O   1 
ATOM 894  C CB  . THR A 1 118 ? -7.190  13.168 -3.721  1.00 37.58  ? 119 THR A CB  1 
ATOM 895  O OG1 . THR A 1 118 ? -7.771  13.872 -4.829  1.00 37.58  ? 119 THR A OG1 1 
ATOM 896  C CG2 . THR A 1 118 ? -8.076  13.351 -2.502  1.00 37.58  ? 119 THR A CG2 1 
ATOM 897  N N   . LEU A 1 119 ? -5.225  14.109 -1.112  1.00 39.22  ? 120 LEU A N   1 
ATOM 898  C CA  . LEU A 1 119 ? -4.796  13.763 0.239   1.00 39.22  ? 120 LEU A CA  1 
ATOM 899  C C   . LEU A 1 119 ? -6.015  13.637 1.135   1.00 39.22  ? 120 LEU A C   1 
ATOM 900  O O   . LEU A 1 119 ? -6.969  14.413 1.023   1.00 39.22  ? 120 LEU A O   1 
ATOM 901  C CB  . LEU A 1 119 ? -3.838  14.819 0.804   1.00 25.59  ? 120 LEU A CB  1 
ATOM 902  C CG  . LEU A 1 119 ? -2.528  15.017 0.033   1.00 25.59  ? 120 LEU A CG  1 
ATOM 903  C CD1 . LEU A 1 119 ? -1.578  15.841 0.883   1.00 25.59  ? 120 LEU A CD1 1 
ATOM 904  C CD2 . LEU A 1 119 ? -1.899  13.656 -0.314  1.00 25.59  ? 120 LEU A CD2 1 
ATOM 905  N N   . GLN A 1 120 ? -5.966  12.654 2.029   1.00 52.66  ? 121 GLN A N   1 
ATOM 906  C CA  . GLN A 1 120 ? -7.076  12.379 2.923   1.00 52.66  ? 121 GLN A CA  1 
ATOM 907  C C   . GLN A 1 120 ? -6.689  12.370 4.390   1.00 52.66  ? 121 GLN A C   1 
ATOM 908  O O   . GLN A 1 120 ? -5.897  11.533 4.837   1.00 52.66  ? 121 GLN A O   1 
ATOM 909  C CB  . GLN A 1 120 ? -7.697  11.035 2.561   1.00 47.03  ? 121 GLN A CB  1 
ATOM 910  C CG  . GLN A 1 120 ? -9.169  10.932 2.847   1.00 47.03  ? 121 GLN A CG  1 
ATOM 911  C CD  . GLN A 1 120 ? -9.810  9.865  2.005   1.00 47.03  ? 121 GLN A CD  1 
ATOM 912  O OE1 . GLN A 1 120 ? -9.546  8.678  2.183   1.00 47.03  ? 121 GLN A OE1 1 
ATOM 913  N NE2 . GLN A 1 120 ? -10.645 10.281 1.061   1.00 47.03  ? 121 GLN A NE2 1 
ATOM 914  N N   . CYS A 1 121 ? -7.268  13.321 5.119   1.00 49.73  ? 122 CYS A N   1 
ATOM 915  C CA  . CYS A 1 121 ? -7.070  13.480 6.552   1.00 49.73  ? 122 CYS A CA  1 
ATOM 916  C C   . CYS A 1 121 ? -8.340  12.860 7.123   1.00 49.73  ? 122 CYS A C   1 
ATOM 917  O O   . CYS A 1 121 ? -9.441  13.353 6.884   1.00 49.73  ? 122 CYS A O   1 
ATOM 918  C CB  . CYS A 1 121 ? -6.985  14.973 6.895   1.00 63.06  ? 122 CYS A CB  1 
ATOM 919  S SG  . CYS A 1 121 ? -6.401  15.414 8.569   1.00 63.06  ? 122 CYS A SG  1 
ATOM 920  N N   . ASP A 1 122 ? -8.194  11.762 7.851   1.00 32.01  ? 123 ASP A N   1 
ATOM 921  C CA  . ASP A 1 122 ? -9.351  11.082 8.413   1.00 32.01  ? 123 ASP A CA  1 
ATOM 922  C C   . ASP A 1 122 ? -9.257  11.014 9.931   1.00 32.01  ? 123 ASP A C   1 
ATOM 923  O O   . ASP A 1 122 ? -8.178  10.761 10.482  1.00 32.01  ? 123 ASP A O   1 
ATOM 924  C CB  . ASP A 1 122 ? -9.439  9.665  7.842   1.00 136.84 ? 123 ASP A CB  1 
ATOM 925  C CG  . ASP A 1 122 ? -10.720 8.958  8.227   1.00 136.84 ? 123 ASP A CG  1 
ATOM 926  O OD1 . ASP A 1 122 ? -11.793 9.391  7.762   1.00 136.84 ? 123 ASP A OD1 1 
ATOM 927  O OD2 . ASP A 1 122 ? -10.655 7.973  8.995   1.00 136.84 ? 123 ASP A OD2 1 
ATOM 928  N N   . SER A 1 123 ? -10.378 11.249 10.608  1.00 37.41  ? 124 SER A N   1 
ATOM 929  C CA  . SER A 1 123 ? -10.388 11.176 12.059  1.00 37.41  ? 124 SER A CA  1 
ATOM 930  C C   . SER A 1 123 ? -11.465 10.223 12.525  1.00 37.41  ? 124 SER A C   1 
ATOM 931  O O   . SER A 1 123 ? -12.457 10.014 11.831  1.00 37.41  ? 124 SER A O   1 
ATOM 932  C CB  . SER A 1 123 ? -10.621 12.545 12.687  1.00 57.49  ? 124 SER A CB  1 
ATOM 933  O OG  . SER A 1 123 ? -10.331 12.488 14.074  1.00 57.49  ? 124 SER A OG  1 
ATOM 934  N N   . GLN A 1 124 ? -11.255 9.650  13.708  1.00 68.82  ? 125 GLN A N   1 
ATOM 935  C CA  . GLN A 1 124 ? -12.189 8.695  14.298  1.00 68.82  ? 125 GLN A CA  1 
ATOM 936  C C   . GLN A 1 124 ? -13.390 9.398  14.905  1.00 68.82  ? 125 GLN A C   1 
ATOM 937  O O   . GLN A 1 124 ? -14.491 8.849  14.949  1.00 68.82  ? 125 GLN A O   1 
ATOM 938  C CB  . GLN A 1 124 ? -11.471 7.851  15.360  1.00 63.13  ? 125 GLN A CB  1 
ATOM 939  C CG  . GLN A 1 124 ? -10.407 6.930  14.765  1.00 63.13  ? 125 GLN A CG  1 
ATOM 940  C CD  . GLN A 1 124 ? -9.527  6.249  15.806  1.00 63.13  ? 125 GLN A CD  1 
ATOM 941  O OE1 . GLN A 1 124 ? -8.625  5.481  15.458  1.00 63.13  ? 125 GLN A OE1 1 
ATOM 942  N NE2 . GLN A 1 124 ? -9.779  6.527  17.086  1.00 63.13  ? 125 GLN A NE2 1 
ATOM 943  N N   . VAL A 1 125 ? -13.170 10.621 15.368  1.00 41.65  ? 126 VAL A N   1 
ATOM 944  C CA  . VAL A 1 125 ? -14.235 11.407 15.959  1.00 41.65  ? 126 VAL A CA  1 
ATOM 945  C C   . VAL A 1 125 ? -14.498 12.566 15.010  1.00 41.65  ? 126 VAL A C   1 
ATOM 946  O O   . VAL A 1 125 ? -13.840 12.671 13.979  1.00 41.65  ? 126 VAL A O   1 
ATOM 947  C CB  . VAL A 1 125 ? -13.816 11.923 17.332  1.00 52.90  ? 126 VAL A CB  1 
ATOM 948  C CG1 . VAL A 1 125 ? -15.018 12.525 18.049  1.00 52.90  ? 126 VAL A CG1 1 
ATOM 949  C CG2 . VAL A 1 125 ? -13.225 10.773 18.156  1.00 52.90  ? 126 VAL A CG2 1 
ATOM 950  N N   . ALA A 1 126 ? -15.448 13.433 15.342  1.00 43.36  ? 127 ALA A N   1 
ATOM 951  C CA  . ALA A 1 126 ? -15.780 14.563 14.475  1.00 43.36  ? 127 ALA A CA  1 
ATOM 952  C C   . ALA A 1 126 ? -15.128 15.877 14.868  1.00 43.36  ? 127 ALA A C   1 
ATOM 953  O O   . ALA A 1 126 ? -15.129 16.248 16.040  1.00 43.36  ? 127 ALA A O   1 
ATOM 954  C CB  . ALA A 1 126 ? -17.286 14.751 14.430  1.00 34.75  ? 127 ALA A CB  1 
ATOM 955  N N   . PHE A 1 127 ? -14.573 16.571 13.878  1.00 31.90  ? 128 PHE A N   1 
ATOM 956  C CA  . PHE A 1 127 ? -13.944 17.882 14.080  1.00 31.90  ? 128 PHE A CA  1 
ATOM 957  C C   . PHE A 1 127 ? -14.401 18.780 12.939  1.00 31.90  ? 128 PHE A C   1 
ATOM 958  O O   . PHE A 1 127 ? -14.402 18.353 11.794  1.00 31.90  ? 128 PHE A O   1 
ATOM 959  C CB  . PHE A 1 127 ? -12.418 17.788 14.039  1.00 30.25  ? 128 PHE A CB  1 
ATOM 960  C CG  . PHE A 1 127 ? -11.845 16.864 15.058  1.00 30.25  ? 128 PHE A CG  1 
ATOM 961  C CD1 . PHE A 1 127 ? -11.824 15.493 14.836  1.00 30.25  ? 128 PHE A CD1 1 
ATOM 962  C CD2 . PHE A 1 127 ? -11.364 17.356 16.261  1.00 30.25  ? 128 PHE A CD2 1 
ATOM 963  C CE1 . PHE A 1 127 ? -11.340 14.628 15.794  1.00 30.25  ? 128 PHE A CE1 1 
ATOM 964  C CE2 . PHE A 1 127 ? -10.878 16.490 17.224  1.00 30.25  ? 128 PHE A CE2 1 
ATOM 965  C CZ  . PHE A 1 127 ? -10.869 15.124 16.987  1.00 30.25  ? 128 PHE A CZ  1 
ATOM 966  N N   . ASP A 1 128 ? -14.783 20.016 13.227  1.00 29.20  ? 129 ASP A N   1 
ATOM 967  C CA  . ASP A 1 128 ? -15.236 20.890 12.151  1.00 29.20  ? 129 ASP A CA  1 
ATOM 968  C C   . ASP A 1 128 ? -14.103 21.610 11.407  1.00 29.20  ? 129 ASP A C   1 
ATOM 969  O O   . ASP A 1 128 ? -14.320 22.671 10.821  1.00 29.20  ? 129 ASP A O   1 
ATOM 970  C CB  . ASP A 1 128 ? -16.244 21.919 12.683  1.00 64.18  ? 129 ASP A CB  1 
ATOM 971  C CG  . ASP A 1 128 ? -15.734 22.669 13.900  1.00 64.18  ? 129 ASP A CG  1 
ATOM 972  O OD1 . ASP A 1 128 ? -14.577 23.140 13.880  1.00 64.18  ? 129 ASP A OD1 1 
ATOM 973  O OD2 . ASP A 1 128 ? -16.500 22.799 14.878  1.00 64.18  ? 129 ASP A OD2 1 
ATOM 974  N N   . GLY A 1 129 ? -12.901 21.042 11.417  1.00 21.88  ? 130 GLY A N   1 
ATOM 975  C CA  . GLY A 1 129 ? -11.804 21.699 10.735  1.00 21.88  ? 130 GLY A CA  1 
ATOM 976  C C   . GLY A 1 129 ? -10.535 20.877 10.623  1.00 21.88  ? 130 GLY A C   1 
ATOM 977  O O   . GLY A 1 129 ? -10.055 20.294 11.599  1.00 21.88  ? 130 GLY A O   1 
ATOM 978  N N   . PHE A 1 130 ? -9.979  20.823 9.419   1.00 31.11  ? 131 PHE A N   1 
ATOM 979  C CA  . PHE A 1 130 ? -8.755  20.074 9.213   1.00 31.11  ? 131 PHE A CA  1 
ATOM 980  C C   . PHE A 1 130 ? -7.694  20.912 8.501   1.00 31.11  ? 131 PHE A C   1 
ATOM 981  O O   . PHE A 1 130 ? -7.986  21.678 7.587   1.00 31.11  ? 131 PHE A O   1 
ATOM 982  C CB  . PHE A 1 130 ? -9.044  18.779 8.441   1.00 3.75   ? 131 PHE A CB  1 
ATOM 983  C CG  . PHE A 1 130 ? -9.802  17.731 9.249   1.00 3.75   ? 131 PHE A CG  1 
ATOM 984  C CD1 . PHE A 1 130 ? -11.199 17.799 9.390   1.00 3.75   ? 131 PHE A CD1 1 
ATOM 985  C CD2 . PHE A 1 130 ? -9.121  16.654 9.844   1.00 3.75   ? 131 PHE A CD2 1 
ATOM 986  C CE1 . PHE A 1 130 ? -11.903 16.813 10.104  1.00 3.75   ? 131 PHE A CE1 1 
ATOM 987  C CE2 . PHE A 1 130 ? -9.816  15.668 10.559  1.00 3.75   ? 131 PHE A CE2 1 
ATOM 988  C CZ  . PHE A 1 130 ? -11.208 15.749 10.685  1.00 3.75   ? 131 PHE A CZ  1 
ATOM 989  N N   . ILE A 1 131 ? -6.457  20.765 8.957   1.00 27.07  ? 132 ILE A N   1 
ATOM 990  C CA  . ILE A 1 131 ? -5.327  21.492 8.412   1.00 27.07  ? 132 ILE A CA  1 
ATOM 991  C C   . ILE A 1 131 ? -4.317  20.520 7.846   1.00 27.07  ? 132 ILE A C   1 
ATOM 992  O O   . ILE A 1 131 ? -4.045  19.487 8.457   1.00 27.07  ? 132 ILE A O   1 
ATOM 993  C CB  . ILE A 1 131 ? -4.629  22.324 9.505   1.00 51.14  ? 132 ILE A CB  1 
ATOM 994  C CG1 . ILE A 1 131 ? -5.524  23.488 9.917   1.00 51.14  ? 132 ILE A CG1 1 
ATOM 995  C CG2 . ILE A 1 131 ? -3.289  22.832 9.007   1.00 51.14  ? 132 ILE A CG2 1 
ATOM 996  C CD1 . ILE A 1 131 ? -5.928  24.382 8.756   1.00 51.14  ? 132 ILE A CD1 1 
ATOM 997  N N   . LEU A 1 132 ? -3.768  20.863 6.682   1.00 38.85  ? 133 LEU A N   1 
ATOM 998  C CA  . LEU A 1 132 ? -2.755  20.054 5.999   1.00 38.85  ? 133 LEU A CA  1 
ATOM 999  C C   . LEU A 1 132 ? -1.447  20.875 5.915   1.00 38.85  ? 133 LEU A C   1 
ATOM 1000 O O   . LEU A 1 132 ? -1.429  21.942 5.306   1.00 38.85  ? 133 LEU A O   1 
ATOM 1001 C CB  . LEU A 1 132 ? -3.266  19.689 4.592   1.00 16.74  ? 133 LEU A CB  1 
ATOM 1002 C CG  . LEU A 1 132 ? -2.273  19.148 3.557   1.00 16.74  ? 133 LEU A CG  1 
ATOM 1003 C CD1 . LEU A 1 132 ? -1.797  17.764 3.944   1.00 16.74  ? 133 LEU A CD1 1 
ATOM 1004 C CD2 . LEU A 1 132 ? -2.946  19.105 2.206   1.00 16.74  ? 133 LEU A CD2 1 
ATOM 1005 N N   . CYS A 1 133 ? -0.370  20.395 6.541   1.00 28.06  ? 134 CYS A N   1 
ATOM 1006 C CA  . CYS A 1 133 ? 0.912   21.112 6.526   1.00 28.06  ? 134 CYS A CA  1 
ATOM 1007 C C   . CYS A 1 133 ? 1.961   20.458 5.642   1.00 28.06  ? 134 CYS A C   1 
ATOM 1008 O O   . CYS A 1 133 ? 2.425   19.357 5.929   1.00 28.06  ? 134 CYS A O   1 
ATOM 1009 C CB  . CYS A 1 133 ? 1.504   21.221 7.928   1.00 69.85  ? 134 CYS A CB  1 
ATOM 1010 S SG  . CYS A 1 133 ? 0.692   22.345 9.104   1.00 69.85  ? 134 CYS A SG  1 
ATOM 1011 N N   . LYS A 1 134 ? 2.361   21.150 4.581   1.00 19.27  ? 135 LYS A N   1 
ATOM 1012 C CA  . LYS A 1 134 ? 3.358   20.614 3.667   1.00 19.27  ? 135 LYS A CA  1 
ATOM 1013 C C   . LYS A 1 134 ? 4.786   20.762 4.197   1.00 19.27  ? 135 LYS A C   1 
ATOM 1014 O O   . LYS A 1 134 ? 5.512   21.657 3.792   1.00 19.27  ? 135 LYS A O   1 
ATOM 1015 C CB  . LYS A 1 134 ? 3.244   21.295 2.300   1.00 50.62  ? 135 LYS A CB  1 
ATOM 1016 C CG  . LYS A 1 134 ? 4.315   20.844 1.333   1.00 50.62  ? 135 LYS A CG  1 
ATOM 1017 C CD  . LYS A 1 134 ? 4.211   21.511 -0.014  1.00 50.62  ? 135 LYS A CD  1 
ATOM 1018 C CE  . LYS A 1 134 ? 5.354   21.029 -0.882  1.00 50.62  ? 135 LYS A CE  1 
ATOM 1019 N NZ  . LYS A 1 134 ? 5.259   21.525 -2.268  1.00 50.62  ? 135 LYS A NZ  1 
ATOM 1020 N N   . GLU A 1 135 ? 5.193   19.867 5.089   1.00 32.72  ? 136 GLU A N   1 
ATOM 1021 C CA  . GLU A 1 135 ? 6.534   19.906 5.670   1.00 32.72  ? 136 GLU A CA  1 
ATOM 1022 C C   . GLU A 1 135 ? 7.542   20.570 4.758   1.00 32.72  ? 136 GLU A C   1 
ATOM 1023 O O   . GLU A 1 135 ? 8.544   19.956 4.399   1.00 32.72  ? 136 GLU A O   1 
ATOM 1024 C CB  . GLU A 1 135 ? 7.016   18.493 5.980   1.00 82.40  ? 136 GLU A CB  1 
ATOM 1025 C CG  . GLU A 1 135 ? 6.076   17.716 6.867   1.00 82.40  ? 136 GLU A CG  1 
ATOM 1026 C CD  . GLU A 1 135 ? 5.721   18.477 8.127   1.00 82.40  ? 136 GLU A CD  1 
ATOM 1027 O OE1 . GLU A 1 135 ? 6.655   19.010 8.767   1.00 82.40  ? 136 GLU A OE1 1 
ATOM 1028 O OE2 . GLU A 1 135 ? 4.517   18.538 8.476   1.00 82.40  ? 136 GLU A OE2 1 
ATOM 1029 N N   . CYS A 1 143 ? 0.724   25.496 5.612   1.00 35.97  ? 144 CYS A N   1 
ATOM 1030 C CA  . CYS A 1 143 ? -0.461  24.695 5.901   1.00 35.97  ? 144 CYS A CA  1 
ATOM 1031 C C   . CYS A 1 143 ? -1.712  25.392 5.371   1.00 35.97  ? 144 CYS A C   1 
ATOM 1032 O O   . CYS A 1 143 ? -1.738  26.612 5.273   1.00 35.97  ? 144 CYS A O   1 
ATOM 1033 C CB  . CYS A 1 143 ? -0.616  24.500 7.410   1.00 59.73  ? 144 CYS A CB  1 
ATOM 1034 S SG  . CYS A 1 143 ? 0.925   24.209 8.329   1.00 59.73  ? 144 CYS A SG  1 
ATOM 1035 N N   . LEU A 1 144 ? -2.742  24.615 5.043   1.00 37.76  ? 145 LEU A N   1 
ATOM 1036 C CA  . LEU A 1 144 ? -3.987  25.192 4.544   1.00 37.76  ? 145 LEU A CA  1 
ATOM 1037 C C   . LEU A 1 144 ? -5.225  24.524 5.104   1.00 37.76  ? 145 LEU A C   1 
ATOM 1038 O O   . LEU A 1 144 ? -5.254  23.310 5.328   1.00 37.76  ? 145 LEU A O   1 
ATOM 1039 C CB  . LEU A 1 144 ? -4.065  25.122 3.019   1.00 47.70  ? 145 LEU A CB  1 
ATOM 1040 C CG  . LEU A 1 144 ? -3.438  23.882 2.389   1.00 47.70  ? 145 LEU A CG  1 
ATOM 1041 C CD1 . LEU A 1 144 ? -4.073  23.583 1.043   1.00 47.70  ? 145 LEU A CD1 1 
ATOM 1042 C CD2 . LEU A 1 144 ? -1.930  24.101 2.255   1.00 47.70  ? 145 LEU A CD2 1 
ATOM 1043 N N   . ASN A 1 145 ? -6.249  25.337 5.326   1.00 67.15  ? 146 ASN A N   1 
ATOM 1044 C CA  . ASN A 1 145 ? -7.529  24.846 5.821   1.00 67.15  ? 146 ASN A CA  1 
ATOM 1045 C C   . ASN A 1 145 ? -8.258  24.059 4.733   1.00 67.15  ? 146 ASN A C   1 
ATOM 1046 O O   . ASN A 1 145 ? -8.074  24.305 3.538   1.00 67.15  ? 146 ASN A O   1 
ATOM 1047 C CB  . ASN A 1 145 ? -8.419  26.016 6.247   1.00 76.09  ? 146 ASN A CB  1 
ATOM 1048 C CG  . ASN A 1 145 ? -8.313  26.325 7.723   1.00 76.09  ? 146 ASN A CG  1 
ATOM 1049 O OD1 . ASN A 1 145 ? -7.676  27.309 8.128   1.00 76.09  ? 146 ASN A OD1 1 
ATOM 1050 N ND2 . ASN A 1 145 ? -8.935  25.474 8.546   1.00 76.09  ? 146 ASN A ND2 1 
ATOM 1051 N N   . SER A 1 146 ? -9.090  23.114 5.152   1.00 72.55  ? 147 SER A N   1 
ATOM 1052 C CA  . SER A 1 146 ? -9.881  22.345 4.207   1.00 72.55  ? 147 SER A CA  1 
ATOM 1053 C C   . SER A 1 146 ? -10.857 23.326 3.563   1.00 72.55  ? 147 SER A C   1 
ATOM 1054 O O   . SER A 1 146 ? -11.042 24.442 4.061   1.00 72.55  ? 147 SER A O   1 
ATOM 1055 C CB  . SER A 1 146 ? -10.663 21.256 4.933   1.00 62.18  ? 147 SER A CB  1 
ATOM 1056 O OG  . SER A 1 146 ? -11.407 21.823 5.993   1.00 62.18  ? 147 SER A OG  1 
ATOM 1057 N N   . SER A 1 153 ? -17.673 15.197 8.305   1.00 55.42  ? 154 SER A N   1 
ATOM 1058 C CA  . SER A 1 153 ? -17.619 15.601 9.708   1.00 55.42  ? 154 SER A CA  1 
ATOM 1059 C C   . SER A 1 153 ? -16.332 15.087 10.347  1.00 55.42  ? 154 SER A C   1 
ATOM 1060 O O   . SER A 1 153 ? -15.783 15.720 11.250  1.00 55.42  ? 154 SER A O   1 
ATOM 1061 C CB  . SER A 1 153 ? -18.833 15.048 10.470  1.00 81.03  ? 154 SER A CB  1 
ATOM 1062 O OG  . SER A 1 153 ? -18.821 13.628 10.502  1.00 81.03  ? 154 SER A OG  1 
ATOM 1063 N N   . SER A 1 154 ? -15.861 13.934 9.870   1.00 47.31  ? 155 SER A N   1 
ATOM 1064 C CA  . SER A 1 154 ? -14.637 13.323 10.388  1.00 47.31  ? 155 SER A CA  1 
ATOM 1065 C C   . SER A 1 154 ? -13.589 13.013 9.306   1.00 47.31  ? 155 SER A C   1 
ATOM 1066 O O   . SER A 1 154 ? -12.688 12.190 9.518   1.00 47.31  ? 155 SER A O   1 
ATOM 1067 C CB  . SER A 1 154 ? -14.977 12.049 11.179  1.00 35.97  ? 155 SER A CB  1 
ATOM 1068 O OG  . SER A 1 154 ? -15.853 11.209 10.456  1.00 35.97  ? 155 SER A OG  1 
ATOM 1069 N N   . ARG A 1 155 ? -13.709 13.683 8.158   1.00 22.50  ? 156 ARG A N   1 
ATOM 1070 C CA  . ARG A 1 155 ? -12.775 13.515 7.045   1.00 22.50  ? 156 ARG A CA  1 
ATOM 1071 C C   . ARG A 1 155 ? -12.691 14.815 6.238   1.00 22.50  ? 156 ARG A C   1 
ATOM 1072 O O   . ARG A 1 155 ? -13.635 15.605 6.220   1.00 22.50  ? 156 ARG A O   1 
ATOM 1073 C CB  . ARG A 1 155 ? -13.227 12.373 6.126   1.00 87.96  ? 156 ARG A CB  1 
ATOM 1074 C CG  . ARG A 1 155 ? -13.911 12.834 4.842   1.00 87.96  ? 156 ARG A CG  1 
ATOM 1075 C CD  . ARG A 1 155 ? -14.420 11.660 4.014   1.00 87.96  ? 156 ARG A CD  1 
ATOM 1076 N NE  . ARG A 1 155 ? -13.358 10.729 3.643   1.00 87.96  ? 156 ARG A NE  1 
ATOM 1077 C CZ  . ARG A 1 155 ? -13.563 9.603  2.967   1.00 87.96  ? 156 ARG A CZ  1 
ATOM 1078 N NH1 . ARG A 1 155 ? -14.790 9.271  2.588   1.00 87.96  ? 156 ARG A NH1 1 
ATOM 1079 N NH2 . ARG A 1 155 ? -12.545 8.809  2.674   1.00 87.96  ? 156 ARG A NH2 1 
ATOM 1080 N N   . ALA A 1 156 ? -11.560 15.031 5.574   1.00 75.13  ? 157 ALA A N   1 
ATOM 1081 C CA  . ALA A 1 156 ? -11.353 16.226 4.758   1.00 75.13  ? 157 ALA A CA  1 
ATOM 1082 C C   . ALA A 1 156 ? -10.480 15.835 3.564   1.00 75.13  ? 157 ALA A C   1 
ATOM 1083 O O   . ALA A 1 156 ? -9.652  14.930 3.674   1.00 75.13  ? 157 ALA A O   1 
ATOM 1084 C CB  . ALA A 1 156 ? -10.681 17.312 5.582   1.00 73.12  ? 157 ALA A CB  1 
ATOM 1085 N N   . ILE A 1 157 ? -10.651 16.521 2.434   1.00 56.47  ? 158 ILE A N   1 
ATOM 1086 C CA  . ILE A 1 157 ? -9.899  16.184 1.217   1.00 56.47  ? 158 ILE A CA  1 
ATOM 1087 C C   . ILE A 1 157 ? -9.100  17.308 0.561   1.00 56.47  ? 158 ILE A C   1 
ATOM 1088 O O   . ILE A 1 157 ? -9.677  18.244 0.003   1.00 56.47  ? 158 ILE A O   1 
ATOM 1089 C CB  . ILE A 1 157 ? -10.849 15.604 0.141   1.00 53.24  ? 158 ILE A CB  1 
ATOM 1090 C CG1 . ILE A 1 157 ? -11.260 14.180 0.514   1.00 53.24  ? 158 ILE A CG1 1 
ATOM 1091 C CG2 . ILE A 1 157 ? -10.180 15.627 -1.216  1.00 53.24  ? 158 ILE A CG2 1 
ATOM 1092 C CD1 . ILE A 1 157 ? -10.093 13.220 0.639   1.00 53.24  ? 158 ILE A CD1 1 
ATOM 1093 N N   . PHE A 1 158 ? -7.776  17.191 0.585   1.00 43.40  ? 159 PHE A N   1 
ATOM 1094 C CA  . PHE A 1 158 ? -6.922  18.208 -0.017  1.00 43.40  ? 159 PHE A CA  1 
ATOM 1095 C C   . PHE A 1 158 ? -6.323  17.678 -1.315  1.00 43.40  ? 159 PHE A C   1 
ATOM 1096 O O   . PHE A 1 158 ? -6.394  16.485 -1.587  1.00 43.40  ? 159 PHE A O   1 
ATOM 1097 C CB  . PHE A 1 158 ? -5.805  18.591 0.952   1.00 43.25  ? 159 PHE A CB  1 
ATOM 1098 C CG  . PHE A 1 158 ? -6.300  18.973 2.316   1.00 43.25  ? 159 PHE A CG  1 
ATOM 1099 C CD1 . PHE A 1 158 ? -6.824  18.017 3.174   1.00 43.25  ? 159 PHE A CD1 1 
ATOM 1100 C CD2 . PHE A 1 158 ? -6.243  20.290 2.745   1.00 43.25  ? 159 PHE A CD2 1 
ATOM 1101 C CE1 . PHE A 1 158 ? -7.307  18.366 4.430   1.00 43.25  ? 159 PHE A CE1 1 
ATOM 1102 C CE2 . PHE A 1 158 ? -6.723  20.652 4.000   1.00 43.25  ? 159 PHE A CE2 1 
ATOM 1103 C CZ  . PHE A 1 158 ? -7.248  19.685 4.847   1.00 43.25  ? 159 PHE A CZ  1 
ATOM 1104 N N   . SER A 1 159 ? -5.732  18.562 -2.114  1.00 36.98  ? 160 SER A N   1 
ATOM 1105 C CA  . SER A 1 159 ? -5.134  18.149 -3.377  1.00 36.98  ? 160 SER A CA  1 
ATOM 1106 C C   . SER A 1 159 ? -3.901  18.952 -3.752  1.00 36.98  ? 160 SER A C   1 
ATOM 1107 O O   . SER A 1 159 ? -3.977  20.152 -3.986  1.00 36.98  ? 160 SER A O   1 
ATOM 1108 C CB  . SER A 1 159 ? -6.159  18.254 -4.503  1.00 76.22  ? 160 SER A CB  1 
ATOM 1109 O OG  . SER A 1 159 ? -5.576  17.894 -5.741  1.00 76.22  ? 160 SER A OG  1 
ATOM 1110 N N   . VAL A 1 160 ? -2.771  18.265 -3.819  1.00 43.15  ? 161 VAL A N   1 
ATOM 1111 C CA  . VAL A 1 160 ? -1.496  18.869 -4.166  1.00 43.15  ? 161 VAL A CA  1 
ATOM 1112 C C   . VAL A 1 160 ? -1.399  19.174 -5.666  1.00 43.15  ? 161 VAL A C   1 
ATOM 1113 O O   . VAL A 1 160 ? -2.028  18.515 -6.498  1.00 43.15  ? 161 VAL A O   1 
ATOM 1114 C CB  . VAL A 1 160 ? -0.359  17.927 -3.776  1.00 48.69  ? 161 VAL A CB  1 
ATOM 1115 C CG1 . VAL A 1 160 ? -0.834  17.007 -2.687  1.00 48.69  ? 161 VAL A CG1 1 
ATOM 1116 C CG2 . VAL A 1 160 ? 0.096   17.109 -4.977  1.00 48.69  ? 161 VAL A CG2 1 
ATOM 1117 N N   . VAL A 1 163 ? 3.047   17.145 -9.612  1.00 76.26  ? 164 VAL A N   1 
ATOM 1118 C CA  . VAL A 1 163 ? 4.062   17.112 -8.563  1.00 76.26  ? 164 VAL A CA  1 
ATOM 1119 C C   . VAL A 1 163 ? 5.360   16.452 -9.055  1.00 76.26  ? 164 VAL A C   1 
ATOM 1120 O O   . VAL A 1 163 ? 5.345   15.605 -9.958  1.00 76.26  ? 164 VAL A O   1 
ATOM 1121 C CB  . VAL A 1 163 ? 3.523   16.358 -7.304  1.00 78.56  ? 164 VAL A CB  1 
ATOM 1122 C CG1 . VAL A 1 163 ? 2.025   16.273 -7.380  1.00 78.56  ? 164 VAL A CG1 1 
ATOM 1123 C CG2 . VAL A 1 163 ? 4.098   14.937 -7.214  1.00 78.56  ? 164 VAL A CG2 1 
ATOM 1124 N N   . TRP A 1 169 ? 7.723   16.337 -0.868  1.00 69.23  ? 170 TRP A N   1 
ATOM 1125 C CA  . TRP A 1 169 ? 6.271   16.384 -0.719  1.00 69.23  ? 170 TRP A CA  1 
ATOM 1126 C C   . TRP A 1 169 ? 5.777   15.677 0.547   1.00 69.23  ? 170 TRP A C   1 
ATOM 1127 O O   . TRP A 1 169 ? 4.858   14.858 0.501   1.00 69.23  ? 170 TRP A O   1 
ATOM 1128 C CB  . TRP A 1 169 ? 5.589   15.776 -1.951  1.00 87.14  ? 170 TRP A CB  1 
ATOM 1129 C CG  . TRP A 1 169 ? 6.017   16.416 -3.239  1.00 87.14  ? 170 TRP A CG  1 
ATOM 1130 C CD1 . TRP A 1 169 ? 7.131   16.113 -3.976  1.00 87.14  ? 170 TRP A CD1 1 
ATOM 1131 C CD2 . TRP A 1 169 ? 5.387   17.524 -3.901  1.00 87.14  ? 170 TRP A CD2 1 
ATOM 1132 N NE1 . TRP A 1 169 ? 7.233   16.968 -5.051  1.00 87.14  ? 170 TRP A NE1 1 
ATOM 1133 C CE2 . TRP A 1 169 ? 6.177   17.843 -5.029  1.00 87.14  ? 170 TRP A CE2 1 
ATOM 1134 C CE3 . TRP A 1 169 ? 4.234   18.279 -3.648  1.00 87.14  ? 170 TRP A CE3 1 
ATOM 1135 C CZ2 . TRP A 1 169 ? 5.851   18.890 -5.904  1.00 87.14  ? 170 TRP A CZ2 1 
ATOM 1136 C CZ3 . TRP A 1 169 ? 3.910   19.320 -4.520  1.00 87.14  ? 170 TRP A CZ3 1 
ATOM 1137 C CH2 . TRP A 1 169 ? 4.717   19.613 -5.633  1.00 87.14  ? 170 TRP A CH2 1 
ATOM 1138 N N   . TRP A 1 170 ? 6.409   15.998 1.673   1.00 36.68  ? 171 TRP A N   1 
ATOM 1139 C CA  . TRP A 1 170 ? 6.041   15.442 2.970   1.00 36.68  ? 171 TRP A CA  1 
ATOM 1140 C C   . TRP A 1 170 ? 4.820   16.206 3.493   1.00 36.68  ? 171 TRP A C   1 
ATOM 1141 O O   . TRP A 1 170 ? 4.812   17.437 3.515   1.00 36.68  ? 171 TRP A O   1 
ATOM 1142 C CB  . TRP A 1 170 ? 7.190   15.616 3.976   1.00 84.72  ? 171 TRP A CB  1 
ATOM 1143 C CG  . TRP A 1 170 ? 8.404   14.729 3.780   1.00 84.72  ? 171 TRP A CG  1 
ATOM 1144 C CD1 . TRP A 1 170 ? 8.596   13.790 2.806   1.00 84.72  ? 171 TRP A CD1 1 
ATOM 1145 C CD2 . TRP A 1 170 ? 9.574   14.683 4.615   1.00 84.72  ? 171 TRP A CD2 1 
ATOM 1146 N NE1 . TRP A 1 170 ? 9.809   13.161 2.986   1.00 84.72  ? 171 TRP A NE1 1 
ATOM 1147 C CE2 . TRP A 1 170 ? 10.429  13.688 4.087   1.00 84.72  ? 171 TRP A CE2 1 
ATOM 1148 C CE3 . TRP A 1 170 ? 9.981   15.387 5.760   1.00 84.72  ? 171 TRP A CE3 1 
ATOM 1149 C CZ2 . TRP A 1 170 ? 11.666  13.376 4.662   1.00 84.72  ? 171 TRP A CZ2 1 
ATOM 1150 C CZ3 . TRP A 1 170 ? 11.216  15.076 6.335   1.00 84.72  ? 171 TRP A CZ3 1 
ATOM 1151 C CH2 . TRP A 1 170 ? 12.042  14.078 5.782   1.00 84.72  ? 171 TRP A CH2 1 
ATOM 1152 N N   . TYR A 1 171 ? 3.792   15.483 3.918   1.00 38.22  ? 172 TYR A N   1 
ATOM 1153 C CA  . TYR A 1 171 ? 2.598   16.127 4.453   1.00 38.22  ? 172 TYR A CA  1 
ATOM 1154 C C   . TYR A 1 171 ? 2.217   15.576 5.813   1.00 38.22  ? 172 TYR A C   1 
ATOM 1155 O O   . TYR A 1 171 ? 2.622   14.476 6.187   1.00 38.22  ? 172 TYR A O   1 
ATOM 1156 C CB  . TYR A 1 171 ? 1.412   15.947 3.510   1.00 60.72  ? 172 TYR A CB  1 
ATOM 1157 C CG  . TYR A 1 171 ? 1.580   16.628 2.178   1.00 60.72  ? 172 TYR A CG  1 
ATOM 1158 C CD1 . TYR A 1 171 ? 2.257   16.003 1.134   1.00 60.72  ? 172 TYR A CD1 1 
ATOM 1159 C CD2 . TYR A 1 171 ? 1.090   17.917 1.971   1.00 60.72  ? 172 TYR A CD2 1 
ATOM 1160 C CE1 . TYR A 1 171 ? 2.443   16.644 -0.082  1.00 60.72  ? 172 TYR A CE1 1 
ATOM 1161 C CE2 . TYR A 1 171 ? 1.272   18.568 0.761   1.00 60.72  ? 172 TYR A CE2 1 
ATOM 1162 C CZ  . TYR A 1 171 ? 1.951   17.927 -0.261  1.00 60.72  ? 172 TYR A CZ  1 
ATOM 1163 O OH  . TYR A 1 171 ? 2.152   18.580 -1.452  1.00 60.72  ? 172 TYR A OH  1 
ATOM 1164 N N   . ARG A 1 172 ? 1.440   16.361 6.548   1.00 21.51  ? 173 ARG A N   1 
ATOM 1165 C CA  . ARG A 1 172 ? 0.940   15.988 7.865   1.00 21.51  ? 173 ARG A CA  1 
ATOM 1166 C C   . ARG A 1 172 ? -0.305  16.821 8.020   1.00 21.51  ? 173 ARG A C   1 
ATOM 1167 O O   . ARG A 1 172 ? -0.378  17.943 7.529   1.00 21.51  ? 173 ARG A O   1 
ATOM 1168 C CB  . ARG A 1 172 ? 1.933   16.347 8.979   1.00 44.17  ? 173 ARG A CB  1 
ATOM 1169 C CG  . ARG A 1 172 ? 3.200   15.499 8.994   1.00 44.17  ? 173 ARG A CG  1 
ATOM 1170 C CD  . ARG A 1 172 ? 4.109   15.780 10.205  1.00 44.17  ? 173 ARG A CD  1 
ATOM 1171 N NE  . ARG A 1 172 ? 4.101   14.668 11.161  1.00 44.17  ? 173 ARG A NE  1 
ATOM 1172 C CZ  . ARG A 1 172 ? 5.192   14.086 11.650  1.00 44.17  ? 173 ARG A CZ  1 
ATOM 1173 N NH1 . ARG A 1 172 ? 6.395   14.504 11.279  1.00 44.17  ? 173 ARG A NH1 1 
ATOM 1174 N NH2 . ARG A 1 172 ? 5.079   13.081 12.509  1.00 44.17  ? 173 ARG A NH2 1 
ATOM 1175 N N   . CYS A 1 173 ? -1.306  16.285 8.682   1.00 11.88  ? 174 CYS A N   1 
ATOM 1176 C CA  . CYS A 1 173 ? -2.501  17.071 8.852   1.00 11.88  ? 174 CYS A CA  1 
ATOM 1177 C C   . CYS A 1 173 ? -2.897  17.085 10.315  1.00 11.88  ? 174 CYS A C   1 
ATOM 1178 O O   . CYS A 1 173 ? -2.337  16.345 11.120  1.00 11.88  ? 174 CYS A O   1 
ATOM 1179 C CB  . CYS A 1 173 ? -3.636  16.520 7.973   1.00 36.81  ? 174 CYS A CB  1 
ATOM 1180 S SG  . CYS A 1 173 ? -4.413  14.984 8.554   1.00 36.81  ? 174 CYS A SG  1 
ATOM 1181 N N   . TYR A 1 174 ? -3.843  17.955 10.654  1.00 13.31  ? 175 TYR A N   1 
ATOM 1182 C CA  . TYR A 1 174 ? -4.324  18.055 12.018  1.00 13.31  ? 175 TYR A CA  1 
ATOM 1183 C C   . TYR A 1 174 ? -5.839  18.172 12.054  1.00 13.31  ? 175 TYR A C   1 
ATOM 1184 O O   . TYR A 1 174 ? -6.487  18.460 11.041  1.00 13.31  ? 175 TYR A O   1 
ATOM 1185 C CB  . TYR A 1 174 ? -3.720  19.273 12.713  1.00 15.08  ? 175 TYR A CB  1 
ATOM 1186 C CG  . TYR A 1 174 ? -2.208  19.241 12.843  1.00 15.08  ? 175 TYR A CG  1 
ATOM 1187 C CD1 . TYR A 1 174 ? -1.383  19.548 11.762  1.00 15.08  ? 175 TYR A CD1 1 
ATOM 1188 C CD2 . TYR A 1 174 ? -1.603  18.912 14.056  1.00 15.08  ? 175 TYR A CD2 1 
ATOM 1189 C CE1 . TYR A 1 174 ? -0.001  19.531 11.893  1.00 15.08  ? 175 TYR A CE1 1 
ATOM 1190 C CE2 . TYR A 1 174 ? -0.230  18.887 14.187  1.00 15.08  ? 175 TYR A CE2 1 
ATOM 1191 C CZ  . TYR A 1 174 ? 0.561   19.197 13.108  1.00 15.08  ? 175 TYR A CZ  1 
ATOM 1192 O OH  . TYR A 1 174 ? 1.920   19.152 13.264  1.00 15.08  ? 175 TYR A OH  1 
ATOM 1193 N N   . ALA A 1 175 ? -6.400  17.936 13.233  1.00 33.97  ? 176 ALA A N   1 
ATOM 1194 C CA  . ALA A 1 175 ? -7.837  18.047 13.435  1.00 33.97  ? 176 ALA A CA  1 
ATOM 1195 C C   . ALA A 1 175 ? -7.986  19.169 14.435  1.00 33.97  ? 176 ALA A C   1 
ATOM 1196 O O   . ALA A 1 175 ? -7.062  19.434 15.213  1.00 33.97  ? 176 ALA A O   1 
ATOM 1197 C CB  . ALA A 1 175 ? -8.392  16.765 14.013  1.00 48.83  ? 176 ALA A CB  1 
ATOM 1198 N N   . TYR A 1 176 ? -9.131  19.838 14.424  1.00 18.85  ? 177 TYR A N   1 
ATOM 1199 C CA  . TYR A 1 176 ? -9.330  20.919 15.368  1.00 18.85  ? 177 TYR A CA  1 
ATOM 1200 C C   . TYR A 1 176 ? -10.752 21.433 15.377  1.00 18.85  ? 177 TYR A C   1 
ATOM 1201 O O   . TYR A 1 176 ? -11.463 21.364 14.378  1.00 18.85  ? 177 TYR A O   1 
ATOM 1202 C CB  . TYR A 1 176 ? -8.368  22.066 15.056  1.00 30.49  ? 177 TYR A CB  1 
ATOM 1203 C CG  . TYR A 1 176 ? -8.817  22.960 13.922  1.00 30.49  ? 177 TYR A CG  1 
ATOM 1204 C CD1 . TYR A 1 176 ? -9.869  23.866 14.095  1.00 30.49  ? 177 TYR A CD1 1 
ATOM 1205 C CD2 . TYR A 1 176 ? -8.210  22.894 12.665  1.00 30.49  ? 177 TYR A CD2 1 
ATOM 1206 C CE1 . TYR A 1 176 ? -10.307 24.682 13.049  1.00 30.49  ? 177 TYR A CE1 1 
ATOM 1207 C CE2 . TYR A 1 176 ? -8.645  23.705 11.608  1.00 30.49  ? 177 TYR A CE2 1 
ATOM 1208 C CZ  . TYR A 1 176 ? -9.691  24.591 11.812  1.00 30.49  ? 177 TYR A CZ  1 
ATOM 1209 O OH  . TYR A 1 176 ? -10.132 25.385 10.784  1.00 30.49  ? 177 TYR A OH  1 
ATOM 1210 N N   . ASP A 1 177 ? -11.151 21.962 16.527  1.00 37.61  ? 178 ASP A N   1 
ATOM 1211 C CA  . ASP A 1 177 ? -12.484 22.522 16.715  1.00 37.61  ? 178 ASP A CA  1 
ATOM 1212 C C   . ASP A 1 177 ? -12.409 24.007 16.361  1.00 37.61  ? 178 ASP A C   1 
ATOM 1213 O O   . ASP A 1 177 ? -11.452 24.686 16.731  1.00 37.61  ? 178 ASP A O   1 
ATOM 1214 C CB  . ASP A 1 177 ? -12.926 22.341 18.172  1.00 51.61  ? 178 ASP A CB  1 
ATOM 1215 C CG  . ASP A 1 177 ? -14.418 22.534 18.358  1.00 51.61  ? 178 ASP A CG  1 
ATOM 1216 O OD1 . ASP A 1 177 ? -14.923 23.628 18.038  1.00 51.61  ? 178 ASP A OD1 1 
ATOM 1217 O OD2 . ASP A 1 177 ? -15.092 21.592 18.822  1.00 51.61  ? 178 ASP A OD2 1 
ATOM 1218 N N   . SER A 1 178 ? -13.402 24.512 15.634  1.00 35.81  ? 179 SER A N   1 
ATOM 1219 C CA  . SER A 1 178 ? -13.402 25.919 15.257  1.00 35.81  ? 179 SER A CA  1 
ATOM 1220 C C   . SER A 1 178 ? -13.482 26.878 16.449  1.00 35.81  ? 179 SER A C   1 
ATOM 1221 O O   . SER A 1 178 ? -13.232 28.064 16.294  1.00 35.81  ? 179 SER A O   1 
ATOM 1222 C CB  . SER A 1 178 ? -14.529 26.209 14.255  1.00 9.89   ? 179 SER A CB  1 
ATOM 1223 O OG  . SER A 1 178 ? -15.730 25.573 14.625  1.00 9.89   ? 179 SER A OG  1 
ATOM 1224 N N   . ASN A 1 179 ? -13.804 26.368 17.635  1.00 48.66  ? 180 ASN A N   1 
ATOM 1225 C CA  . ASN A 1 179 ? -13.887 27.201 18.837  1.00 48.66  ? 180 ASN A CA  1 
ATOM 1226 C C   . ASN A 1 179 ? -12.510 27.380 19.515  1.00 48.66  ? 180 ASN A C   1 
ATOM 1227 O O   . ASN A 1 179 ? -12.399 27.986 20.588  1.00 48.66  ? 180 ASN A O   1 
ATOM 1228 C CB  . ASN A 1 179 ? -14.877 26.585 19.829  1.00 68.56  ? 180 ASN A CB  1 
ATOM 1229 C CG  . ASN A 1 179 ? -15.887 27.591 20.345  1.00 68.56  ? 180 ASN A CG  1 
ATOM 1230 O OD1 . ASN A 1 179 ? -15.534 28.543 21.037  1.00 68.56  ? 180 ASN A OD1 1 
ATOM 1231 N ND2 . ASN A 1 179 ? -17.154 27.385 20.003  1.00 68.56  ? 180 ASN A ND2 1 
ATOM 1232 N N   . SER A 1 180 ? -11.470 26.846 18.882  1.00 44.99  ? 181 SER A N   1 
ATOM 1233 C CA  . SER A 1 180 ? -10.103 26.930 19.389  1.00 44.99  ? 181 SER A CA  1 
ATOM 1234 C C   . SER A 1 180 ? -9.206  26.704 18.183  1.00 44.99  ? 181 SER A C   1 
ATOM 1235 O O   . SER A 1 180 ? -8.364  25.805 18.184  1.00 44.99  ? 181 SER A O   1 
ATOM 1236 C CB  . SER A 1 180 ? -9.844  25.834 20.425  1.00 57.71  ? 181 SER A CB  1 
ATOM 1237 O OG  . SER A 1 180 ? -10.706 25.968 21.536  1.00 57.71  ? 181 SER A OG  1 
ATOM 1238 N N   . PRO A 1 181 ? -9.373  27.528 17.136  1.00 22.90  ? 182 PRO A N   1 
ATOM 1239 C CA  . PRO A 1 181 ? -8.612  27.455 15.882  1.00 22.90  ? 182 PRO A CA  1 
ATOM 1240 C C   . PRO A 1 181 ? -7.096  27.400 15.945  1.00 22.90  ? 182 PRO A C   1 
ATOM 1241 O O   . PRO A 1 181 ? -6.462  27.085 14.950  1.00 22.90  ? 182 PRO A O   1 
ATOM 1242 C CB  . PRO A 1 181 ? -9.117  28.664 15.095  1.00 10.70  ? 182 PRO A CB  1 
ATOM 1243 C CG  . PRO A 1 181 ? -9.475  29.640 16.163  1.00 10.70  ? 182 PRO A CG  1 
ATOM 1244 C CD  . PRO A 1 181 ? -10.195 28.751 17.174  1.00 10.70  ? 182 PRO A CD  1 
ATOM 1245 N N   . TYR A 1 182 ? -6.506  27.693 17.095  1.00 22.50  ? 183 TYR A N   1 
ATOM 1246 C CA  . TYR A 1 182 ? -5.047  27.639 17.207  1.00 22.50  ? 183 TYR A CA  1 
ATOM 1247 C C   . TYR A 1 182 ? -4.547  26.435 18.045  1.00 22.50  ? 183 TYR A C   1 
ATOM 1248 O O   . TYR A 1 182 ? -3.335  26.173 18.148  1.00 22.50  ? 183 TYR A O   1 
ATOM 1249 C CB  . TYR A 1 182 ? -4.547  28.953 17.787  1.00 24.20  ? 183 TYR A CB  1 
ATOM 1250 C CG  . TYR A 1 182 ? -5.151  30.125 17.077  1.00 24.20  ? 183 TYR A CG  1 
ATOM 1251 C CD1 . TYR A 1 182 ? -5.862  31.095 17.783  1.00 24.20  ? 183 TYR A CD1 1 
ATOM 1252 C CD2 . TYR A 1 182 ? -5.047  30.251 15.695  1.00 24.20  ? 183 TYR A CD2 1 
ATOM 1253 C CE1 . TYR A 1 182 ? -6.464  32.173 17.132  1.00 24.20  ? 183 TYR A CE1 1 
ATOM 1254 C CE2 . TYR A 1 182 ? -5.642  31.321 15.028  1.00 24.20  ? 183 TYR A CE2 1 
ATOM 1255 C CZ  . TYR A 1 182 ? -6.351  32.282 15.759  1.00 24.20  ? 183 TYR A CZ  1 
ATOM 1256 O OH  . TYR A 1 182 ? -6.939  33.359 15.130  1.00 24.20  ? 183 TYR A OH  1 
ATOM 1257 N N   . GLU A 1 183 ? -5.506  25.724 18.640  1.00 13.68  ? 184 GLU A N   1 
ATOM 1258 C CA  . GLU A 1 183 ? -5.270  24.526 19.432  1.00 13.68  ? 184 GLU A CA  1 
ATOM 1259 C C   . GLU A 1 183 ? -5.561  23.343 18.490  1.00 13.68  ? 184 GLU A C   1 
ATOM 1260 O O   . GLU A 1 183 ? -6.723  23.036 18.228  1.00 13.68  ? 184 GLU A O   1 
ATOM 1261 C CB  . GLU A 1 183 ? -6.257  24.499 20.588  1.00 22.28  ? 184 GLU A CB  1 
ATOM 1262 C CG  . GLU A 1 183 ? -6.420  25.841 21.238  1.00 22.28  ? 184 GLU A CG  1 
ATOM 1263 C CD  . GLU A 1 183 ? -5.287  26.150 22.177  1.00 22.28  ? 184 GLU A CD  1 
ATOM 1264 O OE1 . GLU A 1 183 ? -4.192  25.578 22.005  1.00 22.28  ? 184 GLU A OE1 1 
ATOM 1265 O OE2 . GLU A 1 183 ? -5.489  26.976 23.087  1.00 22.28  ? 184 GLU A OE2 1 
ATOM 1266 N N   . TRP A 1 184 ? -4.518  22.698 17.973  1.00 27.25  ? 185 TRP A N   1 
ATOM 1267 C CA  . TRP A 1 184 ? -4.689  21.563 17.067  1.00 27.25  ? 185 TRP A CA  1 
ATOM 1268 C C   . TRP A 1 184 ? -4.457  20.222 17.750  1.00 27.25  ? 185 TRP A C   1 
ATOM 1269 O O   . TRP A 1 184 ? -3.995  20.154 18.887  1.00 27.25  ? 185 TRP A O   1 
ATOM 1270 C CB  . TRP A 1 184 ? -3.730  21.671 15.886  1.00 13.30  ? 185 TRP A CB  1 
ATOM 1271 C CG  . TRP A 1 184 ? -3.913  22.904 15.066  1.00 13.30  ? 185 TRP A CG  1 
ATOM 1272 C CD1 . TRP A 1 184 ? -4.977  23.772 15.102  1.00 13.30  ? 185 TRP A CD1 1 
ATOM 1273 C CD2 . TRP A 1 184 ? -3.054  23.365 14.016  1.00 13.30  ? 185 TRP A CD2 1 
ATOM 1274 N NE1 . TRP A 1 184 ? -4.827  24.737 14.133  1.00 13.30  ? 185 TRP A NE1 1 
ATOM 1275 C CE2 . TRP A 1 184 ? -3.656  24.510 13.452  1.00 13.30  ? 185 TRP A CE2 1 
ATOM 1276 C CE3 . TRP A 1 184 ? -1.829  22.920 13.494  1.00 13.30  ? 185 TRP A CE3 1 
ATOM 1277 C CZ2 . TRP A 1 184 ? -3.087  25.211 12.399  1.00 13.30  ? 185 TRP A CZ2 1 
ATOM 1278 C CZ3 . TRP A 1 184 ? -1.262  23.620 12.446  1.00 13.30  ? 185 TRP A CZ3 1 
ATOM 1279 C CH2 . TRP A 1 184 ? -1.892  24.754 11.910  1.00 13.30  ? 185 TRP A CH2 1 
ATOM 1280 N N   . SER A 1 185 ? -4.773  19.152 17.033  1.00 31.27  ? 186 SER A N   1 
ATOM 1281 C CA  . SER A 1 185 ? -4.600  17.787 17.541  1.00 31.27  ? 186 SER A CA  1 
ATOM 1282 C C   . SER A 1 185 ? -3.131  17.391 17.489  1.00 31.27  ? 186 SER A C   1 
ATOM 1283 O O   . SER A 1 185 ? -2.239  18.238 17.396  1.00 31.27  ? 186 SER A O   1 
ATOM 1284 C CB  . SER A 1 185 ? -5.355  16.813 16.652  1.00 11.71  ? 186 SER A CB  1 
ATOM 1285 O OG  . SER A 1 185 ? -4.786  16.857 15.349  1.00 11.71  ? 186 SER A OG  1 
ATOM 1286 N N   . LEU A 1 186 ? -2.884  16.092 17.564  1.00 15.88  ? 187 LEU A N   1 
ATOM 1287 C CA  . LEU A 1 186 ? -1.527  15.607 17.445  1.00 15.88  ? 187 LEU A CA  1 
ATOM 1288 C C   . LEU A 1 186 ? -1.352  15.564 15.942  1.00 15.88  ? 187 LEU A C   1 
ATOM 1289 O O   . LEU A 1 186 ? -2.331  15.539 15.206  1.00 15.88  ? 187 LEU A O   1 
ATOM 1290 C CB  . LEU A 1 186 ? -1.405  14.193 18.000  1.00 22.46  ? 187 LEU A CB  1 
ATOM 1291 C CG  . LEU A 1 186 ? -1.113  14.027 19.486  1.00 22.46  ? 187 LEU A CG  1 
ATOM 1292 C CD1 . LEU A 1 186 ? -1.181  12.551 19.884  1.00 22.46  ? 187 LEU A CD1 1 
ATOM 1293 C CD2 . LEU A 1 186 ? 0.262   14.612 19.769  1.00 22.46  ? 187 LEU A CD2 1 
ATOM 1294 N N   . PRO A 1 187 ? -0.113  15.559 15.459  1.00 12.96  ? 188 PRO A N   1 
ATOM 1295 C CA  . PRO A 1 187 ? 0.045   15.510 14.008  1.00 12.96  ? 188 PRO A CA  1 
ATOM 1296 C C   . PRO A 1 187 ? -0.162  14.078 13.509  1.00 12.96  ? 188 PRO A C   1 
ATOM 1297 O O   . PRO A 1 187 ? -0.036  13.114 14.263  1.00 12.96  ? 188 PRO A O   1 
ATOM 1298 C CB  . PRO A 1 187 ? 1.473   15.989 13.810  1.00 0.79   ? 188 PRO A CB  1 
ATOM 1299 C CG  . PRO A 1 187 ? 2.169   15.384 14.992  1.00 0.79   ? 188 PRO A CG  1 
ATOM 1300 C CD  . PRO A 1 187 ? 1.189   15.587 16.143  1.00 0.79   ? 188 PRO A CD  1 
ATOM 1301 N N   . SER A 1 188 ? -0.490  13.930 12.237  1.00 27.72  ? 189 SER A N   1 
ATOM 1302 C CA  . SER A 1 188 ? -0.682  12.597 11.687  1.00 27.72  ? 189 SER A CA  1 
ATOM 1303 C C   . SER A 1 188 ? 0.729   12.081 11.443  1.00 27.72  ? 189 SER A C   1 
ATOM 1304 O O   . SER A 1 188 ? 1.693   12.831 11.621  1.00 27.72  ? 189 SER A O   1 
ATOM 1305 C CB  . SER A 1 188 ? -1.445  12.673 10.360  1.00 27.05  ? 189 SER A CB  1 
ATOM 1306 O OG  . SER A 1 188 ? -0.685  13.371 9.382   1.00 27.05  ? 189 SER A OG  1 
ATOM 1307 N N   . ASP A 1 189 ? 0.861   10.810 11.062  1.00 30.52  ? 190 ASP A N   1 
ATOM 1308 C CA  . ASP A 1 189 ? 2.183   10.269 10.772  1.00 30.52  ? 190 ASP A CA  1 
ATOM 1309 C C   . ASP A 1 189 ? 2.631   11.058 9.567   1.00 30.52  ? 190 ASP A C   1 
ATOM 1310 O O   . ASP A 1 189 ? 1.805   11.625 8.856   1.00 30.52  ? 190 ASP A O   1 
ATOM 1311 C CB  . ASP A 1 189 ? 2.122   8.782  10.412  1.00 69.92  ? 190 ASP A CB  1 
ATOM 1312 C CG  . ASP A 1 189 ? 1.794   7.907  11.600  1.00 69.92  ? 190 ASP A CG  1 
ATOM 1313 O OD1 . ASP A 1 189 ? 2.260   8.231  12.712  1.00 69.92  ? 190 ASP A OD1 1 
ATOM 1314 O OD2 . ASP A 1 189 ? 1.090   6.889  11.421  1.00 69.92  ? 190 ASP A OD2 1 
ATOM 1315 N N   . LEU A 1 190 ? 3.932   11.113 9.337   1.00 31.11  ? 191 LEU A N   1 
ATOM 1316 C CA  . LEU A 1 190 ? 4.446   11.849 8.188   1.00 31.11  ? 191 LEU A CA  1 
ATOM 1317 C C   . LEU A 1 190 ? 4.061   11.119 6.909   1.00 31.11  ? 191 LEU A C   1 
ATOM 1318 O O   . LEU A 1 190 ? 4.241   9.908  6.808   1.00 31.11  ? 191 LEU A O   1 
ATOM 1319 C CB  . LEU A 1 190 ? 5.963   11.947 8.283   1.00 41.61  ? 191 LEU A CB  1 
ATOM 1320 C CG  . LEU A 1 190 ? 6.660   12.927 7.355   1.00 41.61  ? 191 LEU A CG  1 
ATOM 1321 C CD1 . LEU A 1 190 ? 6.069   14.316 7.525   1.00 41.61  ? 191 LEU A CD1 1 
ATOM 1322 C CD2 . LEU A 1 190 ? 8.142   12.936 7.692   1.00 41.61  ? 191 LEU A CD2 1 
ATOM 1323 N N   . LEU A 1 191 ? 3.507   11.842 5.943   1.00 37.66  ? 192 LEU A N   1 
ATOM 1324 C CA  . LEU A 1 191 ? 3.130   11.233 4.665   1.00 37.66  ? 192 LEU A CA  1 
ATOM 1325 C C   . LEU A 1 191 ? 4.047   11.738 3.570   1.00 37.66  ? 192 LEU A C   1 
ATOM 1326 O O   . LEU A 1 191 ? 4.014   12.924 3.235   1.00 37.66  ? 192 LEU A O   1 
ATOM 1327 C CB  . LEU A 1 191 ? 1.699   11.587 4.263   1.00 43.11  ? 192 LEU A CB  1 
ATOM 1328 C CG  . LEU A 1 191 ? 1.444   11.295 2.775   1.00 43.11  ? 192 LEU A CG  1 
ATOM 1329 C CD1 . LEU A 1 191 ? 1.636   9.815  2.527   1.00 43.11  ? 192 LEU A CD1 1 
ATOM 1330 C CD2 . LEU A 1 191 ? 0.042   11.727 2.363   1.00 43.11  ? 192 LEU A CD2 1 
ATOM 1331 N N   . GLU A 1 192 ? 4.849   10.848 2.999   1.00 49.86  ? 193 GLU A N   1 
ATOM 1332 C CA  . GLU A 1 192 ? 5.763   11.239 1.936   1.00 49.86  ? 193 GLU A CA  1 
ATOM 1333 C C   . GLU A 1 192 ? 5.315   10.691 0.579   1.00 49.86  ? 193 GLU A C   1 
ATOM 1334 O O   . GLU A 1 192 ? 5.223   9.476  0.403   1.00 49.86  ? 193 GLU A O   1 
ATOM 1335 C CB  . GLU A 1 192 ? 7.174   10.754 2.277   1.00 70.61  ? 193 GLU A CB  1 
ATOM 1336 C CG  . GLU A 1 192 ? 8.202   10.926 1.170   1.00 70.61  ? 193 GLU A CG  1 
ATOM 1337 C CD  . GLU A 1 192 ? 9.626   10.732 1.672   1.00 70.61  ? 193 GLU A CD  1 
ATOM 1338 O OE1 . GLU A 1 192 ? 9.855   9.811  2.484   1.00 70.61  ? 193 GLU A OE1 1 
ATOM 1339 O OE2 . GLU A 1 192 ? 10.521  11.497 1.254   1.00 70.61  ? 193 GLU A OE2 1 
ATOM 1340 N N   . LEU A 1 193 ? 5.004   11.591 -0.360  1.00 54.31  ? 194 LEU A N   1 
ATOM 1341 C CA  . LEU A 1 193 ? 4.598   11.188 -1.710  1.00 54.31  ? 194 LEU A CA  1 
ATOM 1342 C C   . LEU A 1 193 ? 5.879   10.784 -2.429  1.00 54.31  ? 194 LEU A C   1 
ATOM 1343 O O   . LEU A 1 193 ? 6.919   11.430 -2.261  1.00 54.31  ? 194 LEU A O   1 
ATOM 1344 C CB  . LEU A 1 193 ? 3.946   12.340 -2.479  1.00 42.24  ? 194 LEU A CB  1 
ATOM 1345 C CG  . LEU A 1 193 ? 2.580   12.892 -2.066  1.00 42.24  ? 194 LEU A CG  1 
ATOM 1346 C CD1 . LEU A 1 193 ? 1.944   13.580 -3.269  1.00 42.24  ? 194 LEU A CD1 1 
ATOM 1347 C CD2 . LEU A 1 193 ? 1.668   11.773 -1.597  1.00 42.24  ? 194 LEU A CD2 1 
ATOM 1348 N N   . LEU A 1 194 ? 5.818   9.722  -3.222  1.00 58.99  ? 195 LEU A N   1 
ATOM 1349 C CA  . LEU A 1 194 ? 7.002   9.264  -3.925  1.00 58.99  ? 195 LEU A CA  1 
ATOM 1350 C C   . LEU A 1 194 ? 6.856   9.525  -5.413  1.00 58.99  ? 195 LEU A C   1 
ATOM 1351 O O   . LEU A 1 194 ? 5.752   9.273  -5.945  1.00 58.99  ? 195 LEU A O   1 
ATOM 1352 C CB  . LEU A 1 194 ? 7.202   7.775  -3.648  1.00 68.21  ? 195 LEU A CB  1 
ATOM 1353 C CG  . LEU A 1 194 ? 8.503   7.093  -4.071  1.00 68.21  ? 195 LEU A CG  1 
ATOM 1354 C CD1 . LEU A 1 194 ? 8.735   5.837  -3.225  1.00 68.21  ? 195 LEU A CD1 1 
ATOM 1355 C CD2 . LEU A 1 194 ? 8.438   6.759  -5.546  1.00 68.21  ? 195 LEU A CD2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   2   2   HIS HIS A . n 
A 1 2   LEU 2   3   3   LEU LEU A . n 
A 1 3   PRO 3   4   4   PRO PRO A . n 
A 1 4   LYS 4   5   5   LYS LYS A . n 
A 1 5   PRO 5   6   6   PRO PRO A . n 
A 1 6   THR 6   7   7   THR THR A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   TRP 8   9   9   TRP TRP A . n 
A 1 9   ALA 9   10  10  ALA ALA A . n 
A 1 10  GLU 10  11  11  GLU GLU A . n 
A 1 11  PRO 11  12  12  PRO PRO A . n 
A 1 12  GLY 12  13  13  GLY GLY A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  VAL 14  15  15  VAL VAL A . n 
A 1 15  ILE 15  16  16  ILE ILE A . n 
A 1 16  THR 16  17  17  THR THR A . n 
A 1 17  GLN 17  18  18  GLN GLN A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  SER 19  20  20  SER SER A . n 
A 1 20  PRO 20  21  21  PRO PRO A . n 
A 1 21  VAL 21  22  22  VAL VAL A . n 
A 1 22  THR 22  23  23  THR THR A . n 
A 1 23  LEU 23  24  24  LEU LEU A . n 
A 1 24  ARG 24  25  25  ARG ARG A . n 
A 1 25  CYS 25  26  26  CYS CYS A . n 
A 1 26  GLN 26  27  27  GLN GLN A . n 
A 1 27  GLY 27  28  28  GLY GLY A . n 
A 1 28  GLY 28  29  ?   ?   ?   A . n 
A 1 29  GLN 29  30  ?   ?   ?   A . n 
A 1 30  GLU 30  31  ?   ?   ?   A . n 
A 1 31  THR 31  32  32  THR THR A . n 
A 1 32  GLN 32  33  33  GLN GLN A . n 
A 1 33  GLU 33  34  34  GLU GLU A . n 
A 1 34  TYR 34  35  35  TYR TYR A . n 
A 1 35  ARG 35  36  36  ARG ARG A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  TYR 37  38  38  TYR TYR A . n 
A 1 38  ARG 38  39  39  ARG ARG A . n 
A 1 39  GLU 39  40  40  GLU GLU A . n 
A 1 40  LYS 40  41  41  LYS LYS A . n 
A 1 41  LYS 41  42  42  LYS LYS A . n 
A 1 42  THR 42  43  43  THR THR A . n 
A 1 43  ALA 43  44  44  ALA ALA A . n 
A 1 44  PRO 44  45  45  PRO PRO A . n 
A 1 45  TRP 45  46  46  TRP TRP A . n 
A 1 46  ILE 46  47  47  ILE ILE A . n 
A 1 47  THR 47  48  48  THR THR A . n 
A 1 48  ARG 48  49  49  ARG ARG A . n 
A 1 49  ILE 49  50  50  ILE ILE A . n 
A 1 50  PRO 50  51  51  PRO PRO A . n 
A 1 51  GLN 51  52  52  GLN GLN A . n 
A 1 52  GLU 52  53  53  GLU GLU A . n 
A 1 53  LEU 53  54  54  LEU LEU A . n 
A 1 54  VAL 54  55  55  VAL VAL A . n 
A 1 55  LYS 55  56  56  LYS LYS A . n 
A 1 56  LYS 56  57  57  LYS LYS A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  GLN 58  59  59  GLN GLN A . n 
A 1 59  PHE 59  60  60  PHE PHE A . n 
A 1 60  PRO 60  61  61  PRO PRO A . n 
A 1 61  ILE 61  62  62  ILE ILE A . n 
A 1 62  PRO 62  63  63  PRO PRO A . n 
A 1 63  SER 63  64  64  SER SER A . n 
A 1 64  ILE 64  65  65  ILE ILE A . n 
A 1 65  THR 65  66  66  THR THR A . n 
A 1 66  TRP 66  67  67  TRP TRP A . n 
A 1 67  GLU 67  68  68  GLU GLU A . n 
A 1 68  HIS 68  69  69  HIS HIS A . n 
A 1 69  ALA 69  70  70  ALA ALA A . n 
A 1 70  GLY 70  71  71  GLY GLY A . n 
A 1 71  ARG 71  72  72  ARG ARG A . n 
A 1 72  TYR 72  73  73  TYR TYR A . n 
A 1 73  ARG 73  74  74  ARG ARG A . n 
A 1 74  CYS 74  75  75  CYS CYS A . n 
A 1 75  TYR 75  76  76  TYR TYR A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  GLY 77  78  78  GLY GLY A . n 
A 1 78  SER 78  79  79  SER SER A . n 
A 1 79  ASP 79  80  80  ASP ASP A . n 
A 1 80  THR 80  81  81  THR THR A . n 
A 1 81  ALA 81  82  82  ALA ALA A . n 
A 1 82  GLY 82  83  83  GLY GLY A . n 
A 1 83  ARG 83  84  84  ARG ARG A . n 
A 1 84  SER 84  85  85  SER SER A . n 
A 1 85  GLU 85  86  86  GLU GLU A . n 
A 1 86  SER 86  87  87  SER SER A . n 
A 1 87  SER 87  88  88  SER SER A . n 
A 1 88  ASP 88  89  89  ASP ASP A . n 
A 1 89  PRO 89  90  90  PRO PRO A . n 
A 1 90  LEU 90  91  91  LEU LEU A . n 
A 1 91  GLU 91  92  92  GLU GLU A . n 
A 1 92  LEU 92  93  93  LEU LEU A . n 
A 1 93  VAL 93  94  94  VAL VAL A . n 
A 1 94  VAL 94  95  95  VAL VAL A . n 
A 1 95  THR 95  96  96  THR THR A . n 
A 1 96  GLY 96  97  97  GLY GLY A . n 
A 1 97  ALA 97  98  98  ALA ALA A . n 
A 1 98  TYR 98  99  99  TYR TYR A . n 
A 1 99  ILE 99  100 100 ILE ILE A . n 
A 1 100 LYS 100 101 101 LYS LYS A . n 
A 1 101 PRO 101 102 102 PRO PRO A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 LEU 103 104 104 LEU LEU A . n 
A 1 104 SER 104 105 105 SER SER A . n 
A 1 105 ALA 105 106 106 ALA ALA A . n 
A 1 106 GLN 106 107 107 GLN GLN A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 SER 108 109 109 SER SER A . n 
A 1 109 PRO 109 110 110 PRO PRO A . n 
A 1 110 VAL 110 111 111 VAL VAL A . n 
A 1 111 VAL 111 112 112 VAL VAL A . n 
A 1 112 ASN 112 113 113 ASN ASN A . n 
A 1 113 SER 113 114 114 SER SER A . n 
A 1 114 GLY 114 115 115 GLY GLY A . n 
A 1 115 GLY 115 116 116 GLY GLY A . n 
A 1 116 ASN 116 117 117 ASN ASN A . n 
A 1 117 VAL 117 118 118 VAL VAL A . n 
A 1 118 THR 118 119 119 THR THR A . n 
A 1 119 LEU 119 120 120 LEU LEU A . n 
A 1 120 GLN 120 121 121 GLN GLN A . n 
A 1 121 CYS 121 122 122 CYS CYS A . n 
A 1 122 ASP 122 123 123 ASP ASP A . n 
A 1 123 SER 123 124 124 SER SER A . n 
A 1 124 GLN 124 125 125 GLN GLN A . n 
A 1 125 VAL 125 126 126 VAL VAL A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 PHE 127 128 128 PHE PHE A . n 
A 1 128 ASP 128 129 129 ASP ASP A . n 
A 1 129 GLY 129 130 130 GLY GLY A . n 
A 1 130 PHE 130 131 131 PHE PHE A . n 
A 1 131 ILE 131 132 132 ILE ILE A . n 
A 1 132 LEU 132 133 133 LEU LEU A . n 
A 1 133 CYS 133 134 134 CYS CYS A . n 
A 1 134 LYS 134 135 135 LYS LYS A . n 
A 1 135 GLU 135 136 136 GLU GLU A . n 
A 1 136 GLY 136 137 ?   ?   ?   A . n 
A 1 137 GLU 137 138 ?   ?   ?   A . n 
A 1 138 ASP 138 139 ?   ?   ?   A . n 
A 1 139 GLU 139 140 ?   ?   ?   A . n 
A 1 140 HIS 140 141 ?   ?   ?   A . n 
A 1 141 PRO 141 142 ?   ?   ?   A . n 
A 1 142 GLN 142 143 ?   ?   ?   A . n 
A 1 143 CYS 143 144 144 CYS CYS A . n 
A 1 144 LEU 144 145 145 LEU LEU A . n 
A 1 145 ASN 145 146 146 ASN ASN A . n 
A 1 146 SER 146 147 147 SER SER A . n 
A 1 147 GLN 147 148 ?   ?   ?   A . n 
A 1 148 PRO 148 149 ?   ?   ?   A . n 
A 1 149 HIS 149 150 ?   ?   ?   A . n 
A 1 150 ALA 150 151 ?   ?   ?   A . n 
A 1 151 ARG 151 152 ?   ?   ?   A . n 
A 1 152 GLY 152 153 ?   ?   ?   A . n 
A 1 153 SER 153 154 154 SER SER A . n 
A 1 154 SER 154 155 155 SER SER A . n 
A 1 155 ARG 155 156 156 ARG ARG A . n 
A 1 156 ALA 156 157 157 ALA ALA A . n 
A 1 157 ILE 157 158 158 ILE ILE A . n 
A 1 158 PHE 158 159 159 PHE PHE A . n 
A 1 159 SER 159 160 160 SER SER A . n 
A 1 160 VAL 160 161 161 VAL VAL A . n 
A 1 161 GLY 161 162 ?   ?   ?   A . n 
A 1 162 PRO 162 163 ?   ?   ?   A . n 
A 1 163 VAL 163 164 164 VAL VAL A . n 
A 1 164 SER 164 165 ?   ?   ?   A . n 
A 1 165 PRO 165 166 ?   ?   ?   A . n 
A 1 166 SER 166 167 ?   ?   ?   A . n 
A 1 167 ARG 167 168 ?   ?   ?   A . n 
A 1 168 ARG 168 169 ?   ?   ?   A . n 
A 1 169 TRP 169 170 170 TRP TRP A . n 
A 1 170 TRP 170 171 171 TRP TRP A . n 
A 1 171 TYR 171 172 172 TYR TYR A . n 
A 1 172 ARG 172 173 173 ARG ARG A . n 
A 1 173 CYS 173 174 174 CYS CYS A . n 
A 1 174 TYR 174 175 175 TYR TYR A . n 
A 1 175 ALA 175 176 176 ALA ALA A . n 
A 1 176 TYR 176 177 177 TYR TYR A . n 
A 1 177 ASP 177 178 178 ASP ASP A . n 
A 1 178 SER 178 179 179 SER SER A . n 
A 1 179 ASN 179 180 180 ASN ASN A . n 
A 1 180 SER 180 181 181 SER SER A . n 
A 1 181 PRO 181 182 182 PRO PRO A . n 
A 1 182 TYR 182 183 183 TYR TYR A . n 
A 1 183 GLU 183 184 184 GLU GLU A . n 
A 1 184 TRP 184 185 185 TRP TRP A . n 
A 1 185 SER 185 186 186 SER SER A . n 
A 1 186 LEU 186 187 187 LEU LEU A . n 
A 1 187 PRO 187 188 188 PRO PRO A . n 
A 1 188 SER 188 189 189 SER SER A . n 
A 1 189 ASP 189 190 190 ASP ASP A . n 
A 1 190 LEU 190 191 191 LEU LEU A . n 
A 1 191 LEU 191 192 192 LEU LEU A . n 
A 1 192 GLU 192 193 193 GLU GLU A . n 
A 1 193 LEU 193 194 194 LEU LEU A . n 
A 1 194 LEU 194 195 195 LEU LEU A . n 
A 1 195 VAL 195 196 ?   ?   ?   A . n 
A 1 196 LEU 196 197 ?   ?   ?   A . n 
A 1 197 GLY 197 198 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .   ? 1 
SCALEPACK 'data scaling'    .   ? 2 
CNS       refinement        .   ? 3 
HKL-2000  'data reduction'  .   ? 4 
CNS       phasing           1.1 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 3   ? ? -179.93 -85.63  
2 1 GLN A 33  ? ? -145.90 -36.77  
3 1 LYS A 41  ? ? 47.41   -29.10  
4 1 TYR A 99  ? ? -131.38 -117.05 
5 1 SER A 181 ? ? -158.71 56.50   
6 1 SER A 186 ? ? -76.45  -162.11 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 29  ? A GLY 28  
2  1 Y 1 A GLN 30  ? A GLN 29  
3  1 Y 1 A GLU 31  ? A GLU 30  
4  1 Y 1 A GLY 137 ? A GLY 136 
5  1 Y 1 A GLU 138 ? A GLU 137 
6  1 Y 1 A ASP 139 ? A ASP 138 
7  1 Y 1 A GLU 140 ? A GLU 139 
8  1 Y 1 A HIS 141 ? A HIS 140 
9  1 Y 1 A PRO 142 ? A PRO 141 
10 1 Y 1 A GLN 143 ? A GLN 142 
11 1 Y 1 A GLN 148 ? A GLN 147 
12 1 Y 1 A PRO 149 ? A PRO 148 
13 1 Y 1 A HIS 150 ? A HIS 149 
14 1 Y 1 A ALA 151 ? A ALA 150 
15 1 Y 1 A ARG 152 ? A ARG 151 
16 1 Y 1 A GLY 153 ? A GLY 152 
17 1 Y 1 A GLY 162 ? A GLY 161 
18 1 Y 1 A PRO 163 ? A PRO 162 
19 1 Y 1 A SER 165 ? A SER 164 
20 1 Y 1 A PRO 166 ? A PRO 165 
21 1 Y 1 A SER 167 ? A SER 166 
22 1 Y 1 A ARG 168 ? A ARG 167 
23 1 Y 1 A ARG 169 ? A ARG 168 
24 1 Y 1 A VAL 196 ? A VAL 195 
25 1 Y 1 A LEU 197 ? A LEU 196 
26 1 Y 1 A GLY 198 ? A GLY 197 
#