data_1V6G
# 
_entry.id   1V6G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1V6G         
RCSB  RCSB006265   
WWPDB D_1000006265 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002001776.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1V6G 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-29 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Miyamoto, K.'                                           1 
'Tomizawa, T.'                                           2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of the LIM Domain of the Human Actin Binding LIM Protein 2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Miyamoto, K.' 1 
primary 'Tomizawa, T.' 2 
primary 'Koshiba, S.'  3 
primary 'Inoue, M.'    4 
primary 'Kigawa, T.'   5 
primary 'Yokoyama, S.' 6 
# 
_cell.entry_id           1V6G 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1V6G 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Actin Binding LIM Protein 2' 8629.779 1 ? ? 'LIM Domain' ? 
2 non-polymer syn 'ZINC ION'                    65.409   2 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'KIAA1808 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSVSGPSS
G
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSVSGPSS
G
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002001776.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  LEU n 
1 9  ASP n 
1 10 TYR n 
1 11 GLN n 
1 12 ARG n 
1 13 LEU n 
1 14 TYR n 
1 15 GLY n 
1 16 THR n 
1 17 ARG n 
1 18 CYS n 
1 19 PHE n 
1 20 SER n 
1 21 CYS n 
1 22 ASP n 
1 23 GLN n 
1 24 PHE n 
1 25 ILE n 
1 26 GLU n 
1 27 GLY n 
1 28 GLU n 
1 29 VAL n 
1 30 VAL n 
1 31 SER n 
1 32 ALA n 
1 33 LEU n 
1 34 GLY n 
1 35 LYS n 
1 36 THR n 
1 37 TYR n 
1 38 HIS n 
1 39 PRO n 
1 40 ASP n 
1 41 CYS n 
1 42 PHE n 
1 43 VAL n 
1 44 CYS n 
1 45 ALA n 
1 46 VAL n 
1 47 CYS n 
1 48 ARG n 
1 49 LEU n 
1 50 PRO n 
1 51 PHE n 
1 52 PRO n 
1 53 PRO n 
1 54 GLY n 
1 55 ASP n 
1 56 ARG n 
1 57 VAL n 
1 58 THR n 
1 59 PHE n 
1 60 ASN n 
1 61 GLY n 
1 62 LYS n 
1 63 GLU n 
1 64 CYS n 
1 65 MET n 
1 66 CYS n 
1 67 GLN n 
1 68 LYS n 
1 69 CYS n 
1 70 SER n 
1 71 LEU n 
1 72 PRO n 
1 73 VAL n 
1 74 SER n 
1 75 VAL n 
1 76 SER n 
1 77 GLY n 
1 78 PRO n 
1 79 SER n 
1 80 SER n 
1 81 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'KAZUSA cDNA fk00917' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P020930-36 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ABLM2_HUMAN 
_struct_ref.pdbx_db_accession          Q6H8Q1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSV 
_struct_ref.pdbx_align_begin           40 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1V6G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 75 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q6H8Q1 
_struct_ref_seq.db_align_beg                  40 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  107 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       75 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1V6G GLY A 1  ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 1  1  
1 1V6G SER A 2  ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 2  2  
1 1V6G SER A 3  ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 3  3  
1 1V6G GLY A 4  ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 4  4  
1 1V6G SER A 5  ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 5  5  
1 1V6G SER A 6  ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 6  6  
1 1V6G GLY A 7  ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 7  7  
1 1V6G SER A 76 ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 76 8  
1 1V6G GLY A 77 ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 77 9  
1 1V6G PRO A 78 ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 78 10 
1 1V6G SER A 79 ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 79 11 
1 1V6G SER A 80 ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 80 12 
1 1V6G GLY A 81 ? UNP Q6H8Q1 ? ? 'CLONING ARTIFACT' 81 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.22mM LIM Domain U-13C,15N; 20mM d-Tris-HCl(pH 7.5); 100mM NaCl; 0.02% NaN3; 0.1mM ZnCl2; 90% H2O,10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           1V6G 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1V6G 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1V6G 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 2.6      collection           Bruker          1 
NMRPipe 20020425 processing           'Delaglio, F.'  2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
Kujira  0.863    'data analysis'      'Kobayashi, N.' 4 
CYANA   2.0.17   'structure solution' 'Guentert, P.'  5 
CYANA   2.0.17   refinement           'Guentert, P.'  6 
# 
_exptl.entry_id          1V6G 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1V6G 
_struct.title                     'Solution Structure of the LIM Domain of the Human Actin Binding LIM Protein 2' 
_struct.pdbx_descriptor           'Actin Binding LIM Protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1V6G 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
;LIM Domain, Zinc Binding Domain, Actin Binding LIM Protein 2, ABLIM2, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR A 10 ? ARG A 12 ? TYR A 10 ARG A 12 5 ? 3 
HELX_P HELX_P2 2 GLN A 67 ? SER A 70 ? GLN A 67 SER A 70 1 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 18 SG  ? ? A ZN 201 A CYS 18 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 21 SG  ? ? A ZN 201 A CYS 21 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 38 ND1 ? ? A ZN 201 A HIS 38 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 41 SG  ? ? A ZN 201 A CYS 41 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 44 SG  ? ? A ZN 401 A CYS 44 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 47 SG  ? ? A ZN 401 A CYS 47 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 66 SG  ? ? A ZN 401 A CYS 66 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 69 SG  ? ? A ZN 401 A CYS 69 1_555 ? ? ? ? ? ? ? 2.351 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 30 ? ALA A 32 ? VAL A 30 ALA A 32 
A 2 LYS A 35 ? TYR A 37 ? LYS A 35 TYR A 37 
B 1 VAL A 57 ? ASN A 60 ? VAL A 57 ASN A 60 
B 2 GLU A 63 ? CYS A 66 ? GLU A 63 CYS A 66 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 30 ? N VAL A 30 O TYR A 37 ? O TYR A 37 
B 1 2 N THR A 58 ? N THR A 58 O MET A 65 ? O MET A 65 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 
2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 
3 AC1 4 HIS A 38 ? HIS A 38 . ? 1_555 ? 
4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 
5 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
6 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 
7 AC2 4 CYS A 66 ? CYS A 66 . ? 1_555 ? 
8 AC2 4 CYS A 69 ? CYS A 69 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1V6G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1V6G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? -16.370 -21.429 4.540   1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? -16.194 -21.716 3.128   1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? -17.152 -20.931 2.253   1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? -17.922 -20.108 2.748   1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? -17.068 -20.804 4.828   1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? -15.181 -21.470 2.846   1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? -16.357 -22.771 2.964   1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? -17.103 -21.185 0.949   1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? -17.969 -20.492 0.003   1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? -18.773 -21.488 -0.828  1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? -18.314 -21.957 -1.869  1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? -17.139 -19.595 -0.918  1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? -17.888 -18.470 -1.344  1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? -16.467 -21.852 0.616   1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? -18.654 -19.878 0.569   1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? -16.265 -19.249 -0.387  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? -16.834 -20.160 -1.786  1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? -17.323 -17.883 -1.852  1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? -19.975 -21.806 -0.359  1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? -20.842 -22.748 -1.055  1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? -22.311 -22.416 -0.813  1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? -22.810 -22.534 0.305   1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? -20.549 -24.178 -0.597  1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? -21.464 -25.096 -1.171  1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? -20.285 -21.398 0.477   1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? -20.637 -22.669 -2.112  1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? -19.549 -24.452 -0.896  1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? -20.631 -24.232 0.480   1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? -21.738 -25.733 -0.507  1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? -23.000 -21.999 -1.872  1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? -24.405 -21.655 -1.755  1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? -24.634 -20.157 -1.716  1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? -25.460 -19.669 -0.945  1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? -22.549 -21.924 -2.739  1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? -24.937 -22.068 -2.599  1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? -24.796 -22.091 -0.847  1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? -23.899 -19.426 -2.547  1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? -24.022 -17.974 -2.600  1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? -25.096 -17.556 -3.600  1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -24.929 -17.712 -4.809  1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? -22.682 -17.341 -2.980  1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? -21.661 -17.728 -2.077  1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? -23.256 -19.874 -3.137  1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? -24.307 -17.629 -1.617  1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? -22.406 -17.658 -3.974  1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? -22.776 -16.265 -2.958  1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? -21.816 -18.629 -1.785  1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -26.200 -17.024 -3.084  1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -27.304 -16.586 -3.930  1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -27.009 -15.223 -4.547  1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -27.121 -15.040 -5.759  1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -28.600 -16.522 -3.120  1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -29.698 -16.164 -3.942  1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? -26.274 -16.925 -2.112  1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -27.421 -17.310 -4.723  1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -28.795 -17.488 -2.680  1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -28.496 -15.784 -2.337  1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -29.936 -15.249 -3.778  1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -26.630 -14.267 -3.703  1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -26.325 -12.932 -4.183  1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -24.986 -12.428 -3.681  1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -24.187 -13.196 -3.142  1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -26.558 -14.471 -2.747  1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -26.312 -12.943 -5.263  1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -27.098 -12.256 -3.849  1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . LEU A 1 8  ? -24.737 -11.136 -3.860  1.00 0.00 ? 8   LEU A N    1  
ATOM   67    C  CA   . LEU A 1 8  ? -23.484 -10.530 -3.423  1.00 0.00 ? 8   LEU A CA   1  
ATOM   68    C  C    . LEU A 1 8  ? -23.746 -9.336  -2.510  1.00 0.00 ? 8   LEU A C    1  
ATOM   69    O  O    . LEU A 1 8  ? -23.288 -8.225  -2.778  1.00 0.00 ? 8   LEU A O    1  
ATOM   70    C  CB   . LEU A 1 8  ? -22.658 -10.090 -4.633  1.00 0.00 ? 8   LEU A CB   1  
ATOM   71    C  CG   . LEU A 1 8  ? -22.049 -11.213 -5.473  1.00 0.00 ? 8   LEU A CG   1  
ATOM   72    C  CD1  . LEU A 1 8  ? -21.778 -10.732 -6.890  1.00 0.00 ? 8   LEU A CD1  1  
ATOM   73    C  CD2  . LEU A 1 8  ? -20.770 -11.727 -4.829  1.00 0.00 ? 8   LEU A CD2  1  
ATOM   74    H  H    . LEU A 1 8  ? -25.412 -10.574 -4.296  1.00 0.00 ? 8   LEU A H    1  
ATOM   75    H  HA   . LEU A 1 8  ? -22.931 -11.275 -2.871  1.00 0.00 ? 8   LEU A HA   1  
ATOM   76    H  HB2  . LEU A 1 8  ? -23.299 -9.506  -5.276  1.00 0.00 ? 8   LEU A HB2  1  
ATOM   77    H  HB3  . LEU A 1 8  ? -21.850 -9.469  -4.272  1.00 0.00 ? 8   LEU A HB3  1  
ATOM   78    H  HG   . LEU A 1 8  ? -22.750 -12.034 -5.528  1.00 0.00 ? 8   LEU A HG   1  
ATOM   79    H  HD11 . LEU A 1 8  ? -20.861 -11.172 -7.251  1.00 0.00 ? 8   LEU A HD11 1  
ATOM   80    H  HD12 . LEU A 1 8  ? -21.687 -9.656  -6.894  1.00 0.00 ? 8   LEU A HD12 1  
ATOM   81    H  HD13 . LEU A 1 8  ? -22.596 -11.026 -7.532  1.00 0.00 ? 8   LEU A HD13 1  
ATOM   82    H  HD21 . LEU A 1 8  ? -20.280 -10.918 -4.307  1.00 0.00 ? 8   LEU A HD21 1  
ATOM   83    H  HD22 . LEU A 1 8  ? -20.111 -12.112 -5.594  1.00 0.00 ? 8   LEU A HD22 1  
ATOM   84    H  HD23 . LEU A 1 8  ? -21.010 -12.514 -4.130  1.00 0.00 ? 8   LEU A HD23 1  
ATOM   85    N  N    . ASP A 1 9  ? -24.483 -9.573  -1.431  1.00 0.00 ? 9   ASP A N    1  
ATOM   86    C  CA   . ASP A 1 9  ? -24.803 -8.518  -0.476  1.00 0.00 ? 9   ASP A CA   1  
ATOM   87    C  C    . ASP A 1 9  ? -23.803 -8.507  0.676   1.00 0.00 ? 9   ASP A C    1  
ATOM   88    O  O    . ASP A 1 9  ? -23.439 -7.446  1.184   1.00 0.00 ? 9   ASP A O    1  
ATOM   89    C  CB   . ASP A 1 9  ? -26.222 -8.704  0.065   1.00 0.00 ? 9   ASP A CB   1  
ATOM   90    C  CG   . ASP A 1 9  ? -26.414 -10.049 0.736   1.00 0.00 ? 9   ASP A CG   1  
ATOM   91    O  OD1  . ASP A 1 9  ? -26.578 -11.055 0.014   1.00 0.00 ? 9   ASP A OD1  1  
ATOM   92    O  OD2  . ASP A 1 9  ? -26.400 -10.097 1.984   1.00 0.00 ? 9   ASP A OD2  1  
ATOM   93    H  H    . ASP A 1 9  ? -24.820 -10.480 -1.272  1.00 0.00 ? 9   ASP A H    1  
ATOM   94    H  HA   . ASP A 1 9  ? -24.746 -7.573  -0.995  1.00 0.00 ? 9   ASP A HA   1  
ATOM   95    H  HB2  . ASP A 1 9  ? -26.428 -7.928  0.788   1.00 0.00 ? 9   ASP A HB2  1  
ATOM   96    H  HB3  . ASP A 1 9  ? -26.924 -8.625  -0.752  1.00 0.00 ? 9   ASP A HB3  1  
ATOM   97    N  N    . TYR A 1 10 ? -23.365 -9.692  1.084   1.00 0.00 ? 10  TYR A N    1  
ATOM   98    C  CA   . TYR A 1 10 ? -22.410 -9.819  2.179   1.00 0.00 ? 10  TYR A CA   1  
ATOM   99    C  C    . TYR A 1 10 ? -21.298 -8.782  2.054   1.00 0.00 ? 10  TYR A C    1  
ATOM   100   O  O    . TYR A 1 10 ? -20.818 -8.249  3.054   1.00 0.00 ? 10  TYR A O    1  
ATOM   101   C  CB   . TYR A 1 10 ? -21.811 -11.226 2.200   1.00 0.00 ? 10  TYR A CB   1  
ATOM   102   C  CG   . TYR A 1 10 ? -20.856 -11.495 1.059   1.00 0.00 ? 10  TYR A CG   1  
ATOM   103   C  CD1  . TYR A 1 10 ? -21.198 -11.175 -0.249  1.00 0.00 ? 10  TYR A CD1  1  
ATOM   104   C  CD2  . TYR A 1 10 ? -19.612 -12.068 1.290   1.00 0.00 ? 10  TYR A CD2  1  
ATOM   105   C  CE1  . TYR A 1 10 ? -20.329 -11.420 -1.294  1.00 0.00 ? 10  TYR A CE1  1  
ATOM   106   C  CE2  . TYR A 1 10 ? -18.735 -12.315 0.251   1.00 0.00 ? 10  TYR A CE2  1  
ATOM   107   C  CZ   . TYR A 1 10 ? -19.099 -11.990 -1.039  1.00 0.00 ? 10  TYR A CZ   1  
ATOM   108   O  OH   . TYR A 1 10 ? -18.230 -12.234 -2.078  1.00 0.00 ? 10  TYR A OH   1  
ATOM   109   H  H    . TYR A 1 10 ? -23.693 -10.502 0.640   1.00 0.00 ? 10  TYR A H    1  
ATOM   110   H  HA   . TYR A 1 10 ? -22.942 -9.650  3.104   1.00 0.00 ? 10  TYR A HA   1  
ATOM   111   H  HB2  . TYR A 1 10 ? -21.271 -11.366 3.124   1.00 0.00 ? 10  TYR A HB2  1  
ATOM   112   H  HB3  . TYR A 1 10 ? -22.610 -11.951 2.143   1.00 0.00 ? 10  TYR A HB3  1  
ATOM   113   H  HD1  . TYR A 1 10 ? -22.162 -10.729 -0.445  1.00 0.00 ? 10  TYR A HD1  1  
ATOM   114   H  HD2  . TYR A 1 10 ? -19.330 -12.322 2.302   1.00 0.00 ? 10  TYR A HD2  1  
ATOM   115   H  HE1  . TYR A 1 10 ? -20.613 -11.165 -2.304  1.00 0.00 ? 10  TYR A HE1  1  
ATOM   116   H  HE2  . TYR A 1 10 ? -17.772 -12.762 0.450   1.00 0.00 ? 10  TYR A HE2  1  
ATOM   117   H  HH   . TYR A 1 10 ? -17.568 -12.872 -1.798  1.00 0.00 ? 10  TYR A HH   1  
ATOM   118   N  N    . GLN A 1 11 ? -20.895 -8.502  0.819   1.00 0.00 ? 11  GLN A N    1  
ATOM   119   C  CA   . GLN A 1 11 ? -19.839 -7.529  0.563   1.00 0.00 ? 11  GLN A CA   1  
ATOM   120   C  C    . GLN A 1 11 ? -20.112 -6.223  1.301   1.00 0.00 ? 11  GLN A C    1  
ATOM   121   O  O    . GLN A 1 11 ? -19.196 -5.595  1.832   1.00 0.00 ? 11  GLN A O    1  
ATOM   122   C  CB   . GLN A 1 11 ? -19.714 -7.264  -0.938  1.00 0.00 ? 11  GLN A CB   1  
ATOM   123   C  CG   . GLN A 1 11 ? -20.828 -6.393  -1.497  1.00 0.00 ? 11  GLN A CG   1  
ATOM   124   C  CD   . GLN A 1 11 ? -20.688 -6.152  -2.987  1.00 0.00 ? 11  GLN A CD   1  
ATOM   125   O  OE1  . GLN A 1 11 ? -21.571 -6.501  -3.770  1.00 0.00 ? 11  GLN A OE1  1  
ATOM   126   N  NE2  . GLN A 1 11 ? -19.573 -5.552  -3.388  1.00 0.00 ? 11  GLN A NE2  1  
ATOM   127   H  H    . GLN A 1 11 ? -21.316 -8.960  0.063   1.00 0.00 ? 11  GLN A H    1  
ATOM   128   H  HA   . GLN A 1 11 ? -18.911 -7.945  0.924   1.00 0.00 ? 11  GLN A HA   1  
ATOM   129   H  HB2  . GLN A 1 11 ? -18.772 -6.773  -1.128  1.00 0.00 ? 11  GLN A HB2  1  
ATOM   130   H  HB3  . GLN A 1 11 ? -19.730 -8.209  -1.461  1.00 0.00 ? 11  GLN A HB3  1  
ATOM   131   H  HG2  . GLN A 1 11 ? -21.774 -6.880  -1.315  1.00 0.00 ? 11  GLN A HG2  1  
ATOM   132   H  HG3  . GLN A 1 11 ? -20.811 -5.440  -0.990  1.00 0.00 ? 11  GLN A HG3  1  
ATOM   133   H  HE21 . GLN A 1 11 ? -18.912 -5.303  -2.708  1.00 0.00 ? 11  GLN A HE21 1  
ATOM   134   H  HE22 . GLN A 1 11 ? -19.456 -5.384  -4.345  1.00 0.00 ? 11  GLN A HE22 1  
ATOM   135   N  N    . ARG A 1 12 ? -21.378 -5.818  1.330   1.00 0.00 ? 12  ARG A N    1  
ATOM   136   C  CA   . ARG A 1 12 ? -21.771 -4.585  2.001   1.00 0.00 ? 12  ARG A CA   1  
ATOM   137   C  C    . ARG A 1 12 ? -20.862 -4.302  3.193   1.00 0.00 ? 12  ARG A C    1  
ATOM   138   O  O    . ARG A 1 12 ? -20.506 -3.152  3.456   1.00 0.00 ? 12  ARG A O    1  
ATOM   139   C  CB   . ARG A 1 12 ? -23.226 -4.674  2.465   1.00 0.00 ? 12  ARG A CB   1  
ATOM   140   C  CG   . ARG A 1 12 ? -24.235 -4.358  1.373   1.00 0.00 ? 12  ARG A CG   1  
ATOM   141   C  CD   . ARG A 1 12 ? -24.272 -2.869  1.064   1.00 0.00 ? 12  ARG A CD   1  
ATOM   142   N  NE   . ARG A 1 12 ? -24.981 -2.586  -0.181  1.00 0.00 ? 12  ARG A NE   1  
ATOM   143   C  CZ   . ARG A 1 12 ? -24.425 -2.691  -1.383  1.00 0.00 ? 12  ARG A CZ   1  
ATOM   144   N  NH1  . ARG A 1 12 ? -23.160 -3.071  -1.501  1.00 0.00 ? 12  ARG A NH1  1  
ATOM   145   N  NH2  . ARG A 1 12 ? -25.134 -2.417  -2.470  1.00 0.00 ? 12  ARG A NH2  1  
ATOM   146   H  H    . ARG A 1 12 ? -22.064 -6.362  0.888   1.00 0.00 ? 12  ARG A H    1  
ATOM   147   H  HA   . ARG A 1 12 ? -21.678 -3.777  1.291   1.00 0.00 ? 12  ARG A HA   1  
ATOM   148   H  HB2  . ARG A 1 12 ? -23.418 -5.676  2.822   1.00 0.00 ? 12  ARG A HB2  1  
ATOM   149   H  HB3  . ARG A 1 12 ? -23.375 -3.977  3.276   1.00 0.00 ? 12  ARG A HB3  1  
ATOM   150   H  HG2  . ARG A 1 12 ? -23.960 -4.893  0.476   1.00 0.00 ? 12  ARG A HG2  1  
ATOM   151   H  HG3  . ARG A 1 12 ? -25.215 -4.674  1.699   1.00 0.00 ? 12  ARG A HG3  1  
ATOM   152   H  HD2  . ARG A 1 12 ? -24.771 -2.359  1.875   1.00 0.00 ? 12  ARG A HD2  1  
ATOM   153   H  HD3  . ARG A 1 12 ? -23.258 -2.507  0.982   1.00 0.00 ? 12  ARG A HD3  1  
ATOM   154   H  HE   . ARG A 1 12 ? -25.916 -2.304  -0.117  1.00 0.00 ? 12  ARG A HE   1  
ATOM   155   H  HH11 . ARG A 1 12 ? -22.623 -3.280  -0.684  1.00 0.00 ? 12  ARG A HH11 1  
ATOM   156   H  HH12 . ARG A 1 12 ? -22.744 -3.151  -2.407  1.00 0.00 ? 12  ARG A HH12 1  
ATOM   157   H  HH21 . ARG A 1 12 ? -26.088 -2.130  -2.385  1.00 0.00 ? 12  ARG A HH21 1  
ATOM   158   H  HH22 . ARG A 1 12 ? -24.715 -2.496  -3.374  1.00 0.00 ? 12  ARG A HH22 1  
ATOM   159   N  N    . LEU A 1 13 ? -20.490 -5.356  3.910   1.00 0.00 ? 13  LEU A N    1  
ATOM   160   C  CA   . LEU A 1 13 ? -19.622 -5.220  5.075   1.00 0.00 ? 13  LEU A CA   1  
ATOM   161   C  C    . LEU A 1 13 ? -18.535 -4.179  4.827   1.00 0.00 ? 13  LEU A C    1  
ATOM   162   O  O    . LEU A 1 13 ? -18.223 -3.854  3.681   1.00 0.00 ? 13  LEU A O    1  
ATOM   163   C  CB   . LEU A 1 13 ? -18.984 -6.568  5.420   1.00 0.00 ? 13  LEU A CB   1  
ATOM   164   C  CG   . LEU A 1 13 ? -18.365 -7.335  4.252   1.00 0.00 ? 13  LEU A CG   1  
ATOM   165   C  CD1  . LEU A 1 13 ? -16.945 -6.858  3.992   1.00 0.00 ? 13  LEU A CD1  1  
ATOM   166   C  CD2  . LEU A 1 13 ? -18.384 -8.832  4.527   1.00 0.00 ? 13  LEU A CD2  1  
ATOM   167   H  H    . LEU A 1 13 ? -20.805 -6.246  3.652   1.00 0.00 ? 13  LEU A H    1  
ATOM   168   H  HA   . LEU A 1 13 ? -20.231 -4.897  5.906   1.00 0.00 ? 13  LEU A HA   1  
ATOM   169   H  HB2  . LEU A 1 13 ? -18.207 -6.389  6.147   1.00 0.00 ? 13  LEU A HB2  1  
ATOM   170   H  HB3  . LEU A 1 13 ? -19.749 -7.192  5.859   1.00 0.00 ? 13  LEU A HB3  1  
ATOM   171   H  HG   . LEU A 1 13 ? -18.947 -7.151  3.359   1.00 0.00 ? 13  LEU A HG   1  
ATOM   172   H  HD11 . LEU A 1 13 ? -16.945 -6.157  3.171   1.00 0.00 ? 13  LEU A HD11 1  
ATOM   173   H  HD12 . LEU A 1 13 ? -16.320 -7.703  3.743   1.00 0.00 ? 13  LEU A HD12 1  
ATOM   174   H  HD13 . LEU A 1 13 ? -16.560 -6.375  4.879   1.00 0.00 ? 13  LEU A HD13 1  
ATOM   175   H  HD21 . LEU A 1 13 ? -18.959 -9.331  3.760   1.00 0.00 ? 13  LEU A HD21 1  
ATOM   176   H  HD22 . LEU A 1 13 ? -18.837 -9.015  5.491   1.00 0.00 ? 13  LEU A HD22 1  
ATOM   177   H  HD23 . LEU A 1 13 ? -17.374 -9.211  4.525   1.00 0.00 ? 13  LEU A HD23 1  
ATOM   178   N  N    . TYR A 1 14 ? -17.961 -3.662  5.907   1.00 0.00 ? 14  TYR A N    1  
ATOM   179   C  CA   . TYR A 1 14 ? -16.909 -2.657  5.807   1.00 0.00 ? 14  TYR A CA   1  
ATOM   180   C  C    . TYR A 1 14 ? -16.045 -2.895  4.572   1.00 0.00 ? 14  TYR A C    1  
ATOM   181   O  O    . TYR A 1 14 ? -15.909 -2.020  3.718   1.00 0.00 ? 14  TYR A O    1  
ATOM   182   C  CB   . TYR A 1 14 ? -16.038 -2.673  7.064   1.00 0.00 ? 14  TYR A CB   1  
ATOM   183   C  CG   . TYR A 1 14 ? -15.443 -4.029  7.371   1.00 0.00 ? 14  TYR A CG   1  
ATOM   184   C  CD1  . TYR A 1 14 ? -16.217 -5.038  7.930   1.00 0.00 ? 14  TYR A CD1  1  
ATOM   185   C  CD2  . TYR A 1 14 ? -14.107 -4.301  7.102   1.00 0.00 ? 14  TYR A CD2  1  
ATOM   186   C  CE1  . TYR A 1 14 ? -15.678 -6.278  8.213   1.00 0.00 ? 14  TYR A CE1  1  
ATOM   187   C  CE2  . TYR A 1 14 ? -13.560 -5.539  7.380   1.00 0.00 ? 14  TYR A CE2  1  
ATOM   188   C  CZ   . TYR A 1 14 ? -14.350 -6.524  7.936   1.00 0.00 ? 14  TYR A CZ   1  
ATOM   189   O  OH   . TYR A 1 14 ? -13.808 -7.758  8.216   1.00 0.00 ? 14  TYR A OH   1  
ATOM   190   H  H    . TYR A 1 14 ? -18.253 -3.961  6.794   1.00 0.00 ? 14  TYR A H    1  
ATOM   191   H  HA   . TYR A 1 14 ? -17.382 -1.690  5.721   1.00 0.00 ? 14  TYR A HA   1  
ATOM   192   H  HB2  . TYR A 1 14 ? -15.224 -1.976  6.938   1.00 0.00 ? 14  TYR A HB2  1  
ATOM   193   H  HB3  . TYR A 1 14 ? -16.636 -2.373  7.912   1.00 0.00 ? 14  TYR A HB3  1  
ATOM   194   H  HD1  . TYR A 1 14 ? -17.258 -4.843  8.146   1.00 0.00 ? 14  TYR A HD1  1  
ATOM   195   H  HD2  . TYR A 1 14 ? -13.492 -3.527  6.667   1.00 0.00 ? 14  TYR A HD2  1  
ATOM   196   H  HE1  . TYR A 1 14 ? -16.296 -7.051  8.648   1.00 0.00 ? 14  TYR A HE1  1  
ATOM   197   H  HE2  . TYR A 1 14 ? -12.520 -5.731  7.164   1.00 0.00 ? 14  TYR A HE2  1  
ATOM   198   H  HH   . TYR A 1 14 ? -13.186 -7.998  7.525   1.00 0.00 ? 14  TYR A HH   1  
ATOM   199   N  N    . GLY A 1 15 ? -15.464 -4.087  4.485   1.00 0.00 ? 15  GLY A N    1  
ATOM   200   C  CA   . GLY A 1 15 ? -14.620 -4.421  3.352   1.00 0.00 ? 15  GLY A CA   1  
ATOM   201   C  C    . GLY A 1 15 ? -13.440 -3.480  3.211   1.00 0.00 ? 15  GLY A C    1  
ATOM   202   O  O    . GLY A 1 15 ? -13.614 -2.269  3.074   1.00 0.00 ? 15  GLY A O    1  
ATOM   203   H  H    . GLY A 1 15 ? -15.608 -4.746  5.197   1.00 0.00 ? 15  GLY A H    1  
ATOM   204   H  HA2  . GLY A 1 15 ? -14.252 -5.428  3.476   1.00 0.00 ? 15  GLY A HA2  1  
ATOM   205   H  HA3  . GLY A 1 15 ? -15.213 -4.373  2.451   1.00 0.00 ? 15  GLY A HA3  1  
ATOM   206   N  N    . THR A 1 16 ? -12.233 -4.037  3.247   1.00 0.00 ? 16  THR A N    1  
ATOM   207   C  CA   . THR A 1 16 ? -11.020 -3.239  3.125   1.00 0.00 ? 16  THR A CA   1  
ATOM   208   C  C    . THR A 1 16 ? -10.571 -3.140  1.671   1.00 0.00 ? 16  THR A C    1  
ATOM   209   O  O    . THR A 1 16 ? -10.214 -4.143  1.052   1.00 0.00 ? 16  THR A O    1  
ATOM   210   C  CB   . THR A 1 16 ? -9.872  -3.831  3.965   1.00 0.00 ? 16  THR A CB   1  
ATOM   211   O  OG1  . THR A 1 16 ? -10.201 -3.766  5.358   1.00 0.00 ? 16  THR A OG1  1  
ATOM   212   C  CG2  . THR A 1 16 ? -8.573  -3.081  3.711   1.00 0.00 ? 16  THR A CG2  1  
ATOM   213   H  H    . THR A 1 16 ? -12.159 -5.008  3.359   1.00 0.00 ? 16  THR A H    1  
ATOM   214   H  HA   . THR A 1 16 ? -11.234 -2.247  3.494   1.00 0.00 ? 16  THR A HA   1  
ATOM   215   H  HB   . THR A 1 16 ? -9.735  -4.865  3.683   1.00 0.00 ? 16  THR A HB   1  
ATOM   216   H  HG1  . THR A 1 16 ? -9.438  -4.027  5.879   1.00 0.00 ? 16  THR A HG1  1  
ATOM   217   H  HG21 . THR A 1 16 ? -8.652  -2.079  4.107   1.00 0.00 ? 16  THR A HG21 1  
ATOM   218   H  HG22 . THR A 1 16 ? -8.386  -3.035  2.649   1.00 0.00 ? 16  THR A HG22 1  
ATOM   219   H  HG23 . THR A 1 16 ? -7.759  -3.596  4.198   1.00 0.00 ? 16  THR A HG23 1  
ATOM   220   N  N    . ARG A 1 17 ? -10.590 -1.925  1.133   1.00 0.00 ? 17  ARG A N    1  
ATOM   221   C  CA   . ARG A 1 17 ? -10.185 -1.696  -0.249  1.00 0.00 ? 17  ARG A CA   1  
ATOM   222   C  C    . ARG A 1 17 ? -8.892  -0.887  -0.309  1.00 0.00 ? 17  ARG A C    1  
ATOM   223   O  O    . ARG A 1 17 ? -8.770  0.157   0.332   1.00 0.00 ? 17  ARG A O    1  
ATOM   224   C  CB   . ARG A 1 17 ? -11.292 -0.966  -1.013  1.00 0.00 ? 17  ARG A CB   1  
ATOM   225   C  CG   . ARG A 1 17 ? -11.333 -1.304  -2.494  1.00 0.00 ? 17  ARG A CG   1  
ATOM   226   C  CD   . ARG A 1 17 ? -12.188 -0.312  -3.267  1.00 0.00 ? 17  ARG A CD   1  
ATOM   227   N  NE   . ARG A 1 17 ? -13.616 -0.546  -3.066  1.00 0.00 ? 17  ARG A NE   1  
ATOM   228   C  CZ   . ARG A 1 17 ? -14.568 0.122   -3.708  1.00 0.00 ? 17  ARG A CZ   1  
ATOM   229   N  NH1  . ARG A 1 17 ? -14.246 1.061   -4.587  1.00 0.00 ? 17  ARG A NH1  1  
ATOM   230   N  NH2  . ARG A 1 17 ? -15.845 -0.148  -3.470  1.00 0.00 ? 17  ARG A NH2  1  
ATOM   231   H  H    . ARG A 1 17 ? -10.884 -1.165  1.677   1.00 0.00 ? 17  ARG A H    1  
ATOM   232   H  HA   . ARG A 1 17 ? -10.016 -2.658  -0.709  1.00 0.00 ? 17  ARG A HA   1  
ATOM   233   H  HB2  . ARG A 1 17 ? -12.246 -1.229  -0.579  1.00 0.00 ? 17  ARG A HB2  1  
ATOM   234   H  HB3  . ARG A 1 17 ? -11.140 0.098   -0.912  1.00 0.00 ? 17  ARG A HB3  1  
ATOM   235   H  HG2  . ARG A 1 17 ? -10.328 -1.279  -2.888  1.00 0.00 ? 17  ARG A HG2  1  
ATOM   236   H  HG3  . ARG A 1 17 ? -11.746 -2.294  -2.617  1.00 0.00 ? 17  ARG A HG3  1  
ATOM   237   H  HD2  . ARG A 1 17 ? -11.947 0.687   -2.935  1.00 0.00 ? 17  ARG A HD2  1  
ATOM   238   H  HD3  . ARG A 1 17 ? -11.962 -0.405  -4.319  1.00 0.00 ? 17  ARG A HD3  1  
ATOM   239   H  HE   . ARG A 1 17 ? -13.876 -1.235  -2.420  1.00 0.00 ? 17  ARG A HE   1  
ATOM   240   H  HH11 . ARG A 1 17 ? -13.284 1.266   -4.769  1.00 0.00 ? 17  ARG A HH11 1  
ATOM   241   H  HH12 . ARG A 1 17 ? -14.965 1.561   -5.070  1.00 0.00 ? 17  ARG A HH12 1  
ATOM   242   H  HH21 . ARG A 1 17 ? -16.091 -0.855  -2.808  1.00 0.00 ? 17  ARG A HH21 1  
ATOM   243   H  HH22 . ARG A 1 17 ? -16.561 0.355   -3.953  1.00 0.00 ? 17  ARG A HH22 1  
ATOM   244   N  N    . CYS A 1 18 ? -7.930  -1.377  -1.084  1.00 0.00 ? 18  CYS A N    1  
ATOM   245   C  CA   . CYS A 1 18 ? -6.646  -0.702  -1.228  1.00 0.00 ? 18  CYS A CA   1  
ATOM   246   C  C    . CYS A 1 18 ? -6.830  0.701   -1.798  1.00 0.00 ? 18  CYS A C    1  
ATOM   247   O  O    . CYS A 1 18 ? -7.517  0.890   -2.803  1.00 0.00 ? 18  CYS A O    1  
ATOM   248   C  CB   . CYS A 1 18 ? -5.718  -1.515  -2.133  1.00 0.00 ? 18  CYS A CB   1  
ATOM   249   S  SG   . CYS A 1 18 ? -4.056  -0.795  -2.333  1.00 0.00 ? 18  CYS A SG   1  
ATOM   250   H  H    . CYS A 1 18 ? -8.087  -2.214  -1.571  1.00 0.00 ? 18  CYS A H    1  
ATOM   251   H  HA   . CYS A 1 18 ? -6.200  -0.623  -0.248  1.00 0.00 ? 18  CYS A HA   1  
ATOM   252   H  HB2  . CYS A 1 18 ? -5.598  -2.505  -1.717  1.00 0.00 ? 18  CYS A HB2  1  
ATOM   253   H  HB3  . CYS A 1 18 ? -6.162  -1.593  -3.114  1.00 0.00 ? 18  CYS A HB3  1  
ATOM   254   N  N    . PHE A 1 19 ? -6.212  1.683   -1.151  1.00 0.00 ? 19  PHE A N    1  
ATOM   255   C  CA   . PHE A 1 19 ? -6.308  3.070   -1.592  1.00 0.00 ? 19  PHE A CA   1  
ATOM   256   C  C    . PHE A 1 19 ? -5.249  3.379   -2.647  1.00 0.00 ? 19  PHE A C    1  
ATOM   257   O  O    . PHE A 1 19 ? -4.801  4.518   -2.776  1.00 0.00 ? 19  PHE A O    1  
ATOM   258   C  CB   . PHE A 1 19 ? -6.150  4.018   -0.402  1.00 0.00 ? 19  PHE A CB   1  
ATOM   259   C  CG   . PHE A 1 19 ? -7.458  4.449   0.199   1.00 0.00 ? 19  PHE A CG   1  
ATOM   260   C  CD1  . PHE A 1 19 ? -8.405  5.107   -0.569  1.00 0.00 ? 19  PHE A CD1  1  
ATOM   261   C  CD2  . PHE A 1 19 ? -7.740  4.196   1.531   1.00 0.00 ? 19  PHE A CD2  1  
ATOM   262   C  CE1  . PHE A 1 19 ? -9.609  5.504   -0.020  1.00 0.00 ? 19  PHE A CE1  1  
ATOM   263   C  CE2  . PHE A 1 19 ? -8.943  4.590   2.086   1.00 0.00 ? 19  PHE A CE2  1  
ATOM   264   C  CZ   . PHE A 1 19 ? -9.878  5.247   1.310   1.00 0.00 ? 19  PHE A CZ   1  
ATOM   265   H  H    . PHE A 1 19 ? -5.679  1.470   -0.356  1.00 0.00 ? 19  PHE A H    1  
ATOM   266   H  HA   . PHE A 1 19 ? -7.285  3.211   -2.027  1.00 0.00 ? 19  PHE A HA   1  
ATOM   267   H  HB2  . PHE A 1 19 ? -5.578  3.525   0.369   1.00 0.00 ? 19  PHE A HB2  1  
ATOM   268   H  HB3  . PHE A 1 19 ? -5.624  4.904   -0.724  1.00 0.00 ? 19  PHE A HB3  1  
ATOM   269   H  HD1  . PHE A 1 19 ? -8.195  5.310   -1.610  1.00 0.00 ? 19  PHE A HD1  1  
ATOM   270   H  HD2  . PHE A 1 19 ? -7.009  3.684   2.140   1.00 0.00 ? 19  PHE A HD2  1  
ATOM   271   H  HE1  . PHE A 1 19 ? -10.338 6.017   -0.630  1.00 0.00 ? 19  PHE A HE1  1  
ATOM   272   H  HE2  . PHE A 1 19 ? -9.150  4.388   3.126   1.00 0.00 ? 19  PHE A HE2  1  
ATOM   273   H  HZ   . PHE A 1 19 ? -10.818 5.555   1.741   1.00 0.00 ? 19  PHE A HZ   1  
ATOM   274   N  N    . SER A 1 20 ? -4.855  2.356   -3.398  1.00 0.00 ? 20  SER A N    1  
ATOM   275   C  CA   . SER A 1 20 ? -3.846  2.516   -4.439  1.00 0.00 ? 20  SER A CA   1  
ATOM   276   C  C    . SER A 1 20 ? -4.382  2.054   -5.791  1.00 0.00 ? 20  SER A C    1  
ATOM   277   O  O    . SER A 1 20 ? -4.545  2.853   -6.713  1.00 0.00 ? 20  SER A O    1  
ATOM   278   C  CB   . SER A 1 20 ? -2.584  1.729   -4.082  1.00 0.00 ? 20  SER A CB   1  
ATOM   279   O  OG   . SER A 1 20 ? -1.527  2.025   -4.978  1.00 0.00 ? 20  SER A OG   1  
ATOM   280   H  H    . SER A 1 20 ? -5.250  1.472   -3.247  1.00 0.00 ? 20  SER A H    1  
ATOM   281   H  HA   . SER A 1 20 ? -3.600  3.566   -4.503  1.00 0.00 ? 20  SER A HA   1  
ATOM   282   H  HB2  . SER A 1 20 ? -2.274  1.986   -3.080  1.00 0.00 ? 20  SER A HB2  1  
ATOM   283   H  HB3  . SER A 1 20 ? -2.797  0.671   -4.132  1.00 0.00 ? 20  SER A HB3  1  
ATOM   284   H  HG   . SER A 1 20 ? -1.204  2.913   -4.809  1.00 0.00 ? 20  SER A HG   1  
ATOM   285   N  N    . CYS A 1 21 ? -4.654  0.758   -5.900  1.00 0.00 ? 21  CYS A N    1  
ATOM   286   C  CA   . CYS A 1 21 ? -5.171  0.186   -7.138  1.00 0.00 ? 21  CYS A CA   1  
ATOM   287   C  C    . CYS A 1 21 ? -6.696  0.139   -7.120  1.00 0.00 ? 21  CYS A C    1  
ATOM   288   O  O    . CYS A 1 21 ? -7.332  -0.111  -8.144  1.00 0.00 ? 21  CYS A O    1  
ATOM   289   C  CB   . CYS A 1 21 ? -4.609  -1.221  -7.348  1.00 0.00 ? 21  CYS A CB   1  
ATOM   290   S  SG   . CYS A 1 21 ? -4.791  -2.318  -5.905  1.00 0.00 ? 21  CYS A SG   1  
ATOM   291   H  H    . CYS A 1 21 ? -4.503  0.171   -5.129  1.00 0.00 ? 21  CYS A H    1  
ATOM   292   H  HA   . CYS A 1 21 ? -4.852  0.817   -7.953  1.00 0.00 ? 21  CYS A HA   1  
ATOM   293   H  HB2  . CYS A 1 21 ? -5.121  -1.685  -8.178  1.00 0.00 ? 21  CYS A HB2  1  
ATOM   294   H  HB3  . CYS A 1 21 ? -3.556  -1.150  -7.576  1.00 0.00 ? 21  CYS A HB3  1  
ATOM   295   N  N    . ASP A 1 22 ? -7.276  0.382   -5.950  1.00 0.00 ? 22  ASP A N    1  
ATOM   296   C  CA   . ASP A 1 22 ? -8.726  0.369   -5.798  1.00 0.00 ? 22  ASP A CA   1  
ATOM   297   C  C    . ASP A 1 22 ? -9.267  -1.056  -5.865  1.00 0.00 ? 22  ASP A C    1  
ATOM   298   O  O    . ASP A 1 22 ? -10.236 -1.328  -6.574  1.00 0.00 ? 22  ASP A O    1  
ATOM   299   C  CB   . ASP A 1 22 ? -9.381  1.229   -6.880  1.00 0.00 ? 22  ASP A CB   1  
ATOM   300   C  CG   . ASP A 1 22 ? -10.785 1.661   -6.505  1.00 0.00 ? 22  ASP A CG   1  
ATOM   301   O  OD1  . ASP A 1 22 ? -11.694 0.805   -6.520  1.00 0.00 ? 22  ASP A OD1  1  
ATOM   302   O  OD2  . ASP A 1 22 ? -10.974 2.856   -6.195  1.00 0.00 ? 22  ASP A OD2  1  
ATOM   303   H  H    . ASP A 1 22 ? -6.715  0.575   -5.169  1.00 0.00 ? 22  ASP A H    1  
ATOM   304   H  HA   . ASP A 1 22 ? -8.962  0.785   -4.830  1.00 0.00 ? 22  ASP A HA   1  
ATOM   305   H  HB2  . ASP A 1 22 ? -8.783  2.114   -7.040  1.00 0.00 ? 22  ASP A HB2  1  
ATOM   306   H  HB3  . ASP A 1 22 ? -9.432  0.662   -7.798  1.00 0.00 ? 22  ASP A HB3  1  
ATOM   307   N  N    . GLN A 1 23 ? -8.634  -1.959  -5.124  1.00 0.00 ? 23  GLN A N    1  
ATOM   308   C  CA   . GLN A 1 23 ? -9.051  -3.356  -5.102  1.00 0.00 ? 23  GLN A CA   1  
ATOM   309   C  C    . GLN A 1 23 ? -9.099  -3.887  -3.673  1.00 0.00 ? 23  GLN A C    1  
ATOM   310   O  O    . GLN A 1 23 ? -8.265  -3.533  -2.840  1.00 0.00 ? 23  GLN A O    1  
ATOM   311   C  CB   . GLN A 1 23 ? -8.099  -4.208  -5.943  1.00 0.00 ? 23  GLN A CB   1  
ATOM   312   C  CG   . GLN A 1 23 ? -7.980  -3.743  -7.386  1.00 0.00 ? 23  GLN A CG   1  
ATOM   313   C  CD   . GLN A 1 23 ? -9.329  -3.521  -8.040  1.00 0.00 ? 23  GLN A CD   1  
ATOM   314   O  OE1  . GLN A 1 23 ? -10.276 -4.275  -7.810  1.00 0.00 ? 23  GLN A OE1  1  
ATOM   315   N  NE2  . GLN A 1 23 ? -9.425  -2.482  -8.862  1.00 0.00 ? 23  GLN A NE2  1  
ATOM   316   H  H    . GLN A 1 23 ? -7.868  -1.680  -4.581  1.00 0.00 ? 23  GLN A H    1  
ATOM   317   H  HA   . GLN A 1 23 ? -10.041 -3.413  -5.528  1.00 0.00 ? 23  GLN A HA   1  
ATOM   318   H  HB2  . GLN A 1 23 ? -7.117  -4.178  -5.496  1.00 0.00 ? 23  GLN A HB2  1  
ATOM   319   H  HB3  . GLN A 1 23 ? -8.454  -5.228  -5.945  1.00 0.00 ? 23  GLN A HB3  1  
ATOM   320   H  HG2  . GLN A 1 23 ? -7.430  -2.814  -7.407  1.00 0.00 ? 23  GLN A HG2  1  
ATOM   321   H  HG3  . GLN A 1 23 ? -7.442  -4.492  -7.948  1.00 0.00 ? 23  GLN A HG3  1  
ATOM   322   H  HE21 . GLN A 1 23 ? -8.629  -1.926  -8.998  1.00 0.00 ? 23  GLN A HE21 1  
ATOM   323   H  HE22 . GLN A 1 23 ? -10.285 -2.315  -9.299  1.00 0.00 ? 23  GLN A HE22 1  
ATOM   324   N  N    . PHE A 1 24 ? -10.082 -4.738  -3.397  1.00 0.00 ? 24  PHE A N    1  
ATOM   325   C  CA   . PHE A 1 24 ? -10.240 -5.318  -2.068  1.00 0.00 ? 24  PHE A CA   1  
ATOM   326   C  C    . PHE A 1 24 ? -8.989  -6.089  -1.658  1.00 0.00 ? 24  PHE A C    1  
ATOM   327   O  O    . PHE A 1 24 ? -8.489  -6.925  -2.411  1.00 0.00 ? 24  PHE A O    1  
ATOM   328   C  CB   . PHE A 1 24 ? -11.458 -6.243  -2.033  1.00 0.00 ? 24  PHE A CB   1  
ATOM   329   C  CG   . PHE A 1 24 ? -12.764 -5.510  -1.916  1.00 0.00 ? 24  PHE A CG   1  
ATOM   330   C  CD1  . PHE A 1 24 ? -13.038 -4.421  -2.727  1.00 0.00 ? 24  PHE A CD1  1  
ATOM   331   C  CD2  . PHE A 1 24 ? -13.718 -5.912  -0.994  1.00 0.00 ? 24  PHE A CD2  1  
ATOM   332   C  CE1  . PHE A 1 24 ? -14.239 -3.745  -2.620  1.00 0.00 ? 24  PHE A CE1  1  
ATOM   333   C  CE2  . PHE A 1 24 ? -14.921 -5.240  -0.883  1.00 0.00 ? 24  PHE A CE2  1  
ATOM   334   C  CZ   . PHE A 1 24 ? -15.182 -4.155  -1.698  1.00 0.00 ? 24  PHE A CZ   1  
ATOM   335   H  H    . PHE A 1 24 ? -10.716 -4.982  -4.103  1.00 0.00 ? 24  PHE A H    1  
ATOM   336   H  HA   . PHE A 1 24 ? -10.394 -4.508  -1.371  1.00 0.00 ? 24  PHE A HA   1  
ATOM   337   H  HB2  . PHE A 1 24 ? -11.485 -6.824  -2.942  1.00 0.00 ? 24  PHE A HB2  1  
ATOM   338   H  HB3  . PHE A 1 24 ? -11.372 -6.908  -1.187  1.00 0.00 ? 24  PHE A HB3  1  
ATOM   339   H  HD1  . PHE A 1 24 ? -12.303 -4.100  -3.449  1.00 0.00 ? 24  PHE A HD1  1  
ATOM   340   H  HD2  . PHE A 1 24 ? -13.515 -6.760  -0.356  1.00 0.00 ? 24  PHE A HD2  1  
ATOM   341   H  HE1  . PHE A 1 24 ? -14.441 -2.898  -3.258  1.00 0.00 ? 24  PHE A HE1  1  
ATOM   342   H  HE2  . PHE A 1 24 ? -15.656 -5.563  -0.161  1.00 0.00 ? 24  PHE A HE2  1  
ATOM   343   H  HZ   . PHE A 1 24 ? -16.120 -3.629  -1.612  1.00 0.00 ? 24  PHE A HZ   1  
ATOM   344   N  N    . ILE A 1 25 ? -8.490  -5.803  -0.461  1.00 0.00 ? 25  ILE A N    1  
ATOM   345   C  CA   . ILE A 1 25 ? -7.298  -6.470  0.049   1.00 0.00 ? 25  ILE A CA   1  
ATOM   346   C  C    . ILE A 1 25 ? -7.662  -7.740  0.810   1.00 0.00 ? 25  ILE A C    1  
ATOM   347   O  O    . ILE A 1 25 ? -8.097  -7.683  1.959   1.00 0.00 ? 25  ILE A O    1  
ATOM   348   C  CB   . ILE A 1 25 ? -6.488  -5.544  0.976   1.00 0.00 ? 25  ILE A CB   1  
ATOM   349   C  CG1  . ILE A 1 25 ? -6.251  -4.191  0.301   1.00 0.00 ? 25  ILE A CG1  1  
ATOM   350   C  CG2  . ILE A 1 25 ? -5.165  -6.195  1.350   1.00 0.00 ? 25  ILE A CG2  1  
ATOM   351   C  CD1  . ILE A 1 25 ? -5.617  -3.164  1.213   1.00 0.00 ? 25  ILE A CD1  1  
ATOM   352   H  H    . ILE A 1 25 ? -8.933  -5.127  0.093   1.00 0.00 ? 25  ILE A H    1  
ATOM   353   H  HA   . ILE A 1 25 ? -6.677  -6.733  -0.795  1.00 0.00 ? 25  ILE A HA   1  
ATOM   354   H  HB   . ILE A 1 25 ? -7.056  -5.392  1.881   1.00 0.00 ? 25  ILE A HB   1  
ATOM   355   H  HG12 . ILE A 1 25 ? -5.599  -4.328  -0.547  1.00 0.00 ? 25  ILE A HG12 1  
ATOM   356   H  HG13 . ILE A 1 25 ? -7.198  -3.796  -0.037  1.00 0.00 ? 25  ILE A HG13 1  
ATOM   357   H  HG21 . ILE A 1 25 ? -5.354  -7.113  1.887   1.00 0.00 ? 25  ILE A HG21 1  
ATOM   358   H  HG22 . ILE A 1 25 ? -4.606  -6.413  0.452   1.00 0.00 ? 25  ILE A HG22 1  
ATOM   359   H  HG23 . ILE A 1 25 ? -4.596  -5.523  1.974   1.00 0.00 ? 25  ILE A HG23 1  
ATOM   360   H  HD11 . ILE A 1 25 ? -5.478  -2.240  0.673   1.00 0.00 ? 25  ILE A HD11 1  
ATOM   361   H  HD12 . ILE A 1 25 ? -6.258  -2.993  2.064   1.00 0.00 ? 25  ILE A HD12 1  
ATOM   362   H  HD13 . ILE A 1 25 ? -4.658  -3.529  1.553   1.00 0.00 ? 25  ILE A HD13 1  
ATOM   363   N  N    . GLU A 1 26 ? -7.480  -8.885  0.159   1.00 0.00 ? 26  GLU A N    1  
ATOM   364   C  CA   . GLU A 1 26 ? -7.789  -10.170 0.776   1.00 0.00 ? 26  GLU A CA   1  
ATOM   365   C  C    . GLU A 1 26 ? -6.574  -10.726 1.513   1.00 0.00 ? 26  GLU A C    1  
ATOM   366   O  O    . GLU A 1 26 ? -5.432  -10.462 1.137   1.00 0.00 ? 26  GLU A O    1  
ATOM   367   C  CB   . GLU A 1 26 ? -8.258  -11.170 -0.283  1.00 0.00 ? 26  GLU A CB   1  
ATOM   368   C  CG   . GLU A 1 26 ? -8.348  -12.599 0.225   1.00 0.00 ? 26  GLU A CG   1  
ATOM   369   C  CD   . GLU A 1 26 ? -8.648  -13.593 -0.879  1.00 0.00 ? 26  GLU A CD   1  
ATOM   370   O  OE1  . GLU A 1 26 ? -7.695  -14.035 -1.555  1.00 0.00 ? 26  GLU A OE1  1  
ATOM   371   O  OE2  . GLU A 1 26 ? -9.836  -13.929 -1.069  1.00 0.00 ? 26  GLU A OE2  1  
ATOM   372   H  H    . GLU A 1 26 ? -7.131  -8.865  -0.756  1.00 0.00 ? 26  GLU A H    1  
ATOM   373   H  HA   . GLU A 1 26 ? -8.586  -10.014 1.487   1.00 0.00 ? 26  GLU A HA   1  
ATOM   374   H  HB2  . GLU A 1 26 ? -9.235  -10.872 -0.634  1.00 0.00 ? 26  GLU A HB2  1  
ATOM   375   H  HB3  . GLU A 1 26 ? -7.566  -11.148 -1.113  1.00 0.00 ? 26  GLU A HB3  1  
ATOM   376   H  HG2  . GLU A 1 26 ? -7.406  -12.865 0.681   1.00 0.00 ? 26  GLU A HG2  1  
ATOM   377   H  HG3  . GLU A 1 26 ? -9.133  -12.656 0.964   1.00 0.00 ? 26  GLU A HG3  1  
ATOM   378   N  N    . GLY A 1 27 ? -6.829  -11.498 2.565   1.00 0.00 ? 27  GLY A N    1  
ATOM   379   C  CA   . GLY A 1 27 ? -5.747  -12.079 3.338   1.00 0.00 ? 27  GLY A CA   1  
ATOM   380   C  C    . GLY A 1 27 ? -5.254  -11.152 4.432   1.00 0.00 ? 27  GLY A C    1  
ATOM   381   O  O    . GLY A 1 27 ? -5.640  -11.291 5.592   1.00 0.00 ? 27  GLY A O    1  
ATOM   382   H  H    . GLY A 1 27 ? -7.759  -11.674 2.818   1.00 0.00 ? 27  GLY A H    1  
ATOM   383   H  HA2  . GLY A 1 27 ? -6.093  -12.997 3.788   1.00 0.00 ? 27  GLY A HA2  1  
ATOM   384   H  HA3  . GLY A 1 27 ? -4.925  -12.302 2.675   1.00 0.00 ? 27  GLY A HA3  1  
ATOM   385   N  N    . GLU A 1 28 ? -4.397  -10.206 4.062   1.00 0.00 ? 28  GLU A N    1  
ATOM   386   C  CA   . GLU A 1 28 ? -3.849  -9.255  5.022   1.00 0.00 ? 28  GLU A CA   1  
ATOM   387   C  C    . GLU A 1 28 ? -3.779  -7.854  4.421   1.00 0.00 ? 28  GLU A C    1  
ATOM   388   O  O    . GLU A 1 28 ? -3.588  -7.692  3.215   1.00 0.00 ? 28  GLU A O    1  
ATOM   389   C  CB   . GLU A 1 28 ? -2.457  -9.698  5.475   1.00 0.00 ? 28  GLU A CB   1  
ATOM   390   C  CG   . GLU A 1 28 ? -1.797  -8.734  6.447   1.00 0.00 ? 28  GLU A CG   1  
ATOM   391   C  CD   . GLU A 1 28 ? -0.740  -9.403  7.304   1.00 0.00 ? 28  GLU A CD   1  
ATOM   392   O  OE1  . GLU A 1 28 ? 0.209   -9.981  6.734   1.00 0.00 ? 28  GLU A OE1  1  
ATOM   393   O  OE2  . GLU A 1 28 ? -0.862  -9.347  8.546   1.00 0.00 ? 28  GLU A OE2  1  
ATOM   394   H  H    . GLU A 1 28 ? -4.127  -10.145 3.122   1.00 0.00 ? 28  GLU A H    1  
ATOM   395   H  HA   . GLU A 1 28 ? -4.506  -9.233  5.879   1.00 0.00 ? 28  GLU A HA   1  
ATOM   396   H  HB2  . GLU A 1 28 ? -2.537  -10.662 5.955   1.00 0.00 ? 28  GLU A HB2  1  
ATOM   397   H  HB3  . GLU A 1 28 ? -1.822  -9.791  4.606   1.00 0.00 ? 28  GLU A HB3  1  
ATOM   398   H  HG2  . GLU A 1 28 ? -1.332  -7.938  5.884   1.00 0.00 ? 28  GLU A HG2  1  
ATOM   399   H  HG3  . GLU A 1 28 ? -2.556  -8.320  7.094   1.00 0.00 ? 28  GLU A HG3  1  
ATOM   400   N  N    . VAL A 1 29 ? -3.934  -6.843  5.270   1.00 0.00 ? 29  VAL A N    1  
ATOM   401   C  CA   . VAL A 1 29 ? -3.888  -5.456  4.824   1.00 0.00 ? 29  VAL A CA   1  
ATOM   402   C  C    . VAL A 1 29 ? -2.873  -4.653  5.630   1.00 0.00 ? 29  VAL A C    1  
ATOM   403   O  O    . VAL A 1 29 ? -2.701  -4.874  6.829   1.00 0.00 ? 29  VAL A O    1  
ATOM   404   C  CB   . VAL A 1 29 ? -5.268  -4.782  4.941   1.00 0.00 ? 29  VAL A CB   1  
ATOM   405   C  CG1  . VAL A 1 29 ? -5.866  -5.024  6.318   1.00 0.00 ? 29  VAL A CG1  1  
ATOM   406   C  CG2  . VAL A 1 29 ? -5.160  -3.293  4.651   1.00 0.00 ? 29  VAL A CG2  1  
ATOM   407   H  H    . VAL A 1 29 ? -4.083  -7.035  6.220   1.00 0.00 ? 29  VAL A H    1  
ATOM   408   H  HA   . VAL A 1 29 ? -3.594  -5.449  3.785   1.00 0.00 ? 29  VAL A HA   1  
ATOM   409   H  HB   . VAL A 1 29 ? -5.925  -5.224  4.205   1.00 0.00 ? 29  VAL A HB   1  
ATOM   410   H  HG11 . VAL A 1 29 ? -6.921  -4.796  6.297   1.00 0.00 ? 29  VAL A HG11 1  
ATOM   411   H  HG12 . VAL A 1 29 ? -5.724  -6.058  6.596   1.00 0.00 ? 29  VAL A HG12 1  
ATOM   412   H  HG13 . VAL A 1 29 ? -5.376  -4.387  7.040   1.00 0.00 ? 29  VAL A HG13 1  
ATOM   413   H  HG21 . VAL A 1 29 ? -4.985  -3.144  3.596   1.00 0.00 ? 29  VAL A HG21 1  
ATOM   414   H  HG22 . VAL A 1 29 ? -6.079  -2.802  4.937   1.00 0.00 ? 29  VAL A HG22 1  
ATOM   415   H  HG23 . VAL A 1 29 ? -4.339  -2.875  5.215   1.00 0.00 ? 29  VAL A HG23 1  
ATOM   416   N  N    . VAL A 1 30 ? -2.203  -3.718  4.964   1.00 0.00 ? 30  VAL A N    1  
ATOM   417   C  CA   . VAL A 1 30 ? -1.205  -2.880  5.619   1.00 0.00 ? 30  VAL A CA   1  
ATOM   418   C  C    . VAL A 1 30 ? -1.787  -1.521  5.990   1.00 0.00 ? 30  VAL A C    1  
ATOM   419   O  O    . VAL A 1 30 ? -2.056  -0.691  5.122   1.00 0.00 ? 30  VAL A O    1  
ATOM   420   C  CB   . VAL A 1 30 ? 0.028   -2.670  4.721   1.00 0.00 ? 30  VAL A CB   1  
ATOM   421   C  CG1  . VAL A 1 30 ? 1.034   -1.753  5.400   1.00 0.00 ? 30  VAL A CG1  1  
ATOM   422   C  CG2  . VAL A 1 30 ? 0.665   -4.006  4.370   1.00 0.00 ? 30  VAL A CG2  1  
ATOM   423   H  H    . VAL A 1 30 ? -2.384  -3.589  4.010   1.00 0.00 ? 30  VAL A H    1  
ATOM   424   H  HA   . VAL A 1 30 ? -0.886  -3.383  6.521   1.00 0.00 ? 30  VAL A HA   1  
ATOM   425   H  HB   . VAL A 1 30 ? -0.295  -2.197  3.805   1.00 0.00 ? 30  VAL A HB   1  
ATOM   426   H  HG11 . VAL A 1 30 ? 1.901   -1.638  4.767   1.00 0.00 ? 30  VAL A HG11 1  
ATOM   427   H  HG12 . VAL A 1 30 ? 0.582   -0.787  5.573   1.00 0.00 ? 30  VAL A HG12 1  
ATOM   428   H  HG13 . VAL A 1 30 ? 1.333   -2.184  6.344   1.00 0.00 ? 30  VAL A HG13 1  
ATOM   429   H  HG21 . VAL A 1 30 ? 1.395   -3.862  3.587   1.00 0.00 ? 30  VAL A HG21 1  
ATOM   430   H  HG22 . VAL A 1 30 ? 1.151   -4.414  5.244   1.00 0.00 ? 30  VAL A HG22 1  
ATOM   431   H  HG23 . VAL A 1 30 ? -0.097  -4.691  4.030   1.00 0.00 ? 30  VAL A HG23 1  
ATOM   432   N  N    . SER A 1 31 ? -1.980  -1.299  7.287   1.00 0.00 ? 31  SER A N    1  
ATOM   433   C  CA   . SER A 1 31 ? -2.533  -0.041  7.773   1.00 0.00 ? 31  SER A CA   1  
ATOM   434   C  C    . SER A 1 31 ? -1.448  1.026   7.876   1.00 0.00 ? 31  SER A C    1  
ATOM   435   O  O    . SER A 1 31 ? -0.529  0.916   8.687   1.00 0.00 ? 31  SER A O    1  
ATOM   436   C  CB   . SER A 1 31 ? -3.195  -0.245  9.138   1.00 0.00 ? 31  SER A CB   1  
ATOM   437   O  OG   . SER A 1 31 ? -2.247  -0.654  10.108  1.00 0.00 ? 31  SER A OG   1  
ATOM   438   H  H    . SER A 1 31 ? -1.745  -2.000  7.931   1.00 0.00 ? 31  SER A H    1  
ATOM   439   H  HA   . SER A 1 31 ? -3.280  0.288   7.066   1.00 0.00 ? 31  SER A HA   1  
ATOM   440   H  HB2  . SER A 1 31 ? -3.644  0.682   9.459   1.00 0.00 ? 31  SER A HB2  1  
ATOM   441   H  HB3  . SER A 1 31 ? -3.959  -1.005  9.054   1.00 0.00 ? 31  SER A HB3  1  
ATOM   442   H  HG   . SER A 1 31 ? -2.669  -0.697  10.970  1.00 0.00 ? 31  SER A HG   1  
ATOM   443   N  N    . ALA A 1 32 ? -1.563  2.059   7.048   1.00 0.00 ? 32  ALA A N    1  
ATOM   444   C  CA   . ALA A 1 32 ? -0.594  3.148   7.046   1.00 0.00 ? 32  ALA A CA   1  
ATOM   445   C  C    . ALA A 1 32 ? -1.291  4.503   6.984   1.00 0.00 ? 32  ALA A C    1  
ATOM   446   O  O    . ALA A 1 32 ? -2.205  4.707   6.184   1.00 0.00 ? 32  ALA A O    1  
ATOM   447   C  CB   . ALA A 1 32 ? 0.370   2.995   5.880   1.00 0.00 ? 32  ALA A CB   1  
ATOM   448   H  H    . ALA A 1 32 ? -2.318  2.090   6.425   1.00 0.00 ? 32  ALA A H    1  
ATOM   449   H  HA   . ALA A 1 32 ? -0.024  3.089   7.963   1.00 0.00 ? 32  ALA A HA   1  
ATOM   450   H  HB1  . ALA A 1 32 ? 0.595   1.948   5.736   1.00 0.00 ? 32  ALA A HB1  1  
ATOM   451   H  HB2  . ALA A 1 32 ? -0.083  3.392   4.984   1.00 0.00 ? 32  ALA A HB2  1  
ATOM   452   H  HB3  . ALA A 1 32 ? 1.281   3.533   6.093   1.00 0.00 ? 32  ALA A HB3  1  
ATOM   453   N  N    . LEU A 1 33 ? -0.855  5.427   7.834   1.00 0.00 ? 33  LEU A N    1  
ATOM   454   C  CA   . LEU A 1 33 ? -1.438  6.763   7.876   1.00 0.00 ? 33  LEU A CA   1  
ATOM   455   C  C    . LEU A 1 33 ? -2.962  6.692   7.906   1.00 0.00 ? 33  LEU A C    1  
ATOM   456   O  O    . LEU A 1 33 ? -3.643  7.451   7.218   1.00 0.00 ? 33  LEU A O    1  
ATOM   457   C  CB   . LEU A 1 33 ? -0.979  7.580   6.666   1.00 0.00 ? 33  LEU A CB   1  
ATOM   458   C  CG   . LEU A 1 33 ? 0.481   8.034   6.679   1.00 0.00 ? 33  LEU A CG   1  
ATOM   459   C  CD1  . LEU A 1 33 ? 0.934   8.413   5.278   1.00 0.00 ? 33  LEU A CD1  1  
ATOM   460   C  CD2  . LEU A 1 33 ? 0.668   9.202   7.636   1.00 0.00 ? 33  LEU A CD2  1  
ATOM   461   H  H    . LEU A 1 33 ? -0.125  5.206   8.447   1.00 0.00 ? 33  LEU A H    1  
ATOM   462   H  HA   . LEU A 1 33 ? -1.094  7.247   8.778   1.00 0.00 ? 33  LEU A HA   1  
ATOM   463   H  HB2  . LEU A 1 33 ? -1.130  6.977   5.784   1.00 0.00 ? 33  LEU A HB2  1  
ATOM   464   H  HB3  . LEU A 1 33 ? -1.600  8.462   6.608   1.00 0.00 ? 33  LEU A HB3  1  
ATOM   465   H  HG   . LEU A 1 33 ? 1.103   7.218   7.021   1.00 0.00 ? 33  LEU A HG   1  
ATOM   466   H  HD11 . LEU A 1 33 ? 0.301   7.928   4.551   1.00 0.00 ? 33  LEU A HD11 1  
ATOM   467   H  HD12 . LEU A 1 33 ? 1.957   8.098   5.132   1.00 0.00 ? 33  LEU A HD12 1  
ATOM   468   H  HD13 . LEU A 1 33 ? 0.868   9.485   5.155   1.00 0.00 ? 33  LEU A HD13 1  
ATOM   469   H  HD21 . LEU A 1 33 ? 1.052   10.054  7.094   1.00 0.00 ? 33  LEU A HD21 1  
ATOM   470   H  HD22 . LEU A 1 33 ? 1.367   8.924   8.411   1.00 0.00 ? 33  LEU A HD22 1  
ATOM   471   H  HD23 . LEU A 1 33 ? -0.282  9.458   8.082   1.00 0.00 ? 33  LEU A HD23 1  
ATOM   472   N  N    . GLY A 1 34 ? -3.490  5.776   8.712   1.00 0.00 ? 34  GLY A N    1  
ATOM   473   C  CA   . GLY A 1 34 ? -4.930  5.625   8.820   1.00 0.00 ? 34  GLY A CA   1  
ATOM   474   C  C    . GLY A 1 34 ? -5.578  5.289   7.491   1.00 0.00 ? 34  GLY A C    1  
ATOM   475   O  O    . GLY A 1 34 ? -6.642  5.813   7.160   1.00 0.00 ? 34  GLY A O    1  
ATOM   476   H  H    . GLY A 1 34 ? -2.898  5.199   9.238   1.00 0.00 ? 34  GLY A H    1  
ATOM   477   H  HA2  . GLY A 1 34 ? -5.146  4.835   9.524   1.00 0.00 ? 34  GLY A HA2  1  
ATOM   478   H  HA3  . GLY A 1 34 ? -5.351  6.548   9.189   1.00 0.00 ? 34  GLY A HA3  1  
ATOM   479   N  N    . LYS A 1 35 ? -4.936  4.413   6.726   1.00 0.00 ? 35  LYS A N    1  
ATOM   480   C  CA   . LYS A 1 35 ? -5.455  4.008   5.425   1.00 0.00 ? 35  LYS A CA   1  
ATOM   481   C  C    . LYS A 1 35 ? -5.207  2.523   5.179   1.00 0.00 ? 35  LYS A C    1  
ATOM   482   O  O    . LYS A 1 35 ? -4.697  1.815   6.048   1.00 0.00 ? 35  LYS A O    1  
ATOM   483   C  CB   . LYS A 1 35 ? -4.806  4.835   4.313   1.00 0.00 ? 35  LYS A CB   1  
ATOM   484   C  CG   . LYS A 1 35 ? -5.309  6.267   4.249   1.00 0.00 ? 35  LYS A CG   1  
ATOM   485   C  CD   . LYS A 1 35 ? -6.614  6.366   3.477   1.00 0.00 ? 35  LYS A CD   1  
ATOM   486   C  CE   . LYS A 1 35 ? -7.357  7.653   3.801   1.00 0.00 ? 35  LYS A CE   1  
ATOM   487   N  NZ   . LYS A 1 35 ? -7.870  7.661   5.199   1.00 0.00 ? 35  LYS A NZ   1  
ATOM   488   H  H    . LYS A 1 35 ? -4.091  4.029   7.044   1.00 0.00 ? 35  LYS A H    1  
ATOM   489   H  HA   . LYS A 1 35 ? -6.519  4.188   5.422   1.00 0.00 ? 35  LYS A HA   1  
ATOM   490   H  HB2  . LYS A 1 35 ? -3.739  4.857   4.474   1.00 0.00 ? 35  LYS A HB2  1  
ATOM   491   H  HB3  . LYS A 1 35 ? -5.009  4.362   3.363   1.00 0.00 ? 35  LYS A HB3  1  
ATOM   492   H  HG2  . LYS A 1 35 ? -5.469  6.629   5.254   1.00 0.00 ? 35  LYS A HG2  1  
ATOM   493   H  HG3  . LYS A 1 35 ? -4.564  6.878   3.759   1.00 0.00 ? 35  LYS A HG3  1  
ATOM   494   H  HD2  . LYS A 1 35 ? -6.400  6.344   2.419   1.00 0.00 ? 35  LYS A HD2  1  
ATOM   495   H  HD3  . LYS A 1 35 ? -7.240  5.524   3.737   1.00 0.00 ? 35  LYS A HD3  1  
ATOM   496   H  HE2  . LYS A 1 35 ? -6.682  8.485   3.670   1.00 0.00 ? 35  LYS A HE2  1  
ATOM   497   H  HE3  . LYS A 1 35 ? -8.189  7.754   3.120   1.00 0.00 ? 35  LYS A HE3  1  
ATOM   498   H  HZ1  . LYS A 1 35 ? -8.850  8.009   5.217   1.00 0.00 ? 35  LYS A HZ1  1  
ATOM   499   H  HZ2  . LYS A 1 35 ? -7.283  8.281   5.792   1.00 0.00 ? 35  LYS A HZ2  1  
ATOM   500   H  HZ3  . LYS A 1 35 ? -7.848  6.699   5.593   1.00 0.00 ? 35  LYS A HZ3  1  
ATOM   501   N  N    . THR A 1 36 ? -5.569  2.056   3.988   1.00 0.00 ? 36  THR A N    1  
ATOM   502   C  CA   . THR A 1 36 ? -5.385  0.656   3.628   1.00 0.00 ? 36  THR A CA   1  
ATOM   503   C  C    . THR A 1 36 ? -4.671  0.522   2.288   1.00 0.00 ? 36  THR A C    1  
ATOM   504   O  O    . THR A 1 36 ? -5.085  1.115   1.291   1.00 0.00 ? 36  THR A O    1  
ATOM   505   C  CB   . THR A 1 36 ? -6.732  -0.087  3.555   1.00 0.00 ? 36  THR A CB   1  
ATOM   506   O  OG1  . THR A 1 36 ? -7.562  0.501   2.547   1.00 0.00 ? 36  THR A OG1  1  
ATOM   507   C  CG2  . THR A 1 36 ? -7.448  -0.043  4.897   1.00 0.00 ? 36  THR A CG2  1  
ATOM   508   H  H    . THR A 1 36 ? -5.970  2.669   3.338   1.00 0.00 ? 36  THR A H    1  
ATOM   509   H  HA   . THR A 1 36 ? -4.782  0.191   4.394   1.00 0.00 ? 36  THR A HA   1  
ATOM   510   H  HB   . THR A 1 36 ? -6.543  -1.119  3.298   1.00 0.00 ? 36  THR A HB   1  
ATOM   511   H  HG1  . THR A 1 36 ? -8.348  -0.038  2.425   1.00 0.00 ? 36  THR A HG1  1  
ATOM   512   H  HG21 . THR A 1 36 ? -7.095  0.804   5.466   1.00 0.00 ? 36  THR A HG21 1  
ATOM   513   H  HG22 . THR A 1 36 ? -7.245  -0.953  5.442   1.00 0.00 ? 36  THR A HG22 1  
ATOM   514   H  HG23 . THR A 1 36 ? -8.511  0.051   4.734   1.00 0.00 ? 36  THR A HG23 1  
ATOM   515   N  N    . TYR A 1 37 ? -3.597  -0.259  2.270   1.00 0.00 ? 37  TYR A N    1  
ATOM   516   C  CA   . TYR A 1 37 ? -2.824  -0.469  1.052   1.00 0.00 ? 37  TYR A CA   1  
ATOM   517   C  C    . TYR A 1 37 ? -2.372  -1.922  0.937   1.00 0.00 ? 37  TYR A C    1  
ATOM   518   O  O    . TYR A 1 37 ? -2.367  -2.663  1.920   1.00 0.00 ? 37  TYR A O    1  
ATOM   519   C  CB   . TYR A 1 37 ? -1.608  0.458   1.028   1.00 0.00 ? 37  TYR A CB   1  
ATOM   520   C  CG   . TYR A 1 37 ? -1.967  1.926   0.963   1.00 0.00 ? 37  TYR A CG   1  
ATOM   521   C  CD1  . TYR A 1 37 ? -2.415  2.500   -0.220  1.00 0.00 ? 37  TYR A CD1  1  
ATOM   522   C  CD2  . TYR A 1 37 ? -1.857  2.739   2.084   1.00 0.00 ? 37  TYR A CD2  1  
ATOM   523   C  CE1  . TYR A 1 37 ? -2.744  3.840   -0.285  1.00 0.00 ? 37  TYR A CE1  1  
ATOM   524   C  CE2  . TYR A 1 37 ? -2.185  4.080   2.029   1.00 0.00 ? 37  TYR A CE2  1  
ATOM   525   C  CZ   . TYR A 1 37 ? -2.627  4.625   0.843   1.00 0.00 ? 37  TYR A CZ   1  
ATOM   526   O  OH   . TYR A 1 37 ? -2.953  5.961   0.784   1.00 0.00 ? 37  TYR A OH   1  
ATOM   527   H  H    . TYR A 1 37 ? -3.316  -0.705  3.096   1.00 0.00 ? 37  TYR A H    1  
ATOM   528   H  HA   . TYR A 1 37 ? -3.460  -0.234  0.211   1.00 0.00 ? 37  TYR A HA   1  
ATOM   529   H  HB2  . TYR A 1 37 ? -1.025  0.300   1.922   1.00 0.00 ? 37  TYR A HB2  1  
ATOM   530   H  HB3  . TYR A 1 37 ? -1.003  0.226   0.164   1.00 0.00 ? 37  TYR A HB3  1  
ATOM   531   H  HD1  . TYR A 1 37 ? -2.506  1.882   -1.102  1.00 0.00 ? 37  TYR A HD1  1  
ATOM   532   H  HD2  . TYR A 1 37 ? -1.510  2.308   3.012   1.00 0.00 ? 37  TYR A HD2  1  
ATOM   533   H  HE1  . TYR A 1 37 ? -3.091  4.268   -1.214  1.00 0.00 ? 37  TYR A HE1  1  
ATOM   534   H  HE2  . TYR A 1 37 ? -2.093  4.695   2.912   1.00 0.00 ? 37  TYR A HE2  1  
ATOM   535   H  HH   . TYR A 1 37 ? -3.793  6.105   1.226   1.00 0.00 ? 37  TYR A HH   1  
ATOM   536   N  N    . HIS A 1 38 ? -1.992  -2.322  -0.272  1.00 0.00 ? 38  HIS A N    1  
ATOM   537   C  CA   . HIS A 1 38 ? -1.536  -3.686  -0.518  1.00 0.00 ? 38  HIS A CA   1  
ATOM   538   C  C    . HIS A 1 38 ? -0.076  -3.853  -0.108  1.00 0.00 ? 38  HIS A C    1  
ATOM   539   O  O    . HIS A 1 38 ? 0.670   -2.883  0.030   1.00 0.00 ? 38  HIS A O    1  
ATOM   540   C  CB   . HIS A 1 38 ? -1.708  -4.046  -1.994  1.00 0.00 ? 38  HIS A CB   1  
ATOM   541   C  CG   . HIS A 1 38 ? -3.054  -4.619  -2.317  1.00 0.00 ? 38  HIS A CG   1  
ATOM   542   N  ND1  . HIS A 1 38 ? -3.949  -4.004  -3.168  1.00 0.00 ? 38  HIS A ND1  1  
ATOM   543   C  CD2  . HIS A 1 38 ? -3.654  -5.758  -1.901  1.00 0.00 ? 38  HIS A CD2  1  
ATOM   544   C  CE1  . HIS A 1 38 ? -5.042  -4.740  -3.259  1.00 0.00 ? 38  HIS A CE1  1  
ATOM   545   N  NE2  . HIS A 1 38 ? -4.889  -5.810  -2.500  1.00 0.00 ? 38  HIS A NE2  1  
ATOM   546   H  H    . HIS A 1 38 ? -2.018  -1.686  -1.017  1.00 0.00 ? 38  HIS A H    1  
ATOM   547   H  HA   . HIS A 1 38 ? -2.143  -4.351  0.079   1.00 0.00 ? 38  HIS A HA   1  
ATOM   548   H  HB2  . HIS A 1 38 ? -1.574  -3.157  -2.592  1.00 0.00 ? 38  HIS A HB2  1  
ATOM   549   H  HB3  . HIS A 1 38 ? -0.961  -4.776  -2.269  1.00 0.00 ? 38  HIS A HB3  1  
ATOM   550   H  HD2  . HIS A 1 38 ? -3.240  -6.491  -1.223  1.00 0.00 ? 38  HIS A HD2  1  
ATOM   551   H  HE1  . HIS A 1 38 ? -5.913  -4.507  -3.853  1.00 0.00 ? 38  HIS A HE1  1  
ATOM   552   H  HE2  . HIS A 1 38 ? -5.583  -6.478  -2.319  1.00 0.00 ? 38  HIS A HE2  1  
ATOM   553   N  N    . PRO A 1 39 ? 0.343   -5.111  0.092   1.00 0.00 ? 39  PRO A N    1  
ATOM   554   C  CA   . PRO A 1 39 ? 1.716   -5.435  0.489   1.00 0.00 ? 39  PRO A CA   1  
ATOM   555   C  C    . PRO A 1 39 ? 2.720   -5.175  -0.629  1.00 0.00 ? 39  PRO A C    1  
ATOM   556   O  O    . PRO A 1 39 ? 3.931   -5.228  -0.415  1.00 0.00 ? 39  PRO A O    1  
ATOM   557   C  CB   . PRO A 1 39 ? 1.650   -6.930  0.811   1.00 0.00 ? 39  PRO A CB   1  
ATOM   558   C  CG   . PRO A 1 39 ? 0.504   -7.440  0.007   1.00 0.00 ? 39  PRO A CG   1  
ATOM   559   C  CD   . PRO A 1 39 ? -0.492  -6.315  -0.054  1.00 0.00 ? 39  PRO A CD   1  
ATOM   560   H  HA   . PRO A 1 39 ? 2.013   -4.887  1.372   1.00 0.00 ? 39  PRO A HA   1  
ATOM   561   H  HB2  . PRO A 1 39 ? 2.578   -7.404  0.524   1.00 0.00 ? 39  PRO A HB2  1  
ATOM   562   H  HB3  . PRO A 1 39 ? 1.482   -7.067  1.869   1.00 0.00 ? 39  PRO A HB3  1  
ATOM   563   H  HG2  . PRO A 1 39 ? 0.839   -7.699  -0.986  1.00 0.00 ? 39  PRO A HG2  1  
ATOM   564   H  HG3  . PRO A 1 39 ? 0.069   -8.300  0.494   1.00 0.00 ? 39  PRO A HG3  1  
ATOM   565   H  HD2  . PRO A 1 39 ? -1.004  -6.316  -1.004  1.00 0.00 ? 39  PRO A HD2  1  
ATOM   566   H  HD3  . PRO A 1 39 ? -1.200  -6.394  0.758   1.00 0.00 ? 39  PRO A HD3  1  
ATOM   567   N  N    . ASP A 1 40 ? 2.208   -4.894  -1.823  1.00 0.00 ? 40  ASP A N    1  
ATOM   568   C  CA   . ASP A 1 40 ? 3.060   -4.624  -2.975  1.00 0.00 ? 40  ASP A CA   1  
ATOM   569   C  C    . ASP A 1 40 ? 2.854   -3.200  -3.481  1.00 0.00 ? 40  ASP A C    1  
ATOM   570   O  O    . ASP A 1 40 ? 3.665   -2.679  -4.247  1.00 0.00 ? 40  ASP A O    1  
ATOM   571   C  CB   . ASP A 1 40 ? 2.769   -5.624  -4.096  1.00 0.00 ? 40  ASP A CB   1  
ATOM   572   C  CG   . ASP A 1 40 ? 2.888   -7.063  -3.634  1.00 0.00 ? 40  ASP A CG   1  
ATOM   573   O  OD1  . ASP A 1 40 ? 3.816   -7.360  -2.853  1.00 0.00 ? 40  ASP A OD1  1  
ATOM   574   O  OD2  . ASP A 1 40 ? 2.052   -7.891  -4.052  1.00 0.00 ? 40  ASP A OD2  1  
ATOM   575   H  H    . ASP A 1 40 ? 1.234   -4.867  -1.931  1.00 0.00 ? 40  ASP A H    1  
ATOM   576   H  HA   . ASP A 1 40 ? 4.087   -4.737  -2.662  1.00 0.00 ? 40  ASP A HA   1  
ATOM   577   H  HB2  . ASP A 1 40 ? 1.765   -5.464  -4.461  1.00 0.00 ? 40  ASP A HB2  1  
ATOM   578   H  HB3  . ASP A 1 40 ? 3.470   -5.464  -4.902  1.00 0.00 ? 40  ASP A HB3  1  
ATOM   579   N  N    . CYS A 1 41 ? 1.764   -2.575  -3.049  1.00 0.00 ? 41  CYS A N    1  
ATOM   580   C  CA   . CYS A 1 41 ? 1.450   -1.212  -3.458  1.00 0.00 ? 41  CYS A CA   1  
ATOM   581   C  C    . CYS A 1 41 ? 2.176   -0.199  -2.578  1.00 0.00 ? 41  CYS A C    1  
ATOM   582   O  O    . CYS A 1 41 ? 2.615   0.850   -3.052  1.00 0.00 ? 41  CYS A O    1  
ATOM   583   C  CB   . CYS A 1 41 ? -0.060  -0.972  -3.392  1.00 0.00 ? 41  CYS A CB   1  
ATOM   584   S  SG   . CYS A 1 41 ? -1.001  -1.787  -4.722  1.00 0.00 ? 41  CYS A SG   1  
ATOM   585   H  H    . CYS A 1 41 ? 1.155   -3.043  -2.439  1.00 0.00 ? 41  CYS A H    1  
ATOM   586   H  HA   . CYS A 1 41 ? 1.781   -1.087  -4.478  1.00 0.00 ? 41  CYS A HA   1  
ATOM   587   H  HB2  . CYS A 1 41 ? -0.435  -1.344  -2.450  1.00 0.00 ? 41  CYS A HB2  1  
ATOM   588   H  HB3  . CYS A 1 41 ? -0.251  0.089   -3.456  1.00 0.00 ? 41  CYS A HB3  1  
ATOM   589   N  N    . PHE A 1 42 ? 2.299   -0.519  -1.294  1.00 0.00 ? 42  PHE A N    1  
ATOM   590   C  CA   . PHE A 1 42 ? 2.971   0.363   -0.347  1.00 0.00 ? 42  PHE A CA   1  
ATOM   591   C  C    . PHE A 1 42 ? 4.485   0.184   -0.418  1.00 0.00 ? 42  PHE A C    1  
ATOM   592   O  O    . PHE A 1 42 ? 5.160   0.099   0.608   1.00 0.00 ? 42  PHE A O    1  
ATOM   593   C  CB   . PHE A 1 42 ? 2.479   0.088   1.075   1.00 0.00 ? 42  PHE A CB   1  
ATOM   594   C  CG   . PHE A 1 42 ? 2.838   1.170   2.053   1.00 0.00 ? 42  PHE A CG   1  
ATOM   595   C  CD1  . PHE A 1 42 ? 2.462   2.483   1.822   1.00 0.00 ? 42  PHE A CD1  1  
ATOM   596   C  CD2  . PHE A 1 42 ? 3.550   0.874   3.204   1.00 0.00 ? 42  PHE A CD2  1  
ATOM   597   C  CE1  . PHE A 1 42 ? 2.791   3.481   2.720   1.00 0.00 ? 42  PHE A CE1  1  
ATOM   598   C  CE2  . PHE A 1 42 ? 3.882   1.868   4.106   1.00 0.00 ? 42  PHE A CE2  1  
ATOM   599   C  CZ   . PHE A 1 42 ? 3.501   3.173   3.864   1.00 0.00 ? 42  PHE A CZ   1  
ATOM   600   H  H    . PHE A 1 42 ? 1.928   -1.369  -0.976  1.00 0.00 ? 42  PHE A H    1  
ATOM   601   H  HA   . PHE A 1 42 ? 2.728   1.380   -0.613  1.00 0.00 ? 42  PHE A HA   1  
ATOM   602   H  HB2  . PHE A 1 42 ? 1.404   -0.007  1.065   1.00 0.00 ? 42  PHE A HB2  1  
ATOM   603   H  HB3  . PHE A 1 42 ? 2.915   -0.836  1.426   1.00 0.00 ? 42  PHE A HB3  1  
ATOM   604   H  HD1  . PHE A 1 42 ? 1.906   2.726   0.928   1.00 0.00 ? 42  PHE A HD1  1  
ATOM   605   H  HD2  . PHE A 1 42 ? 3.849   -0.147  3.395   1.00 0.00 ? 42  PHE A HD2  1  
ATOM   606   H  HE1  . PHE A 1 42 ? 2.491   4.501   2.528   1.00 0.00 ? 42  PHE A HE1  1  
ATOM   607   H  HE2  . PHE A 1 42 ? 4.437   1.623   4.999   1.00 0.00 ? 42  PHE A HE2  1  
ATOM   608   H  HZ   . PHE A 1 42 ? 3.759   3.951   4.566   1.00 0.00 ? 42  PHE A HZ   1  
ATOM   609   N  N    . VAL A 1 43 ? 5.012   0.128   -1.637  1.00 0.00 ? 43  VAL A N    1  
ATOM   610   C  CA   . VAL A 1 43 ? 6.445   -0.040  -1.843  1.00 0.00 ? 43  VAL A CA   1  
ATOM   611   C  C    . VAL A 1 43 ? 7.056   1.199   -2.488  1.00 0.00 ? 43  VAL A C    1  
ATOM   612   O  O    . VAL A 1 43 ? 6.345   2.130   -2.868  1.00 0.00 ? 43  VAL A O    1  
ATOM   613   C  CB   . VAL A 1 43 ? 6.746   -1.266  -2.725  1.00 0.00 ? 43  VAL A CB   1  
ATOM   614   C  CG1  . VAL A 1 43 ? 6.188   -2.531  -2.090  1.00 0.00 ? 43  VAL A CG1  1  
ATOM   615   C  CG2  . VAL A 1 43 ? 6.180   -1.068  -4.123  1.00 0.00 ? 43  VAL A CG2  1  
ATOM   616   H  H    . VAL A 1 43 ? 4.422   0.202   -2.416  1.00 0.00 ? 43  VAL A H    1  
ATOM   617   H  HA   . VAL A 1 43 ? 6.905   -0.195  -0.878  1.00 0.00 ? 43  VAL A HA   1  
ATOM   618   H  HB   . VAL A 1 43 ? 7.818   -1.373  -2.805  1.00 0.00 ? 43  VAL A HB   1  
ATOM   619   H  HG11 . VAL A 1 43 ? 5.318   -2.856  -2.641  1.00 0.00 ? 43  VAL A HG11 1  
ATOM   620   H  HG12 . VAL A 1 43 ? 6.940   -3.306  -2.111  1.00 0.00 ? 43  VAL A HG12 1  
ATOM   621   H  HG13 . VAL A 1 43 ? 5.909   -2.326  -1.066  1.00 0.00 ? 43  VAL A HG13 1  
ATOM   622   H  HG21 . VAL A 1 43 ? 6.766   -0.327  -4.646  1.00 0.00 ? 43  VAL A HG21 1  
ATOM   623   H  HG22 . VAL A 1 43 ? 6.217   -2.003  -4.663  1.00 0.00 ? 43  VAL A HG22 1  
ATOM   624   H  HG23 . VAL A 1 43 ? 5.155   -0.734  -4.053  1.00 0.00 ? 43  VAL A HG23 1  
ATOM   625   N  N    . CYS A 1 44 ? 8.380   1.204   -2.611  1.00 0.00 ? 44  CYS A N    1  
ATOM   626   C  CA   . CYS A 1 44 ? 9.088   2.327   -3.211  1.00 0.00 ? 44  CYS A CA   1  
ATOM   627   C  C    . CYS A 1 44 ? 8.470   2.707   -4.553  1.00 0.00 ? 44  CYS A C    1  
ATOM   628   O  O    . CYS A 1 44 ? 7.687   1.948   -5.124  1.00 0.00 ? 44  CYS A O    1  
ATOM   629   C  CB   . CYS A 1 44 ? 10.567  1.983   -3.397  1.00 0.00 ? 44  CYS A CB   1  
ATOM   630   S  SG   . CYS A 1 44 ? 11.614  3.411   -3.830  1.00 0.00 ? 44  CYS A SG   1  
ATOM   631   H  H    . CYS A 1 44 ? 8.893   0.432   -2.290  1.00 0.00 ? 44  CYS A H    1  
ATOM   632   H  HA   . CYS A 1 44 ? 9.005   3.169   -2.540  1.00 0.00 ? 44  CYS A HA   1  
ATOM   633   H  HB2  . CYS A 1 44 ? 10.950  1.563   -2.479  1.00 0.00 ? 44  CYS A HB2  1  
ATOM   634   H  HB3  . CYS A 1 44 ? 10.663  1.254   -4.188  1.00 0.00 ? 44  CYS A HB3  1  
ATOM   635   N  N    . ALA A 1 45 ? 8.828   3.886   -5.051  1.00 0.00 ? 45  ALA A N    1  
ATOM   636   C  CA   . ALA A 1 45 ? 8.310   4.365   -6.327  1.00 0.00 ? 45  ALA A CA   1  
ATOM   637   C  C    . ALA A 1 45 ? 9.351   4.217   -7.432  1.00 0.00 ? 45  ALA A C    1  
ATOM   638   O  O    . ALA A 1 45 ? 9.012   4.159   -8.614  1.00 0.00 ? 45  ALA A O    1  
ATOM   639   C  CB   . ALA A 1 45 ? 7.869   5.816   -6.206  1.00 0.00 ? 45  ALA A CB   1  
ATOM   640   H  H    . ALA A 1 45 ? 9.456   4.446   -4.549  1.00 0.00 ? 45  ALA A H    1  
ATOM   641   H  HA   . ALA A 1 45 ? 7.444   3.771   -6.580  1.00 0.00 ? 45  ALA A HA   1  
ATOM   642   H  HB1  . ALA A 1 45 ? 6.906   5.859   -5.718  1.00 0.00 ? 45  ALA A HB1  1  
ATOM   643   H  HB2  . ALA A 1 45 ? 8.593   6.365   -5.622  1.00 0.00 ? 45  ALA A HB2  1  
ATOM   644   H  HB3  . ALA A 1 45 ? 7.794   6.253   -7.190  1.00 0.00 ? 45  ALA A HB3  1  
ATOM   645   N  N    . VAL A 1 46 ? 10.620  4.158   -7.040  1.00 0.00 ? 46  VAL A N    1  
ATOM   646   C  CA   . VAL A 1 46 ? 11.710  4.016   -7.997  1.00 0.00 ? 46  VAL A CA   1  
ATOM   647   C  C    . VAL A 1 46 ? 12.012  2.548   -8.274  1.00 0.00 ? 46  VAL A C    1  
ATOM   648   O  O    . VAL A 1 46 ? 11.786  2.054   -9.379  1.00 0.00 ? 46  VAL A O    1  
ATOM   649   C  CB   . VAL A 1 46 ? 12.992  4.706   -7.494  1.00 0.00 ? 46  VAL A CB   1  
ATOM   650   C  CG1  . VAL A 1 46 ? 14.048  4.735   -8.588  1.00 0.00 ? 46  VAL A CG1  1  
ATOM   651   C  CG2  . VAL A 1 46 ? 12.682  6.113   -7.004  1.00 0.00 ? 46  VAL A CG2  1  
ATOM   652   H  H    . VAL A 1 46 ? 10.827  4.209   -6.083  1.00 0.00 ? 46  VAL A H    1  
ATOM   653   H  HA   . VAL A 1 46 ? 11.408  4.492   -8.919  1.00 0.00 ? 46  VAL A HA   1  
ATOM   654   H  HB   . VAL A 1 46 ? 13.381  4.136   -6.663  1.00 0.00 ? 46  VAL A HB   1  
ATOM   655   H  HG11 . VAL A 1 46 ? 14.959  4.286   -8.220  1.00 0.00 ? 46  VAL A HG11 1  
ATOM   656   H  HG12 . VAL A 1 46 ? 13.693  4.182   -9.446  1.00 0.00 ? 46  VAL A HG12 1  
ATOM   657   H  HG13 . VAL A 1 46 ? 14.242  5.758   -8.874  1.00 0.00 ? 46  VAL A HG13 1  
ATOM   658   H  HG21 . VAL A 1 46 ? 11.844  6.080   -6.324  1.00 0.00 ? 46  VAL A HG21 1  
ATOM   659   H  HG22 . VAL A 1 46 ? 13.544  6.514   -6.492  1.00 0.00 ? 46  VAL A HG22 1  
ATOM   660   H  HG23 . VAL A 1 46 ? 12.438  6.743   -7.846  1.00 0.00 ? 46  VAL A HG23 1  
ATOM   661   N  N    . CYS A 1 47 ? 12.522  1.854   -7.262  1.00 0.00 ? 47  CYS A N    1  
ATOM   662   C  CA   . CYS A 1 47 ? 12.856  0.441   -7.395  1.00 0.00 ? 47  CYS A CA   1  
ATOM   663   C  C    . CYS A 1 47 ? 11.634  -0.434  -7.126  1.00 0.00 ? 47  CYS A C    1  
ATOM   664   O  O    . CYS A 1 47 ? 11.586  -1.593  -7.536  1.00 0.00 ? 47  CYS A O    1  
ATOM   665   C  CB   . CYS A 1 47 ? 13.984  0.069   -6.431  1.00 0.00 ? 47  CYS A CB   1  
ATOM   666   S  SG   . CYS A 1 47 ? 13.552  0.256   -4.672  1.00 0.00 ? 47  CYS A SG   1  
ATOM   667   H  H    . CYS A 1 47 ? 12.680  2.303   -6.404  1.00 0.00 ? 47  CYS A H    1  
ATOM   668   H  HA   . CYS A 1 47 ? 13.188  0.272   -8.407  1.00 0.00 ? 47  CYS A HA   1  
ATOM   669   H  HB2  . CYS A 1 47 ? 14.260  -0.963  -6.593  1.00 0.00 ? 47  CYS A HB2  1  
ATOM   670   H  HB3  . CYS A 1 47 ? 14.839  0.699   -6.629  1.00 0.00 ? 47  CYS A HB3  1  
ATOM   671   N  N    . ARG A 1 48 ? 10.650  0.131   -6.435  1.00 0.00 ? 48  ARG A N    1  
ATOM   672   C  CA   . ARG A 1 48 ? 9.429   -0.597  -6.110  1.00 0.00 ? 48  ARG A CA   1  
ATOM   673   C  C    . ARG A 1 48 ? 9.726   -1.772  -5.183  1.00 0.00 ? 48  ARG A C    1  
ATOM   674   O  O    . ARG A 1 48 ? 9.216   -2.876  -5.379  1.00 0.00 ? 48  ARG A O    1  
ATOM   675   C  CB   . ARG A 1 48 ? 8.754   -1.100  -7.388  1.00 0.00 ? 48  ARG A CB   1  
ATOM   676   C  CG   . ARG A 1 48 ? 8.448   0.002   -8.389  1.00 0.00 ? 48  ARG A CG   1  
ATOM   677   C  CD   . ARG A 1 48 ? 7.065   0.594   -8.160  1.00 0.00 ? 48  ARG A CD   1  
ATOM   678   N  NE   . ARG A 1 48 ? 6.004   -0.341  -8.524  1.00 0.00 ? 48  ARG A NE   1  
ATOM   679   C  CZ   . ARG A 1 48 ? 4.737   0.018   -8.699  1.00 0.00 ? 48  ARG A CZ   1  
ATOM   680   N  NH1  . ARG A 1 48 ? 4.376   1.285   -8.544  1.00 0.00 ? 48  ARG A NH1  1  
ATOM   681   N  NH2  . ARG A 1 48 ? 3.828   -0.890  -9.030  1.00 0.00 ? 48  ARG A NH2  1  
ATOM   682   H  H    . ARG A 1 48 ? 10.747  1.059   -6.135  1.00 0.00 ? 48  ARG A H    1  
ATOM   683   H  HA   . ARG A 1 48 ? 8.760   0.085   -5.605  1.00 0.00 ? 48  ARG A HA   1  
ATOM   684   H  HB2  . ARG A 1 48 ? 9.404   -1.818  -7.865  1.00 0.00 ? 48  ARG A HB2  1  
ATOM   685   H  HB3  . ARG A 1 48 ? 7.827   -1.585  -7.124  1.00 0.00 ? 48  ARG A HB3  1  
ATOM   686   H  HG2  . ARG A 1 48 ? 9.184   0.786   -8.285  1.00 0.00 ? 48  ARG A HG2  1  
ATOM   687   H  HG3  . ARG A 1 48 ? 8.494   -0.408  -9.387  1.00 0.00 ? 48  ARG A HG3  1  
ATOM   688   H  HD2  . ARG A 1 48 ? 6.965   0.848   -7.116  1.00 0.00 ? 48  ARG A HD2  1  
ATOM   689   H  HD3  . ARG A 1 48 ? 6.967   1.487   -8.759  1.00 0.00 ? 48  ARG A HD3  1  
ATOM   690   H  HE   . ARG A 1 48 ? 6.248   -1.282  -8.644  1.00 0.00 ? 48  ARG A HE   1  
ATOM   691   H  HH11 . ARG A 1 48 ? 5.058   1.972   -8.296  1.00 0.00 ? 48  ARG A HH11 1  
ATOM   692   H  HH12 . ARG A 1 48 ? 3.421   1.553   -8.677  1.00 0.00 ? 48  ARG A HH12 1  
ATOM   693   H  HH21 . ARG A 1 48 ? 4.096   -1.846  -9.148  1.00 0.00 ? 48  ARG A HH21 1  
ATOM   694   H  HH22 . ARG A 1 48 ? 2.875   -0.619  -9.161  1.00 0.00 ? 48  ARG A HH22 1  
ATOM   695   N  N    . LEU A 1 49 ? 10.554  -1.527  -4.173  1.00 0.00 ? 49  LEU A N    1  
ATOM   696   C  CA   . LEU A 1 49 ? 10.920  -2.564  -3.215  1.00 0.00 ? 49  LEU A CA   1  
ATOM   697   C  C    . LEU A 1 49 ? 10.149  -2.396  -1.910  1.00 0.00 ? 49  LEU A C    1  
ATOM   698   O  O    . LEU A 1 49 ? 9.868   -1.283  -1.465  1.00 0.00 ? 49  LEU A O    1  
ATOM   699   C  CB   . LEU A 1 49 ? 12.424  -2.525  -2.942  1.00 0.00 ? 49  LEU A CB   1  
ATOM   700   C  CG   . LEU A 1 49 ? 13.310  -3.255  -3.953  1.00 0.00 ? 49  LEU A CG   1  
ATOM   701   C  CD1  . LEU A 1 49 ? 14.774  -2.910  -3.727  1.00 0.00 ? 49  LEU A CD1  1  
ATOM   702   C  CD2  . LEU A 1 49 ? 13.094  -4.759  -3.863  1.00 0.00 ? 49  LEU A CD2  1  
ATOM   703   H  H    . LEU A 1 49 ? 10.928  -0.628  -4.068  1.00 0.00 ? 49  LEU A H    1  
ATOM   704   H  HA   . LEU A 1 49 ? 10.666  -3.520  -3.649  1.00 0.00 ? 49  LEU A HA   1  
ATOM   705   H  HB2  . LEU A 1 49 ? 12.730  -1.491  -2.921  1.00 0.00 ? 49  LEU A HB2  1  
ATOM   706   H  HB3  . LEU A 1 49 ? 12.595  -2.969  -1.971  1.00 0.00 ? 49  LEU A HB3  1  
ATOM   707   H  HG   . LEU A 1 49 ? 13.043  -2.937  -4.951  1.00 0.00 ? 49  LEU A HG   1  
ATOM   708   H  HD11 . LEU A 1 49 ? 14.864  -1.862  -3.487  1.00 0.00 ? 49  LEU A HD11 1  
ATOM   709   H  HD12 . LEU A 1 49 ? 15.336  -3.124  -4.624  1.00 0.00 ? 49  LEU A HD12 1  
ATOM   710   H  HD13 . LEU A 1 49 ? 15.161  -3.502  -2.910  1.00 0.00 ? 49  LEU A HD13 1  
ATOM   711   H  HD21 . LEU A 1 49 ? 13.653  -5.249  -4.647  1.00 0.00 ? 49  LEU A HD21 1  
ATOM   712   H  HD22 . LEU A 1 49 ? 12.042  -4.979  -3.980  1.00 0.00 ? 49  LEU A HD22 1  
ATOM   713   H  HD23 . LEU A 1 49 ? 13.433  -5.114  -2.902  1.00 0.00 ? 49  LEU A HD23 1  
ATOM   714   N  N    . PRO A 1 50 ? 9.802   -3.527  -1.278  1.00 0.00 ? 50  PRO A N    1  
ATOM   715   C  CA   . PRO A 1 50 ? 9.062   -3.532  -0.012  1.00 0.00 ? 50  PRO A CA   1  
ATOM   716   C  C    . PRO A 1 50 ? 9.904   -3.023  1.153   1.00 0.00 ? 50  PRO A C    1  
ATOM   717   O  O    . PRO A 1 50 ? 10.936  -3.606  1.487   1.00 0.00 ? 50  PRO A O    1  
ATOM   718   C  CB   . PRO A 1 50 ? 8.708   -5.008  0.187   1.00 0.00 ? 50  PRO A CB   1  
ATOM   719   C  CG   . PRO A 1 50 ? 9.753   -5.753  -0.570  1.00 0.00 ? 50  PRO A CG   1  
ATOM   720   C  CD   . PRO A 1 50 ? 10.105  -4.889  -1.750  1.00 0.00 ? 50  PRO A CD   1  
ATOM   721   H  HA   . PRO A 1 50 ? 8.155   -2.949  -0.081  1.00 0.00 ? 50  PRO A HA   1  
ATOM   722   H  HB2  . PRO A 1 50 ? 8.736   -5.248  1.240   1.00 0.00 ? 50  PRO A HB2  1  
ATOM   723   H  HB3  . PRO A 1 50 ? 7.722   -5.202  -0.207  1.00 0.00 ? 50  PRO A HB3  1  
ATOM   724   H  HG2  . PRO A 1 50 ? 10.620  -5.906  0.054   1.00 0.00 ? 50  PRO A HG2  1  
ATOM   725   H  HG3  . PRO A 1 50 ? 9.357   -6.700  -0.905  1.00 0.00 ? 50  PRO A HG3  1  
ATOM   726   H  HD2  . PRO A 1 50 ? 11.153  -4.989  -1.992  1.00 0.00 ? 50  PRO A HD2  1  
ATOM   727   H  HD3  . PRO A 1 50 ? 9.493   -5.146  -2.602  1.00 0.00 ? 50  PRO A HD3  1  
ATOM   728   N  N    . PHE A 1 51 ? 9.457   -1.934  1.769   1.00 0.00 ? 51  PHE A N    1  
ATOM   729   C  CA   . PHE A 1 51 ? 10.170  -1.347  2.898   1.00 0.00 ? 51  PHE A CA   1  
ATOM   730   C  C    . PHE A 1 51 ? 10.263  -2.336  4.056   1.00 0.00 ? 51  PHE A C    1  
ATOM   731   O  O    . PHE A 1 51 ? 9.279   -2.961  4.452   1.00 0.00 ? 51  PHE A O    1  
ATOM   732   C  CB   . PHE A 1 51 ? 9.471   -0.067  3.360   1.00 0.00 ? 51  PHE A CB   1  
ATOM   733   C  CG   . PHE A 1 51 ? 9.241   0.923   2.254   1.00 0.00 ? 51  PHE A CG   1  
ATOM   734   C  CD1  . PHE A 1 51 ? 10.290  1.674   1.750   1.00 0.00 ? 51  PHE A CD1  1  
ATOM   735   C  CD2  . PHE A 1 51 ? 7.976   1.103   1.719   1.00 0.00 ? 51  PHE A CD2  1  
ATOM   736   C  CE1  . PHE A 1 51 ? 10.082  2.587   0.733   1.00 0.00 ? 51  PHE A CE1  1  
ATOM   737   C  CE2  . PHE A 1 51 ? 7.761   2.014   0.702   1.00 0.00 ? 51  PHE A CE2  1  
ATOM   738   C  CZ   . PHE A 1 51 ? 8.815   2.756   0.208   1.00 0.00 ? 51  PHE A CZ   1  
ATOM   739   H  H    . PHE A 1 51 ? 8.628   -1.514  1.457   1.00 0.00 ? 51  PHE A H    1  
ATOM   740   H  HA   . PHE A 1 51 ? 11.167  -1.103  2.568   1.00 0.00 ? 51  PHE A HA   1  
ATOM   741   H  HB2  . PHE A 1 51 ? 8.510   -0.322  3.781   1.00 0.00 ? 51  PHE A HB2  1  
ATOM   742   H  HB3  . PHE A 1 51 ? 10.075  0.412   4.116   1.00 0.00 ? 51  PHE A HB3  1  
ATOM   743   H  HD1  . PHE A 1 51 ? 11.281  1.542   2.159   1.00 0.00 ? 51  PHE A HD1  1  
ATOM   744   H  HD2  . PHE A 1 51 ? 7.149   0.523   2.105   1.00 0.00 ? 51  PHE A HD2  1  
ATOM   745   H  HE1  . PHE A 1 51 ? 10.908  3.165   0.348   1.00 0.00 ? 51  PHE A HE1  1  
ATOM   746   H  HE2  . PHE A 1 51 ? 6.769   2.144   0.294   1.00 0.00 ? 51  PHE A HE2  1  
ATOM   747   H  HZ   . PHE A 1 51 ? 8.650   3.468   -0.587  1.00 0.00 ? 51  PHE A HZ   1  
ATOM   748   N  N    . PRO A 1 52 ? 11.474  -2.482  4.613   1.00 0.00 ? 52  PRO A N    1  
ATOM   749   C  CA   . PRO A 1 52 ? 11.726  -3.393  5.733   1.00 0.00 ? 52  PRO A CA   1  
ATOM   750   C  C    . PRO A 1 52 ? 11.081  -2.911  7.028   1.00 0.00 ? 52  PRO A C    1  
ATOM   751   O  O    . PRO A 1 52 ? 10.833  -1.721  7.221   1.00 0.00 ? 52  PRO A O    1  
ATOM   752   C  CB   . PRO A 1 52 ? 13.251  -3.386  5.861   1.00 0.00 ? 52  PRO A CB   1  
ATOM   753   C  CG   . PRO A 1 52 ? 13.673  -2.076  5.289   1.00 0.00 ? 52  PRO A CG   1  
ATOM   754   C  CD   . PRO A 1 52 ? 12.692  -1.768  4.192   1.00 0.00 ? 52  PRO A CD   1  
ATOM   755   H  HA   . PRO A 1 52 ? 11.386  -4.395  5.514   1.00 0.00 ? 52  PRO A HA   1  
ATOM   756   H  HB2  . PRO A 1 52 ? 13.528  -3.470  6.902   1.00 0.00 ? 52  PRO A HB2  1  
ATOM   757   H  HB3  . PRO A 1 52 ? 13.667  -4.212  5.304   1.00 0.00 ? 52  PRO A HB3  1  
ATOM   758   H  HG2  . PRO A 1 52 ? 13.635  -1.313  6.051   1.00 0.00 ? 52  PRO A HG2  1  
ATOM   759   H  HG3  . PRO A 1 52 ? 14.672  -2.157  4.886   1.00 0.00 ? 52  PRO A HG3  1  
ATOM   760   H  HD2  . PRO A 1 52 ? 12.514  -0.705  4.132   1.00 0.00 ? 52  PRO A HD2  1  
ATOM   761   H  HD3  . PRO A 1 52 ? 13.052  -2.147  3.246   1.00 0.00 ? 52  PRO A HD3  1  
ATOM   762   N  N    . PRO A 1 53 ? 10.801  -3.856  7.938   1.00 0.00 ? 53  PRO A N    1  
ATOM   763   C  CA   . PRO A 1 53 ? 10.182  -3.551  9.232   1.00 0.00 ? 53  PRO A CA   1  
ATOM   764   C  C    . PRO A 1 53 ? 11.125  -2.795  10.162  1.00 0.00 ? 53  PRO A C    1  
ATOM   765   O  O    . PRO A 1 53 ? 10.790  -2.524  11.314  1.00 0.00 ? 53  PRO A O    1  
ATOM   766   C  CB   . PRO A 1 53 ? 9.859   -4.933  9.805   1.00 0.00 ? 53  PRO A CB   1  
ATOM   767   C  CG   . PRO A 1 53 ? 10.834  -5.851  9.153   1.00 0.00 ? 53  PRO A CG   1  
ATOM   768   C  CD   . PRO A 1 53 ? 11.069  -5.295  7.775   1.00 0.00 ? 53  PRO A CD   1  
ATOM   769   H  HA   . PRO A 1 53 ? 9.268   -2.987  9.111   1.00 0.00 ? 53  PRO A HA   1  
ATOM   770   H  HB2  . PRO A 1 53 ? 9.986   -4.919  10.879  1.00 0.00 ? 53  PRO A HB2  1  
ATOM   771   H  HB3  . PRO A 1 53 ? 8.842   -5.199  9.561   1.00 0.00 ? 53  PRO A HB3  1  
ATOM   772   H  HG2  . PRO A 1 53 ? 11.756  -5.866  9.713   1.00 0.00 ? 53  PRO A HG2  1  
ATOM   773   H  HG3  . PRO A 1 53 ? 10.416  -6.845  9.089   1.00 0.00 ? 53  PRO A HG3  1  
ATOM   774   H  HD2  . PRO A 1 53 ? 12.090  -5.465  7.469   1.00 0.00 ? 53  PRO A HD2  1  
ATOM   775   H  HD3  . PRO A 1 53 ? 10.382  -5.736  7.068   1.00 0.00 ? 53  PRO A HD3  1  
ATOM   776   N  N    . GLY A 1 54 ? 12.305  -2.456  9.653   1.00 0.00 ? 54  GLY A N    1  
ATOM   777   C  CA   . GLY A 1 54 ? 13.278  -1.734  10.452  1.00 0.00 ? 54  GLY A CA   1  
ATOM   778   C  C    . GLY A 1 54 ? 13.680  -0.415  9.824   1.00 0.00 ? 54  GLY A C    1  
ATOM   779   O  O    . GLY A 1 54 ? 13.316  0.652   10.318  1.00 0.00 ? 54  GLY A O    1  
ATOM   780   H  H    . GLY A 1 54 ? 12.518  -2.699  8.727   1.00 0.00 ? 54  GLY A H    1  
ATOM   781   H  HA2  . GLY A 1 54 ? 12.856  -1.543  11.427  1.00 0.00 ? 54  GLY A HA2  1  
ATOM   782   H  HA3  . GLY A 1 54 ? 14.159  -2.348  10.567  1.00 0.00 ? 54  GLY A HA3  1  
ATOM   783   N  N    . ASP A 1 55 ? 14.434  -0.487  8.733   1.00 0.00 ? 55  ASP A N    1  
ATOM   784   C  CA   . ASP A 1 55 ? 14.887  0.711   8.036   1.00 0.00 ? 55  ASP A CA   1  
ATOM   785   C  C    . ASP A 1 55 ? 13.797  1.779   8.025   1.00 0.00 ? 55  ASP A C    1  
ATOM   786   O  O    . ASP A 1 55 ? 12.614  1.473   8.175   1.00 0.00 ? 55  ASP A O    1  
ATOM   787   C  CB   . ASP A 1 55 ? 15.297  0.370   6.603   1.00 0.00 ? 55  ASP A CB   1  
ATOM   788   C  CG   . ASP A 1 55 ? 16.432  1.241   6.102   1.00 0.00 ? 55  ASP A CG   1  
ATOM   789   O  OD1  . ASP A 1 55 ? 17.213  1.739   6.940   1.00 0.00 ? 55  ASP A OD1  1  
ATOM   790   O  OD2  . ASP A 1 55 ? 16.540  1.424   4.871   1.00 0.00 ? 55  ASP A OD2  1  
ATOM   791   H  H    . ASP A 1 55 ? 14.692  -1.367  8.387   1.00 0.00 ? 55  ASP A H    1  
ATOM   792   H  HA   . ASP A 1 55 ? 15.746  1.097   8.564   1.00 0.00 ? 55  ASP A HA   1  
ATOM   793   H  HB2  . ASP A 1 55 ? 15.616  -0.662  6.562   1.00 0.00 ? 55  ASP A HB2  1  
ATOM   794   H  HB3  . ASP A 1 55 ? 14.447  0.506   5.950   1.00 0.00 ? 55  ASP A HB3  1  
ATOM   795   N  N    . ARG A 1 56 ? 14.204  3.031   7.849   1.00 0.00 ? 56  ARG A N    1  
ATOM   796   C  CA   . ARG A 1 56 ? 13.263  4.144   7.822   1.00 0.00 ? 56  ARG A CA   1  
ATOM   797   C  C    . ARG A 1 56 ? 12.688  4.335   6.421   1.00 0.00 ? 56  ARG A C    1  
ATOM   798   O  O    . ARG A 1 56 ? 13.159  3.732   5.458   1.00 0.00 ? 56  ARG A O    1  
ATOM   799   C  CB   . ARG A 1 56 ? 13.948  5.432   8.284   1.00 0.00 ? 56  ARG A CB   1  
ATOM   800   C  CG   . ARG A 1 56 ? 13.884  5.650   9.786   1.00 0.00 ? 56  ARG A CG   1  
ATOM   801   C  CD   . ARG A 1 56 ? 14.668  6.885   10.203  1.00 0.00 ? 56  ARG A CD   1  
ATOM   802   N  NE   . ARG A 1 56 ? 14.398  7.263   11.588  1.00 0.00 ? 56  ARG A NE   1  
ATOM   803   C  CZ   . ARG A 1 56 ? 15.149  8.114   12.277  1.00 0.00 ? 56  ARG A CZ   1  
ATOM   804   N  NH1  . ARG A 1 56 ? 16.211  8.673   11.713  1.00 0.00 ? 56  ARG A NH1  1  
ATOM   805   N  NH2  . ARG A 1 56 ? 14.838  8.409   13.533  1.00 0.00 ? 56  ARG A NH2  1  
ATOM   806   H  H    . ARG A 1 56 ? 15.161  3.212   7.736   1.00 0.00 ? 56  ARG A H    1  
ATOM   807   H  HA   . ARG A 1 56 ? 12.456  3.913   8.501   1.00 0.00 ? 56  ARG A HA   1  
ATOM   808   H  HB2  . ARG A 1 56 ? 14.987  5.397   7.991   1.00 0.00 ? 56  ARG A HB2  1  
ATOM   809   H  HB3  . ARG A 1 56 ? 13.473  6.271   7.799   1.00 0.00 ? 56  ARG A HB3  1  
ATOM   810   H  HG2  . ARG A 1 56 ? 12.852  5.777   10.079  1.00 0.00 ? 56  ARG A HG2  1  
ATOM   811   H  HG3  . ARG A 1 56 ? 14.298  4.786   10.284  1.00 0.00 ? 56  ARG A HG3  1  
ATOM   812   H  HD2  . ARG A 1 56 ? 15.722  6.679   10.096  1.00 0.00 ? 56  ARG A HD2  1  
ATOM   813   H  HD3  . ARG A 1 56 ? 14.393  7.704   9.556   1.00 0.00 ? 56  ARG A HD3  1  
ATOM   814   H  HE   . ARG A 1 56 ? 13.618  6.862   12.024  1.00 0.00 ? 56  ARG A HE   1  
ATOM   815   H  HH11 . ARG A 1 56 ? 16.446  8.454   10.767  1.00 0.00 ? 56  ARG A HH11 1  
ATOM   816   H  HH12 . ARG A 1 56 ? 16.774  9.315   12.234  1.00 0.00 ? 56  ARG A HH12 1  
ATOM   817   H  HH21 . ARG A 1 56 ? 14.038  7.989   13.962  1.00 0.00 ? 56  ARG A HH21 1  
ATOM   818   H  HH22 . ARG A 1 56 ? 15.404  9.049   14.051  1.00 0.00 ? 56  ARG A HH22 1  
ATOM   819   N  N    . VAL A 1 57 ? 11.666  5.179   6.317   1.00 0.00 ? 57  VAL A N    1  
ATOM   820   C  CA   . VAL A 1 57 ? 11.026  5.451   5.035   1.00 0.00 ? 57  VAL A CA   1  
ATOM   821   C  C    . VAL A 1 57 ? 10.855  6.949   4.813   1.00 0.00 ? 57  VAL A C    1  
ATOM   822   O  O    . VAL A 1 57 ? 10.317  7.657   5.665   1.00 0.00 ? 57  VAL A O    1  
ATOM   823   C  CB   . VAL A 1 57 ? 9.649   4.767   4.939   1.00 0.00 ? 57  VAL A CB   1  
ATOM   824   C  CG1  . VAL A 1 57 ? 8.978   5.103   3.616   1.00 0.00 ? 57  VAL A CG1  1  
ATOM   825   C  CG2  . VAL A 1 57 ? 9.789   3.262   5.108   1.00 0.00 ? 57  VAL A CG2  1  
ATOM   826   H  H    . VAL A 1 57 ? 11.334  5.630   7.121   1.00 0.00 ? 57  VAL A H    1  
ATOM   827   H  HA   . VAL A 1 57 ? 11.658  5.051   4.255   1.00 0.00 ? 57  VAL A HA   1  
ATOM   828   H  HB   . VAL A 1 57 ? 9.027   5.142   5.738   1.00 0.00 ? 57  VAL A HB   1  
ATOM   829   H  HG11 . VAL A 1 57 ? 8.076   5.668   3.803   1.00 0.00 ? 57  VAL A HG11 1  
ATOM   830   H  HG12 . VAL A 1 57 ? 9.652   5.689   3.008   1.00 0.00 ? 57  VAL A HG12 1  
ATOM   831   H  HG13 . VAL A 1 57 ? 8.728   4.189   3.097   1.00 0.00 ? 57  VAL A HG13 1  
ATOM   832   H  HG21 . VAL A 1 57 ? 8.869   2.780   4.812   1.00 0.00 ? 57  VAL A HG21 1  
ATOM   833   H  HG22 . VAL A 1 57 ? 10.598  2.903   4.489   1.00 0.00 ? 57  VAL A HG22 1  
ATOM   834   H  HG23 . VAL A 1 57 ? 9.999   3.034   6.143   1.00 0.00 ? 57  VAL A HG23 1  
ATOM   835   N  N    . THR A 1 58 ? 11.314  7.428   3.661   1.00 0.00 ? 58  THR A N    1  
ATOM   836   C  CA   . THR A 1 58 ? 11.213  8.842   3.326   1.00 0.00 ? 58  THR A CA   1  
ATOM   837   C  C    . THR A 1 58 ? 9.846   9.171   2.737   1.00 0.00 ? 58  THR A C    1  
ATOM   838   O  O    . THR A 1 58 ? 9.291   8.395   1.958   1.00 0.00 ? 58  THR A O    1  
ATOM   839   C  CB   . THR A 1 58 ? 12.305  9.263   2.325   1.00 0.00 ? 58  THR A CB   1  
ATOM   840   O  OG1  . THR A 1 58 ? 13.595  8.886   2.820   1.00 0.00 ? 58  THR A OG1  1  
ATOM   841   C  CG2  . THR A 1 58 ? 12.268  10.764  2.082   1.00 0.00 ? 58  THR A CG2  1  
ATOM   842   H  H    . THR A 1 58 ? 11.733  6.813   3.022   1.00 0.00 ? 58  THR A H    1  
ATOM   843   H  HA   . THR A 1 58 ? 11.349  9.411   4.235   1.00 0.00 ? 58  THR A HA   1  
ATOM   844   H  HB   . THR A 1 58 ? 12.126  8.756   1.387   1.00 0.00 ? 58  THR A HB   1  
ATOM   845   H  HG1  . THR A 1 58 ? 14.254  9.508   2.502   1.00 0.00 ? 58  THR A HG1  1  
ATOM   846   H  HG21 . THR A 1 58 ? 11.335  11.029  1.606   1.00 0.00 ? 58  THR A HG21 1  
ATOM   847   H  HG22 . THR A 1 58 ? 13.091  11.045  1.442   1.00 0.00 ? 58  THR A HG22 1  
ATOM   848   H  HG23 . THR A 1 58 ? 12.350  11.283  3.025   1.00 0.00 ? 58  THR A HG23 1  
ATOM   849   N  N    . PHE A 1 59 ? 9.306   10.326  3.114   1.00 0.00 ? 59  PHE A N    1  
ATOM   850   C  CA   . PHE A 1 59 ? 8.003   10.757  2.622   1.00 0.00 ? 59  PHE A CA   1  
ATOM   851   C  C    . PHE A 1 59 ? 8.154   11.835  1.553   1.00 0.00 ? 59  PHE A C    1  
ATOM   852   O  O    . PHE A 1 59 ? 8.613   12.942  1.833   1.00 0.00 ? 59  PHE A O    1  
ATOM   853   C  CB   . PHE A 1 59 ? 7.148   11.284  3.777   1.00 0.00 ? 59  PHE A CB   1  
ATOM   854   C  CG   . PHE A 1 59 ? 5.825   11.843  3.336   1.00 0.00 ? 59  PHE A CG   1  
ATOM   855   C  CD1  . PHE A 1 59 ? 5.710   13.172  2.960   1.00 0.00 ? 59  PHE A CD1  1  
ATOM   856   C  CD2  . PHE A 1 59 ? 4.697   11.040  3.299   1.00 0.00 ? 59  PHE A CD2  1  
ATOM   857   C  CE1  . PHE A 1 59 ? 4.494   13.688  2.555   1.00 0.00 ? 59  PHE A CE1  1  
ATOM   858   C  CE2  . PHE A 1 59 ? 3.478   11.551  2.894   1.00 0.00 ? 59  PHE A CE2  1  
ATOM   859   C  CZ   . PHE A 1 59 ? 3.377   12.877  2.521   1.00 0.00 ? 59  PHE A CZ   1  
ATOM   860   H  H    . PHE A 1 59 ? 9.797   10.902  3.737   1.00 0.00 ? 59  PHE A H    1  
ATOM   861   H  HA   . PHE A 1 59 ? 7.514   9.900   2.186   1.00 0.00 ? 59  PHE A HA   1  
ATOM   862   H  HB2  . PHE A 1 59 ? 6.954   10.478  4.468   1.00 0.00 ? 59  PHE A HB2  1  
ATOM   863   H  HB3  . PHE A 1 59 ? 7.688   12.068  4.286   1.00 0.00 ? 59  PHE A HB3  1  
ATOM   864   H  HD1  . PHE A 1 59 ? 6.583   13.807  2.985   1.00 0.00 ? 59  PHE A HD1  1  
ATOM   865   H  HD2  . PHE A 1 59 ? 4.775   10.002  3.590   1.00 0.00 ? 59  PHE A HD2  1  
ATOM   866   H  HE1  . PHE A 1 59 ? 4.418   14.725  2.264   1.00 0.00 ? 59  PHE A HE1  1  
ATOM   867   H  HE2  . PHE A 1 59 ? 2.607   10.914  2.869   1.00 0.00 ? 59  PHE A HE2  1  
ATOM   868   H  HZ   . PHE A 1 59 ? 2.425   13.278  2.206   1.00 0.00 ? 59  PHE A HZ   1  
ATOM   869   N  N    . ASN A 1 60 ? 7.765   11.502  0.327   1.00 0.00 ? 60  ASN A N    1  
ATOM   870   C  CA   . ASN A 1 60 ? 7.858   12.441  -0.786  1.00 0.00 ? 60  ASN A CA   1  
ATOM   871   C  C    . ASN A 1 60 ? 6.494   12.652  -1.435  1.00 0.00 ? 60  ASN A C    1  
ATOM   872   O  O    . ASN A 1 60 ? 6.084   11.886  -2.306  1.00 0.00 ? 60  ASN A O    1  
ATOM   873   C  CB   . ASN A 1 60 ? 8.858   11.932  -1.827  1.00 0.00 ? 60  ASN A CB   1  
ATOM   874   C  CG   . ASN A 1 60 ? 8.916   12.821  -3.055  1.00 0.00 ? 60  ASN A CG   1  
ATOM   875   O  OD1  . ASN A 1 60 ? 8.256   12.556  -4.059  1.00 0.00 ? 60  ASN A OD1  1  
ATOM   876   N  ND2  . ASN A 1 60 ? 9.710   13.883  -2.978  1.00 0.00 ? 60  ASN A ND2  1  
ATOM   877   H  H    . ASN A 1 60 ? 7.408   10.604  0.165   1.00 0.00 ? 60  ASN A H    1  
ATOM   878   H  HA   . ASN A 1 60 ? 8.208   13.384  -0.395  1.00 0.00 ? 60  ASN A HA   1  
ATOM   879   H  HB2  . ASN A 1 60 ? 9.843   11.897  -1.385  1.00 0.00 ? 60  ASN A HB2  1  
ATOM   880   H  HB3  . ASN A 1 60 ? 8.571   10.939  -2.138  1.00 0.00 ? 60  ASN A HB3  1  
ATOM   881   H  HD21 . ASN A 1 60 ? 10.207  14.031  -2.147  1.00 0.00 ? 60  ASN A HD21 1  
ATOM   882   H  HD22 . ASN A 1 60 ? 9.767   14.475  -3.757  1.00 0.00 ? 60  ASN A HD22 1  
ATOM   883   N  N    . GLY A 1 61 ? 5.795   13.698  -1.004  1.00 0.00 ? 61  GLY A N    1  
ATOM   884   C  CA   . GLY A 1 61 ? 4.485   13.993  -1.554  1.00 0.00 ? 61  GLY A CA   1  
ATOM   885   C  C    . GLY A 1 61 ? 3.500   12.859  -1.344  1.00 0.00 ? 61  GLY A C    1  
ATOM   886   O  O    . GLY A 1 61 ? 3.051   12.616  -0.223  1.00 0.00 ? 61  GLY A O    1  
ATOM   887   H  H    . GLY A 1 61 ? 6.173   14.275  -0.307  1.00 0.00 ? 61  GLY A H    1  
ATOM   888   H  HA2  . GLY A 1 61 ? 4.100   14.883  -1.080  1.00 0.00 ? 61  GLY A HA2  1  
ATOM   889   H  HA3  . GLY A 1 61 ? 4.585   14.175  -2.614  1.00 0.00 ? 61  GLY A HA3  1  
ATOM   890   N  N    . LYS A 1 62 ? 3.161   12.164  -2.424  1.00 0.00 ? 62  LYS A N    1  
ATOM   891   C  CA   . LYS A 1 62 ? 2.223   11.050  -2.354  1.00 0.00 ? 62  LYS A CA   1  
ATOM   892   C  C    . LYS A 1 62 ? 2.963   9.718   -2.295  1.00 0.00 ? 62  LYS A C    1  
ATOM   893   O  O    . LYS A 1 62 ? 2.636   8.852   -1.484  1.00 0.00 ? 62  LYS A O    1  
ATOM   894   C  CB   . LYS A 1 62 ? 1.285   11.071  -3.563  1.00 0.00 ? 62  LYS A CB   1  
ATOM   895   C  CG   . LYS A 1 62 ? 0.403   12.306  -3.628  1.00 0.00 ? 62  LYS A CG   1  
ATOM   896   C  CD   . LYS A 1 62 ? -0.906  12.096  -2.887  1.00 0.00 ? 62  LYS A CD   1  
ATOM   897   C  CE   . LYS A 1 62 ? -1.861  11.217  -3.681  1.00 0.00 ? 62  LYS A CE   1  
ATOM   898   N  NZ   . LYS A 1 62 ? -3.182  11.083  -3.006  1.00 0.00 ? 62  LYS A NZ   1  
ATOM   899   H  H    . LYS A 1 62 ? 3.553   12.406  -3.290  1.00 0.00 ? 62  LYS A H    1  
ATOM   900   H  HA   . LYS A 1 62 ? 1.639   11.164  -1.454  1.00 0.00 ? 62  LYS A HA   1  
ATOM   901   H  HB2  . LYS A 1 62 ? 1.878   11.029  -4.465  1.00 0.00 ? 62  LYS A HB2  1  
ATOM   902   H  HB3  . LYS A 1 62 ? 0.646   10.200  -3.523  1.00 0.00 ? 62  LYS A HB3  1  
ATOM   903   H  HG2  . LYS A 1 62 ? 0.929   13.136  -3.180  1.00 0.00 ? 62  LYS A HG2  1  
ATOM   904   H  HG3  . LYS A 1 62 ? 0.189   12.530  -4.664  1.00 0.00 ? 62  LYS A HG3  1  
ATOM   905   H  HD2  . LYS A 1 62 ? -0.702  11.622  -1.939  1.00 0.00 ? 62  LYS A HD2  1  
ATOM   906   H  HD3  . LYS A 1 62 ? -1.372  13.057  -2.718  1.00 0.00 ? 62  LYS A HD3  1  
ATOM   907   H  HE2  . LYS A 1 62 ? -2.007  11.655  -4.656  1.00 0.00 ? 62  LYS A HE2  1  
ATOM   908   H  HE3  . LYS A 1 62 ? -1.420  10.237  -3.789  1.00 0.00 ? 62  LYS A HE3  1  
ATOM   909   H  HZ1  . LYS A 1 62 ? -3.531  12.019  -2.716  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM   910   H  HZ2  . LYS A 1 62 ? -3.093  10.482  -2.162  1.00 0.00 ? 62  LYS A HZ2  1  
ATOM   911   H  HZ3  . LYS A 1 62 ? -3.872  10.652  -3.654  1.00 0.00 ? 62  LYS A HZ3  1  
ATOM   912   N  N    . GLU A 1 63 ? 3.963   9.562   -3.158  1.00 0.00 ? 63  GLU A N    1  
ATOM   913   C  CA   . GLU A 1 63 ? 4.749   8.335   -3.201  1.00 0.00 ? 63  GLU A CA   1  
ATOM   914   C  C    . GLU A 1 63 ? 5.956   8.429   -2.272  1.00 0.00 ? 63  GLU A C    1  
ATOM   915   O  O    . GLU A 1 63 ? 6.496   9.513   -2.047  1.00 0.00 ? 63  GLU A O    1  
ATOM   916   C  CB   . GLU A 1 63 ? 5.213   8.051   -4.631  1.00 0.00 ? 63  GLU A CB   1  
ATOM   917   C  CG   . GLU A 1 63 ? 6.050   9.168   -5.233  1.00 0.00 ? 63  GLU A CG   1  
ATOM   918   C  CD   . GLU A 1 63 ? 6.339   8.951   -6.705  1.00 0.00 ? 63  GLU A CD   1  
ATOM   919   O  OE1  . GLU A 1 63 ? 5.556   8.237   -7.366  1.00 0.00 ? 63  GLU A OE1  1  
ATOM   920   O  OE2  . GLU A 1 63 ? 7.350   9.496   -7.197  1.00 0.00 ? 63  GLU A OE2  1  
ATOM   921   H  H    . GLU A 1 63 ? 4.175   10.289  -3.779  1.00 0.00 ? 63  GLU A H    1  
ATOM   922   H  HA   . GLU A 1 63 ? 4.117   7.525   -2.870  1.00 0.00 ? 63  GLU A HA   1  
ATOM   923   H  HB2  . GLU A 1 63 ? 5.803   7.146   -4.632  1.00 0.00 ? 63  GLU A HB2  1  
ATOM   924   H  HB3  . GLU A 1 63 ? 4.344   7.904   -5.256  1.00 0.00 ? 63  GLU A HB3  1  
ATOM   925   H  HG2  . GLU A 1 63 ? 5.517   10.100  -5.120  1.00 0.00 ? 63  GLU A HG2  1  
ATOM   926   H  HG3  . GLU A 1 63 ? 6.988   9.224   -4.701  1.00 0.00 ? 63  GLU A HG3  1  
ATOM   927   N  N    . CYS A 1 64 ? 6.372   7.287   -1.736  1.00 0.00 ? 64  CYS A N    1  
ATOM   928   C  CA   . CYS A 1 64 ? 7.515   7.240   -0.830  1.00 0.00 ? 64  CYS A CA   1  
ATOM   929   C  C    . CYS A 1 64 ? 8.685   6.500   -1.469  1.00 0.00 ? 64  CYS A C    1  
ATOM   930   O  O    . CYS A 1 64 ? 8.497   5.671   -2.359  1.00 0.00 ? 64  CYS A O    1  
ATOM   931   C  CB   . CYS A 1 64 ? 7.122   6.562   0.484   1.00 0.00 ? 64  CYS A CB   1  
ATOM   932   S  SG   . CYS A 1 64 ? 6.207   7.628   1.621   1.00 0.00 ? 64  CYS A SG   1  
ATOM   933   H  H    . CYS A 1 64 ? 5.901   6.456   -1.953  1.00 0.00 ? 64  CYS A H    1  
ATOM   934   H  HA   . CYS A 1 64 ? 7.816   8.256   -0.624  1.00 0.00 ? 64  CYS A HA   1  
ATOM   935   H  HB2  . CYS A 1 64 ? 6.501   5.705   0.266   1.00 0.00 ? 64  CYS A HB2  1  
ATOM   936   H  HB3  . CYS A 1 64 ? 8.017   6.230   0.990   1.00 0.00 ? 64  CYS A HB3  1  
ATOM   937   H  HG   . CYS A 1 64 ? 5.238   6.908   2.166   1.00 0.00 ? 64  CYS A HG   1  
ATOM   938   N  N    . MET A 1 65 ? 9.894   6.806   -1.009  1.00 0.00 ? 65  MET A N    1  
ATOM   939   C  CA   . MET A 1 65 ? 11.095  6.170   -1.537  1.00 0.00 ? 65  MET A CA   1  
ATOM   940   C  C    . MET A 1 65 ? 11.866  5.459   -0.428  1.00 0.00 ? 65  MET A C    1  
ATOM   941   O  O    . MET A 1 65 ? 11.706  5.773   0.752   1.00 0.00 ? 65  MET A O    1  
ATOM   942   C  CB   . MET A 1 65 ? 11.993  7.208   -2.213  1.00 0.00 ? 65  MET A CB   1  
ATOM   943   C  CG   . MET A 1 65 ? 11.670  7.425   -3.683  1.00 0.00 ? 65  MET A CG   1  
ATOM   944   S  SD   . MET A 1 65 ? 12.781  8.606   -4.471  1.00 0.00 ? 65  MET A SD   1  
ATOM   945   C  CE   . MET A 1 65 ? 12.241  10.136  -3.714  1.00 0.00 ? 65  MET A CE   1  
ATOM   946   H  H    . MET A 1 65 ? 9.981   7.475   -0.298  1.00 0.00 ? 65  MET A H    1  
ATOM   947   H  HA   . MET A 1 65 ? 10.788  5.440   -2.270  1.00 0.00 ? 65  MET A HA   1  
ATOM   948   H  HB2  . MET A 1 65 ? 11.883  8.151   -1.700  1.00 0.00 ? 65  MET A HB2  1  
ATOM   949   H  HB3  . MET A 1 65 ? 13.020  6.883   -2.137  1.00 0.00 ? 65  MET A HB3  1  
ATOM   950   H  HG2  . MET A 1 65 ? 11.749  6.479   -4.199  1.00 0.00 ? 65  MET A HG2  1  
ATOM   951   H  HG3  . MET A 1 65 ? 10.658  7.793   -3.764  1.00 0.00 ? 65  MET A HG3  1  
ATOM   952   H  HE1  . MET A 1 65 ? 12.589  10.972  -4.303  1.00 0.00 ? 65  MET A HE1  1  
ATOM   953   H  HE2  . MET A 1 65 ? 11.162  10.153  -3.668  1.00 0.00 ? 65  MET A HE2  1  
ATOM   954   H  HE3  . MET A 1 65 ? 12.646  10.206  -2.715  1.00 0.00 ? 65  MET A HE3  1  
ATOM   955   N  N    . CYS A 1 66 ? 12.701  4.501   -0.815  1.00 0.00 ? 66  CYS A N    1  
ATOM   956   C  CA   . CYS A 1 66 ? 13.496  3.745   0.146   1.00 0.00 ? 66  CYS A CA   1  
ATOM   957   C  C    . CYS A 1 66 ? 14.847  4.415   0.380   1.00 0.00 ? 66  CYS A C    1  
ATOM   958   O  O    . CYS A 1 66 ? 15.385  5.076   -0.507  1.00 0.00 ? 66  CYS A O    1  
ATOM   959   C  CB   . CYS A 1 66 ? 13.704  2.312   -0.348  1.00 0.00 ? 66  CYS A CB   1  
ATOM   960   S  SG   . CYS A 1 66 ? 14.804  2.176   -1.793  1.00 0.00 ? 66  CYS A SG   1  
ATOM   961   H  H    . CYS A 1 66 ? 12.785  4.296   -1.770  1.00 0.00 ? 66  CYS A H    1  
ATOM   962   H  HA   . CYS A 1 66 ? 12.954  3.720   1.079   1.00 0.00 ? 66  CYS A HA   1  
ATOM   963   H  HB2  . CYS A 1 66 ? 14.135  1.724   0.449   1.00 0.00 ? 66  CYS A HB2  1  
ATOM   964   H  HB3  . CYS A 1 66 ? 12.747  1.892   -0.621  1.00 0.00 ? 66  CYS A HB3  1  
ATOM   965   N  N    . GLN A 1 67 ? 15.388  4.239   1.582   1.00 0.00 ? 67  GLN A N    1  
ATOM   966   C  CA   . GLN A 1 67 ? 16.675  4.826   1.933   1.00 0.00 ? 67  GLN A CA   1  
ATOM   967   C  C    . GLN A 1 67 ? 17.658  4.717   0.772   1.00 0.00 ? 67  GLN A C    1  
ATOM   968   O  O    . GLN A 1 67 ? 18.299  5.698   0.392   1.00 0.00 ? 67  GLN A O    1  
ATOM   969   C  CB   . GLN A 1 67 ? 17.252  4.139   3.172   1.00 0.00 ? 67  GLN A CB   1  
ATOM   970   C  CG   . GLN A 1 67 ? 18.212  5.015   3.961   1.00 0.00 ? 67  GLN A CG   1  
ATOM   971   C  CD   . GLN A 1 67 ? 19.092  4.215   4.902   1.00 0.00 ? 67  GLN A CD   1  
ATOM   972   O  OE1  . GLN A 1 67 ? 19.021  4.373   6.121   1.00 0.00 ? 67  GLN A OE1  1  
ATOM   973   N  NE2  . GLN A 1 67 ? 19.928  3.350   4.340   1.00 0.00 ? 67  GLN A NE2  1  
ATOM   974   H  H    . GLN A 1 67 ? 14.910  3.702   2.247   1.00 0.00 ? 67  GLN A H    1  
ATOM   975   H  HA   . GLN A 1 67 ? 16.514  5.871   2.154   1.00 0.00 ? 67  GLN A HA   1  
ATOM   976   H  HB2  . GLN A 1 67 ? 16.439  3.855   3.823   1.00 0.00 ? 67  GLN A HB2  1  
ATOM   977   H  HB3  . GLN A 1 67 ? 17.783  3.251   2.862   1.00 0.00 ? 67  GLN A HB3  1  
ATOM   978   H  HG2  . GLN A 1 67 ? 18.845  5.549   3.269   1.00 0.00 ? 67  GLN A HG2  1  
ATOM   979   H  HG3  . GLN A 1 67 ? 17.638  5.722   4.542   1.00 0.00 ? 67  GLN A HG3  1  
ATOM   980   H  HE21 . GLN A 1 67 ? 19.930  3.279   3.362   1.00 0.00 ? 67  GLN A HE21 1  
ATOM   981   H  HE22 . GLN A 1 67 ? 20.508  2.821   4.924   1.00 0.00 ? 67  GLN A HE22 1  
ATOM   982   N  N    . LYS A 1 68 ? 17.773  3.518   0.211   1.00 0.00 ? 68  LYS A N    1  
ATOM   983   C  CA   . LYS A 1 68 ? 18.677  3.280   -0.908  1.00 0.00 ? 68  LYS A CA   1  
ATOM   984   C  C    . LYS A 1 68 ? 18.506  4.348   -1.983  1.00 0.00 ? 68  LYS A C    1  
ATOM   985   O  O    . LYS A 1 68 ? 19.462  5.028   -2.354  1.00 0.00 ? 68  LYS A O    1  
ATOM   986   C  CB   . LYS A 1 68 ? 18.427  1.894   -1.506  1.00 0.00 ? 68  LYS A CB   1  
ATOM   987   C  CG   . LYS A 1 68 ? 18.820  0.753   -0.583  1.00 0.00 ? 68  LYS A CG   1  
ATOM   988   C  CD   . LYS A 1 68 ? 20.277  0.363   -0.767  1.00 0.00 ? 68  LYS A CD   1  
ATOM   989   C  CE   . LYS A 1 68 ? 20.779  -0.482  0.393   1.00 0.00 ? 68  LYS A CE   1  
ATOM   990   N  NZ   . LYS A 1 68 ? 20.361  -1.906  0.263   1.00 0.00 ? 68  LYS A NZ   1  
ATOM   991   H  H    . LYS A 1 68 ? 17.235  2.775   0.558   1.00 0.00 ? 68  LYS A H    1  
ATOM   992   H  HA   . LYS A 1 68 ? 19.688  3.323   -0.532  1.00 0.00 ? 68  LYS A HA   1  
ATOM   993   H  HB2  . LYS A 1 68 ? 17.375  1.798   -1.735  1.00 0.00 ? 68  LYS A HB2  1  
ATOM   994   H  HB3  . LYS A 1 68 ? 18.995  1.801   -2.420  1.00 0.00 ? 68  LYS A HB3  1  
ATOM   995   H  HG2  . LYS A 1 68 ? 18.667  1.060   0.440   1.00 0.00 ? 68  LYS A HG2  1  
ATOM   996   H  HG3  . LYS A 1 68 ? 18.198  -0.104  -0.800  1.00 0.00 ? 68  LYS A HG3  1  
ATOM   997   H  HD2  . LYS A 1 68 ? 20.377  -0.204  -1.681  1.00 0.00 ? 68  LYS A HD2  1  
ATOM   998   H  HD3  . LYS A 1 68 ? 20.875  1.262   -0.832  1.00 0.00 ? 68  LYS A HD3  1  
ATOM   999   H  HE2  . LYS A 1 68 ? 21.857  -0.433  0.417   1.00 0.00 ? 68  LYS A HE2  1  
ATOM   1000  H  HE3  . LYS A 1 68 ? 20.379  -0.081  1.313   1.00 0.00 ? 68  LYS A HE3  1  
ATOM   1001  H  HZ1  . LYS A 1 68 ? 20.094  -2.111  -0.721  1.00 0.00 ? 68  LYS A HZ1  1  
ATOM   1002  H  HZ2  . LYS A 1 68 ? 19.545  -2.096  0.878   1.00 0.00 ? 68  LYS A HZ2  1  
ATOM   1003  H  HZ3  . LYS A 1 68 ? 21.143  -2.534  0.537   1.00 0.00 ? 68  LYS A HZ3  1  
ATOM   1004  N  N    . CYS A 1 69 ? 17.281  4.490   -2.479  1.00 0.00 ? 69  CYS A N    1  
ATOM   1005  C  CA   . CYS A 1 69 ? 16.984  5.476   -3.511  1.00 0.00 ? 69  CYS A CA   1  
ATOM   1006  C  C    . CYS A 1 69 ? 17.142  6.894   -2.970  1.00 0.00 ? 69  CYS A C    1  
ATOM   1007  O  O    . CYS A 1 69 ? 17.909  7.693   -3.508  1.00 0.00 ? 69  CYS A O    1  
ATOM   1008  C  CB   . CYS A 1 69 ? 15.563  5.276   -4.042  1.00 0.00 ? 69  CYS A CB   1  
ATOM   1009  S  SG   . CYS A 1 69 ? 15.335  3.742   -4.997  1.00 0.00 ? 69  CYS A SG   1  
ATOM   1010  H  H    . CYS A 1 69 ? 16.559  3.918   -2.143  1.00 0.00 ? 69  CYS A H    1  
ATOM   1011  H  HA   . CYS A 1 69 ? 17.684  5.332   -4.319  1.00 0.00 ? 69  CYS A HA   1  
ATOM   1012  H  HB2  . CYS A 1 69 ? 14.876  5.248   -3.208  1.00 0.00 ? 69  CYS A HB2  1  
ATOM   1013  H  HB3  . CYS A 1 69 ? 15.307  6.106   -4.685  1.00 0.00 ? 69  CYS A HB3  1  
ATOM   1014  N  N    . SER A 1 70 ? 16.411  7.199   -1.903  1.00 0.00 ? 70  SER A N    1  
ATOM   1015  C  CA   . SER A 1 70 ? 16.467  8.522   -1.291  1.00 0.00 ? 70  SER A CA   1  
ATOM   1016  C  C    . SER A 1 70 ? 17.908  9.016   -1.195  1.00 0.00 ? 70  SER A C    1  
ATOM   1017  O  O    . SER A 1 70 ? 18.202  10.170  -1.507  1.00 0.00 ? 70  SER A O    1  
ATOM   1018  C  CB   . SER A 1 70 ? 15.834  8.490   0.101   1.00 0.00 ? 70  SER A CB   1  
ATOM   1019  O  OG   . SER A 1 70 ? 15.488  9.794   0.534   1.00 0.00 ? 70  SER A OG   1  
ATOM   1020  H  H    . SER A 1 70 ? 15.818  6.519   -1.519  1.00 0.00 ? 70  SER A H    1  
ATOM   1021  H  HA   . SER A 1 70 ? 15.907  9.201   -1.916  1.00 0.00 ? 70  SER A HA   1  
ATOM   1022  H  HB2  . SER A 1 70 ? 14.941  7.884   0.074   1.00 0.00 ? 70  SER A HB2  1  
ATOM   1023  H  HB3  . SER A 1 70 ? 16.536  8.065   0.804   1.00 0.00 ? 70  SER A HB3  1  
ATOM   1024  H  HG   . SER A 1 70 ? 15.394  10.370  -0.228  1.00 0.00 ? 70  SER A HG   1  
ATOM   1025  N  N    . LEU A 1 71 ? 18.801  8.133   -0.763  1.00 0.00 ? 71  LEU A N    1  
ATOM   1026  C  CA   . LEU A 1 71 ? 20.212  8.478   -0.626  1.00 0.00 ? 71  LEU A CA   1  
ATOM   1027  C  C    . LEU A 1 71 ? 20.931  8.373   -1.967  1.00 0.00 ? 71  LEU A C    1  
ATOM   1028  O  O    . LEU A 1 71 ? 20.475  7.701   -2.892  1.00 0.00 ? 71  LEU A O    1  
ATOM   1029  C  CB   . LEU A 1 71 ? 20.884  7.562   0.399   1.00 0.00 ? 71  LEU A CB   1  
ATOM   1030  C  CG   . LEU A 1 71 ? 20.764  7.990   1.862   1.00 0.00 ? 71  LEU A CG   1  
ATOM   1031  C  CD1  . LEU A 1 71 ? 21.573  9.252   2.117   1.00 0.00 ? 71  LEU A CD1  1  
ATOM   1032  C  CD2  . LEU A 1 71 ? 19.305  8.206   2.237   1.00 0.00 ? 71  LEU A CD2  1  
ATOM   1033  H  H    . LEU A 1 71 ? 18.507  7.229   -0.530  1.00 0.00 ? 71  LEU A H    1  
ATOM   1034  H  HA   . LEU A 1 71 ? 20.272  9.498   -0.278  1.00 0.00 ? 71  LEU A HA   1  
ATOM   1035  H  HB2  . LEU A 1 71 ? 20.444  6.581   0.305   1.00 0.00 ? 71  LEU A HB2  1  
ATOM   1036  H  HB3  . LEU A 1 71 ? 21.935  7.508   0.154   1.00 0.00 ? 71  LEU A HB3  1  
ATOM   1037  H  HG   . LEU A 1 71 ? 21.160  7.207   2.494   1.00 0.00 ? 71  LEU A HG   1  
ATOM   1038  H  HD11 . LEU A 1 71 ? 22.622  9.002   2.173   1.00 0.00 ? 71  LEU A HD11 1  
ATOM   1039  H  HD12 . LEU A 1 71 ? 21.260  9.698   3.050   1.00 0.00 ? 71  LEU A HD12 1  
ATOM   1040  H  HD13 . LEU A 1 71 ? 21.411  9.953   1.311   1.00 0.00 ? 71  LEU A HD13 1  
ATOM   1041  H  HD21 . LEU A 1 71 ? 19.231  8.406   3.295   1.00 0.00 ? 71  LEU A HD21 1  
ATOM   1042  H  HD22 . LEU A 1 71 ? 18.737  7.318   1.999   1.00 0.00 ? 71  LEU A HD22 1  
ATOM   1043  H  HD23 . LEU A 1 71 ? 18.911  9.045   1.683   1.00 0.00 ? 71  LEU A HD23 1  
ATOM   1044  N  N    . PRO A 1 72 ? 22.084  9.050   -2.075  1.00 0.00 ? 72  PRO A N    1  
ATOM   1045  C  CA   . PRO A 1 72 ? 22.892  9.046   -3.298  1.00 0.00 ? 72  PRO A CA   1  
ATOM   1046  C  C    . PRO A 1 72 ? 23.549  7.694   -3.555  1.00 0.00 ? 72  PRO A C    1  
ATOM   1047  O  O    . PRO A 1 72 ? 24.072  7.062   -2.636  1.00 0.00 ? 72  PRO A O    1  
ATOM   1048  C  CB   . PRO A 1 72 ? 23.955  10.113  -3.024  1.00 0.00 ? 72  PRO A CB   1  
ATOM   1049  C  CG   . PRO A 1 72 ? 24.064  10.167  -1.539  1.00 0.00 ? 72  PRO A CG   1  
ATOM   1050  C  CD   . PRO A 1 72 ? 22.687  9.871   -1.012  1.00 0.00 ? 72  PRO A CD   1  
ATOM   1051  H  HA   . PRO A 1 72 ? 22.308  9.331   -4.161  1.00 0.00 ? 72  PRO A HA   1  
ATOM   1052  H  HB2  . PRO A 1 72 ? 24.890  9.819   -3.480  1.00 0.00 ? 72  PRO A HB2  1  
ATOM   1053  H  HB3  . PRO A 1 72 ? 23.632  11.060  -3.431  1.00 0.00 ? 72  PRO A HB3  1  
ATOM   1054  H  HG2  . PRO A 1 72 ? 24.765  9.423   -1.195  1.00 0.00 ? 72  PRO A HG2  1  
ATOM   1055  H  HG3  . PRO A 1 72 ? 24.379  11.153  -1.230  1.00 0.00 ? 72  PRO A HG3  1  
ATOM   1056  H  HD2  . PRO A 1 72 ? 22.748  9.319   -0.086  1.00 0.00 ? 72  PRO A HD2  1  
ATOM   1057  H  HD3  . PRO A 1 72 ? 22.132  10.787  -0.871  1.00 0.00 ? 72  PRO A HD3  1  
ATOM   1058  N  N    . VAL A 1 73 ? 23.519  7.255   -4.809  1.00 0.00 ? 73  VAL A N    1  
ATOM   1059  C  CA   . VAL A 1 73 ? 24.113  5.979   -5.187  1.00 0.00 ? 73  VAL A CA   1  
ATOM   1060  C  C    . VAL A 1 73 ? 25.164  6.162   -6.276  1.00 0.00 ? 73  VAL A C    1  
ATOM   1061  O  O    . VAL A 1 73 ? 24.972  6.936   -7.214  1.00 0.00 ? 73  VAL A O    1  
ATOM   1062  C  CB   . VAL A 1 73 ? 23.044  4.987   -5.682  1.00 0.00 ? 73  VAL A CB   1  
ATOM   1063  C  CG1  . VAL A 1 73 ? 22.262  5.580   -6.844  1.00 0.00 ? 73  VAL A CG1  1  
ATOM   1064  C  CG2  . VAL A 1 73 ? 23.686  3.666   -6.080  1.00 0.00 ? 73  VAL A CG2  1  
ATOM   1065  H  H    . VAL A 1 73 ? 23.088  7.804   -5.497  1.00 0.00 ? 73  VAL A H    1  
ATOM   1066  H  HA   . VAL A 1 73 ? 24.586  5.558   -4.311  1.00 0.00 ? 73  VAL A HA   1  
ATOM   1067  H  HB   . VAL A 1 73 ? 22.355  4.798   -4.872  1.00 0.00 ? 73  VAL A HB   1  
ATOM   1068  H  HG11 . VAL A 1 73 ? 22.160  6.646   -6.701  1.00 0.00 ? 73  VAL A HG11 1  
ATOM   1069  H  HG12 . VAL A 1 73 ? 22.787  5.388   -7.768  1.00 0.00 ? 73  VAL A HG12 1  
ATOM   1070  H  HG13 . VAL A 1 73 ? 21.281  5.128   -6.886  1.00 0.00 ? 73  VAL A HG13 1  
ATOM   1071  H  HG21 . VAL A 1 73 ? 23.336  3.378   -7.060  1.00 0.00 ? 73  VAL A HG21 1  
ATOM   1072  H  HG22 . VAL A 1 73 ? 24.761  3.780   -6.101  1.00 0.00 ? 73  VAL A HG22 1  
ATOM   1073  H  HG23 . VAL A 1 73 ? 23.419  2.905   -5.363  1.00 0.00 ? 73  VAL A HG23 1  
ATOM   1074  N  N    . SER A 1 74 ? 26.275  5.445   -6.145  1.00 0.00 ? 74  SER A N    1  
ATOM   1075  C  CA   . SER A 1 74 ? 27.359  5.531   -7.117  1.00 0.00 ? 74  SER A CA   1  
ATOM   1076  C  C    . SER A 1 74 ? 26.846  5.258   -8.528  1.00 0.00 ? 74  SER A C    1  
ATOM   1077  O  O    . SER A 1 74 ? 27.304  5.867   -9.495  1.00 0.00 ? 74  SER A O    1  
ATOM   1078  C  CB   . SER A 1 74 ? 28.468  4.538   -6.765  1.00 0.00 ? 74  SER A CB   1  
ATOM   1079  O  OG   . SER A 1 74 ? 29.085  4.877   -5.535  1.00 0.00 ? 74  SER A OG   1  
ATOM   1080  H  H    . SER A 1 74 ? 26.369  4.845   -5.375  1.00 0.00 ? 74  SER A H    1  
ATOM   1081  H  HA   . SER A 1 74 ? 27.759  6.533   -7.079  1.00 0.00 ? 74  SER A HA   1  
ATOM   1082  H  HB2  . SER A 1 74 ? 28.048  3.547   -6.681  1.00 0.00 ? 74  SER A HB2  1  
ATOM   1083  H  HB3  . SER A 1 74 ? 29.217  4.547   -7.544  1.00 0.00 ? 74  SER A HB3  1  
ATOM   1084  H  HG   . SER A 1 74 ? 30.018  5.049   -5.681  1.00 0.00 ? 74  SER A HG   1  
ATOM   1085  N  N    . VAL A 1 75 ? 25.893  4.339   -8.637  1.00 0.00 ? 75  VAL A N    1  
ATOM   1086  C  CA   . VAL A 1 75 ? 25.316  3.986   -9.929  1.00 0.00 ? 75  VAL A CA   1  
ATOM   1087  C  C    . VAL A 1 75 ? 23.838  4.355   -9.990  1.00 0.00 ? 75  VAL A C    1  
ATOM   1088  O  O    . VAL A 1 75 ? 23.008  3.752   -9.310  1.00 0.00 ? 75  VAL A O    1  
ATOM   1089  C  CB   . VAL A 1 75 ? 25.470  2.481   -10.219 1.00 0.00 ? 75  VAL A CB   1  
ATOM   1090  C  CG1  . VAL A 1 75 ? 26.860  2.181   -10.760 1.00 0.00 ? 75  VAL A CG1  1  
ATOM   1091  C  CG2  . VAL A 1 75 ? 25.189  1.665   -8.967  1.00 0.00 ? 75  VAL A CG2  1  
ATOM   1092  H  H    . VAL A 1 75 ? 25.569  3.888   -7.830  1.00 0.00 ? 75  VAL A H    1  
ATOM   1093  H  HA   . VAL A 1 75 ? 25.846  4.535   -10.693 1.00 0.00 ? 75  VAL A HA   1  
ATOM   1094  H  HB   . VAL A 1 75 ? 24.748  2.205   -10.973 1.00 0.00 ? 75  VAL A HB   1  
ATOM   1095  H  HG11 . VAL A 1 75 ? 26.893  2.414   -11.815 1.00 0.00 ? 75  VAL A HG11 1  
ATOM   1096  H  HG12 . VAL A 1 75 ? 27.588  2.781   -10.235 1.00 0.00 ? 75  VAL A HG12 1  
ATOM   1097  H  HG13 . VAL A 1 75 ? 27.084  1.134   -10.616 1.00 0.00 ? 75  VAL A HG13 1  
ATOM   1098  H  HG21 . VAL A 1 75 ? 25.035  0.631   -9.238  1.00 0.00 ? 75  VAL A HG21 1  
ATOM   1099  H  HG22 . VAL A 1 75 ? 26.030  1.738   -8.293  1.00 0.00 ? 75  VAL A HG22 1  
ATOM   1100  H  HG23 . VAL A 1 75 ? 24.304  2.046   -8.480  1.00 0.00 ? 75  VAL A HG23 1  
ATOM   1101  N  N    . SER A 1 76 ? 23.516  5.350   -10.810 1.00 0.00 ? 76  SER A N    1  
ATOM   1102  C  CA   . SER A 1 76 ? 22.137  5.803   -10.959 1.00 0.00 ? 76  SER A CA   1  
ATOM   1103  C  C    . SER A 1 76 ? 21.749  5.888   -12.432 1.00 0.00 ? 76  SER A C    1  
ATOM   1104  O  O    . SER A 1 76 ? 22.609  5.946   -13.310 1.00 0.00 ? 76  SER A O    1  
ATOM   1105  C  CB   . SER A 1 76 ? 21.952  7.166   -10.291 1.00 0.00 ? 76  SER A CB   1  
ATOM   1106  O  OG   . SER A 1 76 ? 22.594  8.189   -11.033 1.00 0.00 ? 76  SER A OG   1  
ATOM   1107  H  H    . SER A 1 76 ? 24.223  5.792   -11.326 1.00 0.00 ? 76  SER A H    1  
ATOM   1108  H  HA   . SER A 1 76 ? 21.498  5.082   -10.471 1.00 0.00 ? 76  SER A HA   1  
ATOM   1109  H  HB2  . SER A 1 76 ? 20.898  7.392   -10.226 1.00 0.00 ? 76  SER A HB2  1  
ATOM   1110  H  HB3  . SER A 1 76 ? 22.375  7.138   -9.297  1.00 0.00 ? 76  SER A HB3  1  
ATOM   1111  H  HG   . SER A 1 76 ? 22.806  8.922   -10.450 1.00 0.00 ? 76  SER A HG   1  
ATOM   1112  N  N    . GLY A 1 77 ? 20.446  5.895   -12.694 1.00 0.00 ? 77  GLY A N    1  
ATOM   1113  C  CA   . GLY A 1 77 ? 19.965  5.973   -14.061 1.00 0.00 ? 77  GLY A CA   1  
ATOM   1114  C  C    . GLY A 1 77 ? 18.512  5.561   -14.189 1.00 0.00 ? 77  GLY A C    1  
ATOM   1115  O  O    . GLY A 1 77 ? 17.809  5.368   -13.196 1.00 0.00 ? 77  GLY A O    1  
ATOM   1116  H  H    . GLY A 1 77 ? 19.805  5.846   -11.954 1.00 0.00 ? 77  GLY A H    1  
ATOM   1117  H  HA2  . GLY A 1 77 ? 20.072  6.988   -14.412 1.00 0.00 ? 77  GLY A HA2  1  
ATOM   1118  H  HA3  . GLY A 1 77 ? 20.567  5.323   -14.680 1.00 0.00 ? 77  GLY A HA3  1  
ATOM   1119  N  N    . PRO A 1 78 ? 18.040  5.421   -15.437 1.00 0.00 ? 78  PRO A N    1  
ATOM   1120  C  CA   . PRO A 1 78 ? 16.656  5.029   -15.720 1.00 0.00 ? 78  PRO A CA   1  
ATOM   1121  C  C    . PRO A 1 78 ? 16.376  3.577   -15.347 1.00 0.00 ? 78  PRO A C    1  
ATOM   1122  O  O    . PRO A 1 78 ? 17.206  2.697   -15.575 1.00 0.00 ? 78  PRO A O    1  
ATOM   1123  C  CB   . PRO A 1 78 ? 16.535  5.225   -17.234 1.00 0.00 ? 78  PRO A CB   1  
ATOM   1124  C  CG   . PRO A 1 78 ? 17.927  5.088   -17.746 1.00 0.00 ? 78  PRO A CG   1  
ATOM   1125  C  CD   . PRO A 1 78 ? 18.821  5.634   -16.667 1.00 0.00 ? 78  PRO A CD   1  
ATOM   1126  H  HA   . PRO A 1 78 ? 15.950  5.672   -15.215 1.00 0.00 ? 78  PRO A HA   1  
ATOM   1127  H  HB2  . PRO A 1 78 ? 15.885  4.466   -17.647 1.00 0.00 ? 78  PRO A HB2  1  
ATOM   1128  H  HB3  . PRO A 1 78 ? 16.132  6.204   -17.442 1.00 0.00 ? 78  PRO A HB3  1  
ATOM   1129  H  HG2  . PRO A 1 78 ? 18.151  4.048   -17.928 1.00 0.00 ? 78  PRO A HG2  1  
ATOM   1130  H  HG3  . PRO A 1 78 ? 18.042  5.663   -18.653 1.00 0.00 ? 78  PRO A HG3  1  
ATOM   1131  H  HD2  . PRO A 1 78 ? 19.750  5.086   -16.633 1.00 0.00 ? 78  PRO A HD2  1  
ATOM   1132  H  HD3  . PRO A 1 78 ? 19.007  6.686   -16.827 1.00 0.00 ? 78  PRO A HD3  1  
ATOM   1133  N  N    . SER A 1 79 ? 15.202  3.334   -14.774 1.00 0.00 ? 79  SER A N    1  
ATOM   1134  C  CA   . SER A 1 79 ? 14.815  1.988   -14.366 1.00 0.00 ? 79  SER A CA   1  
ATOM   1135  C  C    . SER A 1 79 ? 14.006  1.300   -15.461 1.00 0.00 ? 79  SER A C    1  
ATOM   1136  O  O    . SER A 1 79 ? 13.509  1.949   -16.381 1.00 0.00 ? 79  SER A O    1  
ATOM   1137  C  CB   . SER A 1 79 ? 14.001  2.039   -13.071 1.00 0.00 ? 79  SER A CB   1  
ATOM   1138  O  OG   . SER A 1 79 ? 14.838  2.270   -11.951 1.00 0.00 ? 79  SER A OG   1  
ATOM   1139  H  H    . SER A 1 79 ? 14.583  4.078   -14.619 1.00 0.00 ? 79  SER A H    1  
ATOM   1140  H  HA   . SER A 1 79 ? 15.718  1.422   -14.191 1.00 0.00 ? 79  SER A HA   1  
ATOM   1141  H  HB2  . SER A 1 79 ? 13.278  2.838   -13.135 1.00 0.00 ? 79  SER A HB2  1  
ATOM   1142  H  HB3  . SER A 1 79 ? 13.488  1.099   -12.935 1.00 0.00 ? 79  SER A HB3  1  
ATOM   1143  H  HG   . SER A 1 79 ? 14.988  3.213   -11.852 1.00 0.00 ? 79  SER A HG   1  
ATOM   1144  N  N    . SER A 1 80 ? 13.880  -0.019  -15.355 1.00 0.00 ? 80  SER A N    1  
ATOM   1145  C  CA   . SER A 1 80 ? 13.135  -0.797  -16.338 1.00 0.00 ? 80  SER A CA   1  
ATOM   1146  C  C    . SER A 1 80 ? 11.684  -0.333  -16.412 1.00 0.00 ? 80  SER A C    1  
ATOM   1147  O  O    . SER A 1 80 ? 11.216  0.419   -15.557 1.00 0.00 ? 80  SER A O    1  
ATOM   1148  C  CB   . SER A 1 80 ? 13.190  -2.285  -15.989 1.00 0.00 ? 80  SER A CB   1  
ATOM   1149  O  OG   . SER A 1 80 ? 12.286  -2.597  -14.942 1.00 0.00 ? 80  SER A OG   1  
ATOM   1150  H  H    . SER A 1 80 ? 14.300  -0.479  -14.599 1.00 0.00 ? 80  SER A H    1  
ATOM   1151  H  HA   . SER A 1 80 ? 13.599  -0.645  -17.301 1.00 0.00 ? 80  SER A HA   1  
ATOM   1152  H  HB2  . SER A 1 80 ? 12.927  -2.867  -16.859 1.00 0.00 ? 80  SER A HB2  1  
ATOM   1153  H  HB3  . SER A 1 80 ? 14.190  -2.541  -15.673 1.00 0.00 ? 80  SER A HB3  1  
ATOM   1154  H  HG   . SER A 1 80 ? 11.991  -1.786  -14.522 1.00 0.00 ? 80  SER A HG   1  
ATOM   1155  N  N    . GLY A 1 81 ? 10.975  -0.787  -17.441 1.00 0.00 ? 81  GLY A N    1  
ATOM   1156  C  CA   . GLY A 1 81 ? 9.584   -0.409  -17.608 1.00 0.00 ? 81  GLY A CA   1  
ATOM   1157  C  C    . GLY A 1 81 ? 8.635   -1.373  -16.925 1.00 0.00 ? 81  GLY A C    1  
ATOM   1158  O  O    . GLY A 1 81 ? 9.061   -2.099  -16.028 1.00 0.00 ? 81  GLY A O    1  
ATOM   1159  H  H    . GLY A 1 81 ? 11.400  -1.384  -18.092 1.00 0.00 ? 81  GLY A H    1  
ATOM   1160  H  HA2  . GLY A 1 81 ? 9.438   0.578   -17.195 1.00 0.00 ? 81  GLY A HA2  1  
ATOM   1161  H  HA3  . GLY A 1 81 ? 9.355   -0.383  -18.664 1.00 0.00 ? 81  GLY A HA3  1  
HETATM 1162  ZN ZN   . ZN  B 2 .  ? -3.257  -1.982  -4.195  1.00 0.00 ? 201 ZN  A ZN   1  
HETATM 1163  ZN ZN   . ZN  C 2 .  ? 13.753  2.430   -3.856  1.00 0.00 ? 401 ZN  A ZN   1  
ATOM   1164  N  N    . GLY A 1 1  ? -18.753 -21.439 -18.678 1.00 0.00 ? 1   GLY A N    2  
ATOM   1165  C  CA   . GLY A 1 1  ? -19.033 -20.635 -17.502 1.00 0.00 ? 1   GLY A CA   2  
ATOM   1166  C  C    . GLY A 1 1  ? -20.295 -21.075 -16.787 1.00 0.00 ? 1   GLY A C    2  
ATOM   1167  O  O    . GLY A 1 1  ? -21.387 -20.590 -17.084 1.00 0.00 ? 1   GLY A O    2  
ATOM   1168  H  H1   . GLY A 1 1  ? -19.481 -21.686 -19.285 1.00 0.00 ? 1   GLY A H1   2  
ATOM   1169  H  HA2  . GLY A 1 1  ? -18.200 -20.712 -16.820 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   1170  H  HA3  . GLY A 1 1  ? -19.145 -19.604 -17.804 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   1171  N  N    . SER A 1 2  ? -20.147 -21.998 -15.842 1.00 0.00 ? 2   SER A N    2  
ATOM   1172  C  CA   . SER A 1 2  ? -21.284 -22.508 -15.085 1.00 0.00 ? 2   SER A CA   2  
ATOM   1173  C  C    . SER A 1 2  ? -22.310 -21.405 -14.838 1.00 0.00 ? 2   SER A C    2  
ATOM   1174  O  O    . SER A 1 2  ? -21.954 -20.243 -14.645 1.00 0.00 ? 2   SER A O    2  
ATOM   1175  C  CB   . SER A 1 2  ? -20.816 -23.093 -13.752 1.00 0.00 ? 2   SER A CB   2  
ATOM   1176  O  OG   . SER A 1 2  ? -21.918 -23.493 -12.956 1.00 0.00 ? 2   SER A OG   2  
ATOM   1177  H  H    . SER A 1 2  ? -19.250 -22.346 -15.651 1.00 0.00 ? 2   SER A H    2  
ATOM   1178  H  HA   . SER A 1 2  ? -21.747 -23.289 -15.669 1.00 0.00 ? 2   SER A HA   2  
ATOM   1179  H  HB2  . SER A 1 2  ? -20.192 -23.953 -13.938 1.00 0.00 ? 2   SER A HB2  2  
ATOM   1180  H  HB3  . SER A 1 2  ? -20.251 -22.347 -13.213 1.00 0.00 ? 2   SER A HB3  2  
ATOM   1181  H  HG   . SER A 1 2  ? -22.466 -24.107 -13.452 1.00 0.00 ? 2   SER A HG   2  
ATOM   1182  N  N    . SER A 1 3  ? -23.585 -21.780 -14.845 1.00 0.00 ? 3   SER A N    2  
ATOM   1183  C  CA   . SER A 1 3  ? -24.664 -20.823 -14.626 1.00 0.00 ? 3   SER A CA   2  
ATOM   1184  C  C    . SER A 1 3  ? -24.842 -20.538 -13.138 1.00 0.00 ? 3   SER A C    2  
ATOM   1185  O  O    . SER A 1 3  ? -25.636 -21.190 -12.460 1.00 0.00 ? 3   SER A O    2  
ATOM   1186  C  CB   . SER A 1 3  ? -25.972 -21.354 -15.216 1.00 0.00 ? 3   SER A CB   2  
ATOM   1187  O  OG   . SER A 1 3  ? -26.008 -21.173 -16.621 1.00 0.00 ? 3   SER A OG   2  
ATOM   1188  H  H    . SER A 1 3  ? -23.806 -22.721 -15.005 1.00 0.00 ? 3   SER A H    2  
ATOM   1189  H  HA   . SER A 1 3  ? -24.399 -19.905 -15.127 1.00 0.00 ? 3   SER A HA   2  
ATOM   1190  H  HB2  . SER A 1 3  ? -26.061 -22.407 -14.998 1.00 0.00 ? 3   SER A HB2  2  
ATOM   1191  H  HB3  . SER A 1 3  ? -26.804 -20.823 -14.775 1.00 0.00 ? 3   SER A HB3  2  
ATOM   1192  H  HG   . SER A 1 3  ? -26.429 -20.335 -16.825 1.00 0.00 ? 3   SER A HG   2  
ATOM   1193  N  N    . GLY A 1 4  ? -24.097 -19.558 -12.636 1.00 0.00 ? 4   GLY A N    2  
ATOM   1194  C  CA   . GLY A 1 4  ? -24.187 -19.203 -11.232 1.00 0.00 ? 4   GLY A CA   2  
ATOM   1195  C  C    . GLY A 1 4  ? -25.361 -18.291 -10.938 1.00 0.00 ? 4   GLY A C    2  
ATOM   1196  O  O    . GLY A 1 4  ? -26.422 -18.417 -11.549 1.00 0.00 ? 4   GLY A O    2  
ATOM   1197  H  H    . GLY A 1 4  ? -23.481 -19.073 -13.224 1.00 0.00 ? 4   GLY A H    2  
ATOM   1198  H  HA2  . GLY A 1 4  ? -24.291 -20.106 -10.649 1.00 0.00 ? 4   GLY A HA2  2  
ATOM   1199  H  HA3  . GLY A 1 4  ? -23.275 -18.701 -10.940 1.00 0.00 ? 4   GLY A HA3  2  
ATOM   1200  N  N    . SER A 1 5  ? -25.173 -17.369 -9.999  1.00 0.00 ? 5   SER A N    2  
ATOM   1201  C  CA   . SER A 1 5  ? -26.228 -16.436 -9.622  1.00 0.00 ? 5   SER A CA   2  
ATOM   1202  C  C    . SER A 1 5  ? -25.644 -15.072 -9.265  1.00 0.00 ? 5   SER A C    2  
ATOM   1203  O  O    . SER A 1 5  ? -24.446 -14.944 -9.014  1.00 0.00 ? 5   SER A O    2  
ATOM   1204  C  CB   . SER A 1 5  ? -27.026 -16.986 -8.439  1.00 0.00 ? 5   SER A CB   2  
ATOM   1205  O  OG   . SER A 1 5  ? -28.122 -17.768 -8.883  1.00 0.00 ? 5   SER A OG   2  
ATOM   1206  H  H    . SER A 1 5  ? -24.304 -17.318 -9.547  1.00 0.00 ? 5   SER A H    2  
ATOM   1207  H  HA   . SER A 1 5  ? -26.888 -16.321 -10.468 1.00 0.00 ? 5   SER A HA   2  
ATOM   1208  H  HB2  . SER A 1 5  ? -26.383 -17.603 -7.829  1.00 0.00 ? 5   SER A HB2  2  
ATOM   1209  H  HB3  . SER A 1 5  ? -27.402 -16.164 -7.847  1.00 0.00 ? 5   SER A HB3  2  
ATOM   1210  H  HG   . SER A 1 5  ? -28.757 -17.863 -8.169  1.00 0.00 ? 5   SER A HG   2  
ATOM   1211  N  N    . SER A 1 6  ? -26.501 -14.056 -9.244  1.00 0.00 ? 6   SER A N    2  
ATOM   1212  C  CA   . SER A 1 6  ? -26.071 -12.700 -8.922  1.00 0.00 ? 6   SER A CA   2  
ATOM   1213  C  C    . SER A 1 6  ? -26.457 -12.332 -7.493  1.00 0.00 ? 6   SER A C    2  
ATOM   1214  O  O    . SER A 1 6  ? -27.507 -11.737 -7.256  1.00 0.00 ? 6   SER A O    2  
ATOM   1215  C  CB   . SER A 1 6  ? -26.687 -11.700 -9.903  1.00 0.00 ? 6   SER A CB   2  
ATOM   1216  O  OG   . SER A 1 6  ? -28.101 -11.700 -9.809  1.00 0.00 ? 6   SER A OG   2  
ATOM   1217  H  H    . SER A 1 6  ? -27.444 -14.222 -9.453  1.00 0.00 ? 6   SER A H    2  
ATOM   1218  H  HA   . SER A 1 6  ? -24.995 -12.663 -9.013  1.00 0.00 ? 6   SER A HA   2  
ATOM   1219  H  HB2  . SER A 1 6  ? -26.324 -10.709 -9.678  1.00 0.00 ? 6   SER A HB2  2  
ATOM   1220  H  HB3  . SER A 1 6  ? -26.405 -11.968 -10.911 1.00 0.00 ? 6   SER A HB3  2  
ATOM   1221  H  HG   . SER A 1 6  ? -28.370 -11.232 -9.015  1.00 0.00 ? 6   SER A HG   2  
ATOM   1222  N  N    . GLY A 1 7  ? -25.599 -12.693 -6.543  1.00 0.00 ? 7   GLY A N    2  
ATOM   1223  C  CA   . GLY A 1 7  ? -25.868 -12.394 -5.149  1.00 0.00 ? 7   GLY A CA   2  
ATOM   1224  C  C    . GLY A 1 7  ? -24.638 -11.896 -4.415  1.00 0.00 ? 7   GLY A C    2  
ATOM   1225  O  O    . GLY A 1 7  ? -23.924 -12.677 -3.784  1.00 0.00 ? 7   GLY A O    2  
ATOM   1226  H  H    . GLY A 1 7  ? -24.777 -13.166 -6.791  1.00 0.00 ? 7   GLY A H    2  
ATOM   1227  H  HA2  . GLY A 1 7  ? -26.637 -11.637 -5.096  1.00 0.00 ? 7   GLY A HA2  2  
ATOM   1228  H  HA3  . GLY A 1 7  ? -26.225 -13.290 -4.662  1.00 0.00 ? 7   GLY A HA3  2  
ATOM   1229  N  N    . LEU A 1 8  ? -24.388 -10.594 -4.498  1.00 0.00 ? 8   LEU A N    2  
ATOM   1230  C  CA   . LEU A 1 8  ? -23.235 -9.992  -3.838  1.00 0.00 ? 8   LEU A CA   2  
ATOM   1231  C  C    . LEU A 1 8  ? -23.642 -8.747  -3.057  1.00 0.00 ? 8   LEU A C    2  
ATOM   1232  O  O    . LEU A 1 8  ? -23.487 -7.624  -3.537  1.00 0.00 ? 8   LEU A O    2  
ATOM   1233  C  CB   . LEU A 1 8  ? -22.162 -9.635  -4.868  1.00 0.00 ? 8   LEU A CB   2  
ATOM   1234  C  CG   . LEU A 1 8  ? -21.778 -10.743 -5.849  1.00 0.00 ? 8   LEU A CG   2  
ATOM   1235  C  CD1  . LEU A 1 8  ? -21.335 -10.149 -7.178  1.00 0.00 ? 8   LEU A CD1  2  
ATOM   1236  C  CD2  . LEU A 1 8  ? -20.680 -11.618 -5.262  1.00 0.00 ? 8   LEU A CD2  2  
ATOM   1237  H  H    . LEU A 1 8  ? -24.993 -10.022 -5.015  1.00 0.00 ? 8   LEU A H    2  
ATOM   1238  H  HA   . LEU A 1 8  ? -22.832 -10.719 -3.148  1.00 0.00 ? 8   LEU A HA   2  
ATOM   1239  H  HB2  . LEU A 1 8  ? -22.523 -8.795  -5.443  1.00 0.00 ? 8   LEU A HB2  2  
ATOM   1240  H  HB3  . LEU A 1 8  ? -21.271 -9.344  -4.329  1.00 0.00 ? 8   LEU A HB3  2  
ATOM   1241  H  HG   . LEU A 1 8  ? -22.641 -11.367 -6.034  1.00 0.00 ? 8   LEU A HG   2  
ATOM   1242  H  HD11 . LEU A 1 8  ? -20.469 -10.683 -7.539  1.00 0.00 ? 8   LEU A HD11 2  
ATOM   1243  H  HD12 . LEU A 1 8  ? -21.085 -9.107  -7.041  1.00 0.00 ? 8   LEU A HD12 2  
ATOM   1244  H  HD13 . LEU A 1 8  ? -22.137 -10.236 -7.896  1.00 0.00 ? 8   LEU A HD13 2  
ATOM   1245  H  HD21 . LEU A 1 8  ? -19.732 -11.106 -5.339  1.00 0.00 ? 8   LEU A HD21 2  
ATOM   1246  H  HD22 . LEU A 1 8  ? -20.632 -12.549 -5.808  1.00 0.00 ? 8   LEU A HD22 2  
ATOM   1247  H  HD23 . LEU A 1 8  ? -20.898 -11.819 -4.224  1.00 0.00 ? 8   LEU A HD23 2  
ATOM   1248  N  N    . ASP A 1 9  ? -24.162 -8.954  -1.852  1.00 0.00 ? 9   ASP A N    2  
ATOM   1249  C  CA   . ASP A 1 9  ? -24.588 -7.848  -1.003  1.00 0.00 ? 9   ASP A CA   2  
ATOM   1250  C  C    . ASP A 1 9  ? -23.776 -7.809  0.288   1.00 0.00 ? 9   ASP A C    2  
ATOM   1251  O  O    . ASP A 1 9  ? -23.567 -6.745  0.870   1.00 0.00 ? 9   ASP A O    2  
ATOM   1252  C  CB   . ASP A 1 9  ? -26.078 -7.970  -0.680  1.00 0.00 ? 9   ASP A CB   2  
ATOM   1253  C  CG   . ASP A 1 9  ? -26.429 -9.310  -0.064  1.00 0.00 ? 9   ASP A CG   2  
ATOM   1254  O  OD1  . ASP A 1 9  ? -26.664 -10.271 -0.827  1.00 0.00 ? 9   ASP A OD1  2  
ATOM   1255  O  OD2  . ASP A 1 9  ? -26.467 -9.398  1.181   1.00 0.00 ? 9   ASP A OD2  2  
ATOM   1256  H  H    . ASP A 1 9  ? -24.260 -9.873  -1.526  1.00 0.00 ? 9   ASP A H    2  
ATOM   1257  H  HA   . ASP A 1 9  ? -24.421 -6.929  -1.546  1.00 0.00 ? 9   ASP A HA   2  
ATOM   1258  H  HB2  . ASP A 1 9  ? -26.354 -7.191  0.016   1.00 0.00 ? 9   ASP A HB2  2  
ATOM   1259  H  HB3  . ASP A 1 9  ? -26.648 -7.852  -1.590  1.00 0.00 ? 9   ASP A HB3  2  
ATOM   1260  N  N    . TYR A 1 10 ? -23.323 -8.977  0.730   1.00 0.00 ? 10  TYR A N    2  
ATOM   1261  C  CA   . TYR A 1 10 ? -22.537 -9.077  1.954   1.00 0.00 ? 10  TYR A CA   2  
ATOM   1262  C  C    . TYR A 1 10 ? -21.254 -8.259  1.847   1.00 0.00 ? 10  TYR A C    2  
ATOM   1263  O  O    . TYR A 1 10 ? -20.534 -8.083  2.829   1.00 0.00 ? 10  TYR A O    2  
ATOM   1264  C  CB   . TYR A 1 10 ? -22.200 -10.539 2.250   1.00 0.00 ? 10  TYR A CB   2  
ATOM   1265  C  CG   . TYR A 1 10 ? -22.034 -11.386 1.008   1.00 0.00 ? 10  TYR A CG   2  
ATOM   1266  C  CD1  . TYR A 1 10 ? -21.541 -10.837 -0.169  1.00 0.00 ? 10  TYR A CD1  2  
ATOM   1267  C  CD2  . TYR A 1 10 ? -22.368 -12.734 1.013   1.00 0.00 ? 10  TYR A CD2  2  
ATOM   1268  C  CE1  . TYR A 1 10 ? -21.388 -11.606 -1.306  1.00 0.00 ? 10  TYR A CE1  2  
ATOM   1269  C  CE2  . TYR A 1 10 ? -22.217 -13.512 -0.119  1.00 0.00 ? 10  TYR A CE2  2  
ATOM   1270  C  CZ   . TYR A 1 10 ? -21.727 -12.943 -1.276  1.00 0.00 ? 10  TYR A CZ   2  
ATOM   1271  O  OH   . TYR A 1 10 ? -21.575 -13.713 -2.406  1.00 0.00 ? 10  TYR A OH   2  
ATOM   1272  H  H    . TYR A 1 10 ? -23.523 -9.791  0.223   1.00 0.00 ? 10  TYR A H    2  
ATOM   1273  H  HA   . TYR A 1 10 ? -23.134 -8.685  2.765   1.00 0.00 ? 10  TYR A HA   2  
ATOM   1274  H  HB2  . TYR A 1 10 ? -21.277 -10.583 2.807   1.00 0.00 ? 10  TYR A HB2  2  
ATOM   1275  H  HB3  . TYR A 1 10 ? -22.993 -10.972 2.843   1.00 0.00 ? 10  TYR A HB3  2  
ATOM   1276  H  HD1  . TYR A 1 10 ? -21.276 -9.790  -0.189  1.00 0.00 ? 10  TYR A HD1  2  
ATOM   1277  H  HD2  . TYR A 1 10 ? -22.751 -13.177 1.921   1.00 0.00 ? 10  TYR A HD2  2  
ATOM   1278  H  HE1  . TYR A 1 10 ? -21.004 -11.162 -2.212  1.00 0.00 ? 10  TYR A HE1  2  
ATOM   1279  H  HE2  . TYR A 1 10 ? -22.482 -14.558 -0.096  1.00 0.00 ? 10  TYR A HE2  2  
ATOM   1280  H  HH   . TYR A 1 10 ? -20.668 -13.650 -2.716  1.00 0.00 ? 10  TYR A HH   2  
ATOM   1281  N  N    . GLN A 1 11 ? -20.976 -7.762  0.646   1.00 0.00 ? 11  GLN A N    2  
ATOM   1282  C  CA   . GLN A 1 11 ? -19.780 -6.962  0.409   1.00 0.00 ? 11  GLN A CA   2  
ATOM   1283  C  C    . GLN A 1 11 ? -19.989 -5.522  0.865   1.00 0.00 ? 11  GLN A C    2  
ATOM   1284  O  O    . GLN A 1 11 ? -19.037 -4.831  1.228   1.00 0.00 ? 11  GLN A O    2  
ATOM   1285  C  CB   . GLN A 1 11 ? -19.407 -6.991  -1.074  1.00 0.00 ? 11  GLN A CB   2  
ATOM   1286  C  CG   . GLN A 1 11 ? -20.499 -6.457  -1.987  1.00 0.00 ? 11  GLN A CG   2  
ATOM   1287  C  CD   . GLN A 1 11 ? -20.026 -6.270  -3.415  1.00 0.00 ? 11  GLN A CD   2  
ATOM   1288  O  OE1  . GLN A 1 11 ? -20.666 -6.736  -4.359  1.00 0.00 ? 11  GLN A OE1  2  
ATOM   1289  N  NE2  . GLN A 1 11 ? -18.901 -5.586  -3.582  1.00 0.00 ? 11  GLN A NE2  2  
ATOM   1290  H  H    . GLN A 1 11 ? -21.589 -7.936  -0.097  1.00 0.00 ? 11  GLN A H    2  
ATOM   1291  H  HA   . GLN A 1 11 ? -18.974 -7.394  0.982   1.00 0.00 ? 11  GLN A HA   2  
ATOM   1292  H  HB2  . GLN A 1 11 ? -18.520 -6.394  -1.222  1.00 0.00 ? 11  GLN A HB2  2  
ATOM   1293  H  HB3  . GLN A 1 11 ? -19.197 -8.011  -1.360  1.00 0.00 ? 11  GLN A HB3  2  
ATOM   1294  H  HG2  . GLN A 1 11 ? -21.325 -7.153  -1.985  1.00 0.00 ? 11  GLN A HG2  2  
ATOM   1295  H  HG3  . GLN A 1 11 ? -20.833 -5.503  -1.606  1.00 0.00 ? 11  GLN A HG3  2  
ATOM   1296  H  HE21 . GLN A 1 11 ? -18.444 -5.246  -2.784  1.00 0.00 ? 11  GLN A HE21 2  
ATOM   1297  H  HE22 . GLN A 1 11 ? -18.572 -5.451  -4.494  1.00 0.00 ? 11  GLN A HE22 2  
ATOM   1298  N  N    . ARG A 1 12 ? -21.241 -5.075  0.842   1.00 0.00 ? 12  ARG A N    2  
ATOM   1299  C  CA   . ARG A 1 12 ? -21.574 -3.716  1.251   1.00 0.00 ? 12  ARG A CA   2  
ATOM   1300  C  C    . ARG A 1 12 ? -20.720 -3.280  2.438   1.00 0.00 ? 12  ARG A C    2  
ATOM   1301  O  O    . ARG A 1 12 ? -20.336 -2.115  2.546   1.00 0.00 ? 12  ARG A O    2  
ATOM   1302  C  CB   . ARG A 1 12 ? -23.057 -3.619  1.613   1.00 0.00 ? 12  ARG A CB   2  
ATOM   1303  C  CG   . ARG A 1 12 ? -23.674 -2.266  1.297   1.00 0.00 ? 12  ARG A CG   2  
ATOM   1304  C  CD   . ARG A 1 12 ? -23.476 -1.282  2.439   1.00 0.00 ? 12  ARG A CD   2  
ATOM   1305  N  NE   . ARG A 1 12 ? -23.889 0.070   2.074   1.00 0.00 ? 12  ARG A NE   2  
ATOM   1306  C  CZ   . ARG A 1 12 ? -25.141 0.506   2.162   1.00 0.00 ? 12  ARG A CZ   2  
ATOM   1307  N  NH1  . ARG A 1 12 ? -26.097 -0.301  2.600   1.00 0.00 ? 12  ARG A NH1  2  
ATOM   1308  N  NH2  . ARG A 1 12 ? -25.437 1.751   1.811   1.00 0.00 ? 12  ARG A NH2  2  
ATOM   1309  H  H    . ARG A 1 12 ? -21.957 -5.673  0.542   1.00 0.00 ? 12  ARG A H    2  
ATOM   1310  H  HA   . ARG A 1 12 ? -21.372 -3.059  0.418   1.00 0.00 ? 12  ARG A HA   2  
ATOM   1311  H  HB2  . ARG A 1 12 ? -23.600 -4.375  1.065   1.00 0.00 ? 12  ARG A HB2  2  
ATOM   1312  H  HB3  . ARG A 1 12 ? -23.169 -3.802  2.671   1.00 0.00 ? 12  ARG A HB3  2  
ATOM   1313  H  HG2  . ARG A 1 12 ? -23.208 -1.867  0.408   1.00 0.00 ? 12  ARG A HG2  2  
ATOM   1314  H  HG3  . ARG A 1 12 ? -24.732 -2.396  1.123   1.00 0.00 ? 12  ARG A HG3  2  
ATOM   1315  H  HD2  . ARG A 1 12 ? -24.062 -1.611  3.285   1.00 0.00 ? 12  ARG A HD2  2  
ATOM   1316  H  HD3  . ARG A 1 12 ? -22.431 -1.270  2.708   1.00 0.00 ? 12  ARG A HD3  2  
ATOM   1317  H  HE   . ARG A 1 12 ? -23.198 0.683   1.747   1.00 0.00 ? 12  ARG A HE   2  
ATOM   1318  H  HH11 . ARG A 1 12 ? -25.876 -1.239  2.867   1.00 0.00 ? 12  ARG A HH11 2  
ATOM   1319  H  HH12 . ARG A 1 12 ? -27.039 0.030   2.667   1.00 0.00 ? 12  ARG A HH12 2  
ATOM   1320  H  HH21 . ARG A 1 12 ? -24.719 2.361   1.480   1.00 0.00 ? 12  ARG A HH21 2  
ATOM   1321  H  HH22 . ARG A 1 12 ? -26.380 2.077   1.877   1.00 0.00 ? 12  ARG A HH22 2  
ATOM   1322  N  N    . LEU A 1 13 ? -20.427 -4.223  3.327   1.00 0.00 ? 13  LEU A N    2  
ATOM   1323  C  CA   . LEU A 1 13 ? -19.618 -3.938  4.507   1.00 0.00 ? 13  LEU A CA   2  
ATOM   1324  C  C    . LEU A 1 13 ? -18.492 -2.965  4.173   1.00 0.00 ? 13  LEU A C    2  
ATOM   1325  O  O    . LEU A 1 13 ? -18.095 -2.832  3.015   1.00 0.00 ? 13  LEU A O    2  
ATOM   1326  C  CB   . LEU A 1 13 ? -19.036 -5.233  5.076   1.00 0.00 ? 13  LEU A CB   2  
ATOM   1327  C  CG   . LEU A 1 13 ? -18.392 -6.181  4.065   1.00 0.00 ? 13  LEU A CG   2  
ATOM   1328  C  CD1  . LEU A 1 13 ? -17.016 -5.674  3.660   1.00 0.00 ? 13  LEU A CD1  2  
ATOM   1329  C  CD2  . LEU A 1 13 ? -18.297 -7.588  4.637   1.00 0.00 ? 13  LEU A CD2  2  
ATOM   1330  H  H    . LEU A 1 13 ? -20.761 -5.133  3.186   1.00 0.00 ? 13  LEU A H    2  
ATOM   1331  H  HA   . LEU A 1 13 ? -20.261 -3.485  5.247   1.00 0.00 ? 13  LEU A HA   2  
ATOM   1332  H  HB2  . LEU A 1 13 ? -18.286 -4.966  5.804   1.00 0.00 ? 13  LEU A HB2  2  
ATOM   1333  H  HB3  . LEU A 1 13 ? -19.838 -5.766  5.567   1.00 0.00 ? 13  LEU A HB3  2  
ATOM   1334  H  HG   . LEU A 1 13 ? -19.006 -6.221  3.176   1.00 0.00 ? 13  LEU A HG   2  
ATOM   1335  H  HD11 . LEU A 1 13 ? -16.791 -4.769  4.204   1.00 0.00 ? 13  LEU A HD11 2  
ATOM   1336  H  HD12 . LEU A 1 13 ? -17.005 -5.470  2.600   1.00 0.00 ? 13  LEU A HD12 2  
ATOM   1337  H  HD13 . LEU A 1 13 ? -16.274 -6.426  3.889   1.00 0.00 ? 13  LEU A HD13 2  
ATOM   1338  H  HD21 . LEU A 1 13 ? -18.927 -7.663  5.511   1.00 0.00 ? 13  LEU A HD21 2  
ATOM   1339  H  HD22 . LEU A 1 13 ? -17.273 -7.796  4.912   1.00 0.00 ? 13  LEU A HD22 2  
ATOM   1340  H  HD23 . LEU A 1 13 ? -18.624 -8.301  3.895   1.00 0.00 ? 13  LEU A HD23 2  
ATOM   1341  N  N    . TYR A 1 14 ? -17.979 -2.288  5.195   1.00 0.00 ? 14  TYR A N    2  
ATOM   1342  C  CA   . TYR A 1 14 ? -16.899 -1.327  5.010   1.00 0.00 ? 14  TYR A CA   2  
ATOM   1343  C  C    . TYR A 1 14 ? -15.939 -1.789  3.918   1.00 0.00 ? 14  TYR A C    2  
ATOM   1344  O  O    . TYR A 1 14 ? -15.720 -1.089  2.930   1.00 0.00 ? 14  TYR A O    2  
ATOM   1345  C  CB   . TYR A 1 14 ? -16.137 -1.126  6.321   1.00 0.00 ? 14  TYR A CB   2  
ATOM   1346  C  CG   . TYR A 1 14 ? -15.633 -2.413  6.933   1.00 0.00 ? 14  TYR A CG   2  
ATOM   1347  C  CD1  . TYR A 1 14 ? -16.491 -3.259  7.625   1.00 0.00 ? 14  TYR A CD1  2  
ATOM   1348  C  CD2  . TYR A 1 14 ? -14.299 -2.784  6.818   1.00 0.00 ? 14  TYR A CD2  2  
ATOM   1349  C  CE1  . TYR A 1 14 ? -16.034 -4.436  8.186   1.00 0.00 ? 14  TYR A CE1  2  
ATOM   1350  C  CE2  . TYR A 1 14 ? -13.834 -3.960  7.374   1.00 0.00 ? 14  TYR A CE2  2  
ATOM   1351  C  CZ   . TYR A 1 14 ? -14.705 -4.782  8.057   1.00 0.00 ? 14  TYR A CZ   2  
ATOM   1352  O  OH   . TYR A 1 14 ? -14.246 -5.954  8.614   1.00 0.00 ? 14  TYR A OH   2  
ATOM   1353  H  H    . TYR A 1 14 ? -18.337 -2.437  6.095   1.00 0.00 ? 14  TYR A H    2  
ATOM   1354  H  HA   . TYR A 1 14 ? -17.339 -0.386  4.712   1.00 0.00 ? 14  TYR A HA   2  
ATOM   1355  H  HB2  . TYR A 1 14 ? -15.285 -0.489  6.141   1.00 0.00 ? 14  TYR A HB2  2  
ATOM   1356  H  HB3  . TYR A 1 14 ? -16.790 -0.651  7.039   1.00 0.00 ? 14  TYR A HB3  2  
ATOM   1357  H  HD1  . TYR A 1 14 ? -17.531 -2.985  7.724   1.00 0.00 ? 14  TYR A HD1  2  
ATOM   1358  H  HD2  . TYR A 1 14 ? -13.619 -2.137  6.283   1.00 0.00 ? 14  TYR A HD2  2  
ATOM   1359  H  HE1  . TYR A 1 14 ? -16.716 -5.081  8.721   1.00 0.00 ? 14  TYR A HE1  2  
ATOM   1360  H  HE2  . TYR A 1 14 ? -12.793 -4.231  7.274   1.00 0.00 ? 14  TYR A HE2  2  
ATOM   1361  H  HH   . TYR A 1 14 ? -14.038 -5.808  9.540   1.00 0.00 ? 14  TYR A HH   2  
ATOM   1362  N  N    . GLY A 1 15 ? -15.369 -2.976  4.103   1.00 0.00 ? 15  GLY A N    2  
ATOM   1363  C  CA   . GLY A 1 15 ? -14.440 -3.514  3.127   1.00 0.00 ? 15  GLY A CA   2  
ATOM   1364  C  C    . GLY A 1 15 ? -13.234 -2.619  2.920   1.00 0.00 ? 15  GLY A C    2  
ATOM   1365  O  O    . GLY A 1 15 ? -13.374 -1.443  2.580   1.00 0.00 ? 15  GLY A O    2  
ATOM   1366  H  H    . GLY A 1 15 ? -15.581 -3.491  4.910   1.00 0.00 ? 15  GLY A H    2  
ATOM   1367  H  HA2  . GLY A 1 15 ? -14.103 -4.483  3.462   1.00 0.00 ? 15  GLY A HA2  2  
ATOM   1368  H  HA3  . GLY A 1 15 ? -14.954 -3.629  2.184   1.00 0.00 ? 15  GLY A HA3  2  
ATOM   1369  N  N    . THR A 1 16 ? -12.044 -3.174  3.127   1.00 0.00 ? 16  THR A N    2  
ATOM   1370  C  CA   . THR A 1 16 ? -10.809 -2.418  2.964   1.00 0.00 ? 16  THR A CA   2  
ATOM   1371  C  C    . THR A 1 16 ? -10.300 -2.500  1.529   1.00 0.00 ? 16  THR A C    2  
ATOM   1372  O  O    . THR A 1 16 ? -9.884  -3.563  1.068   1.00 0.00 ? 16  THR A O    2  
ATOM   1373  C  CB   . THR A 1 16 ? -9.710  -2.926  3.916   1.00 0.00 ? 16  THR A CB   2  
ATOM   1374  O  OG1  . THR A 1 16 ? -10.074 -2.653  5.274   1.00 0.00 ? 16  THR A OG1  2  
ATOM   1375  C  CG2  . THR A 1 16 ? -8.375  -2.268  3.602   1.00 0.00 ? 16  THR A CG2  2  
ATOM   1376  H  H    . THR A 1 16 ? -11.998 -4.115  3.396   1.00 0.00 ? 16  THR A H    2  
ATOM   1377  H  HA   . THR A 1 16 ? -11.016 -1.386  3.204   1.00 0.00 ? 16  THR A HA   2  
ATOM   1378  H  HB   . THR A 1 16 ? -9.607  -3.994  3.787   1.00 0.00 ? 16  THR A HB   2  
ATOM   1379  H  HG1  . THR A 1 16 ? -9.573  -3.225  5.861   1.00 0.00 ? 16  THR A HG1  2  
ATOM   1380  H  HG21 . THR A 1 16 ? -8.518  -1.205  3.476   1.00 0.00 ? 16  THR A HG21 2  
ATOM   1381  H  HG22 . THR A 1 16 ? -7.972  -2.687  2.692   1.00 0.00 ? 16  THR A HG22 2  
ATOM   1382  H  HG23 . THR A 1 16 ? -7.687  -2.444  4.415   1.00 0.00 ? 16  THR A HG23 2  
ATOM   1383  N  N    . ARG A 1 17 ? -10.334 -1.371  0.829   1.00 0.00 ? 17  ARG A N    2  
ATOM   1384  C  CA   . ARG A 1 17 ? -9.876  -1.315  -0.554  1.00 0.00 ? 17  ARG A CA   2  
ATOM   1385  C  C    . ARG A 1 17 ? -8.516  -0.630  -0.649  1.00 0.00 ? 17  ARG A C    2  
ATOM   1386  O  O    . ARG A 1 17 ? -8.353  0.513   -0.220  1.00 0.00 ? 17  ARG A O    2  
ATOM   1387  C  CB   . ARG A 1 17 ? -10.895 -0.574  -1.421  1.00 0.00 ? 17  ARG A CB   2  
ATOM   1388  C  CG   . ARG A 1 17 ? -10.934 -1.056  -2.862  1.00 0.00 ? 17  ARG A CG   2  
ATOM   1389  C  CD   . ARG A 1 17 ? -11.752 -0.123  -3.740  1.00 0.00 ? 17  ARG A CD   2  
ATOM   1390  N  NE   . ARG A 1 17 ? -11.177 1.218   -3.799  1.00 0.00 ? 17  ARG A NE   2  
ATOM   1391  C  CZ   . ARG A 1 17 ? -11.467 2.181   -2.932  1.00 0.00 ? 17  ARG A CZ   2  
ATOM   1392  N  NH1  . ARG A 1 17 ? -12.322 1.953   -1.944  1.00 0.00 ? 17  ARG A NH1  2  
ATOM   1393  N  NH2  . ARG A 1 17 ? -10.902 3.376   -3.051  1.00 0.00 ? 17  ARG A NH2  2  
ATOM   1394  H  H    . ARG A 1 17 ? -10.677 -0.556  1.252   1.00 0.00 ? 17  ARG A H    2  
ATOM   1395  H  HA   . ARG A 1 17 ? -9.781  -2.329  -0.913  1.00 0.00 ? 17  ARG A HA   2  
ATOM   1396  H  HB2  . ARG A 1 17 ? -11.878 -0.705  -0.994  1.00 0.00 ? 17  ARG A HB2  2  
ATOM   1397  H  HB3  . ARG A 1 17 ? -10.650 0.478   -1.424  1.00 0.00 ? 17  ARG A HB3  2  
ATOM   1398  H  HG2  . ARG A 1 17 ? -9.925  -1.101  -3.245  1.00 0.00 ? 17  ARG A HG2  2  
ATOM   1399  H  HG3  . ARG A 1 17 ? -11.375 -2.042  -2.890  1.00 0.00 ? 17  ARG A HG3  2  
ATOM   1400  H  HD2  . ARG A 1 17 ? -11.791 -0.531  -4.739  1.00 0.00 ? 17  ARG A HD2  2  
ATOM   1401  H  HD3  . ARG A 1 17 ? -12.753 -0.058  -3.339  1.00 0.00 ? 17  ARG A HD3  2  
ATOM   1402  H  HE   . ARG A 1 17 ? -10.543 1.409   -4.521  1.00 0.00 ? 17  ARG A HE   2  
ATOM   1403  H  HH11 . ARG A 1 17 ? -12.748 1.053   -1.851  1.00 0.00 ? 17  ARG A HH11 2  
ATOM   1404  H  HH12 . ARG A 1 17 ? -12.538 2.680   -1.292  1.00 0.00 ? 17  ARG A HH12 2  
ATOM   1405  H  HH21 . ARG A 1 17 ? -10.257 3.552   -3.794  1.00 0.00 ? 17  ARG A HH21 2  
ATOM   1406  H  HH22 . ARG A 1 17 ? -11.122 4.100   -2.398  1.00 0.00 ? 17  ARG A HH22 2  
ATOM   1407  N  N    . CYS A 1 18 ? -7.542  -1.335  -1.214  1.00 0.00 ? 18  CYS A N    2  
ATOM   1408  C  CA   . CYS A 1 18 ? -6.196  -0.797  -1.365  1.00 0.00 ? 18  CYS A CA   2  
ATOM   1409  C  C    . CYS A 1 18 ? -6.228  0.560   -2.063  1.00 0.00 ? 18  CYS A C    2  
ATOM   1410  O  O    . CYS A 1 18 ? -6.694  0.677   -3.196  1.00 0.00 ? 18  CYS A O    2  
ATOM   1411  C  CB   . CYS A 1 18 ? -5.321  -1.770  -2.158  1.00 0.00 ? 18  CYS A CB   2  
ATOM   1412  S  SG   . CYS A 1 18 ? -3.588  -1.236  -2.336  1.00 0.00 ? 18  CYS A SG   2  
ATOM   1413  H  H    . CYS A 1 18 ? -7.733  -2.242  -1.538  1.00 0.00 ? 18  CYS A H    2  
ATOM   1414  H  HA   . CYS A 1 18 ? -5.776  -0.671  -0.379  1.00 0.00 ? 18  CYS A HA   2  
ATOM   1415  H  HB2  . CYS A 1 18 ? -5.319  -2.728  -1.660  1.00 0.00 ? 18  CYS A HB2  2  
ATOM   1416  H  HB3  . CYS A 1 18 ? -5.733  -1.886  -3.150  1.00 0.00 ? 18  CYS A HB3  2  
ATOM   1417  N  N    . PHE A 1 19 ? -5.729  1.583   -1.377  1.00 0.00 ? 19  PHE A N    2  
ATOM   1418  C  CA   . PHE A 1 19 ? -5.701  2.932   -1.930  1.00 0.00 ? 19  PHE A CA   2  
ATOM   1419  C  C    . PHE A 1 19 ? -4.636  3.053   -3.017  1.00 0.00 ? 19  PHE A C    2  
ATOM   1420  O  O    . PHE A 1 19 ? -4.396  4.137   -3.548  1.00 0.00 ? 19  PHE A O    2  
ATOM   1421  C  CB   . PHE A 1 19 ? -5.433  3.954   -0.823  1.00 0.00 ? 19  PHE A CB   2  
ATOM   1422  C  CG   . PHE A 1 19 ? -6.684  4.542   -0.235  1.00 0.00 ? 19  PHE A CG   2  
ATOM   1423  C  CD1  . PHE A 1 19 ? -7.553  5.283   -1.020  1.00 0.00 ? 19  PHE A CD1  2  
ATOM   1424  C  CD2  . PHE A 1 19 ? -6.991  4.355   1.103   1.00 0.00 ? 19  PHE A CD2  2  
ATOM   1425  C  CE1  . PHE A 1 19 ? -8.705  5.825   -0.482  1.00 0.00 ? 19  PHE A CE1  2  
ATOM   1426  C  CE2  . PHE A 1 19 ? -8.141  4.894   1.647   1.00 0.00 ? 19  PHE A CE2  2  
ATOM   1427  C  CZ   . PHE A 1 19 ? -8.999  5.631   0.853   1.00 0.00 ? 19  PHE A CZ   2  
ATOM   1428  H  H    . PHE A 1 19 ? -5.372  1.427   -0.478  1.00 0.00 ? 19  PHE A H    2  
ATOM   1429  H  HA   . PHE A 1 19 ? -6.667  3.131   -2.366  1.00 0.00 ? 19  PHE A HA   2  
ATOM   1430  H  HB2  . PHE A 1 19 ? -4.886  3.475   -0.025  1.00 0.00 ? 19  PHE A HB2  2  
ATOM   1431  H  HB3  . PHE A 1 19 ? -4.842  4.763   -1.225  1.00 0.00 ? 19  PHE A HB3  2  
ATOM   1432  H  HD1  . PHE A 1 19 ? -7.323  5.435   -2.065  1.00 0.00 ? 19  PHE A HD1  2  
ATOM   1433  H  HD2  . PHE A 1 19 ? -6.320  3.780   1.725   1.00 0.00 ? 19  PHE A HD2  2  
ATOM   1434  H  HE1  . PHE A 1 19 ? -9.373  6.401   -1.105  1.00 0.00 ? 19  PHE A HE1  2  
ATOM   1435  H  HE2  . PHE A 1 19 ? -8.369  4.741   2.691   1.00 0.00 ? 19  PHE A HE2  2  
ATOM   1436  H  HZ   . PHE A 1 19 ? -9.899  6.053   1.276   1.00 0.00 ? 19  PHE A HZ   2  
ATOM   1437  N  N    . SER A 1 20 ? -4.002  1.931   -3.342  1.00 0.00 ? 20  SER A N    2  
ATOM   1438  C  CA   . SER A 1 20 ? -2.960  1.911   -4.362  1.00 0.00 ? 20  SER A CA   2  
ATOM   1439  C  C    . SER A 1 20 ? -3.527  1.473   -5.709  1.00 0.00 ? 20  SER A C    2  
ATOM   1440  O  O    . SER A 1 20 ? -3.621  2.269   -6.644  1.00 0.00 ? 20  SER A O    2  
ATOM   1441  C  CB   . SER A 1 20 ? -1.826  0.972   -3.944  1.00 0.00 ? 20  SER A CB   2  
ATOM   1442  O  OG   . SER A 1 20 ? -0.622  1.295   -4.619  1.00 0.00 ? 20  SER A OG   2  
ATOM   1443  H  H    . SER A 1 20 ? -4.238  1.098   -2.883  1.00 0.00 ? 20  SER A H    2  
ATOM   1444  H  HA   . SER A 1 20 ? -2.569  2.913   -4.457  1.00 0.00 ? 20  SER A HA   2  
ATOM   1445  H  HB2  . SER A 1 20 ? -1.663  1.059   -2.881  1.00 0.00 ? 20  SER A HB2  2  
ATOM   1446  H  HB3  . SER A 1 20 ? -2.098  -0.046  -4.185  1.00 0.00 ? 20  SER A HB3  2  
ATOM   1447  H  HG   . SER A 1 20 ? -0.120  1.924   -4.094  1.00 0.00 ? 20  SER A HG   2  
ATOM   1448  N  N    . CYS A 1 21 ? -3.904  0.203   -5.801  1.00 0.00 ? 21  CYS A N    2  
ATOM   1449  C  CA   . CYS A 1 21 ? -4.462  -0.343  -7.032  1.00 0.00 ? 21  CYS A CA   2  
ATOM   1450  C  C    . CYS A 1 21 ? -5.987  -0.311  -7.000  1.00 0.00 ? 21  CYS A C    2  
ATOM   1451  O  O    . CYS A 1 21 ? -6.648  -0.763  -7.935  1.00 0.00 ? 21  CYS A O    2  
ATOM   1452  C  CB   . CYS A 1 21 ? -3.976  -1.778  -7.245  1.00 0.00 ? 21  CYS A CB   2  
ATOM   1453  S  SG   . CYS A 1 21 ? -4.299  -2.889  -5.837  1.00 0.00 ? 21  CYS A SG   2  
ATOM   1454  H  H    . CYS A 1 21 ? -3.804  -0.384  -5.021  1.00 0.00 ? 21  CYS A H    2  
ATOM   1455  H  HA   . CYS A 1 21 ? -4.118  0.269   -7.852  1.00 0.00 ? 21  CYS A HA   2  
ATOM   1456  H  HB2  . CYS A 1 21 ? -4.471  -2.194  -8.110  1.00 0.00 ? 21  CYS A HB2  2  
ATOM   1457  H  HB3  . CYS A 1 21 ? -2.910  -1.767  -7.418  1.00 0.00 ? 21  CYS A HB3  2  
ATOM   1458  N  N    . ASP A 1 22 ? -6.539  0.227   -5.918  1.00 0.00 ? 22  ASP A N    2  
ATOM   1459  C  CA   . ASP A 1 22 ? -7.986  0.320   -5.763  1.00 0.00 ? 22  ASP A CA   2  
ATOM   1460  C  C    . ASP A 1 22 ? -8.628  -1.062  -5.814  1.00 0.00 ? 22  ASP A C    2  
ATOM   1461  O  O    . ASP A 1 22 ? -9.636  -1.264  -6.491  1.00 0.00 ? 22  ASP A O    2  
ATOM   1462  C  CB   . ASP A 1 22 ? -8.580  1.213   -6.853  1.00 0.00 ? 22  ASP A CB   2  
ATOM   1463  C  CG   . ASP A 1 22 ? -8.293  2.683   -6.619  1.00 0.00 ? 22  ASP A CG   2  
ATOM   1464  O  OD1  . ASP A 1 22 ? -8.331  3.116   -5.447  1.00 0.00 ? 22  ASP A OD1  2  
ATOM   1465  O  OD2  . ASP A 1 22 ? -8.029  3.401   -7.606  1.00 0.00 ? 22  ASP A OD2  2  
ATOM   1466  H  H    . ASP A 1 22 ? -5.959  0.570   -5.206  1.00 0.00 ? 22  ASP A H    2  
ATOM   1467  H  HA   . ASP A 1 22 ? -8.189  0.762   -4.799  1.00 0.00 ? 22  ASP A HA   2  
ATOM   1468  H  HB2  . ASP A 1 22 ? -8.161  0.932   -7.809  1.00 0.00 ? 22  ASP A HB2  2  
ATOM   1469  H  HB3  . ASP A 1 22 ? -9.651  1.074   -6.880  1.00 0.00 ? 22  ASP A HB3  2  
ATOM   1470  N  N    . GLN A 1 23 ? -8.036  -2.011  -5.096  1.00 0.00 ? 23  GLN A N    2  
ATOM   1471  C  CA   . GLN A 1 23 ? -8.551  -3.375  -5.061  1.00 0.00 ? 23  GLN A CA   2  
ATOM   1472  C  C    . GLN A 1 23 ? -8.765  -3.840  -3.625  1.00 0.00 ? 23  GLN A C    2  
ATOM   1473  O  O    . GLN A 1 23 ? -7.962  -3.544  -2.739  1.00 0.00 ? 23  GLN A O    2  
ATOM   1474  C  CB   . GLN A 1 23 ? -7.588  -4.323  -5.779  1.00 0.00 ? 23  GLN A CB   2  
ATOM   1475  C  CG   . GLN A 1 23 ? -7.332  -3.947  -7.229  1.00 0.00 ? 23  GLN A CG   2  
ATOM   1476  C  CD   . GLN A 1 23 ? -8.611  -3.685  -7.999  1.00 0.00 ? 23  GLN A CD   2  
ATOM   1477  O  OE1  . GLN A 1 23 ? -9.579  -4.439  -7.894  1.00 0.00 ? 23  GLN A OE1  2  
ATOM   1478  N  NE2  . GLN A 1 23 ? -8.623  -2.610  -8.780  1.00 0.00 ? 23  GLN A NE2  2  
ATOM   1479  H  H    . GLN A 1 23 ? -7.236  -1.789  -4.577  1.00 0.00 ? 23  GLN A H    2  
ATOM   1480  H  HA   . GLN A 1 23 ? -9.500  -3.384  -5.575  1.00 0.00 ? 23  GLN A HA   2  
ATOM   1481  H  HB2  . GLN A 1 23 ? -6.644  -4.322  -5.256  1.00 0.00 ? 23  GLN A HB2  2  
ATOM   1482  H  HB3  . GLN A 1 23 ? -8.002  -5.321  -5.757  1.00 0.00 ? 23  GLN A HB3  2  
ATOM   1483  H  HG2  . GLN A 1 23 ? -6.726  -3.053  -7.254  1.00 0.00 ? 23  GLN A HG2  2  
ATOM   1484  H  HG3  . GLN A 1 23 ? -6.799  -4.755  -7.709  1.00 0.00 ? 23  GLN A HG3  2  
ATOM   1485  H  HE21 . GLN A 1 23 ? -7.815  -2.055  -8.815  1.00 0.00 ? 23  GLN A HE21 2  
ATOM   1486  H  HE22 . GLN A 1 23 ? -9.436  -2.417  -9.289  1.00 0.00 ? 23  GLN A HE22 2  
ATOM   1487  N  N    . PHE A 1 24 ? -9.852  -4.570  -3.400  1.00 0.00 ? 24  PHE A N    2  
ATOM   1488  C  CA   . PHE A 1 24 ? -10.173 -5.075  -2.070  1.00 0.00 ? 24  PHE A CA   2  
ATOM   1489  C  C    . PHE A 1 24 ? -9.034  -5.932  -1.525  1.00 0.00 ? 24  PHE A C    2  
ATOM   1490  O  O    . PHE A 1 24 ? -8.662  -6.942  -2.123  1.00 0.00 ? 24  PHE A O    2  
ATOM   1491  C  CB   . PHE A 1 24 ? -11.466 -5.892  -2.110  1.00 0.00 ? 24  PHE A CB   2  
ATOM   1492  C  CG   . PHE A 1 24 ? -12.708 -5.047  -2.140  1.00 0.00 ? 24  PHE A CG   2  
ATOM   1493  C  CD1  . PHE A 1 24 ? -12.825 -3.996  -3.036  1.00 0.00 ? 24  PHE A CD1  2  
ATOM   1494  C  CD2  . PHE A 1 24 ? -13.757 -5.304  -1.273  1.00 0.00 ? 24  PHE A CD2  2  
ATOM   1495  C  CE1  . PHE A 1 24 ? -13.966 -3.217  -3.065  1.00 0.00 ? 24  PHE A CE1  2  
ATOM   1496  C  CE2  . PHE A 1 24 ? -14.901 -4.528  -1.298  1.00 0.00 ? 24  PHE A CE2  2  
ATOM   1497  C  CZ   . PHE A 1 24 ? -15.006 -3.484  -2.196  1.00 0.00 ? 24  PHE A CZ   2  
ATOM   1498  H  H    . PHE A 1 24 ? -10.454 -4.773  -4.147  1.00 0.00 ? 24  PHE A H    2  
ATOM   1499  H  HA   . PHE A 1 24 ? -10.312 -4.227  -1.419  1.00 0.00 ? 24  PHE A HA   2  
ATOM   1500  H  HB2  . PHE A 1 24 ? -11.466 -6.511  -2.994  1.00 0.00 ? 24  PHE A HB2  2  
ATOM   1501  H  HB3  . PHE A 1 24 ? -11.513 -6.521  -1.234  1.00 0.00 ? 24  PHE A HB3  2  
ATOM   1502  H  HD1  . PHE A 1 24 ? -12.013 -3.787  -3.717  1.00 0.00 ? 24  PHE A HD1  2  
ATOM   1503  H  HD2  . PHE A 1 24 ? -13.677 -6.121  -0.570  1.00 0.00 ? 24  PHE A HD2  2  
ATOM   1504  H  HE1  . PHE A 1 24 ? -14.045 -2.401  -3.768  1.00 0.00 ? 24  PHE A HE1  2  
ATOM   1505  H  HE2  . PHE A 1 24 ? -15.712 -4.739  -0.617  1.00 0.00 ? 24  PHE A HE2  2  
ATOM   1506  H  HZ   . PHE A 1 24 ? -15.898 -2.876  -2.217  1.00 0.00 ? 24  PHE A HZ   2  
ATOM   1507  N  N    . ILE A 1 25 ? -8.485  -5.521  -0.387  1.00 0.00 ? 25  ILE A N    2  
ATOM   1508  C  CA   . ILE A 1 25 ? -7.389  -6.250  0.239   1.00 0.00 ? 25  ILE A CA   2  
ATOM   1509  C  C    . ILE A 1 25 ? -7.908  -7.429  1.055   1.00 0.00 ? 25  ILE A C    2  
ATOM   1510  O  O    . ILE A 1 25 ? -8.493  -7.248  2.122   1.00 0.00 ? 25  ILE A O    2  
ATOM   1511  C  CB   . ILE A 1 25 ? -6.554  -5.335  1.155   1.00 0.00 ? 25  ILE A CB   2  
ATOM   1512  C  CG1  . ILE A 1 25 ? -6.147  -4.063  0.408   1.00 0.00 ? 25  ILE A CG1  2  
ATOM   1513  C  CG2  . ILE A 1 25 ? -5.325  -6.073  1.664   1.00 0.00 ? 25  ILE A CG2  2  
ATOM   1514  C  CD1  . ILE A 1 25 ? -5.436  -3.052  1.279   1.00 0.00 ? 25  ILE A CD1  2  
ATOM   1515  H  H    . ILE A 1 25 ? -8.825  -4.708  0.042   1.00 0.00 ? 25  ILE A H    2  
ATOM   1516  H  HA   . ILE A 1 25 ? -6.746  -6.623  -0.545  1.00 0.00 ? 25  ILE A HA   2  
ATOM   1517  H  HB   . ILE A 1 25 ? -7.161  -5.065  2.006   1.00 0.00 ? 25  ILE A HB   2  
ATOM   1518  H  HG12 . ILE A 1 25 ? -5.486  -4.325  -0.403  1.00 0.00 ? 25  ILE A HG12 2  
ATOM   1519  H  HG13 . ILE A 1 25 ? -7.033  -3.592  0.006   1.00 0.00 ? 25  ILE A HG13 2  
ATOM   1520  H  HG21 . ILE A 1 25 ? -4.453  -5.736  1.123   1.00 0.00 ? 25  ILE A HG21 2  
ATOM   1521  H  HG22 . ILE A 1 25 ? -5.195  -5.872  2.716   1.00 0.00 ? 25  ILE A HG22 2  
ATOM   1522  H  HG23 . ILE A 1 25 ? -5.454  -7.134  1.513   1.00 0.00 ? 25  ILE A HG23 2  
ATOM   1523  H  HD11 . ILE A 1 25 ? -6.165  -2.445  1.796   1.00 0.00 ? 25  ILE A HD11 2  
ATOM   1524  H  HD12 . ILE A 1 25 ? -4.819  -3.567  2.000   1.00 0.00 ? 25  ILE A HD12 2  
ATOM   1525  H  HD13 . ILE A 1 25 ? -4.815  -2.419  0.662   1.00 0.00 ? 25  ILE A HD13 2  
ATOM   1526  N  N    . GLU A 1 26 ? -7.690  -8.637  0.544   1.00 0.00 ? 26  GLU A N    2  
ATOM   1527  C  CA   . GLU A 1 26 ? -8.135  -9.846  1.226   1.00 0.00 ? 26  GLU A CA   2  
ATOM   1528  C  C    . GLU A 1 26 ? -7.006  -10.450 2.057   1.00 0.00 ? 26  GLU A C    2  
ATOM   1529  O  O    . GLU A 1 26 ? -5.831  -10.311 1.720   1.00 0.00 ? 26  GLU A O    2  
ATOM   1530  C  CB   . GLU A 1 26 ? -8.643  -10.873 0.212   1.00 0.00 ? 26  GLU A CB   2  
ATOM   1531  C  CG   . GLU A 1 26 ? -8.947  -12.231 0.821   1.00 0.00 ? 26  GLU A CG   2  
ATOM   1532  C  CD   . GLU A 1 26 ? -9.397  -13.246 -0.211  1.00 0.00 ? 26  GLU A CD   2  
ATOM   1533  O  OE1  . GLU A 1 26 ? -8.525  -13.914 -0.805  1.00 0.00 ? 26  GLU A OE1  2  
ATOM   1534  O  OE2  . GLU A 1 26 ? -10.621 -13.372 -0.426  1.00 0.00 ? 26  GLU A OE2  2  
ATOM   1535  H  H    . GLU A 1 26 ? -7.218  -8.716  -0.311  1.00 0.00 ? 26  GLU A H    2  
ATOM   1536  H  HA   . GLU A 1 26 ? -8.946  -9.575  1.886   1.00 0.00 ? 26  GLU A HA   2  
ATOM   1537  H  HB2  . GLU A 1 26 ? -9.546  -10.495 -0.244  1.00 0.00 ? 26  GLU A HB2  2  
ATOM   1538  H  HB3  . GLU A 1 26 ? -7.893  -11.005 -0.553  1.00 0.00 ? 26  GLU A HB3  2  
ATOM   1539  H  HG2  . GLU A 1 26 ? -8.056  -12.603 1.304   1.00 0.00 ? 26  GLU A HG2  2  
ATOM   1540  H  HG3  . GLU A 1 26 ? -9.731  -12.115 1.555   1.00 0.00 ? 26  GLU A HG3  2  
ATOM   1541  N  N    . GLY A 1 27 ? -7.373  -11.121 3.144   1.00 0.00 ? 27  GLY A N    2  
ATOM   1542  C  CA   . GLY A 1 27 ? -6.380  -11.736 4.006   1.00 0.00 ? 27  GLY A CA   2  
ATOM   1543  C  C    . GLY A 1 27 ? -5.823  -10.768 5.031   1.00 0.00 ? 27  GLY A C    2  
ATOM   1544  O  O    . GLY A 1 27 ? -6.232  -10.780 6.191   1.00 0.00 ? 27  GLY A O    2  
ATOM   1545  H  H    . GLY A 1 27 ? -8.325  -11.200 3.363   1.00 0.00 ? 27  GLY A H    2  
ATOM   1546  H  HA2  . GLY A 1 27 ? -6.834  -12.569 4.522   1.00 0.00 ? 27  GLY A HA2  2  
ATOM   1547  H  HA3  . GLY A 1 27 ? -5.568  -12.103 3.396   1.00 0.00 ? 27  GLY A HA3  2  
ATOM   1548  N  N    . GLU A 1 28 ? -4.886  -9.928  4.602   1.00 0.00 ? 28  GLU A N    2  
ATOM   1549  C  CA   . GLU A 1 28 ? -4.271  -8.951  5.492   1.00 0.00 ? 28  GLU A CA   2  
ATOM   1550  C  C    . GLU A 1 28 ? -4.152  -7.592  4.809   1.00 0.00 ? 28  GLU A C    2  
ATOM   1551  O  O    . GLU A 1 28 ? -4.022  -7.507  3.588   1.00 0.00 ? 28  GLU A O    2  
ATOM   1552  C  CB   . GLU A 1 28 ? -2.889  -9.433  5.937   1.00 0.00 ? 28  GLU A CB   2  
ATOM   1553  C  CG   . GLU A 1 28 ? -2.134  -8.421  6.783   1.00 0.00 ? 28  GLU A CG   2  
ATOM   1554  C  CD   . GLU A 1 28 ? -1.077  -9.065  7.659   1.00 0.00 ? 28  GLU A CD   2  
ATOM   1555  O  OE1  . GLU A 1 28 ? -0.630  -10.183 7.326   1.00 0.00 ? 28  GLU A OE1  2  
ATOM   1556  O  OE2  . GLU A 1 28 ? -0.697  -8.451  8.678   1.00 0.00 ? 28  GLU A OE2  2  
ATOM   1557  H  H    . GLU A 1 28 ? -4.602  -9.967  3.665   1.00 0.00 ? 28  GLU A H    2  
ATOM   1558  H  HA   . GLU A 1 28 ? -4.903  -8.850  6.361   1.00 0.00 ? 28  GLU A HA   2  
ATOM   1559  H  HB2  . GLU A 1 28 ? -3.005  -10.339 6.514   1.00 0.00 ? 28  GLU A HB2  2  
ATOM   1560  H  HB3  . GLU A 1 28 ? -2.297  -9.649  5.060   1.00 0.00 ? 28  GLU A HB3  2  
ATOM   1561  H  HG2  . GLU A 1 28 ? -1.653  -7.711  6.128   1.00 0.00 ? 28  GLU A HG2  2  
ATOM   1562  H  HG3  . GLU A 1 28 ? -2.840  -7.904  7.417   1.00 0.00 ? 28  GLU A HG3  2  
ATOM   1563  N  N    . VAL A 1 29 ? -4.198  -6.529  5.607   1.00 0.00 ? 29  VAL A N    2  
ATOM   1564  C  CA   . VAL A 1 29 ? -4.095  -5.173  5.081   1.00 0.00 ? 29  VAL A CA   2  
ATOM   1565  C  C    . VAL A 1 29 ? -3.078  -4.354  5.868   1.00 0.00 ? 29  VAL A C    2  
ATOM   1566  O  O    . VAL A 1 29 ? -3.042  -4.406  7.098   1.00 0.00 ? 29  VAL A O    2  
ATOM   1567  C  CB   . VAL A 1 29 ? -5.456  -4.453  5.117   1.00 0.00 ? 29  VAL A CB   2  
ATOM   1568  C  CG1  . VAL A 1 29 ? -6.075  -4.548  6.503   1.00 0.00 ? 29  VAL A CG1  2  
ATOM   1569  C  CG2  . VAL A 1 29 ? -5.301  -3.000  4.692   1.00 0.00 ? 29  VAL A CG2  2  
ATOM   1570  H  H    . VAL A 1 29 ? -4.303  -6.661  6.573   1.00 0.00 ? 29  VAL A H    2  
ATOM   1571  H  HA   . VAL A 1 29 ? -3.772  -5.238  4.052   1.00 0.00 ? 29  VAL A HA   2  
ATOM   1572  H  HB   . VAL A 1 29 ? -6.118  -4.942  4.417   1.00 0.00 ? 29  VAL A HB   2  
ATOM   1573  H  HG11 . VAL A 1 29 ? -5.555  -3.882  7.176   1.00 0.00 ? 29  VAL A HG11 2  
ATOM   1574  H  HG12 . VAL A 1 29 ? -7.117  -4.269  6.452   1.00 0.00 ? 29  VAL A HG12 2  
ATOM   1575  H  HG13 . VAL A 1 29 ? -5.991  -5.562  6.865   1.00 0.00 ? 29  VAL A HG13 2  
ATOM   1576  H  HG21 . VAL A 1 29 ? -4.259  -2.720  4.744   1.00 0.00 ? 29  VAL A HG21 2  
ATOM   1577  H  HG22 . VAL A 1 29 ? -5.655  -2.881  3.678   1.00 0.00 ? 29  VAL A HG22 2  
ATOM   1578  H  HG23 . VAL A 1 29 ? -5.878  -2.369  5.351   1.00 0.00 ? 29  VAL A HG23 2  
ATOM   1579  N  N    . VAL A 1 30 ? -2.254  -3.598  5.151   1.00 0.00 ? 30  VAL A N    2  
ATOM   1580  C  CA   . VAL A 1 30 ? -1.236  -2.765  5.782   1.00 0.00 ? 30  VAL A CA   2  
ATOM   1581  C  C    . VAL A 1 30 ? -1.768  -1.364  6.062   1.00 0.00 ? 30  VAL A C    2  
ATOM   1582  O  O    . VAL A 1 30 ? -1.764  -0.501  5.184   1.00 0.00 ? 30  VAL A O    2  
ATOM   1583  C  CB   . VAL A 1 30 ? 0.025   -2.658  4.904   1.00 0.00 ? 30  VAL A CB   2  
ATOM   1584  C  CG1  . VAL A 1 30 ? 1.059   -1.759  5.563   1.00 0.00 ? 30  VAL A CG1  2  
ATOM   1585  C  CG2  . VAL A 1 30 ? 0.603   -4.039  4.631   1.00 0.00 ? 30  VAL A CG2  2  
ATOM   1586  H  H    . VAL A 1 30 ? -2.332  -3.599  4.174   1.00 0.00 ? 30  VAL A H    2  
ATOM   1587  H  HA   . VAL A 1 30 ? -0.959  -3.229  6.718   1.00 0.00 ? 30  VAL A HA   2  
ATOM   1588  H  HB   . VAL A 1 30 ? -0.255  -2.215  3.960   1.00 0.00 ? 30  VAL A HB   2  
ATOM   1589  H  HG11 . VAL A 1 30 ? 0.881   -1.725  6.628   1.00 0.00 ? 30  VAL A HG11 2  
ATOM   1590  H  HG12 . VAL A 1 30 ? 2.049   -2.149  5.375   1.00 0.00 ? 30  VAL A HG12 2  
ATOM   1591  H  HG13 . VAL A 1 30 ? 0.982   -0.762  5.154   1.00 0.00 ? 30  VAL A HG13 2  
ATOM   1592  H  HG21 . VAL A 1 30 ? 1.642   -3.945  4.356   1.00 0.00 ? 30  VAL A HG21 2  
ATOM   1593  H  HG22 . VAL A 1 30 ? 0.520   -4.646  5.521   1.00 0.00 ? 30  VAL A HG22 2  
ATOM   1594  H  HG23 . VAL A 1 30 ? 0.057   -4.505  3.825   1.00 0.00 ? 30  VAL A HG23 2  
ATOM   1595  N  N    . SER A 1 31 ? -2.226  -1.146  7.290   1.00 0.00 ? 31  SER A N    2  
ATOM   1596  C  CA   . SER A 1 31 ? -2.765  0.150   7.685   1.00 0.00 ? 31  SER A CA   2  
ATOM   1597  C  C    . SER A 1 31 ? -1.653  1.187   7.806   1.00 0.00 ? 31  SER A C    2  
ATOM   1598  O  O    . SER A 1 31 ? -0.863  1.160   8.750   1.00 0.00 ? 31  SER A O    2  
ATOM   1599  C  CB   . SER A 1 31 ? -3.514  0.031   9.015   1.00 0.00 ? 31  SER A CB   2  
ATOM   1600  O  OG   . SER A 1 31 ? -2.687  -0.535  10.016  1.00 0.00 ? 31  SER A OG   2  
ATOM   1601  H  H    . SER A 1 31 ? -2.203  -1.874  7.945   1.00 0.00 ? 31  SER A H    2  
ATOM   1602  H  HA   . SER A 1 31 ? -3.457  0.469   6.920   1.00 0.00 ? 31  SER A HA   2  
ATOM   1603  H  HB2  . SER A 1 31 ? -3.829  1.012   9.337   1.00 0.00 ? 31  SER A HB2  2  
ATOM   1604  H  HB3  . SER A 1 31 ? -4.381  -0.600  8.881   1.00 0.00 ? 31  SER A HB3  2  
ATOM   1605  H  HG   . SER A 1 31 ? -2.920  -1.458  10.141  1.00 0.00 ? 31  SER A HG   2  
ATOM   1606  N  N    . ALA A 1 32 ? -1.598  2.101   6.843   1.00 0.00 ? 32  ALA A N    2  
ATOM   1607  C  CA   . ALA A 1 32 ? -0.584  3.149   6.842   1.00 0.00 ? 32  ALA A CA   2  
ATOM   1608  C  C    . ALA A 1 32 ? -1.198  4.507   7.166   1.00 0.00 ? 32  ALA A C    2  
ATOM   1609  O  O    . ALA A 1 32 ? -1.915  5.086   6.349   1.00 0.00 ? 32  ALA A O    2  
ATOM   1610  C  CB   . ALA A 1 32 ? 0.125   3.196   5.496   1.00 0.00 ? 32  ALA A CB   2  
ATOM   1611  H  H    . ALA A 1 32 ? -2.255  2.071   6.117   1.00 0.00 ? 32  ALA A H    2  
ATOM   1612  H  HA   . ALA A 1 32 ? 0.148   2.906   7.598   1.00 0.00 ? 32  ALA A HA   2  
ATOM   1613  H  HB1  . ALA A 1 32 ? 1.152   2.886   5.621   1.00 0.00 ? 32  ALA A HB1  2  
ATOM   1614  H  HB2  . ALA A 1 32 ? -0.371  2.530   4.805   1.00 0.00 ? 32  ALA A HB2  2  
ATOM   1615  H  HB3  . ALA A 1 32 ? 0.096   4.203   5.109   1.00 0.00 ? 32  ALA A HB3  2  
ATOM   1616  N  N    . LEU A 1 33 ? -0.912  5.010   8.362   1.00 0.00 ? 33  LEU A N    2  
ATOM   1617  C  CA   . LEU A 1 33 ? -1.437  6.300   8.794   1.00 0.00 ? 33  LEU A CA   2  
ATOM   1618  C  C    . LEU A 1 33 ? -2.946  6.371   8.589   1.00 0.00 ? 33  LEU A C    2  
ATOM   1619  O  O    . LEU A 1 33 ? -3.484  7.412   8.215   1.00 0.00 ? 33  LEU A O    2  
ATOM   1620  C  CB   . LEU A 1 33 ? -0.753  7.434   8.028   1.00 0.00 ? 33  LEU A CB   2  
ATOM   1621  C  CG   . LEU A 1 33 ? 0.691   7.739   8.428   1.00 0.00 ? 33  LEU A CG   2  
ATOM   1622  C  CD1  . LEU A 1 33 ? 1.473   8.274   7.238   1.00 0.00 ? 33  LEU A CD1  2  
ATOM   1623  C  CD2  . LEU A 1 33 ? 0.726   8.732   9.581   1.00 0.00 ? 33  LEU A CD2  2  
ATOM   1624  H  H    . LEU A 1 33 ? -0.335  4.502   8.969   1.00 0.00 ? 33  LEU A H    2  
ATOM   1625  H  HA   . LEU A 1 33 ? -1.223  6.409   9.847   1.00 0.00 ? 33  LEU A HA   2  
ATOM   1626  H  HB2  . LEU A 1 33 ? -0.758  7.174   6.980   1.00 0.00 ? 33  LEU A HB2  2  
ATOM   1627  H  HB3  . LEU A 1 33 ? -1.336  8.332   8.177   1.00 0.00 ? 33  LEU A HB3  2  
ATOM   1628  H  HG   . LEU A 1 33 ? 1.168   6.826   8.757   1.00 0.00 ? 33  LEU A HG   2  
ATOM   1629  H  HD11 . LEU A 1 33 ? 1.142   9.276   7.011   1.00 0.00 ? 33  LEU A HD11 2  
ATOM   1630  H  HD12 . LEU A 1 33 ? 1.306   7.636   6.382   1.00 0.00 ? 33  LEU A HD12 2  
ATOM   1631  H  HD13 . LEU A 1 33 ? 2.527   8.287   7.477   1.00 0.00 ? 33  LEU A HD13 2  
ATOM   1632  H  HD21 . LEU A 1 33 ? 0.827   8.196   10.513  1.00 0.00 ? 33  LEU A HD21 2  
ATOM   1633  H  HD22 . LEU A 1 33 ? -0.190  9.304   9.592   1.00 0.00 ? 33  LEU A HD22 2  
ATOM   1634  H  HD23 . LEU A 1 33 ? 1.567   9.398   9.456   1.00 0.00 ? 33  LEU A HD23 2  
ATOM   1635  N  N    . GLY A 1 34 ? -3.625  5.255   8.839   1.00 0.00 ? 34  GLY A N    2  
ATOM   1636  C  CA   . GLY A 1 34 ? -5.067  5.213   8.678   1.00 0.00 ? 34  GLY A CA   2  
ATOM   1637  C  C    . GLY A 1 34 ? -5.484  4.645   7.336   1.00 0.00 ? 34  GLY A C    2  
ATOM   1638  O  O    . GLY A 1 34 ? -6.556  4.052   7.210   1.00 0.00 ? 34  GLY A O    2  
ATOM   1639  H  H    . GLY A 1 34 ? -3.143  4.455   9.135   1.00 0.00 ? 34  GLY A H    2  
ATOM   1640  H  HA2  . GLY A 1 34 ? -5.488  4.602   9.463   1.00 0.00 ? 34  GLY A HA2  2  
ATOM   1641  H  HA3  . GLY A 1 34 ? -5.458  6.216   8.768   1.00 0.00 ? 34  GLY A HA3  2  
ATOM   1642  N  N    . LYS A 1 35 ? -4.637  4.827   6.329   1.00 0.00 ? 35  LYS A N    2  
ATOM   1643  C  CA   . LYS A 1 35 ? -4.922  4.329   4.989   1.00 0.00 ? 35  LYS A CA   2  
ATOM   1644  C  C    . LYS A 1 35 ? -4.747  2.815   4.922   1.00 0.00 ? 35  LYS A C    2  
ATOM   1645  O  O    . LYS A 1 35 ? -4.343  2.182   5.898   1.00 0.00 ? 35  LYS A O    2  
ATOM   1646  C  CB   . LYS A 1 35 ? -4.005  5.004   3.966   1.00 0.00 ? 35  LYS A CB   2  
ATOM   1647  C  CG   . LYS A 1 35 ? -4.106  6.519   3.966   1.00 0.00 ? 35  LYS A CG   2  
ATOM   1648  C  CD   . LYS A 1 35 ? -5.378  6.993   3.282   1.00 0.00 ? 35  LYS A CD   2  
ATOM   1649  C  CE   . LYS A 1 35 ? -5.212  7.046   1.771   1.00 0.00 ? 35  LYS A CE   2  
ATOM   1650  N  NZ   . LYS A 1 35 ? -6.256  7.891   1.128   1.00 0.00 ? 35  LYS A NZ   2  
ATOM   1651  H  H    . LYS A 1 35 ? -3.797  5.307   6.492   1.00 0.00 ? 35  LYS A H    2  
ATOM   1652  H  HA   . LYS A 1 35 ? -5.947  4.572   4.756   1.00 0.00 ? 35  LYS A HA   2  
ATOM   1653  H  HB2  . LYS A 1 35 ? -2.983  4.732   4.182   1.00 0.00 ? 35  LYS A HB2  2  
ATOM   1654  H  HB3  . LYS A 1 35 ? -4.262  4.647   2.979   1.00 0.00 ? 35  LYS A HB3  2  
ATOM   1655  H  HG2  . LYS A 1 35 ? -4.107  6.871   4.986   1.00 0.00 ? 35  LYS A HG2  2  
ATOM   1656  H  HG3  . LYS A 1 35 ? -3.253  6.928   3.442   1.00 0.00 ? 35  LYS A HG3  2  
ATOM   1657  H  HD2  . LYS A 1 35 ? -6.180  6.311   3.521   1.00 0.00 ? 35  LYS A HD2  2  
ATOM   1658  H  HD3  . LYS A 1 35 ? -5.624  7.982   3.644   1.00 0.00 ? 35  LYS A HD3  2  
ATOM   1659  H  HE2  . LYS A 1 35 ? -4.240  7.455   1.543   1.00 0.00 ? 35  LYS A HE2  2  
ATOM   1660  H  HE3  . LYS A 1 35 ? -5.281  6.042   1.379   1.00 0.00 ? 35  LYS A HE3  2  
ATOM   1661  H  HZ1  . LYS A 1 35 ? -7.126  7.879   1.698   1.00 0.00 ? 35  LYS A HZ1  2  
ATOM   1662  H  HZ2  . LYS A 1 35 ? -6.474  7.528   0.178   1.00 0.00 ? 35  LYS A HZ2  2  
ATOM   1663  H  HZ3  . LYS A 1 35 ? -5.922  8.872   1.044   1.00 0.00 ? 35  LYS A HZ3  2  
ATOM   1664  N  N    . THR A 1 36 ? -5.054  2.239   3.764   1.00 0.00 ? 36  THR A N    2  
ATOM   1665  C  CA   . THR A 1 36 ? -4.931  0.799   3.570   1.00 0.00 ? 36  THR A CA   2  
ATOM   1666  C  C    . THR A 1 36 ? -4.291  0.479   2.224   1.00 0.00 ? 36  THR A C    2  
ATOM   1667  O  O    . THR A 1 36 ? -4.746  0.951   1.182   1.00 0.00 ? 36  THR A O    2  
ATOM   1668  C  CB   . THR A 1 36 ? -6.302  0.102   3.653   1.00 0.00 ? 36  THR A CB   2  
ATOM   1669  O  OG1  . THR A 1 36 ? -7.221  0.717   2.742   1.00 0.00 ? 36  THR A OG1  2  
ATOM   1670  C  CG2  . THR A 1 36 ? -6.860  0.171   5.067   1.00 0.00 ? 36  THR A CG2  2  
ATOM   1671  H  H    . THR A 1 36 ? -5.372  2.796   3.023   1.00 0.00 ? 36  THR A H    2  
ATOM   1672  H  HA   . THR A 1 36 ? -4.304  0.409   4.359   1.00 0.00 ? 36  THR A HA   2  
ATOM   1673  H  HB   . THR A 1 36 ? -6.178  -0.936  3.381   1.00 0.00 ? 36  THR A HB   2  
ATOM   1674  H  HG1  . THR A 1 36 ? -6.970  0.501   1.841   1.00 0.00 ? 36  THR A HG1  2  
ATOM   1675  H  HG21 . THR A 1 36 ? -7.878  -0.190  5.071   1.00 0.00 ? 36  THR A HG21 2  
ATOM   1676  H  HG22 . THR A 1 36 ? -6.839  1.194   5.413   1.00 0.00 ? 36  THR A HG22 2  
ATOM   1677  H  HG23 . THR A 1 36 ? -6.259  -0.442  5.721   1.00 0.00 ? 36  THR A HG23 2  
ATOM   1678  N  N    . TYR A 1 37 ? -3.236  -0.327  2.254   1.00 0.00 ? 37  TYR A N    2  
ATOM   1679  C  CA   . TYR A 1 37 ? -2.532  -0.709  1.035   1.00 0.00 ? 37  TYR A CA   2  
ATOM   1680  C  C    . TYR A 1 37 ? -2.147  -2.185  1.069   1.00 0.00 ? 37  TYR A C    2  
ATOM   1681  O  O    . TYR A 1 37 ? -2.178  -2.823  2.122   1.00 0.00 ? 37  TYR A O    2  
ATOM   1682  C  CB   . TYR A 1 37 ? -1.282  0.152   0.852   1.00 0.00 ? 37  TYR A CB   2  
ATOM   1683  C  CG   . TYR A 1 37 ? -1.559  1.638   0.884   1.00 0.00 ? 37  TYR A CG   2  
ATOM   1684  C  CD1  . TYR A 1 37 ? -2.090  2.289   -0.222  1.00 0.00 ? 37  TYR A CD1  2  
ATOM   1685  C  CD2  . TYR A 1 37 ? -1.291  2.390   2.021   1.00 0.00 ? 37  TYR A CD2  2  
ATOM   1686  C  CE1  . TYR A 1 37 ? -2.345  3.647   -0.198  1.00 0.00 ? 37  TYR A CE1  2  
ATOM   1687  C  CE2  . TYR A 1 37 ? -1.544  3.748   2.055   1.00 0.00 ? 37  TYR A CE2  2  
ATOM   1688  C  CZ   . TYR A 1 37 ? -2.071  4.372   0.944   1.00 0.00 ? 37  TYR A CZ   2  
ATOM   1689  O  OH   . TYR A 1 37 ? -2.323  5.724   0.973   1.00 0.00 ? 37  TYR A OH   2  
ATOM   1690  H  H    . TYR A 1 37 ? -2.921  -0.671  3.115   1.00 0.00 ? 37  TYR A H    2  
ATOM   1691  H  HA   . TYR A 1 37 ? -3.198  -0.542  0.201   1.00 0.00 ? 37  TYR A HA   2  
ATOM   1692  H  HB2  . TYR A 1 37 ? -0.580  -0.071  1.641   1.00 0.00 ? 37  TYR A HB2  2  
ATOM   1693  H  HB3  . TYR A 1 37 ? -0.829  -0.081  -0.101  1.00 0.00 ? 37  TYR A HB3  2  
ATOM   1694  H  HD1  . TYR A 1 37 ? -2.304  1.719   -1.115  1.00 0.00 ? 37  TYR A HD1  2  
ATOM   1695  H  HD2  . TYR A 1 37 ? -0.877  1.898   2.890   1.00 0.00 ? 37  TYR A HD2  2  
ATOM   1696  H  HE1  . TYR A 1 37 ? -2.758  4.136   -1.068  1.00 0.00 ? 37  TYR A HE1  2  
ATOM   1697  H  HE2  . TYR A 1 37 ? -1.329  4.315   2.948   1.00 0.00 ? 37  TYR A HE2  2  
ATOM   1698  H  HH   . TYR A 1 37 ? -2.944  5.918   1.679   1.00 0.00 ? 37  TYR A HH   2  
ATOM   1699  N  N    . HIS A 1 38 ? -1.782  -2.722  -0.091  1.00 0.00 ? 38  HIS A N    2  
ATOM   1700  C  CA   . HIS A 1 38 ? -1.388  -4.122  -0.195  1.00 0.00 ? 38  HIS A CA   2  
ATOM   1701  C  C    . HIS A 1 38 ? 0.025   -4.331  0.340   1.00 0.00 ? 38  HIS A C    2  
ATOM   1702  O  O    . HIS A 1 38 ? 0.808   -3.391  0.477   1.00 0.00 ? 38  HIS A O    2  
ATOM   1703  C  CB   . HIS A 1 38 ? -1.470  -4.590  -1.649  1.00 0.00 ? 38  HIS A CB   2  
ATOM   1704  C  CG   . HIS A 1 38 ? -2.807  -5.149  -2.024  1.00 0.00 ? 38  HIS A CG   2  
ATOM   1705  N  ND1  . HIS A 1 38 ? -3.508  -4.741  -3.139  1.00 0.00 ? 38  HIS A ND1  2  
ATOM   1706  C  CD2  . HIS A 1 38 ? -3.572  -6.092  -1.426  1.00 0.00 ? 38  HIS A CD2  2  
ATOM   1707  C  CE1  . HIS A 1 38 ? -4.647  -5.407  -3.209  1.00 0.00 ? 38  HIS A CE1  2  
ATOM   1708  N  NE2  . HIS A 1 38 ? -4.710  -6.234  -2.181  1.00 0.00 ? 38  HIS A NE2  2  
ATOM   1709  H  H    . HIS A 1 38 ? -1.777  -2.162  -0.895  1.00 0.00 ? 38  HIS A H    2  
ATOM   1710  H  HA   . HIS A 1 38 ? -2.075  -4.705  0.400   1.00 0.00 ? 38  HIS A HA   2  
ATOM   1711  H  HB2  . HIS A 1 38 ? -1.266  -3.753  -2.301  1.00 0.00 ? 38  HIS A HB2  2  
ATOM   1712  H  HB3  . HIS A 1 38 ? -0.729  -5.359  -1.815  1.00 0.00 ? 38  HIS A HB3  2  
ATOM   1713  H  HD2  . HIS A 1 38 ? -3.333  -6.633  -0.521  1.00 0.00 ? 38  HIS A HD2  2  
ATOM   1714  H  HE1  . HIS A 1 38 ? -5.398  -5.295  -3.976  1.00 0.00 ? 38  HIS A HE1  2  
ATOM   1715  H  HE2  . HIS A 1 38 ? -5.486  -6.783  -1.946  1.00 0.00 ? 38  HIS A HE2  2  
ATOM   1716  N  N    . PRO A 1 39 ? 0.361   -5.591  0.652   1.00 0.00 ? 39  PRO A N    2  
ATOM   1717  C  CA   . PRO A 1 39 ? 1.681   -5.953  1.178   1.00 0.00 ? 39  PRO A CA   2  
ATOM   1718  C  C    . PRO A 1 39 ? 2.779   -5.816  0.129   1.00 0.00 ? 39  PRO A C    2  
ATOM   1719  O  O    . PRO A 1 39 ? 3.958   -6.016  0.422   1.00 0.00 ? 39  PRO A O    2  
ATOM   1720  C  CB   . PRO A 1 39 ? 1.511   -7.418  1.586   1.00 0.00 ? 39  PRO A CB   2  
ATOM   1721  C  CG   . PRO A 1 39 ? 0.406   -7.926  0.726   1.00 0.00 ? 39  PRO A CG   2  
ATOM   1722  C  CD   . PRO A 1 39 ? -0.523  -6.762  0.515   1.00 0.00 ? 39  PRO A CD   2  
ATOM   1723  H  HA   . PRO A 1 39 ? 1.937   -5.362  2.045   1.00 0.00 ? 39  PRO A HA   2  
ATOM   1724  H  HB2  . PRO A 1 39 ? 2.432   -7.954  1.405   1.00 0.00 ? 39  PRO A HB2  2  
ATOM   1725  H  HB3  . PRO A 1 39 ? 1.254   -7.476  2.633   1.00 0.00 ? 39  PRO A HB3  2  
ATOM   1726  H  HG2  . PRO A 1 39 ? 0.802   -8.265  -0.219  1.00 0.00 ? 39  PRO A HG2  2  
ATOM   1727  H  HG3  . PRO A 1 39 ? -0.111  -8.730  1.229   1.00 0.00 ? 39  PRO A HG3  2  
ATOM   1728  H  HD2  . PRO A 1 39 ? -0.960  -6.802  -0.472  1.00 0.00 ? 39  PRO A HD2  2  
ATOM   1729  H  HD3  . PRO A 1 39 ? -1.294  -6.752  1.271   1.00 0.00 ? 39  PRO A HD3  2  
ATOM   1730  N  N    . ASP A 1 40 ? 2.386   -5.473  -1.092  1.00 0.00 ? 40  ASP A N    2  
ATOM   1731  C  CA   . ASP A 1 40 ? 3.338   -5.308  -2.184  1.00 0.00 ? 40  ASP A CA   2  
ATOM   1732  C  C    . ASP A 1 40 ? 3.191   -3.934  -2.830  1.00 0.00 ? 40  ASP A C    2  
ATOM   1733  O  O    . ASP A 1 40 ? 4.069   -3.486  -3.568  1.00 0.00 ? 40  ASP A O    2  
ATOM   1734  C  CB   . ASP A 1 40 ? 3.138   -6.403  -3.234  1.00 0.00 ? 40  ASP A CB   2  
ATOM   1735  C  CG   . ASP A 1 40 ? 3.832   -7.697  -2.859  1.00 0.00 ? 40  ASP A CG   2  
ATOM   1736  O  OD1  . ASP A 1 40 ? 3.730   -8.107  -1.684  1.00 0.00 ? 40  ASP A OD1  2  
ATOM   1737  O  OD2  . ASP A 1 40 ? 4.477   -8.301  -3.742  1.00 0.00 ? 40  ASP A OD2  2  
ATOM   1738  H  H    . ASP A 1 40 ? 1.431   -5.327  -1.264  1.00 0.00 ? 40  ASP A H    2  
ATOM   1739  H  HA   . ASP A 1 40 ? 4.332   -5.394  -1.773  1.00 0.00 ? 40  ASP A HA   2  
ATOM   1740  H  HB2  . ASP A 1 40 ? 2.081   -6.601  -3.341  1.00 0.00 ? 40  ASP A HB2  2  
ATOM   1741  H  HB3  . ASP A 1 40 ? 3.534   -6.062  -4.179  1.00 0.00 ? 40  ASP A HB3  2  
ATOM   1742  N  N    . CYS A 1 41 ? 2.075   -3.270  -2.549  1.00 0.00 ? 41  CYS A N    2  
ATOM   1743  C  CA   . CYS A 1 41 ? 1.811   -1.947  -3.103  1.00 0.00 ? 41  CYS A CA   2  
ATOM   1744  C  C    . CYS A 1 41 ? 2.468   -0.862  -2.256  1.00 0.00 ? 41  CYS A C    2  
ATOM   1745  O  O    . CYS A 1 41 ? 2.834   0.199   -2.762  1.00 0.00 ? 41  CYS A O    2  
ATOM   1746  C  CB   . CYS A 1 41 ? 0.303   -1.699  -3.190  1.00 0.00 ? 41  CYS A CB   2  
ATOM   1747  S  SG   . CYS A 1 41 ? -0.529  -2.632  -4.515  1.00 0.00 ? 41  CYS A SG   2  
ATOM   1748  H  H    . CYS A 1 41 ? 1.411   -3.680  -1.954  1.00 0.00 ? 41  CYS A H    2  
ATOM   1749  H  HA   . CYS A 1 41 ? 2.230   -1.914  -4.097  1.00 0.00 ? 41  CYS A HA   2  
ATOM   1750  H  HB2  . CYS A 1 41 ? -0.155  -1.982  -2.253  1.00 0.00 ? 41  CYS A HB2  2  
ATOM   1751  H  HB3  . CYS A 1 41 ? 0.129   -0.649  -3.367  1.00 0.00 ? 41  CYS A HB3  2  
ATOM   1752  N  N    . PHE A 1 42 ? 2.614   -1.135  -0.964  1.00 0.00 ? 42  PHE A N    2  
ATOM   1753  C  CA   . PHE A 1 42 ? 3.227   -0.182  -0.046  1.00 0.00 ? 42  PHE A CA   2  
ATOM   1754  C  C    . PHE A 1 42 ? 4.749   -0.241  -0.135  1.00 0.00 ? 42  PHE A C    2  
ATOM   1755  O  O    . PHE A 1 42 ? 5.444   -0.200  0.880   1.00 0.00 ? 42  PHE A O    2  
ATOM   1756  C  CB   . PHE A 1 42 ? 2.778   -0.463  1.390   1.00 0.00 ? 42  PHE A CB   2  
ATOM   1757  C  CG   . PHE A 1 42 ? 3.230   0.577   2.374   1.00 0.00 ? 42  PHE A CG   2  
ATOM   1758  C  CD1  . PHE A 1 42 ? 2.855   1.902   2.224   1.00 0.00 ? 42  PHE A CD1  2  
ATOM   1759  C  CD2  . PHE A 1 42 ? 4.030   0.230   3.451   1.00 0.00 ? 42  PHE A CD2  2  
ATOM   1760  C  CE1  . PHE A 1 42 ? 3.270   2.861   3.128   1.00 0.00 ? 42  PHE A CE1  2  
ATOM   1761  C  CE2  . PHE A 1 42 ? 4.449   1.184   4.358   1.00 0.00 ? 42  PHE A CE2  2  
ATOM   1762  C  CZ   . PHE A 1 42 ? 4.067   2.502   4.197   1.00 0.00 ? 42  PHE A CZ   2  
ATOM   1763  H  H    . PHE A 1 42 ? 2.302   -1.998  -0.619  1.00 0.00 ? 42  PHE A H    2  
ATOM   1764  H  HA   . PHE A 1 42 ? 2.900   0.807   -0.329  1.00 0.00 ? 42  PHE A HA   2  
ATOM   1765  H  HB2  . PHE A 1 42 ? 1.699   -0.502  1.421   1.00 0.00 ? 42  PHE A HB2  2  
ATOM   1766  H  HB3  . PHE A 1 42 ? 3.177   -1.415  1.704   1.00 0.00 ? 42  PHE A HB3  2  
ATOM   1767  H  HD1  . PHE A 1 42 ? 2.231   2.185   1.389   1.00 0.00 ? 42  PHE A HD1  2  
ATOM   1768  H  HD2  . PHE A 1 42 ? 4.329   -0.802  3.578   1.00 0.00 ? 42  PHE A HD2  2  
ATOM   1769  H  HE1  . PHE A 1 42 ? 2.970   3.891   3.000   1.00 0.00 ? 42  PHE A HE1  2  
ATOM   1770  H  HE2  . PHE A 1 42 ? 5.072   0.899   5.193   1.00 0.00 ? 42  PHE A HE2  2  
ATOM   1771  H  HZ   . PHE A 1 42 ? 4.394   3.249   4.905   1.00 0.00 ? 42  PHE A HZ   2  
ATOM   1772  N  N    . VAL A 1 43 ? 5.260   -0.340  -1.358  1.00 0.00 ? 43  VAL A N    2  
ATOM   1773  C  CA   . VAL A 1 43 ? 6.700   -0.405  -1.582  1.00 0.00 ? 43  VAL A CA   2  
ATOM   1774  C  C    . VAL A 1 43 ? 7.202   0.844   -2.298  1.00 0.00 ? 43  VAL A C    2  
ATOM   1775  O  O    . VAL A 1 43 ? 6.414   1.630   -2.825  1.00 0.00 ? 43  VAL A O    2  
ATOM   1776  C  CB   . VAL A 1 43 ? 7.084   -1.646  -2.409  1.00 0.00 ? 43  VAL A CB   2  
ATOM   1777  C  CG1  . VAL A 1 43 ? 6.472   -2.901  -1.804  1.00 0.00 ? 43  VAL A CG1  2  
ATOM   1778  C  CG2  . VAL A 1 43 ? 6.650   -1.476  -3.857  1.00 0.00 ? 43  VAL A CG2  2  
ATOM   1779  H  H    . VAL A 1 43 ? 4.655   -0.368  -2.128  1.00 0.00 ? 43  VAL A H    2  
ATOM   1780  H  HA   . VAL A 1 43 ? 7.184   -0.475  -0.619  1.00 0.00 ? 43  VAL A HA   2  
ATOM   1781  H  HB   . VAL A 1 43 ? 8.158   -1.750  -2.387  1.00 0.00 ? 43  VAL A HB   2  
ATOM   1782  H  HG11 . VAL A 1 43 ? 6.228   -3.597  -2.593  1.00 0.00 ? 43  VAL A HG11 2  
ATOM   1783  H  HG12 . VAL A 1 43 ? 7.179   -3.356  -1.126  1.00 0.00 ? 43  VAL A HG12 2  
ATOM   1784  H  HG13 . VAL A 1 43 ? 5.573   -2.639  -1.266  1.00 0.00 ? 43  VAL A HG13 2  
ATOM   1785  H  HG21 . VAL A 1 43 ? 5.895   -0.707  -3.918  1.00 0.00 ? 43  VAL A HG21 2  
ATOM   1786  H  HG22 . VAL A 1 43 ? 7.502   -1.191  -4.457  1.00 0.00 ? 43  VAL A HG22 2  
ATOM   1787  H  HG23 . VAL A 1 43 ? 6.247   -2.408  -4.224  1.00 0.00 ? 43  VAL A HG23 2  
ATOM   1788  N  N    . CYS A 1 44 ? 8.518   1.022   -2.313  1.00 0.00 ? 44  CYS A N    2  
ATOM   1789  C  CA   . CYS A 1 44 ? 9.127   2.175   -2.964  1.00 0.00 ? 44  CYS A CA   2  
ATOM   1790  C  C    . CYS A 1 44 ? 8.452   2.465   -4.301  1.00 0.00 ? 44  CYS A C    2  
ATOM   1791  O  O    . CYS A 1 44 ? 7.726   1.627   -4.835  1.00 0.00 ? 44  CYS A O    2  
ATOM   1792  C  CB   . CYS A 1 44 ? 10.623  1.936   -3.177  1.00 0.00 ? 44  CYS A CB   2  
ATOM   1793  S  SG   . CYS A 1 44 ? 11.528  3.390   -3.799  1.00 0.00 ? 44  CYS A SG   2  
ATOM   1794  H  H    . CYS A 1 44 ? 9.095   0.361   -1.875  1.00 0.00 ? 44  CYS A H    2  
ATOM   1795  H  HA   . CYS A 1 44 ? 8.997   3.029   -2.316  1.00 0.00 ? 44  CYS A HA   2  
ATOM   1796  H  HB2  . CYS A 1 44 ? 11.072  1.649   -2.236  1.00 0.00 ? 44  CYS A HB2  2  
ATOM   1797  H  HB3  . CYS A 1 44 ? 10.754  1.137   -3.891  1.00 0.00 ? 44  CYS A HB3  2  
ATOM   1798  N  N    . ALA A 1 45 ? 8.697   3.656   -4.836  1.00 0.00 ? 45  ALA A N    2  
ATOM   1799  C  CA   . ALA A 1 45 ? 8.115   4.056   -6.111  1.00 0.00 ? 45  ALA A CA   2  
ATOM   1800  C  C    . ALA A 1 45 ? 9.161   4.039   -7.221  1.00 0.00 ? 45  ALA A C    2  
ATOM   1801  O  O    . ALA A 1 45 ? 8.835   3.843   -8.392  1.00 0.00 ? 45  ALA A O    2  
ATOM   1802  C  CB   . ALA A 1 45 ? 7.488   5.437   -5.996  1.00 0.00 ? 45  ALA A CB   2  
ATOM   1803  H  H    . ALA A 1 45 ? 9.285   4.281   -4.362  1.00 0.00 ? 45  ALA A H    2  
ATOM   1804  H  HA   . ALA A 1 45 ? 7.334   3.351   -6.357  1.00 0.00 ? 45  ALA A HA   2  
ATOM   1805  H  HB1  . ALA A 1 45 ? 7.325   5.841   -6.984  1.00 0.00 ? 45  ALA A HB1  2  
ATOM   1806  H  HB2  . ALA A 1 45 ? 6.544   5.361   -5.477  1.00 0.00 ? 45  ALA A HB2  2  
ATOM   1807  H  HB3  . ALA A 1 45 ? 8.150   6.088   -5.445  1.00 0.00 ? 45  ALA A HB3  2  
ATOM   1808  N  N    . VAL A 1 46 ? 10.419  4.247   -6.846  1.00 0.00 ? 46  VAL A N    2  
ATOM   1809  C  CA   . VAL A 1 46 ? 11.513  4.255   -7.810  1.00 0.00 ? 46  VAL A CA   2  
ATOM   1810  C  C    . VAL A 1 46 ? 11.950  2.836   -8.157  1.00 0.00 ? 46  VAL A C    2  
ATOM   1811  O  O    . VAL A 1 46 ? 11.812  2.394   -9.298  1.00 0.00 ? 46  VAL A O    2  
ATOM   1812  C  CB   . VAL A 1 46 ? 12.727  5.038   -7.274  1.00 0.00 ? 46  VAL A CB   2  
ATOM   1813  C  CG1  . VAL A 1 46 ? 13.794  5.169   -8.350  1.00 0.00 ? 46  VAL A CG1  2  
ATOM   1814  C  CG2  . VAL A 1 46 ? 12.297  6.406   -6.768  1.00 0.00 ? 46  VAL A CG2  2  
ATOM   1815  H  H    . VAL A 1 46 ? 10.617  4.397   -5.898  1.00 0.00 ? 46  VAL A H    2  
ATOM   1816  H  HA   . VAL A 1 46 ? 11.164  4.744   -8.707  1.00 0.00 ? 46  VAL A HA   2  
ATOM   1817  H  HB   . VAL A 1 46 ? 13.148  4.487   -6.446  1.00 0.00 ? 46  VAL A HB   2  
ATOM   1818  H  HG11 . VAL A 1 46 ? 13.332  5.111   -9.324  1.00 0.00 ? 46  VAL A HG11 2  
ATOM   1819  H  HG12 . VAL A 1 46 ? 14.297  6.119   -8.244  1.00 0.00 ? 46  VAL A HG12 2  
ATOM   1820  H  HG13 . VAL A 1 46 ? 14.512  4.368   -8.245  1.00 0.00 ? 46  VAL A HG13 2  
ATOM   1821  H  HG21 . VAL A 1 46 ? 11.506  6.289   -6.042  1.00 0.00 ? 46  VAL A HG21 2  
ATOM   1822  H  HG22 . VAL A 1 46 ? 13.139  6.901   -6.306  1.00 0.00 ? 46  VAL A HG22 2  
ATOM   1823  H  HG23 . VAL A 1 46 ? 11.941  7.001   -7.596  1.00 0.00 ? 46  VAL A HG23 2  
ATOM   1824  N  N    . CYS A 1 47 ? 12.478  2.126   -7.166  1.00 0.00 ? 47  CYS A N    2  
ATOM   1825  C  CA   . CYS A 1 47 ? 12.936  0.757   -7.366  1.00 0.00 ? 47  CYS A CA   2  
ATOM   1826  C  C    . CYS A 1 47 ? 11.801  -0.236  -7.131  1.00 0.00 ? 47  CYS A C    2  
ATOM   1827  O  O    . CYS A 1 47 ? 11.857  -1.378  -7.588  1.00 0.00 ? 47  CYS A O    2  
ATOM   1828  C  CB   . CYS A 1 47 ? 14.103  0.445   -6.427  1.00 0.00 ? 47  CYS A CB   2  
ATOM   1829  S  SG   . CYS A 1 47 ? 13.680  0.540   -4.657  1.00 0.00 ? 47  CYS A SG   2  
ATOM   1830  H  H    . CYS A 1 47 ? 12.562  2.533   -6.278  1.00 0.00 ? 47  CYS A H    2  
ATOM   1831  H  HA   . CYS A 1 47 ? 13.273  0.664   -8.387  1.00 0.00 ? 47  CYS A HA   2  
ATOM   1832  H  HB2  . CYS A 1 47 ? 14.458  -0.556  -6.625  1.00 0.00 ? 47  CYS A HB2  2  
ATOM   1833  H  HB3  . CYS A 1 47 ? 14.902  1.147   -6.612  1.00 0.00 ? 47  CYS A HB3  2  
ATOM   1834  N  N    . ARG A 1 48 ? 10.773  0.208   -6.415  1.00 0.00 ? 48  ARG A N    2  
ATOM   1835  C  CA   . ARG A 1 48 ? 9.625   -0.641  -6.119  1.00 0.00 ? 48  ARG A CA   2  
ATOM   1836  C  C    . ARG A 1 48 ? 10.040  -1.841  -5.273  1.00 0.00 ? 48  ARG A C    2  
ATOM   1837  O  O    . ARG A 1 48 ? 9.581   -2.961  -5.497  1.00 0.00 ? 48  ARG A O    2  
ATOM   1838  C  CB   . ARG A 1 48 ? 8.970   -1.120  -7.416  1.00 0.00 ? 48  ARG A CB   2  
ATOM   1839  C  CG   . ARG A 1 48 ? 8.292   -0.010  -8.202  1.00 0.00 ? 48  ARG A CG   2  
ATOM   1840  C  CD   . ARG A 1 48 ? 6.840   0.162   -7.784  1.00 0.00 ? 48  ARG A CD   2  
ATOM   1841  N  NE   . ARG A 1 48 ? 6.041   0.795   -8.830  1.00 0.00 ? 48  ARG A NE   2  
ATOM   1842  C  CZ   . ARG A 1 48 ? 4.729   0.630   -8.955  1.00 0.00 ? 48  ARG A CZ   2  
ATOM   1843  N  NH1  . ARG A 1 48 ? 4.072   -0.145  -8.103  1.00 0.00 ? 48  ARG A NH1  2  
ATOM   1844  N  NH2  . ARG A 1 48 ? 4.072   1.239   -9.933  1.00 0.00 ? 48  ARG A NH2  2  
ATOM   1845  H  H    . ARG A 1 48 ? 10.786  1.128   -6.078  1.00 0.00 ? 48  ARG A H    2  
ATOM   1846  H  HA   . ARG A 1 48 ? 8.912   -0.052  -5.562  1.00 0.00 ? 48  ARG A HA   2  
ATOM   1847  H  HB2  . ARG A 1 48 ? 9.726   -1.566  -8.044  1.00 0.00 ? 48  ARG A HB2  2  
ATOM   1848  H  HB3  . ARG A 1 48 ? 8.227   -1.866  -7.175  1.00 0.00 ? 48  ARG A HB3  2  
ATOM   1849  H  HG2  . ARG A 1 48 ? 8.818   0.917   -8.025  1.00 0.00 ? 48  ARG A HG2  2  
ATOM   1850  H  HG3  . ARG A 1 48 ? 8.329   -0.252  -9.253  1.00 0.00 ? 48  ARG A HG3  2  
ATOM   1851  H  HD2  . ARG A 1 48 ? 6.424   -0.810  -7.566  1.00 0.00 ? 48  ARG A HD2  2  
ATOM   1852  H  HD3  . ARG A 1 48 ? 6.805   0.776   -6.897  1.00 0.00 ? 48  ARG A HD3  2  
ATOM   1853  H  HE   . ARG A 1 48 ? 6.507   1.372   -9.471  1.00 0.00 ? 48  ARG A HE   2  
ATOM   1854  H  HH11 . ARG A 1 48 ? 4.564   -0.605  -7.364  1.00 0.00 ? 48  ARG A HH11 2  
ATOM   1855  H  HH12 . ARG A 1 48 ? 3.083   -0.267  -8.198  1.00 0.00 ? 48  ARG A HH12 2  
ATOM   1856  H  HH21 . ARG A 1 48 ? 4.564   1.824   -10.577 1.00 0.00 ? 48  ARG A HH21 2  
ATOM   1857  H  HH22 . ARG A 1 48 ? 3.084   1.114   -10.026 1.00 0.00 ? 48  ARG A HH22 2  
ATOM   1858  N  N    . LEU A 1 49 ? 10.913  -1.599  -4.301  1.00 0.00 ? 49  LEU A N    2  
ATOM   1859  C  CA   . LEU A 1 49 ? 11.391  -2.659  -3.420  1.00 0.00 ? 49  LEU A CA   2  
ATOM   1860  C  C    . LEU A 1 49 ? 10.740  -2.561  -2.045  1.00 0.00 ? 49  LEU A C    2  
ATOM   1861  O  O    . LEU A 1 49 ? 10.547  -1.474  -1.499  1.00 0.00 ? 49  LEU A O    2  
ATOM   1862  C  CB   . LEU A 1 49 ? 12.913  -2.588  -3.283  1.00 0.00 ? 49  LEU A CB   2  
ATOM   1863  C  CG   . LEU A 1 49 ? 13.719  -3.104  -4.475  1.00 0.00 ? 49  LEU A CG   2  
ATOM   1864  C  CD1  . LEU A 1 49 ? 15.199  -2.805  -4.289  1.00 0.00 ? 49  LEU A CD1  2  
ATOM   1865  C  CD2  . LEU A 1 49 ? 13.495  -4.597  -4.664  1.00 0.00 ? 49  LEU A CD2  2  
ATOM   1866  H  H    . LEU A 1 49 ? 11.243  -0.686  -4.170  1.00 0.00 ? 49  LEU A H    2  
ATOM   1867  H  HA   . LEU A 1 49 ? 11.122  -3.606  -3.866  1.00 0.00 ? 49  LEU A HA   2  
ATOM   1868  H  HB2  . LEU A 1 49 ? 13.182  -1.555  -3.125  1.00 0.00 ? 49  LEU A HB2  2  
ATOM   1869  H  HB3  . LEU A 1 49 ? 13.194  -3.168  -2.416  1.00 0.00 ? 49  LEU A HB3  2  
ATOM   1870  H  HG   . LEU A 1 49 ? 13.388  -2.599  -5.372  1.00 0.00 ? 49  LEU A HG   2  
ATOM   1871  H  HD11 . LEU A 1 49 ? 15.647  -3.572  -3.676  1.00 0.00 ? 49  LEU A HD11 2  
ATOM   1872  H  HD12 . LEU A 1 49 ? 15.314  -1.845  -3.806  1.00 0.00 ? 49  LEU A HD12 2  
ATOM   1873  H  HD13 . LEU A 1 49 ? 15.686  -2.783  -5.253  1.00 0.00 ? 49  LEU A HD13 2  
ATOM   1874  H  HD21 . LEU A 1 49 ? 13.653  -5.106  -3.724  1.00 0.00 ? 49  LEU A HD21 2  
ATOM   1875  H  HD22 . LEU A 1 49 ? 14.191  -4.976  -5.399  1.00 0.00 ? 49  LEU A HD22 2  
ATOM   1876  H  HD23 . LEU A 1 49 ? 12.484  -4.770  -5.002  1.00 0.00 ? 49  LEU A HD23 2  
ATOM   1877  N  N    . PRO A 1 50 ? 10.394  -3.722  -1.469  1.00 0.00 ? 50  PRO A N    2  
ATOM   1878  C  CA   . PRO A 1 50 ? 9.762   -3.792  -0.148  1.00 0.00 ? 50  PRO A CA   2  
ATOM   1879  C  C    . PRO A 1 50 ? 10.719  -3.408  0.974   1.00 0.00 ? 50  PRO A C    2  
ATOM   1880  O  O    . PRO A 1 50 ? 11.756  -4.045  1.165   1.00 0.00 ? 50  PRO A O    2  
ATOM   1881  C  CB   . PRO A 1 50 ? 9.358   -5.264  -0.027  1.00 0.00 ? 50  PRO A CB   2  
ATOM   1882  C  CG   . PRO A 1 50 ? 10.301  -5.990  -0.923  1.00 0.00 ? 50  PRO A CG   2  
ATOM   1883  C  CD   . PRO A 1 50 ? 10.593  -5.054  -2.062  1.00 0.00 ? 50  PRO A CD   2  
ATOM   1884  H  HA   . PRO A 1 50 ? 8.880   -3.170  -0.096  1.00 0.00 ? 50  PRO A HA   2  
ATOM   1885  H  HB2  . PRO A 1 50 ? 9.462   -5.585  1.001   1.00 0.00 ? 50  PRO A HB2  2  
ATOM   1886  H  HB3  . PRO A 1 50 ? 8.335   -5.388  -0.347  1.00 0.00 ? 50  PRO A HB3  2  
ATOM   1887  H  HG2  . PRO A 1 50 ? 11.208  -6.226  -0.388  1.00 0.00 ? 50  PRO A HG2  2  
ATOM   1888  H  HG3  . PRO A 1 50 ? 9.835   -6.893  -1.290  1.00 0.00 ? 50  PRO A HG3  2  
ATOM   1889  H  HD2  . PRO A 1 50 ? 11.612  -5.177  -2.400  1.00 0.00 ? 50  PRO A HD2  2  
ATOM   1890  H  HD3  . PRO A 1 50 ? 9.902   -5.221  -2.875  1.00 0.00 ? 50  PRO A HD3  2  
ATOM   1891  N  N    . PHE A 1 51 ? 10.366  -2.364  1.716   1.00 0.00 ? 51  PHE A N    2  
ATOM   1892  C  CA   . PHE A 1 51 ? 11.195  -1.894  2.820   1.00 0.00 ? 51  PHE A CA   2  
ATOM   1893  C  C    . PHE A 1 51 ? 11.401  -2.998  3.853   1.00 0.00 ? 51  PHE A C    2  
ATOM   1894  O  O    . PHE A 1 51 ? 10.449  -3.590  4.364   1.00 0.00 ? 51  PHE A O    2  
ATOM   1895  C  CB   . PHE A 1 51 ? 10.555  -0.673  3.483   1.00 0.00 ? 51  PHE A CB   2  
ATOM   1896  C  CG   . PHE A 1 51 ? 9.961   0.298   2.503   1.00 0.00 ? 51  PHE A CG   2  
ATOM   1897  C  CD1  . PHE A 1 51 ? 10.776  1.121   1.742   1.00 0.00 ? 51  PHE A CD1  2  
ATOM   1898  C  CD2  . PHE A 1 51 ? 8.587   0.388   2.343   1.00 0.00 ? 51  PHE A CD2  2  
ATOM   1899  C  CE1  . PHE A 1 51 ? 10.231  2.016   0.840   1.00 0.00 ? 51  PHE A CE1  2  
ATOM   1900  C  CE2  . PHE A 1 51 ? 8.037   1.281   1.442   1.00 0.00 ? 51  PHE A CE2  2  
ATOM   1901  C  CZ   . PHE A 1 51 ? 8.860   2.095   0.689   1.00 0.00 ? 51  PHE A CZ   2  
ATOM   1902  H  H    . PHE A 1 51 ? 9.527   -1.897  1.516   1.00 0.00 ? 51  PHE A H    2  
ATOM   1903  H  HA   . PHE A 1 51 ? 12.155  -1.613  2.416   1.00 0.00 ? 51  PHE A HA   2  
ATOM   1904  H  HB2  . PHE A 1 51 ? 9.767   -1.002  4.143   1.00 0.00 ? 51  PHE A HB2  2  
ATOM   1905  H  HB3  . PHE A 1 51 ? 11.305  -0.150  4.057   1.00 0.00 ? 51  PHE A HB3  2  
ATOM   1906  H  HD1  . PHE A 1 51 ? 11.848  1.059   1.858   1.00 0.00 ? 51  PHE A HD1  2  
ATOM   1907  H  HD2  . PHE A 1 51 ? 7.942   -0.249  2.932   1.00 0.00 ? 51  PHE A HD2  2  
ATOM   1908  H  HE1  . PHE A 1 51 ? 10.877  2.651   0.253   1.00 0.00 ? 51  PHE A HE1  2  
ATOM   1909  H  HE2  . PHE A 1 51 ? 6.965   1.340   1.327   1.00 0.00 ? 51  PHE A HE2  2  
ATOM   1910  H  HZ   . PHE A 1 51 ? 8.433   2.793   -0.014  1.00 0.00 ? 51  PHE A HZ   2  
ATOM   1911  N  N    . PRO A 1 52 ? 12.673  -3.283  4.169   1.00 0.00 ? 52  PRO A N    2  
ATOM   1912  C  CA   . PRO A 1 52 ? 13.034  -4.317  5.144   1.00 0.00 ? 52  PRO A CA   2  
ATOM   1913  C  C    . PRO A 1 52 ? 12.665  -3.924  6.570   1.00 0.00 ? 52  PRO A C    2  
ATOM   1914  O  O    . PRO A 1 52 ? 12.294  -2.783  6.849   1.00 0.00 ? 52  PRO A O    2  
ATOM   1915  C  CB   . PRO A 1 52 ? 14.554  -4.428  4.995   1.00 0.00 ? 52  PRO A CB   2  
ATOM   1916  C  CG   . PRO A 1 52 ? 14.981  -3.101  4.472   1.00 0.00 ? 52  PRO A CG   2  
ATOM   1917  C  CD   . PRO A 1 52 ? 13.856  -2.617  3.600   1.00 0.00 ? 52  PRO A CD   2  
ATOM   1918  H  HA   . PRO A 1 52 ? 12.577  -5.266  4.903   1.00 0.00 ? 52  PRO A HA   2  
ATOM   1919  H  HB2  . PRO A 1 52 ? 14.997  -4.636  5.959   1.00 0.00 ? 52  PRO A HB2  2  
ATOM   1920  H  HB3  . PRO A 1 52 ? 14.794  -5.221  4.304   1.00 0.00 ? 52  PRO A HB3  2  
ATOM   1921  H  HG2  . PRO A 1 52 ? 15.141  -2.417  5.292   1.00 0.00 ? 52  PRO A HG2  2  
ATOM   1922  H  HG3  . PRO A 1 52 ? 15.885  -3.210  3.891   1.00 0.00 ? 52  PRO A HG3  2  
ATOM   1923  H  HD2  . PRO A 1 52 ? 13.763  -1.543  3.664   1.00 0.00 ? 52  PRO A HD2  2  
ATOM   1924  H  HD3  . PRO A 1 52 ? 14.014  -2.923  2.576   1.00 0.00 ? 52  PRO A HD3  2  
ATOM   1925  N  N    . PRO A 1 53 ? 12.770  -4.888  7.496   1.00 0.00 ? 53  PRO A N    2  
ATOM   1926  C  CA   . PRO A 1 53 ? 12.452  -4.665  8.910   1.00 0.00 ? 53  PRO A CA   2  
ATOM   1927  C  C    . PRO A 1 53 ? 13.469  -3.759  9.597   1.00 0.00 ? 53  PRO A C    2  
ATOM   1928  O  O    . PRO A 1 53 ? 13.408  -3.547  10.807  1.00 0.00 ? 53  PRO A O    2  
ATOM   1929  C  CB   . PRO A 1 53 ? 12.499  -6.072  9.510   1.00 0.00 ? 53  PRO A CB   2  
ATOM   1930  C  CG   . PRO A 1 53 ? 13.410  -6.837  8.613   1.00 0.00 ? 53  PRO A CG   2  
ATOM   1931  C  CD   . PRO A 1 53 ? 13.206  -6.270  7.235   1.00 0.00 ? 53  PRO A CD   2  
ATOM   1932  H  HA   . PRO A 1 53 ? 11.462  -4.252  9.034   1.00 0.00 ? 53  PRO A HA   2  
ATOM   1933  H  HB2  . PRO A 1 53 ? 12.885  -6.024  10.519  1.00 0.00 ? 53  PRO A HB2  2  
ATOM   1934  H  HB3  . PRO A 1 53 ? 11.506  -6.497  9.519   1.00 0.00 ? 53  PRO A HB3  2  
ATOM   1935  H  HG2  . PRO A 1 53 ? 14.434  -6.701  8.927   1.00 0.00 ? 53  PRO A HG2  2  
ATOM   1936  H  HG3  . PRO A 1 53 ? 13.147  -7.884  8.629   1.00 0.00 ? 53  PRO A HG3  2  
ATOM   1937  H  HD2  . PRO A 1 53 ? 14.133  -6.283  6.681   1.00 0.00 ? 53  PRO A HD2  2  
ATOM   1938  H  HD3  . PRO A 1 53 ? 12.442  -6.822  6.709   1.00 0.00 ? 53  PRO A HD3  2  
ATOM   1939  N  N    . GLY A 1 54 ? 14.404  -3.227  8.815   1.00 0.00 ? 54  GLY A N    2  
ATOM   1940  C  CA   . GLY A 1 54 ? 15.420  -2.350  9.366   1.00 0.00 ? 54  GLY A CA   2  
ATOM   1941  C  C    . GLY A 1 54 ? 15.734  -1.181  8.453   1.00 0.00 ? 54  GLY A C    2  
ATOM   1942  O  O    . GLY A 1 54 ? 16.852  -1.059  7.953   1.00 0.00 ? 54  GLY A O    2  
ATOM   1943  H  H    . GLY A 1 54 ? 14.403  -3.431  7.856   1.00 0.00 ? 54  GLY A H    2  
ATOM   1944  H  HA2  . GLY A 1 54 ? 15.075  -1.969  10.316  1.00 0.00 ? 54  GLY A HA2  2  
ATOM   1945  H  HA3  . GLY A 1 54 ? 16.324  -2.920  9.525   1.00 0.00 ? 54  GLY A HA3  2  
ATOM   1946  N  N    . ASP A 1 55 ? 14.746  -0.321  8.234   1.00 0.00 ? 55  ASP A N    2  
ATOM   1947  C  CA   . ASP A 1 55 ? 14.922  0.843   7.374   1.00 0.00 ? 55  ASP A CA   2  
ATOM   1948  C  C    . ASP A 1 55 ? 13.762  1.820   7.538   1.00 0.00 ? 55  ASP A C    2  
ATOM   1949  O  O    . ASP A 1 55 ? 12.679  1.444   7.988   1.00 0.00 ? 55  ASP A O    2  
ATOM   1950  C  CB   . ASP A 1 55 ? 15.039  0.411   5.912   1.00 0.00 ? 55  ASP A CB   2  
ATOM   1951  C  CG   . ASP A 1 55 ? 15.825  1.402   5.076   1.00 0.00 ? 55  ASP A CG   2  
ATOM   1952  O  OD1  . ASP A 1 55 ? 15.899  2.584   5.472   1.00 0.00 ? 55  ASP A OD1  2  
ATOM   1953  O  OD2  . ASP A 1 55 ? 16.365  0.996   4.026   1.00 0.00 ? 55  ASP A OD2  2  
ATOM   1954  H  H    . ASP A 1 55 ? 13.877  -0.473  8.662   1.00 0.00 ? 55  ASP A H    2  
ATOM   1955  H  HA   . ASP A 1 55 ? 15.836  1.337   7.668   1.00 0.00 ? 55  ASP A HA   2  
ATOM   1956  H  HB2  . ASP A 1 55 ? 15.537  -0.546  5.865   1.00 0.00 ? 55  ASP A HB2  2  
ATOM   1957  H  HB3  . ASP A 1 55 ? 14.048  0.318   5.491   1.00 0.00 ? 55  ASP A HB3  2  
ATOM   1958  N  N    . ARG A 1 56 ? 13.996  3.076   7.171   1.00 0.00 ? 56  ARG A N    2  
ATOM   1959  C  CA   . ARG A 1 56 ? 12.971  4.107   7.279   1.00 0.00 ? 56  ARG A CA   2  
ATOM   1960  C  C    . ARG A 1 56 ? 12.323  4.374   5.923   1.00 0.00 ? 56  ARG A C    2  
ATOM   1961  O  O    . ARG A 1 56 ? 12.946  4.187   4.878   1.00 0.00 ? 56  ARG A O    2  
ATOM   1962  C  CB   . ARG A 1 56 ? 13.574  5.400   7.832   1.00 0.00 ? 56  ARG A CB   2  
ATOM   1963  C  CG   . ARG A 1 56 ? 13.550  5.483   9.349   1.00 0.00 ? 56  ARG A CG   2  
ATOM   1964  C  CD   . ARG A 1 56 ? 12.193  5.939   9.861   1.00 0.00 ? 56  ARG A CD   2  
ATOM   1965  N  NE   . ARG A 1 56 ? 12.293  6.604   11.157  1.00 0.00 ? 56  ARG A NE   2  
ATOM   1966  C  CZ   . ARG A 1 56 ? 11.281  7.242   11.736  1.00 0.00 ? 56  ARG A CZ   2  
ATOM   1967  N  NH1  . ARG A 1 56 ? 10.100  7.300   11.136  1.00 0.00 ? 56  ARG A NH1  2  
ATOM   1968  N  NH2  . ARG A 1 56 ? 11.450  7.823   12.917  1.00 0.00 ? 56  ARG A NH2  2  
ATOM   1969  H  H    . ARG A 1 56 ? 14.879  3.315   6.819   1.00 0.00 ? 56  ARG A H    2  
ATOM   1970  H  HA   . ARG A 1 56 ? 12.214  3.752   7.963   1.00 0.00 ? 56  ARG A HA   2  
ATOM   1971  H  HB2  . ARG A 1 56 ? 14.601  5.472   7.505   1.00 0.00 ? 56  ARG A HB2  2  
ATOM   1972  H  HB3  . ARG A 1 56 ? 13.020  6.238   7.438   1.00 0.00 ? 56  ARG A HB3  2  
ATOM   1973  H  HG2  . ARG A 1 56 ? 13.767  4.506   9.757   1.00 0.00 ? 56  ARG A HG2  2  
ATOM   1974  H  HG3  . ARG A 1 56 ? 14.303  6.185   9.674   1.00 0.00 ? 56  ARG A HG3  2  
ATOM   1975  H  HD2  . ARG A 1 56 ? 11.766  6.627   9.146   1.00 0.00 ? 56  ARG A HD2  2  
ATOM   1976  H  HD3  . ARG A 1 56 ? 11.551  5.076   9.958   1.00 0.00 ? 56  ARG A HD3  2  
ATOM   1977  H  HE   . ARG A 1 56 ? 13.157  6.574   11.618  1.00 0.00 ? 56  ARG A HE   2  
ATOM   1978  H  HH11 . ARG A 1 56 ? 9.970   6.862   10.247  1.00 0.00 ? 56  ARG A HH11 2  
ATOM   1979  H  HH12 . ARG A 1 56 ? 9.339   7.779   11.575  1.00 0.00 ? 56  ARG A HH12 2  
ATOM   1980  H  HH21 . ARG A 1 56 ? 12.339  7.781   13.372  1.00 0.00 ? 56  ARG A HH21 2  
ATOM   1981  H  HH22 . ARG A 1 56 ? 10.688  8.303   13.351  1.00 0.00 ? 56  ARG A HH22 2  
ATOM   1982  N  N    . VAL A 1 57 ? 11.068  4.813   5.949   1.00 0.00 ? 57  VAL A N    2  
ATOM   1983  C  CA   . VAL A 1 57 ? 10.336  5.106   4.723   1.00 0.00 ? 57  VAL A CA   2  
ATOM   1984  C  C    . VAL A 1 57 ? 10.010  6.592   4.620   1.00 0.00 ? 57  VAL A C    2  
ATOM   1985  O  O    . VAL A 1 57 ? 9.611   7.221   5.601   1.00 0.00 ? 57  VAL A O    2  
ATOM   1986  C  CB   . VAL A 1 57 ? 9.027   4.298   4.644   1.00 0.00 ? 57  VAL A CB   2  
ATOM   1987  C  CG1  . VAL A 1 57 ? 8.098   4.672   5.788   1.00 0.00 ? 57  VAL A CG1  2  
ATOM   1988  C  CG2  . VAL A 1 57 ? 8.347   4.517   3.301   1.00 0.00 ? 57  VAL A CG2  2  
ATOM   1989  H  H    . VAL A 1 57 ? 10.625  4.942   6.813   1.00 0.00 ? 57  VAL A H    2  
ATOM   1990  H  HA   . VAL A 1 57 ? 10.959  4.826   3.886   1.00 0.00 ? 57  VAL A HA   2  
ATOM   1991  H  HB   . VAL A 1 57 ? 9.270   3.249   4.734   1.00 0.00 ? 57  VAL A HB   2  
ATOM   1992  H  HG11 . VAL A 1 57 ? 7.911   5.735   5.767   1.00 0.00 ? 57  VAL A HG11 2  
ATOM   1993  H  HG12 . VAL A 1 57 ? 7.165   4.138   5.684   1.00 0.00 ? 57  VAL A HG12 2  
ATOM   1994  H  HG13 . VAL A 1 57 ? 8.561   4.407   6.728   1.00 0.00 ? 57  VAL A HG13 2  
ATOM   1995  H  HG21 . VAL A 1 57 ? 8.526   3.663   2.664   1.00 0.00 ? 57  VAL A HG21 2  
ATOM   1996  H  HG22 . VAL A 1 57 ? 7.284   4.637   3.450   1.00 0.00 ? 57  VAL A HG22 2  
ATOM   1997  H  HG23 . VAL A 1 57 ? 8.747   5.405   2.835   1.00 0.00 ? 57  VAL A HG23 2  
ATOM   1998  N  N    . THR A 1 58 ? 10.181  7.149   3.425   1.00 0.00 ? 58  THR A N    2  
ATOM   1999  C  CA   . THR A 1 58 ? 9.906   8.561   3.193   1.00 0.00 ? 58  THR A CA   2  
ATOM   2000  C  C    . THR A 1 58 ? 8.542   8.755   2.542   1.00 0.00 ? 58  THR A C    2  
ATOM   2001  O  O    . THR A 1 58 ? 8.229   8.123   1.533   1.00 0.00 ? 58  THR A O    2  
ATOM   2002  C  CB   . THR A 1 58 ? 10.985  9.205   2.302   1.00 0.00 ? 58  THR A CB   2  
ATOM   2003  O  OG1  . THR A 1 58 ? 12.282  8.990   2.869   1.00 0.00 ? 58  THR A OG1  2  
ATOM   2004  C  CG2  . THR A 1 58 ? 10.736  10.697  2.143   1.00 0.00 ? 58  THR A CG2  2  
ATOM   2005  H  H    . THR A 1 58 ? 10.502  6.595   2.683   1.00 0.00 ? 58  THR A H    2  
ATOM   2006  H  HA   . THR A 1 58 ? 9.912   9.063   4.150   1.00 0.00 ? 58  THR A HA   2  
ATOM   2007  H  HB   . THR A 1 58 ? 10.946  8.742   1.326   1.00 0.00 ? 58  THR A HB   2  
ATOM   2008  H  HG1  . THR A 1 58 ? 12.214  8.977   3.827   1.00 0.00 ? 58  THR A HG1  2  
ATOM   2009  H  HG21 . THR A 1 58 ? 11.647  11.238  2.350   1.00 0.00 ? 58  THR A HG21 2  
ATOM   2010  H  HG22 . THR A 1 58 ? 9.967   11.009  2.834   1.00 0.00 ? 58  THR A HG22 2  
ATOM   2011  H  HG23 . THR A 1 58 ? 10.416  10.903  1.133   1.00 0.00 ? 58  THR A HG23 2  
ATOM   2012  N  N    . PHE A 1 59 ? 7.733   9.635   3.123   1.00 0.00 ? 59  PHE A N    2  
ATOM   2013  C  CA   . PHE A 1 59 ? 6.401   9.912   2.599   1.00 0.00 ? 59  PHE A CA   2  
ATOM   2014  C  C    . PHE A 1 59 ? 6.369   11.259  1.881   1.00 0.00 ? 59  PHE A C    2  
ATOM   2015  O  O    . PHE A 1 59 ? 6.454   12.312  2.511   1.00 0.00 ? 59  PHE A O    2  
ATOM   2016  C  CB   . PHE A 1 59 ? 5.371   9.900   3.730   1.00 0.00 ? 59  PHE A CB   2  
ATOM   2017  C  CG   . PHE A 1 59 ? 5.756   10.761  4.900   1.00 0.00 ? 59  PHE A CG   2  
ATOM   2018  C  CD1  . PHE A 1 59 ? 6.584   10.269  5.896   1.00 0.00 ? 59  PHE A CD1  2  
ATOM   2019  C  CD2  . PHE A 1 59 ? 5.289   12.061  5.003   1.00 0.00 ? 59  PHE A CD2  2  
ATOM   2020  C  CE1  . PHE A 1 59 ? 6.939   11.059  6.973   1.00 0.00 ? 59  PHE A CE1  2  
ATOM   2021  C  CE2  . PHE A 1 59 ? 5.641   12.856  6.078   1.00 0.00 ? 59  PHE A CE2  2  
ATOM   2022  C  CZ   . PHE A 1 59 ? 6.467   12.354  7.064   1.00 0.00 ? 59  PHE A CZ   2  
ATOM   2023  H  H    . PHE A 1 59 ? 8.039   10.108  3.926   1.00 0.00 ? 59  PHE A H    2  
ATOM   2024  H  HA   . PHE A 1 59 ? 6.156   9.135   1.892   1.00 0.00 ? 59  PHE A HA   2  
ATOM   2025  H  HB2  . PHE A 1 59 ? 4.426   10.259  3.351   1.00 0.00 ? 59  PHE A HB2  2  
ATOM   2026  H  HB3  . PHE A 1 59 ? 5.251   8.888   4.086   1.00 0.00 ? 59  PHE A HB3  2  
ATOM   2027  H  HD1  . PHE A 1 59 ? 6.955   9.257   5.826   1.00 0.00 ? 59  PHE A HD1  2  
ATOM   2028  H  HD2  . PHE A 1 59 ? 4.642   12.455  4.232   1.00 0.00 ? 59  PHE A HD2  2  
ATOM   2029  H  HE1  . PHE A 1 59 ? 7.586   10.664  7.743   1.00 0.00 ? 59  PHE A HE1  2  
ATOM   2030  H  HE2  . PHE A 1 59 ? 5.270   13.868  6.146   1.00 0.00 ? 59  PHE A HE2  2  
ATOM   2031  H  HZ   . PHE A 1 59 ? 6.743   12.972  7.905   1.00 0.00 ? 59  PHE A HZ   2  
ATOM   2032  N  N    . ASN A 1 60 ? 6.246   11.214  0.558   1.00 0.00 ? 60  ASN A N    2  
ATOM   2033  C  CA   . ASN A 1 60 ? 6.203   12.430  -0.246  1.00 0.00 ? 60  ASN A CA   2  
ATOM   2034  C  C    . ASN A 1 60 ? 4.941   12.472  -1.102  1.00 0.00 ? 60  ASN A C    2  
ATOM   2035  O  O    . ASN A 1 60 ? 4.739   11.626  -1.971  1.00 0.00 ? 60  ASN A O    2  
ATOM   2036  C  CB   . ASN A 1 60 ? 7.442   12.518  -1.140  1.00 0.00 ? 60  ASN A CB   2  
ATOM   2037  C  CG   . ASN A 1 60 ? 7.359   13.662  -2.132  1.00 0.00 ? 60  ASN A CG   2  
ATOM   2038  O  OD1  . ASN A 1 60 ? 7.008   13.466  -3.296  1.00 0.00 ? 60  ASN A OD1  2  
ATOM   2039  N  ND2  . ASN A 1 60 ? 7.683   14.866  -1.675  1.00 0.00 ? 60  ASN A ND2  2  
ATOM   2040  H  H    . ASN A 1 60 ? 6.182   10.344  0.113   1.00 0.00 ? 60  ASN A H    2  
ATOM   2041  H  HA   . ASN A 1 60 ? 6.196   13.273  0.428   1.00 0.00 ? 60  ASN A HA   2  
ATOM   2042  H  HB2  . ASN A 1 60 ? 8.315   12.667  -0.521  1.00 0.00 ? 60  ASN A HB2  2  
ATOM   2043  H  HB3  . ASN A 1 60 ? 7.548   11.595  -1.690  1.00 0.00 ? 60  ASN A HB3  2  
ATOM   2044  H  HD21 . ASN A 1 60 ? 7.953   14.948  -0.736  1.00 0.00 ? 60  ASN A HD21 2  
ATOM   2045  H  HD22 . ASN A 1 60 ? 7.637   15.624  -2.295  1.00 0.00 ? 60  ASN A HD22 2  
ATOM   2046  N  N    . GLY A 1 61 ? 4.094   13.465  -0.849  1.00 0.00 ? 61  GLY A N    2  
ATOM   2047  C  CA   . GLY A 1 61 ? 2.862   13.600  -1.604  1.00 0.00 ? 61  GLY A CA   2  
ATOM   2048  C  C    . GLY A 1 61 ? 1.945   12.405  -1.437  1.00 0.00 ? 61  GLY A C    2  
ATOM   2049  O  O    . GLY A 1 61 ? 1.302   12.246  -0.400  1.00 0.00 ? 61  GLY A O    2  
ATOM   2050  H  H    . GLY A 1 61 ? 4.307   14.112  -0.143  1.00 0.00 ? 61  GLY A H    2  
ATOM   2051  H  HA2  . GLY A 1 61 ? 2.344   14.487  -1.271  1.00 0.00 ? 61  GLY A HA2  2  
ATOM   2052  H  HA3  . GLY A 1 61 ? 3.105   13.709  -2.651  1.00 0.00 ? 61  GLY A HA3  2  
ATOM   2053  N  N    . LYS A 1 62 ? 1.884   11.561  -2.462  1.00 0.00 ? 62  LYS A N    2  
ATOM   2054  C  CA   . LYS A 1 62 ? 1.039   10.373  -2.425  1.00 0.00 ? 62  LYS A CA   2  
ATOM   2055  C  C    . LYS A 1 62 ? 1.839   9.125   -2.787  1.00 0.00 ? 62  LYS A C    2  
ATOM   2056  O  O    . LYS A 1 62 ? 1.314   8.198   -3.401  1.00 0.00 ? 62  LYS A O    2  
ATOM   2057  C  CB   . LYS A 1 62 ? -0.141  10.532  -3.387  1.00 0.00 ? 62  LYS A CB   2  
ATOM   2058  C  CG   . LYS A 1 62 ? -1.371  11.148  -2.743  1.00 0.00 ? 62  LYS A CG   2  
ATOM   2059  C  CD   . LYS A 1 62 ? -2.414  11.524  -3.782  1.00 0.00 ? 62  LYS A CD   2  
ATOM   2060  C  CE   . LYS A 1 62 ? -3.443  12.490  -3.214  1.00 0.00 ? 62  LYS A CE   2  
ATOM   2061  N  NZ   . LYS A 1 62 ? -4.242  11.870  -2.121  1.00 0.00 ? 62  LYS A NZ   2  
ATOM   2062  H  H    . LYS A 1 62 ? 2.421   11.741  -3.262  1.00 0.00 ? 62  LYS A H    2  
ATOM   2063  H  HA   . LYS A 1 62 ? 0.661   10.265  -1.420  1.00 0.00 ? 62  LYS A HA   2  
ATOM   2064  H  HB2  . LYS A 1 62 ? 0.163   11.161  -4.210  1.00 0.00 ? 62  LYS A HB2  2  
ATOM   2065  H  HB3  . LYS A 1 62 ? -0.411  9.558   -3.770  1.00 0.00 ? 62  LYS A HB3  2  
ATOM   2066  H  HG2  . LYS A 1 62 ? -1.803  10.435  -2.057  1.00 0.00 ? 62  LYS A HG2  2  
ATOM   2067  H  HG3  . LYS A 1 62 ? -1.076  12.037  -2.203  1.00 0.00 ? 62  LYS A HG3  2  
ATOM   2068  H  HD2  . LYS A 1 62 ? -1.922  11.993  -4.621  1.00 0.00 ? 62  LYS A HD2  2  
ATOM   2069  H  HD3  . LYS A 1 62 ? -2.919  10.628  -4.113  1.00 0.00 ? 62  LYS A HD3  2  
ATOM   2070  H  HE2  . LYS A 1 62 ? -2.929  13.356  -2.826  1.00 0.00 ? 62  LYS A HE2  2  
ATOM   2071  H  HE3  . LYS A 1 62 ? -4.109  12.793  -4.008  1.00 0.00 ? 62  LYS A HE3  2  
ATOM   2072  H  HZ1  . LYS A 1 62 ? -4.705  11.004  -2.464  1.00 0.00 ? 62  LYS A HZ1  2  
ATOM   2073  H  HZ2  . LYS A 1 62 ? -4.973  12.533  -1.792  1.00 0.00 ? 62  LYS A HZ2  2  
ATOM   2074  H  HZ3  . LYS A 1 62 ? -3.624  11.627  -1.320  1.00 0.00 ? 62  LYS A HZ3  2  
ATOM   2075  N  N    . GLU A 1 63 ? 3.111   9.110   -2.400  1.00 0.00 ? 63  GLU A N    2  
ATOM   2076  C  CA   . GLU A 1 63 ? 3.982   7.976   -2.684  1.00 0.00 ? 63  GLU A CA   2  
ATOM   2077  C  C    . GLU A 1 63 ? 5.023   7.800   -1.583  1.00 0.00 ? 63  GLU A C    2  
ATOM   2078  O  O    . GLU A 1 63 ? 5.144   8.639   -0.689  1.00 0.00 ? 63  GLU A O    2  
ATOM   2079  C  CB   . GLU A 1 63 ? 4.677   8.164   -4.034  1.00 0.00 ? 63  GLU A CB   2  
ATOM   2080  C  CG   . GLU A 1 63 ? 3.736   8.066   -5.223  1.00 0.00 ? 63  GLU A CG   2  
ATOM   2081  C  CD   . GLU A 1 63 ? 4.474   7.957   -6.543  1.00 0.00 ? 63  GLU A CD   2  
ATOM   2082  O  OE1  . GLU A 1 63 ? 4.821   9.010   -7.117  1.00 0.00 ? 63  GLU A OE1  2  
ATOM   2083  O  OE2  . GLU A 1 63 ? 4.704   6.819   -7.003  1.00 0.00 ? 63  GLU A OE2  2  
ATOM   2084  H  H    . GLU A 1 63 ? 3.472   9.881   -1.914  1.00 0.00 ? 63  GLU A H    2  
ATOM   2085  H  HA   . GLU A 1 63 ? 3.367   7.089   -2.727  1.00 0.00 ? 63  GLU A HA   2  
ATOM   2086  H  HB2  . GLU A 1 63 ? 5.147   9.136   -4.051  1.00 0.00 ? 63  GLU A HB2  2  
ATOM   2087  H  HB3  . GLU A 1 63 ? 5.439   7.405   -4.141  1.00 0.00 ? 63  GLU A HB3  2  
ATOM   2088  H  HG2  . GLU A 1 63 ? 3.114   7.191   -5.102  1.00 0.00 ? 63  GLU A HG2  2  
ATOM   2089  H  HG3  . GLU A 1 63 ? 3.114   8.948   -5.247  1.00 0.00 ? 63  GLU A HG3  2  
ATOM   2090  N  N    . CYS A 1 64 ? 5.771   6.705   -1.654  1.00 0.00 ? 64  CYS A N    2  
ATOM   2091  C  CA   . CYS A 1 64 ? 6.802   6.418   -0.662  1.00 0.00 ? 64  CYS A CA   2  
ATOM   2092  C  C    . CYS A 1 64 ? 8.055   5.859   -1.327  1.00 0.00 ? 64  CYS A C    2  
ATOM   2093  O  O    . CYS A 1 64 ? 7.972   5.037   -2.240  1.00 0.00 ? 64  CYS A O    2  
ATOM   2094  C  CB   . CYS A 1 64 ? 6.277   5.427   0.378   1.00 0.00 ? 64  CYS A CB   2  
ATOM   2095  S  SG   . CYS A 1 64 ? 5.620   3.897   -0.326  1.00 0.00 ? 64  CYS A SG   2  
ATOM   2096  H  H    . CYS A 1 64 ? 5.628   6.074   -2.390  1.00 0.00 ? 64  CYS A H    2  
ATOM   2097  H  HA   . CYS A 1 64 ? 7.054   7.345   -0.169  1.00 0.00 ? 64  CYS A HA   2  
ATOM   2098  H  HB2  . CYS A 1 64 ? 7.080   5.161   1.049   1.00 0.00 ? 64  CYS A HB2  2  
ATOM   2099  H  HB3  . CYS A 1 64 ? 5.485   5.897   0.943   1.00 0.00 ? 64  CYS A HB3  2  
ATOM   2100  H  HG   . CYS A 1 64 ? 6.639   3.196   -0.800  1.00 0.00 ? 64  CYS A HG   2  
ATOM   2101  N  N    . MET A 1 65 ? 9.216   6.311   -0.865  1.00 0.00 ? 65  MET A N    2  
ATOM   2102  C  CA   . MET A 1 65 ? 10.488  5.856   -1.416  1.00 0.00 ? 65  MET A CA   2  
ATOM   2103  C  C    . MET A 1 65 ? 11.398  5.322   -0.314  1.00 0.00 ? 65  MET A C    2  
ATOM   2104  O  O    . MET A 1 65 ? 11.227  5.651   0.860   1.00 0.00 ? 65  MET A O    2  
ATOM   2105  C  CB   . MET A 1 65 ? 11.184  6.997   -2.159  1.00 0.00 ? 65  MET A CB   2  
ATOM   2106  C  CG   . MET A 1 65 ? 10.643  7.228   -3.561  1.00 0.00 ? 65  MET A CG   2  
ATOM   2107  S  SD   . MET A 1 65 ? 9.282   8.410   -3.595  1.00 0.00 ? 65  MET A SD   2  
ATOM   2108  C  CE   . MET A 1 65 ? 10.110  9.895   -3.031  1.00 0.00 ? 65  MET A CE   2  
ATOM   2109  H  H    . MET A 1 65 ? 9.219   6.965   -0.135  1.00 0.00 ? 65  MET A H    2  
ATOM   2110  H  HA   . MET A 1 65 ? 10.280  5.058   -2.113  1.00 0.00 ? 65  MET A HA   2  
ATOM   2111  H  HB2  . MET A 1 65 ? 11.059  7.908   -1.594  1.00 0.00 ? 65  MET A HB2  2  
ATOM   2112  H  HB3  . MET A 1 65 ? 12.237  6.772   -2.236  1.00 0.00 ? 65  MET A HB3  2  
ATOM   2113  H  HG2  . MET A 1 65 ? 11.441  7.603   -4.184  1.00 0.00 ? 65  MET A HG2  2  
ATOM   2114  H  HG3  . MET A 1 65 ? 10.293  6.285   -3.956  1.00 0.00 ? 65  MET A HG3  2  
ATOM   2115  H  HE1  . MET A 1 65 ? 11.179  9.746   -3.064  1.00 0.00 ? 65  MET A HE1  2  
ATOM   2116  H  HE2  . MET A 1 65 ? 9.842   10.721  -3.673  1.00 0.00 ? 65  MET A HE2  2  
ATOM   2117  H  HE3  . MET A 1 65 ? 9.807   10.113  -2.017  1.00 0.00 ? 65  MET A HE3  2  
ATOM   2118  N  N    . CYS A 1 66 ? 12.364  4.496   -0.699  1.00 0.00 ? 66  CYS A N    2  
ATOM   2119  C  CA   . CYS A 1 66 ? 13.301  3.915   0.255   1.00 0.00 ? 66  CYS A CA   2  
ATOM   2120  C  C    . CYS A 1 66 ? 14.481  4.852   0.497   1.00 0.00 ? 66  CYS A C    2  
ATOM   2121  O  O    . CYS A 1 66 ? 14.955  5.518   -0.422  1.00 0.00 ? 66  CYS A O    2  
ATOM   2122  C  CB   . CYS A 1 66 ? 13.805  2.562   -0.251  1.00 0.00 ? 66  CYS A CB   2  
ATOM   2123  S  SG   . CYS A 1 66 ? 14.871  2.670   -1.724  1.00 0.00 ? 66  CYS A SG   2  
ATOM   2124  H  H    . CYS A 1 66 ? 12.450  4.270   -1.650  1.00 0.00 ? 66  CYS A H    2  
ATOM   2125  H  HA   . CYS A 1 66 ? 12.777  3.768   1.187   1.00 0.00 ? 66  CYS A HA   2  
ATOM   2126  H  HB2  . CYS A 1 66 ? 14.375  2.083   0.532   1.00 0.00 ? 66  CYS A HB2  2  
ATOM   2127  H  HB3  . CYS A 1 66 ? 12.957  1.942   -0.503  1.00 0.00 ? 66  CYS A HB3  2  
ATOM   2128  N  N    . GLN A 1 67 ? 14.949  4.895   1.741   1.00 0.00 ? 67  GLN A N    2  
ATOM   2129  C  CA   . GLN A 1 67 ? 16.074  5.750   2.103   1.00 0.00 ? 67  GLN A CA   2  
ATOM   2130  C  C    . GLN A 1 67 ? 17.097  5.811   0.974   1.00 0.00 ? 67  GLN A C    2  
ATOM   2131  O  O    . GLN A 1 67 ? 17.503  6.893   0.548   1.00 0.00 ? 67  GLN A O    2  
ATOM   2132  C  CB   . GLN A 1 67 ? 16.738  5.239   3.383   1.00 0.00 ? 67  GLN A CB   2  
ATOM   2133  C  CG   . GLN A 1 67 ? 17.937  6.066   3.818   1.00 0.00 ? 67  GLN A CG   2  
ATOM   2134  C  CD   . GLN A 1 67 ? 18.876  5.298   4.727   1.00 0.00 ? 67  GLN A CD   2  
ATOM   2135  O  OE1  . GLN A 1 67 ? 18.717  5.300   5.948   1.00 0.00 ? 67  GLN A OE1  2  
ATOM   2136  N  NE2  . GLN A 1 67 ? 19.864  4.636   4.135   1.00 0.00 ? 67  GLN A NE2  2  
ATOM   2137  H  H    . GLN A 1 67 ? 14.529  4.340   2.429   1.00 0.00 ? 67  GLN A H    2  
ATOM   2138  H  HA   . GLN A 1 67 ? 15.691  6.744   2.280   1.00 0.00 ? 67  GLN A HA   2  
ATOM   2139  H  HB2  . GLN A 1 67 ? 16.011  5.251   4.181   1.00 0.00 ? 67  GLN A HB2  2  
ATOM   2140  H  HB3  . GLN A 1 67 ? 17.068  4.223   3.222   1.00 0.00 ? 67  GLN A HB3  2  
ATOM   2141  H  HG2  . GLN A 1 67 ? 18.484  6.373   2.939   1.00 0.00 ? 67  GLN A HG2  2  
ATOM   2142  H  HG3  . GLN A 1 67 ? 17.584  6.940   4.344   1.00 0.00 ? 67  GLN A HG3  2  
ATOM   2143  H  HE21 . GLN A 1 67 ? 19.930  4.681   3.158   1.00 0.00 ? 67  GLN A HE21 2  
ATOM   2144  H  HE22 . GLN A 1 67 ? 20.486  4.132   4.699   1.00 0.00 ? 67  GLN A HE22 2  
ATOM   2145  N  N    . LYS A 1 68 ? 17.512  4.644   0.495   1.00 0.00 ? 68  LYS A N    2  
ATOM   2146  C  CA   . LYS A 1 68 ? 18.488  4.564   -0.585  1.00 0.00 ? 68  LYS A CA   2  
ATOM   2147  C  C    . LYS A 1 68 ? 18.130  5.523   -1.716  1.00 0.00 ? 68  LYS A C    2  
ATOM   2148  O  O    . LYS A 1 68 ? 18.946  6.347   -2.127  1.00 0.00 ? 68  LYS A O    2  
ATOM   2149  C  CB   . LYS A 1 68 ? 18.568  3.133   -1.123  1.00 0.00 ? 68  LYS A CB   2  
ATOM   2150  C  CG   . LYS A 1 68 ? 18.946  2.107   -0.068  1.00 0.00 ? 68  LYS A CG   2  
ATOM   2151  C  CD   . LYS A 1 68 ? 18.381  0.736   -0.396  1.00 0.00 ? 68  LYS A CD   2  
ATOM   2152  C  CE   . LYS A 1 68 ? 19.229  0.016   -1.433  1.00 0.00 ? 68  LYS A CE   2  
ATOM   2153  N  NZ   . LYS A 1 68 ? 19.101  -1.463  -1.325  1.00 0.00 ? 68  LYS A NZ   2  
ATOM   2154  H  H    . LYS A 1 68 ? 17.152  3.815   0.877   1.00 0.00 ? 68  LYS A H    2  
ATOM   2155  H  HA   . LYS A 1 68 ? 19.451  4.843   -0.184  1.00 0.00 ? 68  LYS A HA   2  
ATOM   2156  H  HB2  . LYS A 1 68 ? 17.607  2.860   -1.532  1.00 0.00 ? 68  LYS A HB2  2  
ATOM   2157  H  HB3  . LYS A 1 68 ? 19.308  3.098   -1.910  1.00 0.00 ? 68  LYS A HB3  2  
ATOM   2158  H  HG2  . LYS A 1 68 ? 20.022  2.038   -0.015  1.00 0.00 ? 68  LYS A HG2  2  
ATOM   2159  H  HG3  . LYS A 1 68 ? 18.557  2.428   0.888   1.00 0.00 ? 68  LYS A HG3  2  
ATOM   2160  H  HD2  . LYS A 1 68 ? 18.354  0.142   0.505   1.00 0.00 ? 68  LYS A HD2  2  
ATOM   2161  H  HD3  . LYS A 1 68 ? 17.378  0.852   -0.782  1.00 0.00 ? 68  LYS A HD3  2  
ATOM   2162  H  HE2  . LYS A 1 68 ? 18.911  0.325   -2.417  1.00 0.00 ? 68  LYS A HE2  2  
ATOM   2163  H  HE3  . LYS A 1 68 ? 20.263  0.292   -1.286  1.00 0.00 ? 68  LYS A HE3  2  
ATOM   2164  H  HZ1  . LYS A 1 68 ? 18.539  -1.713  -0.486  1.00 0.00 ? 68  LYS A HZ1  2  
ATOM   2165  H  HZ2  . LYS A 1 68 ? 20.042  -1.898  -1.238  1.00 0.00 ? 68  LYS A HZ2  2  
ATOM   2166  H  HZ3  . LYS A 1 68 ? 18.632  -1.845  -2.171  1.00 0.00 ? 68  LYS A HZ3  2  
ATOM   2167  N  N    . CYS A 1 69 ? 16.903  5.411   -2.213  1.00 0.00 ? 69  CYS A N    2  
ATOM   2168  C  CA   . CYS A 1 69 ? 16.435  6.269   -3.295  1.00 0.00 ? 69  CYS A CA   2  
ATOM   2169  C  C    . CYS A 1 69 ? 16.293  7.713   -2.822  1.00 0.00 ? 69  CYS A C    2  
ATOM   2170  O  O    . CYS A 1 69 ? 16.915  8.621   -3.373  1.00 0.00 ? 69  CYS A O    2  
ATOM   2171  C  CB   . CYS A 1 69 ? 15.094  5.763   -3.832  1.00 0.00 ? 69  CYS A CB   2  
ATOM   2172  S  SG   . CYS A 1 69 ? 15.214  4.225   -4.801  1.00 0.00 ? 69  CYS A SG   2  
ATOM   2173  H  H    . CYS A 1 69 ? 16.296  4.734   -1.844  1.00 0.00 ? 69  CYS A H    2  
ATOM   2174  H  HA   . CYS A 1 69 ? 17.166  6.233   -4.088  1.00 0.00 ? 69  CYS A HA   2  
ATOM   2175  H  HB2  . CYS A 1 69 ? 14.430  5.575   -3.000  1.00 0.00 ? 69  CYS A HB2  2  
ATOM   2176  H  HB3  . CYS A 1 69 ? 14.661  6.520   -4.468  1.00 0.00 ? 69  CYS A HB3  2  
ATOM   2177  N  N    . SER A 1 70 ? 15.471  7.916   -1.798  1.00 0.00 ? 70  SER A N    2  
ATOM   2178  C  CA   . SER A 1 70 ? 15.244  9.249   -1.253  1.00 0.00 ? 70  SER A CA   2  
ATOM   2179  C  C    . SER A 1 70 ? 16.532  10.068  -1.266  1.00 0.00 ? 70  SER A C    2  
ATOM   2180  O  O    . SER A 1 70 ? 16.620  11.098  -1.934  1.00 0.00 ? 70  SER A O    2  
ATOM   2181  C  CB   . SER A 1 70 ? 14.701  9.154   0.175   1.00 0.00 ? 70  SER A CB   2  
ATOM   2182  O  OG   . SER A 1 70 ? 14.138  10.387  0.589   1.00 0.00 ? 70  SER A OG   2  
ATOM   2183  H  H    . SER A 1 70 ? 15.003  7.151   -1.402  1.00 0.00 ? 70  SER A H    2  
ATOM   2184  H  HA   . SER A 1 70 ? 14.512  9.742   -1.875  1.00 0.00 ? 70  SER A HA   2  
ATOM   2185  H  HB2  . SER A 1 70 ? 13.939  8.392   0.217   1.00 0.00 ? 70  SER A HB2  2  
ATOM   2186  H  HB3  . SER A 1 70 ? 15.507  8.896   0.847   1.00 0.00 ? 70  SER A HB3  2  
ATOM   2187  H  HG   . SER A 1 70 ? 14.727  10.813  1.216   1.00 0.00 ? 70  SER A HG   2  
ATOM   2188  N  N    . LEU A 1 71 ? 17.529  9.601   -0.522  1.00 0.00 ? 71  LEU A N    2  
ATOM   2189  C  CA   . LEU A 1 71 ? 18.814  10.288  -0.447  1.00 0.00 ? 71  LEU A CA   2  
ATOM   2190  C  C    . LEU A 1 71 ? 19.506  10.300  -1.806  1.00 0.00 ? 71  LEU A C    2  
ATOM   2191  O  O    . LEU A 1 71 ? 19.246  9.461   -2.670  1.00 0.00 ? 71  LEU A O    2  
ATOM   2192  C  CB   . LEU A 1 71 ? 19.714  9.616   0.591   1.00 0.00 ? 71  LEU A CB   2  
ATOM   2193  C  CG   . LEU A 1 71 ? 19.392  9.917   2.055   1.00 0.00 ? 71  LEU A CG   2  
ATOM   2194  C  CD1  . LEU A 1 71 ? 19.450  11.414  2.317   1.00 0.00 ? 71  LEU A CD1  2  
ATOM   2195  C  CD2  . LEU A 1 71 ? 18.025  9.362   2.426   1.00 0.00 ? 71  LEU A CD2  2  
ATOM   2196  H  H    . LEU A 1 71 ? 17.399  8.775   -0.011  1.00 0.00 ? 71  LEU A H    2  
ATOM   2197  H  HA   . LEU A 1 71 ? 18.627  11.307  -0.143  1.00 0.00 ? 71  LEU A HA   2  
ATOM   2198  H  HB2  . LEU A 1 71 ? 19.641  8.548   0.450   1.00 0.00 ? 71  LEU A HB2  2  
ATOM   2199  H  HB3  . LEU A 1 71 ? 20.730  9.933   0.402   1.00 0.00 ? 71  LEU A HB3  2  
ATOM   2200  H  HG   . LEU A 1 71 ? 20.130  9.440   2.685   1.00 0.00 ? 71  LEU A HG   2  
ATOM   2201  H  HD11 . LEU A 1 71 ? 20.308  11.834  1.815   1.00 0.00 ? 71  LEU A HD11 2  
ATOM   2202  H  HD12 . LEU A 1 71 ? 19.532  11.591  3.379   1.00 0.00 ? 71  LEU A HD12 2  
ATOM   2203  H  HD13 . LEU A 1 71 ? 18.550  11.880  1.943   1.00 0.00 ? 71  LEU A HD13 2  
ATOM   2204  H  HD21 . LEU A 1 71 ? 17.871  9.466   3.490   1.00 0.00 ? 71  LEU A HD21 2  
ATOM   2205  H  HD22 . LEU A 1 71 ? 17.976  8.317   2.156   1.00 0.00 ? 71  LEU A HD22 2  
ATOM   2206  H  HD23 . LEU A 1 71 ? 17.259  9.908   1.896   1.00 0.00 ? 71  LEU A HD23 2  
ATOM   2207  N  N    . PRO A 1 72 ? 20.410  11.271  -2.002  1.00 0.00 ? 72  PRO A N    2  
ATOM   2208  C  CA   . PRO A 1 72 ? 21.160  11.413  -3.253  1.00 0.00 ? 72  PRO A CA   2  
ATOM   2209  C  C    . PRO A 1 72 ? 22.176  10.292  -3.451  1.00 0.00 ? 72  PRO A C    2  
ATOM   2210  O  O    . PRO A 1 72 ? 22.985  10.011  -2.567  1.00 0.00 ? 72  PRO A O    2  
ATOM   2211  C  CB   . PRO A 1 72 ? 21.873  12.757  -3.088  1.00 0.00 ? 72  PRO A CB   2  
ATOM   2212  C  CG   . PRO A 1 72 ? 21.992  12.945  -1.615  1.00 0.00 ? 72  PRO A CG   2  
ATOM   2213  C  CD   . PRO A 1 72 ? 20.770  12.304  -1.017  1.00 0.00 ? 72  PRO A CD   2  
ATOM   2214  H  HA   . PRO A 1 72 ? 20.502  11.455  -4.108  1.00 0.00 ? 72  PRO A HA   2  
ATOM   2215  H  HB2  . PRO A 1 72 ? 22.845  12.713  -3.561  1.00 0.00 ? 72  PRO A HB2  2  
ATOM   2216  H  HB3  . PRO A 1 72 ? 21.282  13.540  -3.540  1.00 0.00 ? 72  PRO A HB3  2  
ATOM   2217  H  HG2  . PRO A 1 72 ? 22.885  12.460  -1.254  1.00 0.00 ? 72  PRO A HG2  2  
ATOM   2218  H  HG3  . PRO A 1 72 ? 22.014  13.999  -1.381  1.00 0.00 ? 72  PRO A HG3  2  
ATOM   2219  H  HD2  . PRO A 1 72 ? 21.007  11.860  -0.061  1.00 0.00 ? 72  PRO A HD2  2  
ATOM   2220  H  HD3  . PRO A 1 72 ? 19.977  13.029  -0.911  1.00 0.00 ? 72  PRO A HD3  2  
ATOM   2221  N  N    . VAL A 1 73 ? 22.127  9.655   -4.617  1.00 0.00 ? 73  VAL A N    2  
ATOM   2222  C  CA   . VAL A 1 73 ? 23.044  8.566   -4.931  1.00 0.00 ? 73  VAL A CA   2  
ATOM   2223  C  C    . VAL A 1 73 ? 24.107  9.013   -5.929  1.00 0.00 ? 73  VAL A C    2  
ATOM   2224  O  O    . VAL A 1 73 ? 23.849  9.852   -6.792  1.00 0.00 ? 73  VAL A O    2  
ATOM   2225  C  CB   . VAL A 1 73 ? 22.295  7.350   -5.507  1.00 0.00 ? 73  VAL A CB   2  
ATOM   2226  C  CG1  . VAL A 1 73 ? 23.228  6.155   -5.626  1.00 0.00 ? 73  VAL A CG1  2  
ATOM   2227  C  CG2  . VAL A 1 73 ? 21.089  7.011   -4.644  1.00 0.00 ? 73  VAL A CG2  2  
ATOM   2228  H  H    . VAL A 1 73 ? 21.460  9.925   -5.281  1.00 0.00 ? 73  VAL A H    2  
ATOM   2229  H  HA   . VAL A 1 73 ? 23.529  8.263   -4.015  1.00 0.00 ? 73  VAL A HA   2  
ATOM   2230  H  HB   . VAL A 1 73 ? 21.943  7.604   -6.496  1.00 0.00 ? 73  VAL A HB   2  
ATOM   2231  H  HG11 . VAL A 1 73 ? 24.206  6.492   -5.936  1.00 0.00 ? 73  VAL A HG11 2  
ATOM   2232  H  HG12 . VAL A 1 73 ? 23.303  5.659   -4.670  1.00 0.00 ? 73  VAL A HG12 2  
ATOM   2233  H  HG13 . VAL A 1 73 ? 22.837  5.465   -6.360  1.00 0.00 ? 73  VAL A HG13 2  
ATOM   2234  H  HG21 . VAL A 1 73 ? 21.398  6.925   -3.613  1.00 0.00 ? 73  VAL A HG21 2  
ATOM   2235  H  HG22 . VAL A 1 73 ? 20.349  7.794   -4.734  1.00 0.00 ? 73  VAL A HG22 2  
ATOM   2236  H  HG23 . VAL A 1 73 ? 20.663  6.074   -4.972  1.00 0.00 ? 73  VAL A HG23 2  
ATOM   2237  N  N    . SER A 1 74 ? 25.303  8.447   -5.804  1.00 0.00 ? 74  SER A N    2  
ATOM   2238  C  CA   . SER A 1 74 ? 26.407  8.789   -6.693  1.00 0.00 ? 74  SER A CA   2  
ATOM   2239  C  C    . SER A 1 74 ? 26.230  8.132   -8.058  1.00 0.00 ? 74  SER A C    2  
ATOM   2240  O  O    . SER A 1 74 ? 27.152  7.510   -8.585  1.00 0.00 ? 74  SER A O    2  
ATOM   2241  C  CB   . SER A 1 74 ? 27.739  8.358   -6.076  1.00 0.00 ? 74  SER A CB   2  
ATOM   2242  O  OG   . SER A 1 74 ? 28.280  9.384   -5.262  1.00 0.00 ? 74  SER A OG   2  
ATOM   2243  H  H    . SER A 1 74 ? 25.447  7.785   -5.095  1.00 0.00 ? 74  SER A H    2  
ATOM   2244  H  HA   . SER A 1 74 ? 26.410  9.861   -6.821  1.00 0.00 ? 74  SER A HA   2  
ATOM   2245  H  HB2  . SER A 1 74 ? 27.584  7.478   -5.470  1.00 0.00 ? 74  SER A HB2  2  
ATOM   2246  H  HB3  . SER A 1 74 ? 28.442  8.133   -6.865  1.00 0.00 ? 74  SER A HB3  2  
ATOM   2247  H  HG   . SER A 1 74 ? 29.215  9.220   -5.117  1.00 0.00 ? 74  SER A HG   2  
ATOM   2248  N  N    . VAL A 1 75 ? 25.036  8.273   -8.625  1.00 0.00 ? 75  VAL A N    2  
ATOM   2249  C  CA   . VAL A 1 75 ? 24.736  7.694   -9.929  1.00 0.00 ? 75  VAL A CA   2  
ATOM   2250  C  C    . VAL A 1 75 ? 25.487  6.384   -10.135 1.00 0.00 ? 75  VAL A C    2  
ATOM   2251  O  O    . VAL A 1 75 ? 26.055  6.143   -11.200 1.00 0.00 ? 75  VAL A O    2  
ATOM   2252  C  CB   . VAL A 1 75 ? 25.096  8.664   -11.070 1.00 0.00 ? 75  VAL A CB   2  
ATOM   2253  C  CG1  . VAL A 1 75 ? 26.594  8.927   -11.096 1.00 0.00 ? 75  VAL A CG1  2  
ATOM   2254  C  CG2  . VAL A 1 75 ? 24.619  8.115   -12.406 1.00 0.00 ? 75  VAL A CG2  2  
ATOM   2255  H  H    . VAL A 1 75 ? 24.341  8.779   -8.156  1.00 0.00 ? 75  VAL A H    2  
ATOM   2256  H  HA   . VAL A 1 75 ? 23.674  7.500   -9.972  1.00 0.00 ? 75  VAL A HA   2  
ATOM   2257  H  HB   . VAL A 1 75 ? 24.591  9.603   -10.890 1.00 0.00 ? 75  VAL A HB   2  
ATOM   2258  H  HG11 . VAL A 1 75 ? 27.102  8.070   -11.513 1.00 0.00 ? 75  VAL A HG11 2  
ATOM   2259  H  HG12 . VAL A 1 75 ? 26.797  9.798   -11.702 1.00 0.00 ? 75  VAL A HG12 2  
ATOM   2260  H  HG13 . VAL A 1 75 ? 26.946  9.098   -10.089 1.00 0.00 ? 75  VAL A HG13 2  
ATOM   2261  H  HG21 . VAL A 1 75 ? 23.995  8.849   -12.894 1.00 0.00 ? 75  VAL A HG21 2  
ATOM   2262  H  HG22 . VAL A 1 75 ? 25.473  7.897   -13.031 1.00 0.00 ? 75  VAL A HG22 2  
ATOM   2263  H  HG23 . VAL A 1 75 ? 24.053  7.211   -12.243 1.00 0.00 ? 75  VAL A HG23 2  
ATOM   2264  N  N    . SER A 1 76 ? 25.486  5.540   -9.109  1.00 0.00 ? 76  SER A N    2  
ATOM   2265  C  CA   . SER A 1 76 ? 26.171  4.254   -9.175  1.00 0.00 ? 76  SER A CA   2  
ATOM   2266  C  C    . SER A 1 76 ? 25.534  3.353   -10.229 1.00 0.00 ? 76  SER A C    2  
ATOM   2267  O  O    . SER A 1 76 ? 26.229  2.696   -11.002 1.00 0.00 ? 76  SER A O    2  
ATOM   2268  C  CB   . SER A 1 76 ? 26.138  3.563   -7.811  1.00 0.00 ? 76  SER A CB   2  
ATOM   2269  O  OG   . SER A 1 76 ? 24.837  3.087   -7.511  1.00 0.00 ? 76  SER A OG   2  
ATOM   2270  H  H    . SER A 1 76 ? 25.015  5.789   -8.286  1.00 0.00 ? 76  SER A H    2  
ATOM   2271  H  HA   . SER A 1 76 ? 27.198  4.440   -9.450  1.00 0.00 ? 76  SER A HA   2  
ATOM   2272  H  HB2  . SER A 1 76 ? 26.821  2.728   -7.816  1.00 0.00 ? 76  SER A HB2  2  
ATOM   2273  H  HB3  . SER A 1 76 ? 26.435  4.267   -7.047  1.00 0.00 ? 76  SER A HB3  2  
ATOM   2274  H  HG   . SER A 1 76 ? 24.339  3.775   -7.063  1.00 0.00 ? 76  SER A HG   2  
ATOM   2275  N  N    . GLY A 1 77 ? 24.205  3.330   -10.254 1.00 0.00 ? 77  GLY A N    2  
ATOM   2276  C  CA   . GLY A 1 77 ? 23.495  2.507   -11.216 1.00 0.00 ? 77  GLY A CA   2  
ATOM   2277  C  C    . GLY A 1 77 ? 22.427  3.280   -11.964 1.00 0.00 ? 77  GLY A C    2  
ATOM   2278  O  O    . GLY A 1 77 ? 21.732  4.125   -11.399 1.00 0.00 ? 77  GLY A O    2  
ATOM   2279  H  H    . GLY A 1 77 ? 23.702  3.875   -9.613  1.00 0.00 ? 77  GLY A H    2  
ATOM   2280  H  HA2  . GLY A 1 77 ? 24.204  2.112   -11.928 1.00 0.00 ? 77  GLY A HA2  2  
ATOM   2281  H  HA3  . GLY A 1 77 ? 23.028  1.685   -10.694 1.00 0.00 ? 77  GLY A HA3  2  
ATOM   2282  N  N    . PRO A 1 78 ? 22.287  2.994   -13.267 1.00 0.00 ? 78  PRO A N    2  
ATOM   2283  C  CA   . PRO A 1 78 ? 21.299  3.659   -14.122 1.00 0.00 ? 78  PRO A CA   2  
ATOM   2284  C  C    . PRO A 1 78 ? 19.870  3.254   -13.779 1.00 0.00 ? 78  PRO A C    2  
ATOM   2285  O  O    . PRO A 1 78 ? 19.574  2.072   -13.607 1.00 0.00 ? 78  PRO A O    2  
ATOM   2286  C  CB   . PRO A 1 78 ? 21.668  3.181   -15.528 1.00 0.00 ? 78  PRO A CB   2  
ATOM   2287  C  CG   . PRO A 1 78 ? 22.355  1.876   -15.317 1.00 0.00 ? 78  PRO A CG   2  
ATOM   2288  C  CD   . PRO A 1 78 ? 23.082  1.999   -14.006 1.00 0.00 ? 78  PRO A CD   2  
ATOM   2289  H  HA   . PRO A 1 78 ? 21.390  4.734   -14.070 1.00 0.00 ? 78  PRO A HA   2  
ATOM   2290  H  HB2  . PRO A 1 78 ? 20.769  3.064   -16.118 1.00 0.00 ? 78  PRO A HB2  2  
ATOM   2291  H  HB3  . PRO A 1 78 ? 22.322  3.900   -15.997 1.00 0.00 ? 78  PRO A HB3  2  
ATOM   2292  H  HG2  . PRO A 1 78 ? 21.627  1.081   -15.269 1.00 0.00 ? 78  PRO A HG2  2  
ATOM   2293  H  HG3  . PRO A 1 78 ? 23.057  1.697   -16.118 1.00 0.00 ? 78  PRO A HG3  2  
ATOM   2294  H  HD2  . PRO A 1 78 ? 23.091  1.051   -13.489 1.00 0.00 ? 78  PRO A HD2  2  
ATOM   2295  H  HD3  . PRO A 1 78 ? 24.090  2.353   -14.166 1.00 0.00 ? 78  PRO A HD3  2  
ATOM   2296  N  N    . SER A 1 79 ? 18.987  4.243   -13.681 1.00 0.00 ? 79  SER A N    2  
ATOM   2297  C  CA   . SER A 1 79 ? 17.588  3.989   -13.355 1.00 0.00 ? 79  SER A CA   2  
ATOM   2298  C  C    . SER A 1 79 ? 16.706  5.148   -13.808 1.00 0.00 ? 79  SER A C    2  
ATOM   2299  O  O    . SER A 1 79 ? 17.201  6.219   -14.160 1.00 0.00 ? 79  SER A O    2  
ATOM   2300  C  CB   . SER A 1 79 ? 17.425  3.767   -11.850 1.00 0.00 ? 79  SER A CB   2  
ATOM   2301  O  OG   . SER A 1 79 ? 17.516  4.991   -11.142 1.00 0.00 ? 79  SER A OG   2  
ATOM   2302  H  H    . SER A 1 79 ? 19.284  5.165   -13.830 1.00 0.00 ? 79  SER A H    2  
ATOM   2303  H  HA   . SER A 1 79 ? 17.283  3.094   -13.877 1.00 0.00 ? 79  SER A HA   2  
ATOM   2304  H  HB2  . SER A 1 79 ? 16.461  3.324   -11.657 1.00 0.00 ? 79  SER A HB2  2  
ATOM   2305  H  HB3  . SER A 1 79 ? 18.203  3.104   -11.501 1.00 0.00 ? 79  SER A HB3  2  
ATOM   2306  H  HG   . SER A 1 79 ? 16.677  5.454   -11.192 1.00 0.00 ? 79  SER A HG   2  
ATOM   2307  N  N    . SER A 1 80 ? 15.395  4.926   -13.797 1.00 0.00 ? 80  SER A N    2  
ATOM   2308  C  CA   . SER A 1 80 ? 14.443  5.949   -14.211 1.00 0.00 ? 80  SER A CA   2  
ATOM   2309  C  C    . SER A 1 80 ? 14.613  7.217   -13.380 1.00 0.00 ? 80  SER A C    2  
ATOM   2310  O  O    . SER A 1 80 ? 15.239  7.199   -12.320 1.00 0.00 ? 80  SER A O    2  
ATOM   2311  C  CB   . SER A 1 80 ? 13.011  5.427   -14.077 1.00 0.00 ? 80  SER A CB   2  
ATOM   2312  O  OG   . SER A 1 80 ? 12.598  4.763   -15.259 1.00 0.00 ? 80  SER A OG   2  
ATOM   2313  H  H    . SER A 1 80 ? 15.062  4.051   -13.507 1.00 0.00 ? 80  SER A H    2  
ATOM   2314  H  HA   . SER A 1 80 ? 14.636  6.183   -15.247 1.00 0.00 ? 80  SER A HA   2  
ATOM   2315  H  HB2  . SER A 1 80 ? 12.959  4.733   -13.252 1.00 0.00 ? 80  SER A HB2  2  
ATOM   2316  H  HB3  . SER A 1 80 ? 12.344  6.257   -13.892 1.00 0.00 ? 80  SER A HB3  2  
ATOM   2317  H  HG   . SER A 1 80 ? 12.509  3.823   -15.084 1.00 0.00 ? 80  SER A HG   2  
ATOM   2318  N  N    . GLY A 1 81 ? 14.052  8.318   -13.870 1.00 0.00 ? 81  GLY A N    2  
ATOM   2319  C  CA   . GLY A 1 81 ? 14.153  9.581   -13.161 1.00 0.00 ? 81  GLY A CA   2  
ATOM   2320  C  C    . GLY A 1 81 ? 13.535  9.520   -11.778 1.00 0.00 ? 81  GLY A C    2  
ATOM   2321  O  O    . GLY A 1 81 ? 12.872  8.534   -11.461 1.00 0.00 ? 81  GLY A O    2  
ATOM   2322  H  H    . GLY A 1 81 ? 13.565  8.273   -14.720 1.00 0.00 ? 81  GLY A H    2  
ATOM   2323  H  HA2  . GLY A 1 81 ? 15.195  9.847   -13.068 1.00 0.00 ? 81  GLY A HA2  2  
ATOM   2324  H  HA3  . GLY A 1 81 ? 13.647  10.344  -13.735 1.00 0.00 ? 81  GLY A HA3  2  
HETATM 2325  ZN ZN   . ZN  B 2 .  ? -2.832  -2.658  -4.049  1.00 0.00 ? 201 ZN  A ZN   2  
HETATM 2326  ZN ZN   . ZN  C 2 .  ? 13.755  2.702   -3.764  1.00 0.00 ? 401 ZN  A ZN   2  
ATOM   2327  N  N    . GLY A 1 1  ? -39.648 -11.170 -12.636 1.00 0.00 ? 1   GLY A N    3  
ATOM   2328  C  CA   . GLY A 1 1  ? -38.213 -11.362 -12.534 1.00 0.00 ? 1   GLY A CA   3  
ATOM   2329  C  C    . GLY A 1 1  ? -37.844 -12.459 -11.555 1.00 0.00 ? 1   GLY A C    3  
ATOM   2330  O  O    . GLY A 1 1  ? -38.625 -12.796 -10.666 1.00 0.00 ? 1   GLY A O    3  
ATOM   2331  H  H1   . GLY A 1 1  ? -40.155 -10.850 -11.861 1.00 0.00 ? 1   GLY A H1   3  
ATOM   2332  H  HA2  . GLY A 1 1  ? -37.825 -11.617 -13.508 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   2333  H  HA3  . GLY A 1 1  ? -37.761 -10.437 -12.207 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   2334  N  N    . SER A 1 2  ? -36.650 -13.019 -11.719 1.00 0.00 ? 2   SER A N    3  
ATOM   2335  C  CA   . SER A 1 2  ? -36.180 -14.088 -10.846 1.00 0.00 ? 2   SER A CA   3  
ATOM   2336  C  C    . SER A 1 2  ? -34.966 -13.637 -10.039 1.00 0.00 ? 2   SER A C    3  
ATOM   2337  O  O    . SER A 1 2  ? -34.013 -14.394 -9.856  1.00 0.00 ? 2   SER A O    3  
ATOM   2338  C  CB   . SER A 1 2  ? -35.828 -15.329 -11.669 1.00 0.00 ? 2   SER A CB   3  
ATOM   2339  O  OG   . SER A 1 2  ? -34.753 -15.066 -12.554 1.00 0.00 ? 2   SER A OG   3  
ATOM   2340  H  H    . SER A 1 2  ? -36.072 -12.706 -12.447 1.00 0.00 ? 2   SER A H    3  
ATOM   2341  H  HA   . SER A 1 2  ? -36.980 -14.334 -10.164 1.00 0.00 ? 2   SER A HA   3  
ATOM   2342  H  HB2  . SER A 1 2  ? -35.543 -16.130 -11.004 1.00 0.00 ? 2   SER A HB2  3  
ATOM   2343  H  HB3  . SER A 1 2  ? -36.689 -15.630 -12.247 1.00 0.00 ? 2   SER A HB3  3  
ATOM   2344  H  HG   . SER A 1 2  ? -34.220 -14.347 -12.206 1.00 0.00 ? 2   SER A HG   3  
ATOM   2345  N  N    . SER A 1 3  ? -35.009 -12.399 -9.560  1.00 0.00 ? 3   SER A N    3  
ATOM   2346  C  CA   . SER A 1 3  ? -33.912 -11.844 -8.775  1.00 0.00 ? 3   SER A CA   3  
ATOM   2347  C  C    . SER A 1 3  ? -34.063 -12.202 -7.300  1.00 0.00 ? 3   SER A C    3  
ATOM   2348  O  O    . SER A 1 3  ? -35.175 -12.267 -6.776  1.00 0.00 ? 3   SER A O    3  
ATOM   2349  C  CB   . SER A 1 3  ? -33.857 -10.324 -8.940  1.00 0.00 ? 3   SER A CB   3  
ATOM   2350  O  OG   . SER A 1 3  ? -32.715 -9.783  -8.298  1.00 0.00 ? 3   SER A OG   3  
ATOM   2351  H  H    . SER A 1 3  ? -35.797 -11.844 -9.740  1.00 0.00 ? 3   SER A H    3  
ATOM   2352  H  HA   . SER A 1 3  ? -32.992 -12.271 -9.145  1.00 0.00 ? 3   SER A HA   3  
ATOM   2353  H  HB2  . SER A 1 3  ? -33.814 -10.080 -9.990  1.00 0.00 ? 3   SER A HB2  3  
ATOM   2354  H  HB3  . SER A 1 3  ? -34.743 -9.885  -8.504  1.00 0.00 ? 3   SER A HB3  3  
ATOM   2355  H  HG   . SER A 1 3  ? -32.287 -10.466 -7.777  1.00 0.00 ? 3   SER A HG   3  
ATOM   2356  N  N    . GLY A 1 4  ? -32.936 -12.434 -6.635  1.00 0.00 ? 4   GLY A N    3  
ATOM   2357  C  CA   . GLY A 1 4  ? -32.964 -12.783 -5.227  1.00 0.00 ? 4   GLY A CA   3  
ATOM   2358  C  C    . GLY A 1 4  ? -31.576 -13.004 -4.657  1.00 0.00 ? 4   GLY A C    3  
ATOM   2359  O  O    . GLY A 1 4  ? -30.783 -12.068 -4.556  1.00 0.00 ? 4   GLY A O    3  
ATOM   2360  H  H    . GLY A 1 4  ? -32.078 -12.368 -7.105  1.00 0.00 ? 4   GLY A H    3  
ATOM   2361  H  HA2  . GLY A 1 4  ? -33.444 -11.987 -4.679  1.00 0.00 ? 4   GLY A HA2  3  
ATOM   2362  H  HA3  . GLY A 1 4  ? -33.539 -13.689 -5.103  1.00 0.00 ? 4   GLY A HA3  3  
ATOM   2363  N  N    . SER A 1 5  ? -31.283 -14.245 -4.280  1.00 0.00 ? 5   SER A N    3  
ATOM   2364  C  CA   . SER A 1 5  ? -29.984 -14.584 -3.712  1.00 0.00 ? 5   SER A CA   3  
ATOM   2365  C  C    . SER A 1 5  ? -28.853 -14.011 -4.560  1.00 0.00 ? 5   SER A C    3  
ATOM   2366  O  O    . SER A 1 5  ? -27.970 -13.320 -4.052  1.00 0.00 ? 5   SER A O    3  
ATOM   2367  C  CB   . SER A 1 5  ? -29.834 -16.102 -3.600  1.00 0.00 ? 5   SER A CB   3  
ATOM   2368  O  OG   . SER A 1 5  ? -28.892 -16.449 -2.599  1.00 0.00 ? 5   SER A OG   3  
ATOM   2369  H  H    . SER A 1 5  ? -31.958 -14.948 -4.386  1.00 0.00 ? 5   SER A H    3  
ATOM   2370  H  HA   . SER A 1 5  ? -29.932 -14.152 -2.724  1.00 0.00 ? 5   SER A HA   3  
ATOM   2371  H  HB2  . SER A 1 5  ? -30.788 -16.539 -3.347  1.00 0.00 ? 5   SER A HB2  3  
ATOM   2372  H  HB3  . SER A 1 5  ? -29.497 -16.499 -4.547  1.00 0.00 ? 5   SER A HB3  3  
ATOM   2373  H  HG   . SER A 1 5  ? -29.143 -17.286 -2.200  1.00 0.00 ? 5   SER A HG   3  
ATOM   2374  N  N    . SER A 1 6  ? -28.887 -14.303 -5.857  1.00 0.00 ? 6   SER A N    3  
ATOM   2375  C  CA   . SER A 1 6  ? -27.864 -13.821 -6.776  1.00 0.00 ? 6   SER A CA   3  
ATOM   2376  C  C    . SER A 1 6  ? -27.496 -12.372 -6.468  1.00 0.00 ? 6   SER A C    3  
ATOM   2377  O  O    . SER A 1 6  ? -28.251 -11.450 -6.772  1.00 0.00 ? 6   SER A O    3  
ATOM   2378  C  CB   . SER A 1 6  ? -28.351 -13.938 -8.222  1.00 0.00 ? 6   SER A CB   3  
ATOM   2379  O  OG   . SER A 1 6  ? -27.402 -13.398 -9.125  1.00 0.00 ? 6   SER A OG   3  
ATOM   2380  H  H    . SER A 1 6  ? -29.617 -14.859 -6.202  1.00 0.00 ? 6   SER A H    3  
ATOM   2381  H  HA   . SER A 1 6  ? -26.987 -14.438 -6.649  1.00 0.00 ? 6   SER A HA   3  
ATOM   2382  H  HB2  . SER A 1 6  ? -28.507 -14.979 -8.463  1.00 0.00 ? 6   SER A HB2  3  
ATOM   2383  H  HB3  . SER A 1 6  ? -29.281 -13.400 -8.330  1.00 0.00 ? 6   SER A HB3  3  
ATOM   2384  H  HG   . SER A 1 6  ? -26.703 -14.037 -9.276  1.00 0.00 ? 6   SER A HG   3  
ATOM   2385  N  N    . GLY A 1 7  ? -26.328 -12.181 -5.862  1.00 0.00 ? 7   GLY A N    3  
ATOM   2386  C  CA   . GLY A 1 7  ? -25.879 -10.844 -5.522  1.00 0.00 ? 7   GLY A CA   3  
ATOM   2387  C  C    . GLY A 1 7  ? -24.783 -10.849 -4.474  1.00 0.00 ? 7   GLY A C    3  
ATOM   2388  O  O    . GLY A 1 7  ? -24.641 -11.811 -3.718  1.00 0.00 ? 7   GLY A O    3  
ATOM   2389  H  H    . GLY A 1 7  ? -25.767 -12.955 -5.643  1.00 0.00 ? 7   GLY A H    3  
ATOM   2390  H  HA2  . GLY A 1 7  ? -25.507 -10.363 -6.414  1.00 0.00 ? 7   GLY A HA2  3  
ATOM   2391  H  HA3  . GLY A 1 7  ? -26.719 -10.280 -5.144  1.00 0.00 ? 7   GLY A HA3  3  
ATOM   2392  N  N    . LEU A 1 8  ? -24.006 -9.773  -4.428  1.00 0.00 ? 8   LEU A N    3  
ATOM   2393  C  CA   . LEU A 1 8  ? -22.915 -9.658  -3.466  1.00 0.00 ? 8   LEU A CA   3  
ATOM   2394  C  C    . LEU A 1 8  ? -23.265 -8.662  -2.364  1.00 0.00 ? 8   LEU A C    3  
ATOM   2395  O  O    . LEU A 1 8  ? -22.838 -7.508  -2.398  1.00 0.00 ? 8   LEU A O    3  
ATOM   2396  C  CB   . LEU A 1 8  ? -21.630 -9.223  -4.171  1.00 0.00 ? 8   LEU A CB   3  
ATOM   2397  C  CG   . LEU A 1 8  ? -21.809 -8.385  -5.437  1.00 0.00 ? 8   LEU A CG   3  
ATOM   2398  C  CD1  . LEU A 1 8  ? -20.524 -7.644  -5.774  1.00 0.00 ? 8   LEU A CD1  3  
ATOM   2399  C  CD2  . LEU A 1 8  ? -22.241 -9.263  -6.602  1.00 0.00 ? 8   LEU A CD2  3  
ATOM   2400  H  H    . LEU A 1 8  ? -24.167 -9.039  -5.056  1.00 0.00 ? 8   LEU A H    3  
ATOM   2401  H  HA   . LEU A 1 8  ? -22.762 -10.629 -3.021  1.00 0.00 ? 8   LEU A HA   3  
ATOM   2402  H  HB2  . LEU A 1 8  ? -21.048 -8.644  -3.471  1.00 0.00 ? 8   LEU A HB2  3  
ATOM   2403  H  HB3  . LEU A 1 8  ? -21.083 -10.116 -4.440  1.00 0.00 ? 8   LEU A HB3  3  
ATOM   2404  H  HG   . LEU A 1 8  ? -22.583 -7.649  -5.267  1.00 0.00 ? 8   LEU A HG   3  
ATOM   2405  H  HD11 . LEU A 1 8  ? -19.803 -7.798  -4.985  1.00 0.00 ? 8   LEU A HD11 3  
ATOM   2406  H  HD12 . LEU A 1 8  ? -20.732 -6.589  -5.871  1.00 0.00 ? 8   LEU A HD12 3  
ATOM   2407  H  HD13 . LEU A 1 8  ? -20.126 -8.019  -6.705  1.00 0.00 ? 8   LEU A HD13 3  
ATOM   2408  H  HD21 . LEU A 1 8  ? -21.386 -9.480  -7.225  1.00 0.00 ? 8   LEU A HD21 3  
ATOM   2409  H  HD22 . LEU A 1 8  ? -22.989 -8.745  -7.186  1.00 0.00 ? 8   LEU A HD22 3  
ATOM   2410  H  HD23 . LEU A 1 8  ? -22.655 -10.186 -6.223  1.00 0.00 ? 8   LEU A HD23 3  
ATOM   2411  N  N    . ASP A 1 9  ? -24.042 -9.118  -1.387  1.00 0.00 ? 9   ASP A N    3  
ATOM   2412  C  CA   . ASP A 1 9  ? -24.447 -8.269  -0.273  1.00 0.00 ? 9   ASP A CA   3  
ATOM   2413  C  C    . ASP A 1 9  ? -23.470 -8.400  0.892   1.00 0.00 ? 9   ASP A C    3  
ATOM   2414  O  O    . ASP A 1 9  ? -23.308 -7.473  1.686   1.00 0.00 ? 9   ASP A O    3  
ATOM   2415  C  CB   . ASP A 1 9  ? -25.860 -8.632  0.186   1.00 0.00 ? 9   ASP A CB   3  
ATOM   2416  C  CG   . ASP A 1 9  ? -26.042 -10.126 0.371   1.00 0.00 ? 9   ASP A CG   3  
ATOM   2417  O  OD1  . ASP A 1 9  ? -26.178 -10.837 -0.647  1.00 0.00 ? 9   ASP A OD1  3  
ATOM   2418  O  OD2  . ASP A 1 9  ? -26.049 -10.583 1.532   1.00 0.00 ? 9   ASP A OD2  3  
ATOM   2419  H  H    . ASP A 1 9  ? -24.350 -10.048 -1.416  1.00 0.00 ? 9   ASP A H    3  
ATOM   2420  H  HA   . ASP A 1 9  ? -24.442 -7.246  -0.617  1.00 0.00 ? 9   ASP A HA   3  
ATOM   2421  H  HB2  . ASP A 1 9  ? -26.061 -8.145  1.129   1.00 0.00 ? 9   ASP A HB2  3  
ATOM   2422  H  HB3  . ASP A 1 9  ? -26.570 -8.288  -0.551  1.00 0.00 ? 9   ASP A HB3  3  
ATOM   2423  N  N    . TYR A 1 10 ? -22.824 -9.556  0.989   1.00 0.00 ? 10  TYR A N    3  
ATOM   2424  C  CA   . TYR A 1 10 ? -21.867 -9.810  2.059   1.00 0.00 ? 10  TYR A CA   3  
ATOM   2425  C  C    . TYR A 1 10 ? -20.684 -8.851  1.970   1.00 0.00 ? 10  TYR A C    3  
ATOM   2426  O  O    . TYR A 1 10 ? -19.830 -8.818  2.856   1.00 0.00 ? 10  TYR A O    3  
ATOM   2427  C  CB   . TYR A 1 10 ? -21.371 -11.255 1.996   1.00 0.00 ? 10  TYR A CB   3  
ATOM   2428  C  CG   . TYR A 1 10 ? -21.277 -11.803 0.590   1.00 0.00 ? 10  TYR A CG   3  
ATOM   2429  C  CD1  . TYR A 1 10 ? -21.020 -10.964 -0.488  1.00 0.00 ? 10  TYR A CD1  3  
ATOM   2430  C  CD2  . TYR A 1 10 ? -21.442 -13.159 0.339   1.00 0.00 ? 10  TYR A CD2  3  
ATOM   2431  C  CE1  . TYR A 1 10 ? -20.933 -11.460 -1.774  1.00 0.00 ? 10  TYR A CE1  3  
ATOM   2432  C  CE2  . TYR A 1 10 ? -21.356 -13.664 -0.944  1.00 0.00 ? 10  TYR A CE2  3  
ATOM   2433  C  CZ   . TYR A 1 10 ? -21.102 -12.810 -1.997  1.00 0.00 ? 10  TYR A CZ   3  
ATOM   2434  O  OH   . TYR A 1 10 ? -21.015 -13.308 -3.277  1.00 0.00 ? 10  TYR A OH   3  
ATOM   2435  H  H    . TYR A 1 10 ? -22.996 -10.257 0.326   1.00 0.00 ? 10  TYR A H    3  
ATOM   2436  H  HA   . TYR A 1 10 ? -22.373 -9.653  3.000   1.00 0.00 ? 10  TYR A HA   3  
ATOM   2437  H  HB2  . TYR A 1 10 ? -20.390 -11.312 2.440   1.00 0.00 ? 10  TYR A HB2  3  
ATOM   2438  H  HB3  . TYR A 1 10 ? -22.050 -11.886 2.553   1.00 0.00 ? 10  TYR A HB3  3  
ATOM   2439  H  HD1  . TYR A 1 10 ? -20.888 -9.906  -0.309  1.00 0.00 ? 10  TYR A HD1  3  
ATOM   2440  H  HD2  . TYR A 1 10 ? -21.641 -13.826 1.166   1.00 0.00 ? 10  TYR A HD2  3  
ATOM   2441  H  HE1  . TYR A 1 10 ? -20.734 -10.791 -2.599  1.00 0.00 ? 10  TYR A HE1  3  
ATOM   2442  H  HE2  . TYR A 1 10 ? -21.488 -14.722 -1.120  1.00 0.00 ? 10  TYR A HE2  3  
ATOM   2443  H  HH   . TYR A 1 10 ? -21.896 -13.499 -3.607  1.00 0.00 ? 10  TYR A HH   3  
ATOM   2444  N  N    . GLN A 1 11 ? -20.642 -8.071  0.894   1.00 0.00 ? 11  GLN A N    3  
ATOM   2445  C  CA   . GLN A 1 11 ? -19.564 -7.111  0.689   1.00 0.00 ? 11  GLN A CA   3  
ATOM   2446  C  C    . GLN A 1 11 ? -19.848 -5.807  1.428   1.00 0.00 ? 11  GLN A C    3  
ATOM   2447  O  O    . GLN A 1 11 ? -18.934 -5.036  1.720   1.00 0.00 ? 11  GLN A O    3  
ATOM   2448  C  CB   . GLN A 1 11 ? -19.377 -6.834  -0.804  1.00 0.00 ? 11  GLN A CB   3  
ATOM   2449  C  CG   . GLN A 1 11 ? -20.547 -6.098  -1.438  1.00 0.00 ? 11  GLN A CG   3  
ATOM   2450  C  CD   . GLN A 1 11 ? -20.428 -4.593  -1.311  1.00 0.00 ? 11  GLN A CD   3  
ATOM   2451  O  OE1  . GLN A 1 11 ? -19.548 -3.975  -1.912  1.00 0.00 ? 11  GLN A OE1  3  
ATOM   2452  N  NE2  . GLN A 1 11 ? -21.314 -3.993  -0.525  1.00 0.00 ? 11  GLN A NE2  3  
ATOM   2453  H  H    . GLN A 1 11 ? -21.352 -8.144  0.223   1.00 0.00 ? 11  GLN A H    3  
ATOM   2454  H  HA   . GLN A 1 11 ? -18.657 -7.542  1.082   1.00 0.00 ? 11  GLN A HA   3  
ATOM   2455  H  HB2  . GLN A 1 11 ? -18.488 -6.236  -0.939  1.00 0.00 ? 11  GLN A HB2  3  
ATOM   2456  H  HB3  . GLN A 1 11 ? -19.250 -7.775  -1.319  1.00 0.00 ? 11  GLN A HB3  3  
ATOM   2457  H  HG2  . GLN A 1 11 ? -20.590 -6.353  -2.487  1.00 0.00 ? 11  GLN A HG2  3  
ATOM   2458  H  HG3  . GLN A 1 11 ? -21.459 -6.415  -0.954  1.00 0.00 ? 11  GLN A HG3  3  
ATOM   2459  H  HE21 . GLN A 1 11 ? -21.986 -4.549  -0.077  1.00 0.00 ? 11  GLN A HE21 3  
ATOM   2460  H  HE22 . GLN A 1 11 ? -21.260 -3.020  -0.424  1.00 0.00 ? 11  GLN A HE22 3  
ATOM   2461  N  N    . ARG A 1 12 ? -21.121 -5.567  1.727   1.00 0.00 ? 12  ARG A N    3  
ATOM   2462  C  CA   . ARG A 1 12 ? -21.525 -4.356  2.430   1.00 0.00 ? 12  ARG A CA   3  
ATOM   2463  C  C    . ARG A 1 12 ? -20.582 -4.062  3.593   1.00 0.00 ? 12  ARG A C    3  
ATOM   2464  O  O    . ARG A 1 12 ? -20.303 -2.903  3.902   1.00 0.00 ? 12  ARG A O    3  
ATOM   2465  C  CB   . ARG A 1 12 ? -22.959 -4.495  2.946   1.00 0.00 ? 12  ARG A CB   3  
ATOM   2466  C  CG   . ARG A 1 12 ? -23.731 -3.185  2.960   1.00 0.00 ? 12  ARG A CG   3  
ATOM   2467  C  CD   . ARG A 1 12 ? -23.438 -2.380  4.216   1.00 0.00 ? 12  ARG A CD   3  
ATOM   2468  N  NE   . ARG A 1 12 ? -24.206 -2.858  5.363   1.00 0.00 ? 12  ARG A NE   3  
ATOM   2469  C  CZ   . ARG A 1 12 ? -23.845 -2.654  6.625   1.00 0.00 ? 12  ARG A CZ   3  
ATOM   2470  N  NH1  . ARG A 1 12 ? -22.734 -1.984  6.901   1.00 0.00 ? 12  ARG A NH1  3  
ATOM   2471  N  NH2  . ARG A 1 12 ? -24.596 -3.120  7.615   1.00 0.00 ? 12  ARG A NH2  3  
ATOM   2472  H  H    . ARG A 1 12 ? -21.804 -6.220  1.467   1.00 0.00 ? 12  ARG A H    3  
ATOM   2473  H  HA   . ARG A 1 12 ? -21.482 -3.535  1.730   1.00 0.00 ? 12  ARG A HA   3  
ATOM   2474  H  HB2  . ARG A 1 12 ? -23.490 -5.193  2.315   1.00 0.00 ? 12  ARG A HB2  3  
ATOM   2475  H  HB3  . ARG A 1 12 ? -22.931 -4.882  3.953   1.00 0.00 ? 12  ARG A HB3  3  
ATOM   2476  H  HG2  . ARG A 1 12 ? -23.446 -2.601  2.097   1.00 0.00 ? 12  ARG A HG2  3  
ATOM   2477  H  HG3  . ARG A 1 12 ? -24.788 -3.401  2.918   1.00 0.00 ? 12  ARG A HG3  3  
ATOM   2478  H  HD2  . ARG A 1 12 ? -22.385 -2.459  4.442   1.00 0.00 ? 12  ARG A HD2  3  
ATOM   2479  H  HD3  . ARG A 1 12 ? -23.690 -1.346  4.031   1.00 0.00 ? 12  ARG A HD3  3  
ATOM   2480  H  HE   . ARG A 1 12 ? -25.030 -3.356  5.182   1.00 0.00 ? 12  ARG A HE   3  
ATOM   2481  H  HH11 . ARG A 1 12 ? -22.167 -1.630  6.157   1.00 0.00 ? 12  ARG A HH11 3  
ATOM   2482  H  HH12 . ARG A 1 12 ? -22.466 -1.830  7.852   1.00 0.00 ? 12  ARG A HH12 3  
ATOM   2483  H  HH21 . ARG A 1 12 ? -25.433 -3.626  7.411   1.00 0.00 ? 12  ARG A HH21 3  
ATOM   2484  H  HH22 . ARG A 1 12 ? -24.323 -2.966  8.564   1.00 0.00 ? 12  ARG A HH22 3  
ATOM   2485  N  N    . LEU A 1 13 ? -20.094 -5.119  4.233   1.00 0.00 ? 13  LEU A N    3  
ATOM   2486  C  CA   . LEU A 1 13 ? -19.181 -4.974  5.363   1.00 0.00 ? 13  LEU A CA   3  
ATOM   2487  C  C    . LEU A 1 13 ? -18.166 -3.866  5.104   1.00 0.00 ? 13  LEU A C    3  
ATOM   2488  O  O    . LEU A 1 13 ? -17.970 -3.443  3.965   1.00 0.00 ? 13  LEU A O    3  
ATOM   2489  C  CB   . LEU A 1 13 ? -18.456 -6.294  5.629   1.00 0.00 ? 13  LEU A CB   3  
ATOM   2490  C  CG   . LEU A 1 13 ? -17.880 -7.003  4.403   1.00 0.00 ? 13  LEU A CG   3  
ATOM   2491  C  CD1  . LEU A 1 13 ? -16.548 -6.386  4.005   1.00 0.00 ? 13  LEU A CD1  3  
ATOM   2492  C  CD2  . LEU A 1 13 ? -17.720 -8.492  4.674   1.00 0.00 ? 13  LEU A CD2  3  
ATOM   2493  H  H    . LEU A 1 13 ? -20.352 -6.017  3.941   1.00 0.00 ? 13  LEU A H    3  
ATOM   2494  H  HA   . LEU A 1 13 ? -19.768 -4.714  6.231   1.00 0.00 ? 13  LEU A HA   3  
ATOM   2495  H  HB2  . LEU A 1 13 ? -17.641 -6.093  6.307   1.00 0.00 ? 13  LEU A HB2  3  
ATOM   2496  H  HB3  . LEU A 1 13 ? -19.157 -6.967  6.102   1.00 0.00 ? 13  LEU A HB3  3  
ATOM   2497  H  HG   . LEU A 1 13 ? -18.563 -6.885  3.573   1.00 0.00 ? 13  LEU A HG   3  
ATOM   2498  H  HD11 . LEU A 1 13 ? -15.763 -6.797  4.621   1.00 0.00 ? 13  LEU A HD11 3  
ATOM   2499  H  HD12 . LEU A 1 13 ? -16.592 -5.316  4.144   1.00 0.00 ? 13  LEU A HD12 3  
ATOM   2500  H  HD13 . LEU A 1 13 ? -16.346 -6.605  2.967   1.00 0.00 ? 13  LEU A HD13 3  
ATOM   2501  H  HD21 . LEU A 1 13 ? -18.475 -8.813  5.376   1.00 0.00 ? 13  LEU A HD21 3  
ATOM   2502  H  HD22 . LEU A 1 13 ? -16.740 -8.679  5.090   1.00 0.00 ? 13  LEU A HD22 3  
ATOM   2503  H  HD23 . LEU A 1 13 ? -17.830 -9.040  3.750   1.00 0.00 ? 13  LEU A HD23 3  
ATOM   2504  N  N    . TYR A 1 14 ? -17.521 -3.402  6.169   1.00 0.00 ? 14  TYR A N    3  
ATOM   2505  C  CA   . TYR A 1 14 ? -16.526 -2.342  6.057   1.00 0.00 ? 14  TYR A CA   3  
ATOM   2506  C  C    . TYR A 1 14 ? -15.761 -2.449  4.742   1.00 0.00 ? 14  TYR A C    3  
ATOM   2507  O  O    . TYR A 1 14 ? -15.713 -1.501  3.959   1.00 0.00 ? 14  TYR A O    3  
ATOM   2508  C  CB   . TYR A 1 14 ? -15.550 -2.405  7.234   1.00 0.00 ? 14  TYR A CB   3  
ATOM   2509  C  CG   . TYR A 1 14 ? -14.819 -3.724  7.345   1.00 0.00 ? 14  TYR A CG   3  
ATOM   2510  C  CD1  . TYR A 1 14 ? -15.454 -4.851  7.851   1.00 0.00 ? 14  TYR A CD1  3  
ATOM   2511  C  CD2  . TYR A 1 14 ? -13.494 -3.843  6.944   1.00 0.00 ? 14  TYR A CD2  3  
ATOM   2512  C  CE1  . TYR A 1 14 ? -14.790 -6.058  7.955   1.00 0.00 ? 14  TYR A CE1  3  
ATOM   2513  C  CE2  . TYR A 1 14 ? -12.823 -5.046  7.043   1.00 0.00 ? 14  TYR A CE2  3  
ATOM   2514  C  CZ   . TYR A 1 14 ? -13.475 -6.151  7.549   1.00 0.00 ? 14  TYR A CZ   3  
ATOM   2515  O  OH   . TYR A 1 14 ? -12.810 -7.351  7.651   1.00 0.00 ? 14  TYR A OH   3  
ATOM   2516  H  H    . TYR A 1 14 ? -17.721 -3.779  7.051   1.00 0.00 ? 14  TYR A H    3  
ATOM   2517  H  HA   . TYR A 1 14 ? -17.045 -1.395  6.083   1.00 0.00 ? 14  TYR A HA   3  
ATOM   2518  H  HB2  . TYR A 1 14 ? -14.812 -1.626  7.122   1.00 0.00 ? 14  TYR A HB2  3  
ATOM   2519  H  HB3  . TYR A 1 14 ? -16.095 -2.249  8.153   1.00 0.00 ? 14  TYR A HB3  3  
ATOM   2520  H  HD1  . TYR A 1 14 ? -16.484 -4.776  8.169   1.00 0.00 ? 14  TYR A HD1  3  
ATOM   2521  H  HD2  . TYR A 1 14 ? -12.986 -2.975  6.548   1.00 0.00 ? 14  TYR A HD2  3  
ATOM   2522  H  HE1  . TYR A 1 14 ? -15.300 -6.924  8.352   1.00 0.00 ? 14  TYR A HE1  3  
ATOM   2523  H  HE2  . TYR A 1 14 ? -11.793 -5.118  6.726   1.00 0.00 ? 14  TYR A HE2  3  
ATOM   2524  H  HH   . TYR A 1 14 ? -12.387 -7.411  8.511   1.00 0.00 ? 14  TYR A HH   3  
ATOM   2525  N  N    . GLY A 1 15 ? -15.164 -3.613  4.505   1.00 0.00 ? 15  GLY A N    3  
ATOM   2526  C  CA   . GLY A 1 15 ? -14.409 -3.825  3.283   1.00 0.00 ? 15  GLY A CA   3  
ATOM   2527  C  C    . GLY A 1 15 ? -13.264 -2.843  3.131   1.00 0.00 ? 15  GLY A C    3  
ATOM   2528  O  O    . GLY A 1 15 ? -13.474 -1.630  3.109   1.00 0.00 ? 15  GLY A O    3  
ATOM   2529  H  H    . GLY A 1 15 ? -15.236 -4.334  5.165   1.00 0.00 ? 15  GLY A H    3  
ATOM   2530  H  HA2  . GLY A 1 15 ? -14.011 -4.829  3.288   1.00 0.00 ? 15  GLY A HA2  3  
ATOM   2531  H  HA3  . GLY A 1 15 ? -15.075 -3.717  2.439   1.00 0.00 ? 15  GLY A HA3  3  
ATOM   2532  N  N    . THR A 1 16 ? -12.047 -3.368  3.028   1.00 0.00 ? 16  THR A N    3  
ATOM   2533  C  CA   . THR A 1 16 ? -10.864 -2.530  2.881   1.00 0.00 ? 16  THR A CA   3  
ATOM   2534  C  C    . THR A 1 16 ? -10.369 -2.525  1.439   1.00 0.00 ? 16  THR A C    3  
ATOM   2535  O  O    . THR A 1 16 ? -9.925  -3.550  0.921   1.00 0.00 ? 16  THR A O    3  
ATOM   2536  C  CB   . THR A 1 16 ? -9.722  -3.003  3.801   1.00 0.00 ? 16  THR A CB   3  
ATOM   2537  O  OG1  . THR A 1 16 ? -10.105 -2.852  5.173   1.00 0.00 ? 16  THR A OG1  3  
ATOM   2538  C  CG2  . THR A 1 16 ? -8.450  -2.213  3.535   1.00 0.00 ? 16  THR A CG2  3  
ATOM   2539  H  H    . THR A 1 16 ? -11.944 -4.342  3.053   1.00 0.00 ? 16  THR A H    3  
ATOM   2540  H  HA   . THR A 1 16 ? -11.131 -1.522  3.163   1.00 0.00 ? 16  THR A HA   3  
ATOM   2541  H  HB   . THR A 1 16 ? -9.529  -4.047  3.602   1.00 0.00 ? 16  THR A HB   3  
ATOM   2542  H  HG1  . THR A 1 16 ? -10.845 -3.433  5.364   1.00 0.00 ? 16  THR A HG1  3  
ATOM   2543  H  HG21 . THR A 1 16 ? -7.618  -2.694  4.027   1.00 0.00 ? 16  THR A HG21 3  
ATOM   2544  H  HG22 . THR A 1 16 ? -8.563  -1.209  3.916   1.00 0.00 ? 16  THR A HG22 3  
ATOM   2545  H  HG23 . THR A 1 16 ? -8.266  -2.176  2.472   1.00 0.00 ? 16  THR A HG23 3  
ATOM   2546  N  N    . ARG A 1 17 ? -10.449 -1.365  0.795   1.00 0.00 ? 17  ARG A N    3  
ATOM   2547  C  CA   . ARG A 1 17 ? -10.010 -1.227  -0.588  1.00 0.00 ? 17  ARG A CA   3  
ATOM   2548  C  C    . ARG A 1 17 ? -8.702  -0.444  -0.668  1.00 0.00 ? 17  ARG A C    3  
ATOM   2549  O  O    . ARG A 1 17 ? -8.641  0.724   -0.283  1.00 0.00 ? 17  ARG A O    3  
ATOM   2550  C  CB   . ARG A 1 17 ? -11.087 -0.529  -1.420  1.00 0.00 ? 17  ARG A CB   3  
ATOM   2551  C  CG   . ARG A 1 17 ? -11.088 -0.940  -2.884  1.00 0.00 ? 17  ARG A CG   3  
ATOM   2552  C  CD   . ARG A 1 17 ? -12.170 -0.213  -3.666  1.00 0.00 ? 17  ARG A CD   3  
ATOM   2553  N  NE   . ARG A 1 17 ? -12.080 1.236   -3.507  1.00 0.00 ? 17  ARG A NE   3  
ATOM   2554  C  CZ   . ARG A 1 17 ? -13.074 2.070   -3.792  1.00 0.00 ? 17  ARG A CZ   3  
ATOM   2555  N  NH1  . ARG A 1 17 ? -14.227 1.601   -4.248  1.00 0.00 ? 17  ARG A NH1  3  
ATOM   2556  N  NH2  . ARG A 1 17 ? -12.916 3.376   -3.620  1.00 0.00 ? 17  ARG A NH2  3  
ATOM   2557  H  H    . ARG A 1 17 ? -10.812 -0.583  1.261   1.00 0.00 ? 17  ARG A H    3  
ATOM   2558  H  HA   . ARG A 1 17 ? -9.847  -2.218  -0.985  1.00 0.00 ? 17  ARG A HA   3  
ATOM   2559  H  HB2  . ARG A 1 17 ? -12.055 -0.762  -1.003  1.00 0.00 ? 17  ARG A HB2  3  
ATOM   2560  H  HB3  . ARG A 1 17 ? -10.929 0.538   -1.369  1.00 0.00 ? 17  ARG A HB3  3  
ATOM   2561  H  HG2  . ARG A 1 17 ? -10.126 -0.704  -3.315  1.00 0.00 ? 17  ARG A HG2  3  
ATOM   2562  H  HG3  . ARG A 1 17 ? -11.262 -2.004  -2.949  1.00 0.00 ? 17  ARG A HG3  3  
ATOM   2563  H  HD2  . ARG A 1 17 ? -12.065 -0.457  -4.713  1.00 0.00 ? 17  ARG A HD2  3  
ATOM   2564  H  HD3  . ARG A 1 17 ? -13.135 -0.545  -3.314  1.00 0.00 ? 17  ARG A HD3  3  
ATOM   2565  H  HE   . ARG A 1 17 ? -11.237 1.604   -3.171  1.00 0.00 ? 17  ARG A HE   3  
ATOM   2566  H  HH11 . ARG A 1 17 ? -14.349 0.617   -4.378  1.00 0.00 ? 17  ARG A HH11 3  
ATOM   2567  H  HH12 . ARG A 1 17 ? -14.974 2.231   -4.462  1.00 0.00 ? 17  ARG A HH12 3  
ATOM   2568  H  HH21 . ARG A 1 17 ? -12.048 3.734   -3.276  1.00 0.00 ? 17  ARG A HH21 3  
ATOM   2569  H  HH22 . ARG A 1 17 ? -13.664 4.003   -3.836  1.00 0.00 ? 17  ARG A HH22 3  
ATOM   2570  N  N    . CYS A 1 18 ? -7.659  -1.095  -1.171  1.00 0.00 ? 18  CYS A N    3  
ATOM   2571  C  CA   . CYS A 1 18 ? -6.352  -0.461  -1.301  1.00 0.00 ? 18  CYS A CA   3  
ATOM   2572  C  C    . CYS A 1 18 ? -6.487  0.955   -1.853  1.00 0.00 ? 18  CYS A C    3  
ATOM   2573  O  O    . CYS A 1 18 ? -7.048  1.163   -2.929  1.00 0.00 ? 18  CYS A O    3  
ATOM   2574  C  CB   . CYS A 1 18 ? -5.448  -1.292  -2.214  1.00 0.00 ? 18  CYS A CB   3  
ATOM   2575  S  SG   . CYS A 1 18 ? -3.749  -0.651  -2.361  1.00 0.00 ? 18  CYS A SG   3  
ATOM   2576  H  H    . CYS A 1 18 ? -7.769  -2.025  -1.461  1.00 0.00 ? 18  CYS A H    3  
ATOM   2577  H  HA   . CYS A 1 18 ? -5.908  -0.411  -0.318  1.00 0.00 ? 18  CYS A HA   3  
ATOM   2578  H  HB2  . CYS A 1 18 ? -5.386  -2.299  -1.826  1.00 0.00 ? 18  CYS A HB2  3  
ATOM   2579  H  HB3  . CYS A 1 18 ? -5.877  -1.319  -3.204  1.00 0.00 ? 18  CYS A HB3  3  
ATOM   2580  N  N    . PHE A 1 19 ? -5.968  1.926   -1.109  1.00 0.00 ? 19  PHE A N    3  
ATOM   2581  C  CA   . PHE A 1 19 ? -6.031  3.323   -1.522  1.00 0.00 ? 19  PHE A CA   3  
ATOM   2582  C  C    . PHE A 1 19 ? -4.997  3.616   -2.606  1.00 0.00 ? 19  PHE A C    3  
ATOM   2583  O  O    . PHE A 1 19 ? -4.787  4.769   -2.982  1.00 0.00 ? 19  PHE A O    3  
ATOM   2584  C  CB   . PHE A 1 19 ? -5.802  4.243   -0.321  1.00 0.00 ? 19  PHE A CB   3  
ATOM   2585  C  CG   . PHE A 1 19 ? -7.073  4.690   0.342   1.00 0.00 ? 19  PHE A CG   3  
ATOM   2586  C  CD1  . PHE A 1 19 ? -8.085  5.281   -0.397  1.00 0.00 ? 19  PHE A CD1  3  
ATOM   2587  C  CD2  . PHE A 1 19 ? -7.256  4.519   1.705   1.00 0.00 ? 19  PHE A CD2  3  
ATOM   2588  C  CE1  . PHE A 1 19 ? -9.257  5.693   0.210   1.00 0.00 ? 19  PHE A CE1  3  
ATOM   2589  C  CE2  . PHE A 1 19 ? -8.426  4.929   2.318   1.00 0.00 ? 19  PHE A CE2  3  
ATOM   2590  C  CZ   . PHE A 1 19 ? -9.426  5.518   1.570   1.00 0.00 ? 19  PHE A CZ   3  
ATOM   2591  H  H    . PHE A 1 19 ? -5.533  1.697   -0.260  1.00 0.00 ? 19  PHE A H    3  
ATOM   2592  H  HA   . PHE A 1 19 ? -7.016  3.505   -1.922  1.00 0.00 ? 19  PHE A HA   3  
ATOM   2593  H  HB2  . PHE A 1 19 ? -5.210  3.722   0.415   1.00 0.00 ? 19  PHE A HB2  3  
ATOM   2594  H  HB3  . PHE A 1 19 ? -5.270  5.123   -0.648  1.00 0.00 ? 19  PHE A HB3  3  
ATOM   2595  H  HD1  . PHE A 1 19 ? -7.953  5.420   -1.461  1.00 0.00 ? 19  PHE A HD1  3  
ATOM   2596  H  HD2  . PHE A 1 19 ? -6.474  4.060   2.291   1.00 0.00 ? 19  PHE A HD2  3  
ATOM   2597  H  HE1  . PHE A 1 19 ? -10.037 6.154   -0.378  1.00 0.00 ? 19  PHE A HE1  3  
ATOM   2598  H  HE2  . PHE A 1 19 ? -8.556  4.790   3.380   1.00 0.00 ? 19  PHE A HE2  3  
ATOM   2599  H  HZ   . PHE A 1 19 ? -10.341 5.838   2.046   1.00 0.00 ? 19  PHE A HZ   3  
ATOM   2600  N  N    . SER A 1 20 ? -4.355  2.564   -3.103  1.00 0.00 ? 20  SER A N    3  
ATOM   2601  C  CA   . SER A 1 20 ? -3.341  2.708   -4.140  1.00 0.00 ? 20  SER A CA   3  
ATOM   2602  C  C    . SER A 1 20 ? -3.913  2.361   -5.512  1.00 0.00 ? 20  SER A C    3  
ATOM   2603  O  O    . SER A 1 20 ? -4.093  3.235   -6.361  1.00 0.00 ? 20  SER A O    3  
ATOM   2604  C  CB   . SER A 1 20 ? -2.139  1.811   -3.836  1.00 0.00 ? 20  SER A CB   3  
ATOM   2605  O  OG   . SER A 1 20 ? -0.970  2.290   -4.477  1.00 0.00 ? 20  SER A OG   3  
ATOM   2606  H  H    . SER A 1 20 ? -4.568  1.670   -2.762  1.00 0.00 ? 20  SER A H    3  
ATOM   2607  H  HA   . SER A 1 20 ? -3.018  3.738   -4.148  1.00 0.00 ? 20  SER A HA   3  
ATOM   2608  H  HB2  . SER A 1 20 ? -1.968  1.793   -2.770  1.00 0.00 ? 20  SER A HB2  3  
ATOM   2609  H  HB3  . SER A 1 20 ? -2.343  0.810   -4.185  1.00 0.00 ? 20  SER A HB3  3  
ATOM   2610  H  HG   . SER A 1 20 ? -0.240  1.691   -4.303  1.00 0.00 ? 20  SER A HG   3  
ATOM   2611  N  N    . CYS A 1 21 ? -4.197  1.080   -5.721  1.00 0.00 ? 21  CYS A N    3  
ATOM   2612  C  CA   . CYS A 1 21 ? -4.748  0.616   -6.988  1.00 0.00 ? 21  CYS A CA   3  
ATOM   2613  C  C    . CYS A 1 21 ? -6.273  0.633   -6.957  1.00 0.00 ? 21  CYS A C    3  
ATOM   2614  O  O    . CYS A 1 21 ? -6.928  0.336   -7.956  1.00 0.00 ? 21  CYS A O    3  
ATOM   2615  C  CB   . CYS A 1 21 ? -4.249  -0.797  -7.298  1.00 0.00 ? 21  CYS A CB   3  
ATOM   2616  S  SG   . CYS A 1 21 ? -4.508  -1.990  -5.946  1.00 0.00 ? 21  CYS A SG   3  
ATOM   2617  H  H    . CYS A 1 21 ? -4.031  0.430   -5.005  1.00 0.00 ? 21  CYS A H    3  
ATOM   2618  H  HA   . CYS A 1 21 ? -4.409  1.286   -7.763  1.00 0.00 ? 21  CYS A HA   3  
ATOM   2619  H  HB2  . CYS A 1 21 ? -4.768  -1.171  -8.169  1.00 0.00 ? 21  CYS A HB2  3  
ATOM   2620  H  HB3  . CYS A 1 21 ? -3.190  -0.759  -7.506  1.00 0.00 ? 21  CYS A HB3  3  
ATOM   2621  N  N    . ASP A 1 22 ? -6.832  0.982   -5.803  1.00 0.00 ? 22  ASP A N    3  
ATOM   2622  C  CA   . ASP A 1 22 ? -8.280  1.040   -5.641  1.00 0.00 ? 22  ASP A CA   3  
ATOM   2623  C  C    . ASP A 1 22 ? -8.899  -0.346  -5.794  1.00 0.00 ? 22  ASP A C    3  
ATOM   2624  O  O    . ASP A 1 22 ? -9.935  -0.504  -6.440  1.00 0.00 ? 22  ASP A O    3  
ATOM   2625  C  CB   . ASP A 1 22 ? -8.891  2.001   -6.662  1.00 0.00 ? 22  ASP A CB   3  
ATOM   2626  C  CG   . ASP A 1 22 ? -10.202 2.595   -6.185  1.00 0.00 ? 22  ASP A CG   3  
ATOM   2627  O  OD1  . ASP A 1 22 ? -10.175 3.404   -5.234  1.00 0.00 ? 22  ASP A OD1  3  
ATOM   2628  O  OD2  . ASP A 1 22 ? -11.254 2.250   -6.762  1.00 0.00 ? 22  ASP A OD2  3  
ATOM   2629  H  H    . ASP A 1 22 ? -6.256  1.208   -5.042  1.00 0.00 ? 22  ASP A H    3  
ATOM   2630  H  HA   . ASP A 1 22 ? -8.488  1.405   -4.647  1.00 0.00 ? 22  ASP A HA   3  
ATOM   2631  H  HB2  . ASP A 1 22 ? -8.197  2.809   -6.846  1.00 0.00 ? 22  ASP A HB2  3  
ATOM   2632  H  HB3  . ASP A 1 22 ? -9.071  1.469   -7.584  1.00 0.00 ? 22  ASP A HB3  3  
ATOM   2633  N  N    . GLN A 1 23 ? -8.257  -1.345  -5.198  1.00 0.00 ? 23  GLN A N    3  
ATOM   2634  C  CA   . GLN A 1 23 ? -8.745  -2.717  -5.270  1.00 0.00 ? 23  GLN A CA   3  
ATOM   2635  C  C    . GLN A 1 23 ? -8.865  -3.326  -3.877  1.00 0.00 ? 23  GLN A C    3  
ATOM   2636  O  O    . GLN A 1 23 ? -8.069  -3.027  -2.986  1.00 0.00 ? 23  GLN A O    3  
ATOM   2637  C  CB   . GLN A 1 23 ? -7.810  -3.568  -6.132  1.00 0.00 ? 23  GLN A CB   3  
ATOM   2638  C  CG   . GLN A 1 23 ? -7.647  -3.045  -7.550  1.00 0.00 ? 23  GLN A CG   3  
ATOM   2639  C  CD   . GLN A 1 23 ? -8.971  -2.891  -8.272  1.00 0.00 ? 23  GLN A CD   3  
ATOM   2640  O  OE1  . GLN A 1 23 ? -9.807  -3.795  -8.259  1.00 0.00 ? 23  GLN A OE1  3  
ATOM   2641  N  NE2  . GLN A 1 23 ? -9.169  -1.741  -8.907  1.00 0.00 ? 23  GLN A NE2  3  
ATOM   2642  H  H    . GLN A 1 23 ? -7.436  -1.155  -4.698  1.00 0.00 ? 23  GLN A H    3  
ATOM   2643  H  HA   . GLN A 1 23 ? -9.722  -2.697  -5.726  1.00 0.00 ? 23  GLN A HA   3  
ATOM   2644  H  HB2  . GLN A 1 23 ? -6.836  -3.596  -5.667  1.00 0.00 ? 23  GLN A HB2  3  
ATOM   2645  H  HB3  . GLN A 1 23 ? -8.204  -4.572  -6.186  1.00 0.00 ? 23  GLN A HB3  3  
ATOM   2646  H  HG2  . GLN A 1 23 ? -7.162  -2.080  -7.511  1.00 0.00 ? 23  GLN A HG2  3  
ATOM   2647  H  HG3  . GLN A 1 23 ? -7.028  -3.735  -8.105  1.00 0.00 ? 23  GLN A HG3  3  
ATOM   2648  H  HE21 . GLN A 1 23 ? -8.458  -1.067  -8.875  1.00 0.00 ? 23  GLN A HE21 3  
ATOM   2649  H  HE22 . GLN A 1 23 ? -10.016 -1.615  -9.382  1.00 0.00 ? 23  GLN A HE22 3  
ATOM   2650  N  N    . PHE A 1 24 ? -9.866  -4.182  -3.695  1.00 0.00 ? 24  PHE A N    3  
ATOM   2651  C  CA   . PHE A 1 24 ? -10.092 -4.832  -2.410  1.00 0.00 ? 24  PHE A CA   3  
ATOM   2652  C  C    . PHE A 1 24 ? -8.848  -5.594  -1.960  1.00 0.00 ? 24  PHE A C    3  
ATOM   2653  O  O    . PHE A 1 24 ? -8.307  -6.413  -2.703  1.00 0.00 ? 24  PHE A O    3  
ATOM   2654  C  CB   . PHE A 1 24 ? -11.284 -5.787  -2.500  1.00 0.00 ? 24  PHE A CB   3  
ATOM   2655  C  CG   . PHE A 1 24 ? -12.614 -5.094  -2.421  1.00 0.00 ? 24  PHE A CG   3  
ATOM   2656  C  CD1  . PHE A 1 24 ? -12.885 -3.994  -3.220  1.00 0.00 ? 24  PHE A CD1  3  
ATOM   2657  C  CD2  . PHE A 1 24 ? -13.593 -5.542  -1.550  1.00 0.00 ? 24  PHE A CD2  3  
ATOM   2658  C  CE1  . PHE A 1 24 ? -14.108 -3.354  -3.149  1.00 0.00 ? 24  PHE A CE1  3  
ATOM   2659  C  CE2  . PHE A 1 24 ? -14.819 -4.907  -1.475  1.00 0.00 ? 24  PHE A CE2  3  
ATOM   2660  C  CZ   . PHE A 1 24 ? -15.076 -3.812  -2.276  1.00 0.00 ? 24  PHE A CZ   3  
ATOM   2661  H  H    . PHE A 1 24 ? -10.467 -4.380  -4.444  1.00 0.00 ? 24  PHE A H    3  
ATOM   2662  H  HA   . PHE A 1 24 ? -10.311 -4.064  -1.684  1.00 0.00 ? 24  PHE A HA   3  
ATOM   2663  H  HB2  . PHE A 1 24 ? -11.241 -6.317  -3.439  1.00 0.00 ? 24  PHE A HB2  3  
ATOM   2664  H  HB3  . PHE A 1 24 ? -11.229 -6.496  -1.688  1.00 0.00 ? 24  PHE A HB3  3  
ATOM   2665  H  HD1  . PHE A 1 24 ? -12.130 -3.636  -3.903  1.00 0.00 ? 24  PHE A HD1  3  
ATOM   2666  H  HD2  . PHE A 1 24 ? -13.393 -6.400  -0.923  1.00 0.00 ? 24  PHE A HD2  3  
ATOM   2667  H  HE1  . PHE A 1 24 ? -14.307 -2.499  -3.777  1.00 0.00 ? 24  PHE A HE1  3  
ATOM   2668  H  HE2  . PHE A 1 24 ? -15.573 -5.267  -0.792  1.00 0.00 ? 24  PHE A HE2  3  
ATOM   2669  H  HZ   . PHE A 1 24 ? -16.033 -3.314  -2.219  1.00 0.00 ? 24  PHE A HZ   3  
ATOM   2670  N  N    . ILE A 1 25 ? -8.401  -5.317  -0.739  1.00 0.00 ? 25  ILE A N    3  
ATOM   2671  C  CA   . ILE A 1 25 ? -7.223  -5.975  -0.190  1.00 0.00 ? 25  ILE A CA   3  
ATOM   2672  C  C    . ILE A 1 25 ? -7.584  -7.321  0.430   1.00 0.00 ? 25  ILE A C    3  
ATOM   2673  O  O    . ILE A 1 25 ? -8.178  -7.380  1.506   1.00 0.00 ? 25  ILE A O    3  
ATOM   2674  C  CB   . ILE A 1 25 ? -6.534  -5.101  0.874   1.00 0.00 ? 25  ILE A CB   3  
ATOM   2675  C  CG1  . ILE A 1 25 ? -6.138  -3.749  0.277   1.00 0.00 ? 25  ILE A CG1  3  
ATOM   2676  C  CG2  . ILE A 1 25 ? -5.314  -5.815  1.438   1.00 0.00 ? 25  ILE A CG2  3  
ATOM   2677  C  CD1  . ILE A 1 25 ? -5.520  -2.802  1.281   1.00 0.00 ? 25  ILE A CD1  3  
ATOM   2678  H  H    . ILE A 1 25 ? -8.876  -4.654  -0.196  1.00 0.00 ? 25  ILE A H    3  
ATOM   2679  H  HA   . ILE A 1 25 ? -6.526  -6.139  -0.999  1.00 0.00 ? 25  ILE A HA   3  
ATOM   2680  H  HB   . ILE A 1 25 ? -7.231  -4.939  1.682   1.00 0.00 ? 25  ILE A HB   3  
ATOM   2681  H  HG12 . ILE A 1 25 ? -5.421  -3.908  -0.513  1.00 0.00 ? 25  ILE A HG12 3  
ATOM   2682  H  HG13 . ILE A 1 25 ? -7.018  -3.273  -0.132  1.00 0.00 ? 25  ILE A HG13 3  
ATOM   2683  H  HG21 . ILE A 1 25 ? -4.423  -5.434  0.962   1.00 0.00 ? 25  ILE A HG21 3  
ATOM   2684  H  HG22 . ILE A 1 25 ? -5.256  -5.641  2.502   1.00 0.00 ? 25  ILE A HG22 3  
ATOM   2685  H  HG23 . ILE A 1 25 ? -5.398  -6.875  1.250   1.00 0.00 ? 25  ILE A HG23 3  
ATOM   2686  H  HD11 . ILE A 1 25 ? -4.705  -3.297  1.790   1.00 0.00 ? 25  ILE A HD11 3  
ATOM   2687  H  HD12 . ILE A 1 25 ? -5.148  -1.927  0.771   1.00 0.00 ? 25  ILE A HD12 3  
ATOM   2688  H  HD13 . ILE A 1 25 ? -6.267  -2.507  2.004   1.00 0.00 ? 25  ILE A HD13 3  
ATOM   2689  N  N    . GLU A 1 26 ? -7.220  -8.400  -0.257  1.00 0.00 ? 26  GLU A N    3  
ATOM   2690  C  CA   . GLU A 1 26 ? -7.505  -9.745  0.228   1.00 0.00 ? 26  GLU A CA   3  
ATOM   2691  C  C    . GLU A 1 26 ? -6.393  -10.239 1.148   1.00 0.00 ? 26  GLU A C    3  
ATOM   2692  O  O    . GLU A 1 26 ? -5.286  -9.702  1.146   1.00 0.00 ? 26  GLU A O    3  
ATOM   2693  C  CB   . GLU A 1 26 ? -7.675  -10.709 -0.948  1.00 0.00 ? 26  GLU A CB   3  
ATOM   2694  C  CG   . GLU A 1 26 ? -7.780  -12.166 -0.530  1.00 0.00 ? 26  GLU A CG   3  
ATOM   2695  C  CD   . GLU A 1 26 ? -7.903  -13.105 -1.714  1.00 0.00 ? 26  GLU A CD   3  
ATOM   2696  O  OE1  . GLU A 1 26 ? -7.194  -12.888 -2.719  1.00 0.00 ? 26  GLU A OE1  3  
ATOM   2697  O  OE2  . GLU A 1 26 ? -8.708  -14.057 -1.636  1.00 0.00 ? 26  GLU A OE2  3  
ATOM   2698  H  H    . GLU A 1 26 ? -6.749  -8.288  -1.109  1.00 0.00 ? 26  GLU A H    3  
ATOM   2699  H  HA   . GLU A 1 26 ? -8.428  -9.708  0.787   1.00 0.00 ? 26  GLU A HA   3  
ATOM   2700  H  HB2  . GLU A 1 26 ? -8.572  -10.445 -1.488  1.00 0.00 ? 26  GLU A HB2  3  
ATOM   2701  H  HB3  . GLU A 1 26 ? -6.826  -10.606 -1.607  1.00 0.00 ? 26  GLU A HB3  3  
ATOM   2702  H  HG2  . GLU A 1 26 ? -6.896  -12.432 0.030   1.00 0.00 ? 26  GLU A HG2  3  
ATOM   2703  H  HG3  . GLU A 1 26 ? -8.651  -12.286 0.098   1.00 0.00 ? 26  GLU A HG3  3  
ATOM   2704  N  N    . GLY A 1 27 ? -6.696  -11.266 1.936   1.00 0.00 ? 27  GLY A N    3  
ATOM   2705  C  CA   . GLY A 1 27 ? -5.713  -11.816 2.851   1.00 0.00 ? 27  GLY A CA   3  
ATOM   2706  C  C    . GLY A 1 27 ? -5.430  -10.893 4.020   1.00 0.00 ? 27  GLY A C    3  
ATOM   2707  O  O    . GLY A 1 27 ? -6.130  -10.929 5.030   1.00 0.00 ? 27  GLY A O    3  
ATOM   2708  H  H    . GLY A 1 27 ? -7.596  -11.654 1.895   1.00 0.00 ? 27  GLY A H    3  
ATOM   2709  H  HA2  . GLY A 1 27 ? -6.078  -12.759 3.230   1.00 0.00 ? 27  GLY A HA2  3  
ATOM   2710  H  HA3  . GLY A 1 27 ? -4.793  -11.988 2.312   1.00 0.00 ? 27  GLY A HA3  3  
ATOM   2711  N  N    . GLU A 1 28 ? -4.398  -10.066 3.882   1.00 0.00 ? 28  GLU A N    3  
ATOM   2712  C  CA   . GLU A 1 28 ? -4.023  -9.132  4.937   1.00 0.00 ? 28  GLU A CA   3  
ATOM   2713  C  C    . GLU A 1 28 ? -3.909  -7.711  4.391   1.00 0.00 ? 28  GLU A C    3  
ATOM   2714  O  O    . GLU A 1 28 ? -3.677  -7.509  3.199   1.00 0.00 ? 28  GLU A O    3  
ATOM   2715  C  CB   . GLU A 1 28 ? -2.697  -9.553  5.573   1.00 0.00 ? 28  GLU A CB   3  
ATOM   2716  C  CG   . GLU A 1 28 ? -2.125  -8.519  6.528   1.00 0.00 ? 28  GLU A CG   3  
ATOM   2717  C  CD   . GLU A 1 28 ? -1.197  -9.129  7.561   1.00 0.00 ? 28  GLU A CD   3  
ATOM   2718  O  OE1  . GLU A 1 28 ? -1.615  -10.090 8.239   1.00 0.00 ? 28  GLU A OE1  3  
ATOM   2719  O  OE2  . GLU A 1 28 ? -0.053  -8.645  7.691   1.00 0.00 ? 28  GLU A OE2  3  
ATOM   2720  H  H    . GLU A 1 28 ? -3.878  -10.084 3.052   1.00 0.00 ? 28  GLU A H    3  
ATOM   2721  H  HA   . GLU A 1 28 ? -4.796  -9.154  5.690   1.00 0.00 ? 28  GLU A HA   3  
ATOM   2722  H  HB2  . GLU A 1 28 ? -2.849  -10.472 6.119   1.00 0.00 ? 28  GLU A HB2  3  
ATOM   2723  H  HB3  . GLU A 1 28 ? -1.974  -9.726  4.789   1.00 0.00 ? 28  GLU A HB3  3  
ATOM   2724  H  HG2  . GLU A 1 28 ? -1.572  -7.787  5.958   1.00 0.00 ? 28  GLU A HG2  3  
ATOM   2725  H  HG3  . GLU A 1 28 ? -2.940  -8.031  7.042   1.00 0.00 ? 28  GLU A HG3  3  
ATOM   2726  N  N    . VAL A 1 29 ? -4.075  -6.730  5.271   1.00 0.00 ? 29  VAL A N    3  
ATOM   2727  C  CA   . VAL A 1 29 ? -3.991  -5.328  4.879   1.00 0.00 ? 29  VAL A CA   3  
ATOM   2728  C  C    . VAL A 1 29 ? -2.846  -4.624  5.599   1.00 0.00 ? 29  VAL A C    3  
ATOM   2729  O  O    . VAL A 1 29 ? -2.567  -4.902  6.765   1.00 0.00 ? 29  VAL A O    3  
ATOM   2730  C  CB   . VAL A 1 29 ? -5.305  -4.582  5.176   1.00 0.00 ? 29  VAL A CB   3  
ATOM   2731  C  CG1  . VAL A 1 29 ? -5.203  -3.127  4.746   1.00 0.00 ? 29  VAL A CG1  3  
ATOM   2732  C  CG2  . VAL A 1 29 ? -6.475  -5.269  4.487   1.00 0.00 ? 29  VAL A CG2  3  
ATOM   2733  H  H    . VAL A 1 29 ? -4.258  -6.954  6.208   1.00 0.00 ? 29  VAL A H    3  
ATOM   2734  H  HA   . VAL A 1 29 ? -3.812  -5.289  3.814   1.00 0.00 ? 29  VAL A HA   3  
ATOM   2735  H  HB   . VAL A 1 29 ? -5.477  -4.608  6.242   1.00 0.00 ? 29  VAL A HB   3  
ATOM   2736  H  HG11 . VAL A 1 29 ? -5.318  -3.060  3.674   1.00 0.00 ? 29  VAL A HG11 3  
ATOM   2737  H  HG12 . VAL A 1 29 ? -5.979  -2.552  5.229   1.00 0.00 ? 29  VAL A HG12 3  
ATOM   2738  H  HG13 . VAL A 1 29 ? -4.236  -2.735  5.028   1.00 0.00 ? 29  VAL A HG13 3  
ATOM   2739  H  HG21 . VAL A 1 29 ? -7.309  -5.328  5.170   1.00 0.00 ? 29  VAL A HG21 3  
ATOM   2740  H  HG22 . VAL A 1 29 ? -6.763  -4.702  3.614   1.00 0.00 ? 29  VAL A HG22 3  
ATOM   2741  H  HG23 . VAL A 1 29 ? -6.183  -6.265  4.189   1.00 0.00 ? 29  VAL A HG23 3  
ATOM   2742  N  N    . VAL A 1 30 ? -2.186  -3.709  4.895   1.00 0.00 ? 30  VAL A N    3  
ATOM   2743  C  CA   . VAL A 1 30 ? -1.071  -2.963  5.467   1.00 0.00 ? 30  VAL A CA   3  
ATOM   2744  C  C    . VAL A 1 30 ? -1.501  -1.557  5.871   1.00 0.00 ? 30  VAL A C    3  
ATOM   2745  O  O    . VAL A 1 30 ? -1.377  -0.612  5.093   1.00 0.00 ? 30  VAL A O    3  
ATOM   2746  C  CB   . VAL A 1 30 ? 0.105   -2.864  4.477   1.00 0.00 ? 30  VAL A CB   3  
ATOM   2747  C  CG1  . VAL A 1 30 ? 1.237   -2.043  5.073   1.00 0.00 ? 30  VAL A CG1  3  
ATOM   2748  C  CG2  . VAL A 1 30 ? 0.590   -4.252  4.086   1.00 0.00 ? 30  VAL A CG2  3  
ATOM   2749  H  H    . VAL A 1 30 ? -2.455  -3.532  3.970   1.00 0.00 ? 30  VAL A H    3  
ATOM   2750  H  HA   . VAL A 1 30 ? -0.731  -3.492  6.345   1.00 0.00 ? 30  VAL A HA   3  
ATOM   2751  H  HB   . VAL A 1 30 ? -0.243  -2.363  3.585   1.00 0.00 ? 30  VAL A HB   3  
ATOM   2752  H  HG11 . VAL A 1 30 ? 1.054   -0.993  4.894   1.00 0.00 ? 30  VAL A HG11 3  
ATOM   2753  H  HG12 . VAL A 1 30 ? 1.292   -2.223  6.137   1.00 0.00 ? 30  VAL A HG12 3  
ATOM   2754  H  HG13 . VAL A 1 30 ? 2.171   -2.328  4.611   1.00 0.00 ? 30  VAL A HG13 3  
ATOM   2755  H  HG21 . VAL A 1 30 ? 1.183   -4.664  4.888   1.00 0.00 ? 30  VAL A HG21 3  
ATOM   2756  H  HG22 . VAL A 1 30 ? -0.261  -4.892  3.901   1.00 0.00 ? 30  VAL A HG22 3  
ATOM   2757  H  HG23 . VAL A 1 30 ? 1.191   -4.185  3.191   1.00 0.00 ? 30  VAL A HG23 3  
ATOM   2758  N  N    . SER A 1 31 ? -2.006  -1.427  7.093   1.00 0.00 ? 31  SER A N    3  
ATOM   2759  C  CA   . SER A 1 31 ? -2.458  -0.137  7.601   1.00 0.00 ? 31  SER A CA   3  
ATOM   2760  C  C    . SER A 1 31 ? -1.271  0.775   7.899   1.00 0.00 ? 31  SER A C    3  
ATOM   2761  O  O    . SER A 1 31 ? -0.566  0.589   8.890   1.00 0.00 ? 31  SER A O    3  
ATOM   2762  C  CB   . SER A 1 31 ? -3.299  -0.328  8.864   1.00 0.00 ? 31  SER A CB   3  
ATOM   2763  O  OG   . SER A 1 31 ? -3.682  0.920   9.415   1.00 0.00 ? 31  SER A OG   3  
ATOM   2764  H  H    . SER A 1 31 ? -2.079  -2.219  7.667   1.00 0.00 ? 31  SER A H    3  
ATOM   2765  H  HA   . SER A 1 31 ? -3.068  0.324   6.838   1.00 0.00 ? 31  SER A HA   3  
ATOM   2766  H  HB2  . SER A 1 31 ? -4.189  -0.887  8.619   1.00 0.00 ? 31  SER A HB2  3  
ATOM   2767  H  HB3  . SER A 1 31 ? -2.723  -0.871  9.598   1.00 0.00 ? 31  SER A HB3  3  
ATOM   2768  H  HG   . SER A 1 31 ? -4.230  1.394   8.785   1.00 0.00 ? 31  SER A HG   3  
ATOM   2769  N  N    . ALA A 1 32 ? -1.058  1.761   7.034   1.00 0.00 ? 32  ALA A N    3  
ATOM   2770  C  CA   . ALA A 1 32 ? 0.040   2.703   7.206   1.00 0.00 ? 32  ALA A CA   3  
ATOM   2771  C  C    . ALA A 1 32 ? -0.418  4.134   6.946   1.00 0.00 ? 32  ALA A C    3  
ATOM   2772  O  O    . ALA A 1 32 ? -1.093  4.411   5.954   1.00 0.00 ? 32  ALA A O    3  
ATOM   2773  C  CB   . ALA A 1 32 ? 1.194   2.341   6.282   1.00 0.00 ? 32  ALA A CB   3  
ATOM   2774  H  H    . ALA A 1 32 ? -1.656  1.858   6.264   1.00 0.00 ? 32  ALA A H    3  
ATOM   2775  H  HA   . ALA A 1 32 ? 0.390   2.627   8.225   1.00 0.00 ? 32  ALA A HA   3  
ATOM   2776  H  HB1  . ALA A 1 32 ? 1.660   3.246   5.918   1.00 0.00 ? 32  ALA A HB1  3  
ATOM   2777  H  HB2  . ALA A 1 32 ? 1.921   1.756   6.827   1.00 0.00 ? 32  ALA A HB2  3  
ATOM   2778  H  HB3  . ALA A 1 32 ? 0.821   1.767   5.448   1.00 0.00 ? 32  ALA A HB3  3  
ATOM   2779  N  N    . LEU A 1 33 ? -0.049  5.041   7.845   1.00 0.00 ? 33  LEU A N    3  
ATOM   2780  C  CA   . LEU A 1 33 ? -0.423  6.445   7.713   1.00 0.00 ? 33  LEU A CA   3  
ATOM   2781  C  C    . LEU A 1 33 ? -1.940  6.602   7.671   1.00 0.00 ? 33  LEU A C    3  
ATOM   2782  O  O    . LEU A 1 33 ? -2.477  7.302   6.813   1.00 0.00 ? 33  LEU A O    3  
ATOM   2783  C  CB   . LEU A 1 33 ? 0.199   7.043   6.451   1.00 0.00 ? 33  LEU A CB   3  
ATOM   2784  C  CG   . LEU A 1 33 ? 1.703   7.316   6.508   1.00 0.00 ? 33  LEU A CG   3  
ATOM   2785  C  CD1  . LEU A 1 33 ? 2.021   8.317   7.608   1.00 0.00 ? 33  LEU A CD1  3  
ATOM   2786  C  CD2  . LEU A 1 33 ? 2.472   6.021   6.723   1.00 0.00 ? 33  LEU A CD2  3  
ATOM   2787  H  H    . LEU A 1 33 ? 0.488   4.760   8.614   1.00 0.00 ? 33  LEU A H    3  
ATOM   2788  H  HA   . LEU A 1 33 ? -0.043  6.971   8.576   1.00 0.00 ? 33  LEU A HA   3  
ATOM   2789  H  HB2  . LEU A 1 33 ? 0.019   6.357   5.637   1.00 0.00 ? 33  LEU A HB2  3  
ATOM   2790  H  HB3  . LEU A 1 33 ? -0.301  7.979   6.248   1.00 0.00 ? 33  LEU A HB3  3  
ATOM   2791  H  HG   . LEU A 1 33 ? 2.020   7.743   5.566   1.00 0.00 ? 33  LEU A HG   3  
ATOM   2792  H  HD11 . LEU A 1 33 ? 1.115   8.572   8.136   1.00 0.00 ? 33  LEU A HD11 3  
ATOM   2793  H  HD12 . LEU A 1 33 ? 2.447   9.208   7.171   1.00 0.00 ? 33  LEU A HD12 3  
ATOM   2794  H  HD13 . LEU A 1 33 ? 2.730   7.881   8.297   1.00 0.00 ? 33  LEU A HD13 3  
ATOM   2795  H  HD21 . LEU A 1 33 ? 2.604   5.853   7.781   1.00 0.00 ? 33  LEU A HD21 3  
ATOM   2796  H  HD22 . LEU A 1 33 ? 3.440   6.095   6.247   1.00 0.00 ? 33  LEU A HD22 3  
ATOM   2797  H  HD23 . LEU A 1 33 ? 1.920   5.199   6.293   1.00 0.00 ? 33  LEU A HD23 3  
ATOM   2798  N  N    . GLY A 1 34 ? -2.624  5.948   8.604   1.00 0.00 ? 34  GLY A N    3  
ATOM   2799  C  CA   . GLY A 1 34 ? -4.072  6.030   8.656   1.00 0.00 ? 34  GLY A CA   3  
ATOM   2800  C  C    . GLY A 1 34 ? -4.720  5.709   7.323   1.00 0.00 ? 34  GLY A C    3  
ATOM   2801  O  O    . GLY A 1 34 ? -5.667  6.377   6.908   1.00 0.00 ? 34  GLY A O    3  
ATOM   2802  H  H    . GLY A 1 34 ? -2.142  5.404   9.262   1.00 0.00 ? 34  GLY A H    3  
ATOM   2803  H  HA2  . GLY A 1 34 ? -4.435  5.333   9.397   1.00 0.00 ? 34  GLY A HA2  3  
ATOM   2804  H  HA3  . GLY A 1 34 ? -4.354  7.031   8.948   1.00 0.00 ? 34  GLY A HA3  3  
ATOM   2805  N  N    . LYS A 1 35 ? -4.207  4.685   6.650   1.00 0.00 ? 35  LYS A N    3  
ATOM   2806  C  CA   . LYS A 1 35 ? -4.740  4.277   5.355   1.00 0.00 ? 35  LYS A CA   3  
ATOM   2807  C  C    . LYS A 1 35 ? -4.595  2.771   5.158   1.00 0.00 ? 35  LYS A C    3  
ATOM   2808  O  O    . LYS A 1 35 ? -4.109  2.062   6.040   1.00 0.00 ? 35  LYS A O    3  
ATOM   2809  C  CB   . LYS A 1 35 ? -4.023  5.021   4.227   1.00 0.00 ? 35  LYS A CB   3  
ATOM   2810  C  CG   . LYS A 1 35 ? -4.261  6.521   4.240   1.00 0.00 ? 35  LYS A CG   3  
ATOM   2811  C  CD   . LYS A 1 35 ? -5.672  6.865   3.791   1.00 0.00 ? 35  LYS A CD   3  
ATOM   2812  C  CE   . LYS A 1 35 ? -5.746  8.273   3.219   1.00 0.00 ? 35  LYS A CE   3  
ATOM   2813  N  NZ   . LYS A 1 35 ? -5.790  9.306   4.291   1.00 0.00 ? 35  LYS A NZ   3  
ATOM   2814  H  H    . LYS A 1 35 ? -3.451  4.191   7.033   1.00 0.00 ? 35  LYS A H    3  
ATOM   2815  H  HA   . LYS A 1 35 ? -5.789  4.531   5.333   1.00 0.00 ? 35  LYS A HA   3  
ATOM   2816  H  HB2  . LYS A 1 35 ? -2.961  4.846   4.314   1.00 0.00 ? 35  LYS A HB2  3  
ATOM   2817  H  HB3  . LYS A 1 35 ? -4.367  4.632   3.280   1.00 0.00 ? 35  LYS A HB3  3  
ATOM   2818  H  HG2  . LYS A 1 35 ? -4.115  6.891   5.244   1.00 0.00 ? 35  LYS A HG2  3  
ATOM   2819  H  HG3  . LYS A 1 35 ? -3.555  6.995   3.573   1.00 0.00 ? 35  LYS A HG3  3  
ATOM   2820  H  HD2  . LYS A 1 35 ? -5.979  6.163   3.030   1.00 0.00 ? 35  LYS A HD2  3  
ATOM   2821  H  HD3  . LYS A 1 35 ? -6.338  6.795   4.639   1.00 0.00 ? 35  LYS A HD3  3  
ATOM   2822  H  HE2  . LYS A 1 35 ? -4.877  8.443   2.602   1.00 0.00 ? 35  LYS A HE2  3  
ATOM   2823  H  HE3  . LYS A 1 35 ? -6.638  8.355   2.615   1.00 0.00 ? 35  LYS A HE3  3  
ATOM   2824  H  HZ1  . LYS A 1 35 ? -5.741  8.852   5.226   1.00 0.00 ? 35  LYS A HZ1  3  
ATOM   2825  H  HZ2  . LYS A 1 35 ? -6.675  9.848   4.228   1.00 0.00 ? 35  LYS A HZ2  3  
ATOM   2826  H  HZ3  . LYS A 1 35 ? -4.988  9.959   4.191   1.00 0.00 ? 35  LYS A HZ3  3  
ATOM   2827  N  N    . THR A 1 36 ? -5.018  2.288   3.994   1.00 0.00 ? 36  THR A N    3  
ATOM   2828  C  CA   . THR A 1 36 ? -4.935  0.867   3.681   1.00 0.00 ? 36  THR A CA   3  
ATOM   2829  C  C    . THR A 1 36 ? -4.339  0.643   2.295   1.00 0.00 ? 36  THR A C    3  
ATOM   2830  O  O    . THR A 1 36 ? -4.813  1.206   1.307   1.00 0.00 ? 36  THR A O    3  
ATOM   2831  C  CB   . THR A 1 36 ? -6.319  0.195   3.746   1.00 0.00 ? 36  THR A CB   3  
ATOM   2832  O  OG1  . THR A 1 36 ? -7.261  0.937   2.964   1.00 0.00 ? 36  THR A OG1  3  
ATOM   2833  C  CG2  . THR A 1 36 ? -6.808  0.102   5.184   1.00 0.00 ? 36  THR A CG2  3  
ATOM   2834  H  H    . THR A 1 36 ? -5.396  2.903   3.331   1.00 0.00 ? 36  THR A H    3  
ATOM   2835  H  HA   . THR A 1 36 ? -4.296  0.400   4.416   1.00 0.00 ? 36  THR A HA   3  
ATOM   2836  H  HB   . THR A 1 36 ? -6.237  -0.805  3.345   1.00 0.00 ? 36  THR A HB   3  
ATOM   2837  H  HG1  . THR A 1 36 ? -7.321  0.553   2.086   1.00 0.00 ? 36  THR A HG1  3  
ATOM   2838  H  HG21 . THR A 1 36 ? -6.011  0.387   5.854   1.00 0.00 ? 36  THR A HG21 3  
ATOM   2839  H  HG22 . THR A 1 36 ? -7.112  -0.912  5.396   1.00 0.00 ? 36  THR A HG22 3  
ATOM   2840  H  HG23 . THR A 1 36 ? -7.648  0.767   5.322   1.00 0.00 ? 36  THR A HG23 3  
ATOM   2841  N  N    . TYR A 1 37 ? -3.300  -0.181  2.229   1.00 0.00 ? 37  TYR A N    3  
ATOM   2842  C  CA   . TYR A 1 37 ? -2.638  -0.477  0.964   1.00 0.00 ? 37  TYR A CA   3  
ATOM   2843  C  C    . TYR A 1 37 ? -2.287  -1.959  0.867   1.00 0.00 ? 37  TYR A C    3  
ATOM   2844  O  O    . TYR A 1 37 ? -2.353  -2.691  1.856   1.00 0.00 ? 37  TYR A O    3  
ATOM   2845  C  CB   . TYR A 1 37 ? -1.373  0.369   0.815   1.00 0.00 ? 37  TYR A CB   3  
ATOM   2846  C  CG   . TYR A 1 37 ? -1.627  1.857   0.904   1.00 0.00 ? 37  TYR A CG   3  
ATOM   2847  C  CD1  . TYR A 1 37 ? -2.345  2.519   -0.085  1.00 0.00 ? 37  TYR A CD1  3  
ATOM   2848  C  CD2  . TYR A 1 37 ? -1.148  2.601   1.975   1.00 0.00 ? 37  TYR A CD2  3  
ATOM   2849  C  CE1  . TYR A 1 37 ? -2.578  3.879   -0.009  1.00 0.00 ? 37  TYR A CE1  3  
ATOM   2850  C  CE2  . TYR A 1 37 ? -1.378  3.961   2.060   1.00 0.00 ? 37  TYR A CE2  3  
ATOM   2851  C  CZ   . TYR A 1 37 ? -2.093  4.595   1.066   1.00 0.00 ? 37  TYR A CZ   3  
ATOM   2852  O  OH   . TYR A 1 37 ? -2.323  5.949   1.146   1.00 0.00 ? 37  TYR A OH   3  
ATOM   2853  H  H    . TYR A 1 37 ? -2.968  -0.599  3.051   1.00 0.00 ? 37  TYR A H    3  
ATOM   2854  H  HA   . TYR A 1 37 ? -3.322  -0.229  0.166   1.00 0.00 ? 37  TYR A HA   3  
ATOM   2855  H  HB2  . TYR A 1 37 ? -0.677  0.105   1.596   1.00 0.00 ? 37  TYR A HB2  3  
ATOM   2856  H  HB3  . TYR A 1 37 ? -0.923  0.166   -0.145  1.00 0.00 ? 37  TYR A HB3  3  
ATOM   2857  H  HD1  . TYR A 1 37 ? -2.724  1.956   -0.925  1.00 0.00 ? 37  TYR A HD1  3  
ATOM   2858  H  HD2  . TYR A 1 37 ? -0.587  2.101   2.751   1.00 0.00 ? 37  TYR A HD2  3  
ATOM   2859  H  HE1  . TYR A 1 37 ? -3.139  4.376   -0.787  1.00 0.00 ? 37  TYR A HE1  3  
ATOM   2860  H  HE2  . TYR A 1 37 ? -0.997  4.522   2.901   1.00 0.00 ? 37  TYR A HE2  3  
ATOM   2861  H  HH   . TYR A 1 37 ? -1.717  6.340   1.780   1.00 0.00 ? 37  TYR A HH   3  
ATOM   2862  N  N    . HIS A 1 38 ? -1.912  -2.394  -0.331  1.00 0.00 ? 38  HIS A N    3  
ATOM   2863  C  CA   . HIS A 1 38 ? -1.548  -3.788  -0.559  1.00 0.00 ? 38  HIS A CA   3  
ATOM   2864  C  C    . HIS A 1 38 ? -0.145  -4.076  -0.034  1.00 0.00 ? 38  HIS A C    3  
ATOM   2865  O  O    . HIS A 1 38 ? 0.657   -3.170  0.193   1.00 0.00 ? 38  HIS A O    3  
ATOM   2866  C  CB   . HIS A 1 38 ? -1.626  -4.121  -2.049  1.00 0.00 ? 38  HIS A CB   3  
ATOM   2867  C  CG   . HIS A 1 38 ? -2.967  -4.631  -2.480  1.00 0.00 ? 38  HIS A CG   3  
ATOM   2868  N  ND1  . HIS A 1 38 ? -3.727  -4.020  -3.455  1.00 0.00 ? 38  HIS A ND1  3  
ATOM   2869  C  CD2  . HIS A 1 38 ? -3.682  -5.702  -2.064  1.00 0.00 ? 38  HIS A CD2  3  
ATOM   2870  C  CE1  . HIS A 1 38 ? -4.852  -4.692  -3.618  1.00 0.00 ? 38  HIS A CE1  3  
ATOM   2871  N  NE2  . HIS A 1 38 ? -4.849  -5.718  -2.786  1.00 0.00 ? 38  HIS A NE2  3  
ATOM   2872  H  H    . HIS A 1 38 ? -1.879  -1.763  -1.080  1.00 0.00 ? 38  HIS A H    3  
ATOM   2873  H  HA   . HIS A 1 38 ? -2.253  -4.407  -0.024  1.00 0.00 ? 38  HIS A HA   3  
ATOM   2874  H  HB2  . HIS A 1 38 ? -1.411  -3.231  -2.622  1.00 0.00 ? 38  HIS A HB2  3  
ATOM   2875  H  HB3  . HIS A 1 38 ? -0.891  -4.879  -2.282  1.00 0.00 ? 38  HIS A HB3  3  
ATOM   2876  H  HD2  . HIS A 1 38 ? -3.389  -6.413  -1.304  1.00 0.00 ? 38  HIS A HD2  3  
ATOM   2877  H  HE1  . HIS A 1 38 ? -5.640  -4.446  -4.314  1.00 0.00 ? 38  HIS A HE1  3  
ATOM   2878  H  HE2  . HIS A 1 38 ? -5.601  -6.329  -2.641  1.00 0.00 ? 38  HIS A HE2  3  
ATOM   2879  N  N    . PRO A 1 39 ? 0.160   -5.367  0.164   1.00 0.00 ? 39  PRO A N    3  
ATOM   2880  C  CA   . PRO A 1 39 ? 1.467   -5.804  0.665   1.00 0.00 ? 39  PRO A CA   3  
ATOM   2881  C  C    . PRO A 1 39 ? 2.579   -5.597  -0.358  1.00 0.00 ? 39  PRO A C    3  
ATOM   2882  O  O    . PRO A 1 39 ? 3.746   -5.876  -0.086  1.00 0.00 ? 39  PRO A O    3  
ATOM   2883  C  CB   . PRO A 1 39 ? 1.262   -7.296  0.937   1.00 0.00 ? 39  PRO A CB   3  
ATOM   2884  C  CG   . PRO A 1 39 ? 0.154   -7.698  0.026   1.00 0.00 ? 39  PRO A CG   3  
ATOM   2885  C  CD   . PRO A 1 39 ? -0.747  -6.500  -0.086  1.00 0.00 ? 39  PRO A CD   3  
ATOM   2886  H  HA   . PRO A 1 39 ? 1.728   -5.301  1.585   1.00 0.00 ? 39  PRO A HA   3  
ATOM   2887  H  HB2  . PRO A 1 39 ? 2.173   -7.834  0.714   1.00 0.00 ? 39  PRO A HB2  3  
ATOM   2888  H  HB3  . PRO A 1 39 ? 0.994   -7.443  1.973   1.00 0.00 ? 39  PRO A HB3  3  
ATOM   2889  H  HG2  . PRO A 1 39 ? 0.552   -7.960  -0.943  1.00 0.00 ? 39  PRO A HG2  3  
ATOM   2890  H  HG3  . PRO A 1 39 ? -0.384  -8.533  0.449   1.00 0.00 ? 39  PRO A HG3  3  
ATOM   2891  H  HD2  . PRO A 1 39 ? -1.175  -6.440  -1.075  1.00 0.00 ? 39  PRO A HD2  3  
ATOM   2892  H  HD3  . PRO A 1 39 ? -1.525  -6.542  0.662   1.00 0.00 ? 39  PRO A HD3  3  
ATOM   2893  N  N    . ASP A 1 40 ? 2.208   -5.105  -1.536  1.00 0.00 ? 40  ASP A N    3  
ATOM   2894  C  CA   . ASP A 1 40 ? 3.175   -4.859  -2.600  1.00 0.00 ? 40  ASP A CA   3  
ATOM   2895  C  C    . ASP A 1 40 ? 3.081   -3.420  -3.097  1.00 0.00 ? 40  ASP A C    3  
ATOM   2896  O  O    . ASP A 1 40 ? 4.029   -2.889  -3.675  1.00 0.00 ? 40  ASP A O    3  
ATOM   2897  C  CB   . ASP A 1 40 ? 2.946   -5.829  -3.760  1.00 0.00 ? 40  ASP A CB   3  
ATOM   2898  C  CG   . ASP A 1 40 ? 1.483   -5.939  -4.143  1.00 0.00 ? 40  ASP A CG   3  
ATOM   2899  O  OD1  . ASP A 1 40 ? 0.712   -6.545  -3.371  1.00 0.00 ? 40  ASP A OD1  3  
ATOM   2900  O  OD2  . ASP A 1 40 ? 1.110   -5.418  -5.216  1.00 0.00 ? 40  ASP A OD2  3  
ATOM   2901  H  H    . ASP A 1 40 ? 1.262   -4.902  -1.693  1.00 0.00 ? 40  ASP A H    3  
ATOM   2902  H  HA   . ASP A 1 40 ? 4.162   -5.023  -2.195  1.00 0.00 ? 40  ASP A HA   3  
ATOM   2903  H  HB2  . ASP A 1 40 ? 3.500   -5.486  -4.622  1.00 0.00 ? 40  ASP A HB2  3  
ATOM   2904  H  HB3  . ASP A 1 40 ? 3.300   -6.809  -3.476  1.00 0.00 ? 40  ASP A HB3  3  
ATOM   2905  N  N    . CYS A 1 41 ? 1.931   -2.795  -2.870  1.00 0.00 ? 41  CYS A N    3  
ATOM   2906  C  CA   . CYS A 1 41 ? 1.711   -1.418  -3.296  1.00 0.00 ? 41  CYS A CA   3  
ATOM   2907  C  C    . CYS A 1 41 ? 2.455   -0.443  -2.388  1.00 0.00 ? 41  CYS A C    3  
ATOM   2908  O  O    . CYS A 1 41 ? 2.845   0.645   -2.815  1.00 0.00 ? 41  CYS A O    3  
ATOM   2909  C  CB   . CYS A 1 41 ? 0.216   -1.094  -3.293  1.00 0.00 ? 41  CYS A CB   3  
ATOM   2910  S  SG   . CYS A 1 41 ? -0.705  -1.820  -4.688  1.00 0.00 ? 41  CYS A SG   3  
ATOM   2911  H  H    . CYS A 1 41 ? 1.211   -3.272  -2.404  1.00 0.00 ? 41  CYS A H    3  
ATOM   2912  H  HA   . CYS A 1 41 ? 2.091   -1.317  -4.301  1.00 0.00 ? 41  CYS A HA   3  
ATOM   2913  H  HB2  . CYS A 1 41 ? -0.224  -1.467  -2.380  1.00 0.00 ? 41  CYS A HB2  3  
ATOM   2914  H  HB3  . CYS A 1 41 ? 0.087   -0.023  -3.337  1.00 0.00 ? 41  CYS A HB3  3  
ATOM   2915  N  N    . PHE A 1 42 ? 2.650   -0.840  -1.135  1.00 0.00 ? 42  PHE A N    3  
ATOM   2916  C  CA   . PHE A 1 42 ? 3.347   -0.001  -0.167  1.00 0.00 ? 42  PHE A CA   3  
ATOM   2917  C  C    . PHE A 1 42 ? 4.859   -0.140  -0.316  1.00 0.00 ? 42  PHE A C    3  
ATOM   2918  O  O    . PHE A 1 42 ? 5.592   -0.165  0.672   1.00 0.00 ? 42  PHE A O    3  
ATOM   2919  C  CB   . PHE A 1 42 ? 2.927   -0.373  1.257   1.00 0.00 ? 42  PHE A CB   3  
ATOM   2920  C  CG   . PHE A 1 42 ? 3.331   0.644   2.285   1.00 0.00 ? 42  PHE A CG   3  
ATOM   2921  C  CD1  . PHE A 1 42 ? 2.793   1.921   2.264   1.00 0.00 ? 42  PHE A CD1  3  
ATOM   2922  C  CD2  . PHE A 1 42 ? 4.247   0.324   3.274   1.00 0.00 ? 42  PHE A CD2  3  
ATOM   2923  C  CE1  . PHE A 1 42 ? 3.163   2.859   3.209   1.00 0.00 ? 42  PHE A CE1  3  
ATOM   2924  C  CE2  . PHE A 1 42 ? 4.621   1.258   4.222   1.00 0.00 ? 42  PHE A CE2  3  
ATOM   2925  C  CZ   . PHE A 1 42 ? 4.077   2.527   4.190   1.00 0.00 ? 42  PHE A CZ   3  
ATOM   2926  H  H    . PHE A 1 42 ? 2.316   -1.718  -0.855  1.00 0.00 ? 42  PHE A H    3  
ATOM   2927  H  HA   . PHE A 1 42 ? 3.071   1.024   -0.358  1.00 0.00 ? 42  PHE A HA   3  
ATOM   2928  H  HB2  . PHE A 1 42 ? 1.853   -0.473  1.293   1.00 0.00 ? 42  PHE A HB2  3  
ATOM   2929  H  HB3  . PHE A 1 42 ? 3.382   -1.315  1.524   1.00 0.00 ? 42  PHE A HB3  3  
ATOM   2930  H  HD1  . PHE A 1 42 ? 2.077   2.182   1.499   1.00 0.00 ? 42  PHE A HD1  3  
ATOM   2931  H  HD2  . PHE A 1 42 ? 4.673   -0.669  3.300   1.00 0.00 ? 42  PHE A HD2  3  
ATOM   2932  H  HE1  . PHE A 1 42 ? 2.736   3.851   3.182   1.00 0.00 ? 42  PHE A HE1  3  
ATOM   2933  H  HE2  . PHE A 1 42 ? 5.336   0.995   4.987   1.00 0.00 ? 42  PHE A HE2  3  
ATOM   2934  H  HZ   . PHE A 1 42 ? 4.368   3.259   4.929   1.00 0.00 ? 42  PHE A HZ   3  
ATOM   2935  N  N    . VAL A 1 43 ? 5.319   -0.230  -1.560  1.00 0.00 ? 43  VAL A N    3  
ATOM   2936  C  CA   . VAL A 1 43 ? 6.743   -0.365  -1.841  1.00 0.00 ? 43  VAL A CA   3  
ATOM   2937  C  C    . VAL A 1 43 ? 7.285   0.874   -2.544  1.00 0.00 ? 43  VAL A C    3  
ATOM   2938  O  O    . VAL A 1 43 ? 6.522   1.715   -3.020  1.00 0.00 ? 43  VAL A O    3  
ATOM   2939  C  CB   . VAL A 1 43 ? 7.029   -1.603  -2.712  1.00 0.00 ? 43  VAL A CB   3  
ATOM   2940  C  CG1  . VAL A 1 43 ? 6.481   -2.859  -2.051  1.00 0.00 ? 43  VAL A CG1  3  
ATOM   2941  C  CG2  . VAL A 1 43 ? 6.439   -1.422  -4.103  1.00 0.00 ? 43  VAL A CG2  3  
ATOM   2942  H  H    . VAL A 1 43 ? 4.685   -0.203  -2.307  1.00 0.00 ? 43  VAL A H    3  
ATOM   2943  H  HA   . VAL A 1 43 ? 7.259   -0.487  -0.899  1.00 0.00 ? 43  VAL A HA   3  
ATOM   2944  H  HB   . VAL A 1 43 ? 8.099   -1.711  -2.809  1.00 0.00 ? 43  VAL A HB   3  
ATOM   2945  H  HG11 . VAL A 1 43 ? 6.051   -3.503  -2.804  1.00 0.00 ? 43  VAL A HG11 3  
ATOM   2946  H  HG12 . VAL A 1 43 ? 7.283   -3.379  -1.546  1.00 0.00 ? 43  VAL A HG12 3  
ATOM   2947  H  HG13 . VAL A 1 43 ? 5.721   -2.586  -1.334  1.00 0.00 ? 43  VAL A HG13 3  
ATOM   2948  H  HG21 . VAL A 1 43 ? 7.084   -0.782  -4.685  1.00 0.00 ? 43  VAL A HG21 3  
ATOM   2949  H  HG22 . VAL A 1 43 ? 6.355   -2.385  -4.587  1.00 0.00 ? 43  VAL A HG22 3  
ATOM   2950  H  HG23 . VAL A 1 43 ? 5.460   -0.973  -4.024  1.00 0.00 ? 43  VAL A HG23 3  
ATOM   2951  N  N    . CYS A 1 44 ? 8.608   0.981   -2.607  1.00 0.00 ? 44  CYS A N    3  
ATOM   2952  C  CA   . CYS A 1 44 ? 9.255   2.117   -3.253  1.00 0.00 ? 44  CYS A CA   3  
ATOM   2953  C  C    . CYS A 1 44 ? 8.570   2.453   -4.575  1.00 0.00 ? 44  CYS A C    3  
ATOM   2954  O  O    . CYS A 1 44 ? 7.787   1.661   -5.099  1.00 0.00 ? 44  CYS A O    3  
ATOM   2955  C  CB   . CYS A 1 44 ? 10.736  1.819   -3.493  1.00 0.00 ? 44  CYS A CB   3  
ATOM   2956  S  SG   . CYS A 1 44 ? 11.722  3.279   -3.958  1.00 0.00 ? 44  CYS A SG   3  
ATOM   2957  H  H    . CYS A 1 44 ? 9.165   0.278   -2.209  1.00 0.00 ? 44  CYS A H    3  
ATOM   2958  H  HA   . CYS A 1 44 ? 9.170   2.966   -2.592  1.00 0.00 ? 44  CYS A HA   3  
ATOM   2959  H  HB2  . CYS A 1 44 ? 11.164  1.408   -2.590  1.00 0.00 ? 44  CYS A HB2  3  
ATOM   2960  H  HB3  . CYS A 1 44 ? 10.825  1.094   -4.289  1.00 0.00 ? 44  CYS A HB3  3  
ATOM   2961  N  N    . ALA A 1 45 ? 8.873   3.632   -5.109  1.00 0.00 ? 45  ALA A N    3  
ATOM   2962  C  CA   . ALA A 1 45 ? 8.290   4.071   -6.370  1.00 0.00 ? 45  ALA A CA   3  
ATOM   2963  C  C    . ALA A 1 45 ? 9.296   3.955   -7.510  1.00 0.00 ? 45  ALA A C    3  
ATOM   2964  O  O    . ALA A 1 45 ? 8.922   3.947   -8.683  1.00 0.00 ? 45  ALA A O    3  
ATOM   2965  C  CB   . ALA A 1 45 ? 7.789   5.503   -6.249  1.00 0.00 ? 45  ALA A CB   3  
ATOM   2966  H  H    . ALA A 1 45 ? 9.504   4.219   -4.643  1.00 0.00 ? 45  ALA A H    3  
ATOM   2967  H  HA   . ALA A 1 45 ? 7.442   3.436   -6.585  1.00 0.00 ? 45  ALA A HA   3  
ATOM   2968  H  HB1  . ALA A 1 45 ? 8.295   5.992   -5.429  1.00 0.00 ? 45  ALA A HB1  3  
ATOM   2969  H  HB2  . ALA A 1 45 ? 7.993   6.034   -7.167  1.00 0.00 ? 45  ALA A HB2  3  
ATOM   2970  H  HB3  . ALA A 1 45 ? 6.725   5.497   -6.065  1.00 0.00 ? 45  ALA A HB3  3  
ATOM   2971  N  N    . VAL A 1 46 ? 10.575  3.866   -7.158  1.00 0.00 ? 46  VAL A N    3  
ATOM   2972  C  CA   . VAL A 1 46 ? 11.635  3.750   -8.152  1.00 0.00 ? 46  VAL A CA   3  
ATOM   2973  C  C    . VAL A 1 46 ? 12.047  2.295   -8.349  1.00 0.00 ? 46  VAL A C    3  
ATOM   2974  O  O    . VAL A 1 46 ? 11.854  1.724   -9.422  1.00 0.00 ? 46  VAL A O    3  
ATOM   2975  C  CB   . VAL A 1 46 ? 12.874  4.573   -7.750  1.00 0.00 ? 46  VAL A CB   3  
ATOM   2976  C  CG1  . VAL A 1 46 ? 13.877  4.620   -8.892  1.00 0.00 ? 46  VAL A CG1  3  
ATOM   2977  C  CG2  . VAL A 1 46 ? 12.466  5.977   -7.329  1.00 0.00 ? 46  VAL A CG2  3  
ATOM   2978  H  H    . VAL A 1 46 ? 10.810  3.878   -6.207  1.00 0.00 ? 46  VAL A H    3  
ATOM   2979  H  HA   . VAL A 1 46 ? 11.259  4.138   -9.088  1.00 0.00 ? 46  VAL A HA   3  
ATOM   2980  H  HB   . VAL A 1 46 ? 13.344  4.089   -6.906  1.00 0.00 ? 46  VAL A HB   3  
ATOM   2981  H  HG11 . VAL A 1 46 ? 13.648  5.454   -9.538  1.00 0.00 ? 46  VAL A HG11 3  
ATOM   2982  H  HG12 . VAL A 1 46 ? 14.874  4.736   -8.491  1.00 0.00 ? 46  VAL A HG12 3  
ATOM   2983  H  HG13 . VAL A 1 46 ? 13.821  3.701   -9.458  1.00 0.00 ? 46  VAL A HG13 3  
ATOM   2984  H  HG21 . VAL A 1 46 ? 11.655  5.918   -6.619  1.00 0.00 ? 46  VAL A HG21 3  
ATOM   2985  H  HG22 . VAL A 1 46 ? 13.309  6.475   -6.871  1.00 0.00 ? 46  VAL A HG22 3  
ATOM   2986  H  HG23 . VAL A 1 46 ? 12.147  6.535   -8.196  1.00 0.00 ? 46  VAL A HG23 3  
ATOM   2987  N  N    . CYS A 1 47 ? 12.615  1.701   -7.305  1.00 0.00 ? 47  CYS A N    3  
ATOM   2988  C  CA   . CYS A 1 47 ? 13.055  0.312   -7.362  1.00 0.00 ? 47  CYS A CA   3  
ATOM   2989  C  C    . CYS A 1 47 ? 11.912  -0.636  -7.007  1.00 0.00 ? 47  CYS A C    3  
ATOM   2990  O  O    . CYS A 1 47 ? 11.978  -1.834  -7.282  1.00 0.00 ? 47  CYS A O    3  
ATOM   2991  C  CB   . CYS A 1 47 ? 14.231  0.088   -6.410  1.00 0.00 ? 47  CYS A CB   3  
ATOM   2992  S  SG   . CYS A 1 47 ? 13.810  0.285   -4.648  1.00 0.00 ? 47  CYS A SG   3  
ATOM   2993  H  H    . CYS A 1 47 ? 12.742  2.208   -6.476  1.00 0.00 ? 47  CYS A H    3  
ATOM   2994  H  HA   . CYS A 1 47 ? 13.376  0.106   -8.372  1.00 0.00 ? 47  CYS A HA   3  
ATOM   2995  H  HB2  . CYS A 1 47 ? 14.610  -0.914  -6.547  1.00 0.00 ? 47  CYS A HB2  3  
ATOM   2996  H  HB3  . CYS A 1 47 ? 15.012  0.797   -6.643  1.00 0.00 ? 47  CYS A HB3  3  
ATOM   2997  N  N    . ARG A 1 48 ? 10.866  -0.089  -6.395  1.00 0.00 ? 48  ARG A N    3  
ATOM   2998  C  CA   . ARG A 1 48 ? 9.710   -0.885  -6.002  1.00 0.00 ? 48  ARG A CA   3  
ATOM   2999  C  C    . ARG A 1 48 ? 10.124  -2.026  -5.077  1.00 0.00 ? 48  ARG A C    3  
ATOM   3000  O  O    . ARG A 1 48 ? 9.797   -3.188  -5.321  1.00 0.00 ? 48  ARG A O    3  
ATOM   3001  C  CB   . ARG A 1 48 ? 9.007   -1.447  -7.239  1.00 0.00 ? 48  ARG A CB   3  
ATOM   3002  C  CG   . ARG A 1 48 ? 8.468   -0.376  -8.173  1.00 0.00 ? 48  ARG A CG   3  
ATOM   3003  C  CD   . ARG A 1 48 ? 7.044   0.013   -7.812  1.00 0.00 ? 48  ARG A CD   3  
ATOM   3004  N  NE   . ARG A 1 48 ? 6.058   -0.823  -8.492  1.00 0.00 ? 48  ARG A NE   3  
ATOM   3005  C  CZ   . ARG A 1 48 ? 5.643   -0.606  -9.735  1.00 0.00 ? 48  ARG A CZ   3  
ATOM   3006  N  NH1  . ARG A 1 48 ? 6.126   0.414   -10.430 1.00 0.00 ? 48  ARG A NH1  3  
ATOM   3007  N  NH2  . ARG A 1 48 ? 4.744   -1.412  -10.285 1.00 0.00 ? 48  ARG A NH2  3  
ATOM   3008  H  H    . ARG A 1 48 ? 10.873  0.872   -6.203  1.00 0.00 ? 48  ARG A H    3  
ATOM   3009  H  HA   . ARG A 1 48 ? 9.026   -0.238  -5.473  1.00 0.00 ? 48  ARG A HA   3  
ATOM   3010  H  HB2  . ARG A 1 48 ? 9.707   -2.057  -7.791  1.00 0.00 ? 48  ARG A HB2  3  
ATOM   3011  H  HB3  . ARG A 1 48 ? 8.180   -2.064  -6.919  1.00 0.00 ? 48  ARG A HB3  3  
ATOM   3012  H  HG2  . ARG A 1 48 ? 9.098   0.499   -8.103  1.00 0.00 ? 48  ARG A HG2  3  
ATOM   3013  H  HG3  . ARG A 1 48 ? 8.484   -0.753  -9.185  1.00 0.00 ? 48  ARG A HG3  3  
ATOM   3014  H  HD2  . ARG A 1 48 ? 6.915   -0.092  -6.745  1.00 0.00 ? 48  ARG A HD2  3  
ATOM   3015  H  HD3  . ARG A 1 48 ? 6.884   1.044   -8.093  1.00 0.00 ? 48  ARG A HD3  3  
ATOM   3016  H  HE   . ARG A 1 48 ? 5.688   -1.582  -7.996  1.00 0.00 ? 48  ARG A HE   3  
ATOM   3017  H  HH11 . ARG A 1 48 ? 6.805   1.022   -10.019 1.00 0.00 ? 48  ARG A HH11 3  
ATOM   3018  H  HH12 . ARG A 1 48 ? 5.813   0.574   -11.367 1.00 0.00 ? 48  ARG A HH12 3  
ATOM   3019  H  HH21 . ARG A 1 48 ? 4.378   -2.182  -9.764  1.00 0.00 ? 48  ARG A HH21 3  
ATOM   3020  H  HH22 . ARG A 1 48 ? 4.432   -1.248  -11.221 1.00 0.00 ? 48  ARG A HH22 3  
ATOM   3021  N  N    . LEU A 1 49 ? 10.845  -1.686  -4.014  1.00 0.00 ? 49  LEU A N    3  
ATOM   3022  C  CA   . LEU A 1 49 ? 11.305  -2.681  -3.051  1.00 0.00 ? 49  LEU A CA   3  
ATOM   3023  C  C    . LEU A 1 49 ? 10.542  -2.560  -1.736  1.00 0.00 ? 49  LEU A C    3  
ATOM   3024  O  O    . LEU A 1 49 ? 10.256  -1.463  -1.255  1.00 0.00 ? 49  LEU A O    3  
ATOM   3025  C  CB   . LEU A 1 49 ? 12.805  -2.522  -2.801  1.00 0.00 ? 49  LEU A CB   3  
ATOM   3026  C  CG   . LEU A 1 49 ? 13.729  -3.300  -3.738  1.00 0.00 ? 49  LEU A CG   3  
ATOM   3027  C  CD1  . LEU A 1 49 ? 15.154  -2.780  -3.637  1.00 0.00 ? 49  LEU A CD1  3  
ATOM   3028  C  CD2  . LEU A 1 49 ? 13.679  -4.788  -3.422  1.00 0.00 ? 49  LEU A CD2  3  
ATOM   3029  H  H    . LEU A 1 49 ? 11.074  -0.744  -3.872  1.00 0.00 ? 49  LEU A H    3  
ATOM   3030  H  HA   . LEU A 1 49 ? 11.120  -3.659  -3.472  1.00 0.00 ? 49  LEU A HA   3  
ATOM   3031  H  HB2  . LEU A 1 49 ? 13.047  -1.474  -2.894  1.00 0.00 ? 49  LEU A HB2  3  
ATOM   3032  H  HB3  . LEU A 1 49 ? 13.007  -2.847  -1.790  1.00 0.00 ? 49  LEU A HB3  3  
ATOM   3033  H  HG   . LEU A 1 49 ? 13.396  -3.162  -4.758  1.00 0.00 ? 49  LEU A HG   3  
ATOM   3034  H  HD11 . LEU A 1 49 ? 15.142  -1.701  -3.604  1.00 0.00 ? 49  LEU A HD11 3  
ATOM   3035  H  HD12 . LEU A 1 49 ? 15.719  -3.107  -4.497  1.00 0.00 ? 49  LEU A HD12 3  
ATOM   3036  H  HD13 . LEU A 1 49 ? 15.614  -3.163  -2.737  1.00 0.00 ? 49  LEU A HD13 3  
ATOM   3037  H  HD21 . LEU A 1 49 ? 14.595  -5.256  -3.750  1.00 0.00 ? 49  LEU A HD21 3  
ATOM   3038  H  HD22 . LEU A 1 49 ? 12.841  -5.237  -3.936  1.00 0.00 ? 49  LEU A HD22 3  
ATOM   3039  H  HD23 . LEU A 1 49 ? 13.565  -4.926  -2.357  1.00 0.00 ? 49  LEU A HD23 3  
ATOM   3040  N  N    . PRO A 1 50 ? 10.205  -3.712  -1.138  1.00 0.00 ? 50  PRO A N    3  
ATOM   3041  C  CA   . PRO A 1 50 ? 9.474   -3.761  0.131   1.00 0.00 ? 50  PRO A CA   3  
ATOM   3042  C  C    . PRO A 1 50 ? 10.320  -3.285  1.307   1.00 0.00 ? 50  PRO A C    3  
ATOM   3043  O  O    . PRO A 1 50 ? 11.463  -3.711  1.475   1.00 0.00 ? 50  PRO A O    3  
ATOM   3044  C  CB   . PRO A 1 50 ? 9.131   -5.245  0.285   1.00 0.00 ? 50  PRO A CB   3  
ATOM   3045  C  CG   . PRO A 1 50 ? 10.175  -5.959  -0.502  1.00 0.00 ? 50  PRO A CG   3  
ATOM   3046  C  CD   . PRO A 1 50 ? 10.514  -5.056  -1.655  1.00 0.00 ? 50  PRO A CD   3  
ATOM   3047  H  HA   . PRO A 1 50 ? 8.563   -3.182  0.087   1.00 0.00 ? 50  PRO A HA   3  
ATOM   3048  H  HB2  . PRO A 1 50 ? 9.167   -5.519  1.331   1.00 0.00 ? 50  PRO A HB2  3  
ATOM   3049  H  HB3  . PRO A 1 50 ? 8.143   -5.433  -0.108  1.00 0.00 ? 50  PRO A HB3  3  
ATOM   3050  H  HG2  . PRO A 1 50 ? 11.047  -6.127  0.112   1.00 0.00 ? 50  PRO A HG2  3  
ATOM   3051  H  HG3  . PRO A 1 50 ? 9.783   -6.898  -0.864  1.00 0.00 ? 50  PRO A HG3  3  
ATOM   3052  H  HD2  . PRO A 1 50 ? 11.560  -5.142  -1.907  1.00 0.00 ? 50  PRO A HD2  3  
ATOM   3053  H  HD3  . PRO A 1 50 ? 9.897   -5.290  -2.511  1.00 0.00 ? 50  PRO A HD3  3  
ATOM   3054  N  N    . PHE A 1 51 ? 9.752   -2.399  2.118   1.00 0.00 ? 51  PHE A N    3  
ATOM   3055  C  CA   . PHE A 1 51 ? 10.455  -1.865  3.279   1.00 0.00 ? 51  PHE A CA   3  
ATOM   3056  C  C    . PHE A 1 51 ? 10.267  -2.770  4.493   1.00 0.00 ? 51  PHE A C    3  
ATOM   3057  O  O    . PHE A 1 51 ? 9.152   -3.150  4.849   1.00 0.00 ? 51  PHE A O    3  
ATOM   3058  C  CB   . PHE A 1 51 ? 9.957   -0.454  3.598   1.00 0.00 ? 51  PHE A CB   3  
ATOM   3059  C  CG   . PHE A 1 51 ? 9.588   0.342   2.379   1.00 0.00 ? 51  PHE A CG   3  
ATOM   3060  C  CD1  . PHE A 1 51 ? 10.543  0.655   1.425   1.00 0.00 ? 51  PHE A CD1  3  
ATOM   3061  C  CD2  . PHE A 1 51 ? 8.286   0.776   2.186   1.00 0.00 ? 51  PHE A CD2  3  
ATOM   3062  C  CE1  . PHE A 1 51 ? 10.206  1.388   0.302   1.00 0.00 ? 51  PHE A CE1  3  
ATOM   3063  C  CE2  . PHE A 1 51 ? 7.943   1.509   1.065   1.00 0.00 ? 51  PHE A CE2  3  
ATOM   3064  C  CZ   . PHE A 1 51 ? 8.905   1.814   0.122   1.00 0.00 ? 51  PHE A CZ   3  
ATOM   3065  H  H    . PHE A 1 51 ? 8.838   -2.098  1.932   1.00 0.00 ? 51  PHE A H    3  
ATOM   3066  H  HA   . PHE A 1 51 ? 11.506  -1.820  3.037   1.00 0.00 ? 51  PHE A HA   3  
ATOM   3067  H  HB2  . PHE A 1 51 ? 9.081   -0.522  4.226   1.00 0.00 ? 51  PHE A HB2  3  
ATOM   3068  H  HB3  . PHE A 1 51 ? 10.732  0.083   4.124   1.00 0.00 ? 51  PHE A HB3  3  
ATOM   3069  H  HD1  . PHE A 1 51 ? 11.561  0.322   1.564   1.00 0.00 ? 51  PHE A HD1  3  
ATOM   3070  H  HD2  . PHE A 1 51 ? 7.533   0.537   2.924   1.00 0.00 ? 51  PHE A HD2  3  
ATOM   3071  H  HE1  . PHE A 1 51 ? 10.959  1.626   -0.434  1.00 0.00 ? 51  PHE A HE1  3  
ATOM   3072  H  HE2  . PHE A 1 51 ? 6.925   1.840   0.928   1.00 0.00 ? 51  PHE A HE2  3  
ATOM   3073  H  HZ   . PHE A 1 51 ? 8.639   2.387   -0.754  1.00 0.00 ? 51  PHE A HZ   3  
ATOM   3074  N  N    . PRO A 1 52 ? 11.385  -3.124  5.145   1.00 0.00 ? 52  PRO A N    3  
ATOM   3075  C  CA   . PRO A 1 52 ? 11.370  -3.988  6.329   1.00 0.00 ? 52  PRO A CA   3  
ATOM   3076  C  C    . PRO A 1 52 ? 10.764  -3.296  7.544   1.00 0.00 ? 52  PRO A C    3  
ATOM   3077  O  O    . PRO A 1 52 ? 10.517  -2.090  7.543   1.00 0.00 ? 52  PRO A O    3  
ATOM   3078  C  CB   . PRO A 1 52 ? 12.853  -4.287  6.567   1.00 0.00 ? 52  PRO A CB   3  
ATOM   3079  C  CG   . PRO A 1 52 ? 13.574  -3.135  5.958   1.00 0.00 ? 52  PRO A CG   3  
ATOM   3080  C  CD   . PRO A 1 52 ? 12.748  -2.708  4.776   1.00 0.00 ? 52  PRO A CD   3  
ATOM   3081  H  HA   . PRO A 1 52 ? 10.841  -4.911  6.140   1.00 0.00 ? 52  PRO A HA   3  
ATOM   3082  H  HB2  . PRO A 1 52 ? 13.042  -4.356  7.630   1.00 0.00 ? 52  PRO A HB2  3  
ATOM   3083  H  HB3  . PRO A 1 52 ? 13.118  -5.217  6.088   1.00 0.00 ? 52  PRO A HB3  3  
ATOM   3084  H  HG2  . PRO A 1 52 ? 13.652  -2.330  6.672   1.00 0.00 ? 52  PRO A HG2  3  
ATOM   3085  H  HG3  . PRO A 1 52 ? 14.557  -3.448  5.634   1.00 0.00 ? 52  PRO A HG3  3  
ATOM   3086  H  HD2  . PRO A 1 52 ? 12.803  -1.637  4.645   1.00 0.00 ? 52  PRO A HD2  3  
ATOM   3087  H  HD3  . PRO A 1 52 ? 13.077  -3.216  3.882   1.00 0.00 ? 52  PRO A HD3  3  
ATOM   3088  N  N    . PRO A 1 53 ? 10.518  -4.075  8.608   1.00 0.00 ? 53  PRO A N    3  
ATOM   3089  C  CA   . PRO A 1 53 ? 9.938   -3.557  9.851   1.00 0.00 ? 53  PRO A CA   3  
ATOM   3090  C  C    . PRO A 1 53 ? 10.906  -2.656  10.611  1.00 0.00 ? 53  PRO A C    3  
ATOM   3091  O  O    . PRO A 1 53 ? 10.580  -2.140  11.679  1.00 0.00 ? 53  PRO A O    3  
ATOM   3092  C  CB   . PRO A 1 53 ? 9.640   -4.823  10.658  1.00 0.00 ? 53  PRO A CB   3  
ATOM   3093  C  CG   . PRO A 1 53 ? 10.598  -5.838  10.138  1.00 0.00 ? 53  PRO A CG   3  
ATOM   3094  C  CD   . PRO A 1 53 ? 10.787  -5.521  8.680   1.00 0.00 ? 53  PRO A CD   3  
ATOM   3095  H  HA   . PRO A 1 53 ? 9.018   -3.021  9.667   1.00 0.00 ? 53  PRO A HA   3  
ATOM   3096  H  HB2  . PRO A 1 53 ? 9.801   -4.629  11.709  1.00 0.00 ? 53  PRO A HB2  3  
ATOM   3097  H  HB3  . PRO A 1 53 ? 8.617   -5.126  10.494  1.00 0.00 ? 53  PRO A HB3  3  
ATOM   3098  H  HG2  . PRO A 1 53 ? 11.538  -5.759  10.663  1.00 0.00 ? 53  PRO A HG2  3  
ATOM   3099  H  HG3  . PRO A 1 53 ? 10.183  -6.828  10.254  1.00 0.00 ? 53  PRO A HG3  3  
ATOM   3100  H  HD2  . PRO A 1 53 ? 11.799  -5.740  8.374   1.00 0.00 ? 53  PRO A HD2  3  
ATOM   3101  H  HD3  . PRO A 1 53 ? 10.081  -6.074  8.079   1.00 0.00 ? 53  PRO A HD3  3  
ATOM   3102  N  N    . GLY A 1 54 ? 12.098  -2.471  10.052  1.00 0.00 ? 54  GLY A N    3  
ATOM   3103  C  CA   . GLY A 1 54 ? 13.094  -1.632  10.691  1.00 0.00 ? 54  GLY A CA   3  
ATOM   3104  C  C    . GLY A 1 54 ? 13.459  -0.423  9.853   1.00 0.00 ? 54  GLY A C    3  
ATOM   3105  O  O    . GLY A 1 54 ? 13.236  0.716   10.263  1.00 0.00 ? 54  GLY A O    3  
ATOM   3106  H  H    . GLY A 1 54 ? 12.302  -2.908  9.199   1.00 0.00 ? 54  GLY A H    3  
ATOM   3107  H  HA2  . GLY A 1 54 ? 12.709  -1.295  11.642  1.00 0.00 ? 54  GLY A HA2  3  
ATOM   3108  H  HA3  . GLY A 1 54 ? 13.986  -2.218  10.863  1.00 0.00 ? 54  GLY A HA3  3  
ATOM   3109  N  N    . ASP A 1 55 ? 14.022  -0.670  8.675   1.00 0.00 ? 55  ASP A N    3  
ATOM   3110  C  CA   . ASP A 1 55 ? 14.419  0.408   7.776   1.00 0.00 ? 55  ASP A CA   3  
ATOM   3111  C  C    . ASP A 1 55 ? 13.396  1.539   7.799   1.00 0.00 ? 55  ASP A C    3  
ATOM   3112  O  O    . ASP A 1 55 ? 12.231  1.329   8.137   1.00 0.00 ? 55  ASP A O    3  
ATOM   3113  C  CB   . ASP A 1 55 ? 14.581  -0.122  6.351   1.00 0.00 ? 55  ASP A CB   3  
ATOM   3114  C  CG   . ASP A 1 55 ? 15.267  0.874   5.437   1.00 0.00 ? 55  ASP A CG   3  
ATOM   3115  O  OD1  . ASP A 1 55 ? 16.141  1.622   5.925   1.00 0.00 ? 55  ASP A OD1  3  
ATOM   3116  O  OD2  . ASP A 1 55 ? 14.932  0.905   4.235   1.00 0.00 ? 55  ASP A OD2  3  
ATOM   3117  H  H    . ASP A 1 55 ? 14.174  -1.600  8.404   1.00 0.00 ? 55  ASP A H    3  
ATOM   3118  H  HA   . ASP A 1 55 ? 15.369  0.791   8.118   1.00 0.00 ? 55  ASP A HA   3  
ATOM   3119  H  HB2  . ASP A 1 55 ? 15.171  -1.027  6.374   1.00 0.00 ? 55  ASP A HB2  3  
ATOM   3120  H  HB3  . ASP A 1 55 ? 13.605  -0.344  5.944   1.00 0.00 ? 55  ASP A HB3  3  
ATOM   3121  N  N    . ARG A 1 56 ? 13.840  2.738   7.438   1.00 0.00 ? 56  ARG A N    3  
ATOM   3122  C  CA   . ARG A 1 56 ? 12.963  3.903   7.420   1.00 0.00 ? 56  ARG A CA   3  
ATOM   3123  C  C    . ARG A 1 56 ? 12.302  4.065   6.054   1.00 0.00 ? 56  ARG A C    3  
ATOM   3124  O  O    . ARG A 1 56 ? 12.776  3.522   5.055   1.00 0.00 ? 56  ARG A O    3  
ATOM   3125  C  CB   . ARG A 1 56 ? 13.752  5.167   7.769   1.00 0.00 ? 56  ARG A CB   3  
ATOM   3126  C  CG   . ARG A 1 56 ? 14.291  5.175   9.190   1.00 0.00 ? 56  ARG A CG   3  
ATOM   3127  C  CD   . ARG A 1 56 ? 15.315  6.281   9.391   1.00 0.00 ? 56  ARG A CD   3  
ATOM   3128  N  NE   . ARG A 1 56 ? 15.326  6.774   10.766  1.00 0.00 ? 56  ARG A NE   3  
ATOM   3129  C  CZ   . ARG A 1 56 ? 16.343  7.441   11.299  1.00 0.00 ? 56  ARG A CZ   3  
ATOM   3130  N  NH1  . ARG A 1 56 ? 17.426  7.694   10.577  1.00 0.00 ? 56  ARG A NH1  3  
ATOM   3131  N  NH2  . ARG A 1 56 ? 16.278  7.857   12.558  1.00 0.00 ? 56  ARG A NH2  3  
ATOM   3132  H  H    . ARG A 1 56 ? 14.779  2.843   7.179   1.00 0.00 ? 56  ARG A H    3  
ATOM   3133  H  HA   . ARG A 1 56 ? 12.195  3.752   8.163   1.00 0.00 ? 56  ARG A HA   3  
ATOM   3134  H  HB2  . ARG A 1 56 ? 14.587  5.255   7.090   1.00 0.00 ? 56  ARG A HB2  3  
ATOM   3135  H  HB3  . ARG A 1 56 ? 13.107  6.024   7.647   1.00 0.00 ? 56  ARG A HB3  3  
ATOM   3136  H  HG2  . ARG A 1 56 ? 13.471  5.330   9.875   1.00 0.00 ? 56  ARG A HG2  3  
ATOM   3137  H  HG3  . ARG A 1 56 ? 14.757  4.223   9.393   1.00 0.00 ? 56  ARG A HG3  3  
ATOM   3138  H  HD2  . ARG A 1 56 ? 16.294  5.895   9.149   1.00 0.00 ? 56  ARG A HD2  3  
ATOM   3139  H  HD3  . ARG A 1 56 ? 15.077  7.099   8.727   1.00 0.00 ? 56  ARG A HD3  3  
ATOM   3140  H  HE   . ARG A 1 56 ? 14.536  6.598   11.317  1.00 0.00 ? 56  ARG A HE   3  
ATOM   3141  H  HH11 . ARG A 1 56 ? 17.477  7.383   9.628   1.00 0.00 ? 56  ARG A HH11 3  
ATOM   3142  H  HH12 . ARG A 1 56 ? 18.190  8.198   10.981  1.00 0.00 ? 56  ARG A HH12 3  
ATOM   3143  H  HH21 . ARG A 1 56 ? 15.464  7.668   13.105  1.00 0.00 ? 56  ARG A HH21 3  
ATOM   3144  H  HH22 . ARG A 1 56 ? 17.044  8.358   12.958  1.00 0.00 ? 56  ARG A HH22 3  
ATOM   3145  N  N    . VAL A 1 57 ? 11.205  4.814   6.018   1.00 0.00 ? 57  VAL A N    3  
ATOM   3146  C  CA   . VAL A 1 57 ? 10.479  5.047   4.775   1.00 0.00 ? 57  VAL A CA   3  
ATOM   3147  C  C    . VAL A 1 57 ? 10.166  6.528   4.592   1.00 0.00 ? 57  VAL A C    3  
ATOM   3148  O  O    . VAL A 1 57 ? 9.575   7.163   5.466   1.00 0.00 ? 57  VAL A O    3  
ATOM   3149  C  CB   . VAL A 1 57 ? 9.164   4.247   4.735   1.00 0.00 ? 57  VAL A CB   3  
ATOM   3150  C  CG1  . VAL A 1 57 ? 8.233   4.692   5.852   1.00 0.00 ? 57  VAL A CG1  3  
ATOM   3151  C  CG2  . VAL A 1 57 ? 8.491   4.396   3.378   1.00 0.00 ? 57  VAL A CG2  3  
ATOM   3152  H  H    . VAL A 1 57 ? 10.876  5.220   6.847   1.00 0.00 ? 57  VAL A H    3  
ATOM   3153  H  HA   . VAL A 1 57 ? 11.102  4.717   3.957   1.00 0.00 ? 57  VAL A HA   3  
ATOM   3154  H  HB   . VAL A 1 57 ? 9.396   3.203   4.885   1.00 0.00 ? 57  VAL A HB   3  
ATOM   3155  H  HG11 . VAL A 1 57 ? 7.432   5.287   5.437   1.00 0.00 ? 57  VAL A HG11 3  
ATOM   3156  H  HG12 . VAL A 1 57 ? 7.820   3.824   6.345   1.00 0.00 ? 57  VAL A HG12 3  
ATOM   3157  H  HG13 . VAL A 1 57 ? 8.786   5.284   6.567   1.00 0.00 ? 57  VAL A HG13 3  
ATOM   3158  H  HG21 . VAL A 1 57 ? 7.524   4.858   3.506   1.00 0.00 ? 57  VAL A HG21 3  
ATOM   3159  H  HG22 . VAL A 1 57 ? 9.104   5.014   2.738   1.00 0.00 ? 57  VAL A HG22 3  
ATOM   3160  H  HG23 . VAL A 1 57 ? 8.369   3.422   2.928   1.00 0.00 ? 57  VAL A HG23 3  
ATOM   3161  N  N    . THR A 1 58 ? 10.565  7.074   3.447   1.00 0.00 ? 58  THR A N    3  
ATOM   3162  C  CA   . THR A 1 58 ? 10.327  8.481   3.148   1.00 0.00 ? 58  THR A CA   3  
ATOM   3163  C  C    . THR A 1 58 ? 8.972   8.680   2.479   1.00 0.00 ? 58  THR A C    3  
ATOM   3164  O  O    . THR A 1 58 ? 8.702   8.113   1.420   1.00 0.00 ? 58  THR A O    3  
ATOM   3165  C  CB   . THR A 1 58 ? 11.427  9.054   2.234   1.00 0.00 ? 58  THR A CB   3  
ATOM   3166  O  OG1  . THR A 1 58 ? 12.709  8.892   2.849   1.00 0.00 ? 58  THR A OG1  3  
ATOM   3167  C  CG2  . THR A 1 58 ? 11.179  10.527  1.948   1.00 0.00 ? 58  THR A CG2  3  
ATOM   3168  H  H    . THR A 1 58 ? 11.030  6.517   2.789   1.00 0.00 ? 58  THR A H    3  
ATOM   3169  H  HA   . THR A 1 58 ? 10.342  9.027   4.080   1.00 0.00 ? 58  THR A HA   3  
ATOM   3170  H  HB   . THR A 1 58 ? 11.414  8.513   1.298   1.00 0.00 ? 58  THR A HB   3  
ATOM   3171  H  HG1  . THR A 1 58 ? 13.299  9.587   2.549   1.00 0.00 ? 58  THR A HG1  3  
ATOM   3172  H  HG21 . THR A 1 58 ? 10.176  10.657  1.569   1.00 0.00 ? 58  THR A HG21 3  
ATOM   3173  H  HG22 . THR A 1 58 ? 11.889  10.876  1.213   1.00 0.00 ? 58  THR A HG22 3  
ATOM   3174  H  HG23 . THR A 1 58 ? 11.296  11.095  2.859   1.00 0.00 ? 58  THR A HG23 3  
ATOM   3175  N  N    . PHE A 1 59 ? 8.122   9.489   3.104   1.00 0.00 ? 59  PHE A N    3  
ATOM   3176  C  CA   . PHE A 1 59 ? 6.794   9.762   2.568   1.00 0.00 ? 59  PHE A CA   3  
ATOM   3177  C  C    . PHE A 1 59 ? 6.808   11.008  1.687   1.00 0.00 ? 59  PHE A C    3  
ATOM   3178  O  O    . PHE A 1 59 ? 6.982   12.124  2.175   1.00 0.00 ? 59  PHE A O    3  
ATOM   3179  C  CB   . PHE A 1 59 ? 5.789   9.941   3.708   1.00 0.00 ? 59  PHE A CB   3  
ATOM   3180  C  CG   . PHE A 1 59 ? 6.357   10.653  4.902   1.00 0.00 ? 59  PHE A CG   3  
ATOM   3181  C  CD1  . PHE A 1 59 ? 7.012   9.948   5.899   1.00 0.00 ? 59  PHE A CD1  3  
ATOM   3182  C  CD2  . PHE A 1 59 ? 6.237   12.028  5.028   1.00 0.00 ? 59  PHE A CD2  3  
ATOM   3183  C  CE1  . PHE A 1 59 ? 7.535   10.600  6.999   1.00 0.00 ? 59  PHE A CE1  3  
ATOM   3184  C  CE2  . PHE A 1 59 ? 6.759   12.686  6.126   1.00 0.00 ? 59  PHE A CE2  3  
ATOM   3185  C  CZ   . PHE A 1 59 ? 7.410   11.971  7.112   1.00 0.00 ? 59  PHE A CZ   3  
ATOM   3186  H  H    . PHE A 1 59 ? 8.396   9.911   3.945   1.00 0.00 ? 59  PHE A H    3  
ATOM   3187  H  HA   . PHE A 1 59 ? 6.498   8.915   1.969   1.00 0.00 ? 59  PHE A HA   3  
ATOM   3188  H  HB2  . PHE A 1 59 ? 4.947   10.515  3.350   1.00 0.00 ? 59  PHE A HB2  3  
ATOM   3189  H  HB3  . PHE A 1 59 ? 5.445   8.970   4.031   1.00 0.00 ? 59  PHE A HB3  3  
ATOM   3190  H  HD1  . PHE A 1 59 ? 7.112   8.876   5.811   1.00 0.00 ? 59  PHE A HD1  3  
ATOM   3191  H  HD2  . PHE A 1 59 ? 5.728   12.588  4.256   1.00 0.00 ? 59  PHE A HD2  3  
ATOM   3192  H  HE1  . PHE A 1 59 ? 8.044   10.039  7.769   1.00 0.00 ? 59  PHE A HE1  3  
ATOM   3193  H  HE2  . PHE A 1 59 ? 6.659   13.758  6.211   1.00 0.00 ? 59  PHE A HE2  3  
ATOM   3194  H  HZ   . PHE A 1 59 ? 7.817   12.483  7.971   1.00 0.00 ? 59  PHE A HZ   3  
ATOM   3195  N  N    . ASN A 1 60 ? 6.625   10.808  0.386   1.00 0.00 ? 60  ASN A N    3  
ATOM   3196  C  CA   . ASN A 1 60 ? 6.618   11.914  -0.564  1.00 0.00 ? 60  ASN A CA   3  
ATOM   3197  C  C    . ASN A 1 60 ? 5.327   11.924  -1.377  1.00 0.00 ? 60  ASN A C    3  
ATOM   3198  O  O    . ASN A 1 60 ? 5.139   11.104  -2.274  1.00 0.00 ? 60  ASN A O    3  
ATOM   3199  C  CB   . ASN A 1 60 ? 7.823   11.816  -1.501  1.00 0.00 ? 60  ASN A CB   3  
ATOM   3200  C  CG   . ASN A 1 60 ? 8.143   13.138  -2.172  1.00 0.00 ? 60  ASN A CG   3  
ATOM   3201  O  OD1  . ASN A 1 60 ? 7.386   13.618  -3.015  1.00 0.00 ? 60  ASN A OD1  3  
ATOM   3202  N  ND2  . ASN A 1 60 ? 9.270   13.733  -1.798  1.00 0.00 ? 60  ASN A ND2  3  
ATOM   3203  H  H    . ASN A 1 60 ? 6.491   9.894   0.057   1.00 0.00 ? 60  ASN A H    3  
ATOM   3204  H  HA   . ASN A 1 60 ? 6.683   12.833  -0.002  1.00 0.00 ? 60  ASN A HA   3  
ATOM   3205  H  HB2  . ASN A 1 60 ? 8.688   11.504  -0.934  1.00 0.00 ? 60  ASN A HB2  3  
ATOM   3206  H  HB3  . ASN A 1 60 ? 7.617   11.085  -2.268  1.00 0.00 ? 60  ASN A HB3  3  
ATOM   3207  H  HD21 . ASN A 1 60 ? 9.824   13.292  -1.121  1.00 0.00 ? 60  ASN A HD21 3  
ATOM   3208  H  HD22 . ASN A 1 60 ? 9.501   14.590  -2.215  1.00 0.00 ? 60  ASN A HD22 3  
ATOM   3209  N  N    . GLY A 1 61 ? 4.439   12.861  -1.056  1.00 0.00 ? 61  GLY A N    3  
ATOM   3210  C  CA   . GLY A 1 61 ? 3.177   12.962  -1.766  1.00 0.00 ? 61  GLY A CA   3  
ATOM   3211  C  C    . GLY A 1 61 ? 2.245   11.807  -1.458  1.00 0.00 ? 61  GLY A C    3  
ATOM   3212  O  O    . GLY A 1 61 ? 1.824   11.626  -0.315  1.00 0.00 ? 61  GLY A O    3  
ATOM   3213  H  H    . GLY A 1 61 ? 4.643   13.489  -0.331  1.00 0.00 ? 61  GLY A H    3  
ATOM   3214  H  HA2  . GLY A 1 61 ? 2.693   13.886  -1.488  1.00 0.00 ? 61  GLY A HA2  3  
ATOM   3215  H  HA3  . GLY A 1 61 ? 3.375   12.976  -2.828  1.00 0.00 ? 61  GLY A HA3  3  
ATOM   3216  N  N    . LYS A 1 62 ? 1.920   11.022  -2.479  1.00 0.00 ? 62  LYS A N    3  
ATOM   3217  C  CA   . LYS A 1 62 ? 1.031   9.878   -2.314  1.00 0.00 ? 62  LYS A CA   3  
ATOM   3218  C  C    . LYS A 1 62 ? 1.825   8.578   -2.245  1.00 0.00 ? 62  LYS A C    3  
ATOM   3219  O  O    . LYS A 1 62 ? 1.373   7.595   -1.658  1.00 0.00 ? 62  LYS A O    3  
ATOM   3220  C  CB   . LYS A 1 62 ? 0.027   9.815   -3.467  1.00 0.00 ? 62  LYS A CB   3  
ATOM   3221  C  CG   . LYS A 1 62 ? 0.619   9.281   -4.760  1.00 0.00 ? 62  LYS A CG   3  
ATOM   3222  C  CD   . LYS A 1 62 ? 0.481   7.770   -4.854  1.00 0.00 ? 62  LYS A CD   3  
ATOM   3223  C  CE   . LYS A 1 62 ? 0.911   7.255   -6.219  1.00 0.00 ? 62  LYS A CE   3  
ATOM   3224  N  NZ   . LYS A 1 62 ? 0.680   5.791   -6.357  1.00 0.00 ? 62  LYS A NZ   3  
ATOM   3225  H  H    . LYS A 1 62 ? 2.288   11.217  -3.367  1.00 0.00 ? 62  LYS A H    3  
ATOM   3226  H  HA   . LYS A 1 62 ? 0.493   10.008  -1.387  1.00 0.00 ? 62  LYS A HA   3  
ATOM   3227  H  HB2  . LYS A 1 62 ? -0.794  9.175   -3.180  1.00 0.00 ? 62  LYS A HB2  3  
ATOM   3228  H  HB3  . LYS A 1 62 ? -0.352  10.810  -3.654  1.00 0.00 ? 62  LYS A HB3  3  
ATOM   3229  H  HG2  . LYS A 1 62 ? 0.104   9.731   -5.595  1.00 0.00 ? 62  LYS A HG2  3  
ATOM   3230  H  HG3  . LYS A 1 62 ? 1.668   9.540   -4.799  1.00 0.00 ? 62  LYS A HG3  3  
ATOM   3231  H  HD2  . LYS A 1 62 ? 1.100   7.313   -4.098  1.00 0.00 ? 62  LYS A HD2  3  
ATOM   3232  H  HD3  . LYS A 1 62 ? -0.553  7.501   -4.687  1.00 0.00 ? 62  LYS A HD3  3  
ATOM   3233  H  HE2  . LYS A 1 62 ? 0.346   7.773   -6.979  1.00 0.00 ? 62  LYS A HE2  3  
ATOM   3234  H  HE3  . LYS A 1 62 ? 1.963   7.459   -6.351  1.00 0.00 ? 62  LYS A HE3  3  
ATOM   3235  H  HZ1  . LYS A 1 62 ? 1.120   5.441   -7.232  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM   3236  H  HZ2  . LYS A 1 62 ? -0.340  5.592   -6.393  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM   3237  H  HZ3  . LYS A 1 62 ? 1.093   5.286   -5.548  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM   3238  N  N    . GLU A 1 63 ? 3.010   8.580   -2.847  1.00 0.00 ? 63  GLU A N    3  
ATOM   3239  C  CA   . GLU A 1 63 ? 3.866   7.400   -2.852  1.00 0.00 ? 63  GLU A CA   3  
ATOM   3240  C  C    . GLU A 1 63 ? 5.057   7.587   -1.917  1.00 0.00 ? 63  GLU A C    3  
ATOM   3241  O  O    . GLU A 1 63 ? 5.274   8.675   -1.381  1.00 0.00 ? 63  GLU A O    3  
ATOM   3242  C  CB   . GLU A 1 63 ? 4.358   7.106   -4.271  1.00 0.00 ? 63  GLU A CB   3  
ATOM   3243  C  CG   . GLU A 1 63 ? 5.180   8.233   -4.876  1.00 0.00 ? 63  GLU A CG   3  
ATOM   3244  C  CD   . GLU A 1 63 ? 6.445   8.518   -4.091  1.00 0.00 ? 63  GLU A CD   3  
ATOM   3245  O  OE1  . GLU A 1 63 ? 7.096   7.552   -3.642  1.00 0.00 ? 63  GLU A OE1  3  
ATOM   3246  O  OE2  . GLU A 1 63 ? 6.784   9.709   -3.926  1.00 0.00 ? 63  GLU A OE2  3  
ATOM   3247  H  H    . GLU A 1 63 ? 3.315   9.395   -3.299  1.00 0.00 ? 63  GLU A H    3  
ATOM   3248  H  HA   . GLU A 1 63 ? 3.279   6.563   -2.505  1.00 0.00 ? 63  GLU A HA   3  
ATOM   3249  H  HB2  . GLU A 1 63 ? 4.968   6.215   -4.250  1.00 0.00 ? 63  GLU A HB2  3  
ATOM   3250  H  HB3  . GLU A 1 63 ? 3.503   6.931   -4.907  1.00 0.00 ? 63  GLU A HB3  3  
ATOM   3251  H  HG2  . GLU A 1 63 ? 5.454   7.960   -5.884  1.00 0.00 ? 63  GLU A HG2  3  
ATOM   3252  H  HG3  . GLU A 1 63 ? 4.577   9.129   -4.897  1.00 0.00 ? 63  GLU A HG3  3  
ATOM   3253  N  N    . CYS A 1 64 ? 5.825   6.520   -1.726  1.00 0.00 ? 64  CYS A N    3  
ATOM   3254  C  CA   . CYS A 1 64 ? 6.994   6.566   -0.855  1.00 0.00 ? 64  CYS A CA   3  
ATOM   3255  C  C    . CYS A 1 64 ? 8.207   5.946   -1.540  1.00 0.00 ? 64  CYS A C    3  
ATOM   3256  O  O    . CYS A 1 64 ? 8.071   5.201   -2.510  1.00 0.00 ? 64  CYS A O    3  
ATOM   3257  C  CB   . CYS A 1 64 ? 6.706   5.836   0.458   1.00 0.00 ? 64  CYS A CB   3  
ATOM   3258  S  SG   . CYS A 1 64 ? 5.368   6.566   1.431   1.00 0.00 ? 64  CYS A SG   3  
ATOM   3259  H  H    . CYS A 1 64 ? 5.601   5.682   -2.181  1.00 0.00 ? 64  CYS A H    3  
ATOM   3260  H  HA   . CYS A 1 64 ? 7.207   7.602   -0.641  1.00 0.00 ? 64  CYS A HA   3  
ATOM   3261  H  HB2  . CYS A 1 64 ? 6.432   4.814   0.240   1.00 0.00 ? 64  CYS A HB2  3  
ATOM   3262  H  HB3  . CYS A 1 64 ? 7.597   5.841   1.067   1.00 0.00 ? 64  CYS A HB3  3  
ATOM   3263  H  HG   . CYS A 1 64 ? 4.608   5.581   1.885   1.00 0.00 ? 64  CYS A HG   3  
ATOM   3264  N  N    . MET A 1 65 ? 9.393   6.260   -1.029  1.00 0.00 ? 65  MET A N    3  
ATOM   3265  C  CA   . MET A 1 65 ? 10.631  5.734   -1.593  1.00 0.00 ? 65  MET A CA   3  
ATOM   3266  C  C    . MET A 1 65 ? 11.590  5.302   -0.488  1.00 0.00 ? 65  MET A C    3  
ATOM   3267  O  O    . MET A 1 65 ? 11.483  5.753   0.653   1.00 0.00 ? 65  MET A O    3  
ATOM   3268  C  CB   . MET A 1 65 ? 11.299  6.785   -2.482  1.00 0.00 ? 65  MET A CB   3  
ATOM   3269  C  CG   . MET A 1 65 ? 10.695  6.875   -3.874  1.00 0.00 ? 65  MET A CG   3  
ATOM   3270  S  SD   . MET A 1 65 ? 11.463  8.157   -4.883  1.00 0.00 ? 65  MET A SD   3  
ATOM   3271  C  CE   . MET A 1 65 ? 11.030  9.624   -3.951  1.00 0.00 ? 65  MET A CE   3  
ATOM   3272  H  H    . MET A 1 65 ? 9.438   6.860   -0.255  1.00 0.00 ? 65  MET A H    3  
ATOM   3273  H  HA   . MET A 1 65 ? 10.381  4.873   -2.194  1.00 0.00 ? 65  MET A HA   3  
ATOM   3274  H  HB2  . MET A 1 65 ? 11.205  7.751   -2.010  1.00 0.00 ? 65  MET A HB2  3  
ATOM   3275  H  HB3  . MET A 1 65 ? 12.346  6.542   -2.582  1.00 0.00 ? 65  MET A HB3  3  
ATOM   3276  H  HG2  . MET A 1 65 ? 10.822  5.924   -4.370  1.00 0.00 ? 65  MET A HG2  3  
ATOM   3277  H  HG3  . MET A 1 65 ? 9.641   7.091   -3.781  1.00 0.00 ? 65  MET A HG3  3  
ATOM   3278  H  HE1  . MET A 1 65 ? 11.779  9.805   -3.194  1.00 0.00 ? 65  MET A HE1  3  
ATOM   3279  H  HE2  . MET A 1 65 ? 10.981  10.472  -4.618  1.00 0.00 ? 65  MET A HE2  3  
ATOM   3280  H  HE3  . MET A 1 65 ? 10.069  9.480   -3.480  1.00 0.00 ? 65  MET A HE3  3  
ATOM   3281  N  N    . CYS A 1 66 ? 12.527  4.425   -0.834  1.00 0.00 ? 66  CYS A N    3  
ATOM   3282  C  CA   . CYS A 1 66 ? 13.505  3.931   0.127   1.00 0.00 ? 66  CYS A CA   3  
ATOM   3283  C  C    . CYS A 1 66 ? 14.637  4.938   0.319   1.00 0.00 ? 66  CYS A C    3  
ATOM   3284  O  O    . CYS A 1 66 ? 15.017  5.643   -0.615  1.00 0.00 ? 66  CYS A O    3  
ATOM   3285  C  CB   . CYS A 1 66 ? 14.075  2.589   -0.337  1.00 0.00 ? 66  CYS A CB   3  
ATOM   3286  S  SG   . CYS A 1 66 ? 15.077  2.692   -1.854  1.00 0.00 ? 66  CYS A SG   3  
ATOM   3287  H  H    . CYS A 1 66 ? 12.562  4.102   -1.760  1.00 0.00 ? 66  CYS A H    3  
ATOM   3288  H  HA   . CYS A 1 66 ? 13.001  3.792   1.072   1.00 0.00 ? 66  CYS A HA   3  
ATOM   3289  H  HB2  . CYS A 1 66 ? 14.703  2.184   0.444   1.00 0.00 ? 66  CYS A HB2  3  
ATOM   3290  H  HB3  . CYS A 1 66 ? 13.260  1.907   -0.526  1.00 0.00 ? 66  CYS A HB3  3  
ATOM   3291  N  N    . GLN A 1 67 ? 15.169  4.997   1.535   1.00 0.00 ? 67  GLN A N    3  
ATOM   3292  C  CA   . GLN A 1 67 ? 16.256  5.917   1.848   1.00 0.00 ? 67  GLN A CA   3  
ATOM   3293  C  C    . GLN A 1 67 ? 17.361  5.831   0.801   1.00 0.00 ? 67  GLN A C    3  
ATOM   3294  O  O    . GLN A 1 67 ? 18.015  6.827   0.490   1.00 0.00 ? 67  GLN A O    3  
ATOM   3295  C  CB   . GLN A 1 67 ? 16.827  5.612   3.235   1.00 0.00 ? 67  GLN A CB   3  
ATOM   3296  C  CG   . GLN A 1 67 ? 17.511  4.258   3.326   1.00 0.00 ? 67  GLN A CG   3  
ATOM   3297  C  CD   . GLN A 1 67 ? 16.525  3.109   3.398   1.00 0.00 ? 67  GLN A CD   3  
ATOM   3298  O  OE1  . GLN A 1 67 ? 15.337  3.310   3.651   1.00 0.00 ? 67  GLN A OE1  3  
ATOM   3299  N  NE2  . GLN A 1 67 ? 17.013  1.894   3.174   1.00 0.00 ? 67  GLN A NE2  3  
ATOM   3300  H  H    . GLN A 1 67 ? 14.823  4.409   2.238   1.00 0.00 ? 67  GLN A H    3  
ATOM   3301  H  HA   . GLN A 1 67 ? 15.853  6.918   1.847   1.00 0.00 ? 67  GLN A HA   3  
ATOM   3302  H  HB2  . GLN A 1 67 ? 17.548  6.374   3.490   1.00 0.00 ? 67  GLN A HB2  3  
ATOM   3303  H  HB3  . GLN A 1 67 ? 16.022  5.633   3.955   1.00 0.00 ? 67  GLN A HB3  3  
ATOM   3304  H  HG2  . GLN A 1 67 ? 18.134  4.123   2.454   1.00 0.00 ? 67  GLN A HG2  3  
ATOM   3305  H  HG3  . GLN A 1 67 ? 18.128  4.240   4.213   1.00 0.00 ? 67  GLN A HG3  3  
ATOM   3306  H  HE21 . GLN A 1 67 ? 17.971  1.809   2.980   1.00 0.00 ? 67  GLN A HE21 3  
ATOM   3307  H  HE22 . GLN A 1 67 ? 16.398  1.133   3.215   1.00 0.00 ? 67  GLN A HE22 3  
ATOM   3308  N  N    . LYS A 1 68 ? 17.565  4.635   0.259   1.00 0.00 ? 68  LYS A N    3  
ATOM   3309  C  CA   . LYS A 1 68 ? 18.590  4.418   -0.755  1.00 0.00 ? 68  LYS A CA   3  
ATOM   3310  C  C    . LYS A 1 68 ? 18.309  5.254   -1.999  1.00 0.00 ? 68  LYS A C    3  
ATOM   3311  O  O    . LYS A 1 68 ? 19.222  5.836   -2.588  1.00 0.00 ? 68  LYS A O    3  
ATOM   3312  C  CB   . LYS A 1 68 ? 18.661  2.936   -1.129  1.00 0.00 ? 68  LYS A CB   3  
ATOM   3313  C  CG   . LYS A 1 68 ? 19.785  2.606   -2.096  1.00 0.00 ? 68  LYS A CG   3  
ATOM   3314  C  CD   . LYS A 1 68 ? 20.040  1.109   -2.164  1.00 0.00 ? 68  LYS A CD   3  
ATOM   3315  C  CE   . LYS A 1 68 ? 18.966  0.397   -2.973  1.00 0.00 ? 68  LYS A CE   3  
ATOM   3316  N  NZ   . LYS A 1 68 ? 19.086  0.685   -4.429  1.00 0.00 ? 68  LYS A NZ   3  
ATOM   3317  H  H    . LYS A 1 68 ? 17.011  3.879   0.548   1.00 0.00 ? 68  LYS A H    3  
ATOM   3318  H  HA   . LYS A 1 68 ? 19.538  4.721   -0.338  1.00 0.00 ? 68  LYS A HA   3  
ATOM   3319  H  HB2  . LYS A 1 68 ? 18.806  2.356   -0.229  1.00 0.00 ? 68  LYS A HB2  3  
ATOM   3320  H  HB3  . LYS A 1 68 ? 17.725  2.647   -1.585  1.00 0.00 ? 68  LYS A HB3  3  
ATOM   3321  H  HG2  . LYS A 1 68 ? 19.516  2.959   -3.080  1.00 0.00 ? 68  LYS A HG2  3  
ATOM   3322  H  HG3  . LYS A 1 68 ? 20.687  3.101   -1.767  1.00 0.00 ? 68  LYS A HG3  3  
ATOM   3323  H  HD2  . LYS A 1 68 ? 20.998  0.937   -2.630  1.00 0.00 ? 68  LYS A HD2  3  
ATOM   3324  H  HD3  . LYS A 1 68 ? 20.048  0.708   -1.160  1.00 0.00 ? 68  LYS A HD3  3  
ATOM   3325  H  HE2  . LYS A 1 68 ? 19.061  -0.666  -2.816  1.00 0.00 ? 68  LYS A HE2  3  
ATOM   3326  H  HE3  . LYS A 1 68 ? 17.997  0.726   -2.628  1.00 0.00 ? 68  LYS A HE3  3  
ATOM   3327  H  HZ1  . LYS A 1 68 ? 19.474  1.639   -4.573  1.00 0.00 ? 68  LYS A HZ1  3  
ATOM   3328  H  HZ2  . LYS A 1 68 ? 18.152  0.631   -4.882  1.00 0.00 ? 68  LYS A HZ2  3  
ATOM   3329  H  HZ3  . LYS A 1 68 ? 19.719  -0.007  -4.879  1.00 0.00 ? 68  LYS A HZ3  3  
ATOM   3330  N  N    . CYS A 1 69 ? 17.042  5.312   -2.395  1.00 0.00 ? 69  CYS A N    3  
ATOM   3331  C  CA   . CYS A 1 69 ? 16.641  6.077   -3.569  1.00 0.00 ? 69  CYS A CA   3  
ATOM   3332  C  C    . CYS A 1 69 ? 16.567  7.567   -3.247  1.00 0.00 ? 69  CYS A C    3  
ATOM   3333  O  O    . CYS A 1 69 ? 17.138  8.395   -3.957  1.00 0.00 ? 69  CYS A O    3  
ATOM   3334  C  CB   . CYS A 1 69 ? 15.286  5.588   -4.085  1.00 0.00 ? 69  CYS A CB   3  
ATOM   3335  S  SG   . CYS A 1 69 ? 15.348  3.969   -4.918  1.00 0.00 ? 69  CYS A SG   3  
ATOM   3336  H  H    . CYS A 1 69 ? 16.359  4.826   -1.885  1.00 0.00 ? 69  CYS A H    3  
ATOM   3337  H  HA   . CYS A 1 69 ? 17.385  5.924   -4.336  1.00 0.00 ? 69  CYS A HA   3  
ATOM   3338  H  HB2  . CYS A 1 69 ? 14.603  5.502   -3.252  1.00 0.00 ? 69  CYS A HB2  3  
ATOM   3339  H  HB3  . CYS A 1 69 ? 14.897  6.307   -4.790  1.00 0.00 ? 69  CYS A HB3  3  
ATOM   3340  N  N    . SER A 1 70 ? 15.860  7.901   -2.173  1.00 0.00 ? 70  SER A N    3  
ATOM   3341  C  CA   . SER A 1 70 ? 15.708  9.290   -1.758  1.00 0.00 ? 70  SER A CA   3  
ATOM   3342  C  C    . SER A 1 70 ? 17.030  10.041  -1.879  1.00 0.00 ? 70  SER A C    3  
ATOM   3343  O  O    . SER A 1 70 ? 17.117  11.064  -2.559  1.00 0.00 ? 70  SER A O    3  
ATOM   3344  C  CB   . SER A 1 70 ? 15.197  9.362   -0.318  1.00 0.00 ? 70  SER A CB   3  
ATOM   3345  O  OG   . SER A 1 70 ? 14.784  10.677  0.011   1.00 0.00 ? 70  SER A OG   3  
ATOM   3346  H  H    . SER A 1 70 ? 15.427  7.195   -1.647  1.00 0.00 ? 70  SER A H    3  
ATOM   3347  H  HA   . SER A 1 70 ? 14.983  9.754   -2.412  1.00 0.00 ? 70  SER A HA   3  
ATOM   3348  H  HB2  . SER A 1 70 ? 14.356  8.695   -0.203  1.00 0.00 ? 70  SER A HB2  3  
ATOM   3349  H  HB3  . SER A 1 70 ? 15.987  9.066   0.356   1.00 0.00 ? 70  SER A HB3  3  
ATOM   3350  H  HG   . SER A 1 70 ? 14.068  10.638  0.650   1.00 0.00 ? 70  SER A HG   3  
ATOM   3351  N  N    . LEU A 1 71 ? 18.058  9.525   -1.214  1.00 0.00 ? 71  LEU A N    3  
ATOM   3352  C  CA   . LEU A 1 71 ? 19.378  10.146  -1.245  1.00 0.00 ? 71  LEU A CA   3  
ATOM   3353  C  C    . LEU A 1 71 ? 19.979  10.077  -2.646  1.00 0.00 ? 71  LEU A C    3  
ATOM   3354  O  O    . LEU A 1 71 ? 19.593  9.252   -3.474  1.00 0.00 ? 71  LEU A O    3  
ATOM   3355  C  CB   . LEU A 1 71 ? 20.310  9.459   -0.245  1.00 0.00 ? 71  LEU A CB   3  
ATOM   3356  C  CG   . LEU A 1 71 ? 20.333  10.050  1.165   1.00 0.00 ? 71  LEU A CG   3  
ATOM   3357  C  CD1  . LEU A 1 71 ? 19.293  9.373   2.045   1.00 0.00 ? 71  LEU A CD1  3  
ATOM   3358  C  CD2  . LEU A 1 71 ? 21.720  9.917   1.777   1.00 0.00 ? 71  LEU A CD2  3  
ATOM   3359  H  H    . LEU A 1 71 ? 17.928  8.709   -0.689  1.00 0.00 ? 71  LEU A H    3  
ATOM   3360  H  HA   . LEU A 1 71 ? 19.264  11.182  -0.966  1.00 0.00 ? 71  LEU A HA   3  
ATOM   3361  H  HB2  . LEU A 1 71 ? 20.007  8.427   -0.165  1.00 0.00 ? 71  LEU A HB2  3  
ATOM   3362  H  HB3  . LEU A 1 71 ? 21.314  9.508   -0.641  1.00 0.00 ? 71  LEU A HB3  3  
ATOM   3363  H  HG   . LEU A 1 71 ? 20.090  11.103  1.112   1.00 0.00 ? 71  LEU A HG   3  
ATOM   3364  H  HD11 . LEU A 1 71 ? 19.445  8.305   2.025   1.00 0.00 ? 71  LEU A HD11 3  
ATOM   3365  H  HD12 . LEU A 1 71 ? 18.305  9.603   1.676   1.00 0.00 ? 71  LEU A HD12 3  
ATOM   3366  H  HD13 . LEU A 1 71 ? 19.391  9.733   3.059   1.00 0.00 ? 71  LEU A HD13 3  
ATOM   3367  H  HD21 . LEU A 1 71 ? 22.466  10.109  1.021   1.00 0.00 ? 71  LEU A HD21 3  
ATOM   3368  H  HD22 . LEU A 1 71 ? 21.848  8.916   2.164   1.00 0.00 ? 71  LEU A HD22 3  
ATOM   3369  H  HD23 . LEU A 1 71 ? 21.829  10.630  2.580   1.00 0.00 ? 71  LEU A HD23 3  
ATOM   3370  N  N    . PRO A 1 72 ? 20.948  10.964  -2.918  1.00 0.00 ? 72  PRO A N    3  
ATOM   3371  C  CA   . PRO A 1 72 ? 21.625  11.023  -4.217  1.00 0.00 ? 72  PRO A CA   3  
ATOM   3372  C  C    . PRO A 1 72 ? 22.526  9.816   -4.457  1.00 0.00 ? 72  PRO A C    3  
ATOM   3373  O  O    . PRO A 1 72 ? 23.103  9.264   -3.520  1.00 0.00 ? 72  PRO A O    3  
ATOM   3374  C  CB   . PRO A 1 72 ? 22.459  12.303  -4.125  1.00 0.00 ? 72  PRO A CB   3  
ATOM   3375  C  CG   . PRO A 1 72 ? 22.688  12.502  -2.667  1.00 0.00 ? 72  PRO A CG   3  
ATOM   3376  C  CD   . PRO A 1 72 ? 21.458  11.976  -1.979  1.00 0.00 ? 72  PRO A CD   3  
ATOM   3377  H  HA   . PRO A 1 72 ? 20.918  11.109  -5.029  1.00 0.00 ? 72  PRO A HA   3  
ATOM   3378  H  HB2  . PRO A 1 72 ? 23.390  12.168  -4.658  1.00 0.00 ? 72  PRO A HB2  3  
ATOM   3379  H  HB3  . PRO A 1 72 ? 21.908  13.127  -4.554  1.00 0.00 ? 72  PRO A HB3  3  
ATOM   3380  H  HG2  . PRO A 1 72 ? 23.559  11.947  -2.353  1.00 0.00 ? 72  PRO A HG2  3  
ATOM   3381  H  HG3  . PRO A 1 72 ? 22.815  13.553  -2.455  1.00 0.00 ? 72  PRO A HG3  3  
ATOM   3382  H  HD2  . PRO A 1 72 ? 21.718  11.528  -1.032  1.00 0.00 ? 72  PRO A HD2  3  
ATOM   3383  H  HD3  . PRO A 1 72 ? 20.738  12.768  -1.838  1.00 0.00 ? 72  PRO A HD3  3  
ATOM   3384  N  N    . VAL A 1 73 ? 22.643  9.411   -5.717  1.00 0.00 ? 73  VAL A N    3  
ATOM   3385  C  CA   . VAL A 1 73 ? 23.475  8.270   -6.080  1.00 0.00 ? 73  VAL A CA   3  
ATOM   3386  C  C    . VAL A 1 73 ? 24.185  8.508   -7.408  1.00 0.00 ? 73  VAL A C    3  
ATOM   3387  O  O    . VAL A 1 73 ? 23.590  9.016   -8.359  1.00 0.00 ? 73  VAL A O    3  
ATOM   3388  C  CB   . VAL A 1 73 ? 22.644  6.978   -6.179  1.00 0.00 ? 73  VAL A CB   3  
ATOM   3389  C  CG1  . VAL A 1 73 ? 23.546  5.781   -6.436  1.00 0.00 ? 73  VAL A CG1  3  
ATOM   3390  C  CG2  . VAL A 1 73 ? 21.823  6.775   -4.914  1.00 0.00 ? 73  VAL A CG2  3  
ATOM   3391  H  H    . VAL A 1 73 ? 22.158  9.892   -6.420  1.00 0.00 ? 73  VAL A H    3  
ATOM   3392  H  HA   . VAL A 1 73 ? 24.217  8.138   -5.305  1.00 0.00 ? 73  VAL A HA   3  
ATOM   3393  H  HB   . VAL A 1 73 ? 21.964  7.074   -7.013  1.00 0.00 ? 73  VAL A HB   3  
ATOM   3394  H  HG11 . VAL A 1 73 ? 23.929  5.410   -5.497  1.00 0.00 ? 73  VAL A HG11 3  
ATOM   3395  H  HG12 . VAL A 1 73 ? 22.981  5.003   -6.929  1.00 0.00 ? 73  VAL A HG12 3  
ATOM   3396  H  HG13 . VAL A 1 73 ? 24.371  6.081   -7.066  1.00 0.00 ? 73  VAL A HG13 3  
ATOM   3397  H  HG21 . VAL A 1 73 ? 21.340  7.703   -4.647  1.00 0.00 ? 73  VAL A HG21 3  
ATOM   3398  H  HG22 . VAL A 1 73 ? 21.073  6.016   -5.089  1.00 0.00 ? 73  VAL A HG22 3  
ATOM   3399  H  HG23 . VAL A 1 73 ? 22.471  6.461   -4.110  1.00 0.00 ? 73  VAL A HG23 3  
ATOM   3400  N  N    . SER A 1 74 ? 25.460  8.137   -7.466  1.00 0.00 ? 74  SER A N    3  
ATOM   3401  C  CA   . SER A 1 74 ? 26.252  8.313   -8.678  1.00 0.00 ? 74  SER A CA   3  
ATOM   3402  C  C    . SER A 1 74 ? 25.422  8.004   -9.920  1.00 0.00 ? 74  SER A C    3  
ATOM   3403  O  O    . SER A 1 74 ? 25.461  8.741   -10.905 1.00 0.00 ? 74  SER A O    3  
ATOM   3404  C  CB   . SER A 1 74 ? 27.488  7.411   -8.639  1.00 0.00 ? 74  SER A CB   3  
ATOM   3405  O  OG   . SER A 1 74 ? 28.232  7.616   -7.451  1.00 0.00 ? 74  SER A OG   3  
ATOM   3406  H  H    . SER A 1 74 ? 25.878  7.738   -6.675  1.00 0.00 ? 74  SER A H    3  
ATOM   3407  H  HA   . SER A 1 74 ? 26.571  9.344   -8.719  1.00 0.00 ? 74  SER A HA   3  
ATOM   3408  H  HB2  . SER A 1 74 ? 27.178  6.378   -8.682  1.00 0.00 ? 74  SER A HB2  3  
ATOM   3409  H  HB3  . SER A 1 74 ? 28.119  7.634   -9.488  1.00 0.00 ? 74  SER A HB3  3  
ATOM   3410  H  HG   . SER A 1 74 ? 28.984  8.182   -7.637  1.00 0.00 ? 74  SER A HG   3  
ATOM   3411  N  N    . VAL A 1 75 ? 24.671  6.909   -9.865  1.00 0.00 ? 75  VAL A N    3  
ATOM   3412  C  CA   . VAL A 1 75 ? 23.830  6.502   -10.984 1.00 0.00 ? 75  VAL A CA   3  
ATOM   3413  C  C    . VAL A 1 75 ? 22.514  7.272   -10.992 1.00 0.00 ? 75  VAL A C    3  
ATOM   3414  O  O    . VAL A 1 75 ? 21.553  6.887   -10.326 1.00 0.00 ? 75  VAL A O    3  
ATOM   3415  C  CB   . VAL A 1 75 ? 23.528  4.992   -10.939 1.00 0.00 ? 75  VAL A CB   3  
ATOM   3416  C  CG1  . VAL A 1 75 ? 22.635  4.591   -12.103 1.00 0.00 ? 75  VAL A CG1  3  
ATOM   3417  C  CG2  . VAL A 1 75 ? 24.820  4.190   -10.946 1.00 0.00 ? 75  VAL A CG2  3  
ATOM   3418  H  H    . VAL A 1 75 ? 24.682  6.362   -9.052  1.00 0.00 ? 75  VAL A H    3  
ATOM   3419  H  HA   . VAL A 1 75 ? 24.365  6.713   -11.898 1.00 0.00 ? 75  VAL A HA   3  
ATOM   3420  H  HB   . VAL A 1 75 ? 23.001  4.778   -10.020 1.00 0.00 ? 75  VAL A HB   3  
ATOM   3421  H  HG11 . VAL A 1 75 ? 22.412  5.462   -12.702 1.00 0.00 ? 75  VAL A HG11 3  
ATOM   3422  H  HG12 . VAL A 1 75 ? 23.142  3.855   -12.710 1.00 0.00 ? 75  VAL A HG12 3  
ATOM   3423  H  HG13 . VAL A 1 75 ? 21.715  4.171   -11.723 1.00 0.00 ? 75  VAL A HG13 3  
ATOM   3424  H  HG21 . VAL A 1 75 ? 24.703  3.325   -11.582 1.00 0.00 ? 75  VAL A HG21 3  
ATOM   3425  H  HG22 . VAL A 1 75 ? 25.625  4.806   -11.321 1.00 0.00 ? 75  VAL A HG22 3  
ATOM   3426  H  HG23 . VAL A 1 75 ? 25.051  3.869   -9.941  1.00 0.00 ? 75  VAL A HG23 3  
ATOM   3427  N  N    . SER A 1 76 ? 22.479  8.364   -11.750 1.00 0.00 ? 76  SER A N    3  
ATOM   3428  C  CA   . SER A 1 76 ? 21.282  9.191   -11.842 1.00 0.00 ? 76  SER A CA   3  
ATOM   3429  C  C    . SER A 1 76 ? 20.274  8.583   -12.812 1.00 0.00 ? 76  SER A C    3  
ATOM   3430  O  O    . SER A 1 76 ? 20.611  8.250   -13.948 1.00 0.00 ? 76  SER A O    3  
ATOM   3431  C  CB   . SER A 1 76 ? 21.648  10.607  -12.291 1.00 0.00 ? 76  SER A CB   3  
ATOM   3432  O  OG   . SER A 1 76 ? 22.220  11.348  -11.226 1.00 0.00 ? 76  SER A OG   3  
ATOM   3433  H  H    . SER A 1 76 ? 23.278  8.619   -12.257 1.00 0.00 ? 76  SER A H    3  
ATOM   3434  H  HA   . SER A 1 76 ? 20.835  9.238   -10.860 1.00 0.00 ? 76  SER A HA   3  
ATOM   3435  H  HB2  . SER A 1 76 ? 22.362  10.552  -13.099 1.00 0.00 ? 76  SER A HB2  3  
ATOM   3436  H  HB3  . SER A 1 76 ? 20.758  11.116  -12.630 1.00 0.00 ? 76  SER A HB3  3  
ATOM   3437  H  HG   . SER A 1 76 ? 22.664  10.749  -10.622 1.00 0.00 ? 76  SER A HG   3  
ATOM   3438  N  N    . GLY A 1 77 ? 19.033  8.440   -12.356 1.00 0.00 ? 77  GLY A N    3  
ATOM   3439  C  CA   . GLY A 1 77 ? 17.995  7.872   -13.195 1.00 0.00 ? 77  GLY A CA   3  
ATOM   3440  C  C    . GLY A 1 77 ? 17.487  8.853   -14.233 1.00 0.00 ? 77  GLY A C    3  
ATOM   3441  O  O    . GLY A 1 77 ? 17.520  10.068  -14.039 1.00 0.00 ? 77  GLY A O    3  
ATOM   3442  H  H    . GLY A 1 77 ? 18.822  8.723   -11.441 1.00 0.00 ? 77  GLY A H    3  
ATOM   3443  H  HA2  . GLY A 1 77 ? 18.389  7.002   -13.699 1.00 0.00 ? 77  GLY A HA2  3  
ATOM   3444  H  HA3  . GLY A 1 77 ? 17.168  7.569   -12.569 1.00 0.00 ? 77  GLY A HA3  3  
ATOM   3445  N  N    . PRO A 1 78 ? 17.006  8.323   -15.368 1.00 0.00 ? 78  PRO A N    3  
ATOM   3446  C  CA   . PRO A 1 78 ? 16.482  9.143   -16.464 1.00 0.00 ? 78  PRO A CA   3  
ATOM   3447  C  C    . PRO A 1 78 ? 15.162  9.817   -16.104 1.00 0.00 ? 78  PRO A C    3  
ATOM   3448  O  O    . PRO A 1 78 ? 14.284  9.200   -15.501 1.00 0.00 ? 78  PRO A O    3  
ATOM   3449  C  CB   . PRO A 1 78 ? 16.275  8.133   -17.595 1.00 0.00 ? 78  PRO A CB   3  
ATOM   3450  C  CG   . PRO A 1 78 ? 16.085  6.826   -16.906 1.00 0.00 ? 78  PRO A CG   3  
ATOM   3451  C  CD   . PRO A 1 78 ? 16.937  6.883   -15.668 1.00 0.00 ? 78  PRO A CD   3  
ATOM   3452  H  HA   . PRO A 1 78 ? 17.195  9.893   -16.775 1.00 0.00 ? 78  PRO A HA   3  
ATOM   3453  H  HB2  . PRO A 1 78 ? 15.402  8.407   -18.171 1.00 0.00 ? 78  PRO A HB2  3  
ATOM   3454  H  HB3  . PRO A 1 78 ? 17.145  8.119   -18.234 1.00 0.00 ? 78  PRO A HB3  3  
ATOM   3455  H  HG2  . PRO A 1 78 ? 15.047  6.698   -16.641 1.00 0.00 ? 78  PRO A HG2  3  
ATOM   3456  H  HG3  . PRO A 1 78 ? 16.412  6.021   -17.548 1.00 0.00 ? 78  PRO A HG3  3  
ATOM   3457  H  HD2  . PRO A 1 78 ? 16.466  6.343   -14.860 1.00 0.00 ? 78  PRO A HD2  3  
ATOM   3458  H  HD3  . PRO A 1 78 ? 17.921  6.484   -15.868 1.00 0.00 ? 78  PRO A HD3  3  
ATOM   3459  N  N    . SER A 1 79 ? 15.029  11.086  -16.478 1.00 0.00 ? 79  SER A N    3  
ATOM   3460  C  CA   . SER A 1 79 ? 13.818  11.844  -16.191 1.00 0.00 ? 79  SER A CA   3  
ATOM   3461  C  C    . SER A 1 79 ? 12.802  11.693  -17.320 1.00 0.00 ? 79  SER A C    3  
ATOM   3462  O  O    . SER A 1 79 ? 13.135  11.851  -18.494 1.00 0.00 ? 79  SER A O    3  
ATOM   3463  C  CB   . SER A 1 79 ? 14.153  13.323  -15.986 1.00 0.00 ? 79  SER A CB   3  
ATOM   3464  O  OG   . SER A 1 79 ? 13.212  13.944  -15.127 1.00 0.00 ? 79  SER A OG   3  
ATOM   3465  H  H    . SER A 1 79 ? 15.765  11.522  -16.956 1.00 0.00 ? 79  SER A H    3  
ATOM   3466  H  HA   . SER A 1 79 ? 13.388  11.451  -15.281 1.00 0.00 ? 79  SER A HA   3  
ATOM   3467  H  HB2  . SER A 1 79 ? 15.135  13.409  -15.547 1.00 0.00 ? 79  SER A HB2  3  
ATOM   3468  H  HB3  . SER A 1 79 ? 14.139  13.828  -16.941 1.00 0.00 ? 79  SER A HB3  3  
ATOM   3469  H  HG   . SER A 1 79 ? 13.281  13.564  -14.248 1.00 0.00 ? 79  SER A HG   3  
ATOM   3470  N  N    . SER A 1 80 ? 11.562  11.386  -16.954 1.00 0.00 ? 80  SER A N    3  
ATOM   3471  C  CA   . SER A 1 80 ? 10.497  11.210  -17.935 1.00 0.00 ? 80  SER A CA   3  
ATOM   3472  C  C    . SER A 1 80 ? 9.133   11.494  -17.313 1.00 0.00 ? 80  SER A C    3  
ATOM   3473  O  O    . SER A 1 80 ? 8.980   11.484  -16.092 1.00 0.00 ? 80  SER A O    3  
ATOM   3474  C  CB   . SER A 1 80 ? 10.526  9.788   -18.500 1.00 0.00 ? 80  SER A CB   3  
ATOM   3475  O  OG   . SER A 1 80 ? 11.697  9.569   -19.269 1.00 0.00 ? 80  SER A OG   3  
ATOM   3476  H  H    . SER A 1 80 ? 11.358  11.273  -16.002 1.00 0.00 ? 80  SER A H    3  
ATOM   3477  H  HA   . SER A 1 80 ? 10.667  11.911  -18.738 1.00 0.00 ? 80  SER A HA   3  
ATOM   3478  H  HB2  . SER A 1 80 ? 10.507  9.079   -17.686 1.00 0.00 ? 80  SER A HB2  3  
ATOM   3479  H  HB3  . SER A 1 80 ? 9.662   9.637   -19.131 1.00 0.00 ? 80  SER A HB3  3  
ATOM   3480  H  HG   . SER A 1 80 ? 11.855  8.626   -19.349 1.00 0.00 ? 80  SER A HG   3  
ATOM   3481  N  N    . GLY A 1 81 ? 8.143   11.747  -18.164 1.00 0.00 ? 81  GLY A N    3  
ATOM   3482  C  CA   . GLY A 1 81 ? 6.804   12.031  -17.681 1.00 0.00 ? 81  GLY A CA   3  
ATOM   3483  C  C    . GLY A 1 81 ? 5.911   10.807  -17.696 1.00 0.00 ? 81  GLY A C    3  
ATOM   3484  O  O    . GLY A 1 81 ? 6.372   9.734   -18.083 1.00 0.00 ? 81  GLY A O    3  
ATOM   3485  H  H    . GLY A 1 81 ? 8.323   11.742  -19.127 1.00 0.00 ? 81  GLY A H    3  
ATOM   3486  H  HA2  . GLY A 1 81 ? 6.870   12.404  -16.670 1.00 0.00 ? 81  GLY A HA2  3  
ATOM   3487  H  HA3  . GLY A 1 81 ? 6.362   12.792  -18.307 1.00 0.00 ? 81  GLY A HA3  3  
HETATM 3488  ZN ZN   . ZN  B 2 .  ? -2.972  -1.904  -4.213  1.00 0.00 ? 201 ZN  A ZN   3  
HETATM 3489  ZN ZN   . ZN  C 2 .  ? 13.900  2.466   -3.846  1.00 0.00 ? 401 ZN  A ZN   3  
ATOM   3490  N  N    . GLY A 1 1  ? -39.066 -10.719 -5.449  1.00 0.00 ? 1   GLY A N    4  
ATOM   3491  C  CA   . GLY A 1 1  ? -38.640 -10.490 -4.080  1.00 0.00 ? 1   GLY A CA   4  
ATOM   3492  C  C    . GLY A 1 1  ? -39.501 -11.228 -3.074  1.00 0.00 ? 1   GLY A C    4  
ATOM   3493  O  O    . GLY A 1 1  ? -39.984 -10.637 -2.109  1.00 0.00 ? 1   GLY A O    4  
ATOM   3494  H  H1   . GLY A 1 1  ? -38.397 -10.864 -6.150  1.00 0.00 ? 1   GLY A H1   4  
ATOM   3495  H  HA2  . GLY A 1 1  ? -37.617 -10.818 -3.973  1.00 0.00 ? 1   GLY A HA2  4  
ATOM   3496  H  HA3  . GLY A 1 1  ? -38.691 -9.431  -3.872  1.00 0.00 ? 1   GLY A HA3  4  
ATOM   3497  N  N    . SER A 1 2  ? -39.694 -12.523 -3.301  1.00 0.00 ? 2   SER A N    4  
ATOM   3498  C  CA   . SER A 1 2  ? -40.507 -13.342 -2.409  1.00 0.00 ? 2   SER A CA   4  
ATOM   3499  C  C    . SER A 1 2  ? -39.797 -13.565 -1.078  1.00 0.00 ? 2   SER A C    4  
ATOM   3500  O  O    . SER A 1 2  ? -40.406 -13.472 -0.012  1.00 0.00 ? 2   SER A O    4  
ATOM   3501  C  CB   . SER A 1 2  ? -40.823 -14.688 -3.064  1.00 0.00 ? 2   SER A CB   4  
ATOM   3502  O  OG   . SER A 1 2  ? -41.404 -15.584 -2.133  1.00 0.00 ? 2   SER A OG   4  
ATOM   3503  H  H    . SER A 1 2  ? -39.282 -12.937 -4.088  1.00 0.00 ? 2   SER A H    4  
ATOM   3504  H  HA   . SER A 1 2  ? -41.432 -12.815 -2.226  1.00 0.00 ? 2   SER A HA   4  
ATOM   3505  H  HB2  . SER A 1 2  ? -41.514 -14.536 -3.879  1.00 0.00 ? 2   SER A HB2  4  
ATOM   3506  H  HB3  . SER A 1 2  ? -39.910 -15.123 -3.444  1.00 0.00 ? 2   SER A HB3  4  
ATOM   3507  H  HG   . SER A 1 2  ? -40.903 -16.403 -2.122  1.00 0.00 ? 2   SER A HG   4  
ATOM   3508  N  N    . SER A 1 3  ? -38.503 -13.862 -1.147  1.00 0.00 ? 3   SER A N    4  
ATOM   3509  C  CA   . SER A 1 3  ? -37.708 -14.103 0.052   1.00 0.00 ? 3   SER A CA   4  
ATOM   3510  C  C    . SER A 1 3  ? -36.223 -14.183 -0.288  1.00 0.00 ? 3   SER A C    4  
ATOM   3511  O  O    . SER A 1 3  ? -35.848 -14.342 -1.449  1.00 0.00 ? 3   SER A O    4  
ATOM   3512  C  CB   . SER A 1 3  ? -38.157 -15.396 0.735   1.00 0.00 ? 3   SER A CB   4  
ATOM   3513  O  OG   . SER A 1 3  ? -37.871 -15.365 2.123   1.00 0.00 ? 3   SER A OG   4  
ATOM   3514  H  H    . SER A 1 3  ? -38.073 -13.922 -2.026  1.00 0.00 ? 3   SER A H    4  
ATOM   3515  H  HA   . SER A 1 3  ? -37.867 -13.275 0.726   1.00 0.00 ? 3   SER A HA   4  
ATOM   3516  H  HB2  . SER A 1 3  ? -39.221 -15.519 0.602   1.00 0.00 ? 3   SER A HB2  4  
ATOM   3517  H  HB3  . SER A 1 3  ? -37.639 -16.233 0.291   1.00 0.00 ? 3   SER A HB3  4  
ATOM   3518  H  HG   . SER A 1 3  ? -37.486 -16.203 2.389   1.00 0.00 ? 3   SER A HG   4  
ATOM   3519  N  N    . GLY A 1 4  ? -35.381 -14.071 0.735   1.00 0.00 ? 4   GLY A N    4  
ATOM   3520  C  CA   . GLY A 1 4  ? -33.947 -14.133 0.526   1.00 0.00 ? 4   GLY A CA   4  
ATOM   3521  C  C    . GLY A 1 4  ? -33.378 -12.825 0.013   1.00 0.00 ? 4   GLY A C    4  
ATOM   3522  O  O    . GLY A 1 4  ? -34.095 -11.831 -0.099  1.00 0.00 ? 4   GLY A O    4  
ATOM   3523  H  H    . GLY A 1 4  ? -35.737 -13.946 1.640   1.00 0.00 ? 4   GLY A H    4  
ATOM   3524  H  HA2  . GLY A 1 4  ? -33.467 -14.380 1.461   1.00 0.00 ? 4   GLY A HA2  4  
ATOM   3525  H  HA3  . GLY A 1 4  ? -33.733 -14.911 -0.193  1.00 0.00 ? 4   GLY A HA3  4  
ATOM   3526  N  N    . SER A 1 5  ? -32.086 -12.824 -0.297  1.00 0.00 ? 5   SER A N    4  
ATOM   3527  C  CA   . SER A 1 5  ? -31.420 -11.626 -0.795  1.00 0.00 ? 5   SER A CA   4  
ATOM   3528  C  C    . SER A 1 5  ? -31.023 -11.794 -2.258  1.00 0.00 ? 5   SER A C    4  
ATOM   3529  O  O    . SER A 1 5  ? -30.350 -12.758 -2.624  1.00 0.00 ? 5   SER A O    4  
ATOM   3530  C  CB   . SER A 1 5  ? -30.182 -11.316 0.049   1.00 0.00 ? 5   SER A CB   4  
ATOM   3531  O  OG   . SER A 1 5  ? -29.098 -12.156 -0.309  1.00 0.00 ? 5   SER A OG   4  
ATOM   3532  H  H    . SER A 1 5  ? -31.567 -13.648 -0.186  1.00 0.00 ? 5   SER A H    4  
ATOM   3533  H  HA   . SER A 1 5  ? -32.115 -10.803 -0.715  1.00 0.00 ? 5   SER A HA   4  
ATOM   3534  H  HB2  . SER A 1 5  ? -29.892 -10.288 -0.106  1.00 0.00 ? 5   SER A HB2  4  
ATOM   3535  H  HB3  . SER A 1 5  ? -30.414 -11.472 1.093   1.00 0.00 ? 5   SER A HB3  4  
ATOM   3536  H  HG   . SER A 1 5  ? -28.777 -12.614 0.471   1.00 0.00 ? 5   SER A HG   4  
ATOM   3537  N  N    . SER A 1 6  ? -31.445 -10.848 -3.092  1.00 0.00 ? 6   SER A N    4  
ATOM   3538  C  CA   . SER A 1 6  ? -31.137 -10.892 -4.516  1.00 0.00 ? 6   SER A CA   4  
ATOM   3539  C  C    . SER A 1 6  ? -30.300 -9.684  -4.929  1.00 0.00 ? 6   SER A C    4  
ATOM   3540  O  O    . SER A 1 6  ? -30.835 -8.656  -5.340  1.00 0.00 ? 6   SER A O    4  
ATOM   3541  C  CB   . SER A 1 6  ? -32.427 -10.937 -5.337  1.00 0.00 ? 6   SER A CB   4  
ATOM   3542  O  OG   . SER A 1 6  ? -32.947 -12.253 -5.398  1.00 0.00 ? 6   SER A OG   4  
ATOM   3543  H  H    . SER A 1 6  ? -31.978 -10.104 -2.740  1.00 0.00 ? 6   SER A H    4  
ATOM   3544  H  HA   . SER A 1 6  ? -30.568 -11.790 -4.705  1.00 0.00 ? 6   SER A HA   4  
ATOM   3545  H  HB2  . SER A 1 6  ? -33.163 -10.293 -4.881  1.00 0.00 ? 6   SER A HB2  4  
ATOM   3546  H  HB3  . SER A 1 6  ? -32.223 -10.596 -6.342  1.00 0.00 ? 6   SER A HB3  4  
ATOM   3547  H  HG   . SER A 1 6  ? -33.107 -12.576 -4.508  1.00 0.00 ? 6   SER A HG   4  
ATOM   3548  N  N    . GLY A 1 7  ? -28.982 -9.818  -4.815  1.00 0.00 ? 7   GLY A N    4  
ATOM   3549  C  CA   . GLY A 1 7  ? -28.092 -8.732  -5.179  1.00 0.00 ? 7   GLY A CA   4  
ATOM   3550  C  C    . GLY A 1 7  ? -26.775 -8.785  -4.430  1.00 0.00 ? 7   GLY A C    4  
ATOM   3551  O  O    . GLY A 1 7  ? -26.440 -9.802  -3.820  1.00 0.00 ? 7   GLY A O    4  
ATOM   3552  H  H    . GLY A 1 7  ? -28.612 -10.662 -4.481  1.00 0.00 ? 7   GLY A H    4  
ATOM   3553  H  HA2  . GLY A 1 7  ? -27.893 -8.784  -6.239  1.00 0.00 ? 7   GLY A HA2  4  
ATOM   3554  H  HA3  . GLY A 1 7  ? -28.579 -7.793  -4.960  1.00 0.00 ? 7   GLY A HA3  4  
ATOM   3555  N  N    . LEU A 1 8  ? -26.025 -7.690  -4.476  1.00 0.00 ? 8   LEU A N    4  
ATOM   3556  C  CA   . LEU A 1 8  ? -24.736 -7.616  -3.797  1.00 0.00 ? 8   LEU A CA   4  
ATOM   3557  C  C    . LEU A 1 8  ? -24.825 -6.739  -2.553  1.00 0.00 ? 8   LEU A C    4  
ATOM   3558  O  O    . LEU A 1 8  ? -24.357 -5.600  -2.549  1.00 0.00 ? 8   LEU A O    4  
ATOM   3559  C  CB   . LEU A 1 8  ? -23.668 -7.068  -4.746  1.00 0.00 ? 8   LEU A CB   4  
ATOM   3560  C  CG   . LEU A 1 8  ? -23.394 -7.900  -6.000  1.00 0.00 ? 8   LEU A CG   4  
ATOM   3561  C  CD1  . LEU A 1 8  ? -24.431 -7.605  -7.072  1.00 0.00 ? 8   LEU A CD1  4  
ATOM   3562  C  CD2  . LEU A 1 8  ? -21.991 -7.629  -6.523  1.00 0.00 ? 8   LEU A CD2  4  
ATOM   3563  H  H    . LEU A 1 8  ? -26.345 -6.912  -4.978  1.00 0.00 ? 8   LEU A H    4  
ATOM   3564  H  HA   . LEU A 1 8  ? -24.461 -8.617  -3.498  1.00 0.00 ? 8   LEU A HA   4  
ATOM   3565  H  HB2  . LEU A 1 8  ? -23.981 -6.085  -5.063  1.00 0.00 ? 8   LEU A HB2  4  
ATOM   3566  H  HB3  . LEU A 1 8  ? -22.744 -6.989  -4.192  1.00 0.00 ? 8   LEU A HB3  4  
ATOM   3567  H  HG   . LEU A 1 8  ? -23.463 -8.950  -5.750  1.00 0.00 ? 8   LEU A HG   4  
ATOM   3568  H  HD11 . LEU A 1 8  ? -25.419 -7.795  -6.680  1.00 0.00 ? 8   LEU A HD11 4  
ATOM   3569  H  HD12 . LEU A 1 8  ? -24.255 -8.241  -7.927  1.00 0.00 ? 8   LEU A HD12 4  
ATOM   3570  H  HD13 . LEU A 1 8  ? -24.355 -6.570  -7.372  1.00 0.00 ? 8   LEU A HD13 4  
ATOM   3571  H  HD21 . LEU A 1 8  ? -21.281 -7.726  -5.714  1.00 0.00 ? 8   LEU A HD21 4  
ATOM   3572  H  HD22 . LEU A 1 8  ? -21.944 -6.628  -6.926  1.00 0.00 ? 8   LEU A HD22 4  
ATOM   3573  H  HD23 . LEU A 1 8  ? -21.753 -8.342  -7.298  1.00 0.00 ? 8   LEU A HD23 4  
ATOM   3574  N  N    . ASP A 1 9  ? -25.428 -7.276  -1.498  1.00 0.00 ? 9   ASP A N    4  
ATOM   3575  C  CA   . ASP A 1 9  ? -25.576 -6.544  -0.246  1.00 0.00 ? 9   ASP A CA   4  
ATOM   3576  C  C    . ASP A 1 9  ? -24.522 -6.981  0.767   1.00 0.00 ? 9   ASP A C    4  
ATOM   3577  O  O    . ASP A 1 9  ? -24.164 -6.225  1.671   1.00 0.00 ? 9   ASP A O    4  
ATOM   3578  C  CB   . ASP A 1 9  ? -26.976 -6.756  0.332   1.00 0.00 ? 9   ASP A CB   4  
ATOM   3579  C  CG   . ASP A 1 9  ? -27.078 -8.029  1.149   1.00 0.00 ? 9   ASP A CG   4  
ATOM   3580  O  OD1  . ASP A 1 9  ? -26.835 -9.117  0.586   1.00 0.00 ? 9   ASP A OD1  4  
ATOM   3581  O  OD2  . ASP A 1 9  ? -27.400 -7.937  2.352   1.00 0.00 ? 9   ASP A OD2  4  
ATOM   3582  H  H    . ASP A 1 9  ? -25.781 -8.188  -1.563  1.00 0.00 ? 9   ASP A H    4  
ATOM   3583  H  HA   . ASP A 1 9  ? -25.439 -5.494  -0.458  1.00 0.00 ? 9   ASP A HA   4  
ATOM   3584  H  HB2  . ASP A 1 9  ? -27.226 -5.920  0.969   1.00 0.00 ? 9   ASP A HB2  4  
ATOM   3585  H  HB3  . ASP A 1 9  ? -27.688 -6.811  -0.478  1.00 0.00 ? 9   ASP A HB3  4  
ATOM   3586  N  N    . TYR A 1 10 ? -24.031 -8.205  0.611   1.00 0.00 ? 10  TYR A N    4  
ATOM   3587  C  CA   . TYR A 1 10 ? -23.021 -8.744  1.514   1.00 0.00 ? 10  TYR A CA   4  
ATOM   3588  C  C    . TYR A 1 10 ? -21.695 -8.008  1.351   1.00 0.00 ? 10  TYR A C    4  
ATOM   3589  O  O    . TYR A 1 10 ? -20.721 -8.301  2.044   1.00 0.00 ? 10  TYR A O    4  
ATOM   3590  C  CB   . TYR A 1 10 ? -22.823 -10.239 1.257   1.00 0.00 ? 10  TYR A CB   4  
ATOM   3591  C  CG   . TYR A 1 10 ? -22.851 -10.610 -0.209  1.00 0.00 ? 10  TYR A CG   4  
ATOM   3592  C  CD1  . TYR A 1 10 ? -22.597 -9.661  -1.191  1.00 0.00 ? 10  TYR A CD1  4  
ATOM   3593  C  CD2  . TYR A 1 10 ? -23.132 -11.910 -0.611  1.00 0.00 ? 10  TYR A CD2  4  
ATOM   3594  C  CE1  . TYR A 1 10 ? -22.622 -9.995  -2.531  1.00 0.00 ? 10  TYR A CE1  4  
ATOM   3595  C  CE2  . TYR A 1 10 ? -23.158 -12.254 -1.949  1.00 0.00 ? 10  TYR A CE2  4  
ATOM   3596  C  CZ   . TYR A 1 10 ? -22.904 -11.293 -2.905  1.00 0.00 ? 10  TYR A CZ   4  
ATOM   3597  O  OH   . TYR A 1 10 ? -22.929 -11.631 -4.239  1.00 0.00 ? 10  TYR A OH   4  
ATOM   3598  H  H    . TYR A 1 10 ? -24.356 -8.760  -0.128  1.00 0.00 ? 10  TYR A H    4  
ATOM   3599  H  HA   . TYR A 1 10 ? -23.374 -8.607  2.526   1.00 0.00 ? 10  TYR A HA   4  
ATOM   3600  H  HB2  . TYR A 1 10 ? -21.867 -10.542 1.656   1.00 0.00 ? 10  TYR A HB2  4  
ATOM   3601  H  HB3  . TYR A 1 10 ? -23.607 -10.790 1.754   1.00 0.00 ? 10  TYR A HB3  4  
ATOM   3602  H  HD1  . TYR A 1 10 ? -22.376 -8.645  -0.895  1.00 0.00 ? 10  TYR A HD1  4  
ATOM   3603  H  HD2  . TYR A 1 10 ? -23.331 -12.660 0.140   1.00 0.00 ? 10  TYR A HD2  4  
ATOM   3604  H  HE1  . TYR A 1 10 ? -22.422 -9.243  -3.280  1.00 0.00 ? 10  TYR A HE1  4  
ATOM   3605  H  HE2  . TYR A 1 10 ? -23.379 -13.270 -2.242  1.00 0.00 ? 10  TYR A HE2  4  
ATOM   3606  H  HH   . TYR A 1 10 ? -23.756 -12.075 -4.441  1.00 0.00 ? 10  TYR A HH   4  
ATOM   3607  N  N    . GLN A 1 11 ? -21.667 -7.050  0.429   1.00 0.00 ? 11  GLN A N    4  
ATOM   3608  C  CA   . GLN A 1 11 ? -20.461 -6.271  0.174   1.00 0.00 ? 11  GLN A CA   4  
ATOM   3609  C  C    . GLN A 1 11 ? -20.537 -4.911  0.859   1.00 0.00 ? 11  GLN A C    4  
ATOM   3610  O  O    . GLN A 1 11 ? -19.513 -4.318  1.199   1.00 0.00 ? 11  GLN A O    4  
ATOM   3611  C  CB   . GLN A 1 11 ? -20.256 -6.088  -1.331  1.00 0.00 ? 11  GLN A CB   4  
ATOM   3612  C  CG   . GLN A 1 11 ? -20.080 -7.395  -2.085  1.00 0.00 ? 11  GLN A CG   4  
ATOM   3613  C  CD   . GLN A 1 11 ? -19.219 -7.243  -3.324  1.00 0.00 ? 11  GLN A CD   4  
ATOM   3614  O  OE1  . GLN A 1 11 ? -19.716 -6.919  -4.403  1.00 0.00 ? 11  GLN A OE1  4  
ATOM   3615  N  NE2  . GLN A 1 11 ? -17.920 -7.477  -3.175  1.00 0.00 ? 11  GLN A NE2  4  
ATOM   3616  H  H    . GLN A 1 11 ? -22.476 -6.864  -0.091  1.00 0.00 ? 11  GLN A H    4  
ATOM   3617  H  HA   . GLN A 1 11 ? -19.622 -6.818  0.578   1.00 0.00 ? 11  GLN A HA   4  
ATOM   3618  H  HB2  . GLN A 1 11 ? -21.114 -5.574  -1.739  1.00 0.00 ? 11  GLN A HB2  4  
ATOM   3619  H  HB3  . GLN A 1 11 ? -19.375 -5.483  -1.491  1.00 0.00 ? 11  GLN A HB3  4  
ATOM   3620  H  HG2  . GLN A 1 11 ? -19.614 -8.115  -1.428  1.00 0.00 ? 11  GLN A HG2  4  
ATOM   3621  H  HG3  . GLN A 1 11 ? -21.053 -7.758  -2.382  1.00 0.00 ? 11  GLN A HG3  4  
ATOM   3622  H  HE21 . GLN A 1 11 ? -17.596 -7.732  -2.285  1.00 0.00 ? 11  GLN A HE21 4  
ATOM   3623  H  HE22 . GLN A 1 11 ? -17.341 -7.387  -3.959  1.00 0.00 ? 11  GLN A HE22 4  
ATOM   3624  N  N    . ARG A 1 12 ? -21.756 -4.421  1.058   1.00 0.00 ? 12  ARG A N    4  
ATOM   3625  C  CA   . ARG A 1 12 ? -21.965 -3.129  1.701   1.00 0.00 ? 12  ARG A CA   4  
ATOM   3626  C  C    . ARG A 1 12 ? -21.019 -2.952  2.885   1.00 0.00 ? 12  ARG A C    4  
ATOM   3627  O  O    . ARG A 1 12 ? -20.555 -1.845  3.162   1.00 0.00 ? 12  ARG A O    4  
ATOM   3628  C  CB   . ARG A 1 12 ? -23.415 -2.998  2.169   1.00 0.00 ? 12  ARG A CB   4  
ATOM   3629  C  CG   . ARG A 1 12 ? -23.893 -1.558  2.274   1.00 0.00 ? 12  ARG A CG   4  
ATOM   3630  C  CD   . ARG A 1 12 ? -23.345 -0.879  3.519   1.00 0.00 ? 12  ARG A CD   4  
ATOM   3631  N  NE   . ARG A 1 12 ? -24.256 0.142   4.031   1.00 0.00 ? 12  ARG A NE   4  
ATOM   3632  C  CZ   . ARG A 1 12 ? -23.898 1.072   4.910   1.00 0.00 ? 12  ARG A CZ   4  
ATOM   3633  N  NH1  . ARG A 1 12 ? -22.656 1.109   5.372   1.00 0.00 ? 12  ARG A NH1  4  
ATOM   3634  N  NH2  . ARG A 1 12 ? -24.784 1.966   5.329   1.00 0.00 ? 12  ARG A NH2  4  
ATOM   3635  H  H    . ARG A 1 12 ? -22.534 -4.940  0.765   1.00 0.00 ? 12  ARG A H    4  
ATOM   3636  H  HA   . ARG A 1 12 ? -21.760 -2.359  0.973   1.00 0.00 ? 12  ARG A HA   4  
ATOM   3637  H  HB2  . ARG A 1 12 ? -24.056 -3.516  1.471   1.00 0.00 ? 12  ARG A HB2  4  
ATOM   3638  H  HB3  . ARG A 1 12 ? -23.510 -3.457  3.142   1.00 0.00 ? 12  ARG A HB3  4  
ATOM   3639  H  HG2  . ARG A 1 12 ? -23.559 -1.014  1.404   1.00 0.00 ? 12  ARG A HG2  4  
ATOM   3640  H  HG3  . ARG A 1 12 ? -24.972 -1.549  2.315   1.00 0.00 ? 12  ARG A HG3  4  
ATOM   3641  H  HD2  . ARG A 1 12 ? -23.192 -1.626  4.283   1.00 0.00 ? 12  ARG A HD2  4  
ATOM   3642  H  HD3  . ARG A 1 12 ? -22.401 -0.416  3.274   1.00 0.00 ? 12  ARG A HD3  4  
ATOM   3643  H  HE   . ARG A 1 12 ? -25.179 0.133   3.703   1.00 0.00 ? 12  ARG A HE   4  
ATOM   3644  H  HH11 . ARG A 1 12 ? -21.986 0.436   5.058   1.00 0.00 ? 12  ARG A HH11 4  
ATOM   3645  H  HH12 . ARG A 1 12 ? -22.389 1.811   6.033   1.00 0.00 ? 12  ARG A HH12 4  
ATOM   3646  H  HH21 . ARG A 1 12 ? -25.721 1.941   4.982   1.00 0.00 ? 12  ARG A HH21 4  
ATOM   3647  H  HH22 . ARG A 1 12 ? -24.514 2.665   5.990   1.00 0.00 ? 12  ARG A HH22 4  
ATOM   3648  N  N    . LEU A 1 13 ? -20.737 -4.049  3.580   1.00 0.00 ? 13  LEU A N    4  
ATOM   3649  C  CA   . LEU A 1 13 ? -19.846 -4.015  4.735   1.00 0.00 ? 13  LEU A CA   4  
ATOM   3650  C  C    . LEU A 1 13 ? -18.671 -3.074  4.489   1.00 0.00 ? 13  LEU A C    4  
ATOM   3651  O  O    . LEU A 1 13 ? -18.317 -2.793  3.343   1.00 0.00 ? 13  LEU A O    4  
ATOM   3652  C  CB   . LEU A 1 13 ? -19.332 -5.421  5.048   1.00 0.00 ? 13  LEU A CB   4  
ATOM   3653  C  CG   . LEU A 1 13 ? -18.860 -6.245  3.850   1.00 0.00 ? 13  LEU A CG   4  
ATOM   3654  C  CD1  . LEU A 1 13 ? -17.469 -5.808  3.416   1.00 0.00 ? 13  LEU A CD1  4  
ATOM   3655  C  CD2  . LEU A 1 13 ? -18.874 -7.730  4.185   1.00 0.00 ? 13  LEU A CD2  4  
ATOM   3656  H  H    . LEU A 1 13 ? -21.137 -4.902  3.311   1.00 0.00 ? 13  LEU A H    4  
ATOM   3657  H  HA   . LEU A 1 13 ? -20.413 -3.651  5.579   1.00 0.00 ? 13  LEU A HA   4  
ATOM   3658  H  HB2  . LEU A 1 13 ? -18.502 -5.325  5.731   1.00 0.00 ? 13  LEU A HB2  4  
ATOM   3659  H  HB3  . LEU A 1 13 ? -20.132 -5.965  5.531   1.00 0.00 ? 13  LEU A HB3  4  
ATOM   3660  H  HG   . LEU A 1 13 ? -19.534 -6.082  3.021   1.00 0.00 ? 13  LEU A HG   4  
ATOM   3661  H  HD11 . LEU A 1 13 ? -16.963 -6.636  2.943   1.00 0.00 ? 13  LEU A HD11 4  
ATOM   3662  H  HD12 . LEU A 1 13 ? -16.906 -5.489  4.281   1.00 0.00 ? 13  LEU A HD12 4  
ATOM   3663  H  HD13 . LEU A 1 13 ? -17.551 -4.988  2.718   1.00 0.00 ? 13  LEU A HD13 4  
ATOM   3664  H  HD21 . LEU A 1 13 ? -19.754 -7.958  4.767   1.00 0.00 ? 13  LEU A HD21 4  
ATOM   3665  H  HD22 . LEU A 1 13 ? -17.991 -7.978  4.756   1.00 0.00 ? 13  LEU A HD22 4  
ATOM   3666  H  HD23 . LEU A 1 13 ? -18.887 -8.305  3.271   1.00 0.00 ? 13  LEU A HD23 4  
ATOM   3667  N  N    . TYR A 1 14 ? -18.069 -2.592  5.570   1.00 0.00 ? 14  TYR A N    4  
ATOM   3668  C  CA   . TYR A 1 14 ? -16.934 -1.683  5.472   1.00 0.00 ? 14  TYR A CA   4  
ATOM   3669  C  C    . TYR A 1 14 ? -16.054 -2.038  4.277   1.00 0.00 ? 14  TYR A C    4  
ATOM   3670  O  O    . TYR A 1 14 ? -15.825 -1.212  3.394   1.00 0.00 ? 14  TYR A O    4  
ATOM   3671  C  CB   . TYR A 1 14 ? -16.107 -1.725  6.759   1.00 0.00 ? 14  TYR A CB   4  
ATOM   3672  C  CG   . TYR A 1 14 ? -15.664 -3.117  7.149   1.00 0.00 ? 14  TYR A CG   4  
ATOM   3673  C  CD1  . TYR A 1 14 ? -16.547 -4.004  7.753   1.00 0.00 ? 14  TYR A CD1  4  
ATOM   3674  C  CD2  . TYR A 1 14 ? -14.364 -3.545  6.913   1.00 0.00 ? 14  TYR A CD2  4  
ATOM   3675  C  CE1  . TYR A 1 14 ? -16.146 -5.277  8.112   1.00 0.00 ? 14  TYR A CE1  4  
ATOM   3676  C  CE2  . TYR A 1 14 ? -13.955 -4.817  7.267   1.00 0.00 ? 14  TYR A CE2  4  
ATOM   3677  C  CZ   . TYR A 1 14 ? -14.850 -5.679  7.866   1.00 0.00 ? 14  TYR A CZ   4  
ATOM   3678  O  OH   . TYR A 1 14 ? -14.446 -6.945  8.222   1.00 0.00 ? 14  TYR A OH   4  
ATOM   3679  H  H    . TYR A 1 14 ? -18.397 -2.853  6.456   1.00 0.00 ? 14  TYR A H    4  
ATOM   3680  H  HA   . TYR A 1 14 ? -17.320 -0.684  5.337   1.00 0.00 ? 14  TYR A HA   4  
ATOM   3681  H  HB2  . TYR A 1 14 ? -15.223 -1.120  6.630   1.00 0.00 ? 14  TYR A HB2  4  
ATOM   3682  H  HB3  . TYR A 1 14 ? -16.697 -1.325  7.570   1.00 0.00 ? 14  TYR A HB3  4  
ATOM   3683  H  HD1  . TYR A 1 14 ? -17.562 -3.687  7.944   1.00 0.00 ? 14  TYR A HD1  4  
ATOM   3684  H  HD2  . TYR A 1 14 ? -13.665 -2.867  6.444   1.00 0.00 ? 14  TYR A HD2  4  
ATOM   3685  H  HE1  . TYR A 1 14 ? -16.847 -5.953  8.581   1.00 0.00 ? 14  TYR A HE1  4  
ATOM   3686  H  HE2  . TYR A 1 14 ? -12.940 -5.131  7.076   1.00 0.00 ? 14  TYR A HE2  4  
ATOM   3687  H  HH   . TYR A 1 14 ? -14.735 -7.133  9.118   1.00 0.00 ? 14  TYR A HH   4  
ATOM   3688  N  N    . GLY A 1 15 ? -15.564 -3.273  4.258   1.00 0.00 ? 15  GLY A N    4  
ATOM   3689  C  CA   . GLY A 1 15 ? -14.715 -3.717  3.167   1.00 0.00 ? 15  GLY A CA   4  
ATOM   3690  C  C    . GLY A 1 15 ? -13.456 -2.883  3.036   1.00 0.00 ? 15  GLY A C    4  
ATOM   3691  O  O    . GLY A 1 15 ? -13.523 -1.665  2.869   1.00 0.00 ? 15  GLY A O    4  
ATOM   3692  H  H    . GLY A 1 15 ? -15.780 -3.889  4.989   1.00 0.00 ? 15  GLY A H    4  
ATOM   3693  H  HA2  . GLY A 1 15 ? -14.436 -4.746  3.339   1.00 0.00 ? 15  GLY A HA2  4  
ATOM   3694  H  HA3  . GLY A 1 15 ? -15.272 -3.655  2.244   1.00 0.00 ? 15  GLY A HA3  4  
ATOM   3695  N  N    . THR A 1 16 ? -12.302 -3.539  3.113   1.00 0.00 ? 16  THR A N    4  
ATOM   3696  C  CA   . THR A 1 16 ? -11.022 -2.850  3.004   1.00 0.00 ? 16  THR A CA   4  
ATOM   3697  C  C    . THR A 1 16 ? -10.541 -2.808  1.559   1.00 0.00 ? 16  THR A C    4  
ATOM   3698  O  O    . THR A 1 16 ? -10.284 -3.847  0.950   1.00 0.00 ? 16  THR A O    4  
ATOM   3699  C  CB   . THR A 1 16 ? -9.945  -3.527  3.873   1.00 0.00 ? 16  THR A CB   4  
ATOM   3700  O  OG1  . THR A 1 16 ? -10.369 -3.563  5.240   1.00 0.00 ? 16  THR A OG1  4  
ATOM   3701  C  CG2  . THR A 1 16 ? -8.621  -2.786  3.766   1.00 0.00 ? 16  THR A CG2  4  
ATOM   3702  H  H    . THR A 1 16 ? -12.314 -4.510  3.247   1.00 0.00 ? 16  THR A H    4  
ATOM   3703  H  HA   . THR A 1 16 ? -11.157 -1.838  3.358   1.00 0.00 ? 16  THR A HA   4  
ATOM   3704  H  HB   . THR A 1 16 ? -9.804  -4.539  3.521   1.00 0.00 ? 16  THR A HB   4  
ATOM   3705  H  HG1  . THR A 1 16 ? -9.736  -3.087  5.784   1.00 0.00 ? 16  THR A HG1  4  
ATOM   3706  H  HG21 . THR A 1 16 ? -8.016  -3.003  4.634   1.00 0.00 ? 16  THR A HG21 4  
ATOM   3707  H  HG22 . THR A 1 16 ? -8.806  -1.724  3.713   1.00 0.00 ? 16  THR A HG22 4  
ATOM   3708  H  HG23 . THR A 1 16 ? -8.100  -3.106  2.876   1.00 0.00 ? 16  THR A HG23 4  
ATOM   3709  N  N    . ARG A 1 17 ? -10.422 -1.602  1.014   1.00 0.00 ? 17  ARG A N    4  
ATOM   3710  C  CA   . ARG A 1 17 ? -9.972  -1.425  -0.361  1.00 0.00 ? 17  ARG A CA   4  
ATOM   3711  C  C    . ARG A 1 17 ? -8.635  -0.692  -0.406  1.00 0.00 ? 17  ARG A C    4  
ATOM   3712  O  O    . ARG A 1 17 ? -8.509  0.424   0.101   1.00 0.00 ? 17  ARG A O    4  
ATOM   3713  C  CB   . ARG A 1 17 ? -11.017 -0.652  -1.167  1.00 0.00 ? 17  ARG A CB   4  
ATOM   3714  C  CG   . ARG A 1 17 ? -10.968 -0.935  -2.659  1.00 0.00 ? 17  ARG A CG   4  
ATOM   3715  C  CD   . ARG A 1 17 ? -11.553 0.215   -3.464  1.00 0.00 ? 17  ARG A CD   4  
ATOM   3716  N  NE   . ARG A 1 17 ? -13.001 0.317   -3.299  1.00 0.00 ? 17  ARG A NE   4  
ATOM   3717  C  CZ   . ARG A 1 17 ? -13.677 1.453   -3.433  1.00 0.00 ? 17  ARG A CZ   4  
ATOM   3718  N  NH1  . ARG A 1 17 ? -13.040 2.576   -3.733  1.00 0.00 ? 17  ARG A NH1  4  
ATOM   3719  N  NH2  . ARG A 1 17 ? -14.993 1.466   -3.267  1.00 0.00 ? 17  ARG A NH2  4  
ATOM   3720  H  H    . ARG A 1 17 ? -10.643 -0.811  1.550   1.00 0.00 ? 17  ARG A H    4  
ATOM   3721  H  HA   . ARG A 1 17 ? -9.847  -2.405  -0.798  1.00 0.00 ? 17  ARG A HA   4  
ATOM   3722  H  HB2  . ARG A 1 17 ? -12.001 -0.915  -0.806  1.00 0.00 ? 17  ARG A HB2  4  
ATOM   3723  H  HB3  . ARG A 1 17 ? -10.859 0.406   -1.018  1.00 0.00 ? 17  ARG A HB3  4  
ATOM   3724  H  HG2  . ARG A 1 17 ? -9.939  -1.079  -2.955  1.00 0.00 ? 17  ARG A HG2  4  
ATOM   3725  H  HG3  . ARG A 1 17 ? -11.533 -1.832  -2.865  1.00 0.00 ? 17  ARG A HG3  4  
ATOM   3726  H  HD2  . ARG A 1 17 ? -11.097 1.136   -3.135  1.00 0.00 ? 17  ARG A HD2  4  
ATOM   3727  H  HD3  . ARG A 1 17 ? -11.330 0.056   -4.509  1.00 0.00 ? 17  ARG A HD3  4  
ATOM   3728  H  HE   . ARG A 1 17 ? -13.491 -0.501  -3.077  1.00 0.00 ? 17  ARG A HE   4  
ATOM   3729  H  HH11 . ARG A 1 17 ? -12.048 2.569   -3.860  1.00 0.00 ? 17  ARG A HH11 4  
ATOM   3730  H  HH12 . ARG A 1 17 ? -13.552 3.430   -3.835  1.00 0.00 ? 17  ARG A HH12 4  
ATOM   3731  H  HH21 . ARG A 1 17 ? -15.477 0.621   -3.041  1.00 0.00 ? 17  ARG A HH21 4  
ATOM   3732  H  HH22 . ARG A 1 17 ? -15.501 2.321   -3.368  1.00 0.00 ? 17  ARG A HH22 4  
ATOM   3733  N  N    . CYS A 1 18 ? -7.638  -1.325  -1.015  1.00 0.00 ? 18  CYS A N    4  
ATOM   3734  C  CA   . CYS A 1 18 ? -6.310  -0.735  -1.125  1.00 0.00 ? 18  CYS A CA   4  
ATOM   3735  C  C    . CYS A 1 18 ? -6.393  0.696   -1.649  1.00 0.00 ? 18  CYS A C    4  
ATOM   3736  O  O    . CYS A 1 18 ? -7.032  0.960   -2.668  1.00 0.00 ? 18  CYS A O    4  
ATOM   3737  C  CB   . CYS A 1 18 ? -5.429  -1.578  -2.050  1.00 0.00 ? 18  CYS A CB   4  
ATOM   3738  S  SG   . CYS A 1 18 ? -3.716  -0.976  -2.197  1.00 0.00 ? 18  CYS A SG   4  
ATOM   3739  H  H    . CYS A 1 18 ? -7.800  -2.213  -1.399  1.00 0.00 ? 18  CYS A H    4  
ATOM   3740  H  HA   . CYS A 1 18 ? -5.871  -0.719  -0.139  1.00 0.00 ? 18  CYS A HA   4  
ATOM   3741  H  HB2  . CYS A 1 18 ? -5.390  -2.590  -1.672  1.00 0.00 ? 18  CYS A HB2  4  
ATOM   3742  H  HB3  . CYS A 1 18 ? -5.862  -1.585  -3.039  1.00 0.00 ? 18  CYS A HB3  4  
ATOM   3743  N  N    . PHE A 1 19 ? -5.742  1.616   -0.945  1.00 0.00 ? 19  PHE A N    4  
ATOM   3744  C  CA   . PHE A 1 19 ? -5.742  3.021   -1.338  1.00 0.00 ? 19  PHE A CA   4  
ATOM   3745  C  C    . PHE A 1 19 ? -4.682  3.287   -2.403  1.00 0.00 ? 19  PHE A C    4  
ATOM   3746  O  O    . PHE A 1 19 ? -4.328  4.436   -2.668  1.00 0.00 ? 19  PHE A O    4  
ATOM   3747  C  CB   . PHE A 1 19 ? -5.493  3.913   -0.120  1.00 0.00 ? 19  PHE A CB   4  
ATOM   3748  C  CG   . PHE A 1 19 ? -6.751  4.316   0.594   1.00 0.00 ? 19  PHE A CG   4  
ATOM   3749  C  CD1  . PHE A 1 19 ? -7.426  5.473   0.238   1.00 0.00 ? 19  PHE A CD1  4  
ATOM   3750  C  CD2  . PHE A 1 19 ? -7.259  3.539   1.623   1.00 0.00 ? 19  PHE A CD2  4  
ATOM   3751  C  CE1  . PHE A 1 19 ? -8.584  5.846   0.893   1.00 0.00 ? 19  PHE A CE1  4  
ATOM   3752  C  CE2  . PHE A 1 19 ? -8.417  3.907   2.281   1.00 0.00 ? 19  PHE A CE2  4  
ATOM   3753  C  CZ   . PHE A 1 19 ? -9.080  5.063   1.917   1.00 0.00 ? 19  PHE A CZ   4  
ATOM   3754  H  H    . PHE A 1 19 ? -5.250  1.344   -0.142  1.00 0.00 ? 19  PHE A H    4  
ATOM   3755  H  HA   . PHE A 1 19 ? -6.713  3.249   -1.749  1.00 0.00 ? 19  PHE A HA   4  
ATOM   3756  H  HB2  . PHE A 1 19 ? -4.868  3.384   0.583   1.00 0.00 ? 19  PHE A HB2  4  
ATOM   3757  H  HB3  . PHE A 1 19 ? -4.988  4.812   -0.439  1.00 0.00 ? 19  PHE A HB3  4  
ATOM   3758  H  HD1  . PHE A 1 19 ? -7.039  6.087   -0.563  1.00 0.00 ? 19  PHE A HD1  4  
ATOM   3759  H  HD2  . PHE A 1 19 ? -6.742  2.635   1.910   1.00 0.00 ? 19  PHE A HD2  4  
ATOM   3760  H  HE1  . PHE A 1 19 ? -9.100  6.751   0.605   1.00 0.00 ? 19  PHE A HE1  4  
ATOM   3761  H  HE2  . PHE A 1 19 ? -8.803  3.293   3.081   1.00 0.00 ? 19  PHE A HE2  4  
ATOM   3762  H  HZ   . PHE A 1 19 ? -9.985  5.353   2.429   1.00 0.00 ? 19  PHE A HZ   4  
ATOM   3763  N  N    . SER A 1 20 ? -4.179  2.217   -3.010  1.00 0.00 ? 20  SER A N    4  
ATOM   3764  C  CA   . SER A 1 20 ? -3.156  2.334   -4.043  1.00 0.00 ? 20  SER A CA   4  
ATOM   3765  C  C    . SER A 1 20 ? -3.721  1.963   -5.411  1.00 0.00 ? 20  SER A C    4  
ATOM   3766  O  O    . SER A 1 20 ? -3.883  2.818   -6.281  1.00 0.00 ? 20  SER A O    4  
ATOM   3767  C  CB   . SER A 1 20 ? -1.961  1.438   -3.711  1.00 0.00 ? 20  SER A CB   4  
ATOM   3768  O  OG   . SER A 1 20 ? -0.822  1.807   -4.469  1.00 0.00 ? 20  SER A OG   4  
ATOM   3769  H  H    . SER A 1 20 ? -4.502  1.328   -2.755  1.00 0.00 ? 20  SER A H    4  
ATOM   3770  H  HA   . SER A 1 20 ? -2.828  3.363   -4.069  1.00 0.00 ? 20  SER A HA   4  
ATOM   3771  H  HB2  . SER A 1 20 ? -1.726  1.530   -2.662  1.00 0.00 ? 20  SER A HB2  4  
ATOM   3772  H  HB3  . SER A 1 20 ? -2.212  0.411   -3.935  1.00 0.00 ? 20  SER A HB3  4  
ATOM   3773  H  HG   . SER A 1 20 ? -0.326  1.019   -4.704  1.00 0.00 ? 20  SER A HG   4  
ATOM   3774  N  N    . CYS A 1 21 ? -4.018  0.681   -5.593  1.00 0.00 ? 21  CYS A N    4  
ATOM   3775  C  CA   . CYS A 1 21 ? -4.563  0.193   -6.854  1.00 0.00 ? 21  CYS A CA   4  
ATOM   3776  C  C    . CYS A 1 21 ? -6.087  0.270   -6.852  1.00 0.00 ? 21  CYS A C    4  
ATOM   3777  O  O    . CYS A 1 21 ? -6.734  -0.014  -7.861  1.00 0.00 ? 21  CYS A O    4  
ATOM   3778  C  CB   . CYS A 1 21 ? -4.114  -1.248  -7.105  1.00 0.00 ? 21  CYS A CB   4  
ATOM   3779  S  SG   . CYS A 1 21 ? -4.446  -2.382  -5.718  1.00 0.00 ? 21  CYS A SG   4  
ATOM   3780  H  H    . CYS A 1 21 ? -3.866  0.046   -4.861  1.00 0.00 ? 21  CYS A H    4  
ATOM   3781  H  HA   . CYS A 1 21 ? -4.184  0.822   -7.645  1.00 0.00 ? 21  CYS A HA   4  
ATOM   3782  H  HB2  . CYS A 1 21 ? -4.631  -1.632  -7.972  1.00 0.00 ? 21  CYS A HB2  4  
ATOM   3783  H  HB3  . CYS A 1 21 ? -3.051  -1.258  -7.292  1.00 0.00 ? 21  CYS A HB3  4  
ATOM   3784  N  N    . ASP A 1 22 ? -6.654  0.655   -5.714  1.00 0.00 ? 22  ASP A N    4  
ATOM   3785  C  CA   . ASP A 1 22 ? -8.101  0.771   -5.581  1.00 0.00 ? 22  ASP A CA   4  
ATOM   3786  C  C    . ASP A 1 22 ? -8.771  -0.592  -5.731  1.00 0.00 ? 22  ASP A C    4  
ATOM   3787  O  O    . ASP A 1 22 ? -9.804  -0.716  -6.389  1.00 0.00 ? 22  ASP A O    4  
ATOM   3788  C  CB   . ASP A 1 22 ? -8.655  1.743   -6.625  1.00 0.00 ? 22  ASP A CB   4  
ATOM   3789  C  CG   . ASP A 1 22 ? -7.879  3.044   -6.673  1.00 0.00 ? 22  ASP A CG   4  
ATOM   3790  O  OD1  . ASP A 1 22 ? -7.707  3.673   -5.607  1.00 0.00 ? 22  ASP A OD1  4  
ATOM   3791  O  OD2  . ASP A 1 22 ? -7.442  3.433   -7.776  1.00 0.00 ? 22  ASP A OD2  4  
ATOM   3792  H  H    . ASP A 1 22 ? -6.084  0.868   -4.945  1.00 0.00 ? 22  ASP A H    4  
ATOM   3793  H  HA   . ASP A 1 22 ? -8.314  1.156   -4.596  1.00 0.00 ? 22  ASP A HA   4  
ATOM   3794  H  HB2  . ASP A 1 22 ? -8.606  1.280   -7.600  1.00 0.00 ? 22  ASP A HB2  4  
ATOM   3795  H  HB3  . ASP A 1 22 ? -9.684  1.967   -6.388  1.00 0.00 ? 22  ASP A HB3  4  
ATOM   3796  N  N    . GLN A 1 23 ? -8.176  -1.609  -5.118  1.00 0.00 ? 23  GLN A N    4  
ATOM   3797  C  CA   . GLN A 1 23 ? -8.715  -2.962  -5.185  1.00 0.00 ? 23  GLN A CA   4  
ATOM   3798  C  C    . GLN A 1 23 ? -8.890  -3.548  -3.788  1.00 0.00 ? 23  GLN A C    4  
ATOM   3799  O  O    . GLN A 1 23 ? -8.094  -3.282  -2.887  1.00 0.00 ? 23  GLN A O    4  
ATOM   3800  C  CB   . GLN A 1 23 ? -7.795  -3.859  -6.015  1.00 0.00 ? 23  GLN A CB   4  
ATOM   3801  C  CG   . GLN A 1 23 ? -7.569  -3.354  -7.431  1.00 0.00 ? 23  GLN A CG   4  
ATOM   3802  C  CD   . GLN A 1 23 ? -8.860  -3.215  -8.214  1.00 0.00 ? 23  GLN A CD   4  
ATOM   3803  O  OE1  . GLN A 1 23 ? -9.683  -4.130  -8.245  1.00 0.00 ? 23  GLN A OE1  4  
ATOM   3804  N  NE2  . GLN A 1 23 ? -9.044  -2.065  -8.852  1.00 0.00 ? 23  GLN A NE2  4  
ATOM   3805  H  H    . GLN A 1 23 ? -7.355  -1.446  -4.608  1.00 0.00 ? 23  GLN A H    4  
ATOM   3806  H  HA   . GLN A 1 23 ? -9.680  -2.911  -5.664  1.00 0.00 ? 23  GLN A HA   4  
ATOM   3807  H  HB2  . GLN A 1 23 ? -6.837  -3.926  -5.522  1.00 0.00 ? 23  GLN A HB2  4  
ATOM   3808  H  HB3  . GLN A 1 23 ? -8.231  -4.846  -6.073  1.00 0.00 ? 23  GLN A HB3  4  
ATOM   3809  H  HG2  . GLN A 1 23 ? -7.089  -2.388  -7.383  1.00 0.00 ? 23  GLN A HG2  4  
ATOM   3810  H  HG3  . GLN A 1 23 ? -6.924  -4.050  -7.948  1.00 0.00 ? 23  GLN A HG3  4  
ATOM   3811  H  HE21 . GLN A 1 23 ? -8.344  -1.381  -8.783  1.00 0.00 ? 23  GLN A HE21 4  
ATOM   3812  H  HE22 . GLN A 1 23 ? -9.869  -1.947  -9.366  1.00 0.00 ? 23  GLN A HE22 4  
ATOM   3813  N  N    . PHE A 1 24 ? -9.938  -4.347  -3.614  1.00 0.00 ? 24  PHE A N    4  
ATOM   3814  C  CA   . PHE A 1 24 ? -10.219 -4.970  -2.326  1.00 0.00 ? 24  PHE A CA   4  
ATOM   3815  C  C    . PHE A 1 24 ? -9.065  -5.870  -1.893  1.00 0.00 ? 24  PHE A C    4  
ATOM   3816  O  O    . PHE A 1 24 ? -8.616  -6.729  -2.653  1.00 0.00 ? 24  PHE A O    4  
ATOM   3817  C  CB   . PHE A 1 24 ? -11.514 -5.782  -2.400  1.00 0.00 ? 24  PHE A CB   4  
ATOM   3818  C  CG   . PHE A 1 24 ? -12.755 -4.939  -2.332  1.00 0.00 ? 24  PHE A CG   4  
ATOM   3819  C  CD1  . PHE A 1 24 ? -12.898 -3.827  -3.146  1.00 0.00 ? 24  PHE A CD1  4  
ATOM   3820  C  CD2  . PHE A 1 24 ? -13.779 -5.259  -1.455  1.00 0.00 ? 24  PHE A CD2  4  
ATOM   3821  C  CE1  . PHE A 1 24 ? -14.039 -3.049  -3.085  1.00 0.00 ? 24  PHE A CE1  4  
ATOM   3822  C  CE2  . PHE A 1 24 ? -14.922 -4.485  -1.390  1.00 0.00 ? 24  PHE A CE2  4  
ATOM   3823  C  CZ   . PHE A 1 24 ? -15.053 -3.379  -2.207  1.00 0.00 ? 24  PHE A CZ   4  
ATOM   3824  H  H    . PHE A 1 24 ? -10.537 -4.521  -4.371  1.00 0.00 ? 24  PHE A H    4  
ATOM   3825  H  HA   . PHE A 1 24 ? -10.339 -4.183  -1.597  1.00 0.00 ? 24  PHE A HA   4  
ATOM   3826  H  HB2  . PHE A 1 24 ? -11.535 -6.329  -3.331  1.00 0.00 ? 24  PHE A HB2  4  
ATOM   3827  H  HB3  . PHE A 1 24 ? -11.540 -6.480  -1.577  1.00 0.00 ? 24  PHE A HB3  4  
ATOM   3828  H  HD1  . PHE A 1 24 ? -12.107 -3.568  -3.834  1.00 0.00 ? 24  PHE A HD1  4  
ATOM   3829  H  HD2  . PHE A 1 24 ? -13.678 -6.125  -0.816  1.00 0.00 ? 24  PHE A HD2  4  
ATOM   3830  H  HE1  . PHE A 1 24 ? -14.139 -2.185  -3.725  1.00 0.00 ? 24  PHE A HE1  4  
ATOM   3831  H  HE2  . PHE A 1 24 ? -15.713 -4.746  -0.702  1.00 0.00 ? 24  PHE A HE2  4  
ATOM   3832  H  HZ   . PHE A 1 24 ? -15.945 -2.773  -2.157  1.00 0.00 ? 24  PHE A HZ   4  
ATOM   3833  N  N    . ILE A 1 25 ? -8.590  -5.666  -0.669  1.00 0.00 ? 25  ILE A N    4  
ATOM   3834  C  CA   . ILE A 1 25 ? -7.490  -6.458  -0.135  1.00 0.00 ? 25  ILE A CA   4  
ATOM   3835  C  C    . ILE A 1 25 ? -8.001  -7.732  0.528   1.00 0.00 ? 25  ILE A C    4  
ATOM   3836  O  O    . ILE A 1 25 ? -8.653  -7.682  1.571   1.00 0.00 ? 25  ILE A O    4  
ATOM   3837  C  CB   . ILE A 1 25 ? -6.663  -5.656  0.887   1.00 0.00 ? 25  ILE A CB   4  
ATOM   3838  C  CG1  . ILE A 1 25 ? -6.341  -4.265  0.337   1.00 0.00 ? 25  ILE A CG1  4  
ATOM   3839  C  CG2  . ILE A 1 25 ? -5.384  -6.403  1.236   1.00 0.00 ? 25  ILE A CG2  4  
ATOM   3840  C  CD1  . ILE A 1 25 ? -5.629  -3.373  1.329   1.00 0.00 ? 25  ILE A CD1  4  
ATOM   3841  H  H    . ILE A 1 25 ? -8.990  -4.966  -0.112  1.00 0.00 ? 25  ILE A H    4  
ATOM   3842  H  HA   . ILE A 1 25 ? -6.844  -6.728  -0.959  1.00 0.00 ? 25  ILE A HA   4  
ATOM   3843  H  HB   . ILE A 1 25 ? -7.248  -5.553  1.788   1.00 0.00 ? 25  ILE A HB   4  
ATOM   3844  H  HG12 . ILE A 1 25 ? -5.708  -4.366  -0.531  1.00 0.00 ? 25  ILE A HG12 4  
ATOM   3845  H  HG13 . ILE A 1 25 ? -7.261  -3.778  0.051   1.00 0.00 ? 25  ILE A HG13 4  
ATOM   3846  H  HG21 . ILE A 1 25 ? -5.229  -6.371  2.305   1.00 0.00 ? 25  ILE A HG21 4  
ATOM   3847  H  HG22 . ILE A 1 25 ? -5.469  -7.431  0.916   1.00 0.00 ? 25  ILE A HG22 4  
ATOM   3848  H  HG23 . ILE A 1 25 ? -4.547  -5.938  0.737   1.00 0.00 ? 25  ILE A HG23 4  
ATOM   3849  H  HD11 . ILE A 1 25 ? -4.631  -3.749  1.500   1.00 0.00 ? 25  ILE A HD11 4  
ATOM   3850  H  HD12 . ILE A 1 25 ? -5.574  -2.369  0.936   1.00 0.00 ? 25  ILE A HD12 4  
ATOM   3851  H  HD13 . ILE A 1 25 ? -6.174  -3.365  2.262   1.00 0.00 ? 25  ILE A HD13 4  
ATOM   3852  N  N    . GLU A 1 26 ? -7.698  -8.874  -0.082  1.00 0.00 ? 26  GLU A N    4  
ATOM   3853  C  CA   . GLU A 1 26 ? -8.127  -10.161 0.451   1.00 0.00 ? 26  GLU A CA   4  
ATOM   3854  C  C    . GLU A 1 26 ? -6.960  -10.894 1.107   1.00 0.00 ? 26  GLU A C    4  
ATOM   3855  O  O    . GLU A 1 26 ? -5.803  -10.695 0.740   1.00 0.00 ? 26  GLU A O    4  
ATOM   3856  C  CB   . GLU A 1 26 ? -8.725  -11.025 -0.661  1.00 0.00 ? 26  GLU A CB   4  
ATOM   3857  C  CG   . GLU A 1 26 ? -9.086  -12.431 -0.213  1.00 0.00 ? 26  GLU A CG   4  
ATOM   3858  C  CD   . GLU A 1 26 ? -9.695  -13.261 -1.326  1.00 0.00 ? 26  GLU A CD   4  
ATOM   3859  O  OE1  . GLU A 1 26 ? -8.961  -13.610 -2.274  1.00 0.00 ? 26  GLU A OE1  4  
ATOM   3860  O  OE2  . GLU A 1 26 ? -10.905 -13.561 -1.250  1.00 0.00 ? 26  GLU A OE2  4  
ATOM   3861  H  H    . GLU A 1 26 ? -7.175  -8.849  -0.911  1.00 0.00 ? 26  GLU A H    4  
ATOM   3862  H  HA   . GLU A 1 26 ? -8.885  -9.976  1.197   1.00 0.00 ? 26  GLU A HA   4  
ATOM   3863  H  HB2  . GLU A 1 26 ? -9.620  -10.546 -1.031  1.00 0.00 ? 26  GLU A HB2  4  
ATOM   3864  H  HB3  . GLU A 1 26 ? -8.009  -11.100 -1.467  1.00 0.00 ? 26  GLU A HB3  4  
ATOM   3865  H  HG2  . GLU A 1 26 ? -8.191  -12.925 0.135   1.00 0.00 ? 26  GLU A HG2  4  
ATOM   3866  H  HG3  . GLU A 1 26 ? -9.797  -12.365 0.598   1.00 0.00 ? 26  GLU A HG3  4  
ATOM   3867  N  N    . GLY A 1 27 ? -7.274  -11.743 2.081   1.00 0.00 ? 27  GLY A N    4  
ATOM   3868  C  CA   . GLY A 1 27 ? -6.242  -12.492 2.774   1.00 0.00 ? 27  GLY A CA   4  
ATOM   3869  C  C    . GLY A 1 27 ? -5.657  -11.726 3.944   1.00 0.00 ? 27  GLY A C    4  
ATOM   3870  O  O    . GLY A 1 27 ? -5.810  -12.129 5.096   1.00 0.00 ? 27  GLY A O    4  
ATOM   3871  H  H    . GLY A 1 27 ? -8.215  -11.861 2.332   1.00 0.00 ? 27  GLY A H    4  
ATOM   3872  H  HA2  . GLY A 1 27 ? -6.666  -13.416 3.138   1.00 0.00 ? 27  GLY A HA2  4  
ATOM   3873  H  HA3  . GLY A 1 27 ? -5.450  -12.721 2.076   1.00 0.00 ? 27  GLY A HA3  4  
ATOM   3874  N  N    . GLU A 1 28 ? -4.982  -10.620 3.647   1.00 0.00 ? 28  GLU A N    4  
ATOM   3875  C  CA   . GLU A 1 28 ? -4.369  -9.798  4.684   1.00 0.00 ? 28  GLU A CA   4  
ATOM   3876  C  C    . GLU A 1 28 ? -4.186  -8.361  4.203   1.00 0.00 ? 28  GLU A C    4  
ATOM   3877  O  O    . GLU A 1 28 ? -3.941  -8.117  3.021   1.00 0.00 ? 28  GLU A O    4  
ATOM   3878  C  CB   . GLU A 1 28 ? -3.017  -10.384 5.098   1.00 0.00 ? 28  GLU A CB   4  
ATOM   3879  C  CG   . GLU A 1 28 ? -2.275  -9.540  6.120   1.00 0.00 ? 28  GLU A CG   4  
ATOM   3880  C  CD   . GLU A 1 28 ? -1.313  -10.355 6.962   1.00 0.00 ? 28  GLU A CD   4  
ATOM   3881  O  OE1  . GLU A 1 28 ? -0.749  -11.337 6.437   1.00 0.00 ? 28  GLU A OE1  4  
ATOM   3882  O  OE2  . GLU A 1 28 ? -1.124  -10.009 8.147   1.00 0.00 ? 28  GLU A OE2  4  
ATOM   3883  H  H    . GLU A 1 28 ? -4.894  -10.351 2.709   1.00 0.00 ? 28  GLU A H    4  
ATOM   3884  H  HA   . GLU A 1 28 ? -5.028  -9.797  5.539   1.00 0.00 ? 28  GLU A HA   4  
ATOM   3885  H  HB2  . GLU A 1 28 ? -3.178  -11.365 5.520   1.00 0.00 ? 28  GLU A HB2  4  
ATOM   3886  H  HB3  . GLU A 1 28 ? -2.396  -10.478 4.220   1.00 0.00 ? 28  GLU A HB3  4  
ATOM   3887  H  HG2  . GLU A 1 28 ? -1.715  -8.777  5.599   1.00 0.00 ? 28  GLU A HG2  4  
ATOM   3888  H  HG3  . GLU A 1 28 ? -2.996  -9.072  6.774   1.00 0.00 ? 28  GLU A HG3  4  
ATOM   3889  N  N    . VAL A 1 29 ? -4.309  -7.414  5.127   1.00 0.00 ? 29  VAL A N    4  
ATOM   3890  C  CA   . VAL A 1 29 ? -4.157  -6.001  4.798   1.00 0.00 ? 29  VAL A CA   4  
ATOM   3891  C  C    . VAL A 1 29 ? -3.123  -5.336  5.700   1.00 0.00 ? 29  VAL A C    4  
ATOM   3892  O  O    . VAL A 1 29 ? -3.029  -5.644  6.888   1.00 0.00 ? 29  VAL A O    4  
ATOM   3893  C  CB   . VAL A 1 29 ? -5.494  -5.249  4.927   1.00 0.00 ? 29  VAL A CB   4  
ATOM   3894  C  CG1  . VAL A 1 29 ? -6.192  -5.617  6.227   1.00 0.00 ? 29  VAL A CG1  4  
ATOM   3895  C  CG2  . VAL A 1 29 ? -5.270  -3.747  4.840   1.00 0.00 ? 29  VAL A CG2  4  
ATOM   3896  H  H    . VAL A 1 29 ? -4.505  -7.671  6.052   1.00 0.00 ? 29  VAL A H    4  
ATOM   3897  H  HA   . VAL A 1 29 ? -3.825  -5.931  3.773   1.00 0.00 ? 29  VAL A HA   4  
ATOM   3898  H  HB   . VAL A 1 29 ? -6.131  -5.544  4.106   1.00 0.00 ? 29  VAL A HB   4  
ATOM   3899  H  HG11 . VAL A 1 29 ? -7.238  -5.355  6.161   1.00 0.00 ? 29  VAL A HG11 4  
ATOM   3900  H  HG12 . VAL A 1 29 ? -6.096  -6.680  6.399   1.00 0.00 ? 29  VAL A HG12 4  
ATOM   3901  H  HG13 . VAL A 1 29 ? -5.738  -5.078  7.045   1.00 0.00 ? 29  VAL A HG13 4  
ATOM   3902  H  HG21 . VAL A 1 29 ? -6.059  -3.299  4.254   1.00 0.00 ? 29  VAL A HG21 4  
ATOM   3903  H  HG22 . VAL A 1 29 ? -5.276  -3.323  5.834   1.00 0.00 ? 29  VAL A HG22 4  
ATOM   3904  H  HG23 . VAL A 1 29 ? -4.317  -3.551  4.372   1.00 0.00 ? 29  VAL A HG23 4  
ATOM   3905  N  N    . VAL A 1 30 ? -2.348  -4.420  5.126   1.00 0.00 ? 30  VAL A N    4  
ATOM   3906  C  CA   . VAL A 1 30 ? -1.321  -3.709  5.878   1.00 0.00 ? 30  VAL A CA   4  
ATOM   3907  C  C    . VAL A 1 30 ? -1.765  -2.287  6.205   1.00 0.00 ? 30  VAL A C    4  
ATOM   3908  O  O    . VAL A 1 30 ? -1.616  -1.377  5.390   1.00 0.00 ? 30  VAL A O    4  
ATOM   3909  C  CB   . VAL A 1 30 ? 0.007   -3.654  5.100   1.00 0.00 ? 30  VAL A CB   4  
ATOM   3910  C  CG1  . VAL A 1 30 ? 1.068   -2.919  5.905   1.00 0.00 ? 30  VAL A CG1  4  
ATOM   3911  C  CG2  . VAL A 1 30 ? 0.474   -5.057  4.743   1.00 0.00 ? 30  VAL A CG2  4  
ATOM   3912  H  H    . VAL A 1 30 ? -2.471  -4.218  4.175   1.00 0.00 ? 30  VAL A H    4  
ATOM   3913  H  HA   . VAL A 1 30 ? -1.152  -4.244  6.801   1.00 0.00 ? 30  VAL A HA   4  
ATOM   3914  H  HB   . VAL A 1 30 ? -0.159  -3.108  4.182   1.00 0.00 ? 30  VAL A HB   4  
ATOM   3915  H  HG11 . VAL A 1 30 ? 0.779   -1.884  6.020   1.00 0.00 ? 30  VAL A HG11 4  
ATOM   3916  H  HG12 . VAL A 1 30 ? 1.164   -3.378  6.878   1.00 0.00 ? 30  VAL A HG12 4  
ATOM   3917  H  HG13 . VAL A 1 30 ? 2.014   -2.972  5.387   1.00 0.00 ? 30  VAL A HG13 4  
ATOM   3918  H  HG21 . VAL A 1 30 ? 0.289   -5.719  5.576   1.00 0.00 ? 30  VAL A HG21 4  
ATOM   3919  H  HG22 . VAL A 1 30 ? -0.069  -5.408  3.877   1.00 0.00 ? 30  VAL A HG22 4  
ATOM   3920  H  HG23 . VAL A 1 30 ? 1.530   -5.041  4.523   1.00 0.00 ? 30  VAL A HG23 4  
ATOM   3921  N  N    . SER A 1 31 ? -2.311  -2.104  7.403   1.00 0.00 ? 31  SER A N    4  
ATOM   3922  C  CA   . SER A 1 31 ? -2.780  -0.794  7.837   1.00 0.00 ? 31  SER A CA   4  
ATOM   3923  C  C    . SER A 1 31 ? -1.605  0.133   8.135   1.00 0.00 ? 31  SER A C    4  
ATOM   3924  O  O    . SER A 1 31 ? -0.952  0.011   9.171   1.00 0.00 ? 31  SER A O    4  
ATOM   3925  C  CB   . SER A 1 31 ? -3.663  -0.931  9.079   1.00 0.00 ? 31  SER A CB   4  
ATOM   3926  O  OG   . SER A 1 31 ? -2.930  -1.457  10.171  1.00 0.00 ? 31  SER A OG   4  
ATOM   3927  H  H    . SER A 1 31 ? -2.402  -2.870  8.008   1.00 0.00 ? 31  SER A H    4  
ATOM   3928  H  HA   . SER A 1 31 ? -3.364  -0.368  7.035   1.00 0.00 ? 31  SER A HA   4  
ATOM   3929  H  HB2  . SER A 1 31 ? -4.048  0.040   9.353   1.00 0.00 ? 31  SER A HB2  4  
ATOM   3930  H  HB3  . SER A 1 31 ? -4.487  -1.595  8.860   1.00 0.00 ? 31  SER A HB3  4  
ATOM   3931  H  HG   . SER A 1 31 ? -3.386  -1.253  10.991  1.00 0.00 ? 31  SER A HG   4  
ATOM   3932  N  N    . ALA A 1 32 ? -1.342  1.058   7.218   1.00 0.00 ? 32  ALA A N    4  
ATOM   3933  C  CA   . ALA A 1 32 ? -0.248  2.007   7.382   1.00 0.00 ? 32  ALA A CA   4  
ATOM   3934  C  C    . ALA A 1 32 ? -0.711  3.433   7.100   1.00 0.00 ? 32  ALA A C    4  
ATOM   3935  O  O    . ALA A 1 32 ? -1.491  3.672   6.178   1.00 0.00 ? 32  ALA A O    4  
ATOM   3936  C  CB   . ALA A 1 32 ? 0.912   1.637   6.470   1.00 0.00 ? 32  ALA A CB   4  
ATOM   3937  H  H    . ALA A 1 32 ? -1.899  1.105   6.413   1.00 0.00 ? 32  ALA A H    4  
ATOM   3938  H  HA   . ALA A 1 32 ? 0.096   1.946   8.404   1.00 0.00 ? 32  ALA A HA   4  
ATOM   3939  H  HB1  . ALA A 1 32 ? 0.556   0.993   5.679   1.00 0.00 ? 32  ALA A HB1  4  
ATOM   3940  H  HB2  . ALA A 1 32 ? 1.334   2.534   6.042   1.00 0.00 ? 32  ALA A HB2  4  
ATOM   3941  H  HB3  . ALA A 1 32 ? 1.668   1.120   7.042   1.00 0.00 ? 32  ALA A HB3  4  
ATOM   3942  N  N    . LEU A 1 33 ? -0.226  4.376   7.900   1.00 0.00 ? 33  LEU A N    4  
ATOM   3943  C  CA   . LEU A 1 33 ? -0.590  5.779   7.738   1.00 0.00 ? 33  LEU A CA   4  
ATOM   3944  C  C    . LEU A 1 33 ? -2.105  5.954   7.757   1.00 0.00 ? 33  LEU A C    4  
ATOM   3945  O  O    . LEU A 1 33 ? -2.668  6.668   6.928   1.00 0.00 ? 33  LEU A O    4  
ATOM   3946  C  CB   . LEU A 1 33 ? -0.018  6.326   6.429   1.00 0.00 ? 33  LEU A CB   4  
ATOM   3947  C  CG   . LEU A 1 33 ? 1.485   6.607   6.418   1.00 0.00 ? 33  LEU A CG   4  
ATOM   3948  C  CD1  . LEU A 1 33 ? 1.835   7.675   7.443   1.00 0.00 ? 33  LEU A CD1  4  
ATOM   3949  C  CD2  . LEU A 1 33 ? 2.268   5.331   6.687   1.00 0.00 ? 33  LEU A CD2  4  
ATOM   3950  H  H    . LEU A 1 33 ? 0.392   4.124   8.618   1.00 0.00 ? 33  LEU A H    4  
ATOM   3951  H  HA   . LEU A 1 33 ? -0.166  6.329   8.564   1.00 0.00 ? 33  LEU A HA   4  
ATOM   3952  H  HB2  . LEU A 1 33 ? -0.225  5.607   5.651   1.00 0.00 ? 33  LEU A HB2  4  
ATOM   3953  H  HB3  . LEU A 1 33 ? -0.531  7.252   6.207   1.00 0.00 ? 33  LEU A HB3  4  
ATOM   3954  H  HG   . LEU A 1 33 ? 1.769   6.976   5.442   1.00 0.00 ? 33  LEU A HG   4  
ATOM   3955  H  HD11 . LEU A 1 33 ? 0.929   8.136   7.806   1.00 0.00 ? 33  LEU A HD11 4  
ATOM   3956  H  HD12 . LEU A 1 33 ? 2.460   8.425   6.981   1.00 0.00 ? 33  LEU A HD12 4  
ATOM   3957  H  HD13 . LEU A 1 33 ? 2.366   7.223   8.267   1.00 0.00 ? 33  LEU A HD13 4  
ATOM   3958  H  HD21 . LEU A 1 33 ? 1.945   4.901   7.624   1.00 0.00 ? 33  LEU A HD21 4  
ATOM   3959  H  HD22 . LEU A 1 33 ? 3.322   5.560   6.741   1.00 0.00 ? 33  LEU A HD22 4  
ATOM   3960  H  HD23 . LEU A 1 33 ? 2.092   4.626   5.888   1.00 0.00 ? 33  LEU A HD23 4  
ATOM   3961  N  N    . GLY A 1 34 ? -2.760  5.297   8.710   1.00 0.00 ? 34  GLY A N    4  
ATOM   3962  C  CA   . GLY A 1 34 ? -4.204  5.395   8.820   1.00 0.00 ? 34  GLY A CA   4  
ATOM   3963  C  C    . GLY A 1 34 ? -4.907  5.082   7.515   1.00 0.00 ? 34  GLY A C    4  
ATOM   3964  O  O    . GLY A 1 34 ? -5.876  5.748   7.148   1.00 0.00 ? 34  GLY A O    4  
ATOM   3965  H  H    . GLY A 1 34 ? -2.258  4.742   9.343   1.00 0.00 ? 34  GLY A H    4  
ATOM   3966  H  HA2  . GLY A 1 34 ? -4.544  4.702   9.576   1.00 0.00 ? 34  GLY A HA2  4  
ATOM   3967  H  HA3  . GLY A 1 34 ? -4.463  6.399   9.124   1.00 0.00 ? 34  GLY A HA3  4  
ATOM   3968  N  N    . LYS A 1 35 ? -4.419  4.067   6.810   1.00 0.00 ? 35  LYS A N    4  
ATOM   3969  C  CA   . LYS A 1 35 ? -5.007  3.667   5.537   1.00 0.00 ? 35  LYS A CA   4  
ATOM   3970  C  C    . LYS A 1 35 ? -4.770  2.184   5.271   1.00 0.00 ? 35  LYS A C    4  
ATOM   3971  O  O    . LYS A 1 35 ? -4.085  1.506   6.038   1.00 0.00 ? 35  LYS A O    4  
ATOM   3972  C  CB   . LYS A 1 35 ? -4.420  4.501   4.396   1.00 0.00 ? 35  LYS A CB   4  
ATOM   3973  C  CG   . LYS A 1 35 ? -5.183  5.786   4.127   1.00 0.00 ? 35  LYS A CG   4  
ATOM   3974  C  CD   . LYS A 1 35 ? -4.678  6.482   2.874   1.00 0.00 ? 35  LYS A CD   4  
ATOM   3975  C  CE   . LYS A 1 35 ? -5.631  7.578   2.423   1.00 0.00 ? 35  LYS A CE   4  
ATOM   3976  N  NZ   . LYS A 1 35 ? -5.333  8.037   1.038   1.00 0.00 ? 35  LYS A NZ   4  
ATOM   3977  H  H    . LYS A 1 35 ? -3.645  3.574   7.155   1.00 0.00 ? 35  LYS A H    4  
ATOM   3978  H  HA   . LYS A 1 35 ? -6.070  3.845   5.591   1.00 0.00 ? 35  LYS A HA   4  
ATOM   3979  H  HB2  . LYS A 1 35 ? -3.400  4.757   4.641   1.00 0.00 ? 35  LYS A HB2  4  
ATOM   3980  H  HB3  . LYS A 1 35 ? -4.425  3.907   3.493   1.00 0.00 ? 35  LYS A HB3  4  
ATOM   3981  H  HG2  . LYS A 1 35 ? -6.229  5.553   3.998   1.00 0.00 ? 35  LYS A HG2  4  
ATOM   3982  H  HG3  . LYS A 1 35 ? -5.061  6.450   4.971   1.00 0.00 ? 35  LYS A HG3  4  
ATOM   3983  H  HD2  . LYS A 1 35 ? -3.714  6.923   3.081   1.00 0.00 ? 35  LYS A HD2  4  
ATOM   3984  H  HD3  . LYS A 1 35 ? -4.580  5.753   2.082   1.00 0.00 ? 35  LYS A HD3  4  
ATOM   3985  H  HE2  . LYS A 1 35 ? -6.640  7.196   2.457   1.00 0.00 ? 35  LYS A HE2  4  
ATOM   3986  H  HE3  . LYS A 1 35 ? -5.541  8.416   3.098   1.00 0.00 ? 35  LYS A HE3  4  
ATOM   3987  H  HZ1  . LYS A 1 35 ? -4.437  8.565   1.022   1.00 0.00 ? 35  LYS A HZ1  4  
ATOM   3988  H  HZ2  . LYS A 1 35 ? -6.094  8.658   0.695   1.00 0.00 ? 35  LYS A HZ2  4  
ATOM   3989  H  HZ3  . LYS A 1 35 ? -5.253  7.220   0.400   1.00 0.00 ? 35  LYS A HZ3  4  
ATOM   3990  N  N    . THR A 1 36 ? -5.339  1.684   4.178   1.00 0.00 ? 36  THR A N    4  
ATOM   3991  C  CA   . THR A 1 36 ? -5.190  0.282   3.811   1.00 0.00 ? 36  THR A CA   4  
ATOM   3992  C  C    . THR A 1 36 ? -4.427  0.136   2.499   1.00 0.00 ? 36  THR A C    4  
ATOM   3993  O  O    . THR A 1 36 ? -4.784  0.745   1.491   1.00 0.00 ? 36  THR A O    4  
ATOM   3994  C  CB   . THR A 1 36 ? -6.558  -0.412  3.676   1.00 0.00 ? 36  THR A CB   4  
ATOM   3995  O  OG1  . THR A 1 36 ? -7.267  0.118   2.551   1.00 0.00 ? 36  THR A OG1  4  
ATOM   3996  C  CG2  . THR A 1 36 ? -7.386  -0.226  4.938   1.00 0.00 ? 36  THR A CG2  4  
ATOM   3997  H  H    . THR A 1 36 ? -5.873  2.275   3.606   1.00 0.00 ? 36  THR A H    4  
ATOM   3998  H  HA   . THR A 1 36 ? -4.635  -0.211  4.596   1.00 0.00 ? 36  THR A HA   4  
ATOM   3999  H  HB   . THR A 1 36 ? -6.394  -1.470  3.523   1.00 0.00 ? 36  THR A HB   4  
ATOM   4000  H  HG1  . THR A 1 36 ? -7.586  0.999   2.759   1.00 0.00 ? 36  THR A HG1  4  
ATOM   4001  H  HG21 . THR A 1 36 ? -6.837  0.382   5.642   1.00 0.00 ? 36  THR A HG21 4  
ATOM   4002  H  HG22 . THR A 1 36 ? -7.593  -1.190  5.379   1.00 0.00 ? 36  THR A HG22 4  
ATOM   4003  H  HG23 . THR A 1 36 ? -8.315  0.264   4.689   1.00 0.00 ? 36  THR A HG23 4  
ATOM   4004  N  N    . TYR A 1 37 ? -3.375  -0.676  2.519   1.00 0.00 ? 37  TYR A N    4  
ATOM   4005  C  CA   . TYR A 1 37 ? -2.561  -0.901  1.331   1.00 0.00 ? 37  TYR A CA   4  
ATOM   4006  C  C    . TYR A 1 37 ? -2.169  -2.371  1.210   1.00 0.00 ? 37  TYR A C    4  
ATOM   4007  O  O    . TYR A 1 37 ? -2.064  -3.082  2.209   1.00 0.00 ? 37  TYR A O    4  
ATOM   4008  C  CB   . TYR A 1 37 ? -1.305  -0.029  1.375   1.00 0.00 ? 37  TYR A CB   4  
ATOM   4009  C  CG   . TYR A 1 37 ? -1.596  1.454   1.327   1.00 0.00 ? 37  TYR A CG   4  
ATOM   4010  C  CD1  . TYR A 1 37 ? -2.169  2.033   0.202   1.00 0.00 ? 37  TYR A CD1  4  
ATOM   4011  C  CD2  . TYR A 1 37 ? -1.296  2.276   2.407   1.00 0.00 ? 37  TYR A CD2  4  
ATOM   4012  C  CE1  . TYR A 1 37 ? -2.436  3.388   0.153   1.00 0.00 ? 37  TYR A CE1  4  
ATOM   4013  C  CE2  . TYR A 1 37 ? -1.561  3.631   2.367   1.00 0.00 ? 37  TYR A CE2  4  
ATOM   4014  C  CZ   . TYR A 1 37 ? -2.131  4.183   1.239   1.00 0.00 ? 37  TYR A CZ   4  
ATOM   4015  O  OH   . TYR A 1 37 ? -2.395  5.532   1.195   1.00 0.00 ? 37  TYR A OH   4  
ATOM   4016  H  H    . TYR A 1 37 ? -3.140  -1.134  3.353   1.00 0.00 ? 37  TYR A H    4  
ATOM   4017  H  HA   . TYR A 1 37 ? -3.149  -0.625  0.468   1.00 0.00 ? 37  TYR A HA   4  
ATOM   4018  H  HB2  . TYR A 1 37 ? -0.766  -0.231  2.288   1.00 0.00 ? 37  TYR A HB2  4  
ATOM   4019  H  HB3  . TYR A 1 37 ? -0.676  -0.271  0.531   1.00 0.00 ? 37  TYR A HB3  4  
ATOM   4020  H  HD1  . TYR A 1 37 ? -2.408  1.408   -0.646  1.00 0.00 ? 37  TYR A HD1  4  
ATOM   4021  H  HD2  . TYR A 1 37 ? -0.849  1.841   3.289   1.00 0.00 ? 37  TYR A HD2  4  
ATOM   4022  H  HE1  . TYR A 1 37 ? -2.883  3.820   -0.730  1.00 0.00 ? 37  TYR A HE1  4  
ATOM   4023  H  HE2  . TYR A 1 37 ? -1.321  4.254   3.217   1.00 0.00 ? 37  TYR A HE2  4  
ATOM   4024  H  HH   . TYR A 1 37 ? -1.908  5.976   1.894   1.00 0.00 ? 37  TYR A HH   4  
ATOM   4025  N  N    . HIS A 1 38 ? -1.952  -2.819  -0.023  1.00 0.00 ? 38  HIS A N    4  
ATOM   4026  C  CA   . HIS A 1 38 ? -1.571  -4.203  -0.277  1.00 0.00 ? 38  HIS A CA   4  
ATOM   4027  C  C    . HIS A 1 38 ? -0.170  -4.487  0.256   1.00 0.00 ? 38  HIS A C    4  
ATOM   4028  O  O    . HIS A 1 38 ? 0.622   -3.578  0.506   1.00 0.00 ? 38  HIS A O    4  
ATOM   4029  C  CB   . HIS A 1 38 ? -1.629  -4.504  -1.775  1.00 0.00 ? 38  HIS A CB   4  
ATOM   4030  C  CG   . HIS A 1 38 ? -2.965  -5.002  -2.234  1.00 0.00 ? 38  HIS A CG   4  
ATOM   4031  N  ND1  . HIS A 1 38 ? -3.673  -4.417  -3.263  1.00 0.00 ? 38  HIS A ND1  4  
ATOM   4032  C  CD2  . HIS A 1 38 ? -3.721  -6.038  -1.800  1.00 0.00 ? 38  HIS A CD2  4  
ATOM   4033  C  CE1  . HIS A 1 38 ? -4.808  -5.070  -3.440  1.00 0.00 ? 38  HIS A CE1  4  
ATOM   4034  N  NE2  . HIS A 1 38 ? -4.861  -6.059  -2.565  1.00 0.00 ? 38  HIS A NE2  4  
ATOM   4035  H  H    . HIS A 1 38 ? -2.052  -2.204  -0.779  1.00 0.00 ? 38  HIS A H    4  
ATOM   4036  H  HA   . HIS A 1 38 ? -2.274  -4.841  0.237   1.00 0.00 ? 38  HIS A HA   4  
ATOM   4037  H  HB2  . HIS A 1 38 ? -1.405  -3.602  -2.326  1.00 0.00 ? 38  HIS A HB2  4  
ATOM   4038  H  HB3  . HIS A 1 38 ? -0.893  -5.258  -2.014  1.00 0.00 ? 38  HIS A HB3  4  
ATOM   4039  H  HD2  . HIS A 1 38 ? -3.474  -6.721  -1.000  1.00 0.00 ? 38  HIS A HD2  4  
ATOM   4040  H  HE1  . HIS A 1 38 ? -5.564  -4.837  -4.175  1.00 0.00 ? 38  HIS A HE1  4  
ATOM   4041  H  HE2  . HIS A 1 38 ? -5.632  -6.645  -2.423  1.00 0.00 ? 38  HIS A HE2  4  
ATOM   4042  N  N    . PRO A 1 39 ? 0.145   -5.778  0.436   1.00 0.00 ? 39  PRO A N    4  
ATOM   4043  C  CA   . PRO A 1 39 ? 1.451   -6.212  0.942   1.00 0.00 ? 39  PRO A CA   4  
ATOM   4044  C  C    . PRO A 1 39 ? 2.570   -5.978  -0.067  1.00 0.00 ? 39  PRO A C    4  
ATOM   4045  O  O    . PRO A 1 39 ? 3.736   -6.266  0.206   1.00 0.00 ? 39  PRO A O    4  
ATOM   4046  C  CB   . PRO A 1 39 ? 1.257   -7.710  1.187   1.00 0.00 ? 39  PRO A CB   4  
ATOM   4047  C  CG   . PRO A 1 39 ? 0.162   -8.107  0.259   1.00 0.00 ? 39  PRO A CG   4  
ATOM   4048  C  CD   . PRO A 1 39 ? -0.749  -6.915  0.159   1.00 0.00 ? 39  PRO A CD   4  
ATOM   4049  H  HA   . PRO A 1 39 ? 1.699   -5.722  1.872   1.00 0.00 ? 39  PRO A HA   4  
ATOM   4050  H  HB2  . PRO A 1 39 ? 2.175   -8.236  0.965   1.00 0.00 ? 39  PRO A HB2  4  
ATOM   4051  H  HB3  . PRO A 1 39 ? 0.981   -7.877  2.217   1.00 0.00 ? 39  PRO A HB3  4  
ATOM   4052  H  HG2  . PRO A 1 39 ? 0.572   -8.349  -0.710  1.00 0.00 ? 39  PRO A HG2  4  
ATOM   4053  H  HG3  . PRO A 1 39 ? -0.373  -8.954  0.664   1.00 0.00 ? 39  PRO A HG3  4  
ATOM   4054  H  HD2  . PRO A 1 39 ? -1.168  -6.843  -0.834  1.00 0.00 ? 39  PRO A HD2  4  
ATOM   4055  H  HD3  . PRO A 1 39 ? -1.534  -6.977  0.898   1.00 0.00 ? 39  PRO A HD3  4  
ATOM   4056  N  N    . ASP A 1 40 ? 2.209   -5.453  -1.233  1.00 0.00 ? 40  ASP A N    4  
ATOM   4057  C  CA   . ASP A 1 40 ? 3.184   -5.179  -2.283  1.00 0.00 ? 40  ASP A CA   4  
ATOM   4058  C  C    . ASP A 1 40 ? 3.084   -3.731  -2.752  1.00 0.00 ? 40  ASP A C    4  
ATOM   4059  O  O    . ASP A 1 40 ? 4.043   -3.172  -3.286  1.00 0.00 ? 40  ASP A O    4  
ATOM   4060  C  CB   . ASP A 1 40 ? 2.973   -6.127  -3.465  1.00 0.00 ? 40  ASP A CB   4  
ATOM   4061  C  CG   . ASP A 1 40 ? 3.324   -7.562  -3.125  1.00 0.00 ? 40  ASP A CG   4  
ATOM   4062  O  OD1  . ASP A 1 40 ? 4.520   -7.914  -3.200  1.00 0.00 ? 40  ASP A OD1  4  
ATOM   4063  O  OD2  . ASP A 1 40 ? 2.403   -8.335  -2.787  1.00 0.00 ? 40  ASP A OD2  4  
ATOM   4064  H  H    . ASP A 1 40 ? 1.264   -5.245  -1.392  1.00 0.00 ? 40  ASP A H    4  
ATOM   4065  H  HA   . ASP A 1 40 ? 4.168   -5.344  -1.873  1.00 0.00 ? 40  ASP A HA   4  
ATOM   4066  H  HB2  . ASP A 1 40 ? 1.936   -6.092  -3.766  1.00 0.00 ? 40  ASP A HB2  4  
ATOM   4067  H  HB3  . ASP A 1 40 ? 3.594   -5.808  -4.289  1.00 0.00 ? 40  ASP A HB3  4  
ATOM   4068  N  N    . CYS A 1 41 ? 1.917   -3.129  -2.551  1.00 0.00 ? 41  CYS A N    4  
ATOM   4069  C  CA   . CYS A 1 41 ? 1.690   -1.746  -2.955  1.00 0.00 ? 41  CYS A CA   4  
ATOM   4070  C  C    . CYS A 1 41 ? 2.365   -0.779  -1.987  1.00 0.00 ? 41  CYS A C    4  
ATOM   4071  O  O    . CYS A 1 41 ? 2.687   0.353   -2.347  1.00 0.00 ? 41  CYS A O    4  
ATOM   4072  C  CB   . CYS A 1 41 ? 0.190   -1.453  -3.023  1.00 0.00 ? 41  CYS A CB   4  
ATOM   4073  S  SG   . CYS A 1 41 ? -0.646  -2.180  -4.469  1.00 0.00 ? 41  CYS A SG   4  
ATOM   4074  H  H    . CYS A 1 41 ? 1.189   -3.626  -2.121  1.00 0.00 ? 41  CYS A H    4  
ATOM   4075  H  HA   . CYS A 1 41 ? 2.119   -1.612  -3.936  1.00 0.00 ? 41  CYS A HA   4  
ATOM   4076  H  HB2  . CYS A 1 41 ? -0.287  -1.847  -2.137  1.00 0.00 ? 41  CYS A HB2  4  
ATOM   4077  H  HB3  . CYS A 1 41 ? 0.041   -0.384  -3.060  1.00 0.00 ? 41  CYS A HB3  4  
ATOM   4078  N  N    . PHE A 1 42 ? 2.576   -1.234  -0.756  1.00 0.00 ? 42  PHE A N    4  
ATOM   4079  C  CA   . PHE A 1 42 ? 3.213   -0.410  0.265   1.00 0.00 ? 42  PHE A CA   4  
ATOM   4080  C  C    . PHE A 1 42 ? 4.732   -0.451  0.128   1.00 0.00 ? 42  PHE A C    4  
ATOM   4081  O  O    . PHE A 1 42 ? 5.456   -0.457  1.124   1.00 0.00 ? 42  PHE A O    4  
ATOM   4082  C  CB   . PHE A 1 42 ? 2.801   -0.882  1.661   1.00 0.00 ? 42  PHE A CB   4  
ATOM   4083  C  CG   . PHE A 1 42 ? 3.145   0.095   2.749   1.00 0.00 ? 42  PHE A CG   4  
ATOM   4084  C  CD1  . PHE A 1 42 ? 2.622   1.379   2.736   1.00 0.00 ? 42  PHE A CD1  4  
ATOM   4085  C  CD2  . PHE A 1 42 ? 3.989   -0.270  3.785   1.00 0.00 ? 42  PHE A CD2  4  
ATOM   4086  C  CE1  . PHE A 1 42 ? 2.937   2.279   3.736   1.00 0.00 ? 42  PHE A CE1  4  
ATOM   4087  C  CE2  . PHE A 1 42 ? 4.307   0.626   4.788   1.00 0.00 ? 42  PHE A CE2  4  
ATOM   4088  C  CZ   . PHE A 1 42 ? 3.779   1.902   4.764   1.00 0.00 ? 42  PHE A CZ   4  
ATOM   4089  H  H    . PHE A 1 42 ? 2.297   -2.146  -0.529  1.00 0.00 ? 42  PHE A H    4  
ATOM   4090  H  HA   . PHE A 1 42 ? 2.878   0.607   0.125   1.00 0.00 ? 42  PHE A HA   4  
ATOM   4091  H  HB2  . PHE A 1 42 ? 1.733   -1.037  1.680   1.00 0.00 ? 42  PHE A HB2  4  
ATOM   4092  H  HB3  . PHE A 1 42 ? 3.301   -1.813  1.879   1.00 0.00 ? 42  PHE A HB3  4  
ATOM   4093  H  HD1  . PHE A 1 42 ? 1.963   1.674   1.934   1.00 0.00 ? 42  PHE A HD1  4  
ATOM   4094  H  HD2  . PHE A 1 42 ? 4.402   -1.269  3.805   1.00 0.00 ? 42  PHE A HD2  4  
ATOM   4095  H  HE1  . PHE A 1 42 ? 2.523   3.277   3.715   1.00 0.00 ? 42  PHE A HE1  4  
ATOM   4096  H  HE2  . PHE A 1 42 ? 4.966   0.328   5.590   1.00 0.00 ? 42  PHE A HE2  4  
ATOM   4097  H  HZ   . PHE A 1 42 ? 4.027   2.605   5.546   1.00 0.00 ? 42  PHE A HZ   4  
ATOM   4098  N  N    . VAL A 1 43 ? 5.208   -0.481  -1.112  1.00 0.00 ? 43  VAL A N    4  
ATOM   4099  C  CA   . VAL A 1 43 ? 6.640   -0.521  -1.381  1.00 0.00 ? 43  VAL A CA   4  
ATOM   4100  C  C    . VAL A 1 43 ? 7.101   0.741   -2.102  1.00 0.00 ? 43  VAL A C    4  
ATOM   4101  O  O    . VAL A 1 43 ? 6.284   1.559   -2.527  1.00 0.00 ? 43  VAL A O    4  
ATOM   4102  C  CB   . VAL A 1 43 ? 7.018   -1.750  -2.229  1.00 0.00 ? 43  VAL A CB   4  
ATOM   4103  C  CG1  . VAL A 1 43 ? 6.521   -3.027  -1.569  1.00 0.00 ? 43  VAL A CG1  4  
ATOM   4104  C  CG2  . VAL A 1 43 ? 6.460   -1.616  -3.638  1.00 0.00 ? 43  VAL A CG2  4  
ATOM   4105  H  H    . VAL A 1 43 ? 4.581   -0.474  -1.865  1.00 0.00 ? 43  VAL A H    4  
ATOM   4106  H  HA   . VAL A 1 43 ? 7.156   -0.592  -0.434  1.00 0.00 ? 43  VAL A HA   4  
ATOM   4107  H  HB   . VAL A 1 43 ? 8.095   -1.800  -2.294  1.00 0.00 ? 43  VAL A HB   4  
ATOM   4108  H  HG11 . VAL A 1 43 ? 7.306   -3.443  -0.954  1.00 0.00 ? 43  VAL A HG11 4  
ATOM   4109  H  HG12 . VAL A 1 43 ? 5.660   -2.805  -0.956  1.00 0.00 ? 43  VAL A HG12 4  
ATOM   4110  H  HG13 . VAL A 1 43 ? 6.246   -3.742  -2.331  1.00 0.00 ? 43  VAL A HG13 4  
ATOM   4111  H  HG21 . VAL A 1 43 ? 7.133   -1.019  -4.235  1.00 0.00 ? 43  VAL A HG21 4  
ATOM   4112  H  HG22 . VAL A 1 43 ? 6.360   -2.597  -4.081  1.00 0.00 ? 43  VAL A HG22 4  
ATOM   4113  H  HG23 . VAL A 1 43 ? 5.493   -1.139  -3.599  1.00 0.00 ? 43  VAL A HG23 4  
ATOM   4114  N  N    . CYS A 1 44 ? 8.414   0.893   -2.237  1.00 0.00 ? 44  CYS A N    4  
ATOM   4115  C  CA   . CYS A 1 44 ? 8.984   2.056   -2.906  1.00 0.00 ? 44  CYS A CA   4  
ATOM   4116  C  C    . CYS A 1 44 ? 8.260   2.337   -4.219  1.00 0.00 ? 44  CYS A C    4  
ATOM   4117  O  O    . CYS A 1 44 ? 7.493   1.508   -4.707  1.00 0.00 ? 44  CYS A O    4  
ATOM   4118  C  CB   . CYS A 1 44 ? 10.475  1.837   -3.170  1.00 0.00 ? 44  CYS A CB   4  
ATOM   4119  S  SG   . CYS A 1 44 ? 11.386  3.357   -3.597  1.00 0.00 ? 44  CYS A SG   4  
ATOM   4120  H  H    . CYS A 1 44 ? 9.015   0.206   -1.877  1.00 0.00 ? 44  CYS A H    4  
ATOM   4121  H  HA   . CYS A 1 44 ? 8.864   2.907   -2.254  1.00 0.00 ? 44  CYS A HA   4  
ATOM   4122  H  HB2  . CYS A 1 44 ? 10.932  1.419   -2.285  1.00 0.00 ? 44  CYS A HB2  4  
ATOM   4123  H  HB3  . CYS A 1 44 ? 10.590  1.143   -3.990  1.00 0.00 ? 44  CYS A HB3  4  
ATOM   4124  N  N    . ALA A 1 45 ? 8.510   3.513   -4.787  1.00 0.00 ? 45  ALA A N    4  
ATOM   4125  C  CA   . ALA A 1 45 ? 7.884   3.903   -6.044  1.00 0.00 ? 45  ALA A CA   4  
ATOM   4126  C  C    . ALA A 1 45 ? 8.871   3.803   -7.202  1.00 0.00 ? 45  ALA A C    4  
ATOM   4127  O  O    . ALA A 1 45 ? 8.482   3.543   -8.341  1.00 0.00 ? 45  ALA A O    4  
ATOM   4128  C  CB   . ALA A 1 45 ? 7.330   5.316   -5.941  1.00 0.00 ? 45  ALA A CB   4  
ATOM   4129  H  H    . ALA A 1 45 ? 9.132   4.131   -4.350  1.00 0.00 ? 45  ALA A H    4  
ATOM   4130  H  HA   . ALA A 1 45 ? 7.058   3.231   -6.228  1.00 0.00 ? 45  ALA A HA   4  
ATOM   4131  H  HB1  . ALA A 1 45 ? 7.737   5.921   -6.738  1.00 0.00 ? 45  ALA A HB1  4  
ATOM   4132  H  HB2  . ALA A 1 45 ? 6.253   5.287   -6.025  1.00 0.00 ? 45  ALA A HB2  4  
ATOM   4133  H  HB3  . ALA A 1 45 ? 7.606   5.742   -4.988  1.00 0.00 ? 45  ALA A HB3  4  
ATOM   4134  N  N    . VAL A 1 46 ? 10.149  4.011   -6.905  1.00 0.00 ? 46  VAL A N    4  
ATOM   4135  C  CA   . VAL A 1 46 ? 11.192  3.944   -7.922  1.00 0.00 ? 46  VAL A CA   4  
ATOM   4136  C  C    . VAL A 1 46 ? 11.653  2.508   -8.142  1.00 0.00 ? 46  VAL A C    4  
ATOM   4137  O  O    . VAL A 1 46 ? 11.446  1.934   -9.212  1.00 0.00 ? 46  VAL A O    4  
ATOM   4138  C  CB   . VAL A 1 46 ? 12.407  4.809   -7.538  1.00 0.00 ? 46  VAL A CB   4  
ATOM   4139  C  CG1  . VAL A 1 46 ? 13.407  4.864   -8.683  1.00 0.00 ? 46  VAL A CG1  4  
ATOM   4140  C  CG2  . VAL A 1 46 ? 11.961  6.208   -7.142  1.00 0.00 ? 46  VAL A CG2  4  
ATOM   4141  H  H    . VAL A 1 46 ? 10.397  4.214   -5.979  1.00 0.00 ? 46  VAL A H    4  
ATOM   4142  H  HA   . VAL A 1 46 ? 10.782  4.326   -8.846  1.00 0.00 ? 46  VAL A HA   4  
ATOM   4143  H  HB   . VAL A 1 46 ? 12.893  4.354   -6.687  1.00 0.00 ? 46  VAL A HB   4  
ATOM   4144  H  HG11 . VAL A 1 46 ? 14.338  4.414   -8.369  1.00 0.00 ? 46  VAL A HG11 4  
ATOM   4145  H  HG12 . VAL A 1 46 ? 13.013  4.324   -9.531  1.00 0.00 ? 46  VAL A HG12 4  
ATOM   4146  H  HG13 . VAL A 1 46 ? 13.580  5.893   -8.960  1.00 0.00 ? 46  VAL A HG13 4  
ATOM   4147  H  HG21 . VAL A 1 46 ? 11.635  6.744   -8.021  1.00 0.00 ? 46  VAL A HG21 4  
ATOM   4148  H  HG22 . VAL A 1 46 ? 11.143  6.140   -6.438  1.00 0.00 ? 46  VAL A HG22 4  
ATOM   4149  H  HG23 . VAL A 1 46 ? 12.786  6.734   -6.684  1.00 0.00 ? 46  VAL A HG23 4  
ATOM   4150  N  N    . CYS A 1 47 ? 12.279  1.931   -7.122  1.00 0.00 ? 47  CYS A N    4  
ATOM   4151  C  CA   . CYS A 1 47 ? 12.771  0.560   -7.202  1.00 0.00 ? 47  CYS A CA   4  
ATOM   4152  C  C    . CYS A 1 47 ? 11.667  -0.435  -6.857  1.00 0.00 ? 47  CYS A C    4  
ATOM   4153  O  O    . CYS A 1 47 ? 11.763  -1.620  -7.175  1.00 0.00 ? 47  CYS A O    4  
ATOM   4154  C  CB   . CYS A 1 47 ? 13.960  0.367   -6.259  1.00 0.00 ? 47  CYS A CB   4  
ATOM   4155  S  SG   . CYS A 1 47 ? 13.548  0.559   -4.495  1.00 0.00 ? 47  CYS A SG   4  
ATOM   4156  H  H    . CYS A 1 47 ? 12.414  2.439   -6.294  1.00 0.00 ? 47  CYS A H    4  
ATOM   4157  H  HA   . CYS A 1 47 ? 13.094  0.383   -8.216  1.00 0.00 ? 47  CYS A HA   4  
ATOM   4158  H  HB2  . CYS A 1 47 ? 14.360  -0.627  -6.395  1.00 0.00 ? 47  CYS A HB2  4  
ATOM   4159  H  HB3  . CYS A 1 47 ? 14.723  1.092   -6.500  1.00 0.00 ? 47  CYS A HB3  4  
ATOM   4160  N  N    . ARG A 1 48 ? 10.618  0.056   -6.204  1.00 0.00 ? 48  ARG A N    4  
ATOM   4161  C  CA   . ARG A 1 48 ? 9.496   -0.789  -5.815  1.00 0.00 ? 48  ARG A CA   4  
ATOM   4162  C  C    . ARG A 1 48 ? 9.960   -1.924  -4.907  1.00 0.00 ? 48  ARG A C    4  
ATOM   4163  O  O    . ARG A 1 48 ? 9.509   -3.063  -5.038  1.00 0.00 ? 48  ARG A O    4  
ATOM   4164  C  CB   . ARG A 1 48 ? 8.808   -1.363  -7.055  1.00 0.00 ? 48  ARG A CB   4  
ATOM   4165  C  CG   . ARG A 1 48 ? 8.286   -0.301  -8.009  1.00 0.00 ? 48  ARG A CG   4  
ATOM   4166  C  CD   . ARG A 1 48 ? 6.848   0.076   -7.689  1.00 0.00 ? 48  ARG A CD   4  
ATOM   4167  N  NE   . ARG A 1 48 ? 5.906   -0.962  -8.100  1.00 0.00 ? 48  ARG A NE   4  
ATOM   4168  C  CZ   . ARG A 1 48 ? 4.623   -0.731  -8.354  1.00 0.00 ? 48  ARG A CZ   4  
ATOM   4169  N  NH1  . ARG A 1 48 ? 4.131   0.495   -8.240  1.00 0.00 ? 48  ARG A NH1  4  
ATOM   4170  N  NH2  . ARG A 1 48 ? 3.828   -1.728  -8.723  1.00 0.00 ? 48  ARG A NH2  4  
ATOM   4171  H  H    . ARG A 1 48 ? 10.599  1.010   -5.979  1.00 0.00 ? 48  ARG A H    4  
ATOM   4172  H  HA   . ARG A 1 48 ? 8.790   -0.177  -5.274  1.00 0.00 ? 48  ARG A HA   4  
ATOM   4173  H  HB2  . ARG A 1 48 ? 9.514   -1.981  -7.591  1.00 0.00 ? 48  ARG A HB2  4  
ATOM   4174  H  HB3  . ARG A 1 48 ? 7.975   -1.974  -6.740  1.00 0.00 ? 48  ARG A HB3  4  
ATOM   4175  H  HG2  . ARG A 1 48 ? 8.904   0.580   -7.925  1.00 0.00 ? 48  ARG A HG2  4  
ATOM   4176  H  HG3  . ARG A 1 48 ? 8.334   -0.682  -9.018  1.00 0.00 ? 48  ARG A HG3  4  
ATOM   4177  H  HD2  . ARG A 1 48 ? 6.758   0.229   -6.624  1.00 0.00 ? 48  ARG A HD2  4  
ATOM   4178  H  HD3  . ARG A 1 48 ? 6.607   0.993   -8.206  1.00 0.00 ? 48  ARG A HD3  4  
ATOM   4179  H  HE   . ARG A 1 48 ? 6.248   -1.876  -8.191  1.00 0.00 ? 48  ARG A HE   4  
ATOM   4180  H  HH11 . ARG A 1 48 ? 4.727   1.248   -7.963  1.00 0.00 ? 48  ARG A HH11 4  
ATOM   4181  H  HH12 . ARG A 1 48 ? 3.164   0.666   -8.432  1.00 0.00 ? 48  ARG A HH12 4  
ATOM   4182  H  HH21 . ARG A 1 48 ? 4.195   -2.654  -8.810  1.00 0.00 ? 48  ARG A HH21 4  
ATOM   4183  H  HH22 . ARG A 1 48 ? 2.863   -1.554  -8.913  1.00 0.00 ? 48  ARG A HH22 4  
ATOM   4184  N  N    . LEU A 1 49 ? 10.863  -1.606  -3.986  1.00 0.00 ? 49  LEU A N    4  
ATOM   4185  C  CA   . LEU A 1 49 ? 11.389  -2.598  -3.055  1.00 0.00 ? 49  LEU A CA   4  
ATOM   4186  C  C    . LEU A 1 49 ? 10.734  -2.461  -1.685  1.00 0.00 ? 49  LEU A C    4  
ATOM   4187  O  O    . LEU A 1 49 ? 10.485  -1.358  -1.196  1.00 0.00 ? 49  LEU A O    4  
ATOM   4188  C  CB   . LEU A 1 49 ? 12.906  -2.451  -2.925  1.00 0.00 ? 49  LEU A CB   4  
ATOM   4189  C  CG   . LEU A 1 49 ? 13.733  -2.951  -4.110  1.00 0.00 ? 49  LEU A CG   4  
ATOM   4190  C  CD1  . LEU A 1 49 ? 15.125  -2.338  -4.086  1.00 0.00 ? 49  LEU A CD1  4  
ATOM   4191  C  CD2  . LEU A 1 49 ? 13.818  -4.471  -4.097  1.00 0.00 ? 49  LEU A CD2  4  
ATOM   4192  H  H    . LEU A 1 49 ? 11.184  -0.682  -3.930  1.00 0.00 ? 49  LEU A H    4  
ATOM   4193  H  HA   . LEU A 1 49 ? 11.163  -3.577  -3.452  1.00 0.00 ? 49  LEU A HA   4  
ATOM   4194  H  HB2  . LEU A 1 49 ? 13.126  -1.403  -2.788  1.00 0.00 ? 49  LEU A HB2  4  
ATOM   4195  H  HB3  . LEU A 1 49 ? 13.217  -3.000  -2.047  1.00 0.00 ? 49  LEU A HB3  4  
ATOM   4196  H  HG   . LEU A 1 49 ? 13.252  -2.650  -5.030  1.00 0.00 ? 49  LEU A HG   4  
ATOM   4197  H  HD11 . LEU A 1 49 ? 15.816  -3.033  -3.635  1.00 0.00 ? 49  LEU A HD11 4  
ATOM   4198  H  HD12 . LEU A 1 49 ? 15.105  -1.425  -3.511  1.00 0.00 ? 49  LEU A HD12 4  
ATOM   4199  H  HD13 . LEU A 1 49 ? 15.439  -2.120  -5.096  1.00 0.00 ? 49  LEU A HD13 4  
ATOM   4200  H  HD21 . LEU A 1 49 ? 13.890  -4.835  -5.111  1.00 0.00 ? 49  LEU A HD21 4  
ATOM   4201  H  HD22 . LEU A 1 49 ? 12.931  -4.877  -3.632  1.00 0.00 ? 49  LEU A HD22 4  
ATOM   4202  H  HD23 . LEU A 1 49 ? 14.690  -4.778  -3.540  1.00 0.00 ? 49  LEU A HD23 4  
ATOM   4203  N  N    . PRO A 1 50 ? 10.449  -3.606  -1.047  1.00 0.00 ? 50  PRO A N    4  
ATOM   4204  C  CA   . PRO A 1 50 ? 9.822   -3.639  0.278   1.00 0.00 ? 50  PRO A CA   4  
ATOM   4205  C  C    . PRO A 1 50 ? 10.758  -3.146  1.375   1.00 0.00 ? 50  PRO A C    4  
ATOM   4206  O  O    . PRO A 1 50 ? 11.884  -3.628  1.508   1.00 0.00 ? 50  PRO A O    4  
ATOM   4207  C  CB   . PRO A 1 50 ? 9.496   -5.121  0.479   1.00 0.00 ? 50  PRO A CB   4  
ATOM   4208  C  CG   . PRO A 1 50 ? 10.475  -5.844  -0.380  1.00 0.00 ? 50  PRO A CG   4  
ATOM   4209  C  CD   . PRO A 1 50 ? 10.718  -4.956  -1.569  1.00 0.00 ? 50  PRO A CD   4  
ATOM   4210  H  HA   . PRO A 1 50 ? 8.909   -3.062  0.299   1.00 0.00 ? 50  PRO A HA   4  
ATOM   4211  H  HB2  . PRO A 1 50 ? 9.616   -5.381  1.521   1.00 0.00 ? 50  PRO A HB2  4  
ATOM   4212  H  HB3  . PRO A 1 50 ? 8.480   -5.316  0.168   1.00 0.00 ? 50  PRO A HB3  4  
ATOM   4213  H  HG2  . PRO A 1 50 ? 11.394  -6.003  0.163   1.00 0.00 ? 50  PRO A HG2  4  
ATOM   4214  H  HG3  . PRO A 1 50 ? 10.058  -6.788  -0.698  1.00 0.00 ? 50  PRO A HG3  4  
ATOM   4215  H  HD2  . PRO A 1 50 ? 11.742  -5.044  -1.903  1.00 0.00 ? 50  PRO A HD2  4  
ATOM   4216  H  HD3  . PRO A 1 50 ? 10.036  -5.202  -2.370  1.00 0.00 ? 50  PRO A HD3  4  
ATOM   4217  N  N    . PHE A 1 51 ? 10.287  -2.184  2.161   1.00 0.00 ? 51  PHE A N    4  
ATOM   4218  C  CA   . PHE A 1 51 ? 11.083  -1.625  3.248   1.00 0.00 ? 51  PHE A CA   4  
ATOM   4219  C  C    . PHE A 1 51 ? 11.193  -2.614  4.405   1.00 0.00 ? 51  PHE A C    4  
ATOM   4220  O  O    . PHE A 1 51 ? 10.194  -3.089  4.946   1.00 0.00 ? 51  PHE A O    4  
ATOM   4221  C  CB   . PHE A 1 51 ? 10.465  -0.314  3.739   1.00 0.00 ? 51  PHE A CB   4  
ATOM   4222  C  CG   . PHE A 1 51 ? 9.966   0.566   2.629   1.00 0.00 ? 51  PHE A CG   4  
ATOM   4223  C  CD1  . PHE A 1 51 ? 10.855  1.189   1.768   1.00 0.00 ? 51  PHE A CD1  4  
ATOM   4224  C  CD2  . PHE A 1 51 ? 8.608   0.770   2.447   1.00 0.00 ? 51  PHE A CD2  4  
ATOM   4225  C  CE1  . PHE A 1 51 ? 10.399  2.000   0.747   1.00 0.00 ? 51  PHE A CE1  4  
ATOM   4226  C  CE2  . PHE A 1 51 ? 8.146   1.580   1.426   1.00 0.00 ? 51  PHE A CE2  4  
ATOM   4227  C  CZ   . PHE A 1 51 ? 9.042   2.195   0.575   1.00 0.00 ? 51  PHE A CZ   4  
ATOM   4228  H  H    . PHE A 1 51 ? 9.382   -1.841  2.006   1.00 0.00 ? 51  PHE A H    4  
ATOM   4229  H  HA   . PHE A 1 51 ? 12.072  -1.426  2.865   1.00 0.00 ? 51  PHE A HA   4  
ATOM   4230  H  HB2  . PHE A 1 51 ? 9.630   -0.538  4.385   1.00 0.00 ? 51  PHE A HB2  4  
ATOM   4231  H  HB3  . PHE A 1 51 ? 11.207  0.238   4.295   1.00 0.00 ? 51  PHE A HB3  4  
ATOM   4232  H  HD1  . PHE A 1 51 ? 11.917  1.037   1.901   1.00 0.00 ? 51  PHE A HD1  4  
ATOM   4233  H  HD2  . PHE A 1 51 ? 7.905   0.289   3.112   1.00 0.00 ? 51  PHE A HD2  4  
ATOM   4234  H  HE1  . PHE A 1 51 ? 11.102  2.480   0.082   1.00 0.00 ? 51  PHE A HE1  4  
ATOM   4235  H  HE2  . PHE A 1 51 ? 7.084   1.730   1.295   1.00 0.00 ? 51  PHE A HE2  4  
ATOM   4236  H  HZ   . PHE A 1 51 ? 8.683   2.829   -0.222  1.00 0.00 ? 51  PHE A HZ   4  
ATOM   4237  N  N    . PRO A 1 52 ? 12.437  -2.931  4.795   1.00 0.00 ? 52  PRO A N    4  
ATOM   4238  C  CA   . PRO A 1 52 ? 12.708  -3.866  5.891   1.00 0.00 ? 52  PRO A CA   4  
ATOM   4239  C  C    . PRO A 1 52 ? 12.324  -3.292  7.250   1.00 0.00 ? 52  PRO A C    4  
ATOM   4240  O  O    . PRO A 1 52 ? 12.060  -2.098  7.395   1.00 0.00 ? 52  PRO A O    4  
ATOM   4241  C  CB   . PRO A 1 52 ? 14.222  -4.078  5.809   1.00 0.00 ? 52  PRO A CB   4  
ATOM   4242  C  CG   . PRO A 1 52 ? 14.743  -2.846  5.155   1.00 0.00 ? 52  PRO A CG   4  
ATOM   4243  C  CD   . PRO A 1 52 ? 13.673  -2.403  4.195   1.00 0.00 ? 52  PRO A CD   4  
ATOM   4244  H  HA   . PRO A 1 52 ? 12.202  -4.809  5.743   1.00 0.00 ? 52  PRO A HA   4  
ATOM   4245  H  HB2  . PRO A 1 52 ? 14.625  -4.199  6.805   1.00 0.00 ? 52  PRO A HB2  4  
ATOM   4246  H  HB3  . PRO A 1 52 ? 14.434  -4.958  5.220   1.00 0.00 ? 52  PRO A HB3  4  
ATOM   4247  H  HG2  . PRO A 1 52 ? 14.920  -2.082  5.898   1.00 0.00 ? 52  PRO A HG2  4  
ATOM   4248  H  HG3  . PRO A 1 52 ? 15.655  -3.071  4.622   1.00 0.00 ? 52  PRO A HG3  4  
ATOM   4249  H  HD2  . PRO A 1 52 ? 13.643  -1.325  4.135   1.00 0.00 ? 52  PRO A HD2  4  
ATOM   4250  H  HD3  . PRO A 1 52 ? 13.842  -2.832  3.218   1.00 0.00 ? 52  PRO A HD3  4  
ATOM   4251  N  N    . PRO A 1 53 ? 12.290  -4.160  8.272   1.00 0.00 ? 53  PRO A N    4  
ATOM   4252  C  CA   . PRO A 1 53 ? 11.940  -3.762  9.639   1.00 0.00 ? 53  PRO A CA   4  
ATOM   4253  C  C    . PRO A 1 53 ? 13.015  -2.894  10.283  1.00 0.00 ? 53  PRO A C    4  
ATOM   4254  O  O    . PRO A 1 53 ? 13.922  -3.400  10.944  1.00 0.00 ? 53  PRO A O    4  
ATOM   4255  C  CB   . PRO A 1 53 ? 11.817  -5.097  10.377  1.00 0.00 ? 53  PRO A CB   4  
ATOM   4256  C  CG   . PRO A 1 53 ? 12.680  -6.036  9.608   1.00 0.00 ? 53  PRO A CG   4  
ATOM   4257  C  CD   . PRO A 1 53 ? 12.593  -5.598  8.172   1.00 0.00 ? 53  PRO A CD   4  
ATOM   4258  H  HA   . PRO A 1 53 ? 10.993  -3.242  9.670   1.00 0.00 ? 53  PRO A HA   4  
ATOM   4259  H  HB2  . PRO A 1 53 ? 12.164  -4.982  11.394  1.00 0.00 ? 53  PRO A HB2  4  
ATOM   4260  H  HB3  . PRO A 1 53 ? 10.786  -5.419  10.377  1.00 0.00 ? 53  PRO A HB3  4  
ATOM   4261  H  HG2  . PRO A 1 53 ? 13.699  -5.970  9.959   1.00 0.00 ? 53  PRO A HG2  4  
ATOM   4262  H  HG3  . PRO A 1 53 ? 12.310  -7.045  9.715   1.00 0.00 ? 53  PRO A HG3  4  
ATOM   4263  H  HD2  . PRO A 1 53 ? 13.535  -5.760  7.670   1.00 0.00 ? 53  PRO A HD2  4  
ATOM   4264  H  HD3  . PRO A 1 53 ? 11.797  -6.124  7.665   1.00 0.00 ? 53  PRO A HD3  4  
ATOM   4265  N  N    . GLY A 1 54 ? 12.908  -1.583  10.087  1.00 0.00 ? 54  GLY A N    4  
ATOM   4266  C  CA   . GLY A 1 54 ? 13.878  -0.666  10.656  1.00 0.00 ? 54  GLY A CA   4  
ATOM   4267  C  C    . GLY A 1 54 ? 14.264  0.440   9.694   1.00 0.00 ? 54  GLY A C    4  
ATOM   4268  O  O    . GLY A 1 54 ? 14.363  1.604   10.084  1.00 0.00 ? 54  GLY A O    4  
ATOM   4269  H  H    . GLY A 1 54 ? 12.164  -1.236  9.551   1.00 0.00 ? 54  GLY A H    4  
ATOM   4270  H  HA2  . GLY A 1 54 ? 13.460  -0.224  11.548  1.00 0.00 ? 54  GLY A HA2  4  
ATOM   4271  H  HA3  . GLY A 1 54 ? 14.766  -1.220  10.924  1.00 0.00 ? 54  GLY A HA3  4  
ATOM   4272  N  N    . ASP A 1 55 ? 14.484  0.077   8.436   1.00 0.00 ? 55  ASP A N    4  
ATOM   4273  C  CA   . ASP A 1 55 ? 14.862  1.048   7.415   1.00 0.00 ? 55  ASP A CA   4  
ATOM   4274  C  C    . ASP A 1 55 ? 13.966  2.281   7.479   1.00 0.00 ? 55  ASP A C    4  
ATOM   4275  O  O    . ASP A 1 55 ? 12.767  2.176   7.739   1.00 0.00 ? 55  ASP A O    4  
ATOM   4276  C  CB   . ASP A 1 55 ? 14.782  0.416   6.025   1.00 0.00 ? 55  ASP A CB   4  
ATOM   4277  C  CG   . ASP A 1 55 ? 14.524  1.440   4.937   1.00 0.00 ? 55  ASP A CG   4  
ATOM   4278  O  OD1  . ASP A 1 55 ? 15.276  2.435   4.868   1.00 0.00 ? 55  ASP A OD1  4  
ATOM   4279  O  OD2  . ASP A 1 55 ? 13.571  1.246   4.154   1.00 0.00 ? 55  ASP A OD2  4  
ATOM   4280  H  H    . ASP A 1 55 ? 14.390  -0.866  8.187   1.00 0.00 ? 55  ASP A H    4  
ATOM   4281  H  HA   . ASP A 1 55 ? 15.881  1.349   7.605   1.00 0.00 ? 55  ASP A HA   4  
ATOM   4282  H  HB2  . ASP A 1 55 ? 15.716  -0.083  5.809   1.00 0.00 ? 55  ASP A HB2  4  
ATOM   4283  H  HB3  . ASP A 1 55 ? 13.980  -0.307  6.011   1.00 0.00 ? 55  ASP A HB3  4  
ATOM   4284  N  N    . ARG A 1 56 ? 14.556  3.448   7.242   1.00 0.00 ? 56  ARG A N    4  
ATOM   4285  C  CA   . ARG A 1 56 ? 13.811  4.701   7.275   1.00 0.00 ? 56  ARG A CA   4  
ATOM   4286  C  C    . ARG A 1 56 ? 13.061  4.923   5.965   1.00 0.00 ? 56  ARG A C    4  
ATOM   4287  O  O    . ARG A 1 56 ? 13.649  4.870   4.884   1.00 0.00 ? 56  ARG A O    4  
ATOM   4288  C  CB   . ARG A 1 56 ? 14.757  5.874   7.539   1.00 0.00 ? 56  ARG A CB   4  
ATOM   4289  C  CG   . ARG A 1 56 ? 14.060  7.225   7.563   1.00 0.00 ? 56  ARG A CG   4  
ATOM   4290  C  CD   . ARG A 1 56 ? 13.279  7.425   8.852   1.00 0.00 ? 56  ARG A CD   4  
ATOM   4291  N  NE   . ARG A 1 56 ? 14.103  8.011   9.906   1.00 0.00 ? 56  ARG A NE   4  
ATOM   4292  C  CZ   . ARG A 1 56 ? 14.786  7.293   10.789  1.00 0.00 ? 56  ARG A CZ   4  
ATOM   4293  N  NH1  . ARG A 1 56 ? 14.745  5.968   10.745  1.00 0.00 ? 56  ARG A NH1  4  
ATOM   4294  N  NH2  . ARG A 1 56 ? 15.514  7.899   11.719  1.00 0.00 ? 56  ARG A NH2  4  
ATOM   4295  H  H    . ARG A 1 56 ? 15.515  3.467   7.040   1.00 0.00 ? 56  ARG A H    4  
ATOM   4296  H  HA   . ARG A 1 56 ? 13.094  4.640   8.080   1.00 0.00 ? 56  ARG A HA   4  
ATOM   4297  H  HB2  . ARG A 1 56 ? 15.239  5.726   8.494   1.00 0.00 ? 56  ARG A HB2  4  
ATOM   4298  H  HB3  . ARG A 1 56 ? 15.509  5.895   6.765   1.00 0.00 ? 56  ARG A HB3  4  
ATOM   4299  H  HG2  . ARG A 1 56 ? 14.803  8.004   7.480   1.00 0.00 ? 56  ARG A HG2  4  
ATOM   4300  H  HG3  . ARG A 1 56 ? 13.380  7.283   6.726   1.00 0.00 ? 56  ARG A HG3  4  
ATOM   4301  H  HD2  . ARG A 1 56 ? 12.445  8.082   8.653   1.00 0.00 ? 56  ARG A HD2  4  
ATOM   4302  H  HD3  . ARG A 1 56 ? 12.910  6.467   9.186   1.00 0.00 ? 56  ARG A HD3  4  
ATOM   4303  H  HE   . ARG A 1 56 ? 14.148  8.989   9.957   1.00 0.00 ? 56  ARG A HE   4  
ATOM   4304  H  HH11 . ARG A 1 56 ? 14.198  5.509   10.046  1.00 0.00 ? 56  ARG A HH11 4  
ATOM   4305  H  HH12 . ARG A 1 56 ? 15.262  5.429   11.411  1.00 0.00 ? 56  ARG A HH12 4  
ATOM   4306  H  HH21 . ARG A 1 56 ? 15.548  8.897   11.755  1.00 0.00 ? 56  ARG A HH21 4  
ATOM   4307  H  HH22 . ARG A 1 56 ? 16.028  7.357   12.383  1.00 0.00 ? 56  ARG A HH22 4  
ATOM   4308  N  N    . VAL A 1 57 ? 11.760  5.171   6.068   1.00 0.00 ? 57  VAL A N    4  
ATOM   4309  C  CA   . VAL A 1 57 ? 10.929  5.401   4.892   1.00 0.00 ? 57  VAL A CA   4  
ATOM   4310  C  C    . VAL A 1 57 ? 10.686  6.891   4.674   1.00 0.00 ? 57  VAL A C    4  
ATOM   4311  O  O    . VAL A 1 57 ? 10.491  7.646   5.627   1.00 0.00 ? 57  VAL A O    4  
ATOM   4312  C  CB   . VAL A 1 57 ? 9.572   4.683   5.014   1.00 0.00 ? 57  VAL A CB   4  
ATOM   4313  C  CG1  . VAL A 1 57 ? 8.713   4.954   3.788   1.00 0.00 ? 57  VAL A CG1  4  
ATOM   4314  C  CG2  . VAL A 1 57 ? 9.777   3.189   5.212   1.00 0.00 ? 57  VAL A CG2  4  
ATOM   4315  H  H    . VAL A 1 57 ? 11.348  5.201   6.957   1.00 0.00 ? 57  VAL A H    4  
ATOM   4316  H  HA   . VAL A 1 57 ? 11.449  5.002   4.033   1.00 0.00 ? 57  VAL A HA   4  
ATOM   4317  H  HB   . VAL A 1 57 ? 9.058   5.073   5.880   1.00 0.00 ? 57  VAL A HB   4  
ATOM   4318  H  HG11 . VAL A 1 57 ? 8.768   6.002   3.535   1.00 0.00 ? 57  VAL A HG11 4  
ATOM   4319  H  HG12 . VAL A 1 57 ? 9.072   4.363   2.958   1.00 0.00 ? 57  VAL A HG12 4  
ATOM   4320  H  HG13 . VAL A 1 57 ? 7.688   4.689   4.002   1.00 0.00 ? 57  VAL A HG13 4  
ATOM   4321  H  HG21 . VAL A 1 57 ? 8.822   2.716   5.389   1.00 0.00 ? 57  VAL A HG21 4  
ATOM   4322  H  HG22 . VAL A 1 57 ? 10.229  2.766   4.327   1.00 0.00 ? 57  VAL A HG22 4  
ATOM   4323  H  HG23 . VAL A 1 57 ? 10.424  3.023   6.061   1.00 0.00 ? 57  VAL A HG23 4  
ATOM   4324  N  N    . THR A 1 58 ? 10.699  7.308   3.412   1.00 0.00 ? 58  THR A N    4  
ATOM   4325  C  CA   . THR A 1 58 ? 10.480  8.708   3.068   1.00 0.00 ? 58  THR A CA   4  
ATOM   4326  C  C    . THR A 1 58 ? 9.086   8.920   2.490   1.00 0.00 ? 58  THR A C    4  
ATOM   4327  O  O    . THR A 1 58 ? 8.623   8.142   1.656   1.00 0.00 ? 58  THR A O    4  
ATOM   4328  C  CB   . THR A 1 58 ? 11.526  9.207   2.053   1.00 0.00 ? 58  THR A CB   4  
ATOM   4329  O  OG1  . THR A 1 58 ? 12.843  8.861   2.497   1.00 0.00 ? 58  THR A OG1  4  
ATOM   4330  C  CG2  . THR A 1 58 ? 11.426  10.713  1.870   1.00 0.00 ? 58  THR A CG2  4  
ATOM   4331  H  H    . THR A 1 58 ? 10.859  6.659   2.697   1.00 0.00 ? 58  THR A H    4  
ATOM   4332  H  HA   . THR A 1 58 ? 10.578  9.292   3.971   1.00 0.00 ? 58  THR A HA   4  
ATOM   4333  H  HB   . THR A 1 58 ? 11.338  8.730   1.102   1.00 0.00 ? 58  THR A HB   4  
ATOM   4334  H  HG1  . THR A 1 58 ? 13.134  9.492   3.159   1.00 0.00 ? 58  THR A HG1  4  
ATOM   4335  H  HG21 . THR A 1 58 ? 12.294  11.187  2.306   1.00 0.00 ? 58  THR A HG21 4  
ATOM   4336  H  HG22 . THR A 1 58 ? 10.534  11.077  2.358   1.00 0.00 ? 58  THR A HG22 4  
ATOM   4337  H  HG23 . THR A 1 58 ? 11.381  10.945  0.817   1.00 0.00 ? 58  THR A HG23 4  
ATOM   4338  N  N    . PHE A 1 59 ? 8.420   9.980   2.938   1.00 0.00 ? 59  PHE A N    4  
ATOM   4339  C  CA   . PHE A 1 59 ? 7.077   10.295  2.464   1.00 0.00 ? 59  PHE A CA   4  
ATOM   4340  C  C    . PHE A 1 59 ? 7.119   11.379  1.391   1.00 0.00 ? 59  PHE A C    4  
ATOM   4341  O  O    . PHE A 1 59 ? 7.341   12.552  1.688   1.00 0.00 ? 59  PHE A O    4  
ATOM   4342  C  CB   . PHE A 1 59 ? 6.196   10.749  3.630   1.00 0.00 ? 59  PHE A CB   4  
ATOM   4343  C  CG   . PHE A 1 59 ? 6.345   9.900   4.860   1.00 0.00 ? 59  PHE A CG   4  
ATOM   4344  C  CD1  . PHE A 1 59 ? 6.155   8.529   4.799   1.00 0.00 ? 59  PHE A CD1  4  
ATOM   4345  C  CD2  . PHE A 1 59 ? 6.676   10.473  6.078   1.00 0.00 ? 59  PHE A CD2  4  
ATOM   4346  C  CE1  . PHE A 1 59 ? 6.291   7.746   5.930   1.00 0.00 ? 59  PHE A CE1  4  
ATOM   4347  C  CE2  . PHE A 1 59 ? 6.814   9.695   7.212   1.00 0.00 ? 59  PHE A CE2  4  
ATOM   4348  C  CZ   . PHE A 1 59 ? 6.622   8.329   7.137   1.00 0.00 ? 59  PHE A CZ   4  
ATOM   4349  H  H    . PHE A 1 59 ? 8.842   10.564  3.603   1.00 0.00 ? 59  PHE A H    4  
ATOM   4350  H  HA   . PHE A 1 59 ? 6.658   9.397   2.036   1.00 0.00 ? 59  PHE A HA   4  
ATOM   4351  H  HB2  . PHE A 1 59 ? 6.455   11.763  3.894   1.00 0.00 ? 59  PHE A HB2  4  
ATOM   4352  H  HB3  . PHE A 1 59 ? 5.161   10.714  3.324   1.00 0.00 ? 59  PHE A HB3  4  
ATOM   4353  H  HD1  . PHE A 1 59 ? 5.897   8.071   3.855   1.00 0.00 ? 59  PHE A HD1  4  
ATOM   4354  H  HD2  . PHE A 1 59 ? 6.827   11.542  6.137   1.00 0.00 ? 59  PHE A HD2  4  
ATOM   4355  H  HE1  . PHE A 1 59 ? 6.140   6.678   5.869   1.00 0.00 ? 59  PHE A HE1  4  
ATOM   4356  H  HE2  . PHE A 1 59 ? 7.072   10.155  8.154   1.00 0.00 ? 59  PHE A HE2  4  
ATOM   4357  H  HZ   . PHE A 1 59 ? 6.728   7.720   8.022   1.00 0.00 ? 59  PHE A HZ   4  
ATOM   4358  N  N    . ASN A 1 60 ? 6.904   10.976  0.143   1.00 0.00 ? 60  ASN A N    4  
ATOM   4359  C  CA   . ASN A 1 60 ? 6.918   11.912  -0.975  1.00 0.00 ? 60  ASN A CA   4  
ATOM   4360  C  C    . ASN A 1 60 ? 5.541   12.002  -1.627  1.00 0.00 ? 60  ASN A C    4  
ATOM   4361  O  O    . ASN A 1 60 ? 5.178   11.163  -2.451  1.00 0.00 ? 60  ASN A O    4  
ATOM   4362  C  CB   . ASN A 1 60 ? 7.959   11.486  -2.011  1.00 0.00 ? 60  ASN A CB   4  
ATOM   4363  C  CG   . ASN A 1 60 ? 8.008   12.424  -3.202  1.00 0.00 ? 60  ASN A CG   4  
ATOM   4364  O  OD1  . ASN A 1 60 ? 7.332   12.205  -4.207  1.00 0.00 ? 60  ASN A OD1  4  
ATOM   4365  N  ND2  . ASN A 1 60 ? 8.811   13.475  -3.094  1.00 0.00 ? 60  ASN A ND2  4  
ATOM   4366  H  H    . ASN A 1 60 ? 6.732   10.027  -0.030  1.00 0.00 ? 60  ASN A H    4  
ATOM   4367  H  HA   . ASN A 1 60 ? 7.184   12.885  -0.590  1.00 0.00 ? 60  ASN A HA   4  
ATOM   4368  H  HB2  . ASN A 1 60 ? 8.935   11.472  -1.548  1.00 0.00 ? 60  ASN A HB2  4  
ATOM   4369  H  HB3  . ASN A 1 60 ? 7.720   10.494  -2.366  1.00 0.00 ? 60  ASN A HB3  4  
ATOM   4370  H  HD21 . ASN A 1 60 ? 9.320   13.586  -2.263  1.00 0.00 ? 60  ASN A HD21 4  
ATOM   4371  H  HD22 . ASN A 1 60 ? 8.862   14.098  -3.848  1.00 0.00 ? 60  ASN A HD22 4  
ATOM   4372  N  N    . GLY A 1 61 ? 4.780   13.025  -1.253  1.00 0.00 ? 61  GLY A N    4  
ATOM   4373  C  CA   . GLY A 1 61 ? 3.453   13.206  -1.811  1.00 0.00 ? 61  GLY A CA   4  
ATOM   4374  C  C    . GLY A 1 61 ? 2.558   12.004  -1.580  1.00 0.00 ? 61  GLY A C    4  
ATOM   4375  O  O    . GLY A 1 61 ? 2.068   11.789  -0.471  1.00 0.00 ? 61  GLY A O    4  
ATOM   4376  H  H    . GLY A 1 61 ? 5.122   13.663  -0.592  1.00 0.00 ? 61  GLY A H    4  
ATOM   4377  H  HA2  . GLY A 1 61 ? 2.998   14.073  -1.357  1.00 0.00 ? 61  GLY A HA2  4  
ATOM   4378  H  HA3  . GLY A 1 61 ? 3.542   13.374  -2.875  1.00 0.00 ? 61  GLY A HA3  4  
ATOM   4379  N  N    . LYS A 1 62 ? 2.342   11.219  -2.630  1.00 0.00 ? 62  LYS A N    4  
ATOM   4380  C  CA   . LYS A 1 62 ? 1.500   10.032  -2.538  1.00 0.00 ? 62  LYS A CA   4  
ATOM   4381  C  C    . LYS A 1 62 ? 2.348   8.773   -2.389  1.00 0.00 ? 62  LYS A C    4  
ATOM   4382  O  O    . LYS A 1 62 ? 2.060   7.915   -1.555  1.00 0.00 ? 62  LYS A O    4  
ATOM   4383  C  CB   . LYS A 1 62 ? 0.609   9.916   -3.777  1.00 0.00 ? 62  LYS A CB   4  
ATOM   4384  C  CG   . LYS A 1 62 ? -0.440  11.010  -3.876  1.00 0.00 ? 62  LYS A CG   4  
ATOM   4385  C  CD   . LYS A 1 62 ? -1.021  11.100  -5.277  1.00 0.00 ? 62  LYS A CD   4  
ATOM   4386  C  CE   . LYS A 1 62 ? -1.581  12.485  -5.561  1.00 0.00 ? 62  LYS A CE   4  
ATOM   4387  N  NZ   . LYS A 1 62 ? -0.524  13.427  -6.022  1.00 0.00 ? 62  LYS A NZ   4  
ATOM   4388  H  H    . LYS A 1 62 ? 2.761   11.442  -3.488  1.00 0.00 ? 62  LYS A H    4  
ATOM   4389  H  HA   . LYS A 1 62 ? 0.875   10.136  -1.664  1.00 0.00 ? 62  LYS A HA   4  
ATOM   4390  H  HB2  . LYS A 1 62 ? 1.232   9.962   -4.658  1.00 0.00 ? 62  LYS A HB2  4  
ATOM   4391  H  HB3  . LYS A 1 62 ? 0.103   8.962   -3.753  1.00 0.00 ? 62  LYS A HB3  4  
ATOM   4392  H  HG2  . LYS A 1 62 ? -1.238  10.795  -3.181  1.00 0.00 ? 62  LYS A HG2  4  
ATOM   4393  H  HG3  . LYS A 1 62 ? 0.016   11.957  -3.624  1.00 0.00 ? 62  LYS A HG3  4  
ATOM   4394  H  HD2  . LYS A 1 62 ? -0.243  10.885  -5.995  1.00 0.00 ? 62  LYS A HD2  4  
ATOM   4395  H  HD3  . LYS A 1 62 ? -1.814  10.373  -5.376  1.00 0.00 ? 62  LYS A HD3  4  
ATOM   4396  H  HE2  . LYS A 1 62 ? -2.337  12.403  -6.326  1.00 0.00 ? 62  LYS A HE2  4  
ATOM   4397  H  HE3  . LYS A 1 62 ? -2.025  12.871  -4.655  1.00 0.00 ? 62  LYS A HE3  4  
ATOM   4398  H  HZ1  . LYS A 1 62 ? 0.295   12.896  -6.382  1.00 0.00 ? 62  LYS A HZ1  4  
ATOM   4399  H  HZ2  . LYS A 1 62 ? -0.213  14.029  -5.233  1.00 0.00 ? 62  LYS A HZ2  4  
ATOM   4400  H  HZ3  . LYS A 1 62 ? -0.892  14.033  -6.783  1.00 0.00 ? 62  LYS A HZ3  4  
ATOM   4401  N  N    . GLU A 1 63 ? 3.395   8.671   -3.201  1.00 0.00 ? 63  GLU A N    4  
ATOM   4402  C  CA   . GLU A 1 63 ? 4.285   7.516   -3.158  1.00 0.00 ? 63  GLU A CA   4  
ATOM   4403  C  C    . GLU A 1 63 ? 5.437   7.753   -2.185  1.00 0.00 ? 63  GLU A C    4  
ATOM   4404  O  O    . GLU A 1 63 ? 5.751   8.894   -1.844  1.00 0.00 ? 63  GLU A O    4  
ATOM   4405  C  CB   . GLU A 1 63 ? 4.836   7.216   -4.553  1.00 0.00 ? 63  GLU A CB   4  
ATOM   4406  C  CG   . GLU A 1 63 ? 3.757   6.944   -5.588  1.00 0.00 ? 63  GLU A CG   4  
ATOM   4407  C  CD   . GLU A 1 63 ? 3.114   5.582   -5.416  1.00 0.00 ? 63  GLU A CD   4  
ATOM   4408  O  OE1  . GLU A 1 63 ? 3.810   4.651   -4.958  1.00 0.00 ? 63  GLU A OE1  4  
ATOM   4409  O  OE2  . GLU A 1 63 ? 1.915   5.446   -5.738  1.00 0.00 ? 63  GLU A OE2  4  
ATOM   4410  H  H    . GLU A 1 63 ? 3.573   9.388   -3.845  1.00 0.00 ? 63  GLU A H    4  
ATOM   4411  H  HA   . GLU A 1 63 ? 3.711   6.668   -2.818  1.00 0.00 ? 63  GLU A HA   4  
ATOM   4412  H  HB2  . GLU A 1 63 ? 5.420   8.062   -4.886  1.00 0.00 ? 63  GLU A HB2  4  
ATOM   4413  H  HB3  . GLU A 1 63 ? 5.476   6.349   -4.495  1.00 0.00 ? 63  GLU A HB3  4  
ATOM   4414  H  HG2  . GLU A 1 63 ? 2.991   7.700   -5.499  1.00 0.00 ? 63  GLU A HG2  4  
ATOM   4415  H  HG3  . GLU A 1 63 ? 4.199   6.995   -6.572  1.00 0.00 ? 63  GLU A HG3  4  
ATOM   4416  N  N    . CYS A 1 64 ? 6.061   6.668   -1.741  1.00 0.00 ? 64  CYS A N    4  
ATOM   4417  C  CA   . CYS A 1 64 ? 7.177   6.756   -0.806  1.00 0.00 ? 64  CYS A CA   4  
ATOM   4418  C  C    . CYS A 1 64 ? 8.443   6.161   -1.413  1.00 0.00 ? 64  CYS A C    4  
ATOM   4419  O  O    . CYS A 1 64 ? 8.393   5.148   -2.109  1.00 0.00 ? 64  CYS A O    4  
ATOM   4420  C  CB   . CYS A 1 64 ? 6.835   6.035   0.498   1.00 0.00 ? 64  CYS A CB   4  
ATOM   4421  S  SG   . CYS A 1 64 ? 5.453   6.767   1.406   1.00 0.00 ? 64  CYS A SG   4  
ATOM   4422  H  H    . CYS A 1 64 ? 5.765   5.786   -2.049  1.00 0.00 ? 64  CYS A H    4  
ATOM   4423  H  HA   . CYS A 1 64 ? 7.350   7.801   -0.595  1.00 0.00 ? 64  CYS A HA   4  
ATOM   4424  H  HB2  . CYS A 1 64 ? 6.575   5.010   0.276   1.00 0.00 ? 64  CYS A HB2  4  
ATOM   4425  H  HB3  . CYS A 1 64 ? 7.699   6.048   1.145   1.00 0.00 ? 64  CYS A HB3  4  
ATOM   4426  H  HG   . CYS A 1 64 ? 5.601   6.466   2.687   1.00 0.00 ? 64  CYS A HG   4  
ATOM   4427  N  N    . MET A 1 65 ? 9.578   6.800   -1.146  1.00 0.00 ? 65  MET A N    4  
ATOM   4428  C  CA   . MET A 1 65 ? 10.858  6.334   -1.667  1.00 0.00 ? 65  MET A CA   4  
ATOM   4429  C  C    . MET A 1 65 ? 11.770  5.873   -0.535  1.00 0.00 ? 65  MET A C    4  
ATOM   4430  O  O    . MET A 1 65 ? 11.666  6.353   0.594   1.00 0.00 ? 65  MET A O    4  
ATOM   4431  C  CB   . MET A 1 65 ? 11.541  7.444   -2.469  1.00 0.00 ? 65  MET A CB   4  
ATOM   4432  C  CG   . MET A 1 65 ? 11.014  7.580   -3.888  1.00 0.00 ? 65  MET A CG   4  
ATOM   4433  S  SD   . MET A 1 65 ? 11.983  8.733   -4.881  1.00 0.00 ? 65  MET A SD   4  
ATOM   4434  C  CE   . MET A 1 65 ? 11.368  10.302  -4.273  1.00 0.00 ? 65  MET A CE   4  
ATOM   4435  H  H    . MET A 1 65 ? 9.555   7.603   -0.585  1.00 0.00 ? 65  MET A H    4  
ATOM   4436  H  HA   . MET A 1 65 ? 10.664  5.497   -2.321  1.00 0.00 ? 65  MET A HA   4  
ATOM   4437  H  HB2  . MET A 1 65 ? 11.390  8.384   -1.960  1.00 0.00 ? 65  MET A HB2  4  
ATOM   4438  H  HB3  . MET A 1 65 ? 12.599  7.236   -2.519  1.00 0.00 ? 65  MET A HB3  4  
ATOM   4439  H  HG2  . MET A 1 65 ? 11.040  6.610   -4.363  1.00 0.00 ? 65  MET A HG2  4  
ATOM   4440  H  HG3  . MET A 1 65 ? 9.994   7.931   -3.846  1.00 0.00 ? 65  MET A HG3  4  
ATOM   4441  H  HE1  . MET A 1 65 ? 10.983  10.174  -3.271  1.00 0.00 ? 65  MET A HE1  4  
ATOM   4442  H  HE2  . MET A 1 65 ? 12.171  11.023  -4.261  1.00 0.00 ? 65  MET A HE2  4  
ATOM   4443  H  HE3  . MET A 1 65 ? 10.577  10.653  -4.920  1.00 0.00 ? 65  MET A HE3  4  
ATOM   4444  N  N    . CYS A 1 66 ? 12.664  4.940   -0.844  1.00 0.00 ? 66  CYS A N    4  
ATOM   4445  C  CA   . CYS A 1 66 ? 13.595  4.414   0.147   1.00 0.00 ? 66  CYS A CA   4  
ATOM   4446  C  C    . CYS A 1 66 ? 14.800  5.336   0.306   1.00 0.00 ? 66  CYS A C    4  
ATOM   4447  O  O    . CYS A 1 66 ? 15.261  5.943   -0.661  1.00 0.00 ? 66  CYS A O    4  
ATOM   4448  C  CB   . CYS A 1 66 ? 14.060  3.013   -0.253  1.00 0.00 ? 66  CYS A CB   4  
ATOM   4449  S  SG   . CYS A 1 66 ? 14.959  2.952   -1.836  1.00 0.00 ? 66  CYS A SG   4  
ATOM   4450  H  H    . CYS A 1 66 ? 12.700  4.597   -1.762  1.00 0.00 ? 66  CYS A H    4  
ATOM   4451  H  HA   . CYS A 1 66 ? 13.076  4.355   1.092   1.00 0.00 ? 66  CYS A HA   4  
ATOM   4452  H  HB2  . CYS A 1 66 ? 14.719  2.628   0.512   1.00 0.00 ? 66  CYS A HB2  4  
ATOM   4453  H  HB3  . CYS A 1 66 ? 13.199  2.366   -0.338  1.00 0.00 ? 66  CYS A HB3  4  
ATOM   4454  N  N    . GLN A 1 67 ? 15.305  5.436   1.531   1.00 0.00 ? 67  GLN A N    4  
ATOM   4455  C  CA   . GLN A 1 67 ? 16.456  6.285   1.816   1.00 0.00 ? 67  GLN A CA   4  
ATOM   4456  C  C    . GLN A 1 67 ? 17.469  6.228   0.677   1.00 0.00 ? 67  GLN A C    4  
ATOM   4457  O  O    . GLN A 1 67 ? 18.210  7.183   0.442   1.00 0.00 ? 67  GLN A O    4  
ATOM   4458  C  CB   . GLN A 1 67 ? 17.119  5.857   3.126   1.00 0.00 ? 67  GLN A CB   4  
ATOM   4459  C  CG   . GLN A 1 67 ? 17.828  4.515   3.040   1.00 0.00 ? 67  GLN A CG   4  
ATOM   4460  C  CD   . GLN A 1 67 ? 18.881  4.341   4.117   1.00 0.00 ? 67  GLN A CD   4  
ATOM   4461  O  OE1  . GLN A 1 67 ? 18.588  4.440   5.309   1.00 0.00 ? 67  GLN A OE1  4  
ATOM   4462  N  NE2  . GLN A 1 67 ? 20.115  4.081   3.702   1.00 0.00 ? 67  GLN A NE2  4  
ATOM   4463  H  H    . GLN A 1 67 ? 14.894  4.928   2.260   1.00 0.00 ? 67  GLN A H    4  
ATOM   4464  H  HA   . GLN A 1 67 ? 16.103  7.300   1.916   1.00 0.00 ? 67  GLN A HA   4  
ATOM   4465  H  HB2  . GLN A 1 67 ? 17.844  6.606   3.410   1.00 0.00 ? 67  GLN A HB2  4  
ATOM   4466  H  HB3  . GLN A 1 67 ? 16.363  5.791   3.894   1.00 0.00 ? 67  GLN A HB3  4  
ATOM   4467  H  HG2  . GLN A 1 67 ? 17.096  3.729   3.144   1.00 0.00 ? 67  GLN A HG2  4  
ATOM   4468  H  HG3  . GLN A 1 67 ? 18.305  4.436   2.075   1.00 0.00 ? 67  GLN A HG3  4  
ATOM   4469  H  HE21 . GLN A 1 67 ? 20.275  4.018   2.737   1.00 0.00 ? 67  GLN A HE21 4  
ATOM   4470  H  HE22 . GLN A 1 67 ? 20.815  3.964   4.377   1.00 0.00 ? 67  GLN A HE22 4  
ATOM   4471  N  N    . LYS A 1 68 ? 17.497  5.102   -0.027  1.00 0.00 ? 68  LYS A N    4  
ATOM   4472  C  CA   . LYS A 1 68 ? 18.418  4.919   -1.143  1.00 0.00 ? 68  LYS A CA   4  
ATOM   4473  C  C    . LYS A 1 68 ? 18.025  5.801   -2.324  1.00 0.00 ? 68  LYS A C    4  
ATOM   4474  O  O    . LYS A 1 68 ? 18.847  6.547   -2.856  1.00 0.00 ? 68  LYS A O    4  
ATOM   4475  C  CB   . LYS A 1 68 ? 18.444  3.451   -1.575  1.00 0.00 ? 68  LYS A CB   4  
ATOM   4476  C  CG   . LYS A 1 68 ? 19.720  3.052   -2.296  1.00 0.00 ? 68  LYS A CG   4  
ATOM   4477  C  CD   . LYS A 1 68 ? 19.661  1.612   -2.776  1.00 0.00 ? 68  LYS A CD   4  
ATOM   4478  C  CE   . LYS A 1 68 ? 18.860  1.485   -4.063  1.00 0.00 ? 68  LYS A CE   4  
ATOM   4479  N  NZ   . LYS A 1 68 ? 19.669  1.853   -5.258  1.00 0.00 ? 68  LYS A NZ   4  
ATOM   4480  H  H    . LYS A 1 68 ? 16.882  4.375   0.208   1.00 0.00 ? 68  LYS A H    4  
ATOM   4481  H  HA   . LYS A 1 68 ? 19.404  5.205   -0.809  1.00 0.00 ? 68  LYS A HA   4  
ATOM   4482  H  HB2  . LYS A 1 68 ? 18.341  2.829   -0.698  1.00 0.00 ? 68  LYS A HB2  4  
ATOM   4483  H  HB3  . LYS A 1 68 ? 17.609  3.269   -2.236  1.00 0.00 ? 68  LYS A HB3  4  
ATOM   4484  H  HG2  . LYS A 1 68 ? 19.858  3.699   -3.149  1.00 0.00 ? 68  LYS A HG2  4  
ATOM   4485  H  HG3  . LYS A 1 68 ? 20.555  3.163   -1.619  1.00 0.00 ? 68  LYS A HG3  4  
ATOM   4486  H  HD2  . LYS A 1 68 ? 20.666  1.259   -2.955  1.00 0.00 ? 68  LYS A HD2  4  
ATOM   4487  H  HD3  . LYS A 1 68 ? 19.196  1.005   -2.012  1.00 0.00 ? 68  LYS A HD3  4  
ATOM   4488  H  HE2  . LYS A 1 68 ? 18.527  0.464   -4.165  1.00 0.00 ? 68  LYS A HE2  4  
ATOM   4489  H  HE3  . LYS A 1 68 ? 18.003  2.140   -4.004  1.00 0.00 ? 68  LYS A HE3  4  
ATOM   4490  H  HZ1  . LYS A 1 68 ? 19.200  2.617   -5.785  1.00 0.00 ? 68  LYS A HZ1  4  
ATOM   4491  H  HZ2  . LYS A 1 68 ? 19.775  1.030   -5.885  1.00 0.00 ? 68  LYS A HZ2  4  
ATOM   4492  H  HZ3  . LYS A 1 68 ? 20.613  2.176   -4.966  1.00 0.00 ? 68  LYS A HZ3  4  
ATOM   4493  N  N    . CYS A 1 69 ? 16.762  5.712   -2.727  1.00 0.00 ? 69  CYS A N    4  
ATOM   4494  C  CA   . CYS A 1 69 ? 16.258  6.502   -3.844  1.00 0.00 ? 69  CYS A CA   4  
ATOM   4495  C  C    . CYS A 1 69 ? 16.182  7.980   -3.474  1.00 0.00 ? 69  CYS A C    4  
ATOM   4496  O  O    . CYS A 1 69 ? 16.788  8.827   -4.130  1.00 0.00 ? 69  CYS A O    4  
ATOM   4497  C  CB   . CYS A 1 69 ? 14.877  5.999   -4.270  1.00 0.00 ? 69  CYS A CB   4  
ATOM   4498  S  SG   . CYS A 1 69 ? 14.877  4.307   -4.944  1.00 0.00 ? 69  CYS A SG   4  
ATOM   4499  H  H    . CYS A 1 69 ? 16.153  5.099   -2.263  1.00 0.00 ? 69  CYS A H    4  
ATOM   4500  H  HA   . CYS A 1 69 ? 16.944  6.385   -4.670  1.00 0.00 ? 69  CYS A HA   4  
ATOM   4501  H  HB2  . CYS A 1 69 ? 14.219  6.010   -3.413  1.00 0.00 ? 69  CYS A HB2  4  
ATOM   4502  H  HB3  . CYS A 1 69 ? 14.482  6.657   -5.030  1.00 0.00 ? 69  CYS A HB3  4  
ATOM   4503  N  N    . SER A 1 70 ? 15.433  8.282   -2.419  1.00 0.00 ? 70  SER A N    4  
ATOM   4504  C  CA   . SER A 1 70 ? 15.274  9.658   -1.963  1.00 0.00 ? 70  SER A CA   4  
ATOM   4505  C  C    . SER A 1 70 ? 16.584  10.429  -2.094  1.00 0.00 ? 70  SER A C    4  
ATOM   4506  O  O    . SER A 1 70 ? 16.618  11.529  -2.647  1.00 0.00 ? 70  SER A O    4  
ATOM   4507  C  CB   . SER A 1 70 ? 14.797  9.684   -0.509  1.00 0.00 ? 70  SER A CB   4  
ATOM   4508  O  OG   . SER A 1 70 ? 15.211  8.520   0.184   1.00 0.00 ? 70  SER A OG   4  
ATOM   4509  H  H    . SER A 1 70 ? 14.974  7.562   -1.937  1.00 0.00 ? 70  SER A H    4  
ATOM   4510  H  HA   . SER A 1 70 ? 14.528  10.130  -2.586  1.00 0.00 ? 70  SER A HA   4  
ATOM   4511  H  HB2  . SER A 1 70 ? 15.209  10.550  -0.013  1.00 0.00 ? 70  SER A HB2  4  
ATOM   4512  H  HB3  . SER A 1 70 ? 13.718  9.737   -0.488  1.00 0.00 ? 70  SER A HB3  4  
ATOM   4513  H  HG   . SER A 1 70 ? 16.154  8.570   0.359   1.00 0.00 ? 70  SER A HG   4  
ATOM   4514  N  N    . LEU A 1 71 ? 17.661  9.843   -1.583  1.00 0.00 ? 71  LEU A N    4  
ATOM   4515  C  CA   . LEU A 1 71 ? 18.975  10.474  -1.642  1.00 0.00 ? 71  LEU A CA   4  
ATOM   4516  C  C    . LEU A 1 71 ? 19.756  9.990   -2.860  1.00 0.00 ? 71  LEU A C    4  
ATOM   4517  O  O    . LEU A 1 71 ? 19.483  8.930   -3.422  1.00 0.00 ? 71  LEU A O    4  
ATOM   4518  C  CB   . LEU A 1 71 ? 19.763  10.176  -0.366  1.00 0.00 ? 71  LEU A CB   4  
ATOM   4519  C  CG   . LEU A 1 71 ? 19.568  11.160  0.788   1.00 0.00 ? 71  LEU A CG   4  
ATOM   4520  C  CD1  . LEU A 1 71 ? 18.434  10.705  1.692   1.00 0.00 ? 71  LEU A CD1  4  
ATOM   4521  C  CD2  . LEU A 1 71 ? 20.857  11.313  1.583   1.00 0.00 ? 71  LEU A CD2  4  
ATOM   4522  H  H    . LEU A 1 71 ? 17.572  8.967   -1.155  1.00 0.00 ? 71  LEU A H    4  
ATOM   4523  H  HA   . LEU A 1 71 ? 18.828  11.540  -1.725  1.00 0.00 ? 71  LEU A HA   4  
ATOM   4524  H  HB2  . LEU A 1 71 ? 19.472  9.197   -0.018  1.00 0.00 ? 71  LEU A HB2  4  
ATOM   4525  H  HB3  . LEU A 1 71 ? 20.814  10.168  -0.621  1.00 0.00 ? 71  LEU A HB3  4  
ATOM   4526  H  HG   . LEU A 1 71 ? 19.306  12.129  0.386   1.00 0.00 ? 71  LEU A HG   4  
ATOM   4527  H  HD11 . LEU A 1 71 ? 18.393  9.626   1.703   1.00 0.00 ? 71  LEU A HD11 4  
ATOM   4528  H  HD12 . LEU A 1 71 ? 17.498  11.096  1.321   1.00 0.00 ? 71  LEU A HD12 4  
ATOM   4529  H  HD13 . LEU A 1 71 ? 18.603  11.070  2.695   1.00 0.00 ? 71  LEU A HD13 4  
ATOM   4530  H  HD21 . LEU A 1 71 ? 20.801  12.203  2.192   1.00 0.00 ? 71  LEU A HD21 4  
ATOM   4531  H  HD22 . LEU A 1 71 ? 21.692  11.395  0.902   1.00 0.00 ? 71  LEU A HD22 4  
ATOM   4532  H  HD23 . LEU A 1 71 ? 20.993  10.450  2.217   1.00 0.00 ? 71  LEU A HD23 4  
ATOM   4533  N  N    . PRO A 1 72 ? 20.753  10.785  -3.277  1.00 0.00 ? 72  PRO A N    4  
ATOM   4534  C  CA   . PRO A 1 72 ? 21.596  10.457  -4.431  1.00 0.00 ? 72  PRO A CA   4  
ATOM   4535  C  C    . PRO A 1 72 ? 22.521  9.276   -4.156  1.00 0.00 ? 72  PRO A C    4  
ATOM   4536  O  O    . PRO A 1 72 ? 23.422  9.361   -3.322  1.00 0.00 ? 72  PRO A O    4  
ATOM   4537  C  CB   . PRO A 1 72 ? 22.411  11.735  -4.649  1.00 0.00 ? 72  PRO A CB   4  
ATOM   4538  C  CG   . PRO A 1 72 ? 22.445  12.395  -3.314  1.00 0.00 ? 72  PRO A CG   4  
ATOM   4539  C  CD   . PRO A 1 72 ? 21.135  12.064  -2.655  1.00 0.00 ? 72  PRO A CD   4  
ATOM   4540  H  HA   . PRO A 1 72 ? 21.004  10.252  -5.310  1.00 0.00 ? 72  PRO A HA   4  
ATOM   4541  H  HB2  . PRO A 1 72 ? 23.405  11.477  -4.989  1.00 0.00 ? 72  PRO A HB2  4  
ATOM   4542  H  HB3  . PRO A 1 72 ? 21.923  12.356  -5.384  1.00 0.00 ? 72  PRO A HB3  4  
ATOM   4543  H  HG2  . PRO A 1 72 ? 23.266  12.005  -2.732  1.00 0.00 ? 72  PRO A HG2  4  
ATOM   4544  H  HG3  . PRO A 1 72 ? 22.543  13.464  -3.436  1.00 0.00 ? 72  PRO A HG3  4  
ATOM   4545  H  HD2  . PRO A 1 72 ? 21.266  11.950  -1.589  1.00 0.00 ? 72  PRO A HD2  4  
ATOM   4546  H  HD3  . PRO A 1 72 ? 20.402  12.828  -2.867  1.00 0.00 ? 72  PRO A HD3  4  
ATOM   4547  N  N    . VAL A 1 73 ? 22.293  8.174   -4.864  1.00 0.00 ? 73  VAL A N    4  
ATOM   4548  C  CA   . VAL A 1 73 ? 23.106  6.976   -4.698  1.00 0.00 ? 73  VAL A CA   4  
ATOM   4549  C  C    . VAL A 1 73 ? 23.889  6.663   -5.968  1.00 0.00 ? 73  VAL A C    4  
ATOM   4550  O  O    . VAL A 1 73 ? 23.481  7.034   -7.068  1.00 0.00 ? 73  VAL A O    4  
ATOM   4551  C  CB   . VAL A 1 73 ? 22.241  5.757   -4.327  1.00 0.00 ? 73  VAL A CB   4  
ATOM   4552  C  CG1  . VAL A 1 73 ? 21.371  5.342   -5.503  1.00 0.00 ? 73  VAL A CG1  4  
ATOM   4553  C  CG2  . VAL A 1 73 ? 23.118  4.602   -3.867  1.00 0.00 ? 73  VAL A CG2  4  
ATOM   4554  H  H    . VAL A 1 73 ? 21.559  8.167   -5.514  1.00 0.00 ? 73  VAL A H    4  
ATOM   4555  H  HA   . VAL A 1 73 ? 23.803  7.155   -3.892  1.00 0.00 ? 73  VAL A HA   4  
ATOM   4556  H  HB   . VAL A 1 73 ? 21.593  6.037   -3.509  1.00 0.00 ? 73  VAL A HB   4  
ATOM   4557  H  HG11 . VAL A 1 73 ? 20.791  6.189   -5.838  1.00 0.00 ? 73  VAL A HG11 4  
ATOM   4558  H  HG12 . VAL A 1 73 ? 21.999  4.992   -6.310  1.00 0.00 ? 73  VAL A HG12 4  
ATOM   4559  H  HG13 . VAL A 1 73 ? 20.705  4.549   -5.196  1.00 0.00 ? 73  VAL A HG13 4  
ATOM   4560  H  HG21 . VAL A 1 73 ? 23.576  4.853   -2.922  1.00 0.00 ? 73  VAL A HG21 4  
ATOM   4561  H  HG22 . VAL A 1 73 ? 22.513  3.715   -3.749  1.00 0.00 ? 73  VAL A HG22 4  
ATOM   4562  H  HG23 . VAL A 1 73 ? 23.886  4.418   -4.603  1.00 0.00 ? 73  VAL A HG23 4  
ATOM   4563  N  N    . SER A 1 74 ? 25.016  5.976   -5.807  1.00 0.00 ? 74  SER A N    4  
ATOM   4564  C  CA   . SER A 1 74 ? 25.859  5.615   -6.941  1.00 0.00 ? 74  SER A CA   4  
ATOM   4565  C  C    . SER A 1 74 ? 25.011  5.313   -8.174  1.00 0.00 ? 74  SER A C    4  
ATOM   4566  O  O    . SER A 1 74 ? 25.349  5.713   -9.287  1.00 0.00 ? 74  SER A O    4  
ATOM   4567  C  CB   . SER A 1 74 ? 26.724  4.402   -6.594  1.00 0.00 ? 74  SER A CB   4  
ATOM   4568  O  OG   . SER A 1 74 ? 27.882  4.791   -5.875  1.00 0.00 ? 74  SER A OG   4  
ATOM   4569  H  H    . SER A 1 74 ? 25.288  5.708   -4.904  1.00 0.00 ? 74  SER A H    4  
ATOM   4570  H  HA   . SER A 1 74 ? 26.501  6.455   -7.158  1.00 0.00 ? 74  SER A HA   4  
ATOM   4571  H  HB2  . SER A 1 74 ? 26.152  3.716   -5.988  1.00 0.00 ? 74  SER A HB2  4  
ATOM   4572  H  HB3  . SER A 1 74 ? 27.030  3.908   -7.506  1.00 0.00 ? 74  SER A HB3  4  
ATOM   4573  H  HG   . SER A 1 74 ? 27.765  5.681   -5.536  1.00 0.00 ? 74  SER A HG   4  
ATOM   4574  N  N    . VAL A 1 75 ? 23.907  4.603   -7.965  1.00 0.00 ? 75  VAL A N    4  
ATOM   4575  C  CA   . VAL A 1 75 ? 23.009  4.247   -9.058  1.00 0.00 ? 75  VAL A CA   4  
ATOM   4576  C  C    . VAL A 1 75 ? 22.395  5.490   -9.691  1.00 0.00 ? 75  VAL A C    4  
ATOM   4577  O  O    . VAL A 1 75 ? 21.931  6.391   -8.992  1.00 0.00 ? 75  VAL A O    4  
ATOM   4578  C  CB   . VAL A 1 75 ? 21.879  3.318   -8.576  1.00 0.00 ? 75  VAL A CB   4  
ATOM   4579  C  CG1  . VAL A 1 75 ? 20.920  3.007   -9.715  1.00 0.00 ? 75  VAL A CG1  4  
ATOM   4580  C  CG2  . VAL A 1 75 ? 22.456  2.039   -7.989  1.00 0.00 ? 75  VAL A CG2  4  
ATOM   4581  H  H    . VAL A 1 75 ? 23.690  4.312   -7.055  1.00 0.00 ? 75  VAL A H    4  
ATOM   4582  H  HA   . VAL A 1 75 ? 23.585  3.721   -9.805  1.00 0.00 ? 75  VAL A HA   4  
ATOM   4583  H  HB   . VAL A 1 75 ? 21.327  3.829   -7.800  1.00 0.00 ? 75  VAL A HB   4  
ATOM   4584  H  HG11 . VAL A 1 75 ? 21.484  2.805   -10.614 1.00 0.00 ? 75  VAL A HG11 4  
ATOM   4585  H  HG12 . VAL A 1 75 ? 20.325  2.143   -9.459  1.00 0.00 ? 75  VAL A HG12 4  
ATOM   4586  H  HG13 . VAL A 1 75 ? 20.272  3.855   -9.881  1.00 0.00 ? 75  VAL A HG13 4  
ATOM   4587  H  HG21 . VAL A 1 75 ? 23.084  1.558   -8.723  1.00 0.00 ? 75  VAL A HG21 4  
ATOM   4588  H  HG22 . VAL A 1 75 ? 23.042  2.276   -7.113  1.00 0.00 ? 75  VAL A HG22 4  
ATOM   4589  H  HG23 . VAL A 1 75 ? 21.651  1.374   -7.713  1.00 0.00 ? 75  VAL A HG23 4  
ATOM   4590  N  N    . SER A 1 76 ? 22.394  5.532   -11.019 1.00 0.00 ? 76  SER A N    4  
ATOM   4591  C  CA   . SER A 1 76 ? 21.840  6.667   -11.748 1.00 0.00 ? 76  SER A CA   4  
ATOM   4592  C  C    . SER A 1 76 ? 20.417  6.371   -12.213 1.00 0.00 ? 76  SER A C    4  
ATOM   4593  O  O    . SER A 1 76 ? 19.980  5.221   -12.218 1.00 0.00 ? 76  SER A O    4  
ATOM   4594  C  CB   . SER A 1 76 ? 22.721  7.008   -12.951 1.00 0.00 ? 76  SER A CB   4  
ATOM   4595  O  OG   . SER A 1 76 ? 23.877  7.723   -12.550 1.00 0.00 ? 76  SER A OG   4  
ATOM   4596  H  H    . SER A 1 76 ? 22.779  4.783   -11.521 1.00 0.00 ? 76  SER A H    4  
ATOM   4597  H  HA   . SER A 1 76 ? 21.818  7.513   -11.078 1.00 0.00 ? 76  SER A HA   4  
ATOM   4598  H  HB2  . SER A 1 76 ? 23.028  6.095   -13.439 1.00 0.00 ? 76  SER A HB2  4  
ATOM   4599  H  HB3  . SER A 1 76 ? 22.159  7.616   -13.645 1.00 0.00 ? 76  SER A HB3  4  
ATOM   4600  H  HG   . SER A 1 76 ? 23.635  8.625   -12.330 1.00 0.00 ? 76  SER A HG   4  
ATOM   4601  N  N    . GLY A 1 77 ? 19.699  7.420   -12.604 1.00 0.00 ? 77  GLY A N    4  
ATOM   4602  C  CA   . GLY A 1 77 ? 18.333  7.253   -13.066 1.00 0.00 ? 77  GLY A CA   4  
ATOM   4603  C  C    . GLY A 1 77 ? 17.314  7.699   -12.036 1.00 0.00 ? 77  GLY A C    4  
ATOM   4604  O  O    . GLY A 1 77 ? 16.652  6.884   -11.393 1.00 0.00 ? 77  GLY A O    4  
ATOM   4605  H  H    . GLY A 1 77 ? 20.099  8.314   -12.579 1.00 0.00 ? 77  GLY A H    4  
ATOM   4606  H  HA2  . GLY A 1 77 ? 18.196  7.831   -13.967 1.00 0.00 ? 77  GLY A HA2  4  
ATOM   4607  H  HA3  . GLY A 1 77 ? 18.167  6.209   -13.291 1.00 0.00 ? 77  GLY A HA3  4  
ATOM   4608  N  N    . PRO A 1 78 ? 17.179  9.022   -11.866 1.00 0.00 ? 78  PRO A N    4  
ATOM   4609  C  CA   . PRO A 1 78 ? 16.236  9.605   -10.907 1.00 0.00 ? 78  PRO A CA   4  
ATOM   4610  C  C    . PRO A 1 78 ? 14.784  9.412   -11.331 1.00 0.00 ? 78  PRO A C    4  
ATOM   4611  O  O    . PRO A 1 78 ? 13.941  9.013   -10.527 1.00 0.00 ? 78  PRO A O    4  
ATOM   4612  C  CB   . PRO A 1 78 ? 16.601  11.092  -10.910 1.00 0.00 ? 78  PRO A CB   4  
ATOM   4613  C  CG   . PRO A 1 78 ? 17.222  11.327  -12.243 1.00 0.00 ? 78  PRO A CG   4  
ATOM   4614  C  CD   . PRO A 1 78 ? 17.935  10.052  -12.599 1.00 0.00 ? 78  PRO A CD   4  
ATOM   4615  H  HA   . PRO A 1 78 ? 16.378  9.200   -9.916  1.00 0.00 ? 78  PRO A HA   4  
ATOM   4616  H  HB2  . PRO A 1 78 ? 15.706  11.684  -10.779 1.00 0.00 ? 78  PRO A HB2  4  
ATOM   4617  H  HB3  . PRO A 1 78 ? 17.295  11.297  -10.109 1.00 0.00 ? 78  PRO A HB3  4  
ATOM   4618  H  HG2  . PRO A 1 78 ? 16.456  11.543  -12.972 1.00 0.00 ? 78  PRO A HG2  4  
ATOM   4619  H  HG3  . PRO A 1 78 ? 17.925  12.144  -12.181 1.00 0.00 ? 78  PRO A HG3  4  
ATOM   4620  H  HD2  . PRO A 1 78 ? 17.891  9.879   -13.664 1.00 0.00 ? 78  PRO A HD2  4  
ATOM   4621  H  HD3  . PRO A 1 78 ? 18.961  10.087  -12.262 1.00 0.00 ? 78  PRO A HD3  4  
ATOM   4622  N  N    . SER A 1 79 ? 14.499  9.697   -12.597 1.00 0.00 ? 79  SER A N    4  
ATOM   4623  C  CA   . SER A 1 79 ? 13.148  9.558   -13.127 1.00 0.00 ? 79  SER A CA   4  
ATOM   4624  C  C    . SER A 1 79 ? 12.119  10.107  -12.143 1.00 0.00 ? 79  SER A C    4  
ATOM   4625  O  O    . SER A 1 79 ? 11.091  9.480   -11.887 1.00 0.00 ? 79  SER A O    4  
ATOM   4626  C  CB   . SER A 1 79 ? 12.845  8.089   -13.431 1.00 0.00 ? 79  SER A CB   4  
ATOM   4627  O  OG   . SER A 1 79 ? 11.779  7.969   -14.357 1.00 0.00 ? 79  SER A OG   4  
ATOM   4628  H  H    . SER A 1 79 ? 15.215  10.011  -13.189 1.00 0.00 ? 79  SER A H    4  
ATOM   4629  H  HA   . SER A 1 79 ? 13.091  10.126  -14.043 1.00 0.00 ? 79  SER A HA   4  
ATOM   4630  H  HB2  . SER A 1 79 ? 13.724  7.623   -13.850 1.00 0.00 ? 79  SER A HB2  4  
ATOM   4631  H  HB3  . SER A 1 79 ? 12.571  7.584   -12.516 1.00 0.00 ? 79  SER A HB3  4  
ATOM   4632  H  HG   . SER A 1 79 ? 11.020  7.576   -13.921 1.00 0.00 ? 79  SER A HG   4  
ATOM   4633  N  N    . SER A 1 80 ? 12.405  11.283  -11.593 1.00 0.00 ? 80  SER A N    4  
ATOM   4634  C  CA   . SER A 1 80 ? 11.508  11.917  -10.634 1.00 0.00 ? 80  SER A CA   4  
ATOM   4635  C  C    . SER A 1 80 ? 10.077  11.943  -11.163 1.00 0.00 ? 80  SER A C    4  
ATOM   4636  O  O    . SER A 1 80 ? 9.182   11.318  -10.596 1.00 0.00 ? 80  SER A O    4  
ATOM   4637  C  CB   . SER A 1 80 ? 11.977  13.340  -10.328 1.00 0.00 ? 80  SER A CB   4  
ATOM   4638  O  OG   . SER A 1 80 ? 11.461  13.792  -9.088  1.00 0.00 ? 80  SER A OG   4  
ATOM   4639  H  H    . SER A 1 80 ? 13.241  11.734  -11.837 1.00 0.00 ? 80  SER A H    4  
ATOM   4640  H  HA   . SER A 1 80 ? 11.532  11.335  -9.724  1.00 0.00 ? 80  SER A HA   4  
ATOM   4641  H  HB2  . SER A 1 80 ? 13.055  13.360  -10.284 1.00 0.00 ? 80  SER A HB2  4  
ATOM   4642  H  HB3  . SER A 1 80 ? 11.637  14.004  -11.109 1.00 0.00 ? 80  SER A HB3  4  
ATOM   4643  H  HG   . SER A 1 80 ? 11.975  14.543  -8.782  1.00 0.00 ? 80  SER A HG   4  
ATOM   4644  N  N    . GLY A 1 81 ? 9.871   12.672  -12.256 1.00 0.00 ? 81  GLY A N    4  
ATOM   4645  C  CA   . GLY A 1 81 ? 8.548   12.768  -12.845 1.00 0.00 ? 81  GLY A CA   4  
ATOM   4646  C  C    . GLY A 1 81 ? 7.594   13.586  -11.997 1.00 0.00 ? 81  GLY A C    4  
ATOM   4647  O  O    . GLY A 1 81 ? 7.501   14.796  -12.199 1.00 0.00 ? 81  GLY A O    4  
ATOM   4648  H  H    . GLY A 1 81 ? 10.623  13.149  -12.665 1.00 0.00 ? 81  GLY A H    4  
ATOM   4649  H  HA2  . GLY A 1 81 ? 8.631   13.226  -13.819 1.00 0.00 ? 81  GLY A HA2  4  
ATOM   4650  H  HA3  . GLY A 1 81 ? 8.145   11.772  -12.960 1.00 0.00 ? 81  GLY A HA3  4  
HETATM 4651  ZN ZN   . ZN  B 2 .  ? -2.913  -2.287  -3.973  1.00 0.00 ? 201 ZN  A ZN   4  
HETATM 4652  ZN ZN   . ZN  C 2 .  ? 13.629  2.760   -3.733  1.00 0.00 ? 401 ZN  A ZN   4  
ATOM   4653  N  N    . GLY A 1 1  ? -25.959 -3.328  -13.221 1.00 0.00 ? 1   GLY A N    5  
ATOM   4654  C  CA   . GLY A 1 1  ? -26.349 -4.313  -14.214 1.00 0.00 ? 1   GLY A CA   5  
ATOM   4655  C  C    . GLY A 1 1  ? -27.397 -5.276  -13.693 1.00 0.00 ? 1   GLY A C    5  
ATOM   4656  O  O    . GLY A 1 1  ? -28.136 -4.957  -12.762 1.00 0.00 ? 1   GLY A O    5  
ATOM   4657  H  H1   . GLY A 1 1  ? -26.584 -2.618  -12.967 1.00 0.00 ? 1   GLY A H1   5  
ATOM   4658  H  HA2  . GLY A 1 1  ? -26.744 -3.800  -15.078 1.00 0.00 ? 1   GLY A HA2  5  
ATOM   4659  H  HA3  . GLY A 1 1  ? -25.475 -4.875  -14.509 1.00 0.00 ? 1   GLY A HA3  5  
ATOM   4660  N  N    . SER A 1 2  ? -27.463 -6.459  -14.297 1.00 0.00 ? 2   SER A N    5  
ATOM   4661  C  CA   . SER A 1 2  ? -28.433 -7.470  -13.892 1.00 0.00 ? 2   SER A CA   5  
ATOM   4662  C  C    . SER A 1 2  ? -28.081 -8.044  -12.523 1.00 0.00 ? 2   SER A C    5  
ATOM   4663  O  O    . SER A 1 2  ? -26.978 -7.838  -12.016 1.00 0.00 ? 2   SER A O    5  
ATOM   4664  C  CB   . SER A 1 2  ? -28.491 -8.594  -14.928 1.00 0.00 ? 2   SER A CB   5  
ATOM   4665  O  OG   . SER A 1 2  ? -29.214 -8.191  -16.079 1.00 0.00 ? 2   SER A OG   5  
ATOM   4666  H  H    . SER A 1 2  ? -26.847 -6.655  -15.033 1.00 0.00 ? 2   SER A H    5  
ATOM   4667  H  HA   . SER A 1 2  ? -29.401 -6.996  -13.833 1.00 0.00 ? 2   SER A HA   5  
ATOM   4668  H  HB2  . SER A 1 2  ? -27.488 -8.861  -15.224 1.00 0.00 ? 2   SER A HB2  5  
ATOM   4669  H  HB3  . SER A 1 2  ? -28.979 -9.455  -14.494 1.00 0.00 ? 2   SER A HB3  5  
ATOM   4670  H  HG   . SER A 1 2  ? -29.666 -8.949  -16.456 1.00 0.00 ? 2   SER A HG   5  
ATOM   4671  N  N    . SER A 1 3  ? -29.027 -8.764  -11.929 1.00 0.00 ? 3   SER A N    5  
ATOM   4672  C  CA   . SER A 1 3  ? -28.819 -9.365  -10.616 1.00 0.00 ? 3   SER A CA   5  
ATOM   4673  C  C    . SER A 1 3  ? -28.612 -10.871 -10.735 1.00 0.00 ? 3   SER A C    5  
ATOM   4674  O  O    . SER A 1 3  ? -29.572 -11.638 -10.805 1.00 0.00 ? 3   SER A O    5  
ATOM   4675  C  CB   . SER A 1 3  ? -30.012 -9.072  -9.704  1.00 0.00 ? 3   SER A CB   5  
ATOM   4676  O  OG   . SER A 1 3  ? -30.029 -7.713  -9.306  1.00 0.00 ? 3   SER A OG   5  
ATOM   4677  H  H    . SER A 1 3  ? -29.886 -8.892  -12.383 1.00 0.00 ? 3   SER A H    5  
ATOM   4678  H  HA   . SER A 1 3  ? -27.932 -8.924  -10.187 1.00 0.00 ? 3   SER A HA   5  
ATOM   4679  H  HB2  . SER A 1 3  ? -30.928 -9.291  -10.232 1.00 0.00 ? 3   SER A HB2  5  
ATOM   4680  H  HB3  . SER A 1 3  ? -29.948 -9.693  -8.822  1.00 0.00 ? 3   SER A HB3  5  
ATOM   4681  H  HG   . SER A 1 3  ? -29.553 -7.184  -9.951  1.00 0.00 ? 3   SER A HG   5  
ATOM   4682  N  N    . GLY A 1 4  ? -27.350 -11.289 -10.757 1.00 0.00 ? 4   GLY A N    5  
ATOM   4683  C  CA   . GLY A 1 4  ? -27.039 -12.702 -10.867 1.00 0.00 ? 4   GLY A CA   5  
ATOM   4684  C  C    . GLY A 1 4  ? -26.315 -13.234 -9.645  1.00 0.00 ? 4   GLY A C    5  
ATOM   4685  O  O    . GLY A 1 4  ? -25.293 -13.909 -9.766  1.00 0.00 ? 4   GLY A O    5  
ATOM   4686  H  H    . GLY A 1 4  ? -26.625 -10.633 -10.698 1.00 0.00 ? 4   GLY A H    5  
ATOM   4687  H  HA2  . GLY A 1 4  ? -27.958 -13.254 -10.997 1.00 0.00 ? 4   GLY A HA2  5  
ATOM   4688  H  HA3  . GLY A 1 4  ? -26.414 -12.855 -11.735 1.00 0.00 ? 4   GLY A HA3  5  
ATOM   4689  N  N    . SER A 1 5  ? -26.846 -12.928 -8.466  1.00 0.00 ? 5   SER A N    5  
ATOM   4690  C  CA   . SER A 1 5  ? -26.241 -13.374 -7.216  1.00 0.00 ? 5   SER A CA   5  
ATOM   4691  C  C    . SER A 1 5  ? -27.312 -13.678 -6.173  1.00 0.00 ? 5   SER A C    5  
ATOM   4692  O  O    . SER A 1 5  ? -28.305 -12.960 -6.059  1.00 0.00 ? 5   SER A O    5  
ATOM   4693  C  CB   . SER A 1 5  ? -25.279 -12.312 -6.683  1.00 0.00 ? 5   SER A CB   5  
ATOM   4694  O  OG   . SER A 1 5  ? -24.257 -12.030 -7.624  1.00 0.00 ? 5   SER A OG   5  
ATOM   4695  H  H    . SER A 1 5  ? -27.663 -12.386 -8.435  1.00 0.00 ? 5   SER A H    5  
ATOM   4696  H  HA   . SER A 1 5  ? -25.688 -14.279 -7.421  1.00 0.00 ? 5   SER A HA   5  
ATOM   4697  H  HB2  . SER A 1 5  ? -25.825 -11.403 -6.480  1.00 0.00 ? 5   SER A HB2  5  
ATOM   4698  H  HB3  . SER A 1 5  ? -24.823 -12.669 -5.770  1.00 0.00 ? 5   SER A HB3  5  
ATOM   4699  H  HG   . SER A 1 5  ? -23.993 -11.111 -7.544  1.00 0.00 ? 5   SER A HG   5  
ATOM   4700  N  N    . SER A 1 6  ? -27.101 -14.747 -5.412  1.00 0.00 ? 6   SER A N    5  
ATOM   4701  C  CA   . SER A 1 6  ? -28.049 -15.149 -4.379  1.00 0.00 ? 6   SER A CA   5  
ATOM   4702  C  C    . SER A 1 6  ? -27.821 -14.358 -3.095  1.00 0.00 ? 6   SER A C    5  
ATOM   4703  O  O    . SER A 1 6  ? -27.855 -14.912 -1.997  1.00 0.00 ? 6   SER A O    5  
ATOM   4704  C  CB   . SER A 1 6  ? -27.924 -16.647 -4.097  1.00 0.00 ? 6   SER A CB   5  
ATOM   4705  O  OG   . SER A 1 6  ? -28.828 -17.053 -3.084  1.00 0.00 ? 6   SER A OG   5  
ATOM   4706  H  H    . SER A 1 6  ? -26.290 -15.279 -5.550  1.00 0.00 ? 6   SER A H    5  
ATOM   4707  H  HA   . SER A 1 6  ? -29.044 -14.942 -4.744  1.00 0.00 ? 6   SER A HA   5  
ATOM   4708  H  HB2  . SER A 1 6  ? -28.141 -17.200 -4.999  1.00 0.00 ? 6   SER A HB2  5  
ATOM   4709  H  HB3  . SER A 1 6  ? -26.917 -16.867 -3.774  1.00 0.00 ? 6   SER A HB3  5  
ATOM   4710  H  HG   . SER A 1 6  ? -29.645 -17.355 -3.487  1.00 0.00 ? 6   SER A HG   5  
ATOM   4711  N  N    . GLY A 1 7  ? -27.588 -13.057 -3.242  1.00 0.00 ? 7   GLY A N    5  
ATOM   4712  C  CA   . GLY A 1 7  ? -27.358 -12.209 -2.086  1.00 0.00 ? 7   GLY A CA   5  
ATOM   4713  C  C    . GLY A 1 7  ? -26.053 -11.444 -2.180  1.00 0.00 ? 7   GLY A C    5  
ATOM   4714  O  O    . GLY A 1 7  ? -24.994 -12.032 -2.403  1.00 0.00 ? 7   GLY A O    5  
ATOM   4715  H  H    . GLY A 1 7  ? -27.573 -12.669 -4.142  1.00 0.00 ? 7   GLY A H    5  
ATOM   4716  H  HA2  . GLY A 1 7  ? -28.172 -11.504 -2.003  1.00 0.00 ? 7   GLY A HA2  5  
ATOM   4717  H  HA3  . GLY A 1 7  ? -27.337 -12.826 -1.200  1.00 0.00 ? 7   GLY A HA3  5  
ATOM   4718  N  N    . LEU A 1 8  ? -26.127 -10.128 -2.010  1.00 0.00 ? 8   LEU A N    5  
ATOM   4719  C  CA   . LEU A 1 8  ? -24.942 -9.280  -2.079  1.00 0.00 ? 8   LEU A CA   5  
ATOM   4720  C  C    . LEU A 1 8  ? -24.688 -8.591  -0.742  1.00 0.00 ? 8   LEU A C    5  
ATOM   4721  O  O    . LEU A 1 8  ? -24.575 -7.367  -0.675  1.00 0.00 ? 8   LEU A O    5  
ATOM   4722  C  CB   . LEU A 1 8  ? -25.102 -8.234  -3.183  1.00 0.00 ? 8   LEU A CB   5  
ATOM   4723  C  CG   . LEU A 1 8  ? -25.201 -8.774  -4.610  1.00 0.00 ? 8   LEU A CG   5  
ATOM   4724  C  CD1  . LEU A 1 8  ? -26.051 -7.853  -5.471  1.00 0.00 ? 8   LEU A CD1  5  
ATOM   4725  C  CD2  . LEU A 1 8  ? -23.814 -8.941  -5.214  1.00 0.00 ? 8   LEU A CD2  5  
ATOM   4726  H  H    . LEU A 1 8  ? -26.998 -9.717  -1.835  1.00 0.00 ? 8   LEU A H    5  
ATOM   4727  H  HA   . LEU A 1 8  ? -24.097 -9.910  -2.311  1.00 0.00 ? 8   LEU A HA   5  
ATOM   4728  H  HB2  . LEU A 1 8  ? -26.002 -7.673  -2.979  1.00 0.00 ? 8   LEU A HB2  5  
ATOM   4729  H  HB3  . LEU A 1 8  ? -24.249 -7.572  -3.136  1.00 0.00 ? 8   LEU A HB3  5  
ATOM   4730  H  HG   . LEU A 1 8  ? -25.677 -9.744  -4.589  1.00 0.00 ? 8   LEU A HG   5  
ATOM   4731  H  HD11 . LEU A 1 8  ? -26.102 -8.245  -6.476  1.00 0.00 ? 8   LEU A HD11 5  
ATOM   4732  H  HD12 . LEU A 1 8  ? -25.609 -6.868  -5.491  1.00 0.00 ? 8   LEU A HD12 5  
ATOM   4733  H  HD13 . LEU A 1 8  ? -27.047 -7.791  -5.057  1.00 0.00 ? 8   LEU A HD13 5  
ATOM   4734  H  HD21 . LEU A 1 8  ? -23.905 -9.182  -6.262  1.00 0.00 ? 8   LEU A HD21 5  
ATOM   4735  H  HD22 . LEU A 1 8  ? -23.295 -9.741  -4.705  1.00 0.00 ? 8   LEU A HD22 5  
ATOM   4736  H  HD23 . LEU A 1 8  ? -23.259 -8.022  -5.102  1.00 0.00 ? 8   LEU A HD23 5  
ATOM   4737  N  N    . ASP A 1 9  ? -24.598 -9.384  0.319   1.00 0.00 ? 9   ASP A N    5  
ATOM   4738  C  CA   . ASP A 1 9  ? -24.354 -8.851  1.655   1.00 0.00 ? 9   ASP A CA   5  
ATOM   4739  C  C    . ASP A 1 9  ? -22.933 -9.162  2.113   1.00 0.00 ? 9   ASP A C    5  
ATOM   4740  O  O    . ASP A 1 9  ? -22.463 -8.629  3.118   1.00 0.00 ? 9   ASP A O    5  
ATOM   4741  C  CB   . ASP A 1 9  ? -25.362 -9.429  2.650   1.00 0.00 ? 9   ASP A CB   5  
ATOM   4742  C  CG   . ASP A 1 9  ? -26.698 -8.713  2.603   1.00 0.00 ? 9   ASP A CG   5  
ATOM   4743  O  OD1  . ASP A 1 9  ? -27.006 -8.102  1.558   1.00 0.00 ? 9   ASP A OD1  5  
ATOM   4744  O  OD2  . ASP A 1 9  ? -27.434 -8.763  3.610   1.00 0.00 ? 9   ASP A OD2  5  
ATOM   4745  H  H    . ASP A 1 9  ? -24.698 -10.353 0.202   1.00 0.00 ? 9   ASP A H    5  
ATOM   4746  H  HA   . ASP A 1 9  ? -24.479 -7.780  1.612   1.00 0.00 ? 9   ASP A HA   5  
ATOM   4747  H  HB2  . ASP A 1 9  ? -25.526 -10.472 2.422   1.00 0.00 ? 9   ASP A HB2  5  
ATOM   4748  H  HB3  . ASP A 1 9  ? -24.962 -9.341  3.649   1.00 0.00 ? 9   ASP A HB3  5  
ATOM   4749  N  N    . TYR A 1 10 ? -22.254 -10.029 1.370   1.00 0.00 ? 10  TYR A N    5  
ATOM   4750  C  CA   . TYR A 1 10 ? -20.887 -10.414 1.702   1.00 0.00 ? 10  TYR A CA   5  
ATOM   4751  C  C    . TYR A 1 10 ? -19.902 -9.317  1.311   1.00 0.00 ? 10  TYR A C    5  
ATOM   4752  O  O    . TYR A 1 10 ? -18.689 -9.490  1.423   1.00 0.00 ? 10  TYR A O    5  
ATOM   4753  C  CB   . TYR A 1 10 ? -20.518 -11.721 0.997   1.00 0.00 ? 10  TYR A CB   5  
ATOM   4754  C  CG   . TYR A 1 10 ? -20.861 -11.732 -0.476  1.00 0.00 ? 10  TYR A CG   5  
ATOM   4755  C  CD1  . TYR A 1 10 ? -21.234 -10.566 -1.132  1.00 0.00 ? 10  TYR A CD1  5  
ATOM   4756  C  CD2  . TYR A 1 10 ? -20.811 -12.910 -1.211  1.00 0.00 ? 10  TYR A CD2  5  
ATOM   4757  C  CE1  . TYR A 1 10 ? -21.549 -10.572 -2.477  1.00 0.00 ? 10  TYR A CE1  5  
ATOM   4758  C  CE2  . TYR A 1 10 ? -21.123 -12.926 -2.557  1.00 0.00 ? 10  TYR A CE2  5  
ATOM   4759  C  CZ   . TYR A 1 10 ? -21.492 -11.754 -3.185  1.00 0.00 ? 10  TYR A CZ   5  
ATOM   4760  O  OH   . TYR A 1 10 ? -21.803 -11.764 -4.525  1.00 0.00 ? 10  TYR A OH   5  
ATOM   4761  H  H    . TYR A 1 10 ? -22.682 -10.421 0.580   1.00 0.00 ? 10  TYR A H    5  
ATOM   4762  H  HA   . TYR A 1 10 ? -20.835 -10.566 2.770   1.00 0.00 ? 10  TYR A HA   5  
ATOM   4763  H  HB2  . TYR A 1 10 ? -19.456 -11.885 1.090   1.00 0.00 ? 10  TYR A HB2  5  
ATOM   4764  H  HB3  . TYR A 1 10 ? -21.046 -12.537 1.467   1.00 0.00 ? 10  TYR A HB3  5  
ATOM   4765  H  HD1  . TYR A 1 10 ? -21.277 -9.641  -0.574  1.00 0.00 ? 10  TYR A HD1  5  
ATOM   4766  H  HD2  . TYR A 1 10 ? -20.522 -13.826 -0.717  1.00 0.00 ? 10  TYR A HD2  5  
ATOM   4767  H  HE1  . TYR A 1 10 ? -21.837 -9.655  -2.969  1.00 0.00 ? 10  TYR A HE1  5  
ATOM   4768  H  HE2  . TYR A 1 10 ? -21.079 -13.851 -3.112  1.00 0.00 ? 10  TYR A HE2  5  
ATOM   4769  H  HH   . TYR A 1 10 ? -22.748 -11.901 -4.633  1.00 0.00 ? 10  TYR A HH   5  
ATOM   4770  N  N    . GLN A 1 11 ? -20.434 -8.188  0.855   1.00 0.00 ? 11  GLN A N    5  
ATOM   4771  C  CA   . GLN A 1 11 ? -19.603 -7.062  0.448   1.00 0.00 ? 11  GLN A CA   5  
ATOM   4772  C  C    . GLN A 1 11 ? -19.924 -5.821  1.274   1.00 0.00 ? 11  GLN A C    5  
ATOM   4773  O  O    . GLN A 1 11 ? -19.029 -5.065  1.652   1.00 0.00 ? 11  GLN A O    5  
ATOM   4774  C  CB   . GLN A 1 11 ? -19.802 -6.764  -1.039  1.00 0.00 ? 11  GLN A CB   5  
ATOM   4775  C  CG   . GLN A 1 11 ? -19.477 -7.941  -1.944  1.00 0.00 ? 11  GLN A CG   5  
ATOM   4776  C  CD   . GLN A 1 11 ? -18.038 -7.930  -2.422  1.00 0.00 ? 11  GLN A CD   5  
ATOM   4777  O  OE1  . GLN A 1 11 ? -17.106 -8.040  -1.624  1.00 0.00 ? 11  GLN A OE1  5  
ATOM   4778  N  NE2  . GLN A 1 11 ? -17.849 -7.797  -3.729  1.00 0.00 ? 11  GLN A NE2  5  
ATOM   4779  H  H    . GLN A 1 11 ? -21.409 -8.111  0.789   1.00 0.00 ? 11  GLN A H    5  
ATOM   4780  H  HA   . GLN A 1 11 ? -18.572 -7.333  0.616   1.00 0.00 ? 11  GLN A HA   5  
ATOM   4781  H  HB2  . GLN A 1 11 ? -20.832 -6.485  -1.203  1.00 0.00 ? 11  GLN A HB2  5  
ATOM   4782  H  HB3  . GLN A 1 11 ? -19.165 -5.938  -1.317  1.00 0.00 ? 11  GLN A HB3  5  
ATOM   4783  H  HG2  . GLN A 1 11 ? -19.651 -8.857  -1.399  1.00 0.00 ? 11  GLN A HG2  5  
ATOM   4784  H  HG3  . GLN A 1 11 ? -20.127 -7.907  -2.806  1.00 0.00 ? 11  GLN A HG3  5  
ATOM   4785  H  HE21 . GLN A 1 11 ? -18.638 -7.714  -4.304  1.00 0.00 ? 11  GLN A HE21 5  
ATOM   4786  H  HE22 . GLN A 1 11 ? -16.929 -7.786  -4.065  1.00 0.00 ? 11  GLN A HE22 5  
ATOM   4787  N  N    . ARG A 1 12 ? -21.208 -5.617  1.552   1.00 0.00 ? 12  ARG A N    5  
ATOM   4788  C  CA   . ARG A 1 12 ? -21.648 -4.467  2.332   1.00 0.00 ? 12  ARG A CA   5  
ATOM   4789  C  C    . ARG A 1 12 ? -20.720 -4.229  3.520   1.00 0.00 ? 12  ARG A C    5  
ATOM   4790  O  O    . ARG A 1 12 ? -20.515 -3.090  3.942   1.00 0.00 ? 12  ARG A O    5  
ATOM   4791  C  CB   . ARG A 1 12 ? -23.081 -4.676  2.825   1.00 0.00 ? 12  ARG A CB   5  
ATOM   4792  C  CG   . ARG A 1 12 ? -24.134 -4.067  1.913   1.00 0.00 ? 12  ARG A CG   5  
ATOM   4793  C  CD   . ARG A 1 12 ? -24.374 -2.601  2.240   1.00 0.00 ? 12  ARG A CD   5  
ATOM   4794  N  NE   . ARG A 1 12 ? -23.392 -1.730  1.602   1.00 0.00 ? 12  ARG A NE   5  
ATOM   4795  C  CZ   . ARG A 1 12 ? -23.330 -1.529  0.290   1.00 0.00 ? 12  ARG A CZ   5  
ATOM   4796  N  NH1  . ARG A 1 12 ? -24.189 -2.134  -0.518  1.00 0.00 ? 12  ARG A NH1  5  
ATOM   4797  N  NH2  . ARG A 1 12 ? -22.407 -0.721  -0.216  1.00 0.00 ? 12  ARG A NH2  5  
ATOM   4798  H  H    . ARG A 1 12 ? -21.876 -6.255  1.223   1.00 0.00 ? 12  ARG A H    5  
ATOM   4799  H  HA   . ARG A 1 12 ? -21.621 -3.600  1.690   1.00 0.00 ? 12  ARG A HA   5  
ATOM   4800  H  HB2  . ARG A 1 12 ? -23.273 -5.736  2.900   1.00 0.00 ? 12  ARG A HB2  5  
ATOM   4801  H  HB3  . ARG A 1 12 ? -23.181 -4.229  3.802   1.00 0.00 ? 12  ARG A HB3  5  
ATOM   4802  H  HG2  . ARG A 1 12 ? -23.798 -4.145  0.889   1.00 0.00 ? 12  ARG A HG2  5  
ATOM   4803  H  HG3  . ARG A 1 12 ? -25.059 -4.610  2.033   1.00 0.00 ? 12  ARG A HG3  5  
ATOM   4804  H  HD2  . ARG A 1 12 ? -25.361 -2.327  1.898   1.00 0.00 ? 12  ARG A HD2  5  
ATOM   4805  H  HD3  . ARG A 1 12 ? -24.315 -2.472  3.310   1.00 0.00 ? 12  ARG A HD3  5  
ATOM   4806  H  HE   . ARG A 1 12 ? -22.747 -1.272  2.180   1.00 0.00 ? 12  ARG A HE   5  
ATOM   4807  H  HH11 . ARG A 1 12 ? -24.886 -2.743  -0.139  1.00 0.00 ? 12  ARG A HH11 5  
ATOM   4808  H  HH12 . ARG A 1 12 ? -24.141 -1.980  -1.505  1.00 0.00 ? 12  ARG A HH12 5  
ATOM   4809  H  HH21 . ARG A 1 12 ? -21.758 -0.262  0.390   1.00 0.00 ? 12  ARG A HH21 5  
ATOM   4810  H  HH22 . ARG A 1 12 ? -22.361 -0.570  -1.203  1.00 0.00 ? 12  ARG A HH22 5  
ATOM   4811  N  N    . LEU A 1 13 ? -20.163 -5.310  4.054   1.00 0.00 ? 13  LEU A N    5  
ATOM   4812  C  CA   . LEU A 1 13 ? -19.257 -5.219  5.194   1.00 0.00 ? 13  LEU A CA   5  
ATOM   4813  C  C    . LEU A 1 13 ? -18.323 -4.021  5.054   1.00 0.00 ? 13  LEU A C    5  
ATOM   4814  O  O    . LEU A 1 13 ? -18.147 -3.484  3.960   1.00 0.00 ? 13  LEU A O    5  
ATOM   4815  C  CB   . LEU A 1 13 ? -18.439 -6.506  5.324   1.00 0.00 ? 13  LEU A CB   5  
ATOM   4816  C  CG   . LEU A 1 13 ? -17.940 -7.119  4.015   1.00 0.00 ? 13  LEU A CG   5  
ATOM   4817  C  CD1  . LEU A 1 13 ? -16.750 -6.337  3.479   1.00 0.00 ? 13  LEU A CD1  5  
ATOM   4818  C  CD2  . LEU A 1 13 ? -17.572 -8.581  4.217   1.00 0.00 ? 13  LEU A CD2  5  
ATOM   4819  H  H    . LEU A 1 13 ? -20.364 -6.190  3.674   1.00 0.00 ? 13  LEU A H    5  
ATOM   4820  H  HA   . LEU A 1 13 ? -19.855 -5.091  6.084   1.00 0.00 ? 13  LEU A HA   5  
ATOM   4821  H  HB2  . LEU A 1 13 ? -17.578 -6.289  5.937   1.00 0.00 ? 13  LEU A HB2  5  
ATOM   4822  H  HB3  . LEU A 1 13 ? -19.057 -7.240  5.820   1.00 0.00 ? 13  LEU A HB3  5  
ATOM   4823  H  HG   . LEU A 1 13 ? -18.730 -7.070  3.278   1.00 0.00 ? 13  LEU A HG   5  
ATOM   4824  H  HD11 . LEU A 1 13 ? -17.061 -5.334  3.230   1.00 0.00 ? 13  LEU A HD11 5  
ATOM   4825  H  HD12 . LEU A 1 13 ? -16.367 -6.826  2.595   1.00 0.00 ? 13  LEU A HD12 5  
ATOM   4826  H  HD13 . LEU A 1 13 ? -15.976 -6.299  4.232   1.00 0.00 ? 13  LEU A HD13 5  
ATOM   4827  H  HD21 . LEU A 1 13 ? -18.360 -9.077  4.765   1.00 0.00 ? 13  LEU A HD21 5  
ATOM   4828  H  HD22 . LEU A 1 13 ? -16.650 -8.647  4.776   1.00 0.00 ? 13  LEU A HD22 5  
ATOM   4829  H  HD23 . LEU A 1 13 ? -17.446 -9.057  3.256   1.00 0.00 ? 13  LEU A HD23 5  
ATOM   4830  N  N    . TYR A 1 14 ? -17.726 -3.610  6.167   1.00 0.00 ? 14  TYR A N    5  
ATOM   4831  C  CA   . TYR A 1 14 ? -16.810 -2.475  6.168   1.00 0.00 ? 14  TYR A CA   5  
ATOM   4832  C  C    . TYR A 1 14 ? -16.032 -2.402  4.858   1.00 0.00 ? 14  TYR A C    5  
ATOM   4833  O  O    . TYR A 1 14 ? -15.882 -1.332  4.270   1.00 0.00 ? 14  TYR A O    5  
ATOM   4834  C  CB   . TYR A 1 14 ? -15.839 -2.578  7.345   1.00 0.00 ? 14  TYR A CB   5  
ATOM   4835  C  CG   . TYR A 1 14 ? -15.040 -3.862  7.361   1.00 0.00 ? 14  TYR A CG   5  
ATOM   4836  C  CD1  . TYR A 1 14 ? -15.585 -5.036  7.866   1.00 0.00 ? 14  TYR A CD1  5  
ATOM   4837  C  CD2  . TYR A 1 14 ? -13.740 -3.901  6.871   1.00 0.00 ? 14  TYR A CD2  5  
ATOM   4838  C  CE1  . TYR A 1 14 ? -14.858 -6.211  7.883   1.00 0.00 ? 14  TYR A CE1  5  
ATOM   4839  C  CE2  . TYR A 1 14 ? -13.007 -5.071  6.883   1.00 0.00 ? 14  TYR A CE2  5  
ATOM   4840  C  CZ   . TYR A 1 14 ? -13.570 -6.224  7.390   1.00 0.00 ? 14  TYR A CZ   5  
ATOM   4841  O  OH   . TYR A 1 14 ? -12.843 -7.392  7.405   1.00 0.00 ? 14  TYR A OH   5  
ATOM   4842  H  H    . TYR A 1 14 ? -17.906 -4.079  7.008   1.00 0.00 ? 14  TYR A H    5  
ATOM   4843  H  HA   . TYR A 1 14 ? -17.397 -1.575  6.276   1.00 0.00 ? 14  TYR A HA   5  
ATOM   4844  H  HB2  . TYR A 1 14 ? -15.143 -1.756  7.302   1.00 0.00 ? 14  TYR A HB2  5  
ATOM   4845  H  HB3  . TYR A 1 14 ? -16.397 -2.523  8.269   1.00 0.00 ? 14  TYR A HB3  5  
ATOM   4846  H  HD1  . TYR A 1 14 ? -16.594 -5.023  8.252   1.00 0.00 ? 14  TYR A HD1  5  
ATOM   4847  H  HD2  . TYR A 1 14 ? -13.302 -2.996  6.475   1.00 0.00 ? 14  TYR A HD2  5  
ATOM   4848  H  HE1  . TYR A 1 14 ? -15.299 -7.114  8.280   1.00 0.00 ? 14  TYR A HE1  5  
ATOM   4849  H  HE2  . TYR A 1 14 ? -11.998 -5.081  6.497   1.00 0.00 ? 14  TYR A HE2  5  
ATOM   4850  H  HH   . TYR A 1 14 ? -13.328 -8.065  7.887   1.00 0.00 ? 14  TYR A HH   5  
ATOM   4851  N  N    . GLY A 1 15 ? -15.538 -3.551  4.405   1.00 0.00 ? 15  GLY A N    5  
ATOM   4852  C  CA   . GLY A 1 15 ? -14.782 -3.596  3.167   1.00 0.00 ? 15  GLY A CA   5  
ATOM   4853  C  C    . GLY A 1 15 ? -13.534 -2.737  3.218   1.00 0.00 ? 15  GLY A C    5  
ATOM   4854  O  O    . GLY A 1 15 ? -13.555 -1.628  3.753   1.00 0.00 ? 15  GLY A O    5  
ATOM   4855  H  H    . GLY A 1 15 ? -15.689 -4.374  4.915   1.00 0.00 ? 15  GLY A H    5  
ATOM   4856  H  HA2  . GLY A 1 15 ? -14.495 -4.619  2.971   1.00 0.00 ? 15  GLY A HA2  5  
ATOM   4857  H  HA3  . GLY A 1 15 ? -15.411 -3.249  2.361   1.00 0.00 ? 15  GLY A HA3  5  
ATOM   4858  N  N    . THR A 1 16 ? -12.441 -3.250  2.662   1.00 0.00 ? 16  THR A N    5  
ATOM   4859  C  CA   . THR A 1 16 ? -11.177 -2.524  2.648   1.00 0.00 ? 16  THR A CA   5  
ATOM   4860  C  C    . THR A 1 16 ? -10.586 -2.475  1.244   1.00 0.00 ? 16  THR A C    5  
ATOM   4861  O  O    . THR A 1 16 ? -9.967  -3.436  0.787   1.00 0.00 ? 16  THR A O    5  
ATOM   4862  C  CB   . THR A 1 16 ? -10.152 -3.164  3.603   1.00 0.00 ? 16  THR A CB   5  
ATOM   4863  O  OG1  . THR A 1 16 ? -10.552 -2.957  4.962   1.00 0.00 ? 16  THR A OG1  5  
ATOM   4864  C  CG2  . THR A 1 16 ? -8.766  -2.576  3.382   1.00 0.00 ? 16  THR A CG2  5  
ATOM   4865  H  H    . THR A 1 16 ? -12.487 -4.139  2.251   1.00 0.00 ? 16  THR A H    5  
ATOM   4866  H  HA   . THR A 1 16 ? -11.369 -1.515  2.983   1.00 0.00 ? 16  THR A HA   5  
ATOM   4867  H  HB   . THR A 1 16 ? -10.112 -4.226  3.405   1.00 0.00 ? 16  THR A HB   5  
ATOM   4868  H  HG1  . THR A 1 16 ? -10.955 -3.759  5.303   1.00 0.00 ? 16  THR A HG1  5  
ATOM   4869  H  HG21 . THR A 1 16 ? -8.390  -2.181  4.313   1.00 0.00 ? 16  THR A HG21 5  
ATOM   4870  H  HG22 . THR A 1 16 ? -8.824  -1.783  2.651   1.00 0.00 ? 16  THR A HG22 5  
ATOM   4871  H  HG23 . THR A 1 16 ? -8.101  -3.348  3.024   1.00 0.00 ? 16  THR A HG23 5  
ATOM   4872  N  N    . ARG A 1 17 ? -10.780 -1.350  0.564   1.00 0.00 ? 17  ARG A N    5  
ATOM   4873  C  CA   . ARG A 1 17 ? -10.266 -1.177  -0.789  1.00 0.00 ? 17  ARG A CA   5  
ATOM   4874  C  C    . ARG A 1 17 ? -8.925  -0.448  -0.772  1.00 0.00 ? 17  ARG A C    5  
ATOM   4875  O  O    . ARG A 1 17 ? -8.829  0.686   -0.301  1.00 0.00 ? 17  ARG A O    5  
ATOM   4876  C  CB   . ARG A 1 17 ? -11.270 -0.400  -1.643  1.00 0.00 ? 17  ARG A CB   5  
ATOM   4877  C  CG   . ARG A 1 17 ? -11.215 -0.755  -3.120  1.00 0.00 ? 17  ARG A CG   5  
ATOM   4878  C  CD   . ARG A 1 17 ? -12.055 0.200   -3.954  1.00 0.00 ? 17  ARG A CD   5  
ATOM   4879  N  NE   . ARG A 1 17 ? -11.417 1.505   -4.100  1.00 0.00 ? 17  ARG A NE   5  
ATOM   4880  C  CZ   . ARG A 1 17 ? -11.609 2.515   -3.259  1.00 0.00 ? 17  ARG A CZ   5  
ATOM   4881  N  NH1  . ARG A 1 17 ? -12.416 2.370   -2.217  1.00 0.00 ? 17  ARG A NH1  5  
ATOM   4882  N  NH2  . ARG A 1 17 ? -10.993 3.673   -3.459  1.00 0.00 ? 17  ARG A NH2  5  
ATOM   4883  H  H    . ARG A 1 17 ? -11.282 -0.619  0.982   1.00 0.00 ? 17  ARG A H    5  
ATOM   4884  H  HA   . ARG A 1 17 ? -10.124 -2.157  -1.218  1.00 0.00 ? 17  ARG A HA   5  
ATOM   4885  H  HB2  . ARG A 1 17 ? -12.267 -0.606  -1.283  1.00 0.00 ? 17  ARG A HB2  5  
ATOM   4886  H  HB3  . ARG A 1 17 ? -11.070 0.655   -1.542  1.00 0.00 ? 17  ARG A HB3  5  
ATOM   4887  H  HG2  . ARG A 1 17 ? -10.190 -0.702  -3.456  1.00 0.00 ? 17  ARG A HG2  5  
ATOM   4888  H  HG3  . ARG A 1 17 ? -11.588 -1.760  -3.253  1.00 0.00 ? 17  ARG A HG3  5  
ATOM   4889  H  HD2  . ARG A 1 17 ? -12.200 -0.231  -4.933  1.00 0.00 ? 17  ARG A HD2  5  
ATOM   4890  H  HD3  . ARG A 1 17 ? -13.013 0.329   -3.473  1.00 0.00 ? 17  ARG A HD3  5  
ATOM   4891  H  HE   . ARG A 1 17 ? -10.817 1.634   -4.863  1.00 0.00 ? 17  ARG A HE   5  
ATOM   4892  H  HH11 . ARG A 1 17 ? -12.881 1.498   -2.063  1.00 0.00 ? 17  ARG A HH11 5  
ATOM   4893  H  HH12 . ARG A 1 17 ? -12.558 3.132   -1.584  1.00 0.00 ? 17  ARG A HH12 5  
ATOM   4894  H  HH21 . ARG A 1 17 ? -10.383 3.786   -4.243  1.00 0.00 ? 17  ARG A HH21 5  
ATOM   4895  H  HH22 . ARG A 1 17 ? -11.138 4.432   -2.825  1.00 0.00 ? 17  ARG A HH22 5  
ATOM   4896  N  N    . CYS A 1 18 ? -7.893  -1.107  -1.288  1.00 0.00 ? 18  CYS A N    5  
ATOM   4897  C  CA   . CYS A 1 18 ? -6.558  -0.524  -1.332  1.00 0.00 ? 18  CYS A CA   5  
ATOM   4898  C  C    . CYS A 1 18 ? -6.605  0.903   -1.871  1.00 0.00 ? 18  CYS A C    5  
ATOM   4899  O  O    . CYS A 1 18 ? -7.196  1.163   -2.920  1.00 0.00 ? 18  CYS A O    5  
ATOM   4900  C  CB   . CYS A 1 18 ? -5.633  -1.379  -2.201  1.00 0.00 ? 18  CYS A CB   5  
ATOM   4901  S  SG   . CYS A 1 18 ? -3.934  -0.736  -2.334  1.00 0.00 ? 18  CYS A SG   5  
ATOM   4902  H  H    . CYS A 1 18 ? -8.033  -2.008  -1.649  1.00 0.00 ? 18  CYS A H    5  
ATOM   4903  H  HA   . CYS A 1 18 ? -6.172  -0.502  -0.324  1.00 0.00 ? 18  CYS A HA   5  
ATOM   4904  H  HB2  . CYS A 1 18 ? -5.576  -2.373  -1.782  1.00 0.00 ? 18  CYS A HB2  5  
ATOM   4905  H  HB3  . CYS A 1 18 ? -6.042  -1.437  -3.199  1.00 0.00 ? 18  CYS A HB3  5  
ATOM   4906  N  N    . PHE A 1 19 ? -5.978  1.824   -1.147  1.00 0.00 ? 19  PHE A N    5  
ATOM   4907  C  CA   . PHE A 1 19 ? -5.948  3.225   -1.552  1.00 0.00 ? 19  PHE A CA   5  
ATOM   4908  C  C    . PHE A 1 19 ? -4.797  3.488   -2.518  1.00 0.00 ? 19  PHE A C    5  
ATOM   4909  O  O    . PHE A 1 19 ? -4.276  4.600   -2.592  1.00 0.00 ? 19  PHE A O    5  
ATOM   4910  C  CB   . PHE A 1 19 ? -5.815  4.130   -0.325  1.00 0.00 ? 19  PHE A CB   5  
ATOM   4911  C  CG   . PHE A 1 19 ? -7.134  4.592   0.225   1.00 0.00 ? 19  PHE A CG   5  
ATOM   4912  C  CD1  . PHE A 1 19 ? -7.872  5.563   -0.433  1.00 0.00 ? 19  PHE A CD1  5  
ATOM   4913  C  CD2  . PHE A 1 19 ? -7.636  4.056   1.400   1.00 0.00 ? 19  PHE A CD2  5  
ATOM   4914  C  CE1  . PHE A 1 19 ? -9.086  5.991   0.070   1.00 0.00 ? 19  PHE A CE1  5  
ATOM   4915  C  CE2  . PHE A 1 19 ? -8.850  4.480   1.908   1.00 0.00 ? 19  PHE A CE2  5  
ATOM   4916  C  CZ   . PHE A 1 19 ? -9.575  5.449   1.243   1.00 0.00 ? 19  PHE A CZ   5  
ATOM   4917  H  H    . PHE A 1 19 ? -5.525  1.556   -0.320  1.00 0.00 ? 19  PHE A H    5  
ATOM   4918  H  HA   . PHE A 1 19 ? -6.879  3.445   -2.051  1.00 0.00 ? 19  PHE A HA   5  
ATOM   4919  H  HB2  . PHE A 1 19 ? -5.301  3.591   0.457   1.00 0.00 ? 19  PHE A HB2  5  
ATOM   4920  H  HB3  . PHE A 1 19 ? -5.240  5.003   -0.592  1.00 0.00 ? 19  PHE A HB3  5  
ATOM   4921  H  HD1  . PHE A 1 19 ? -7.490  5.988   -1.351  1.00 0.00 ? 19  PHE A HD1  5  
ATOM   4922  H  HD2  . PHE A 1 19 ? -7.069  3.299   1.922   1.00 0.00 ? 19  PHE A HD2  5  
ATOM   4923  H  HE1  . PHE A 1 19 ? -9.650  6.749   -0.453  1.00 0.00 ? 19  PHE A HE1  5  
ATOM   4924  H  HE2  . PHE A 1 19 ? -9.230  4.055   2.825   1.00 0.00 ? 19  PHE A HE2  5  
ATOM   4925  H  HZ   . PHE A 1 19 ? -10.524 5.781   1.637   1.00 0.00 ? 19  PHE A HZ   5  
ATOM   4926  N  N    . SER A 1 20 ? -4.407  2.455   -3.258  1.00 0.00 ? 20  SER A N    5  
ATOM   4927  C  CA   . SER A 1 20 ? -3.315  2.572   -4.218  1.00 0.00 ? 20  SER A CA   5  
ATOM   4928  C  C    . SER A 1 20 ? -3.773  2.162   -5.614  1.00 0.00 ? 20  SER A C    5  
ATOM   4929  O  O    . SER A 1 20 ? -3.880  2.995   -6.515  1.00 0.00 ? 20  SER A O    5  
ATOM   4930  C  CB   . SER A 1 20 ? -2.130  1.707   -3.783  1.00 0.00 ? 20  SER A CB   5  
ATOM   4931  O  OG   . SER A 1 20 ? -0.937  2.112   -4.431  1.00 0.00 ? 20  SER A OG   5  
ATOM   4932  H  H    . SER A 1 20 ? -4.862  1.593   -3.154  1.00 0.00 ? 20  SER A H    5  
ATOM   4933  H  HA   . SER A 1 20 ? -3.004  3.606   -4.243  1.00 0.00 ? 20  SER A HA   5  
ATOM   4934  H  HB2  . SER A 1 20 ? -1.995  1.797   -2.716  1.00 0.00 ? 20  SER A HB2  5  
ATOM   4935  H  HB3  . SER A 1 20 ? -2.330  0.675   -4.034  1.00 0.00 ? 20  SER A HB3  5  
ATOM   4936  H  HG   . SER A 1 20 ? -0.235  1.490   -4.228  1.00 0.00 ? 20  SER A HG   5  
ATOM   4937  N  N    . CYS A 1 21 ? -4.041  0.872   -5.787  1.00 0.00 ? 21  CYS A N    5  
ATOM   4938  C  CA   . CYS A 1 21 ? -4.487  0.349   -7.073  1.00 0.00 ? 21  CYS A CA   5  
ATOM   4939  C  C    . CYS A 1 21 ? -6.009  0.393   -7.180  1.00 0.00 ? 21  CYS A C    5  
ATOM   4940  O  O    . CYS A 1 21 ? -6.573  0.173   -8.252  1.00 0.00 ? 21  CYS A O    5  
ATOM   4941  C  CB   . CYS A 1 21 ? -3.992  -1.086  -7.262  1.00 0.00 ? 21  CYS A CB   5  
ATOM   4942  S  SG   . CYS A 1 21 ? -4.440  -2.212  -5.902  1.00 0.00 ? 21  CYS A SG   5  
ATOM   4943  H  H    . CYS A 1 21 ? -3.936  0.256   -5.031  1.00 0.00 ? 21  CYS A H    5  
ATOM   4944  H  HA   . CYS A 1 21 ? -4.066  0.971   -7.848  1.00 0.00 ? 21  CYS A HA   5  
ATOM   4945  H  HB2  . CYS A 1 21 ? -4.415  -1.487  -8.172  1.00 0.00 ? 21  CYS A HB2  5  
ATOM   4946  H  HB3  . CYS A 1 21 ? -2.916  -1.080  -7.344  1.00 0.00 ? 21  CYS A HB3  5  
ATOM   4947  N  N    . ASP A 1 22 ? -6.667  0.678   -6.062  1.00 0.00 ? 22  ASP A N    5  
ATOM   4948  C  CA   . ASP A 1 22 ? -8.123  0.752   -6.029  1.00 0.00 ? 22  ASP A CA   5  
ATOM   4949  C  C    . ASP A 1 22 ? -8.741  -0.635  -6.174  1.00 0.00 ? 22  ASP A C    5  
ATOM   4950  O  O    . ASP A 1 22 ? -9.605  -0.853  -7.023  1.00 0.00 ? 22  ASP A O    5  
ATOM   4951  C  CB   . ASP A 1 22 ? -8.633  1.670   -7.140  1.00 0.00 ? 22  ASP A CB   5  
ATOM   4952  C  CG   . ASP A 1 22 ? -7.836  2.956   -7.240  1.00 0.00 ? 22  ASP A CG   5  
ATOM   4953  O  OD1  . ASP A 1 22 ? -7.896  3.767   -6.292  1.00 0.00 ? 22  ASP A OD1  5  
ATOM   4954  O  OD2  . ASP A 1 22 ? -7.153  3.152   -8.267  1.00 0.00 ? 22  ASP A OD2  5  
ATOM   4955  H  H    . ASP A 1 22 ? -6.161  0.843   -5.238  1.00 0.00 ? 22  ASP A H    5  
ATOM   4956  H  HA   . ASP A 1 22 ? -8.412  1.163   -5.074  1.00 0.00 ? 22  ASP A HA   5  
ATOM   4957  H  HB2  . ASP A 1 22 ? -8.565  1.152   -8.086  1.00 0.00 ? 22  ASP A HB2  5  
ATOM   4958  H  HB3  . ASP A 1 22 ? -9.665  1.921   -6.945  1.00 0.00 ? 22  ASP A HB3  5  
ATOM   4959  N  N    . GLN A 1 23 ? -8.291  -1.568  -5.341  1.00 0.00 ? 23  GLN A N    5  
ATOM   4960  C  CA   . GLN A 1 23 ? -8.799  -2.934  -5.379  1.00 0.00 ? 23  GLN A CA   5  
ATOM   4961  C  C    . GLN A 1 23 ? -9.026  -3.469  -3.969  1.00 0.00 ? 23  GLN A C    5  
ATOM   4962  O  O    . GLN A 1 23 ? -8.268  -3.165  -3.048  1.00 0.00 ? 23  GLN A O    5  
ATOM   4963  C  CB   . GLN A 1 23 ? -7.825  -3.842  -6.131  1.00 0.00 ? 23  GLN A CB   5  
ATOM   4964  C  CG   . GLN A 1 23 ? -7.442  -3.318  -7.506  1.00 0.00 ? 23  GLN A CG   5  
ATOM   4965  C  CD   . GLN A 1 23 ? -8.649  -2.958  -8.350  1.00 0.00 ? 23  GLN A CD   5  
ATOM   4966  O  OE1  . GLN A 1 23 ? -9.671  -3.644  -8.316  1.00 0.00 ? 23  GLN A OE1  5  
ATOM   4967  N  NE2  . GLN A 1 23 ? -8.537  -1.877  -9.112  1.00 0.00 ? 23  GLN A NE2  5  
ATOM   4968  H  H    . GLN A 1 23 ? -7.601  -1.332  -4.687  1.00 0.00 ? 23  GLN A H    5  
ATOM   4969  H  HA   . GLN A 1 23 ? -9.743  -2.922  -5.902  1.00 0.00 ? 23  GLN A HA   5  
ATOM   4970  H  HB2  . GLN A 1 23 ? -6.924  -3.947  -5.546  1.00 0.00 ? 23  GLN A HB2  5  
ATOM   4971  H  HB3  . GLN A 1 23 ? -8.279  -4.814  -6.254  1.00 0.00 ? 23  GLN A HB3  5  
ATOM   4972  H  HG2  . GLN A 1 23 ? -6.832  -2.436  -7.384  1.00 0.00 ? 23  GLN A HG2  5  
ATOM   4973  H  HG3  . GLN A 1 23 ? -6.874  -4.079  -8.021  1.00 0.00 ? 23  GLN A HG3  5  
ATOM   4974  H  HE21 . GLN A 1 23 ? -7.693  -1.380  -9.089  1.00 0.00 ? 23  GLN A HE21 5  
ATOM   4975  H  HE22 . GLN A 1 23 ? -9.302  -1.622  -9.668  1.00 0.00 ? 23  GLN A HE22 5  
ATOM   4976  N  N    . PHE A 1 24 ? -10.075 -4.269  -3.807  1.00 0.00 ? 24  PHE A N    5  
ATOM   4977  C  CA   . PHE A 1 24 ? -10.404 -4.846  -2.508  1.00 0.00 ? 24  PHE A CA   5  
ATOM   4978  C  C    . PHE A 1 24 ? -9.267  -5.729  -2.003  1.00 0.00 ? 24  PHE A C    5  
ATOM   4979  O  O    . PHE A 1 24 ? -8.839  -6.659  -2.686  1.00 0.00 ? 24  PHE A O    5  
ATOM   4980  C  CB   . PHE A 1 24 ? -11.695 -5.661  -2.601  1.00 0.00 ? 24  PHE A CB   5  
ATOM   4981  C  CG   . PHE A 1 24 ? -12.937 -4.816  -2.617  1.00 0.00 ? 24  PHE A CG   5  
ATOM   4982  C  CD1  . PHE A 1 24 ? -13.034 -3.720  -3.458  1.00 0.00 ? 24  PHE A CD1  5  
ATOM   4983  C  CD2  . PHE A 1 24 ? -14.008 -5.119  -1.791  1.00 0.00 ? 24  PHE A CD2  5  
ATOM   4984  C  CE1  . PHE A 1 24 ? -14.176 -2.941  -3.474  1.00 0.00 ? 24  PHE A CE1  5  
ATOM   4985  C  CE2  . PHE A 1 24 ? -15.152 -4.344  -1.803  1.00 0.00 ? 24  PHE A CE2  5  
ATOM   4986  C  CZ   . PHE A 1 24 ? -15.236 -3.254  -2.647  1.00 0.00 ? 24  PHE A CZ   5  
ATOM   4987  H  H    . PHE A 1 24 ? -10.643 -4.475  -4.579  1.00 0.00 ? 24  PHE A H    5  
ATOM   4988  H  HA   . PHE A 1 24 ? -10.549 -4.033  -1.813  1.00 0.00 ? 24  PHE A HA   5  
ATOM   4989  H  HB2  . PHE A 1 24 ? -11.680 -6.245  -3.509  1.00 0.00 ? 24  PHE A HB2  5  
ATOM   4990  H  HB3  . PHE A 1 24 ? -11.755 -6.324  -1.751  1.00 0.00 ? 24  PHE A HB3  5  
ATOM   4991  H  HD1  . PHE A 1 24 ? -12.206 -3.474  -4.107  1.00 0.00 ? 24  PHE A HD1  5  
ATOM   4992  H  HD2  . PHE A 1 24 ? -13.943 -5.972  -1.130  1.00 0.00 ? 24  PHE A HD2  5  
ATOM   4993  H  HE1  . PHE A 1 24 ? -14.239 -2.089  -4.135  1.00 0.00 ? 24  PHE A HE1  5  
ATOM   4994  H  HE2  . PHE A 1 24 ? -15.979 -4.592  -1.154  1.00 0.00 ? 24  PHE A HE2  5  
ATOM   4995  H  HZ   . PHE A 1 24 ? -16.129 -2.646  -2.657  1.00 0.00 ? 24  PHE A HZ   5  
ATOM   4996  N  N    . ILE A 1 25 ? -8.782  -5.429  -0.802  1.00 0.00 ? 25  ILE A N    5  
ATOM   4997  C  CA   . ILE A 1 25 ? -7.696  -6.195  -0.204  1.00 0.00 ? 25  ILE A CA   5  
ATOM   4998  C  C    . ILE A 1 25 ? -8.223  -7.446  0.490   1.00 0.00 ? 25  ILE A C    5  
ATOM   4999  O  O    . ILE A 1 25 ? -8.878  -7.362  1.528   1.00 0.00 ? 25  ILE A O    5  
ATOM   5000  C  CB   . ILE A 1 25 ? -6.905  -5.351  0.813   1.00 0.00 ? 25  ILE A CB   5  
ATOM   5001  C  CG1  . ILE A 1 25 ? -6.539  -3.994  0.208   1.00 0.00 ? 25  ILE A CG1  5  
ATOM   5002  C  CG2  . ILE A 1 25 ? -5.654  -6.094  1.258   1.00 0.00 ? 25  ILE A CG2  5  
ATOM   5003  C  CD1  . ILE A 1 25 ? -6.075  -2.982  1.232   1.00 0.00 ? 25  ILE A CD1  5  
ATOM   5004  H  H    . ILE A 1 25 ? -9.165  -4.675  -0.306  1.00 0.00 ? 25  ILE A H    5  
ATOM   5005  H  HA   . ILE A 1 25 ? -7.023  -6.492  -0.996  1.00 0.00 ? 25  ILE A HA   5  
ATOM   5006  H  HB   . ILE A 1 25 ? -7.529  -5.195  1.679   1.00 0.00 ? 25  ILE A HB   5  
ATOM   5007  H  HG12 . ILE A 1 25 ? -5.744  -4.129  -0.508  1.00 0.00 ? 25  ILE A HG12 5  
ATOM   5008  H  HG13 . ILE A 1 25 ? -7.405  -3.587  -0.293  1.00 0.00 ? 25  ILE A HG13 5  
ATOM   5009  H  HG21 . ILE A 1 25 ? -5.005  -5.416  1.794   1.00 0.00 ? 25  ILE A HG21 5  
ATOM   5010  H  HG22 . ILE A 1 25 ? -5.933  -6.911  1.906   1.00 0.00 ? 25  ILE A HG22 5  
ATOM   5011  H  HG23 . ILE A 1 25 ? -5.136  -6.479  0.393   1.00 0.00 ? 25  ILE A HG23 5  
ATOM   5012  H  HD11 . ILE A 1 25 ? -5.993  -3.458  2.198   1.00 0.00 ? 25  ILE A HD11 5  
ATOM   5013  H  HD12 . ILE A 1 25 ? -5.112  -2.590  0.940   1.00 0.00 ? 25  ILE A HD12 5  
ATOM   5014  H  HD13 . ILE A 1 25 ? -6.790  -2.174  1.288   1.00 0.00 ? 25  ILE A HD13 5  
ATOM   5015  N  N    . GLU A 1 26 ? -7.929  -8.606  -0.089  1.00 0.00 ? 26  GLU A N    5  
ATOM   5016  C  CA   . GLU A 1 26 ? -8.373  -9.875  0.475   1.00 0.00 ? 26  GLU A CA   5  
ATOM   5017  C  C    . GLU A 1 26 ? -7.235  -10.566 1.222   1.00 0.00 ? 26  GLU A C    5  
ATOM   5018  O  O    . GLU A 1 26 ? -6.062  -10.362 0.913   1.00 0.00 ? 26  GLU A O    5  
ATOM   5019  C  CB   . GLU A 1 26 ? -8.904  -10.792 -0.629  1.00 0.00 ? 26  GLU A CB   5  
ATOM   5020  C  CG   . GLU A 1 26 ? -9.361  -12.150 -0.124  1.00 0.00 ? 26  GLU A CG   5  
ATOM   5021  C  CD   . GLU A 1 26 ? -9.987  -12.998 -1.215  1.00 0.00 ? 26  GLU A CD   5  
ATOM   5022  O  OE1  . GLU A 1 26 ? -9.285  -13.306 -2.201  1.00 0.00 ? 26  GLU A OE1  5  
ATOM   5023  O  OE2  . GLU A 1 26 ? -11.177 -13.351 -1.083  1.00 0.00 ? 26  GLU A OE2  5  
ATOM   5024  H  H    . GLU A 1 26 ? -7.402  -8.608  -0.916  1.00 0.00 ? 26  GLU A H    5  
ATOM   5025  H  HA   . GLU A 1 26 ? -9.170  -9.667  1.172   1.00 0.00 ? 26  GLU A HA   5  
ATOM   5026  H  HB2  . GLU A 1 26 ? -9.742  -10.309 -1.109  1.00 0.00 ? 26  GLU A HB2  5  
ATOM   5027  H  HB3  . GLU A 1 26 ? -8.123  -10.947 -1.358  1.00 0.00 ? 26  GLU A HB3  5  
ATOM   5028  H  HG2  . GLU A 1 26 ? -8.508  -12.678 0.275   1.00 0.00 ? 26  GLU A HG2  5  
ATOM   5029  H  HG3  . GLU A 1 26 ? -10.090 -12.003 0.659   1.00 0.00 ? 26  GLU A HG3  5  
ATOM   5030  N  N    . GLY A 1 27 ? -7.592  -11.385 2.206   1.00 0.00 ? 27  GLY A N    5  
ATOM   5031  C  CA   . GLY A 1 27 ? -6.591  -12.093 2.982   1.00 0.00 ? 27  GLY A CA   5  
ATOM   5032  C  C    . GLY A 1 27 ? -6.109  -11.292 4.176   1.00 0.00 ? 27  GLY A C    5  
ATOM   5033  O  O    . GLY A 1 27 ? -6.190  -11.754 5.313   1.00 0.00 ? 27  GLY A O    5  
ATOM   5034  H  H    . GLY A 1 27 ? -8.544  -11.509 2.408   1.00 0.00 ? 27  GLY A H    5  
ATOM   5035  H  HA2  . GLY A 1 27 ? -7.014  -13.023 3.333   1.00 0.00 ? 27  GLY A HA2  5  
ATOM   5036  H  HA3  . GLY A 1 27 ? -5.746  -12.311 2.345   1.00 0.00 ? 27  GLY A HA3  5  
ATOM   5037  N  N    . GLU A 1 28 ? -5.605  -10.090 3.915   1.00 0.00 ? 28  GLU A N    5  
ATOM   5038  C  CA   . GLU A 1 28 ? -5.105  -9.226  4.978   1.00 0.00 ? 28  GLU A CA   5  
ATOM   5039  C  C    . GLU A 1 28 ? -4.764  -7.840  4.436   1.00 0.00 ? 28  GLU A C    5  
ATOM   5040  O  O    . GLU A 1 28 ? -4.357  -7.694  3.284   1.00 0.00 ? 28  GLU A O    5  
ATOM   5041  C  CB   . GLU A 1 28 ? -3.870  -9.847  5.633   1.00 0.00 ? 28  GLU A CB   5  
ATOM   5042  C  CG   . GLU A 1 28 ? -3.305  -9.018  6.775   1.00 0.00 ? 28  GLU A CG   5  
ATOM   5043  C  CD   . GLU A 1 28 ? -2.490  -9.846  7.749   1.00 0.00 ? 28  GLU A CD   5  
ATOM   5044  O  OE1  . GLU A 1 28 ? -3.057  -10.782 8.351   1.00 0.00 ? 28  GLU A OE1  5  
ATOM   5045  O  OE2  . GLU A 1 28 ? -1.285  -9.559  7.908   1.00 0.00 ? 28  GLU A OE2  5  
ATOM   5046  H  H    . GLU A 1 28 ? -5.567  -9.778  2.987   1.00 0.00 ? 28  GLU A H    5  
ATOM   5047  H  HA   . GLU A 1 28 ? -5.884  -9.128  5.719   1.00 0.00 ? 28  GLU A HA   5  
ATOM   5048  H  HB2  . GLU A 1 28 ? -4.133  -10.821 6.018   1.00 0.00 ? 28  GLU A HB2  5  
ATOM   5049  H  HB3  . GLU A 1 28 ? -3.100  -9.962  4.885   1.00 0.00 ? 28  GLU A HB3  5  
ATOM   5050  H  HG2  . GLU A 1 28 ? -2.671  -8.247  6.363   1.00 0.00 ? 28  GLU A HG2  5  
ATOM   5051  H  HG3  . GLU A 1 28 ? -4.124  -8.562  7.311   1.00 0.00 ? 28  GLU A HG3  5  
ATOM   5052  N  N    . VAL A 1 29 ? -4.935  -6.824  5.277   1.00 0.00 ? 29  VAL A N    5  
ATOM   5053  C  CA   . VAL A 1 29 ? -4.646  -5.450  4.884   1.00 0.00 ? 29  VAL A CA   5  
ATOM   5054  C  C    . VAL A 1 29 ? -3.612  -4.820  5.811   1.00 0.00 ? 29  VAL A C    5  
ATOM   5055  O  O    . VAL A 1 29 ? -3.476  -5.217  6.968   1.00 0.00 ? 29  VAL A O    5  
ATOM   5056  C  CB   . VAL A 1 29 ? -5.920  -4.585  4.891   1.00 0.00 ? 29  VAL A CB   5  
ATOM   5057  C  CG1  . VAL A 1 29 ? -6.800  -4.938  6.081   1.00 0.00 ? 29  VAL A CG1  5  
ATOM   5058  C  CG2  . VAL A 1 29 ? -5.559  -3.107  4.904   1.00 0.00 ? 29  VAL A CG2  5  
ATOM   5059  H  H    . VAL A 1 29 ? -5.263  -7.004  6.183   1.00 0.00 ? 29  VAL A H    5  
ATOM   5060  H  HA   . VAL A 1 29 ? -4.252  -5.466  3.879   1.00 0.00 ? 29  VAL A HA   5  
ATOM   5061  H  HB   . VAL A 1 29 ? -6.475  -4.790  3.988   1.00 0.00 ? 29  VAL A HB   5  
ATOM   5062  H  HG11 . VAL A 1 29 ? -7.775  -4.492  5.951   1.00 0.00 ? 29  VAL A HG11 5  
ATOM   5063  H  HG12 . VAL A 1 29 ? -6.899  -6.011  6.149   1.00 0.00 ? 29  VAL A HG12 5  
ATOM   5064  H  HG13 . VAL A 1 29 ? -6.349  -4.559  6.986   1.00 0.00 ? 29  VAL A HG13 5  
ATOM   5065  H  HG21 . VAL A 1 29 ? -4.922  -2.885  4.061   1.00 0.00 ? 29  VAL A HG21 5  
ATOM   5066  H  HG22 . VAL A 1 29 ? -6.461  -2.515  4.839   1.00 0.00 ? 29  VAL A HG22 5  
ATOM   5067  H  HG23 . VAL A 1 29 ? -5.040  -2.871  5.820   1.00 0.00 ? 29  VAL A HG23 5  
ATOM   5068  N  N    . VAL A 1 30 ? -2.884  -3.836  5.294   1.00 0.00 ? 30  VAL A N    5  
ATOM   5069  C  CA   . VAL A 1 30 ? -1.863  -3.149  6.075   1.00 0.00 ? 30  VAL A CA   5  
ATOM   5070  C  C    . VAL A 1 30 ? -2.305  -1.735  6.436   1.00 0.00 ? 30  VAL A C    5  
ATOM   5071  O  O    . VAL A 1 30 ? -2.139  -0.802  5.650   1.00 0.00 ? 30  VAL A O    5  
ATOM   5072  C  CB   . VAL A 1 30 ? -0.526  -3.078  5.312   1.00 0.00 ? 30  VAL A CB   5  
ATOM   5073  C  CG1  . VAL A 1 30 ? 0.526   -2.361  6.145   1.00 0.00 ? 30  VAL A CG1  5  
ATOM   5074  C  CG2  . VAL A 1 30 ? -0.056  -4.473  4.931   1.00 0.00 ? 30  VAL A CG2  5  
ATOM   5075  H  H    . VAL A 1 30 ? -3.039  -3.564  4.365   1.00 0.00 ? 30  VAL A H    5  
ATOM   5076  H  HA   . VAL A 1 30 ? -1.705  -3.709  6.985   1.00 0.00 ? 30  VAL A HA   5  
ATOM   5077  H  HB   . VAL A 1 30 ? -0.682  -2.513  4.405   1.00 0.00 ? 30  VAL A HB   5  
ATOM   5078  H  HG11 . VAL A 1 30 ? 0.538   -1.312  5.884   1.00 0.00 ? 30  VAL A HG11 5  
ATOM   5079  H  HG12 . VAL A 1 30 ? 0.292   -2.470  7.193   1.00 0.00 ? 30  VAL A HG12 5  
ATOM   5080  H  HG13 . VAL A 1 30 ? 1.497   -2.791  5.945   1.00 0.00 ? 30  VAL A HG13 5  
ATOM   5081  H  HG21 . VAL A 1 30 ? 0.971   -4.429  4.602   1.00 0.00 ? 30  VAL A HG21 5  
ATOM   5082  H  HG22 . VAL A 1 30 ? -0.132  -5.126  5.789   1.00 0.00 ? 30  VAL A HG22 5  
ATOM   5083  H  HG23 . VAL A 1 30 ? -0.674  -4.856  4.133   1.00 0.00 ? 30  VAL A HG23 5  
ATOM   5084  N  N    . SER A 1 31 ? -2.869  -1.584  7.630   1.00 0.00 ? 31  SER A N    5  
ATOM   5085  C  CA   . SER A 1 31 ? -3.339  -0.284  8.095   1.00 0.00 ? 31  SER A CA   5  
ATOM   5086  C  C    . SER A 1 31 ? -2.164  0.633   8.423   1.00 0.00 ? 31  SER A C    5  
ATOM   5087  O  O    . SER A 1 31 ? -1.481  0.447   9.430   1.00 0.00 ? 31  SER A O    5  
ATOM   5088  C  CB   . SER A 1 31 ? -4.230  -0.451  9.327   1.00 0.00 ? 31  SER A CB   5  
ATOM   5089  O  OG   . SER A 1 31 ? -3.478  -0.890  10.445  1.00 0.00 ? 31  SER A OG   5  
ATOM   5090  H  H    . SER A 1 31 ? -2.973  -2.366  8.211   1.00 0.00 ? 31  SER A H    5  
ATOM   5091  H  HA   . SER A 1 31 ? -3.917  0.163   7.300   1.00 0.00 ? 31  SER A HA   5  
ATOM   5092  H  HB2  . SER A 1 31 ? -4.689  0.496   9.566   1.00 0.00 ? 31  SER A HB2  5  
ATOM   5093  H  HB3  . SER A 1 31 ? -4.999  -1.180  9.115   1.00 0.00 ? 31  SER A HB3  5  
ATOM   5094  H  HG   . SER A 1 31 ? -2.779  -0.259  10.628  1.00 0.00 ? 31  SER A HG   5  
ATOM   5095  N  N    . ALA A 1 32 ? -1.935  1.622   7.566   1.00 0.00 ? 32  ALA A N    5  
ATOM   5096  C  CA   . ALA A 1 32 ? -0.845  2.569   7.765   1.00 0.00 ? 32  ALA A CA   5  
ATOM   5097  C  C    . ALA A 1 32 ? -1.309  4.000   7.515   1.00 0.00 ? 32  ALA A C    5  
ATOM   5098  O  O    . ALA A 1 32 ? -1.931  4.293   6.493   1.00 0.00 ? 32  ALA A O    5  
ATOM   5099  C  CB   . ALA A 1 32 ? 0.325   2.225   6.855   1.00 0.00 ? 32  ALA A CB   5  
ATOM   5100  H  H    . ALA A 1 32 ? -2.515  1.718   6.781   1.00 0.00 ? 32  ALA A H    5  
ATOM   5101  H  HA   . ALA A 1 32 ? -0.511  2.483   8.789   1.00 0.00 ? 32  ALA A HA   5  
ATOM   5102  H  HB1  . ALA A 1 32 ? 1.104   2.964   6.977   1.00 0.00 ? 32  ALA A HB1  5  
ATOM   5103  H  HB2  . ALA A 1 32 ? 0.709   1.250   7.115   1.00 0.00 ? 32  ALA A HB2  5  
ATOM   5104  H  HB3  . ALA A 1 32 ? -0.007  2.219   5.828   1.00 0.00 ? 32  ALA A HB3  5  
ATOM   5105  N  N    . LEU A 1 33 ? -1.004  4.888   8.455   1.00 0.00 ? 33  LEU A N    5  
ATOM   5106  C  CA   . LEU A 1 33 ? -1.390  6.290   8.337   1.00 0.00 ? 33  LEU A CA   5  
ATOM   5107  C  C    . LEU A 1 33 ? -2.898  6.426   8.154   1.00 0.00 ? 33  LEU A C    5  
ATOM   5108  O  O    . LEU A 1 33 ? -3.366  7.235   7.355   1.00 0.00 ? 33  LEU A O    5  
ATOM   5109  C  CB   . LEU A 1 33 ? -0.661  6.943   7.162   1.00 0.00 ? 33  LEU A CB   5  
ATOM   5110  C  CG   . LEU A 1 33 ? 0.861   6.791   7.148   1.00 0.00 ? 33  LEU A CG   5  
ATOM   5111  C  CD1  . LEU A 1 33 ? 1.430   7.250   5.814   1.00 0.00 ? 33  LEU A CD1  5  
ATOM   5112  C  CD2  . LEU A 1 33 ? 1.485   7.574   8.294   1.00 0.00 ? 33  LEU A CD2  5  
ATOM   5113  H  H    . LEU A 1 33 ? -0.506  4.595   9.247   1.00 0.00 ? 33  LEU A H    5  
ATOM   5114  H  HA   . LEU A 1 33 ? -1.104  6.790   9.251   1.00 0.00 ? 33  LEU A HA   5  
ATOM   5115  H  HB2  . LEU A 1 33 ? -1.045  6.509   6.252   1.00 0.00 ? 33  LEU A HB2  5  
ATOM   5116  H  HB3  . LEU A 1 33 ? -0.889  8.000   7.179   1.00 0.00 ? 33  LEU A HB3  5  
ATOM   5117  H  HG   . LEU A 1 33 ? 1.113   5.748   7.277   1.00 0.00 ? 33  LEU A HG   5  
ATOM   5118  H  HD11 . LEU A 1 33 ? 0.629   7.363   5.100   1.00 0.00 ? 33  LEU A HD11 5  
ATOM   5119  H  HD12 . LEU A 1 33 ? 2.134   6.515   5.452   1.00 0.00 ? 33  LEU A HD12 5  
ATOM   5120  H  HD13 . LEU A 1 33 ? 1.934   8.197   5.945   1.00 0.00 ? 33  LEU A HD13 5  
ATOM   5121  H  HD21 . LEU A 1 33 ? 2.512   7.805   8.053   1.00 0.00 ? 33  LEU A HD21 5  
ATOM   5122  H  HD22 . LEU A 1 33 ? 1.453   6.979   9.195   1.00 0.00 ? 33  LEU A HD22 5  
ATOM   5123  H  HD23 . LEU A 1 33 ? 0.935   8.490   8.446   1.00 0.00 ? 33  LEU A HD23 5  
ATOM   5124  N  N    . GLY A 1 34 ? -3.654  5.628   8.902   1.00 0.00 ? 34  GLY A N    5  
ATOM   5125  C  CA   . GLY A 1 34 ? -5.102  5.676   8.808   1.00 0.00 ? 34  GLY A CA   5  
ATOM   5126  C  C    . GLY A 1 34 ? -5.602  5.392   7.406   1.00 0.00 ? 34  GLY A C    5  
ATOM   5127  O  O    . GLY A 1 34 ? -6.502  6.070   6.910   1.00 0.00 ? 34  GLY A O    5  
ATOM   5128  H  H    . GLY A 1 34 ? -3.226  5.001   9.522   1.00 0.00 ? 34  GLY A H    5  
ATOM   5129  H  HA2  . GLY A 1 34 ? -5.520  4.944   9.484   1.00 0.00 ? 34  GLY A HA2  5  
ATOM   5130  H  HA3  . GLY A 1 34 ? -5.438  6.658   9.105   1.00 0.00 ? 34  GLY A HA3  5  
ATOM   5131  N  N    . LYS A 1 35 ? -5.017  4.387   6.763   1.00 0.00 ? 35  LYS A N    5  
ATOM   5132  C  CA   . LYS A 1 35 ? -5.407  4.014   5.408   1.00 0.00 ? 35  LYS A CA   5  
ATOM   5133  C  C    . LYS A 1 35 ? -5.216  2.518   5.180   1.00 0.00 ? 35  LYS A C    5  
ATOM   5134  O  O    . LYS A 1 35 ? -4.723  1.803   6.054   1.00 0.00 ? 35  LYS A O    5  
ATOM   5135  C  CB   . LYS A 1 35 ? -4.591  4.805   4.384   1.00 0.00 ? 35  LYS A CB   5  
ATOM   5136  C  CG   . LYS A 1 35 ? -4.767  6.309   4.497   1.00 0.00 ? 35  LYS A CG   5  
ATOM   5137  C  CD   . LYS A 1 35 ? -6.161  6.741   4.072   1.00 0.00 ? 35  LYS A CD   5  
ATOM   5138  C  CE   . LYS A 1 35 ? -6.244  6.953   2.568   1.00 0.00 ? 35  LYS A CE   5  
ATOM   5139  N  NZ   . LYS A 1 35 ? -5.542  8.197   2.144   1.00 0.00 ? 35  LYS A NZ   5  
ATOM   5140  H  H    . LYS A 1 35 ? -4.305  3.883   7.211   1.00 0.00 ? 35  LYS A H    5  
ATOM   5141  H  HA   . LYS A 1 35 ? -6.452  4.254   5.286   1.00 0.00 ? 35  LYS A HA   5  
ATOM   5142  H  HB2  . LYS A 1 35 ? -3.544  4.575   4.520   1.00 0.00 ? 35  LYS A HB2  5  
ATOM   5143  H  HB3  . LYS A 1 35 ? -4.891  4.502   3.391   1.00 0.00 ? 35  LYS A HB3  5  
ATOM   5144  H  HG2  . LYS A 1 35 ? -4.608  6.606   5.523   1.00 0.00 ? 35  LYS A HG2  5  
ATOM   5145  H  HG3  . LYS A 1 35 ? -4.040  6.797   3.863   1.00 0.00 ? 35  LYS A HG3  5  
ATOM   5146  H  HD2  . LYS A 1 35 ? -6.868  5.975   4.355   1.00 0.00 ? 35  LYS A HD2  5  
ATOM   5147  H  HD3  . LYS A 1 35 ? -6.410  7.666   4.572   1.00 0.00 ? 35  LYS A HD3  5  
ATOM   5148  H  HE2  . LYS A 1 35 ? -5.791  6.108   2.073   1.00 0.00 ? 35  LYS A HE2  5  
ATOM   5149  H  HE3  . LYS A 1 35 ? -7.284  7.022   2.284   1.00 0.00 ? 35  LYS A HE3  5  
ATOM   5150  H  HZ1  . LYS A 1 35 ? -5.247  8.119   1.150   1.00 0.00 ? 35  LYS A HZ1  5  
ATOM   5151  H  HZ2  . LYS A 1 35 ? -4.699  8.350   2.733   1.00 0.00 ? 35  LYS A HZ2  5  
ATOM   5152  H  HZ3  . LYS A 1 35 ? -6.175  9.016   2.244   1.00 0.00 ? 35  LYS A HZ3  5  
ATOM   5153  N  N    . THR A 1 36 ? -5.608  2.049   3.999   1.00 0.00 ? 36  THR A N    5  
ATOM   5154  C  CA   . THR A 1 36 ? -5.480  0.638   3.656   1.00 0.00 ? 36  THR A CA   5  
ATOM   5155  C  C    . THR A 1 36 ? -4.705  0.457   2.355   1.00 0.00 ? 36  THR A C    5  
ATOM   5156  O  O    . THR A 1 36 ? -5.052  1.042   1.329   1.00 0.00 ? 36  THR A O    5  
ATOM   5157  C  CB   . THR A 1 36 ? -6.859  -0.033  3.517   1.00 0.00 ? 36  THR A CB   5  
ATOM   5158  O  OG1  . THR A 1 36 ? -7.524  0.451   2.344   1.00 0.00 ? 36  THR A OG1  5  
ATOM   5159  C  CG2  . THR A 1 36 ? -7.719  0.237   4.742   1.00 0.00 ? 36  THR A CG2  5  
ATOM   5160  H  H    . THR A 1 36 ? -5.994  2.668   3.345   1.00 0.00 ? 36  THR A H    5  
ATOM   5161  H  HA   . THR A 1 36 ? -4.943  0.148   4.455   1.00 0.00 ? 36  THR A HA   5  
ATOM   5162  H  HB   . THR A 1 36 ? -6.715  -1.101  3.425   1.00 0.00 ? 36  THR A HB   5  
ATOM   5163  H  HG1  . THR A 1 36 ? -7.258  -0.074  1.586   1.00 0.00 ? 36  THR A HG1  5  
ATOM   5164  H  HG21 . THR A 1 36 ? -7.400  -0.399  5.554   1.00 0.00 ? 36  THR A HG21 5  
ATOM   5165  H  HG22 . THR A 1 36 ? -8.753  0.032   4.508   1.00 0.00 ? 36  THR A HG22 5  
ATOM   5166  H  HG23 . THR A 1 36 ? -7.614  1.272   5.033   1.00 0.00 ? 36  THR A HG23 5  
ATOM   5167  N  N    . TYR A 1 37 ? -3.656  -0.356  2.406   1.00 0.00 ? 37  TYR A N    5  
ATOM   5168  C  CA   . TYR A 1 37 ? -2.831  -0.612  1.231   1.00 0.00 ? 37  TYR A CA   5  
ATOM   5169  C  C    . TYR A 1 37 ? -2.451  -2.087  1.144   1.00 0.00 ? 37  TYR A C    5  
ATOM   5170  O  O    . TYR A 1 37 ? -2.508  -2.815  2.136   1.00 0.00 ? 37  TYR A O    5  
ATOM   5171  C  CB   . TYR A 1 37 ? -1.568  0.250   1.271   1.00 0.00 ? 37  TYR A CB   5  
ATOM   5172  C  CG   . TYR A 1 37 ? -1.849  1.735   1.290   1.00 0.00 ? 37  TYR A CG   5  
ATOM   5173  C  CD1  . TYR A 1 37 ? -2.360  2.379   0.169   1.00 0.00 ? 37  TYR A CD1  5  
ATOM   5174  C  CD2  . TYR A 1 37 ? -1.603  2.494   2.427   1.00 0.00 ? 37  TYR A CD2  5  
ATOM   5175  C  CE1  . TYR A 1 37 ? -2.617  3.737   0.182   1.00 0.00 ? 37  TYR A CE1  5  
ATOM   5176  C  CE2  . TYR A 1 37 ? -1.859  3.852   2.449   1.00 0.00 ? 37  TYR A CE2  5  
ATOM   5177  C  CZ   . TYR A 1 37 ? -2.366  4.468   1.324   1.00 0.00 ? 37  TYR A CZ   5  
ATOM   5178  O  OH   . TYR A 1 37 ? -2.621  5.820   1.341   1.00 0.00 ? 37  TYR A OH   5  
ATOM   5179  H  H    . TYR A 1 37 ? -3.430  -0.793  3.253   1.00 0.00 ? 37  TYR A H    5  
ATOM   5180  H  HA   . TYR A 1 37 ? -3.408  -0.348  0.357   1.00 0.00 ? 37  TYR A HA   5  
ATOM   5181  H  HB2  . TYR A 1 37 ? -1.004  0.008   2.158   1.00 0.00 ? 37  TYR A HB2  5  
ATOM   5182  H  HB3  . TYR A 1 37 ? -0.968  0.036   0.399   1.00 0.00 ? 37  TYR A HB3  5  
ATOM   5183  H  HD1  . TYR A 1 37 ? -2.555  1.804   -0.724  1.00 0.00 ? 37  TYR A HD1  5  
ATOM   5184  H  HD2  . TYR A 1 37 ? -1.206  2.008   3.306   1.00 0.00 ? 37  TYR A HD2  5  
ATOM   5185  H  HE1  . TYR A 1 37 ? -3.014  4.220   -0.699  1.00 0.00 ? 37  TYR A HE1  5  
ATOM   5186  H  HE2  . TYR A 1 37 ? -1.662  4.425   3.343   1.00 0.00 ? 37  TYR A HE2  5  
ATOM   5187  H  HH   . TYR A 1 37 ? -2.291  6.198   2.160   1.00 0.00 ? 37  TYR A HH   5  
ATOM   5188  N  N    . HIS A 1 38 ? -2.063  -2.522  -0.051  1.00 0.00 ? 38  HIS A N    5  
ATOM   5189  C  CA   . HIS A 1 38 ? -1.672  -3.910  -0.269  1.00 0.00 ? 38  HIS A CA   5  
ATOM   5190  C  C    . HIS A 1 38 ? -0.266  -4.169  0.264   1.00 0.00 ? 38  HIS A C    5  
ATOM   5191  O  O    . HIS A 1 38 ? 0.524   -3.248  0.472   1.00 0.00 ? 38  HIS A O    5  
ATOM   5192  C  CB   . HIS A 1 38 ? -1.736  -4.252  -1.758  1.00 0.00 ? 38  HIS A CB   5  
ATOM   5193  C  CG   . HIS A 1 38 ? -3.072  -4.769  -2.197  1.00 0.00 ? 38  HIS A CG   5  
ATOM   5194  N  ND1  . HIS A 1 38 ? -3.817  -4.178  -3.195  1.00 0.00 ? 38  HIS A ND1  5  
ATOM   5195  C  CD2  . HIS A 1 38 ? -3.796  -5.829  -1.768  1.00 0.00 ? 38  HIS A CD2  5  
ATOM   5196  C  CE1  . HIS A 1 38 ? -4.941  -4.851  -3.360  1.00 0.00 ? 38  HIS A CE1  5  
ATOM   5197  N  NE2  . HIS A 1 38 ? -4.953  -5.858  -2.506  1.00 0.00 ? 38  HIS A NE2  5  
ATOM   5198  H  H    . HIS A 1 38 ? -2.039  -1.895  -0.803  1.00 0.00 ? 38  HIS A H    5  
ATOM   5199  H  HA   . HIS A 1 38 ? -2.368  -4.539  0.266   1.00 0.00 ? 38  HIS A HA   5  
ATOM   5200  H  HB2  . HIS A 1 38 ? -1.519  -3.365  -2.334  1.00 0.00 ? 38  HIS A HB2  5  
ATOM   5201  H  HB3  . HIS A 1 38 ? -0.998  -5.009  -1.979  1.00 0.00 ? 38  HIS A HB3  5  
ATOM   5202  H  HD2  . HIS A 1 38 ? -3.515  -6.524  -0.988  1.00 0.00 ? 38  HIS A HD2  5  
ATOM   5203  H  HE1  . HIS A 1 38 ? -5.719  -4.618  -4.072  1.00 0.00 ? 38  HIS A HE1  5  
ATOM   5204  H  HE2  . HIS A 1 38 ? -5.708  -6.465  -2.359  1.00 0.00 ? 38  HIS A HE2  5  
ATOM   5205  N  N    . PRO A 1 39 ? 0.055   -5.451  0.491   1.00 0.00 ? 39  PRO A N    5  
ATOM   5206  C  CA   . PRO A 1 39 ? 1.366   -5.861  1.003   1.00 0.00 ? 39  PRO A CA   5  
ATOM   5207  C  C    . PRO A 1 39 ? 2.476   -5.663  -0.023  1.00 0.00 ? 39  PRO A C    5  
ATOM   5208  O  O    . PRO A 1 39 ? 3.650   -5.895  0.266   1.00 0.00 ? 39  PRO A O    5  
ATOM   5209  C  CB   . PRO A 1 39 ? 1.179   -7.349  1.308   1.00 0.00 ? 39  PRO A CB   5  
ATOM   5210  C  CG   . PRO A 1 39 ? 0.078   -7.785  0.405   1.00 0.00 ? 39  PRO A CG   5  
ATOM   5211  C  CD   . PRO A 1 39 ? -0.838  -6.600  0.265   1.00 0.00 ? 39  PRO A CD   5  
ATOM   5212  H  HA   . PRO A 1 39 ? 1.619   -5.334  1.912   1.00 0.00 ? 39  PRO A HA   5  
ATOM   5213  H  HB2  . PRO A 1 39 ? 2.097   -7.880  1.099   1.00 0.00 ? 39  PRO A HB2  5  
ATOM   5214  H  HB3  . PRO A 1 39 ? 0.911   -7.476  2.346   1.00 0.00 ? 39  PRO A HB3  5  
ATOM   5215  H  HG2  . PRO A 1 39 ? 0.480   -8.063  -0.557  1.00 0.00 ? 39  PRO A HG2  5  
ATOM   5216  H  HG3  . PRO A 1 39 ? -0.451  -8.617  0.846   1.00 0.00 ? 39  PRO A HG3  5  
ATOM   5217  H  HD2  . PRO A 1 39 ? -1.265  -6.568  -0.726  1.00 0.00 ? 39  PRO A HD2  5  
ATOM   5218  H  HD3  . PRO A 1 39 ? -1.617  -6.636  1.013   1.00 0.00 ? 39  PRO A HD3  5  
ATOM   5219  N  N    . ASP A 1 40 ? 2.098   -5.232  -1.221  1.00 0.00 ? 40  ASP A N    5  
ATOM   5220  C  CA   . ASP A 1 40 ? 3.063   -5.002  -2.290  1.00 0.00 ? 40  ASP A CA   5  
ATOM   5221  C  C    . ASP A 1 40 ? 2.969   -3.569  -2.807  1.00 0.00 ? 40  ASP A C    5  
ATOM   5222  O  O    . ASP A 1 40 ? 3.890   -3.070  -3.454  1.00 0.00 ? 40  ASP A O    5  
ATOM   5223  C  CB   . ASP A 1 40 ? 2.831   -5.987  -3.437  1.00 0.00 ? 40  ASP A CB   5  
ATOM   5224  C  CG   . ASP A 1 40 ? 2.742   -7.422  -2.958  1.00 0.00 ? 40  ASP A CG   5  
ATOM   5225  O  OD1  . ASP A 1 40 ? 3.584   -7.823  -2.128  1.00 0.00 ? 40  ASP A OD1  5  
ATOM   5226  O  OD2  . ASP A 1 40 ? 1.832   -8.145  -3.415  1.00 0.00 ? 40  ASP A OD2  5  
ATOM   5227  H  H    . ASP A 1 40 ? 1.147   -5.065  -1.391  1.00 0.00 ? 40  ASP A H    5  
ATOM   5228  H  HA   . ASP A 1 40 ? 4.051   -5.161  -1.886  1.00 0.00 ? 40  ASP A HA   5  
ATOM   5229  H  HB2  . ASP A 1 40 ? 1.906   -5.736  -3.937  1.00 0.00 ? 40  ASP A HB2  5  
ATOM   5230  H  HB3  . ASP A 1 40 ? 3.647   -5.910  -4.140  1.00 0.00 ? 40  ASP A HB3  5  
ATOM   5231  N  N    . CYS A 1 41 ? 1.850   -2.913  -2.518  1.00 0.00 ? 41  CYS A N    5  
ATOM   5232  C  CA   . CYS A 1 41 ? 1.634   -1.539  -2.954  1.00 0.00 ? 41  CYS A CA   5  
ATOM   5233  C  C    . CYS A 1 41 ? 2.345   -0.557  -2.027  1.00 0.00 ? 41  CYS A C    5  
ATOM   5234  O  O    . CYS A 1 41 ? 2.687   0.556   -2.429  1.00 0.00 ? 41  CYS A O    5  
ATOM   5235  C  CB   . CYS A 1 41 ? 0.138   -1.225  -2.997  1.00 0.00 ? 41  CYS A CB   5  
ATOM   5236  S  SG   . CYS A 1 41 ? -0.743  -1.990  -4.396  1.00 0.00 ? 41  CYS A SG   5  
ATOM   5237  H  H    . CYS A 1 41 ? 1.151   -3.365  -1.998  1.00 0.00 ? 41  CYS A H    5  
ATOM   5238  H  HA   . CYS A 1 41 ? 2.043   -1.438  -3.948  1.00 0.00 ? 41  CYS A HA   5  
ATOM   5239  H  HB2  . CYS A 1 41 ? -0.323  -1.580  -2.086  1.00 0.00 ? 41  CYS A HB2  5  
ATOM   5240  H  HB3  . CYS A 1 41 ? 0.004   -0.156  -3.069  1.00 0.00 ? 41  CYS A HB3  5  
ATOM   5241  N  N    . PHE A 1 42 ? 2.565   -0.976  -0.786  1.00 0.00 ? 42  PHE A N    5  
ATOM   5242  C  CA   . PHE A 1 42 ? 3.234   -0.134  0.198   1.00 0.00 ? 42  PHE A CA   5  
ATOM   5243  C  C    . PHE A 1 42 ? 4.750   -0.232  0.057   1.00 0.00 ? 42  PHE A C    5  
ATOM   5244  O  O    . PHE A 1 42 ? 5.479   -0.227  1.050   1.00 0.00 ? 42  PHE A O    5  
ATOM   5245  C  CB   . PHE A 1 42 ? 2.815   -0.535  1.614   1.00 0.00 ? 42  PHE A CB   5  
ATOM   5246  C  CG   . PHE A 1 42 ? 3.308   0.407   2.675   1.00 0.00 ? 42  PHE A CG   5  
ATOM   5247  C  CD1  . PHE A 1 42 ? 2.948   1.744   2.654   1.00 0.00 ? 42  PHE A CD1  5  
ATOM   5248  C  CD2  . PHE A 1 42 ? 4.131   -0.045  3.694   1.00 0.00 ? 42  PHE A CD2  5  
ATOM   5249  C  CE1  . PHE A 1 42 ? 3.400   2.613   3.629   1.00 0.00 ? 42  PHE A CE1  5  
ATOM   5250  C  CE2  . PHE A 1 42 ? 4.586   0.819   4.672   1.00 0.00 ? 42  PHE A CE2  5  
ATOM   5251  C  CZ   . PHE A 1 42 ? 4.220   2.150   4.639   1.00 0.00 ? 42  PHE A CZ   5  
ATOM   5252  H  H    . PHE A 1 42 ? 2.269   -1.874  -0.525  1.00 0.00 ? 42  PHE A H    5  
ATOM   5253  H  HA   . PHE A 1 42 ? 2.933   0.887   0.019   1.00 0.00 ? 42  PHE A HA   5  
ATOM   5254  H  HB2  . PHE A 1 42 ? 1.737   -0.562  1.669   1.00 0.00 ? 42  PHE A HB2  5  
ATOM   5255  H  HB3  . PHE A 1 42 ? 3.207   -1.517  1.832   1.00 0.00 ? 42  PHE A HB3  5  
ATOM   5256  H  HD1  . PHE A 1 42 ? 2.306   2.108   1.865   1.00 0.00 ? 42  PHE A HD1  5  
ATOM   5257  H  HD2  . PHE A 1 42 ? 4.418   -1.087  3.720   1.00 0.00 ? 42  PHE A HD2  5  
ATOM   5258  H  HE1  . PHE A 1 42 ? 3.112   3.654   3.601   1.00 0.00 ? 42  PHE A HE1  5  
ATOM   5259  H  HE2  . PHE A 1 42 ? 5.227   0.453   5.460   1.00 0.00 ? 42  PHE A HE2  5  
ATOM   5260  H  HZ   . PHE A 1 42 ? 4.575   2.827   5.402   1.00 0.00 ? 42  PHE A HZ   5  
ATOM   5261  N  N    . VAL A 1 43 ? 5.219   -0.322  -1.184  1.00 0.00 ? 43  VAL A N    5  
ATOM   5262  C  CA   . VAL A 1 43 ? 6.647   -0.421  -1.456  1.00 0.00 ? 43  VAL A CA   5  
ATOM   5263  C  C    . VAL A 1 43 ? 7.160   0.828   -2.164  1.00 0.00 ? 43  VAL A C    5  
ATOM   5264  O  O    . VAL A 1 43 ? 6.380   1.693   -2.563  1.00 0.00 ? 43  VAL A O    5  
ATOM   5265  C  CB   . VAL A 1 43 ? 6.970   -1.655  -2.319  1.00 0.00 ? 43  VAL A CB   5  
ATOM   5266  C  CG1  . VAL A 1 43 ? 6.331   -2.902  -1.728  1.00 0.00 ? 43  VAL A CG1  5  
ATOM   5267  C  CG2  . VAL A 1 43 ? 6.508   -1.438  -3.752  1.00 0.00 ? 43  VAL A CG2  5  
ATOM   5268  H  H    . VAL A 1 43 ? 4.588   -0.321  -1.934  1.00 0.00 ? 43  VAL A H    5  
ATOM   5269  H  HA   . VAL A 1 43 ? 7.161   -0.525  -0.511  1.00 0.00 ? 43  VAL A HA   5  
ATOM   5270  H  HB   . VAL A 1 43 ? 8.041   -1.795  -2.326  1.00 0.00 ? 43  VAL A HB   5  
ATOM   5271  H  HG11 . VAL A 1 43 ? 7.056   -3.425  -1.121  1.00 0.00 ? 43  VAL A HG11 5  
ATOM   5272  H  HG12 . VAL A 1 43 ? 5.486   -2.620  -1.118  1.00 0.00 ? 43  VAL A HG12 5  
ATOM   5273  H  HG13 . VAL A 1 43 ? 5.998   -3.549  -2.526  1.00 0.00 ? 43  VAL A HG13 5  
ATOM   5274  H  HG21 . VAL A 1 43 ? 7.303   -0.978  -4.320  1.00 0.00 ? 43  VAL A HG21 5  
ATOM   5275  H  HG22 . VAL A 1 43 ? 6.252   -2.389  -4.197  1.00 0.00 ? 43  VAL A HG22 5  
ATOM   5276  H  HG23 . VAL A 1 43 ? 5.641   -0.794  -3.758  1.00 0.00 ? 43  VAL A HG23 5  
ATOM   5277  N  N    . CYS A 1 44 ? 8.477   0.917   -2.316  1.00 0.00 ? 44  CYS A N    5  
ATOM   5278  C  CA   . CYS A 1 44 ? 9.096   2.060   -2.976  1.00 0.00 ? 44  CYS A CA   5  
ATOM   5279  C  C    . CYS A 1 44 ? 8.369   2.398   -4.275  1.00 0.00 ? 44  CYS A C    5  
ATOM   5280  O  O    . CYS A 1 44 ? 7.580   1.601   -4.782  1.00 0.00 ? 44  CYS A O    5  
ATOM   5281  C  CB   . CYS A 1 44 ? 10.571  1.773   -3.264  1.00 0.00 ? 44  CYS A CB   5  
ATOM   5282  S  SG   . CYS A 1 44 ? 11.525  3.234   -3.784  1.00 0.00 ? 44  CYS A SG   5  
ATOM   5283  H  H    . CYS A 1 44 ? 9.048   0.195   -1.977  1.00 0.00 ? 44  CYS A H    5  
ATOM   5284  H  HA   . CYS A 1 44 ? 9.027   2.906   -2.309  1.00 0.00 ? 44  CYS A HA   5  
ATOM   5285  H  HB2  . CYS A 1 44 ? 11.034  1.379   -2.371  1.00 0.00 ? 44  CYS A HB2  5  
ATOM   5286  H  HB3  . CYS A 1 44 ? 10.639  1.037   -4.052  1.00 0.00 ? 44  CYS A HB3  5  
ATOM   5287  N  N    . ALA A 1 45 ? 8.641   3.585   -4.807  1.00 0.00 ? 45  ALA A N    5  
ATOM   5288  C  CA   . ALA A 1 45 ? 8.016   4.027   -6.047  1.00 0.00 ? 45  ALA A CA   5  
ATOM   5289  C  C    . ALA A 1 45 ? 8.990   3.935   -7.217  1.00 0.00 ? 45  ALA A C    5  
ATOM   5290  O  O    . ALA A 1 45 ? 8.579   3.847   -8.374  1.00 0.00 ? 45  ALA A O    5  
ATOM   5291  C  CB   . ALA A 1 45 ? 7.499   5.451   -5.899  1.00 0.00 ? 45  ALA A CB   5  
ATOM   5292  H  H    . ALA A 1 45 ? 9.279   4.176   -4.356  1.00 0.00 ? 45  ALA A H    5  
ATOM   5293  H  HA   . ALA A 1 45 ? 7.171   3.383   -6.243  1.00 0.00 ? 45  ALA A HA   5  
ATOM   5294  H  HB1  . ALA A 1 45 ? 7.996   6.089   -6.615  1.00 0.00 ? 45  ALA A HB1  5  
ATOM   5295  H  HB2  . ALA A 1 45 ? 6.435   5.468   -6.078  1.00 0.00 ? 45  ALA A HB2  5  
ATOM   5296  H  HB3  . ALA A 1 45 ? 7.702   5.805   -4.899  1.00 0.00 ? 45  ALA A HB3  5  
ATOM   5297  N  N    . VAL A 1 46 ? 10.282  3.956   -6.908  1.00 0.00 ? 46  VAL A N    5  
ATOM   5298  C  CA   . VAL A 1 46 ? 11.315  3.874   -7.933  1.00 0.00 ? 46  VAL A CA   5  
ATOM   5299  C  C    . VAL A 1 46 ? 11.700  2.425   -8.211  1.00 0.00 ? 46  VAL A C    5  
ATOM   5300  O  O    . VAL A 1 46 ? 11.412  1.889   -9.282  1.00 0.00 ? 46  VAL A O    5  
ATOM   5301  C  CB   . VAL A 1 46 ? 12.575  4.659   -7.525  1.00 0.00 ? 46  VAL A CB   5  
ATOM   5302  C  CG1  . VAL A 1 46 ? 13.551  4.747   -8.689  1.00 0.00 ? 46  VAL A CG1  5  
ATOM   5303  C  CG2  . VAL A 1 46 ? 12.200  6.047   -7.028  1.00 0.00 ? 46  VAL A CG2  5  
ATOM   5304  H  H    . VAL A 1 46 ? 10.548  4.027   -5.967  1.00 0.00 ? 46  VAL A H    5  
ATOM   5305  H  HA   . VAL A 1 46 ? 10.921  4.312   -8.839  1.00 0.00 ? 46  VAL A HA   5  
ATOM   5306  H  HB   . VAL A 1 46 ? 13.059  4.130   -6.718  1.00 0.00 ? 46  VAL A HB   5  
ATOM   5307  H  HG11 . VAL A 1 46 ? 13.179  5.453   -9.417  1.00 0.00 ? 46  VAL A HG11 5  
ATOM   5308  H  HG12 . VAL A 1 46 ? 14.514  5.075   -8.327  1.00 0.00 ? 46  VAL A HG12 5  
ATOM   5309  H  HG13 . VAL A 1 46 ? 13.650  3.775   -9.149  1.00 0.00 ? 46  VAL A HG13 5  
ATOM   5310  H  HG21 . VAL A 1 46 ? 11.964  6.679   -7.871  1.00 0.00 ? 46  VAL A HG21 5  
ATOM   5311  H  HG22 . VAL A 1 46 ? 11.339  5.977   -6.378  1.00 0.00 ? 46  VAL A HG22 5  
ATOM   5312  H  HG23 . VAL A 1 46 ? 13.029  6.471   -6.481  1.00 0.00 ? 46  VAL A HG23 5  
ATOM   5313  N  N    . CYS A 1 47 ? 12.353  1.796   -7.240  1.00 0.00 ? 47  CYS A N    5  
ATOM   5314  C  CA   . CYS A 1 47 ? 12.778  0.408   -7.378  1.00 0.00 ? 47  CYS A CA   5  
ATOM   5315  C  C    . CYS A 1 47 ? 11.616  -0.546  -7.117  1.00 0.00 ? 47  CYS A C    5  
ATOM   5316  O  O    . CYS A 1 47 ? 11.640  -1.701  -7.542  1.00 0.00 ? 47  CYS A O    5  
ATOM   5317  C  CB   . CYS A 1 47 ? 13.927  0.107   -6.414  1.00 0.00 ? 47  CYS A CB   5  
ATOM   5318  S  SG   . CYS A 1 47 ? 13.489  0.291   -4.655  1.00 0.00 ? 47  CYS A SG   5  
ATOM   5319  H  H    . CYS A 1 47 ? 12.554  2.276   -6.409  1.00 0.00 ? 47  CYS A H    5  
ATOM   5320  H  HA   . CYS A 1 47 ? 13.124  0.266   -8.391  1.00 0.00 ? 47  CYS A HA   5  
ATOM   5321  H  HB2  . CYS A 1 47 ? 14.255  -0.912  -6.564  1.00 0.00 ? 47  CYS A HB2  5  
ATOM   5322  H  HB3  . CYS A 1 47 ? 14.747  0.778   -6.621  1.00 0.00 ? 47  CYS A HB3  5  
ATOM   5323  N  N    . ARG A 1 48 ? 10.600  -0.054  -6.415  1.00 0.00 ? 48  ARG A N    5  
ATOM   5324  C  CA   . ARG A 1 48 ? 9.430   -0.862  -6.096  1.00 0.00 ? 48  ARG A CA   5  
ATOM   5325  C  C    . ARG A 1 48 ? 9.822   -2.087  -5.275  1.00 0.00 ? 48  ARG A C    5  
ATOM   5326  O  O    . ARG A 1 48 ? 9.414   -3.208  -5.579  1.00 0.00 ? 48  ARG A O    5  
ATOM   5327  C  CB   . ARG A 1 48 ? 8.722   -1.301  -7.379  1.00 0.00 ? 48  ARG A CB   5  
ATOM   5328  C  CG   . ARG A 1 48 ? 8.347   -0.146  -8.294  1.00 0.00 ? 48  ARG A CG   5  
ATOM   5329  C  CD   . ARG A 1 48 ? 6.964   0.396   -7.969  1.00 0.00 ? 48  ARG A CD   5  
ATOM   5330  N  NE   . ARG A 1 48 ? 6.348   1.049   -9.121  1.00 0.00 ? 48  ARG A NE   5  
ATOM   5331  C  CZ   . ARG A 1 48 ? 5.342   1.911   -9.026  1.00 0.00 ? 48  ARG A CZ   5  
ATOM   5332  N  NH1  . ARG A 1 48 ? 4.841   2.222   -7.838  1.00 0.00 ? 48  ARG A NH1  5  
ATOM   5333  N  NH2  . ARG A 1 48 ? 4.835   2.464   -10.120 1.00 0.00 ? 48  ARG A NH2  5  
ATOM   5334  H  H    . ARG A 1 48 ? 10.639  0.875   -6.104  1.00 0.00 ? 48  ARG A H    5  
ATOM   5335  H  HA   . ARG A 1 48 ? 8.755   -0.253  -5.513  1.00 0.00 ? 48  ARG A HA   5  
ATOM   5336  H  HB2  . ARG A 1 48 ? 9.372   -1.967  -7.926  1.00 0.00 ? 48  ARG A HB2  5  
ATOM   5337  H  HB3  . ARG A 1 48 ? 7.818   -1.829  -7.115  1.00 0.00 ? 48  ARG A HB3  5  
ATOM   5338  H  HG2  . ARG A 1 48 ? 9.070   0.647   -8.171  1.00 0.00 ? 48  ARG A HG2  5  
ATOM   5339  H  HG3  . ARG A 1 48 ? 8.359   -0.491  -9.317  1.00 0.00 ? 48  ARG A HG3  5  
ATOM   5340  H  HD2  . ARG A 1 48 ? 6.336   -0.424  -7.655  1.00 0.00 ? 48  ARG A HD2  5  
ATOM   5341  H  HD3  . ARG A 1 48 ? 7.052   1.111   -7.165  1.00 0.00 ? 48  ARG A HD3  5  
ATOM   5342  H  HE   . ARG A 1 48 ? 6.703   0.834   -10.008 1.00 0.00 ? 48  ARG A HE   5  
ATOM   5343  H  HH11 . ARG A 1 48 ? 5.222   1.807   -7.012  1.00 0.00 ? 48  ARG A HH11 5  
ATOM   5344  H  HH12 . ARG A 1 48 ? 4.084   2.872   -7.769  1.00 0.00 ? 48  ARG A HH12 5  
ATOM   5345  H  HH21 . ARG A 1 48 ? 5.210   2.233   -11.017 1.00 0.00 ? 48  ARG A HH21 5  
ATOM   5346  H  HH22 . ARG A 1 48 ? 4.077   3.113   -10.047 1.00 0.00 ? 48  ARG A HH22 5  
ATOM   5347  N  N    . LEU A 1 49 ? 10.616  -1.864  -4.234  1.00 0.00 ? 49  LEU A N    5  
ATOM   5348  C  CA   . LEU A 1 49 ? 11.065  -2.950  -3.368  1.00 0.00 ? 49  LEU A CA   5  
ATOM   5349  C  C    . LEU A 1 49 ? 10.523  -2.776  -1.953  1.00 0.00 ? 49  LEU A C    5  
ATOM   5350  O  O    . LEU A 1 49 ? 10.429  -1.666  -1.429  1.00 0.00 ? 49  LEU A O    5  
ATOM   5351  C  CB   . LEU A 1 49 ? 12.593  -3.006  -3.338  1.00 0.00 ? 49  LEU A CB   5  
ATOM   5352  C  CG   . LEU A 1 49 ? 13.272  -2.214  -2.220  1.00 0.00 ? 49  LEU A CG   5  
ATOM   5353  C  CD1  . LEU A 1 49 ? 13.026  -2.875  -0.872  1.00 0.00 ? 49  LEU A CD1  5  
ATOM   5354  C  CD2  . LEU A 1 49 ? 14.764  -2.085  -2.488  1.00 0.00 ? 49  LEU A CD2  5  
ATOM   5355  H  H    . LEU A 1 49 ? 10.909  -0.949  -4.041  1.00 0.00 ? 49  LEU A H    5  
ATOM   5356  H  HA   . LEU A 1 49 ? 10.686  -3.876  -3.774  1.00 0.00 ? 49  LEU A HA   5  
ATOM   5357  H  HB2  . LEU A 1 49 ? 12.883  -4.040  -3.233  1.00 0.00 ? 49  LEU A HB2  5  
ATOM   5358  H  HB3  . LEU A 1 49 ? 12.956  -2.625  -4.282  1.00 0.00 ? 49  LEU A HB3  5  
ATOM   5359  H  HG   . LEU A 1 49 ? 12.850  -1.219  -2.185  1.00 0.00 ? 49  LEU A HG   5  
ATOM   5360  H  HD11 . LEU A 1 49 ? 12.348  -2.267  -0.292  1.00 0.00 ? 49  LEU A HD11 5  
ATOM   5361  H  HD12 . LEU A 1 49 ? 13.962  -2.974  -0.344  1.00 0.00 ? 49  LEU A HD12 5  
ATOM   5362  H  HD13 . LEU A 1 49 ? 12.594  -3.853  -1.025  1.00 0.00 ? 49  LEU A HD13 5  
ATOM   5363  H  HD21 . LEU A 1 49 ? 15.269  -1.789  -1.580  1.00 0.00 ? 49  LEU A HD21 5  
ATOM   5364  H  HD22 . LEU A 1 49 ? 14.930  -1.339  -3.252  1.00 0.00 ? 49  LEU A HD22 5  
ATOM   5365  H  HD23 . LEU A 1 49 ? 15.153  -3.035  -2.822  1.00 0.00 ? 49  LEU A HD23 5  
ATOM   5366  N  N    . PRO A 1 50 ? 10.159  -3.900  -1.316  1.00 0.00 ? 50  PRO A N    5  
ATOM   5367  C  CA   . PRO A 1 50 ? 9.623   -3.898  0.048   1.00 0.00 ? 50  PRO A CA   5  
ATOM   5368  C  C    . PRO A 1 50 ? 10.680  -3.536  1.086   1.00 0.00 ? 50  PRO A C    5  
ATOM   5369  O  O    . PRO A 1 50 ? 11.724  -4.184  1.176   1.00 0.00 ? 50  PRO A O    5  
ATOM   5370  C  CB   . PRO A 1 50 ? 9.152   -5.341  0.246   1.00 0.00 ? 50  PRO A CB   5  
ATOM   5371  C  CG   . PRO A 1 50 ? 9.986   -6.144  -0.692  1.00 0.00 ? 50  PRO A CG   5  
ATOM   5372  C  CD   . PRO A 1 50 ? 10.243  -5.258  -1.880  1.00 0.00 ? 50  PRO A CD   5  
ATOM   5373  H  HA   . PRO A 1 50 ? 8.782   -3.227  0.143   1.00 0.00 ? 50  PRO A HA   5  
ATOM   5374  H  HB2  . PRO A 1 50 ? 9.314   -5.638  1.272   1.00 0.00 ? 50  PRO A HB2  5  
ATOM   5375  H  HB3  . PRO A 1 50 ? 8.103   -5.418  0.004   1.00 0.00 ? 50  PRO A HB3  5  
ATOM   5376  H  HG2  . PRO A 1 50 ? 10.917  -6.414  -0.217  1.00 0.00 ? 50  PRO A HG2  5  
ATOM   5377  H  HG3  . PRO A 1 50 ? 9.448   -7.029  -0.996  1.00 0.00 ? 50  PRO A HG3  5  
ATOM   5378  H  HD2  . PRO A 1 50 ? 11.226  -5.446  -2.286  1.00 0.00 ? 50  PRO A HD2  5  
ATOM   5379  H  HD3  . PRO A 1 50 ? 9.486   -5.409  -2.634  1.00 0.00 ? 50  PRO A HD3  5  
ATOM   5380  N  N    . PHE A 1 51 ? 10.404  -2.498  1.868   1.00 0.00 ? 51  PHE A N    5  
ATOM   5381  C  CA   . PHE A 1 51 ? 11.332  -2.050  2.900   1.00 0.00 ? 51  PHE A CA   5  
ATOM   5382  C  C    . PHE A 1 51 ? 11.488  -3.108  3.988   1.00 0.00 ? 51  PHE A C    5  
ATOM   5383  O  O    . PHE A 1 51 ? 10.514  -3.689  4.469   1.00 0.00 ? 51  PHE A O    5  
ATOM   5384  C  CB   . PHE A 1 51 ? 10.846  -0.736  3.516   1.00 0.00 ? 51  PHE A CB   5  
ATOM   5385  C  CG   . PHE A 1 51 ? 10.334  0.247   2.504   1.00 0.00 ? 51  PHE A CG   5  
ATOM   5386  C  CD1  . PHE A 1 51 ? 11.214  0.993   1.735   1.00 0.00 ? 51  PHE A CD1  5  
ATOM   5387  C  CD2  . PHE A 1 51 ? 8.972   0.426   2.319   1.00 0.00 ? 51  PHE A CD2  5  
ATOM   5388  C  CE1  . PHE A 1 51 ? 10.744  1.899   0.803   1.00 0.00 ? 51  PHE A CE1  5  
ATOM   5389  C  CE2  . PHE A 1 51 ? 8.497   1.331   1.389   1.00 0.00 ? 51  PHE A CE2  5  
ATOM   5390  C  CZ   . PHE A 1 51 ? 9.385   2.068   0.629   1.00 0.00 ? 51  PHE A CZ   5  
ATOM   5391  H  H    . PHE A 1 51 ? 9.555   -2.022  1.748   1.00 0.00 ? 51  PHE A H    5  
ATOM   5392  H  HA   . PHE A 1 51 ? 12.291  -1.887  2.434   1.00 0.00 ? 51  PHE A HA   5  
ATOM   5393  H  HB2  . PHE A 1 51 ? 10.045  -0.946  4.209   1.00 0.00 ? 51  PHE A HB2  5  
ATOM   5394  H  HB3  . PHE A 1 51 ? 11.664  -0.273  4.047   1.00 0.00 ? 51  PHE A HB3  5  
ATOM   5395  H  HD1  . PHE A 1 51 ? 12.277  0.862   1.870   1.00 0.00 ? 51  PHE A HD1  5  
ATOM   5396  H  HD2  . PHE A 1 51 ? 8.277   -0.150  2.913   1.00 0.00 ? 51  PHE A HD2  5  
ATOM   5397  H  HE1  . PHE A 1 51 ? 11.440  2.474   0.211   1.00 0.00 ? 51  PHE A HE1  5  
ATOM   5398  H  HE2  . PHE A 1 51 ? 7.433   1.460   1.255   1.00 0.00 ? 51  PHE A HE2  5  
ATOM   5399  H  HZ   . PHE A 1 51 ? 9.016   2.776   -0.098  1.00 0.00 ? 51  PHE A HZ   5  
ATOM   5400  N  N    . PRO A 1 52 ? 12.742  -3.366  4.387   1.00 0.00 ? 52  PRO A N    5  
ATOM   5401  C  CA   . PRO A 1 52 ? 13.057  -4.355  5.422   1.00 0.00 ? 52  PRO A CA   5  
ATOM   5402  C  C    . PRO A 1 52 ? 12.604  -3.907  6.808   1.00 0.00 ? 52  PRO A C    5  
ATOM   5403  O  O    . PRO A 1 52 ? 12.273  -2.743  7.033   1.00 0.00 ? 52  PRO A O    5  
ATOM   5404  C  CB   . PRO A 1 52 ? 14.583  -4.456  5.365   1.00 0.00 ? 52  PRO A CB   5  
ATOM   5405  C  CG   . PRO A 1 52 ? 15.028  -3.146  4.811   1.00 0.00 ? 52  PRO A CG   5  
ATOM   5406  C  CD   . PRO A 1 52 ? 13.950  -2.711  3.857   1.00 0.00 ? 52  PRO A CD   5  
ATOM   5407  H  HA   . PRO A 1 52 ? 12.622  -5.318  5.196   1.00 0.00 ? 52  PRO A HA   5  
ATOM   5408  H  HB2  . PRO A 1 52 ? 14.973  -4.619  6.360   1.00 0.00 ? 52  PRO A HB2  5  
ATOM   5409  H  HB3  . PRO A 1 52 ? 14.869  -5.274  4.721   1.00 0.00 ? 52  PRO A HB3  5  
ATOM   5410  H  HG2  . PRO A 1 52 ? 15.135  -2.427  5.610   1.00 0.00 ? 52  PRO A HG2  5  
ATOM   5411  H  HG3  . PRO A 1 52 ? 15.965  -3.269  4.287   1.00 0.00 ? 52  PRO A HG3  5  
ATOM   5412  H  HD2  . PRO A 1 52 ? 13.844  -1.637  3.872   1.00 0.00 ? 52  PRO A HD2  5  
ATOM   5413  H  HD3  . PRO A 1 52 ? 14.169  -3.057  2.858   1.00 0.00 ? 52  PRO A HD3  5  
ATOM   5414  N  N    . PRO A 1 53 ? 12.590  -4.851  7.760   1.00 0.00 ? 53  PRO A N    5  
ATOM   5415  C  CA   . PRO A 1 53 ? 12.181  -4.577  9.141   1.00 0.00 ? 53  PRO A CA   5  
ATOM   5416  C  C    . PRO A 1 53 ? 13.189  -3.706  9.882   1.00 0.00 ? 53  PRO A C    5  
ATOM   5417  O  O    . PRO A 1 53 ? 14.238  -4.184  10.313  1.00 0.00 ? 53  PRO A O    5  
ATOM   5418  C  CB   . PRO A 1 53 ? 12.109  -5.969  9.773   1.00 0.00 ? 53  PRO A CB   5  
ATOM   5419  C  CG   . PRO A 1 53 ? 13.043  -6.801  8.964   1.00 0.00 ? 53  PRO A CG   5  
ATOM   5420  C  CD   . PRO A 1 53 ? 12.972  -6.260  7.563   1.00 0.00 ? 53  PRO A CD   5  
ATOM   5421  H  HA   . PRO A 1 53 ? 11.207  -4.111  9.181   1.00 0.00 ? 53  PRO A HA   5  
ATOM   5422  H  HB2  . PRO A 1 53 ? 12.422  -5.914  10.807  1.00 0.00 ? 53  PRO A HB2  5  
ATOM   5423  H  HB3  . PRO A 1 53 ? 11.098  -6.343  9.716   1.00 0.00 ? 53  PRO A HB3  5  
ATOM   5424  H  HG2  . PRO A 1 53 ? 14.047  -6.709  9.351   1.00 0.00 ? 53  PRO A HG2  5  
ATOM   5425  H  HG3  . PRO A 1 53 ? 12.726  -7.833  8.983   1.00 0.00 ? 53  PRO A HG3  5  
ATOM   5426  H  HD2  . PRO A 1 53 ? 13.935  -6.334  7.080   1.00 0.00 ? 53  PRO A HD2  5  
ATOM   5427  H  HD3  . PRO A 1 53 ? 12.221  -6.786  6.993   1.00 0.00 ? 53  PRO A HD3  5  
ATOM   5428  N  N    . GLY A 1 54 ? 12.864  -2.425  10.028  1.00 0.00 ? 54  GLY A N    5  
ATOM   5429  C  CA   . GLY A 1 54 ? 13.753  -1.508  10.718  1.00 0.00 ? 54  GLY A CA   5  
ATOM   5430  C  C    . GLY A 1 54 ? 14.441  -0.545  9.771   1.00 0.00 ? 54  GLY A C    5  
ATOM   5431  O  O    . GLY A 1 54 ? 15.644  -0.308  9.883   1.00 0.00 ? 54  GLY A O    5  
ATOM   5432  H  H    . GLY A 1 54 ? 12.014  -2.100  9.664   1.00 0.00 ? 54  GLY A H    5  
ATOM   5433  H  HA2  . GLY A 1 54 ? 13.180  -0.942  11.437  1.00 0.00 ? 54  GLY A HA2  5  
ATOM   5434  H  HA3  . GLY A 1 54 ? 14.505  -2.080  11.241  1.00 0.00 ? 54  GLY A HA3  5  
ATOM   5435  N  N    . ASP A 1 55 ? 13.678  0.010   8.836   1.00 0.00 ? 55  ASP A N    5  
ATOM   5436  C  CA   . ASP A 1 55 ? 14.222  0.952   7.865   1.00 0.00 ? 55  ASP A CA   5  
ATOM   5437  C  C    . ASP A 1 55 ? 13.330  2.184   7.744   1.00 0.00 ? 55  ASP A C    5  
ATOM   5438  O  O    . ASP A 1 55 ? 12.111  2.069   7.615   1.00 0.00 ? 55  ASP A O    5  
ATOM   5439  C  CB   . ASP A 1 55 ? 14.373  0.280   6.500   1.00 0.00 ? 55  ASP A CB   5  
ATOM   5440  C  CG   . ASP A 1 55 ? 15.518  0.860   5.693   1.00 0.00 ? 55  ASP A CG   5  
ATOM   5441  O  OD1  . ASP A 1 55 ? 16.584  1.132   6.285   1.00 0.00 ? 55  ASP A OD1  5  
ATOM   5442  O  OD2  . ASP A 1 55 ? 15.349  1.040   4.469   1.00 0.00 ? 55  ASP A OD2  5  
ATOM   5443  H  H    . ASP A 1 55 ? 12.726  -0.219  8.799   1.00 0.00 ? 55  ASP A H    5  
ATOM   5444  H  HA   . ASP A 1 55 ? 15.196  1.261   8.213   1.00 0.00 ? 55  ASP A HA   5  
ATOM   5445  H  HB2  . ASP A 1 55 ? 14.556  -0.775  6.643   1.00 0.00 ? 55  ASP A HB2  5  
ATOM   5446  H  HB3  . ASP A 1 55 ? 13.459  0.410   5.939   1.00 0.00 ? 55  ASP A HB3  5  
ATOM   5447  N  N    . ARG A 1 56 ? 13.946  3.361   7.789   1.00 0.00 ? 56  ARG A N    5  
ATOM   5448  C  CA   . ARG A 1 56 ? 13.207  4.613   7.686   1.00 0.00 ? 56  ARG A CA   5  
ATOM   5449  C  C    . ARG A 1 56 ? 12.591  4.770   6.299   1.00 0.00 ? 56  ARG A C    5  
ATOM   5450  O  O    . ARG A 1 56 ? 13.092  4.216   5.320   1.00 0.00 ? 56  ARG A O    5  
ATOM   5451  C  CB   . ARG A 1 56 ? 14.128  5.799   7.984   1.00 0.00 ? 56  ARG A CB   5  
ATOM   5452  C  CG   . ARG A 1 56 ? 14.291  6.085   9.468   1.00 0.00 ? 56  ARG A CG   5  
ATOM   5453  C  CD   . ARG A 1 56 ? 13.232  7.054   9.968   1.00 0.00 ? 56  ARG A CD   5  
ATOM   5454  N  NE   . ARG A 1 56 ? 12.017  6.364   10.394  1.00 0.00 ? 56  ARG A NE   5  
ATOM   5455  C  CZ   . ARG A 1 56 ? 11.759  6.041   11.656  1.00 0.00 ? 56  ARG A CZ   5  
ATOM   5456  N  NH1  . ARG A 1 56 ? 12.627  6.343   12.612  1.00 0.00 ? 56  ARG A NH1  5  
ATOM   5457  N  NH2  . ARG A 1 56 ? 10.632  5.413   11.965  1.00 0.00 ? 56  ARG A NH2  5  
ATOM   5458  H  H    . ARG A 1 56 ? 14.920  3.387   7.893   1.00 0.00 ? 56  ARG A H    5  
ATOM   5459  H  HA   . ARG A 1 56 ? 12.414  4.592   8.419   1.00 0.00 ? 56  ARG A HA   5  
ATOM   5460  H  HB2  . ARG A 1 56 ? 15.104  5.594   7.570   1.00 0.00 ? 56  ARG A HB2  5  
ATOM   5461  H  HB3  . ARG A 1 56 ? 13.723  6.681   7.512   1.00 0.00 ? 56  ARG A HB3  5  
ATOM   5462  H  HG2  . ARG A 1 56 ? 14.204  5.158   10.016  1.00 0.00 ? 56  ARG A HG2  5  
ATOM   5463  H  HG3  . ARG A 1 56 ? 15.268  6.514   9.636   1.00 0.00 ? 56  ARG A HG3  5  
ATOM   5464  H  HD2  . ARG A 1 56 ? 13.633  7.605   10.805  1.00 0.00 ? 56  ARG A HD2  5  
ATOM   5465  H  HD3  . ARG A 1 56 ? 12.985  7.740   9.171   1.00 0.00 ? 56  ARG A HD3  5  
ATOM   5466  H  HE   . ARG A 1 56 ? 11.362  6.131   9.704   1.00 0.00 ? 56  ARG A HE   5  
ATOM   5467  H  HH11 . ARG A 1 56 ? 13.478  6.816   12.382  1.00 0.00 ? 56  ARG A HH11 5  
ATOM   5468  H  HH12 . ARG A 1 56 ? 12.431  6.099   13.562  1.00 0.00 ? 56  ARG A HH12 5  
ATOM   5469  H  HH21 . ARG A 1 56 ? 9.975   5.184   11.247  1.00 0.00 ? 56  ARG A HH21 5  
ATOM   5470  H  HH22 . ARG A 1 56 ? 10.439  5.170   12.915  1.00 0.00 ? 56  ARG A HH22 5  
ATOM   5471  N  N    . VAL A 1 57 ? 11.502  5.527   6.223   1.00 0.00 ? 57  VAL A N    5  
ATOM   5472  C  CA   . VAL A 1 57 ? 10.817  5.757   4.956   1.00 0.00 ? 57  VAL A CA   5  
ATOM   5473  C  C    . VAL A 1 57 ? 10.640  7.248   4.690   1.00 0.00 ? 57  VAL A C    5  
ATOM   5474  O  O    . VAL A 1 57 ? 10.124  7.984   5.532   1.00 0.00 ? 57  VAL A O    5  
ATOM   5475  C  CB   . VAL A 1 57 ? 9.437   5.075   4.932   1.00 0.00 ? 57  VAL A CB   5  
ATOM   5476  C  CG1  . VAL A 1 57 ? 8.705   5.395   3.637   1.00 0.00 ? 57  VAL A CG1  5  
ATOM   5477  C  CG2  . VAL A 1 57 ? 9.583   3.572   5.114   1.00 0.00 ? 57  VAL A CG2  5  
ATOM   5478  H  H    . VAL A 1 57 ? 11.150  5.942   7.038   1.00 0.00 ? 57  VAL A H    5  
ATOM   5479  H  HA   . VAL A 1 57 ? 11.421  5.330   4.168   1.00 0.00 ? 57  VAL A HA   5  
ATOM   5480  H  HB   . VAL A 1 57 ? 8.853   5.461   5.755   1.00 0.00 ? 57  VAL A HB   5  
ATOM   5481  H  HG11 . VAL A 1 57 ? 9.353   5.968   2.991   1.00 0.00 ? 57  VAL A HG11 5  
ATOM   5482  H  HG12 . VAL A 1 57 ? 8.425   4.475   3.145   1.00 0.00 ? 57  VAL A HG12 5  
ATOM   5483  H  HG13 . VAL A 1 57 ? 7.818   5.970   3.858   1.00 0.00 ? 57  VAL A HG13 5  
ATOM   5484  H  HG21 . VAL A 1 57 ? 10.574  3.349   5.479   1.00 0.00 ? 57  VAL A HG21 5  
ATOM   5485  H  HG22 . VAL A 1 57 ? 8.850   3.222   5.826   1.00 0.00 ? 57  VAL A HG22 5  
ATOM   5486  H  HG23 . VAL A 1 57 ? 9.428   3.077   4.166   1.00 0.00 ? 57  VAL A HG23 5  
ATOM   5487  N  N    . THR A 1 58 ? 11.071  7.689   3.512   1.00 0.00 ? 58  THR A N    5  
ATOM   5488  C  CA   . THR A 1 58 ? 10.960  9.092   3.134   1.00 0.00 ? 58  THR A CA   5  
ATOM   5489  C  C    . THR A 1 58 ? 9.638   9.369   2.429   1.00 0.00 ? 58  THR A C    5  
ATOM   5490  O  O    . THR A 1 58 ? 9.389   8.865   1.333   1.00 0.00 ? 58  THR A O    5  
ATOM   5491  C  CB   . THR A 1 58 ? 12.119  9.519   2.214   1.00 0.00 ? 58  THR A CB   5  
ATOM   5492  O  OG1  . THR A 1 58 ? 13.374  9.244   2.846   1.00 0.00 ? 58  THR A OG1  5  
ATOM   5493  C  CG2  . THR A 1 58 ? 12.028  11.000  1.880   1.00 0.00 ? 58  THR A CG2  5  
ATOM   5494  H  H    . THR A 1 58 ? 11.473  7.054   2.883   1.00 0.00 ? 58  THR A H    5  
ATOM   5495  H  HA   . THR A 1 58 ? 11.008  9.685   4.036   1.00 0.00 ? 58  THR A HA   5  
ATOM   5496  H  HB   . THR A 1 58 ? 12.056  8.953   1.295   1.00 0.00 ? 58  THR A HB   5  
ATOM   5497  H  HG1  . THR A 1 58 ? 14.049  9.824   2.485   1.00 0.00 ? 58  THR A HG1  5  
ATOM   5498  H  HG21 . THR A 1 58 ? 11.998  11.126  0.808   1.00 0.00 ? 58  THR A HG21 5  
ATOM   5499  H  HG22 . THR A 1 58 ? 12.890  11.513  2.279   1.00 0.00 ? 58  THR A HG22 5  
ATOM   5500  H  HG23 . THR A 1 58 ? 11.130  11.412  2.316   1.00 0.00 ? 58  THR A HG23 5  
ATOM   5501  N  N    . PHE A 1 59 ? 8.791   10.173  3.063   1.00 0.00 ? 59  PHE A N    5  
ATOM   5502  C  CA   . PHE A 1 59 ? 7.493   10.517  2.496   1.00 0.00 ? 59  PHE A CA   5  
ATOM   5503  C  C    . PHE A 1 59 ? 7.621   11.667  1.501   1.00 0.00 ? 59  PHE A C    5  
ATOM   5504  O  O    . PHE A 1 59 ? 7.898   12.803  1.881   1.00 0.00 ? 59  PHE A O    5  
ATOM   5505  C  CB   . PHE A 1 59 ? 6.511   10.897  3.607   1.00 0.00 ? 59  PHE A CB   5  
ATOM   5506  C  CG   . PHE A 1 59 ? 6.785   10.204  4.911   1.00 0.00 ? 59  PHE A CG   5  
ATOM   5507  C  CD1  . PHE A 1 59 ? 6.680   8.826   5.013   1.00 0.00 ? 59  PHE A CD1  5  
ATOM   5508  C  CD2  . PHE A 1 59 ? 7.147   10.930  6.034   1.00 0.00 ? 59  PHE A CD2  5  
ATOM   5509  C  CE1  . PHE A 1 59 ? 6.930   8.186   6.212   1.00 0.00 ? 59  PHE A CE1  5  
ATOM   5510  C  CE2  . PHE A 1 59 ? 7.399   10.295  7.236   1.00 0.00 ? 59  PHE A CE2  5  
ATOM   5511  C  CZ   . PHE A 1 59 ? 7.291   8.921   7.325   1.00 0.00 ? 59  PHE A CZ   5  
ATOM   5512  H  H    . PHE A 1 59 ? 9.046   10.544  3.934   1.00 0.00 ? 59  PHE A H    5  
ATOM   5513  H  HA   . PHE A 1 59 ? 7.118   9.648   1.978   1.00 0.00 ? 59  PHE A HA   5  
ATOM   5514  H  HB2  . PHE A 1 59 ? 6.568   11.961  3.779   1.00 0.00 ? 59  PHE A HB2  5  
ATOM   5515  H  HB3  . PHE A 1 59 ? 5.510   10.640  3.296   1.00 0.00 ? 59  PHE A HB3  5  
ATOM   5516  H  HD1  . PHE A 1 59 ? 6.398   8.250   4.144   1.00 0.00 ? 59  PHE A HD1  5  
ATOM   5517  H  HD2  . PHE A 1 59 ? 7.232   12.005  5.966   1.00 0.00 ? 59  PHE A HD2  5  
ATOM   5518  H  HE1  . PHE A 1 59 ? 6.845   7.111   6.279   1.00 0.00 ? 59  PHE A HE1  5  
ATOM   5519  H  HE2  . PHE A 1 59 ? 7.681   10.873  8.103   1.00 0.00 ? 59  PHE A HE2  5  
ATOM   5520  H  HZ   . PHE A 1 59 ? 7.487   8.423   8.263   1.00 0.00 ? 59  PHE A HZ   5  
ATOM   5521  N  N    . ASN A 1 60 ? 7.418   11.361  0.223   1.00 0.00 ? 60  ASN A N    5  
ATOM   5522  C  CA   . ASN A 1 60 ? 7.513   12.367  -0.828  1.00 0.00 ? 60  ASN A CA   5  
ATOM   5523  C  C    . ASN A 1 60 ? 6.211   12.451  -1.619  1.00 0.00 ? 60  ASN A C    5  
ATOM   5524  O  O    . ASN A 1 60 ? 5.891   11.559  -2.404  1.00 0.00 ? 60  ASN A O    5  
ATOM   5525  C  CB   . ASN A 1 60 ? 8.675   12.045  -1.769  1.00 0.00 ? 60  ASN A CB   5  
ATOM   5526  C  CG   . ASN A 1 60 ? 8.860   13.100  -2.843  1.00 0.00 ? 60  ASN A CG   5  
ATOM   5527  O  OD1  . ASN A 1 60 ? 7.948   13.874  -3.131  1.00 0.00 ? 60  ASN A OD1  5  
ATOM   5528  N  ND2  . ASN A 1 60 ? 10.046  13.135  -3.440  1.00 0.00 ? 60  ASN A ND2  5  
ATOM   5529  H  H    . ASN A 1 60 ? 7.201   10.436  -0.019  1.00 0.00 ? 60  ASN A H    5  
ATOM   5530  H  HA   . ASN A 1 60 ? 7.696   13.321  -0.358  1.00 0.00 ? 60  ASN A HA   5  
ATOM   5531  H  HB2  . ASN A 1 60 ? 9.588   11.979  -1.195  1.00 0.00 ? 60  ASN A HB2  5  
ATOM   5532  H  HB3  . ASN A 1 60 ? 8.489   11.096  -2.250  1.00 0.00 ? 60  ASN A HB3  5  
ATOM   5533  H  HD21 . ASN A 1 60 ? 10.725  12.487  -3.158  1.00 0.00 ? 60  ASN A HD21 5  
ATOM   5534  H  HD22 . ASN A 1 60 ? 10.193  13.807  -4.137  1.00 0.00 ? 60  ASN A HD22 5  
ATOM   5535  N  N    . GLY A 1 61 ? 5.464   13.530  -1.407  1.00 0.00 ? 61  GLY A N    5  
ATOM   5536  C  CA   . GLY A 1 61 ? 4.206   13.711  -2.108  1.00 0.00 ? 61  GLY A CA   5  
ATOM   5537  C  C    . GLY A 1 61 ? 3.225   12.588  -1.837  1.00 0.00 ? 61  GLY A C    5  
ATOM   5538  O  O    . GLY A 1 61 ? 2.760   12.417  -0.710  1.00 0.00 ? 61  GLY A O    5  
ATOM   5539  H  H    . GLY A 1 61 ? 5.769   14.209  -0.770  1.00 0.00 ? 61  GLY A H    5  
ATOM   5540  H  HA2  . GLY A 1 61 ? 3.763   14.645  -1.795  1.00 0.00 ? 61  GLY A HA2  5  
ATOM   5541  H  HA3  . GLY A 1 61 ? 4.402   13.754  -3.169  1.00 0.00 ? 61  GLY A HA3  5  
ATOM   5542  N  N    . LYS A 1 62 ? 2.906   11.820  -2.874  1.00 0.00 ? 62  LYS A N    5  
ATOM   5543  C  CA   . LYS A 1 62 ? 1.973   10.707  -2.744  1.00 0.00 ? 62  LYS A CA   5  
ATOM   5544  C  C    . LYS A 1 62 ? 2.719   9.379   -2.663  1.00 0.00 ? 62  LYS A C    5  
ATOM   5545  O  O    . LYS A 1 62 ? 2.293   8.460   -1.965  1.00 0.00 ? 62  LYS A O    5  
ATOM   5546  C  CB   . LYS A 1 62 ? 1.002   10.688  -3.927  1.00 0.00 ? 62  LYS A CB   5  
ATOM   5547  C  CG   . LYS A 1 62 ? 0.099   11.907  -3.991  1.00 0.00 ? 62  LYS A CG   5  
ATOM   5548  C  CD   . LYS A 1 62 ? -0.942  11.889  -2.885  1.00 0.00 ? 62  LYS A CD   5  
ATOM   5549  C  CE   . LYS A 1 62 ? -1.966  10.786  -3.101  1.00 0.00 ? 62  LYS A CE   5  
ATOM   5550  N  NZ   . LYS A 1 62 ? -1.545  9.506   -2.467  1.00 0.00 ? 62  LYS A NZ   5  
ATOM   5551  H  H    . LYS A 1 62 ? 3.310   12.006  -3.748  1.00 0.00 ? 62  LYS A H    5  
ATOM   5552  H  HA   . LYS A 1 62 ? 1.414   10.848  -1.832  1.00 0.00 ? 62  LYS A HA   5  
ATOM   5553  H  HB2  . LYS A 1 62 ? 1.571   10.638  -4.843  1.00 0.00 ? 62  LYS A HB2  5  
ATOM   5554  H  HB3  . LYS A 1 62 ? 0.380   9.808   -3.851  1.00 0.00 ? 62  LYS A HB3  5  
ATOM   5555  H  HG2  . LYS A 1 62 ? 0.702   12.797  -3.889  1.00 0.00 ? 62  LYS A HG2  5  
ATOM   5556  H  HG3  . LYS A 1 62 ? -0.405  11.920  -4.948  1.00 0.00 ? 62  LYS A HG3  5  
ATOM   5557  H  HD2  . LYS A 1 62 ? -0.447  11.725  -1.939  1.00 0.00 ? 62  LYS A HD2  5  
ATOM   5558  H  HD3  . LYS A 1 62 ? -1.451  12.843  -2.866  1.00 0.00 ? 62  LYS A HD3  5  
ATOM   5559  H  HE2  . LYS A 1 62 ? -2.907  11.097  -2.673  1.00 0.00 ? 62  LYS A HE2  5  
ATOM   5560  H  HE3  . LYS A 1 62 ? -2.088  10.629  -4.163  1.00 0.00 ? 62  LYS A HE3  5  
ATOM   5561  H  HZ1  . LYS A 1 62 ? -1.189  8.849   -3.191  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM   5562  H  HZ2  . LYS A 1 62 ? -2.352  9.065   -1.982  1.00 0.00 ? 62  LYS A HZ2  5  
ATOM   5563  H  HZ3  . LYS A 1 62 ? -0.791  9.682   -1.773  1.00 0.00 ? 62  LYS A HZ3  5  
ATOM   5564  N  N    . GLU A 1 63 ? 3.834   9.286   -3.381  1.00 0.00 ? 63  GLU A N    5  
ATOM   5565  C  CA   . GLU A 1 63 ? 4.638   8.070   -3.389  1.00 0.00 ? 63  GLU A CA   5  
ATOM   5566  C  C    . GLU A 1 63 ? 5.751   8.147   -2.347  1.00 0.00 ? 63  GLU A C    5  
ATOM   5567  O  O    . GLU A 1 63 ? 6.048   9.219   -1.818  1.00 0.00 ? 63  GLU A O    5  
ATOM   5568  C  CB   . GLU A 1 63 ? 5.239   7.838   -4.777  1.00 0.00 ? 63  GLU A CB   5  
ATOM   5569  C  CG   . GLU A 1 63 ? 5.992   9.040   -5.322  1.00 0.00 ? 63  GLU A CG   5  
ATOM   5570  C  CD   . GLU A 1 63 ? 6.691   8.744   -6.635  1.00 0.00 ? 63  GLU A CD   5  
ATOM   5571  O  OE1  . GLU A 1 63 ? 6.034   8.205   -7.549  1.00 0.00 ? 63  GLU A OE1  5  
ATOM   5572  O  OE2  . GLU A 1 63 ? 7.896   9.052   -6.747  1.00 0.00 ? 63  GLU A OE2  5  
ATOM   5573  H  H    . GLU A 1 63 ? 4.122   10.054  -3.918  1.00 0.00 ? 63  GLU A H    5  
ATOM   5574  H  HA   . GLU A 1 63 ? 3.990   7.242   -3.145  1.00 0.00 ? 63  GLU A HA   5  
ATOM   5575  H  HB2  . GLU A 1 63 ? 5.923   7.004   -4.725  1.00 0.00 ? 63  GLU A HB2  5  
ATOM   5576  H  HB3  . GLU A 1 63 ? 4.442   7.597   -5.465  1.00 0.00 ? 63  GLU A HB3  5  
ATOM   5577  H  HG2  . GLU A 1 63 ? 5.292   9.847   -5.479  1.00 0.00 ? 63  GLU A HG2  5  
ATOM   5578  H  HG3  . GLU A 1 63 ? 6.733   9.344   -4.597  1.00 0.00 ? 63  GLU A HG3  5  
ATOM   5579  N  N    . CYS A 1 64 ? 6.361   7.003   -2.057  1.00 0.00 ? 64  CYS A N    5  
ATOM   5580  C  CA   . CYS A 1 64 ? 7.440   6.939   -1.077  1.00 0.00 ? 64  CYS A CA   5  
ATOM   5581  C  C    . CYS A 1 64 ? 8.671   6.259   -1.668  1.00 0.00 ? 64  CYS A C    5  
ATOM   5582  O  O    . CYS A 1 64 ? 8.556   5.358   -2.498  1.00 0.00 ? 64  CYS A O    5  
ATOM   5583  C  CB   . CYS A 1 64 ? 6.978   6.188   0.173   1.00 0.00 ? 64  CYS A CB   5  
ATOM   5584  S  SG   . CYS A 1 64 ? 5.317   6.636   0.731   1.00 0.00 ? 64  CYS A SG   5  
ATOM   5585  H  H    . CYS A 1 64 ? 6.079   6.181   -2.511  1.00 0.00 ? 64  CYS A H    5  
ATOM   5586  H  HA   . CYS A 1 64 ? 7.698   7.951   -0.804  1.00 0.00 ? 64  CYS A HA   5  
ATOM   5587  H  HB2  . CYS A 1 64 ? 6.980   5.128   -0.032  1.00 0.00 ? 64  CYS A HB2  5  
ATOM   5588  H  HB3  . CYS A 1 64 ? 7.664   6.393   0.980   1.00 0.00 ? 64  CYS A HB3  5  
ATOM   5589  H  HG   . CYS A 1 64 ? 5.293   6.546   2.052   1.00 0.00 ? 64  CYS A HG   5  
ATOM   5590  N  N    . MET A 1 65 ? 9.848   6.699   -1.235  1.00 0.00 ? 65  MET A N    5  
ATOM   5591  C  CA   . MET A 1 65 ? 11.100  6.133   -1.721  1.00 0.00 ? 65  MET A CA   5  
ATOM   5592  C  C    . MET A 1 65 ? 11.929  5.575   -0.569  1.00 0.00 ? 65  MET A C    5  
ATOM   5593  O  O    . MET A 1 65 ? 11.753  5.971   0.584   1.00 0.00 ? 65  MET A O    5  
ATOM   5594  C  CB   . MET A 1 65 ? 11.905  7.193   -2.477  1.00 0.00 ? 65  MET A CB   5  
ATOM   5595  C  CG   . MET A 1 65 ? 11.574  7.265   -3.958  1.00 0.00 ? 65  MET A CG   5  
ATOM   5596  S  SD   . MET A 1 65 ? 12.592  8.464   -4.840  1.00 0.00 ? 65  MET A SD   5  
ATOM   5597  C  CE   . MET A 1 65 ? 12.054  9.992   -4.075  1.00 0.00 ? 65  MET A CE   5  
ATOM   5598  H  H    . MET A 1 65 ? 9.875   7.420   -0.572  1.00 0.00 ? 65  MET A H    5  
ATOM   5599  H  HA   . MET A 1 65 ? 10.859  5.327   -2.399  1.00 0.00 ? 65  MET A HA   5  
ATOM   5600  H  HB2  . MET A 1 65 ? 11.705  8.159   -2.038  1.00 0.00 ? 65  MET A HB2  5  
ATOM   5601  H  HB3  . MET A 1 65 ? 12.956  6.970   -2.375  1.00 0.00 ? 65  MET A HB3  5  
ATOM   5602  H  HG2  . MET A 1 65 ? 11.731  6.290   -4.397  1.00 0.00 ? 65  MET A HG2  5  
ATOM   5603  H  HG3  . MET A 1 65 ? 10.537  7.544   -4.068  1.00 0.00 ? 65  MET A HG3  5  
ATOM   5604  H  HE1  . MET A 1 65 ? 11.795  10.706  -4.842  1.00 0.00 ? 65  MET A HE1  5  
ATOM   5605  H  HE2  . MET A 1 65 ? 11.191  9.799   -3.455  1.00 0.00 ? 65  MET A HE2  5  
ATOM   5606  H  HE3  . MET A 1 65 ? 12.854  10.390  -3.467  1.00 0.00 ? 65  MET A HE3  5  
ATOM   5607  N  N    . CYS A 1 66 ? 12.832  4.653   -0.887  1.00 0.00 ? 66  CYS A N    5  
ATOM   5608  C  CA   . CYS A 1 66 ? 13.687  4.040   0.122   1.00 0.00 ? 66  CYS A CA   5  
ATOM   5609  C  C    . CYS A 1 66 ? 14.904  4.915   0.409   1.00 0.00 ? 66  CYS A C    5  
ATOM   5610  O  O    . CYS A 1 66 ? 15.424  5.582   -0.485  1.00 0.00 ? 66  CYS A O    5  
ATOM   5611  C  CB   . CYS A 1 66 ? 14.140  2.653   -0.338  1.00 0.00 ? 66  CYS A CB   5  
ATOM   5612  S  SG   . CYS A 1 66 ? 15.026  2.650   -1.930  1.00 0.00 ? 66  CYS A SG   5  
ATOM   5613  H  H    . CYS A 1 66 ? 12.925  4.378   -1.823  1.00 0.00 ? 66  CYS A H    5  
ATOM   5614  H  HA   . CYS A 1 66 ? 13.111  3.938   1.029   1.00 0.00 ? 66  CYS A HA   5  
ATOM   5615  H  HB2  . CYS A 1 66 ? 14.802  2.233   0.406   1.00 0.00 ? 66  CYS A HB2  5  
ATOM   5616  H  HB3  . CYS A 1 66 ? 13.274  2.016   -0.442  1.00 0.00 ? 66  CYS A HB3  5  
ATOM   5617  N  N    . GLN A 1 67 ? 15.350  4.906   1.661   1.00 0.00 ? 67  GLN A N    5  
ATOM   5618  C  CA   . GLN A 1 67 ? 16.505  5.699   2.065   1.00 0.00 ? 67  GLN A CA   5  
ATOM   5619  C  C    . GLN A 1 67 ? 17.523  5.795   0.933   1.00 0.00 ? 67  GLN A C    5  
ATOM   5620  O  O    . GLN A 1 67 ? 18.069  6.865   0.664   1.00 0.00 ? 67  GLN A O    5  
ATOM   5621  C  CB   . GLN A 1 67 ? 17.160  5.090   3.306   1.00 0.00 ? 67  GLN A CB   5  
ATOM   5622  C  CG   . GLN A 1 67 ? 18.199  5.993   3.951   1.00 0.00 ? 67  GLN A CG   5  
ATOM   5623  C  CD   . GLN A 1 67 ? 18.857  5.355   5.158   1.00 0.00 ? 67  GLN A CD   5  
ATOM   5624  O  OE1  . GLN A 1 67 ? 19.881  4.681   5.038   1.00 0.00 ? 67  GLN A OE1  5  
ATOM   5625  N  NE2  . GLN A 1 67 ? 18.272  5.565   6.331   1.00 0.00 ? 67  GLN A NE2  5  
ATOM   5626  H  H    . GLN A 1 67 ? 14.893  4.354   2.328   1.00 0.00 ? 67  GLN A H    5  
ATOM   5627  H  HA   . GLN A 1 67 ? 16.157  6.693   2.304   1.00 0.00 ? 67  GLN A HA   5  
ATOM   5628  H  HB2  . GLN A 1 67 ? 16.393  4.880   4.037   1.00 0.00 ? 67  GLN A HB2  5  
ATOM   5629  H  HB3  . GLN A 1 67 ? 17.642  4.165   3.026   1.00 0.00 ? 67  GLN A HB3  5  
ATOM   5630  H  HG2  . GLN A 1 67 ? 18.963  6.219   3.222   1.00 0.00 ? 67  GLN A HG2  5  
ATOM   5631  H  HG3  . GLN A 1 67 ? 17.718  6.908   4.262   1.00 0.00 ? 67  GLN A HG3  5  
ATOM   5632  H  HE21 . GLN A 1 67 ? 17.458  6.111   6.351   1.00 0.00 ? 67  GLN A HE21 5  
ATOM   5633  H  HE22 . GLN A 1 67 ? 18.675  5.164   7.128   1.00 0.00 ? 67  GLN A HE22 5  
ATOM   5634  N  N    . LYS A 1 68 ? 17.774  4.669   0.274   1.00 0.00 ? 68  LYS A N    5  
ATOM   5635  C  CA   . LYS A 1 68 ? 18.726  4.625   -0.830  1.00 0.00 ? 68  LYS A CA   5  
ATOM   5636  C  C    . LYS A 1 68 ? 18.292  5.553   -1.960  1.00 0.00 ? 68  LYS A C    5  
ATOM   5637  O  O    . LYS A 1 68 ? 18.923  6.581   -2.210  1.00 0.00 ? 68  LYS A O    5  
ATOM   5638  C  CB   . LYS A 1 68 ? 18.863  3.194   -1.355  1.00 0.00 ? 68  LYS A CB   5  
ATOM   5639  C  CG   . LYS A 1 68 ? 19.492  2.238   -0.357  1.00 0.00 ? 68  LYS A CG   5  
ATOM   5640  C  CD   . LYS A 1 68 ? 18.474  1.736   0.653   1.00 0.00 ? 68  LYS A CD   5  
ATOM   5641  C  CE   . LYS A 1 68 ? 18.910  0.418   1.275   1.00 0.00 ? 68  LYS A CE   5  
ATOM   5642  N  NZ   . LYS A 1 68 ? 18.426  -0.752  0.492   1.00 0.00 ? 68  LYS A NZ   5  
ATOM   5643  H  H    . LYS A 1 68 ? 17.307  3.848   0.535   1.00 0.00 ? 68  LYS A H    5  
ATOM   5644  H  HA   . LYS A 1 68 ? 19.683  4.956   -0.456  1.00 0.00 ? 68  LYS A HA   5  
ATOM   5645  H  HB2  . LYS A 1 68 ? 17.882  2.822   -1.610  1.00 0.00 ? 68  LYS A HB2  5  
ATOM   5646  H  HB3  . LYS A 1 68 ? 19.476  3.207   -2.245  1.00 0.00 ? 68  LYS A HB3  5  
ATOM   5647  H  HG2  . LYS A 1 68 ? 19.901  1.392   -0.891  1.00 0.00 ? 68  LYS A HG2  5  
ATOM   5648  H  HG3  . LYS A 1 68 ? 20.285  2.751   0.169   1.00 0.00 ? 68  LYS A HG3  5  
ATOM   5649  H  HD2  . LYS A 1 68 ? 18.363  2.471   1.435   1.00 0.00 ? 68  LYS A HD2  5  
ATOM   5650  H  HD3  . LYS A 1 68 ? 17.526  1.592   0.154   1.00 0.00 ? 68  LYS A HD3  5  
ATOM   5651  H  HE2  . LYS A 1 68 ? 19.988  0.393   1.316   1.00 0.00 ? 68  LYS A HE2  5  
ATOM   5652  H  HE3  . LYS A 1 68 ? 18.511  0.360   2.277   1.00 0.00 ? 68  LYS A HE3  5  
ATOM   5653  H  HZ1  . LYS A 1 68 ? 19.037  -1.576  0.668   1.00 0.00 ? 68  LYS A HZ1  5  
ATOM   5654  H  HZ2  . LYS A 1 68 ? 18.443  -0.534  -0.524  1.00 0.00 ? 68  LYS A HZ2  5  
ATOM   5655  H  HZ3  . LYS A 1 68 ? 17.453  -0.990  0.768   1.00 0.00 ? 68  LYS A HZ3  5  
ATOM   5656  N  N    . CYS A 1 69 ? 17.211  5.185   -2.640  1.00 0.00 ? 69  CYS A N    5  
ATOM   5657  C  CA   . CYS A 1 69 ? 16.692  5.985   -3.743  1.00 0.00 ? 69  CYS A CA   5  
ATOM   5658  C  C    . CYS A 1 69 ? 16.646  7.464   -3.368  1.00 0.00 ? 69  CYS A C    5  
ATOM   5659  O  O    . CYS A 1 69 ? 17.262  8.301   -4.027  1.00 0.00 ? 69  CYS A O    5  
ATOM   5660  C  CB   . CYS A 1 69 ? 15.294  5.504   -4.135  1.00 0.00 ? 69  CYS A CB   5  
ATOM   5661  S  SG   . CYS A 1 69 ? 15.268  3.865   -4.930  1.00 0.00 ? 69  CYS A SG   5  
ATOM   5662  H  H    . CYS A 1 69 ? 16.751  4.355   -2.394  1.00 0.00 ? 69  CYS A H    5  
ATOM   5663  H  HA   . CYS A 1 69 ? 17.356  5.860   -4.585  1.00 0.00 ? 69  CYS A HA   5  
ATOM   5664  H  HB2  . CYS A 1 69 ? 14.679  5.448   -3.249  1.00 0.00 ? 69  CYS A HB2  5  
ATOM   5665  H  HB3  . CYS A 1 69 ? 14.858  6.211   -4.825  1.00 0.00 ? 69  CYS A HB3  5  
ATOM   5666  N  N    . SER A 1 70 ? 15.912  7.776   -2.305  1.00 0.00 ? 70  SER A N    5  
ATOM   5667  C  CA   . SER A 1 70 ? 15.783  9.154   -1.844  1.00 0.00 ? 70  SER A CA   5  
ATOM   5668  C  C    . SER A 1 70 ? 17.086  9.920   -2.050  1.00 0.00 ? 70  SER A C    5  
ATOM   5669  O  O    . SER A 1 70 ? 17.151  10.852  -2.854  1.00 0.00 ? 70  SER A O    5  
ATOM   5670  C  CB   . SER A 1 70 ? 15.388  9.184   -0.366  1.00 0.00 ? 70  SER A CB   5  
ATOM   5671  O  OG   . SER A 1 70 ? 15.995  8.121   0.346   1.00 0.00 ? 70  SER A OG   5  
ATOM   5672  H  H    . SER A 1 70 ? 15.445  7.064   -1.821  1.00 0.00 ? 70  SER A H    5  
ATOM   5673  H  HA   . SER A 1 70 ? 15.005  9.626   -2.425  1.00 0.00 ? 70  SER A HA   5  
ATOM   5674  H  HB2  . SER A 1 70 ? 15.705  10.120  0.069   1.00 0.00 ? 70  SER A HB2  5  
ATOM   5675  H  HB3  . SER A 1 70 ? 14.315  9.093   -0.281  1.00 0.00 ? 70  SER A HB3  5  
ATOM   5676  H  HG   . SER A 1 70 ? 16.147  8.389   1.255   1.00 0.00 ? 70  SER A HG   5  
ATOM   5677  N  N    . LEU A 1 71 ? 18.121  9.523   -1.319  1.00 0.00 ? 71  LEU A N    5  
ATOM   5678  C  CA   . LEU A 1 71 ? 19.424  10.171  -1.420  1.00 0.00 ? 71  LEU A CA   5  
ATOM   5679  C  C    . LEU A 1 71 ? 20.210  9.631   -2.610  1.00 0.00 ? 71  LEU A C    5  
ATOM   5680  O  O    . LEU A 1 71 ? 19.938  8.546   -3.124  1.00 0.00 ? 71  LEU A O    5  
ATOM   5681  C  CB   . LEU A 1 71 ? 20.220  9.962   -0.131  1.00 0.00 ? 71  LEU A CB   5  
ATOM   5682  C  CG   . LEU A 1 71 ? 19.961  10.970  0.989   1.00 0.00 ? 71  LEU A CG   5  
ATOM   5683  C  CD1  . LEU A 1 71 ? 18.852  10.477  1.905   1.00 0.00 ? 71  LEU A CD1  5  
ATOM   5684  C  CD2  . LEU A 1 71 ? 21.235  11.227  1.781   1.00 0.00 ? 71  LEU A CD2  5  
ATOM   5685  H  H    . LEU A 1 71 ? 18.007  8.775   -0.696  1.00 0.00 ? 71  LEU A H    5  
ATOM   5686  H  HA   . LEU A 1 71 ? 19.257  11.228  -1.563  1.00 0.00 ? 71  LEU A HA   5  
ATOM   5687  H  HB2  . LEU A 1 71 ? 19.985  8.980   0.248   1.00 0.00 ? 71  LEU A HB2  5  
ATOM   5688  H  HB3  . LEU A 1 71 ? 21.271  10.008  -0.382  1.00 0.00 ? 71  LEU A HB3  5  
ATOM   5689  H  HG   . LEU A 1 71 ? 19.642  11.908  0.555   1.00 0.00 ? 71  LEU A HG   5  
ATOM   5690  H  HD11 . LEU A 1 71 ? 17.939  11.008  1.683   1.00 0.00 ? 71  LEU A HD11 5  
ATOM   5691  H  HD12 . LEU A 1 71 ? 19.130  10.653  2.934   1.00 0.00 ? 71  LEU A HD12 5  
ATOM   5692  H  HD13 . LEU A 1 71 ? 18.702  9.419   1.750   1.00 0.00 ? 71  LEU A HD13 5  
ATOM   5693  H  HD21 . LEU A 1 71 ? 21.126  12.137  2.353   1.00 0.00 ? 71  LEU A HD21 5  
ATOM   5694  H  HD22 . LEU A 1 71 ? 22.068  11.328  1.100   1.00 0.00 ? 71  LEU A HD22 5  
ATOM   5695  H  HD23 . LEU A 1 71 ? 21.415  10.399  2.451   1.00 0.00 ? 71  LEU A HD23 5  
ATOM   5696  N  N    . PRO A 1 72 ? 21.209  10.404  -3.059  1.00 0.00 ? 72  PRO A N    5  
ATOM   5697  C  CA   . PRO A 1 72 ? 22.057  10.023  -4.193  1.00 0.00 ? 72  PRO A CA   5  
ATOM   5698  C  C    . PRO A 1 72 ? 22.979  8.855   -3.860  1.00 0.00 ? 72  PRO A C    5  
ATOM   5699  O  O    . PRO A 1 72 ? 23.564  8.802   -2.778  1.00 0.00 ? 72  PRO A O    5  
ATOM   5700  C  CB   . PRO A 1 72 ? 22.874  11.288  -4.466  1.00 0.00 ? 72  PRO A CB   5  
ATOM   5701  C  CG   . PRO A 1 72 ? 22.903  12.010  -3.163  1.00 0.00 ? 72  PRO A CG   5  
ATOM   5702  C  CD   . PRO A 1 72 ? 21.589  11.710  -2.495  1.00 0.00 ? 72  PRO A CD   5  
ATOM   5703  H  HA   . PRO A 1 72 ? 21.468  9.778   -5.064  1.00 0.00 ? 72  PRO A HA   5  
ATOM   5704  H  HB2  . PRO A 1 72 ? 23.869  11.015  -4.789  1.00 0.00 ? 72  PRO A HB2  5  
ATOM   5705  H  HB3  . PRO A 1 72 ? 22.390  11.876  -5.232  1.00 0.00 ? 72  PRO A HB3  5  
ATOM   5706  H  HG2  . PRO A 1 72 ? 23.721  11.647  -2.560  1.00 0.00 ? 72  PRO A HG2  5  
ATOM   5707  H  HG3  . PRO A 1 72 ? 23.003  13.071  -3.334  1.00 0.00 ? 72  PRO A HG3  5  
ATOM   5708  H  HD2  . PRO A 1 72 ? 21.716  11.646  -1.425  1.00 0.00 ? 72  PRO A HD2  5  
ATOM   5709  H  HD3  . PRO A 1 72 ? 20.858  12.465  -2.745  1.00 0.00 ? 72  PRO A HD3  5  
ATOM   5710  N  N    . VAL A 1 73 ? 23.105  7.920   -4.796  1.00 0.00 ? 73  VAL A N    5  
ATOM   5711  C  CA   . VAL A 1 73 ? 23.958  6.754   -4.602  1.00 0.00 ? 73  VAL A CA   5  
ATOM   5712  C  C    . VAL A 1 73 ? 24.897  6.557   -5.787  1.00 0.00 ? 73  VAL A C    5  
ATOM   5713  O  O    . VAL A 1 73 ? 24.518  6.778   -6.937  1.00 0.00 ? 73  VAL A O    5  
ATOM   5714  C  CB   . VAL A 1 73 ? 23.122  5.475   -4.406  1.00 0.00 ? 73  VAL A CB   5  
ATOM   5715  C  CG1  . VAL A 1 73 ? 24.029  4.274   -4.182  1.00 0.00 ? 73  VAL A CG1  5  
ATOM   5716  C  CG2  . VAL A 1 73 ? 22.153  5.645   -3.246  1.00 0.00 ? 73  VAL A CG2  5  
ATOM   5717  H  H    . VAL A 1 73 ? 22.613  8.018   -5.638  1.00 0.00 ? 73  VAL A H    5  
ATOM   5718  H  HA   . VAL A 1 73 ? 24.546  6.915   -3.711  1.00 0.00 ? 73  VAL A HA   5  
ATOM   5719  H  HB   . VAL A 1 73 ? 22.548  5.302   -5.304  1.00 0.00 ? 73  VAL A HB   5  
ATOM   5720  H  HG11 . VAL A 1 73 ? 23.646  3.682   -3.364  1.00 0.00 ? 73  VAL A HG11 5  
ATOM   5721  H  HG12 . VAL A 1 73 ? 24.059  3.673   -5.080  1.00 0.00 ? 73  VAL A HG12 5  
ATOM   5722  H  HG13 . VAL A 1 73 ? 25.025  4.615   -3.943  1.00 0.00 ? 73  VAL A HG13 5  
ATOM   5723  H  HG21 . VAL A 1 73 ? 21.565  6.538   -3.397  1.00 0.00 ? 73  VAL A HG21 5  
ATOM   5724  H  HG22 . VAL A 1 73 ? 21.498  4.787   -3.194  1.00 0.00 ? 73  VAL A HG22 5  
ATOM   5725  H  HG23 . VAL A 1 73 ? 22.707  5.730   -2.323  1.00 0.00 ? 73  VAL A HG23 5  
ATOM   5726  N  N    . SER A 1 74 ? 26.126  6.139   -5.498  1.00 0.00 ? 74  SER A N    5  
ATOM   5727  C  CA   . SER A 1 74 ? 27.122  5.915   -6.539  1.00 0.00 ? 74  SER A CA   5  
ATOM   5728  C  C    . SER A 1 74 ? 26.468  5.387   -7.812  1.00 0.00 ? 74  SER A C    5  
ATOM   5729  O  O    . SER A 1 74 ? 26.777  5.836   -8.915  1.00 0.00 ? 74  SER A O    5  
ATOM   5730  C  CB   . SER A 1 74 ? 28.186  4.930   -6.052  1.00 0.00 ? 74  SER A CB   5  
ATOM   5731  O  OG   . SER A 1 74 ? 29.259  4.843   -6.973  1.00 0.00 ? 74  SER A OG   5  
ATOM   5732  H  H    . SER A 1 74 ? 26.368  5.980   -4.561  1.00 0.00 ? 74  SER A H    5  
ATOM   5733  H  HA   . SER A 1 74 ? 27.592  6.862   -6.756  1.00 0.00 ? 74  SER A HA   5  
ATOM   5734  H  HB2  . SER A 1 74 ? 28.571  5.262   -5.100  1.00 0.00 ? 74  SER A HB2  5  
ATOM   5735  H  HB3  . SER A 1 74 ? 27.743  3.951   -5.940  1.00 0.00 ? 74  SER A HB3  5  
ATOM   5736  H  HG   . SER A 1 74 ? 29.268  5.625   -7.530  1.00 0.00 ? 74  SER A HG   5  
ATOM   5737  N  N    . VAL A 1 75 ? 25.561  4.428   -7.650  1.00 0.00 ? 75  VAL A N    5  
ATOM   5738  C  CA   . VAL A 1 75 ? 24.861  3.838   -8.784  1.00 0.00 ? 75  VAL A CA   5  
ATOM   5739  C  C    . VAL A 1 75 ? 24.527  4.893   -9.833  1.00 0.00 ? 75  VAL A C    5  
ATOM   5740  O  O    . VAL A 1 75 ? 24.097  5.997   -9.502  1.00 0.00 ? 75  VAL A O    5  
ATOM   5741  C  CB   . VAL A 1 75 ? 23.562  3.140   -8.341  1.00 0.00 ? 75  VAL A CB   5  
ATOM   5742  C  CG1  . VAL A 1 75 ? 23.868  2.001   -7.381  1.00 0.00 ? 75  VAL A CG1  5  
ATOM   5743  C  CG2  . VAL A 1 75 ? 22.609  4.142   -7.706  1.00 0.00 ? 75  VAL A CG2  5  
ATOM   5744  H  H    . VAL A 1 75 ? 25.357  4.111   -6.745  1.00 0.00 ? 75  VAL A H    5  
ATOM   5745  H  HA   . VAL A 1 75 ? 25.510  3.096   -9.228  1.00 0.00 ? 75  VAL A HA   5  
ATOM   5746  H  HB   . VAL A 1 75 ? 23.083  2.725   -9.216  1.00 0.00 ? 75  VAL A HB   5  
ATOM   5747  H  HG11 . VAL A 1 75 ? 24.149  1.122   -7.943  1.00 0.00 ? 75  VAL A HG11 5  
ATOM   5748  H  HG12 . VAL A 1 75 ? 24.680  2.287   -6.729  1.00 0.00 ? 75  VAL A HG12 5  
ATOM   5749  H  HG13 . VAL A 1 75 ? 22.990  1.783   -6.790  1.00 0.00 ? 75  VAL A HG13 5  
ATOM   5750  H  HG21 . VAL A 1 75 ? 21.826  4.387   -8.408  1.00 0.00 ? 75  VAL A HG21 5  
ATOM   5751  H  HG22 . VAL A 1 75 ? 22.173  3.711   -6.817  1.00 0.00 ? 75  VAL A HG22 5  
ATOM   5752  H  HG23 . VAL A 1 75 ? 23.151  5.038   -7.443  1.00 0.00 ? 75  VAL A HG23 5  
ATOM   5753  N  N    . SER A 1 76 ? 24.727  4.544   -11.100 1.00 0.00 ? 76  SER A N    5  
ATOM   5754  C  CA   . SER A 1 76 ? 24.449  5.462   -12.198 1.00 0.00 ? 76  SER A CA   5  
ATOM   5755  C  C    . SER A 1 76 ? 24.578  4.754   -13.544 1.00 0.00 ? 76  SER A C    5  
ATOM   5756  O  O    . SER A 1 76 ? 25.492  3.959   -13.755 1.00 0.00 ? 76  SER A O    5  
ATOM   5757  C  CB   . SER A 1 76 ? 25.403  6.657   -12.145 1.00 0.00 ? 76  SER A CB   5  
ATOM   5758  O  OG   . SER A 1 76 ? 26.740  6.254   -12.383 1.00 0.00 ? 76  SER A OG   5  
ATOM   5759  H  H    . SER A 1 76 ? 25.071  3.648   -11.300 1.00 0.00 ? 76  SER A H    5  
ATOM   5760  H  HA   . SER A 1 76 ? 23.435  5.816   -12.086 1.00 0.00 ? 76  SER A HA   5  
ATOM   5761  H  HB2  . SER A 1 76 ? 25.117  7.376   -12.898 1.00 0.00 ? 76  SER A HB2  5  
ATOM   5762  H  HB3  . SER A 1 76 ? 25.346  7.116   -11.169 1.00 0.00 ? 76  SER A HB3  5  
ATOM   5763  H  HG   . SER A 1 76 ? 27.319  7.018   -12.337 1.00 0.00 ? 76  SER A HG   5  
ATOM   5764  N  N    . GLY A 1 77 ? 23.652  5.050   -14.452 1.00 0.00 ? 77  GLY A N    5  
ATOM   5765  C  CA   . GLY A 1 77 ? 23.678  4.434   -15.765 1.00 0.00 ? 77  GLY A CA   5  
ATOM   5766  C  C    . GLY A 1 77 ? 23.756  5.455   -16.883 1.00 0.00 ? 77  GLY A C    5  
ATOM   5767  O  O    . GLY A 1 77 ? 24.197  6.587   -16.688 1.00 0.00 ? 77  GLY A O    5  
ATOM   5768  H  H    . GLY A 1 77 ? 22.945  5.691   -14.227 1.00 0.00 ? 77  GLY A H    5  
ATOM   5769  H  HA2  . GLY A 1 77 ? 24.536  3.781   -15.828 1.00 0.00 ? 77  GLY A HA2  5  
ATOM   5770  H  HA3  . GLY A 1 77 ? 22.781  3.845   -15.892 1.00 0.00 ? 77  GLY A HA3  5  
ATOM   5771  N  N    . PRO A 1 78 ? 23.320  5.054   -18.087 1.00 0.00 ? 78  PRO A N    5  
ATOM   5772  C  CA   . PRO A 1 78 ? 23.333  5.928   -19.264 1.00 0.00 ? 78  PRO A CA   5  
ATOM   5773  C  C    . PRO A 1 78 ? 22.311  7.055   -19.160 1.00 0.00 ? 78  PRO A C    5  
ATOM   5774  O  O    . PRO A 1 78 ? 21.608  7.178   -18.158 1.00 0.00 ? 78  PRO A O    5  
ATOM   5775  C  CB   . PRO A 1 78 ? 22.970  4.982   -20.411 1.00 0.00 ? 78  PRO A CB   5  
ATOM   5776  C  CG   . PRO A 1 78 ? 22.197  3.883   -19.767 1.00 0.00 ? 78  PRO A CG   5  
ATOM   5777  C  CD   . PRO A 1 78 ? 22.780  3.718   -18.391 1.00 0.00 ? 78  PRO A CD   5  
ATOM   5778  H  HA   . PRO A 1 78 ? 24.313  6.346   -19.436 1.00 0.00 ? 78  PRO A HA   5  
ATOM   5779  H  HB2  . PRO A 1 78 ? 22.374  5.510   -21.142 1.00 0.00 ? 78  PRO A HB2  5  
ATOM   5780  H  HB3  . PRO A 1 78 ? 23.872  4.610   -20.875 1.00 0.00 ? 78  PRO A HB3  5  
ATOM   5781  H  HG2  . PRO A 1 78 ? 21.155  4.157   -19.702 1.00 0.00 ? 78  PRO A HG2  5  
ATOM   5782  H  HG3  . PRO A 1 78 ? 22.312  2.972   -20.334 1.00 0.00 ? 78  PRO A HG3  5  
ATOM   5783  H  HD2  . PRO A 1 78 ? 22.010  3.443   -17.685 1.00 0.00 ? 78  PRO A HD2  5  
ATOM   5784  H  HD3  . PRO A 1 78 ? 23.567  2.979   -18.401 1.00 0.00 ? 78  PRO A HD3  5  
ATOM   5785  N  N    . SER A 1 79 ? 22.235  7.876   -20.203 1.00 0.00 ? 79  SER A N    5  
ATOM   5786  C  CA   . SER A 1 79 ? 21.302  8.996   -20.227 1.00 0.00 ? 79  SER A CA   5  
ATOM   5787  C  C    . SER A 1 79 ? 20.072  8.660   -21.065 1.00 0.00 ? 79  SER A C    5  
ATOM   5788  O  O    . SER A 1 79 ? 19.589  9.488   -21.838 1.00 0.00 ? 79  SER A O    5  
ATOM   5789  C  CB   . SER A 1 79 ? 21.986  10.246  -20.784 1.00 0.00 ? 79  SER A CB   5  
ATOM   5790  O  OG   . SER A 1 79 ? 22.975  10.728  -19.890 1.00 0.00 ? 79  SER A OG   5  
ATOM   5791  H  H    . SER A 1 79 ? 22.823  7.727   -20.973 1.00 0.00 ? 79  SER A H    5  
ATOM   5792  H  HA   . SER A 1 79 ? 20.990  9.190   -19.212 1.00 0.00 ? 79  SER A HA   5  
ATOM   5793  H  HB2  . SER A 1 79 ? 22.456  10.007  -21.726 1.00 0.00 ? 79  SER A HB2  5  
ATOM   5794  H  HB3  . SER A 1 79 ? 21.248  11.020  -20.937 1.00 0.00 ? 79  SER A HB3  5  
ATOM   5795  H  HG   . SER A 1 79 ? 23.146  11.655  -20.071 1.00 0.00 ? 79  SER A HG   5  
ATOM   5796  N  N    . SER A 1 80 ? 19.571  7.440   -20.905 1.00 0.00 ? 80  SER A N    5  
ATOM   5797  C  CA   . SER A 1 80 ? 18.399  6.991   -21.649 1.00 0.00 ? 80  SER A CA   5  
ATOM   5798  C  C    . SER A 1 80 ? 17.230  7.951   -21.451 1.00 0.00 ? 80  SER A C    5  
ATOM   5799  O  O    . SER A 1 80 ? 16.732  8.546   -22.406 1.00 0.00 ? 80  SER A O    5  
ATOM   5800  C  CB   . SER A 1 80 ? 17.998  5.582   -21.208 1.00 0.00 ? 80  SER A CB   5  
ATOM   5801  O  OG   . SER A 1 80 ? 18.893  4.612   -21.724 1.00 0.00 ? 80  SER A OG   5  
ATOM   5802  H  H    . SER A 1 80 ? 20.001  6.825   -20.274 1.00 0.00 ? 80  SER A H    5  
ATOM   5803  H  HA   . SER A 1 80 ? 18.660  6.971   -22.697 1.00 0.00 ? 80  SER A HA   5  
ATOM   5804  H  HB2  . SER A 1 80 ? 18.009  5.528   -20.130 1.00 0.00 ? 80  SER A HB2  5  
ATOM   5805  H  HB3  . SER A 1 80 ? 17.003  5.365   -21.569 1.00 0.00 ? 80  SER A HB3  5  
ATOM   5806  H  HG   . SER A 1 80 ? 19.744  5.021   -21.896 1.00 0.00 ? 80  SER A HG   5  
ATOM   5807  N  N    . GLY A 1 81 ? 16.796  8.096   -20.203 1.00 0.00 ? 81  GLY A N    5  
ATOM   5808  C  CA   . GLY A 1 81 ? 15.689  8.984   -19.900 1.00 0.00 ? 81  GLY A CA   5  
ATOM   5809  C  C    . GLY A 1 81 ? 15.591  9.307   -18.423 1.00 0.00 ? 81  GLY A C    5  
ATOM   5810  O  O    . GLY A 1 81 ? 15.443  10.477  -18.074 1.00 0.00 ? 81  GLY A O    5  
ATOM   5811  H  H    . GLY A 1 81 ? 17.232  7.596   -19.481 1.00 0.00 ? 81  GLY A H    5  
ATOM   5812  H  HA2  . GLY A 1 81 ? 15.818  9.903   -20.452 1.00 0.00 ? 81  GLY A HA2  5  
ATOM   5813  H  HA3  . GLY A 1 81 ? 14.769  8.513   -20.216 1.00 0.00 ? 81  GLY A HA3  5  
HETATM 5814  ZN ZN   . ZN  B 2 .  ? -3.045  -2.114  -4.042  1.00 0.00 ? 201 ZN  A ZN   5  
HETATM 5815  ZN ZN   . ZN  C 2 .  ? 13.715  2.454   -3.828  1.00 0.00 ? 401 ZN  A ZN   5  
ATOM   5816  N  N    . GLY A 1 1  ? -30.740 -13.383 -15.573 1.00 0.00 ? 1   GLY A N    6  
ATOM   5817  C  CA   . GLY A 1 1  ? -30.928 -14.273 -14.442 1.00 0.00 ? 1   GLY A CA   6  
ATOM   5818  C  C    . GLY A 1 1  ? -30.722 -15.729 -14.809 1.00 0.00 ? 1   GLY A C    6  
ATOM   5819  O  O    . GLY A 1 1  ? -31.680 -16.498 -14.886 1.00 0.00 ? 1   GLY A O    6  
ATOM   5820  H  H1   . GLY A 1 1  ? -31.288 -12.574 -15.655 1.00 0.00 ? 1   GLY A H1   6  
ATOM   5821  H  HA2  . GLY A 1 1  ? -30.227 -14.004 -13.667 1.00 0.00 ? 1   GLY A HA2  6  
ATOM   5822  H  HA3  . GLY A 1 1  ? -31.933 -14.148 -14.064 1.00 0.00 ? 1   GLY A HA3  6  
ATOM   5823  N  N    . SER A 1 2  ? -29.469 -16.108 -15.037 1.00 0.00 ? 2   SER A N    6  
ATOM   5824  C  CA   . SER A 1 2  ? -29.140 -17.481 -15.404 1.00 0.00 ? 2   SER A CA   6  
ATOM   5825  C  C    . SER A 1 2  ? -28.123 -18.073 -14.433 1.00 0.00 ? 2   SER A C    6  
ATOM   5826  O  O    . SER A 1 2  ? -27.283 -17.360 -13.885 1.00 0.00 ? 2   SER A O    6  
ATOM   5827  C  CB   . SER A 1 2  ? -28.591 -17.532 -16.831 1.00 0.00 ? 2   SER A CB   6  
ATOM   5828  O  OG   . SER A 1 2  ? -27.449 -16.705 -16.968 1.00 0.00 ? 2   SER A OG   6  
ATOM   5829  H  H    . SER A 1 2  ? -28.748 -15.448 -14.960 1.00 0.00 ? 2   SER A H    6  
ATOM   5830  H  HA   . SER A 1 2  ? -30.048 -18.063 -15.355 1.00 0.00 ? 2   SER A HA   6  
ATOM   5831  H  HB2  . SER A 1 2  ? -28.316 -18.548 -17.071 1.00 0.00 ? 2   SER A HB2  6  
ATOM   5832  H  HB3  . SER A 1 2  ? -29.352 -17.193 -17.519 1.00 0.00 ? 2   SER A HB3  6  
ATOM   5833  H  HG   . SER A 1 2  ? -27.385 -16.395 -17.874 1.00 0.00 ? 2   SER A HG   6  
ATOM   5834  N  N    . SER A 1 3  ? -28.205 -19.383 -14.226 1.00 0.00 ? 3   SER A N    6  
ATOM   5835  C  CA   . SER A 1 3  ? -27.295 -20.073 -13.320 1.00 0.00 ? 3   SER A CA   6  
ATOM   5836  C  C    . SER A 1 3  ? -27.403 -19.507 -11.907 1.00 0.00 ? 3   SER A C    6  
ATOM   5837  O  O    . SER A 1 3  ? -26.395 -19.254 -11.249 1.00 0.00 ? 3   SER A O    6  
ATOM   5838  C  CB   . SER A 1 3  ? -25.855 -19.953 -13.820 1.00 0.00 ? 3   SER A CB   6  
ATOM   5839  O  OG   . SER A 1 3  ? -25.732 -20.445 -15.144 1.00 0.00 ? 3   SER A OG   6  
ATOM   5840  H  H    . SER A 1 3  ? -28.897 -19.898 -14.693 1.00 0.00 ? 3   SER A H    6  
ATOM   5841  H  HA   . SER A 1 3  ? -27.575 -21.116 -13.299 1.00 0.00 ? 3   SER A HA   6  
ATOM   5842  H  HB2  . SER A 1 3  ? -25.556 -18.916 -13.806 1.00 0.00 ? 3   SER A HB2  6  
ATOM   5843  H  HB3  . SER A 1 3  ? -25.203 -20.524 -13.175 1.00 0.00 ? 3   SER A HB3  6  
ATOM   5844  H  HG   . SER A 1 3  ? -25.063 -21.133 -15.169 1.00 0.00 ? 3   SER A HG   6  
ATOM   5845  N  N    . GLY A 1 4  ? -28.635 -19.310 -11.448 1.00 0.00 ? 4   GLY A N    6  
ATOM   5846  C  CA   . GLY A 1 4  ? -28.854 -18.775 -10.116 1.00 0.00 ? 4   GLY A CA   6  
ATOM   5847  C  C    . GLY A 1 4  ? -28.778 -17.261 -10.080 1.00 0.00 ? 4   GLY A C    6  
ATOM   5848  O  O    . GLY A 1 4  ? -28.511 -16.622 -11.098 1.00 0.00 ? 4   GLY A O    6  
ATOM   5849  H  H    . GLY A 1 4  ? -29.402 -19.530 -12.017 1.00 0.00 ? 4   GLY A H    6  
ATOM   5850  H  HA2  . GLY A 1 4  ? -29.829 -19.084 -9.772  1.00 0.00 ? 4   GLY A HA2  6  
ATOM   5851  H  HA3  . GLY A 1 4  ? -28.104 -19.177 -9.451  1.00 0.00 ? 4   GLY A HA3  6  
ATOM   5852  N  N    . SER A 1 5  ? -29.014 -16.686 -8.905  1.00 0.00 ? 5   SER A N    6  
ATOM   5853  C  CA   . SER A 1 5  ? -28.975 -15.238 -8.742  1.00 0.00 ? 5   SER A CA   6  
ATOM   5854  C  C    . SER A 1 5  ? -27.851 -14.827 -7.796  1.00 0.00 ? 5   SER A C    6  
ATOM   5855  O  O    . SER A 1 5  ? -27.602 -15.486 -6.787  1.00 0.00 ? 5   SER A O    6  
ATOM   5856  C  CB   . SER A 1 5  ? -30.316 -14.728 -8.209  1.00 0.00 ? 5   SER A CB   6  
ATOM   5857  O  OG   . SER A 1 5  ? -30.578 -13.412 -8.664  1.00 0.00 ? 5   SER A OG   6  
ATOM   5858  H  H    . SER A 1 5  ? -29.221 -17.250 -8.131  1.00 0.00 ? 5   SER A H    6  
ATOM   5859  H  HA   . SER A 1 5  ? -28.793 -14.799 -9.712  1.00 0.00 ? 5   SER A HA   6  
ATOM   5860  H  HB2  . SER A 1 5  ? -31.107 -15.378 -8.551  1.00 0.00 ? 5   SER A HB2  6  
ATOM   5861  H  HB3  . SER A 1 5  ? -30.293 -14.725 -7.129  1.00 0.00 ? 5   SER A HB3  6  
ATOM   5862  H  HG   . SER A 1 5  ? -30.379 -13.351 -9.602  1.00 0.00 ? 5   SER A HG   6  
ATOM   5863  N  N    . SER A 1 6  ? -27.173 -13.734 -8.132  1.00 0.00 ? 6   SER A N    6  
ATOM   5864  C  CA   . SER A 1 6  ? -26.072 -13.236 -7.316  1.00 0.00 ? 6   SER A CA   6  
ATOM   5865  C  C    . SER A 1 6  ? -26.403 -11.865 -6.735  1.00 0.00 ? 6   SER A C    6  
ATOM   5866  O  O    . SER A 1 6  ? -26.771 -10.943 -7.461  1.00 0.00 ? 6   SER A O    6  
ATOM   5867  C  CB   . SER A 1 6  ? -24.790 -13.155 -8.147  1.00 0.00 ? 6   SER A CB   6  
ATOM   5868  O  OG   . SER A 1 6  ? -24.278 -14.447 -8.423  1.00 0.00 ? 6   SER A OG   6  
ATOM   5869  H  H    . SER A 1 6  ? -27.419 -13.252 -8.949  1.00 0.00 ? 6   SER A H    6  
ATOM   5870  H  HA   . SER A 1 6  ? -25.921 -13.931 -6.504  1.00 0.00 ? 6   SER A HA   6  
ATOM   5871  H  HB2  . SER A 1 6  ? -25.001 -12.658 -9.082  1.00 0.00 ? 6   SER A HB2  6  
ATOM   5872  H  HB3  . SER A 1 6  ? -24.046 -12.594 -7.601  1.00 0.00 ? 6   SER A HB3  6  
ATOM   5873  H  HG   . SER A 1 6  ? -24.960 -14.980 -8.838  1.00 0.00 ? 6   SER A HG   6  
ATOM   5874  N  N    . GLY A 1 7  ? -26.268 -11.739 -5.418  1.00 0.00 ? 7   GLY A N    6  
ATOM   5875  C  CA   . GLY A 1 7  ? -26.557 -10.478 -4.761  1.00 0.00 ? 7   GLY A CA   6  
ATOM   5876  C  C    . GLY A 1 7  ? -25.307 -9.659  -4.503  1.00 0.00 ? 7   GLY A C    6  
ATOM   5877  O  O    . GLY A 1 7  ? -25.181 -8.535  -4.990  1.00 0.00 ? 7   GLY A O    6  
ATOM   5878  H  H    . GLY A 1 7  ? -25.971 -12.508 -4.889  1.00 0.00 ? 7   GLY A H    6  
ATOM   5879  H  HA2  . GLY A 1 7  ? -27.228 -9.905  -5.383  1.00 0.00 ? 7   GLY A HA2  6  
ATOM   5880  H  HA3  . GLY A 1 7  ? -27.041 -10.680 -3.816  1.00 0.00 ? 7   GLY A HA3  6  
ATOM   5881  N  N    . LEU A 1 8  ? -24.381 -10.222 -3.735  1.00 0.00 ? 8   LEU A N    6  
ATOM   5882  C  CA   . LEU A 1 8  ? -23.135 -9.536  -3.411  1.00 0.00 ? 8   LEU A CA   6  
ATOM   5883  C  C    . LEU A 1 8  ? -23.400 -8.297  -2.561  1.00 0.00 ? 8   LEU A C    6  
ATOM   5884  O  O    . LEU A 1 8  ? -22.875 -7.218  -2.837  1.00 0.00 ? 8   LEU A O    6  
ATOM   5885  C  CB   . LEU A 1 8  ? -22.400 -9.140  -4.693  1.00 0.00 ? 8   LEU A CB   6  
ATOM   5886  C  CG   . LEU A 1 8  ? -22.212 -10.249 -5.729  1.00 0.00 ? 8   LEU A CG   6  
ATOM   5887  C  CD1  . LEU A 1 8  ? -22.130 -9.663  -7.130  1.00 0.00 ? 8   LEU A CD1  6  
ATOM   5888  C  CD2  . LEU A 1 8  ? -20.967 -11.065 -5.416  1.00 0.00 ? 8   LEU A CD2  6  
ATOM   5889  H  H    . LEU A 1 8  ? -24.538 -11.119 -3.376  1.00 0.00 ? 8   LEU A H    6  
ATOM   5890  H  HA   . LEU A 1 8  ? -22.517 -10.219 -2.848  1.00 0.00 ? 8   LEU A HA   6  
ATOM   5891  H  HB2  . LEU A 1 8  ? -22.957 -8.342  -5.161  1.00 0.00 ? 8   LEU A HB2  6  
ATOM   5892  H  HB3  . LEU A 1 8  ? -21.421 -8.777  -4.414  1.00 0.00 ? 8   LEU A HB3  6  
ATOM   5893  H  HG   . LEU A 1 8  ? -23.065 -10.913 -5.695  1.00 0.00 ? 8   LEU A HG   6  
ATOM   5894  H  HD11 . LEU A 1 8  ? -23.119 -9.382  -7.461  1.00 0.00 ? 8   LEU A HD11 6  
ATOM   5895  H  HD12 . LEU A 1 8  ? -21.721 -10.400 -7.805  1.00 0.00 ? 8   LEU A HD12 6  
ATOM   5896  H  HD13 . LEU A 1 8  ? -21.492 -8.792  -7.119  1.00 0.00 ? 8   LEU A HD13 6  
ATOM   5897  H  HD21 . LEU A 1 8  ? -21.257 -12.036 -5.043  1.00 0.00 ? 8   LEU A HD21 6  
ATOM   5898  H  HD22 . LEU A 1 8  ? -20.379 -10.552 -4.668  1.00 0.00 ? 8   LEU A HD22 6  
ATOM   5899  H  HD23 . LEU A 1 8  ? -20.380 -11.185 -6.315  1.00 0.00 ? 8   LEU A HD23 6  
ATOM   5900  N  N    . ASP A 1 9  ? -24.215 -8.461  -1.525  1.00 0.00 ? 9   ASP A N    6  
ATOM   5901  C  CA   . ASP A 1 9  ? -24.547 -7.358  -0.631  1.00 0.00 ? 9   ASP A CA   6  
ATOM   5902  C  C    . ASP A 1 9  ? -23.592 -7.315  0.558   1.00 0.00 ? 9   ASP A C    6  
ATOM   5903  O  O    . ASP A 1 9  ? -23.259 -6.242  1.061   1.00 0.00 ? 9   ASP A O    6  
ATOM   5904  C  CB   . ASP A 1 9  ? -25.989 -7.488  -0.139  1.00 0.00 ? 9   ASP A CB   6  
ATOM   5905  C  CG   . ASP A 1 9  ? -26.140 -8.546  0.937   1.00 0.00 ? 9   ASP A CG   6  
ATOM   5906  O  OD1  . ASP A 1 9  ? -26.319 -9.731  0.584   1.00 0.00 ? 9   ASP A OD1  6  
ATOM   5907  O  OD2  . ASP A 1 9  ? -26.079 -8.189  2.132   1.00 0.00 ? 9   ASP A OD2  6  
ATOM   5908  H  H    . ASP A 1 9  ? -24.602 -9.346  -1.357  1.00 0.00 ? 9   ASP A H    6  
ATOM   5909  H  HA   . ASP A 1 9  ? -24.449 -6.438  -1.188  1.00 0.00 ? 9   ASP A HA   6  
ATOM   5910  H  HB2  . ASP A 1 9  ? -26.311 -6.540  0.268   1.00 0.00 ? 9   ASP A HB2  6  
ATOM   5911  H  HB3  . ASP A 1 9  ? -26.624 -7.753  -0.971  1.00 0.00 ? 9   ASP A HB3  6  
ATOM   5912  N  N    . TYR A 1 10 ? -23.157 -8.489  1.002   1.00 0.00 ? 10  TYR A N    6  
ATOM   5913  C  CA   . TYR A 1 10 ? -22.243 -8.586  2.135   1.00 0.00 ? 10  TYR A CA   6  
ATOM   5914  C  C    . TYR A 1 10 ? -21.119 -7.561  2.017   1.00 0.00 ? 10  TYR A C    6  
ATOM   5915  O  O    . TYR A 1 10 ? -20.668 -7.002  3.016   1.00 0.00 ? 10  TYR A O    6  
ATOM   5916  C  CB   . TYR A 1 10 ? -21.656 -9.996  2.223   1.00 0.00 ? 10  TYR A CB   6  
ATOM   5917  C  CG   . TYR A 1 10 ? -20.657 -10.305 1.132   1.00 0.00 ? 10  TYR A CG   6  
ATOM   5918  C  CD1  . TYR A 1 10 ? -20.940 -10.019 -0.198  1.00 0.00 ? 10  TYR A CD1  6  
ATOM   5919  C  CD2  . TYR A 1 10 ? -19.429 -10.884 1.430   1.00 0.00 ? 10  TYR A CD2  6  
ATOM   5920  C  CE1  . TYR A 1 10 ? -20.030 -10.301 -1.199  1.00 0.00 ? 10  TYR A CE1  6  
ATOM   5921  C  CE2  . TYR A 1 10 ? -18.513 -11.168 0.436   1.00 0.00 ? 10  TYR A CE2  6  
ATOM   5922  C  CZ   . TYR A 1 10 ? -18.818 -10.875 -0.876  1.00 0.00 ? 10  TYR A CZ   6  
ATOM   5923  O  OH   . TYR A 1 10 ? -17.908 -11.156 -1.870  1.00 0.00 ? 10  TYR A OH   6  
ATOM   5924  H  H    . TYR A 1 10 ? -23.458 -9.310  0.560   1.00 0.00 ? 10  TYR A H    6  
ATOM   5925  H  HA   . TYR A 1 10 ? -22.806 -8.384  3.034   1.00 0.00 ? 10  TYR A HA   6  
ATOM   5926  H  HB2  . TYR A 1 10 ? -21.156 -10.111 3.172   1.00 0.00 ? 10  TYR A HB2  6  
ATOM   5927  H  HB3  . TYR A 1 10 ? -22.457 -10.717 2.154   1.00 0.00 ? 10  TYR A HB3  6  
ATOM   5928  H  HD1  . TYR A 1 10 ? -21.890 -9.569  -0.447  1.00 0.00 ? 10  TYR A HD1  6  
ATOM   5929  H  HD2  . TYR A 1 10 ? -19.193 -11.112 2.460   1.00 0.00 ? 10  TYR A HD2  6  
ATOM   5930  H  HE1  . TYR A 1 10 ? -20.268 -10.071 -2.227  1.00 0.00 ? 10  TYR A HE1  6  
ATOM   5931  H  HE2  . TYR A 1 10 ? -17.564 -11.618 0.688   1.00 0.00 ? 10  TYR A HE2  6  
ATOM   5932  H  HH   . TYR A 1 10 ? -17.018 -11.037 -1.532  1.00 0.00 ? 10  TYR A HH   6  
ATOM   5933  N  N    . GLN A 1 11 ? -20.672 -7.321  0.788   1.00 0.00 ? 11  GLN A N    6  
ATOM   5934  C  CA   . GLN A 1 11 ? -19.601 -6.364  0.539   1.00 0.00 ? 11  GLN A CA   6  
ATOM   5935  C  C    . GLN A 1 11 ? -19.898 -5.027  1.211   1.00 0.00 ? 11  GLN A C    6  
ATOM   5936  O  O    . GLN A 1 11 ? -18.995 -4.362  1.718   1.00 0.00 ? 11  GLN A O    6  
ATOM   5937  C  CB   . GLN A 1 11 ? -19.409 -6.161  -0.965  1.00 0.00 ? 11  GLN A CB   6  
ATOM   5938  C  CG   . GLN A 1 11 ? -20.422 -5.212  -1.585  1.00 0.00 ? 11  GLN A CG   6  
ATOM   5939  C  CD   . GLN A 1 11 ? -20.028 -4.768  -2.980  1.00 0.00 ? 11  GLN A CD   6  
ATOM   5940  O  OE1  . GLN A 1 11 ? -20.495 -5.322  -3.975  1.00 0.00 ? 11  GLN A OE1  6  
ATOM   5941  N  NE2  . GLN A 1 11 ? -19.165 -3.762  -3.059  1.00 0.00 ? 11  GLN A NE2  6  
ATOM   5942  H  H    . GLN A 1 11 ? -21.072 -7.798  0.033   1.00 0.00 ? 11  GLN A H    6  
ATOM   5943  H  HA   . GLN A 1 11 ? -18.692 -6.768  0.958   1.00 0.00 ? 11  GLN A HA   6  
ATOM   5944  H  HB2  . GLN A 1 11 ? -18.421 -5.762  -1.139  1.00 0.00 ? 11  GLN A HB2  6  
ATOM   5945  H  HB3  . GLN A 1 11 ? -19.495 -7.118  -1.459  1.00 0.00 ? 11  GLN A HB3  6  
ATOM   5946  H  HG2  . GLN A 1 11 ? -21.378 -5.713  -1.640  1.00 0.00 ? 11  GLN A HG2  6  
ATOM   5947  H  HG3  . GLN A 1 11 ? -20.510 -4.339  -0.956  1.00 0.00 ? 11  GLN A HG3  6  
ATOM   5948  H  HE21 . GLN A 1 11 ? -18.834 -3.370  -2.223  1.00 0.00 ? 11  GLN A HE21 6  
ATOM   5949  H  HE22 . GLN A 1 11 ? -18.892 -3.456  -3.948  1.00 0.00 ? 11  GLN A HE22 6  
ATOM   5950  N  N    . ARG A 1 12 ? -21.170 -4.639  1.210   1.00 0.00 ? 12  ARG A N    6  
ATOM   5951  C  CA   . ARG A 1 12 ? -21.586 -3.381  1.817   1.00 0.00 ? 12  ARG A CA   6  
ATOM   5952  C  C    . ARG A 1 12 ? -20.702 -3.036  3.012   1.00 0.00 ? 12  ARG A C    6  
ATOM   5953  O  O    . ARG A 1 12 ? -20.389 -1.869  3.251   1.00 0.00 ? 12  ARG A O    6  
ATOM   5954  C  CB   . ARG A 1 12 ? -23.048 -3.462  2.257   1.00 0.00 ? 12  ARG A CB   6  
ATOM   5955  C  CG   . ARG A 1 12 ? -24.038 -3.227  1.128   1.00 0.00 ? 12  ARG A CG   6  
ATOM   5956  C  CD   . ARG A 1 12 ? -25.346 -2.647  1.644   1.00 0.00 ? 12  ARG A CD   6  
ATOM   5957  N  NE   . ARG A 1 12 ? -26.484 -3.046  0.822   1.00 0.00 ? 12  ARG A NE   6  
ATOM   5958  C  CZ   . ARG A 1 12 ? -27.647 -2.403  0.814   1.00 0.00 ? 12  ARG A CZ   6  
ATOM   5959  N  NH1  . ARG A 1 12 ? -27.823 -1.336  1.581   1.00 0.00 ? 12  ARG A NH1  6  
ATOM   5960  N  NH2  . ARG A 1 12 ? -28.636 -2.827  0.038   1.00 0.00 ? 12  ARG A NH2  6  
ATOM   5961  H  H    . ARG A 1 12 ? -21.844 -5.213  0.789   1.00 0.00 ? 12  ARG A H    6  
ATOM   5962  H  HA   . ARG A 1 12 ? -21.485 -2.604  1.074   1.00 0.00 ? 12  ARG A HA   6  
ATOM   5963  H  HB2  . ARG A 1 12 ? -23.234 -4.442  2.671   1.00 0.00 ? 12  ARG A HB2  6  
ATOM   5964  H  HB3  . ARG A 1 12 ? -23.223 -2.719  3.021   1.00 0.00 ? 12  ARG A HB3  6  
ATOM   5965  H  HG2  . ARG A 1 12 ? -23.605 -2.535  0.420   1.00 0.00 ? 12  ARG A HG2  6  
ATOM   5966  H  HG3  . ARG A 1 12 ? -24.240 -4.167  0.638   1.00 0.00 ? 12  ARG A HG3  6  
ATOM   5967  H  HD2  . ARG A 1 12 ? -25.504 -2.995  2.654   1.00 0.00 ? 12  ARG A HD2  6  
ATOM   5968  H  HD3  . ARG A 1 12 ? -25.271 -1.570  1.643   1.00 0.00 ? 12  ARG A HD3  6  
ATOM   5969  H  HE   . ARG A 1 12 ? -26.376 -3.832  0.247   1.00 0.00 ? 12  ARG A HE   6  
ATOM   5970  H  HH11 . ARG A 1 12 ? -27.079 -1.013  2.166   1.00 0.00 ? 12  ARG A HH11 6  
ATOM   5971  H  HH12 . ARG A 1 12 ? -28.699 -0.853  1.573   1.00 0.00 ? 12  ARG A HH12 6  
ATOM   5972  H  HH21 . ARG A 1 12 ? -28.507 -3.631  -0.542  1.00 0.00 ? 12  ARG A HH21 6  
ATOM   5973  H  HH22 . ARG A 1 12 ? -29.510 -2.343  0.033   1.00 0.00 ? 12  ARG A HH22 6  
ATOM   5974  N  N    . LEU A 1 13 ? -20.303 -4.059  3.761   1.00 0.00 ? 13  LEU A N    6  
ATOM   5975  C  CA   . LEU A 1 13 ? -19.455 -3.865  4.932   1.00 0.00 ? 13  LEU A CA   6  
ATOM   5976  C  C    . LEU A 1 13 ? -18.331 -2.878  4.633   1.00 0.00 ? 13  LEU A C    6  
ATOM   5977  O  O    . LEU A 1 13 ? -18.001 -2.630  3.473   1.00 0.00 ? 13  LEU A O    6  
ATOM   5978  C  CB   . LEU A 1 13 ? -18.868 -5.202  5.388   1.00 0.00 ? 13  LEU A CB   6  
ATOM   5979  C  CG   . LEU A 1 13 ? -18.221 -6.057  4.299   1.00 0.00 ? 13  LEU A CG   6  
ATOM   5980  C  CD1  . LEU A 1 13 ? -16.795 -5.599  4.036   1.00 0.00 ? 13  LEU A CD1  6  
ATOM   5981  C  CD2  . LEU A 1 13 ? -18.247 -7.528  4.690   1.00 0.00 ? 13  LEU A CD2  6  
ATOM   5982  H  H    . LEU A 1 13 ? -20.584 -4.966  3.521   1.00 0.00 ? 13  LEU A H    6  
ATOM   5983  H  HA   . LEU A 1 13 ? -20.070 -3.462  5.723   1.00 0.00 ? 13  LEU A HA   6  
ATOM   5984  H  HB2  . LEU A 1 13 ? -18.117 -4.995  6.136   1.00 0.00 ? 13  LEU A HB2  6  
ATOM   5985  H  HB3  . LEU A 1 13 ? -19.667 -5.778  5.833   1.00 0.00 ? 13  LEU A HB3  6  
ATOM   5986  H  HG   . LEU A 1 13 ? -18.782 -5.945  3.381   1.00 0.00 ? 13  LEU A HG   6  
ATOM   5987  H  HD11 . LEU A 1 13 ? -16.359 -6.207  3.259   1.00 0.00 ? 13  LEU A HD11 6  
ATOM   5988  H  HD12 . LEU A 1 13 ? -16.213 -5.697  4.940   1.00 0.00 ? 13  LEU A HD12 6  
ATOM   5989  H  HD13 . LEU A 1 13 ? -16.802 -4.564  3.723   1.00 0.00 ? 13  LEU A HD13 6  
ATOM   5990  H  HD21 . LEU A 1 13 ? -18.848 -7.653  5.579   1.00 0.00 ? 13  LEU A HD21 6  
ATOM   5991  H  HD22 . LEU A 1 13 ? -17.239 -7.865  4.886   1.00 0.00 ? 13  LEU A HD22 6  
ATOM   5992  H  HD23 . LEU A 1 13 ? -18.671 -8.107  3.884   1.00 0.00 ? 13  LEU A HD23 6  
ATOM   5993  N  N    . TYR A 1 14 ? -17.746 -2.319  5.687   1.00 0.00 ? 14  TYR A N    6  
ATOM   5994  C  CA   . TYR A 1 14 ? -16.659 -1.359  5.538   1.00 0.00 ? 14  TYR A CA   6  
ATOM   5995  C  C    . TYR A 1 14 ? -15.771 -1.722  4.351   1.00 0.00 ? 14  TYR A C    6  
ATOM   5996  O  O    . TYR A 1 14 ? -15.542 -0.906  3.460   1.00 0.00 ? 14  TYR A O    6  
ATOM   5997  C  CB   . TYR A 1 14 ? -15.821 -1.302  6.817   1.00 0.00 ? 14  TYR A CB   6  
ATOM   5998  C  CG   . TYR A 1 14 ? -15.111 -2.599  7.133   1.00 0.00 ? 14  TYR A CG   6  
ATOM   5999  C  CD1  . TYR A 1 14 ? -15.823 -3.727  7.520   1.00 0.00 ? 14  TYR A CD1  6  
ATOM   6000  C  CD2  . TYR A 1 14 ? -13.728 -2.695  7.048   1.00 0.00 ? 14  TYR A CD2  6  
ATOM   6001  C  CE1  . TYR A 1 14 ? -15.179 -4.914  7.811   1.00 0.00 ? 14  TYR A CE1  6  
ATOM   6002  C  CE2  . TYR A 1 14 ? -13.075 -3.878  7.336   1.00 0.00 ? 14  TYR A CE2  6  
ATOM   6003  C  CZ   . TYR A 1 14 ? -13.804 -4.984  7.717   1.00 0.00 ? 14  TYR A CZ   6  
ATOM   6004  O  OH   . TYR A 1 14 ? -13.157 -6.164  8.006   1.00 0.00 ? 14  TYR A OH   6  
ATOM   6005  H  H    . TYR A 1 14 ? -18.053 -2.557  6.587   1.00 0.00 ? 14  TYR A H    6  
ATOM   6006  H  HA   . TYR A 1 14 ? -17.096 -0.387  5.362   1.00 0.00 ? 14  TYR A HA   6  
ATOM   6007  H  HB2  . TYR A 1 14 ? -15.073 -0.531  6.715   1.00 0.00 ? 14  TYR A HB2  6  
ATOM   6008  H  HB3  . TYR A 1 14 ? -16.466 -1.064  7.650   1.00 0.00 ? 14  TYR A HB3  6  
ATOM   6009  H  HD1  . TYR A 1 14 ? -16.900 -3.669  7.593   1.00 0.00 ? 14  TYR A HD1  6  
ATOM   6010  H  HD2  . TYR A 1 14 ? -13.159 -1.826  6.749   1.00 0.00 ? 14  TYR A HD2  6  
ATOM   6011  H  HE1  . TYR A 1 14 ? -15.749 -5.781  8.110   1.00 0.00 ? 14  TYR A HE1  6  
ATOM   6012  H  HE2  . TYR A 1 14 ? -11.998 -3.933  7.262   1.00 0.00 ? 14  TYR A HE2  6  
ATOM   6013  H  HH   . TYR A 1 14 ? -13.383 -6.823  7.345   1.00 0.00 ? 14  TYR A HH   6  
ATOM   6014  N  N    . GLY A 1 15 ? -15.273 -2.955  4.348   1.00 0.00 ? 15  GLY A N    6  
ATOM   6015  C  CA   . GLY A 1 15 ? -14.416 -3.406  3.267   1.00 0.00 ? 15  GLY A CA   6  
ATOM   6016  C  C    . GLY A 1 15 ? -13.116 -2.630  3.194   1.00 0.00 ? 15  GLY A C    6  
ATOM   6017  O  O    . GLY A 1 15 ? -13.119 -1.398  3.175   1.00 0.00 ? 15  GLY A O    6  
ATOM   6018  H  H    . GLY A 1 15 ? -15.489 -3.563  5.085   1.00 0.00 ? 15  GLY A H    6  
ATOM   6019  H  HA2  . GLY A 1 15 ? -14.191 -4.452  3.413   1.00 0.00 ? 15  GLY A HA2  6  
ATOM   6020  H  HA3  . GLY A 1 15 ? -14.944 -3.289  2.332   1.00 0.00 ? 15  GLY A HA3  6  
ATOM   6021  N  N    . THR A 1 16 ? -12.000 -3.350  3.156   1.00 0.00 ? 16  THR A N    6  
ATOM   6022  C  CA   . THR A 1 16 ? -10.686 -2.722  3.089   1.00 0.00 ? 16  THR A CA   6  
ATOM   6023  C  C    . THR A 1 16 ? -10.191 -2.635  1.650   1.00 0.00 ? 16  THR A C    6  
ATOM   6024  O  O    . THR A 1 16 ? -9.803  -3.641  1.056   1.00 0.00 ? 16  THR A O    6  
ATOM   6025  C  CB   . THR A 1 16 ? -9.651  -3.492  3.931   1.00 0.00 ? 16  THR A CB   6  
ATOM   6026  O  OG1  . THR A 1 16 ? -10.067 -3.533  5.300   1.00 0.00 ? 16  THR A OG1  6  
ATOM   6027  C  CG2  . THR A 1 16 ? -8.280  -2.840  3.831   1.00 0.00 ? 16  THR A CG2  6  
ATOM   6028  H  H    . THR A 1 16 ? -12.062 -4.328  3.175   1.00 0.00 ? 16  THR A H    6  
ATOM   6029  H  HA   . THR A 1 16 ? -10.774 -1.722  3.490   1.00 0.00 ? 16  THR A HA   6  
ATOM   6030  H  HB   . THR A 1 16 ? -9.582  -4.502  3.553   1.00 0.00 ? 16  THR A HB   6  
ATOM   6031  H  HG1  . THR A 1 16 ? -10.837 -4.100  5.384   1.00 0.00 ? 16  THR A HG1  6  
ATOM   6032  H  HG21 . THR A 1 16 ? -8.134  -2.461  2.831   1.00 0.00 ? 16  THR A HG21 6  
ATOM   6033  H  HG22 . THR A 1 16 ? -7.517  -3.571  4.054   1.00 0.00 ? 16  THR A HG22 6  
ATOM   6034  H  HG23 . THR A 1 16 ? -8.217  -2.026  4.537   1.00 0.00 ? 16  THR A HG23 6  
ATOM   6035  N  N    . ARG A 1 17 ? -10.207 -1.428  1.095   1.00 0.00 ? 17  ARG A N    6  
ATOM   6036  C  CA   . ARG A 1 17 ? -9.760  -1.211  -0.275  1.00 0.00 ? 17  ARG A CA   6  
ATOM   6037  C  C    . ARG A 1 17 ? -8.395  -0.529  -0.300  1.00 0.00 ? 17  ARG A C    6  
ATOM   6038  O  O    . ARG A 1 17 ? -8.227  0.567   0.235   1.00 0.00 ? 17  ARG A O    6  
ATOM   6039  C  CB   . ARG A 1 17 ? -10.780 -0.364  -1.039  1.00 0.00 ? 17  ARG A CB   6  
ATOM   6040  C  CG   . ARG A 1 17 ? -10.771 -0.607  -2.540  1.00 0.00 ? 17  ARG A CG   6  
ATOM   6041  C  CD   . ARG A 1 17 ? -11.649 0.397   -3.271  1.00 0.00 ? 17  ARG A CD   6  
ATOM   6042  N  NE   . ARG A 1 17 ? -11.323 1.774   -2.911  1.00 0.00 ? 17  ARG A NE   6  
ATOM   6043  C  CZ   . ARG A 1 17 ? -11.867 2.413   -1.881  1.00 0.00 ? 17  ARG A CZ   6  
ATOM   6044  N  NH1  . ARG A 1 17 ? -12.758 1.801   -1.113  1.00 0.00 ? 17  ARG A NH1  6  
ATOM   6045  N  NH2  . ARG A 1 17 ? -11.519 3.666   -1.617  1.00 0.00 ? 17  ARG A NH2  6  
ATOM   6046  H  H    . ARG A 1 17 ? -10.528 -0.665  1.619   1.00 0.00 ? 17  ARG A H    6  
ATOM   6047  H  HA   . ARG A 1 17 ? -9.676  -2.175  -0.754  1.00 0.00 ? 17  ARG A HA   6  
ATOM   6048  H  HB2  . ARG A 1 17 ? -11.768 -0.588  -0.666  1.00 0.00 ? 17  ARG A HB2  6  
ATOM   6049  H  HB3  . ARG A 1 17 ? -10.566 0.680   -0.864  1.00 0.00 ? 17  ARG A HB3  6  
ATOM   6050  H  HG2  . ARG A 1 17 ? -9.759  -0.515  -2.904  1.00 0.00 ? 17  ARG A HG2  6  
ATOM   6051  H  HG3  . ARG A 1 17 ? -11.138 -1.603  -2.736  1.00 0.00 ? 17  ARG A HG3  6  
ATOM   6052  H  HD2  . ARG A 1 17 ? -11.509 0.270   -4.334  1.00 0.00 ? 17  ARG A HD2  6  
ATOM   6053  H  HD3  . ARG A 1 17 ? -12.681 0.203   -3.019  1.00 0.00 ? 17  ARG A HD3  6  
ATOM   6054  H  HE   . ARG A 1 17 ? -10.667 2.245   -3.465  1.00 0.00 ? 17  ARG A HE   6  
ATOM   6055  H  HH11 . ARG A 1 17 ? -13.021 0.857   -1.309  1.00 0.00 ? 17  ARG A HH11 6  
ATOM   6056  H  HH12 . ARG A 1 17 ? -13.165 2.284   -0.337  1.00 0.00 ? 17  ARG A HH12 6  
ATOM   6057  H  HH21 . ARG A 1 17 ? -10.847 4.130   -2.193  1.00 0.00 ? 17  ARG A HH21 6  
ATOM   6058  H  HH22 . ARG A 1 17 ? -11.929 4.145   -0.842  1.00 0.00 ? 17  ARG A HH22 6  
ATOM   6059  N  N    . CYS A 1 18 ? -7.423  -1.184  -0.926  1.00 0.00 ? 18  CYS A N    6  
ATOM   6060  C  CA   . CYS A 1 18 ? -6.073  -0.643  -1.020  1.00 0.00 ? 18  CYS A CA   6  
ATOM   6061  C  C    . CYS A 1 18 ? -6.102  0.816   -1.465  1.00 0.00 ? 18  CYS A C    6  
ATOM   6062  O  O    . CYS A 1 18 ? -6.804  1.174   -2.411  1.00 0.00 ? 18  CYS A O    6  
ATOM   6063  C  CB   . CYS A 1 18 ? -5.237  -1.470  -1.999  1.00 0.00 ? 18  CYS A CB   6  
ATOM   6064  S  SG   . CYS A 1 18 ? -3.472  -1.021  -2.033  1.00 0.00 ? 18  CYS A SG   6  
ATOM   6065  H  H    . CYS A 1 18 ? -7.619  -2.055  -1.334  1.00 0.00 ? 18  CYS A H    6  
ATOM   6066  H  HA   . CYS A 1 18 ? -5.624  -0.699  -0.041  1.00 0.00 ? 18  CYS A HA   6  
ATOM   6067  H  HB2  . CYS A 1 18 ? -5.305  -2.513  -1.727  1.00 0.00 ? 18  CYS A HB2  6  
ATOM   6068  H  HB3  . CYS A 1 18 ? -5.630  -1.337  -2.997  1.00 0.00 ? 18  CYS A HB3  6  
ATOM   6069  N  N    . PHE A 1 19 ? -5.334  1.655   -0.777  1.00 0.00 ? 19  PHE A N    6  
ATOM   6070  C  CA   . PHE A 1 19 ? -5.272  3.075   -1.100  1.00 0.00 ? 19  PHE A CA   6  
ATOM   6071  C  C    . PHE A 1 19 ? -4.145  3.359   -2.088  1.00 0.00 ? 19  PHE A C    6  
ATOM   6072  O  O    . PHE A 1 19 ? -3.529  4.425   -2.054  1.00 0.00 ? 19  PHE A O    6  
ATOM   6073  C  CB   . PHE A 1 19 ? -5.071  3.901   0.172   1.00 0.00 ? 19  PHE A CB   6  
ATOM   6074  C  CG   . PHE A 1 19 ? -6.354  4.400   0.772   1.00 0.00 ? 19  PHE A CG   6  
ATOM   6075  C  CD1  . PHE A 1 19 ? -7.338  4.957   -0.029  1.00 0.00 ? 19  PHE A CD1  6  
ATOM   6076  C  CD2  . PHE A 1 19 ? -6.576  4.313   2.137   1.00 0.00 ? 19  PHE A CD2  6  
ATOM   6077  C  CE1  . PHE A 1 19 ? -8.520  5.418   0.520   1.00 0.00 ? 19  PHE A CE1  6  
ATOM   6078  C  CE2  . PHE A 1 19 ? -7.756  4.772   2.691   1.00 0.00 ? 19  PHE A CE2  6  
ATOM   6079  C  CZ   . PHE A 1 19 ? -8.729  5.326   1.882   1.00 0.00 ? 19  PHE A CZ   6  
ATOM   6080  H  H    . PHE A 1 19 ? -4.797  1.309   -0.033  1.00 0.00 ? 19  PHE A H    6  
ATOM   6081  H  HA   . PHE A 1 19 ? -6.211  3.352   -1.554  1.00 0.00 ? 19  PHE A HA   6  
ATOM   6082  H  HB2  . PHE A 1 19 ? -4.574  3.293   0.913   1.00 0.00 ? 19  PHE A HB2  6  
ATOM   6083  H  HB3  . PHE A 1 19 ? -4.455  4.757   -0.057  1.00 0.00 ? 19  PHE A HB3  6  
ATOM   6084  H  HD1  . PHE A 1 19 ? -7.175  5.030   -1.095  1.00 0.00 ? 19  PHE A HD1  6  
ATOM   6085  H  HD2  . PHE A 1 19 ? -5.816  3.882   2.771   1.00 0.00 ? 19  PHE A HD2  6  
ATOM   6086  H  HE1  . PHE A 1 19 ? -9.278  5.850   -0.116  1.00 0.00 ? 19  PHE A HE1  6  
ATOM   6087  H  HE2  . PHE A 1 19 ? -7.917  4.699   3.757   1.00 0.00 ? 19  PHE A HE2  6  
ATOM   6088  H  HZ   . PHE A 1 19 ? -9.652  5.684   2.313   1.00 0.00 ? 19  PHE A HZ   6  
ATOM   6089  N  N    . SER A 1 20 ? -3.880  2.398   -2.967  1.00 0.00 ? 20  SER A N    6  
ATOM   6090  C  CA   . SER A 1 20 ? -2.824  2.542   -3.962  1.00 0.00 ? 20  SER A CA   6  
ATOM   6091  C  C    . SER A 1 20 ? -3.328  2.156   -5.349  1.00 0.00 ? 20  SER A C    6  
ATOM   6092  O  O    . SER A 1 20 ? -3.242  2.940   -6.295  1.00 0.00 ? 20  SER A O    6  
ATOM   6093  C  CB   . SER A 1 20 ? -1.619  1.677   -3.587  1.00 0.00 ? 20  SER A CB   6  
ATOM   6094  O  OG   . SER A 1 20 ? -0.731  2.381   -2.735  1.00 0.00 ? 20  SER A OG   6  
ATOM   6095  H  H    . SER A 1 20 ? -4.406  1.571   -2.943  1.00 0.00 ? 20  SER A H    6  
ATOM   6096  H  HA   . SER A 1 20 ? -2.521  3.578   -3.977  1.00 0.00 ? 20  SER A HA   6  
ATOM   6097  H  HB2  . SER A 1 20 ? -1.961  0.790   -3.076  1.00 0.00 ? 20  SER A HB2  6  
ATOM   6098  H  HB3  . SER A 1 20 ? -1.089  1.394   -4.485  1.00 0.00 ? 20  SER A HB3  6  
ATOM   6099  H  HG   . SER A 1 20 ? -0.217  3.004   -3.253  1.00 0.00 ? 20  SER A HG   6  
ATOM   6100  N  N    . CYS A 1 21 ? -3.856  0.942   -5.464  1.00 0.00 ? 21  CYS A N    6  
ATOM   6101  C  CA   . CYS A 1 21 ? -4.375  0.449   -6.734  1.00 0.00 ? 21  CYS A CA   6  
ATOM   6102  C  C    . CYS A 1 21 ? -5.900  0.474   -6.744  1.00 0.00 ? 21  CYS A C    6  
ATOM   6103  O  O    . CYS A 1 21 ? -6.530  0.131   -7.745  1.00 0.00 ? 21  CYS A O    6  
ATOM   6104  C  CB   . CYS A 1 21 ? -3.874  -0.973  -6.996  1.00 0.00 ? 21  CYS A CB   6  
ATOM   6105  S  SG   . CYS A 1 21 ? -4.346  -2.175  -5.711  1.00 0.00 ? 21  CYS A SG   6  
ATOM   6106  H  H    . CYS A 1 21 ? -3.897  0.362   -4.674  1.00 0.00 ? 21  CYS A H    6  
ATOM   6107  H  HA   . CYS A 1 21 ? -4.011  1.099   -7.515  1.00 0.00 ? 21  CYS A HA   6  
ATOM   6108  H  HB2  . CYS A 1 21 ? -4.279  -1.321  -7.935  1.00 0.00 ? 21  CYS A HB2  6  
ATOM   6109  H  HB3  . CYS A 1 21 ? -2.796  -0.961  -7.057  1.00 0.00 ? 21  CYS A HB3  6  
ATOM   6110  N  N    . ASP A 1 22 ? -6.488  0.881   -5.625  1.00 0.00 ? 22  ASP A N    6  
ATOM   6111  C  CA   . ASP A 1 22 ? -7.939  0.952   -5.505  1.00 0.00 ? 22  ASP A CA   6  
ATOM   6112  C  C    . ASP A 1 22 ? -8.567  -0.427  -5.683  1.00 0.00 ? 22  ASP A C    6  
ATOM   6113  O  O    . ASP A 1 22 ? -9.529  -0.588  -6.434  1.00 0.00 ? 22  ASP A O    6  
ATOM   6114  C  CB   . ASP A 1 22 ? -8.511  1.924   -6.538  1.00 0.00 ? 22  ASP A CB   6  
ATOM   6115  C  CG   . ASP A 1 22 ? -8.506  3.359   -6.047  1.00 0.00 ? 22  ASP A CG   6  
ATOM   6116  O  OD1  . ASP A 1 22 ? -9.263  3.665   -5.102  1.00 0.00 ? 22  ASP A OD1  6  
ATOM   6117  O  OD2  . ASP A 1 22 ? -7.746  4.175   -6.608  1.00 0.00 ? 22  ASP A OD2  6  
ATOM   6118  H  H    . ASP A 1 22 ? -5.931  1.141   -4.860  1.00 0.00 ? 22  ASP A H    6  
ATOM   6119  H  HA   . ASP A 1 22 ? -8.173  1.314   -4.515  1.00 0.00 ? 22  ASP A HA   6  
ATOM   6120  H  HB2  . ASP A 1 22 ? -7.919  1.870   -7.440  1.00 0.00 ? 22  ASP A HB2  6  
ATOM   6121  H  HB3  . ASP A 1 22 ? -9.529  1.642   -6.763  1.00 0.00 ? 22  ASP A HB3  6  
ATOM   6122  N  N    . GLN A 1 23 ? -8.016  -1.417  -4.989  1.00 0.00 ? 23  GLN A N    6  
ATOM   6123  C  CA   . GLN A 1 23 ? -8.521  -2.782  -5.073  1.00 0.00 ? 23  GLN A CA   6  
ATOM   6124  C  C    . GLN A 1 23 ? -8.724  -3.374  -3.683  1.00 0.00 ? 23  GLN A C    6  
ATOM   6125  O  O    . GLN A 1 23 ? -7.914  -3.160  -2.781  1.00 0.00 ? 23  GLN A O    6  
ATOM   6126  C  CB   . GLN A 1 23 ? -7.557  -3.657  -5.877  1.00 0.00 ? 23  GLN A CB   6  
ATOM   6127  C  CG   . GLN A 1 23 ? -7.290  -3.137  -7.280  1.00 0.00 ? 23  GLN A CG   6  
ATOM   6128  C  CD   . GLN A 1 23 ? -8.552  -3.030  -8.113  1.00 0.00 ? 23  GLN A CD   6  
ATOM   6129  O  OE1  . GLN A 1 23 ? -9.313  -3.990  -8.233  1.00 0.00 ? 23  GLN A OE1  6  
ATOM   6130  N  NE2  . GLN A 1 23 ? -8.780  -1.858  -8.695  1.00 0.00 ? 23  GLN A NE2  6  
ATOM   6131  H  H    . GLN A 1 23 ? -7.251  -1.225  -4.408  1.00 0.00 ? 23  GLN A H    6  
ATOM   6132  H  HA   . GLN A 1 23 ? -9.473  -2.752  -5.581  1.00 0.00 ? 23  GLN A HA   6  
ATOM   6133  H  HB2  . GLN A 1 23 ? -6.616  -3.712  -5.351  1.00 0.00 ? 23  GLN A HB2  6  
ATOM   6134  H  HB3  . GLN A 1 23 ? -7.974  -4.650  -5.958  1.00 0.00 ? 23  GLN A HB3  6  
ATOM   6135  H  HG2  . GLN A 1 23 ? -6.841  -2.157  -7.208  1.00 0.00 ? 23  GLN A HG2  6  
ATOM   6136  H  HG3  . GLN A 1 23 ? -6.605  -3.810  -7.775  1.00 0.00 ? 23  GLN A HG3  6  
ATOM   6137  H  HE21 . GLN A 1 23 ? -8.129  -1.139  -8.556  1.00 0.00 ? 23  GLN A HE21 6  
ATOM   6138  H  HE22 . GLN A 1 23 ? -9.588  -1.762  -9.240  1.00 0.00 ? 23  GLN A HE22 6  
ATOM   6139  N  N    . PHE A 1 24 ? -9.812  -4.119  -3.515  1.00 0.00 ? 24  PHE A N    6  
ATOM   6140  C  CA   . PHE A 1 24 ? -10.123 -4.741  -2.233  1.00 0.00 ? 24  PHE A CA   6  
ATOM   6141  C  C    . PHE A 1 24 ? -9.002  -5.681  -1.799  1.00 0.00 ? 24  PHE A C    6  
ATOM   6142  O  O    . PHE A 1 24 ? -8.573  -6.547  -2.562  1.00 0.00 ? 24  PHE A O    6  
ATOM   6143  C  CB   . PHE A 1 24 ? -11.442 -5.511  -2.322  1.00 0.00 ? 24  PHE A CB   6  
ATOM   6144  C  CG   . PHE A 1 24 ? -12.656 -4.628  -2.262  1.00 0.00 ? 24  PHE A CG   6  
ATOM   6145  C  CD1  . PHE A 1 24 ? -12.737 -3.485  -3.041  1.00 0.00 ? 24  PHE A CD1  6  
ATOM   6146  C  CD2  . PHE A 1 24 ? -13.717 -4.942  -1.427  1.00 0.00 ? 24  PHE A CD2  6  
ATOM   6147  C  CE1  . PHE A 1 24 ? -13.852 -2.670  -2.986  1.00 0.00 ? 24  PHE A CE1  6  
ATOM   6148  C  CE2  . PHE A 1 24 ? -14.835 -4.132  -1.369  1.00 0.00 ? 24  PHE A CE2  6  
ATOM   6149  C  CZ   . PHE A 1 24 ? -14.903 -2.995  -2.151  1.00 0.00 ? 24  PHE A CZ   6  
ATOM   6150  H  H    . PHE A 1 24 ? -10.421 -4.253  -4.272  1.00 0.00 ? 24  PHE A H    6  
ATOM   6151  H  HA   . PHE A 1 24 ? -10.223 -3.956  -1.500  1.00 0.00 ? 24  PHE A HA   6  
ATOM   6152  H  HB2  . PHE A 1 24 ? -11.473 -6.052  -3.256  1.00 0.00 ? 24  PHE A HB2  6  
ATOM   6153  H  HB3  . PHE A 1 24 ? -11.498 -6.211  -1.503  1.00 0.00 ? 24  PHE A HB3  6  
ATOM   6154  H  HD1  . PHE A 1 24 ? -11.917 -3.230  -3.695  1.00 0.00 ? 24  PHE A HD1  6  
ATOM   6155  H  HD2  . PHE A 1 24 ? -13.664 -5.832  -0.816  1.00 0.00 ? 24  PHE A HD2  6  
ATOM   6156  H  HE1  . PHE A 1 24 ? -13.903 -1.782  -3.598  1.00 0.00 ? 24  PHE A HE1  6  
ATOM   6157  H  HE2  . PHE A 1 24 ? -15.654 -4.389  -0.715  1.00 0.00 ? 24  PHE A HE2  6  
ATOM   6158  H  HZ   . PHE A 1 24 ? -15.775 -2.360  -2.106  1.00 0.00 ? 24  PHE A HZ   6  
ATOM   6159  N  N    . ILE A 1 25 ? -8.532  -5.502  -0.569  1.00 0.00 ? 25  ILE A N    6  
ATOM   6160  C  CA   . ILE A 1 25 ? -7.462  -6.333  -0.032  1.00 0.00 ? 25  ILE A CA   6  
ATOM   6161  C  C    . ILE A 1 25 ? -8.022  -7.570  0.662   1.00 0.00 ? 25  ILE A C    6  
ATOM   6162  O  O    . ILE A 1 25 ? -8.590  -7.479  1.750   1.00 0.00 ? 25  ILE A O    6  
ATOM   6163  C  CB   . ILE A 1 25 ? -6.587  -5.550  0.965   1.00 0.00 ? 25  ILE A CB   6  
ATOM   6164  C  CG1  . ILE A 1 25 ? -6.260  -4.163  0.410   1.00 0.00 ? 25  ILE A CG1  6  
ATOM   6165  C  CG2  . ILE A 1 25 ? -5.310  -6.320  1.267   1.00 0.00 ? 25  ILE A CG2  6  
ATOM   6166  C  CD1  . ILE A 1 25 ? -5.581  -3.255  1.412   1.00 0.00 ? 25  ILE A CD1  6  
ATOM   6167  H  H    . ILE A 1 25 ? -8.915  -4.795  -0.009  1.00 0.00 ? 25  ILE A H    6  
ATOM   6168  H  HA   . ILE A 1 25 ? -6.839  -6.648  -0.857  1.00 0.00 ? 25  ILE A HA   6  
ATOM   6169  H  HB   . ILE A 1 25 ? -7.139  -5.441  1.886   1.00 0.00 ? 25  ILE A HB   6  
ATOM   6170  H  HG12 . ILE A 1 25 ? -5.604  -4.267  -0.440  1.00 0.00 ? 25  ILE A HG12 6  
ATOM   6171  H  HG13 . ILE A 1 25 ? -7.176  -3.684  0.095   1.00 0.00 ? 25  ILE A HG13 6  
ATOM   6172  H  HG21 . ILE A 1 25 ? -5.099  -6.267  2.325   1.00 0.00 ? 25  ILE A HG21 6  
ATOM   6173  H  HG22 . ILE A 1 25 ? -5.435  -7.353  0.978   1.00 0.00 ? 25  ILE A HG22 6  
ATOM   6174  H  HG23 . ILE A 1 25 ? -4.489  -5.888  0.714   1.00 0.00 ? 25  ILE A HG23 6  
ATOM   6175  H  HD11 . ILE A 1 25 ? -4.805  -3.803  1.926   1.00 0.00 ? 25  ILE A HD11 6  
ATOM   6176  H  HD12 . ILE A 1 25 ? -5.148  -2.411  0.898   1.00 0.00 ? 25  ILE A HD12 6  
ATOM   6177  H  HD13 . ILE A 1 25 ? -6.309  -2.905  2.130   1.00 0.00 ? 25  ILE A HD13 6  
ATOM   6178  N  N    . GLU A 1 26 ? -7.855  -8.725  0.026   1.00 0.00 ? 26  GLU A N    6  
ATOM   6179  C  CA   . GLU A 1 26 ? -8.344  -9.981  0.584   1.00 0.00 ? 26  GLU A CA   6  
ATOM   6180  C  C    . GLU A 1 26 ? -7.220  -10.739 1.285   1.00 0.00 ? 26  GLU A C    6  
ATOM   6181  O  O    . GLU A 1 26 ? -6.047  -10.586 0.945   1.00 0.00 ? 26  GLU A O    6  
ATOM   6182  C  CB   . GLU A 1 26 ? -8.951  -10.852 -0.517  1.00 0.00 ? 26  GLU A CB   6  
ATOM   6183  C  CG   . GLU A 1 26 ? -9.363  -12.235 -0.042  1.00 0.00 ? 26  GLU A CG   6  
ATOM   6184  C  CD   . GLU A 1 26 ? -9.886  -13.107 -1.167  1.00 0.00 ? 26  GLU A CD   6  
ATOM   6185  O  OE1  . GLU A 1 26 ? -9.229  -13.163 -2.227  1.00 0.00 ? 26  GLU A OE1  6  
ATOM   6186  O  OE2  . GLU A 1 26 ? -10.952 -13.733 -0.986  1.00 0.00 ? 26  GLU A OE2  6  
ATOM   6187  H  H    . GLU A 1 26 ? -7.394  -8.734  -0.838  1.00 0.00 ? 26  GLU A H    6  
ATOM   6188  H  HA   . GLU A 1 26 ? -9.109  -9.747  1.308   1.00 0.00 ? 26  GLU A HA   6  
ATOM   6189  H  HB2  . GLU A 1 26 ? -9.824  -10.355 -0.912  1.00 0.00 ? 26  GLU A HB2  6  
ATOM   6190  H  HB3  . GLU A 1 26 ? -8.225  -10.968 -1.309  1.00 0.00 ? 26  GLU A HB3  6  
ATOM   6191  H  HG2  . GLU A 1 26 ? -8.505  -12.720 0.399   1.00 0.00 ? 26  GLU A HG2  6  
ATOM   6192  H  HG3  . GLU A 1 26 ? -10.138 -12.130 0.703   1.00 0.00 ? 26  GLU A HG3  6  
ATOM   6193  N  N    . GLY A 1 27 ? -7.587  -11.556 2.267   1.00 0.00 ? 27  GLY A N    6  
ATOM   6194  C  CA   . GLY A 1 27 ? -6.599  -12.325 3.002   1.00 0.00 ? 27  GLY A CA   6  
ATOM   6195  C  C    . GLY A 1 27 ? -5.992  -11.543 4.149   1.00 0.00 ? 27  GLY A C    6  
ATOM   6196  O  O    . GLY A 1 27 ? -6.318  -11.782 5.312   1.00 0.00 ? 27  GLY A O    6  
ATOM   6197  H  H    . GLY A 1 27 ? -8.537  -11.638 2.495   1.00 0.00 ? 27  GLY A H    6  
ATOM   6198  H  HA2  . GLY A 1 27 ? -7.070  -13.214 3.394   1.00 0.00 ? 27  GLY A HA2  6  
ATOM   6199  H  HA3  . GLY A 1 27 ? -5.811  -12.617 2.324   1.00 0.00 ? 27  GLY A HA3  6  
ATOM   6200  N  N    . GLU A 1 28 ? -5.107  -10.607 3.823   1.00 0.00 ? 28  GLU A N    6  
ATOM   6201  C  CA   . GLU A 1 28 ? -4.451  -9.790  4.837   1.00 0.00 ? 28  GLU A CA   6  
ATOM   6202  C  C    . GLU A 1 28 ? -4.169  -8.387  4.306   1.00 0.00 ? 28  GLU A C    6  
ATOM   6203  O  O    . GLU A 1 28 ? -3.933  -8.198  3.113   1.00 0.00 ? 28  GLU A O    6  
ATOM   6204  C  CB   . GLU A 1 28 ? -3.146  -10.448 5.289   1.00 0.00 ? 28  GLU A CB   6  
ATOM   6205  C  CG   . GLU A 1 28 ? -2.333  -9.593  6.247   1.00 0.00 ? 28  GLU A CG   6  
ATOM   6206  C  CD   . GLU A 1 28 ? -1.283  -10.392 6.994   1.00 0.00 ? 28  GLU A CD   6  
ATOM   6207  O  OE1  . GLU A 1 28 ? -1.656  -11.137 7.925   1.00 0.00 ? 28  GLU A OE1  6  
ATOM   6208  O  OE2  . GLU A 1 28 ? -0.089  -10.273 6.649   1.00 0.00 ? 28  GLU A OE2  6  
ATOM   6209  H  H    . GLU A 1 28 ? -4.889  -10.463 2.879   1.00 0.00 ? 28  GLU A H    6  
ATOM   6210  H  HA   . GLU A 1 28 ? -5.117  -9.714  5.683   1.00 0.00 ? 28  GLU A HA   6  
ATOM   6211  H  HB2  . GLU A 1 28 ? -3.379  -11.381 5.780   1.00 0.00 ? 28  GLU A HB2  6  
ATOM   6212  H  HB3  . GLU A 1 28 ? -2.540  -10.651 4.419   1.00 0.00 ? 28  GLU A HB3  6  
ATOM   6213  H  HG2  . GLU A 1 28 ? -1.839  -8.815  5.685   1.00 0.00 ? 28  GLU A HG2  6  
ATOM   6214  H  HG3  . GLU A 1 28 ? -3.003  -9.146  6.967   1.00 0.00 ? 28  GLU A HG3  6  
ATOM   6215  N  N    . VAL A 1 29 ? -4.195  -7.405  5.202   1.00 0.00 ? 29  VAL A N    6  
ATOM   6216  C  CA   . VAL A 1 29 ? -3.942  -6.020  4.826   1.00 0.00 ? 29  VAL A CA   6  
ATOM   6217  C  C    . VAL A 1 29 ? -2.847  -5.406  5.691   1.00 0.00 ? 29  VAL A C    6  
ATOM   6218  O  O    . VAL A 1 29 ? -2.663  -5.793  6.845   1.00 0.00 ? 29  VAL A O    6  
ATOM   6219  C  CB   . VAL A 1 29 ? -5.216  -5.163  4.947   1.00 0.00 ? 29  VAL A CB   6  
ATOM   6220  C  CG1  . VAL A 1 29 ? -5.953  -5.481  6.239   1.00 0.00 ? 29  VAL A CG1  6  
ATOM   6221  C  CG2  . VAL A 1 29 ? -4.873  -3.683  4.869   1.00 0.00 ? 29  VAL A CG2  6  
ATOM   6222  H  H    . VAL A 1 29 ? -4.389  -7.618  6.139   1.00 0.00 ? 29  VAL A H    6  
ATOM   6223  H  HA   . VAL A 1 29 ? -3.621  -6.007  3.794   1.00 0.00 ? 29  VAL A HA   6  
ATOM   6224  H  HB   . VAL A 1 29 ? -5.867  -5.404  4.119   1.00 0.00 ? 29  VAL A HB   6  
ATOM   6225  H  HG11 . VAL A 1 29 ? -5.465  -4.981  7.063   1.00 0.00 ? 29  VAL A HG11 6  
ATOM   6226  H  HG12 . VAL A 1 29 ? -6.975  -5.141  6.164   1.00 0.00 ? 29  VAL A HG12 6  
ATOM   6227  H  HG13 . VAL A 1 29 ? -5.939  -6.548  6.408   1.00 0.00 ? 29  VAL A HG13 6  
ATOM   6228  H  HG21 . VAL A 1 29 ? -4.157  -3.440  5.640   1.00 0.00 ? 29  VAL A HG21 6  
ATOM   6229  H  HG22 . VAL A 1 29 ? -4.448  -3.462  3.900   1.00 0.00 ? 29  VAL A HG22 6  
ATOM   6230  H  HG23 . VAL A 1 29 ? -5.768  -3.097  5.011   1.00 0.00 ? 29  VAL A HG23 6  
ATOM   6231  N  N    . VAL A 1 30 ? -2.121  -4.447  5.126   1.00 0.00 ? 30  VAL A N    6  
ATOM   6232  C  CA   . VAL A 1 30 ? -1.044  -3.778  5.846   1.00 0.00 ? 30  VAL A CA   6  
ATOM   6233  C  C    . VAL A 1 30 ? -1.445  -2.362  6.243   1.00 0.00 ? 30  VAL A C    6  
ATOM   6234  O  O    . VAL A 1 30 ? -1.364  -1.434  5.438   1.00 0.00 ? 30  VAL A O    6  
ATOM   6235  C  CB   . VAL A 1 30 ? 0.243   -3.718  5.001   1.00 0.00 ? 30  VAL A CB   6  
ATOM   6236  C  CG1  . VAL A 1 30 ? 1.341   -2.981  5.753   1.00 0.00 ? 30  VAL A CG1  6  
ATOM   6237  C  CG2  . VAL A 1 30 ? 0.695   -5.119  4.618   1.00 0.00 ? 30  VAL A CG2  6  
ATOM   6238  H  H    . VAL A 1 30 ? -2.315  -4.183  4.202   1.00 0.00 ? 30  VAL A H    6  
ATOM   6239  H  HA   . VAL A 1 30 ? -0.836  -4.347  6.740   1.00 0.00 ? 30  VAL A HA   6  
ATOM   6240  H  HB   . VAL A 1 30 ? 0.029   -3.171  4.095   1.00 0.00 ? 30  VAL A HB   6  
ATOM   6241  H  HG11 . VAL A 1 30 ? 0.937   -2.077  6.185   1.00 0.00 ? 30  VAL A HG11 6  
ATOM   6242  H  HG12 . VAL A 1 30 ? 1.727   -3.615  6.538   1.00 0.00 ? 30  VAL A HG12 6  
ATOM   6243  H  HG13 . VAL A 1 30 ? 2.138   -2.728  5.070   1.00 0.00 ? 30  VAL A HG13 6  
ATOM   6244  H  HG21 . VAL A 1 30 ? 0.030   -5.518  3.867   1.00 0.00 ? 30  VAL A HG21 6  
ATOM   6245  H  HG22 . VAL A 1 30 ? 1.700   -5.078  4.225   1.00 0.00 ? 30  VAL A HG22 6  
ATOM   6246  H  HG23 . VAL A 1 30 ? 0.676   -5.755  5.491   1.00 0.00 ? 30  VAL A HG23 6  
ATOM   6247  N  N    . SER A 1 31 ? -1.878  -2.203  7.490   1.00 0.00 ? 31  SER A N    6  
ATOM   6248  C  CA   . SER A 1 31 ? -2.295  -0.900  7.994   1.00 0.00 ? 31  SER A CA   6  
ATOM   6249  C  C    . SER A 1 31 ? -1.086  -0.011  8.268   1.00 0.00 ? 31  SER A C    6  
ATOM   6250  O  O    . SER A 1 31 ? -0.356  -0.218  9.236   1.00 0.00 ? 31  SER A O    6  
ATOM   6251  C  CB   . SER A 1 31 ? -3.121  -1.065  9.271   1.00 0.00 ? 31  SER A CB   6  
ATOM   6252  O  OG   . SER A 1 31 ? -2.327  -1.569  10.331  1.00 0.00 ? 31  SER A OG   6  
ATOM   6253  H  H    . SER A 1 31 ? -1.919  -2.982  8.084   1.00 0.00 ? 31  SER A H    6  
ATOM   6254  H  HA   . SER A 1 31 ? -2.907  -0.433  7.237   1.00 0.00 ? 31  SER A HA   6  
ATOM   6255  H  HB2  . SER A 1 31 ? -3.523  -0.106  9.563   1.00 0.00 ? 31  SER A HB2  6  
ATOM   6256  H  HB3  . SER A 1 31 ? -3.933  -1.754  9.085   1.00 0.00 ? 31  SER A HB3  6  
ATOM   6257  H  HG   . SER A 1 31 ? -2.842  -2.193  10.848  1.00 0.00 ? 31  SER A HG   6  
ATOM   6258  N  N    . ALA A 1 32 ? -0.882  0.981   7.406   1.00 0.00 ? 32  ALA A N    6  
ATOM   6259  C  CA   . ALA A 1 32 ? 0.237   1.903   7.555   1.00 0.00 ? 32  ALA A CA   6  
ATOM   6260  C  C    . ALA A 1 32 ? -0.210  3.346   7.347   1.00 0.00 ? 32  ALA A C    6  
ATOM   6261  O  O    . ALA A 1 32 ? -1.060  3.628   6.500   1.00 0.00 ? 32  ALA A O    6  
ATOM   6262  C  CB   . ALA A 1 32 ? 1.348   1.547   6.580   1.00 0.00 ? 32  ALA A CB   6  
ATOM   6263  H  H    . ALA A 1 32 ? -1.499  1.095   6.654   1.00 0.00 ? 32  ALA A H    6  
ATOM   6264  H  HA   . ALA A 1 32 ? 0.625   1.798   8.559   1.00 0.00 ? 32  ALA A HA   6  
ATOM   6265  H  HB1  . ALA A 1 32 ? 0.949   0.926   5.791   1.00 0.00 ? 32  ALA A HB1  6  
ATOM   6266  H  HB2  . ALA A 1 32 ? 1.757   2.451   6.154   1.00 0.00 ? 32  ALA A HB2  6  
ATOM   6267  H  HB3  . ALA A 1 32 ? 2.127   1.010   7.101   1.00 0.00 ? 32  ALA A HB3  6  
ATOM   6268  N  N    . LEU A 1 33 ? 0.365   4.257   8.124   1.00 0.00 ? 33  LEU A N    6  
ATOM   6269  C  CA   . LEU A 1 33 ? 0.025   5.672   8.025   1.00 0.00 ? 33  LEU A CA   6  
ATOM   6270  C  C    . LEU A 1 33 ? -1.484  5.876   8.105   1.00 0.00 ? 33  LEU A C    6  
ATOM   6271  O  O    . LEU A 1 33 ? -2.053  6.675   7.361   1.00 0.00 ? 33  LEU A O    6  
ATOM   6272  C  CB   . LEU A 1 33 ? 0.562   6.255   6.717   1.00 0.00 ? 33  LEU A CB   6  
ATOM   6273  C  CG   . LEU A 1 33 ? 2.071   6.498   6.659   1.00 0.00 ? 33  LEU A CG   6  
ATOM   6274  C  CD1  . LEU A 1 33 ? 2.487   7.524   7.702   1.00 0.00 ? 33  LEU A CD1  6  
ATOM   6275  C  CD2  . LEU A 1 33 ? 2.829   5.194   6.859   1.00 0.00 ? 33  LEU A CD2  6  
ATOM   6276  H  H    . LEU A 1 33 ? 1.035   3.972   8.780   1.00 0.00 ? 33  LEU A H    6  
ATOM   6277  H  HA   . LEU A 1 33 ? 0.490   6.183   8.855   1.00 0.00 ? 33  LEU A HA   6  
ATOM   6278  H  HB2  . LEU A 1 33 ? 0.307   5.573   5.921   1.00 0.00 ? 33  LEU A HB2  6  
ATOM   6279  H  HB3  . LEU A 1 33 ? 0.067   7.202   6.550   1.00 0.00 ? 33  LEU A HB3  6  
ATOM   6280  H  HG   . LEU A 1 33 ? 2.329   6.890   5.685   1.00 0.00 ? 33  LEU A HG   6  
ATOM   6281  H  HD11 . LEU A 1 33 ? 1.684   8.231   7.851   1.00 0.00 ? 33  LEU A HD11 6  
ATOM   6282  H  HD12 . LEU A 1 33 ? 3.368   8.047   7.361   1.00 0.00 ? 33  LEU A HD12 6  
ATOM   6283  H  HD13 . LEU A 1 33 ? 2.704   7.022   8.634   1.00 0.00 ? 33  LEU A HD13 6  
ATOM   6284  H  HD21 . LEU A 1 33 ? 3.823   5.290   6.450   1.00 0.00 ? 33  LEU A HD21 6  
ATOM   6285  H  HD22 . LEU A 1 33 ? 2.307   4.394   6.354   1.00 0.00 ? 33  LEU A HD22 6  
ATOM   6286  H  HD23 . LEU A 1 33 ? 2.893   4.973   7.914   1.00 0.00 ? 33  LEU A HD23 6  
ATOM   6287  N  N    . GLY A 1 34 ? -2.128  5.150   9.014   1.00 0.00 ? 34  GLY A N    6  
ATOM   6288  C  CA   . GLY A 1 34 ? -3.565  5.268   9.175   1.00 0.00 ? 34  GLY A CA   6  
ATOM   6289  C  C    . GLY A 1 34 ? -4.317  4.994   7.888   1.00 0.00 ? 34  GLY A C    6  
ATOM   6290  O  O    . GLY A 1 34 ? -5.342  5.619   7.614   1.00 0.00 ? 34  GLY A O    6  
ATOM   6291  H  H    . GLY A 1 34 ? -1.622  4.529   9.579   1.00 0.00 ? 34  GLY A H    6  
ATOM   6292  H  HA2  . GLY A 1 34 ? -3.890  4.564   9.927   1.00 0.00 ? 34  GLY A HA2  6  
ATOM   6293  H  HA3  . GLY A 1 34 ? -3.797  6.269   9.508   1.00 0.00 ? 34  GLY A HA3  6  
ATOM   6294  N  N    . LYS A 1 35 ? -3.808  4.057   7.095   1.00 0.00 ? 35  LYS A N    6  
ATOM   6295  C  CA   . LYS A 1 35 ? -4.438  3.701   5.829   1.00 0.00 ? 35  LYS A CA   6  
ATOM   6296  C  C    . LYS A 1 35 ? -4.234  2.222   5.517   1.00 0.00 ? 35  LYS A C    6  
ATOM   6297  O  O    . LYS A 1 35 ? -3.610  1.494   6.289   1.00 0.00 ? 35  LYS A O    6  
ATOM   6298  C  CB   . LYS A 1 35 ? -3.869  4.556   4.695   1.00 0.00 ? 35  LYS A CB   6  
ATOM   6299  C  CG   . LYS A 1 35 ? -4.473  5.948   4.620   1.00 0.00 ? 35  LYS A CG   6  
ATOM   6300  C  CD   . LYS A 1 35 ? -4.095  6.651   3.327   1.00 0.00 ? 35  LYS A CD   6  
ATOM   6301  C  CE   . LYS A 1 35 ? -4.918  7.913   3.118   1.00 0.00 ? 35  LYS A CE   6  
ATOM   6302  N  NZ   . LYS A 1 35 ? -4.544  8.617   1.860   1.00 0.00 ? 35  LYS A NZ   6  
ATOM   6303  H  H    . LYS A 1 35 ? -2.989  3.593   7.368   1.00 0.00 ? 35  LYS A H    6  
ATOM   6304  H  HA   . LYS A 1 35 ? -5.496  3.895   5.919   1.00 0.00 ? 35  LYS A HA   6  
ATOM   6305  H  HB2  . LYS A 1 35 ? -2.803  4.656   4.835   1.00 0.00 ? 35  LYS A HB2  6  
ATOM   6306  H  HB3  . LYS A 1 35 ? -4.054  4.056   3.755   1.00 0.00 ? 35  LYS A HB3  6  
ATOM   6307  H  HG2  . LYS A 1 35 ? -5.548  5.867   4.673   1.00 0.00 ? 35  LYS A HG2  6  
ATOM   6308  H  HG3  . LYS A 1 35 ? -4.112  6.532   5.455   1.00 0.00 ? 35  LYS A HG3  6  
ATOM   6309  H  HD2  . LYS A 1 35 ? -3.050  6.920   3.365   1.00 0.00 ? 35  LYS A HD2  6  
ATOM   6310  H  HD3  . LYS A 1 35 ? -4.266  5.978   2.499   1.00 0.00 ? 35  LYS A HD3  6  
ATOM   6311  H  HE2  . LYS A 1 35 ? -5.962  7.642   3.072   1.00 0.00 ? 35  LYS A HE2  6  
ATOM   6312  H  HE3  . LYS A 1 35 ? -4.755  8.576   3.954   1.00 0.00 ? 35  LYS A HE3  6  
ATOM   6313  H  HZ1  . LYS A 1 35 ? -4.951  9.574   1.852   1.00 0.00 ? 35  LYS A HZ1  6  
ATOM   6314  H  HZ2  . LYS A 1 35 ? -4.904  8.093   1.037   1.00 0.00 ? 35  LYS A HZ2  6  
ATOM   6315  H  HZ3  . LYS A 1 35 ? -3.510  8.690   1.785   1.00 0.00 ? 35  LYS A HZ3  6  
ATOM   6316  N  N    . THR A 1 36 ? -4.763  1.784   4.379   1.00 0.00 ? 36  THR A N    6  
ATOM   6317  C  CA   . THR A 1 36 ? -4.638  0.392   3.964   1.00 0.00 ? 36  THR A CA   6  
ATOM   6318  C  C    . THR A 1 36 ? -3.879  0.276   2.647   1.00 0.00 ? 36  THR A C    6  
ATOM   6319  O  O    . THR A 1 36 ? -4.155  1.006   1.694   1.00 0.00 ? 36  THR A O    6  
ATOM   6320  C  CB   . THR A 1 36 ? -6.018  -0.273  3.808   1.00 0.00 ? 36  THR A CB   6  
ATOM   6321  O  OG1  . THR A 1 36 ? -6.743  0.345   2.739   1.00 0.00 ? 36  THR A OG1  6  
ATOM   6322  C  CG2  . THR A 1 36 ? -6.819  -0.167  5.098   1.00 0.00 ? 36  THR A CG2  6  
ATOM   6323  H  H    . THR A 1 36 ? -5.249  2.412   3.805   1.00 0.00 ? 36  THR A H    6  
ATOM   6324  H  HA   . THR A 1 36 ? -4.091  -0.137  4.731   1.00 0.00 ? 36  THR A HA   6  
ATOM   6325  H  HB   . THR A 1 36 ? -5.873  -1.319  3.577   1.00 0.00 ? 36  THR A HB   6  
ATOM   6326  H  HG1  . THR A 1 36 ? -6.128  0.795   2.154   1.00 0.00 ? 36  THR A HG1  6  
ATOM   6327  H  HG21 . THR A 1 36 ? -7.842  0.092   4.866   1.00 0.00 ? 36  THR A HG21 6  
ATOM   6328  H  HG22 . THR A 1 36 ? -6.387  0.596   5.727   1.00 0.00 ? 36  THR A HG22 6  
ATOM   6329  H  HG23 . THR A 1 36 ? -6.796  -1.115  5.614   1.00 0.00 ? 36  THR A HG23 6  
ATOM   6330  N  N    . TYR A 1 37 ? -2.923  -0.645  2.600   1.00 0.00 ? 37  TYR A N    6  
ATOM   6331  C  CA   . TYR A 1 37 ? -2.123  -0.854  1.399   1.00 0.00 ? 37  TYR A CA   6  
ATOM   6332  C  C    . TYR A 1 37 ? -1.816  -2.336  1.201   1.00 0.00 ? 37  TYR A C    6  
ATOM   6333  O  O    . TYR A 1 37 ? -1.853  -3.122  2.149   1.00 0.00 ? 37  TYR A O    6  
ATOM   6334  C  CB   . TYR A 1 37 ? -0.819  -0.059  1.484   1.00 0.00 ? 37  TYR A CB   6  
ATOM   6335  C  CG   . TYR A 1 37 ? -1.017  1.438   1.401   1.00 0.00 ? 37  TYR A CG   6  
ATOM   6336  C  CD1  . TYR A 1 37 ? -1.352  2.048   0.198   1.00 0.00 ? 37  TYR A CD1  6  
ATOM   6337  C  CD2  . TYR A 1 37 ? -0.869  2.242   2.524   1.00 0.00 ? 37  TYR A CD2  6  
ATOM   6338  C  CE1  . TYR A 1 37 ? -1.533  3.415   0.116   1.00 0.00 ? 37  TYR A CE1  6  
ATOM   6339  C  CE2  . TYR A 1 37 ? -1.049  3.610   2.452   1.00 0.00 ? 37  TYR A CE2  6  
ATOM   6340  C  CZ   . TYR A 1 37 ? -1.381  4.192   1.246   1.00 0.00 ? 37  TYR A CZ   6  
ATOM   6341  O  OH   . TYR A 1 37 ? -1.560  5.554   1.170   1.00 0.00 ? 37  TYR A OH   6  
ATOM   6342  H  H    . TYR A 1 37 ? -2.750  -1.195  3.392   1.00 0.00 ? 37  TYR A H    6  
ATOM   6343  H  HA   . TYR A 1 37 ? -2.695  -0.501  0.554   1.00 0.00 ? 37  TYR A HA   6  
ATOM   6344  H  HB2  . TYR A 1 37 ? -0.333  -0.276  2.422   1.00 0.00 ? 37  TYR A HB2  6  
ATOM   6345  H  HB3  . TYR A 1 37 ? -0.172  -0.354  0.672   1.00 0.00 ? 37  TYR A HB3  6  
ATOM   6346  H  HD1  . TYR A 1 37 ? -1.470  1.437   -0.686  1.00 0.00 ? 37  TYR A HD1  6  
ATOM   6347  H  HD2  . TYR A 1 37 ? -0.608  1.783   3.467   1.00 0.00 ? 37  TYR A HD2  6  
ATOM   6348  H  HE1  . TYR A 1 37 ? -1.793  3.872   -0.828  1.00 0.00 ? 37  TYR A HE1  6  
ATOM   6349  H  HE2  . TYR A 1 37 ? -0.930  4.218   3.336   1.00 0.00 ? 37  TYR A HE2  6  
ATOM   6350  H  HH   . TYR A 1 37 ? -2.152  5.838   1.870   1.00 0.00 ? 37  TYR A HH   6  
ATOM   6351  N  N    . HIS A 1 38 ? -1.511  -2.710  -0.037  1.00 0.00 ? 38  HIS A N    6  
ATOM   6352  C  CA   . HIS A 1 38 ? -1.195  -4.096  -0.361  1.00 0.00 ? 38  HIS A CA   6  
ATOM   6353  C  C    . HIS A 1 38 ? 0.239   -4.434  0.036   1.00 0.00 ? 38  HIS A C    6  
ATOM   6354  O  O    . HIS A 1 38 ? 1.075   -3.555  0.245   1.00 0.00 ? 38  HIS A O    6  
ATOM   6355  C  CB   . HIS A 1 38 ? -1.397  -4.352  -1.855  1.00 0.00 ? 38  HIS A CB   6  
ATOM   6356  C  CG   . HIS A 1 38 ? -2.778  -4.814  -2.203  1.00 0.00 ? 38  HIS A CG   6  
ATOM   6357  N  ND1  . HIS A 1 38 ? -3.545  -4.221  -3.184  1.00 0.00 ? 38  HIS A ND1  6  
ATOM   6358  C  CD2  . HIS A 1 38 ? -3.529  -5.819  -1.695  1.00 0.00 ? 38  HIS A CD2  6  
ATOM   6359  C  CE1  . HIS A 1 38 ? -4.710  -4.841  -3.263  1.00 0.00 ? 38  HIS A CE1  6  
ATOM   6360  N  NE2  . HIS A 1 38 ? -4.725  -5.815  -2.371  1.00 0.00 ? 38  HIS A NE2  6  
ATOM   6361  H  H    . HIS A 1 38 ? -1.497  -2.037  -0.750  1.00 0.00 ? 38  HIS A H    6  
ATOM   6362  H  HA   . HIS A 1 38 ? -1.868  -4.729  0.197   1.00 0.00 ? 38  HIS A HA   6  
ATOM   6363  H  HB2  . HIS A 1 38 ? -1.206  -3.438  -2.399  1.00 0.00 ? 38  HIS A HB2  6  
ATOM   6364  H  HB3  . HIS A 1 38 ? -0.700  -5.111  -2.181  1.00 0.00 ? 38  HIS A HB3  6  
ATOM   6365  H  HD2  . HIS A 1 38 ? -3.243  -6.499  -0.905  1.00 0.00 ? 38  HIS A HD2  6  
ATOM   6366  H  HE1  . HIS A 1 38 ? -5.512  -4.594  -3.942  1.00 0.00 ? 38  HIS A HE1  6  
ATOM   6367  H  HE2  . HIS A 1 38 ? -5.501  -6.375  -2.161  1.00 0.00 ? 38  HIS A HE2  6  
ATOM   6368  N  N    . PRO A 1 39 ? 0.532   -5.739  0.144   1.00 0.00 ? 39  PRO A N    6  
ATOM   6369  C  CA   . PRO A 1 39 ? 1.864   -6.223  0.517   1.00 0.00 ? 39  PRO A CA   6  
ATOM   6370  C  C    . PRO A 1 39 ? 2.896   -5.981  -0.579  1.00 0.00 ? 39  PRO A C    6  
ATOM   6371  O  O    . PRO A 1 39 ? 4.082   -6.263  -0.402  1.00 0.00 ? 39  PRO A O    6  
ATOM   6372  C  CB   . PRO A 1 39 ? 1.650   -7.723  0.728   1.00 0.00 ? 39  PRO A CB   6  
ATOM   6373  C  CG   . PRO A 1 39 ? 0.467   -8.060  -0.111  1.00 0.00 ? 39  PRO A CG   6  
ATOM   6374  C  CD   . PRO A 1 39 ? -0.415  -6.842  -0.091  1.00 0.00 ? 39  PRO A CD   6  
ATOM   6375  H  HA   . PRO A 1 39 ? 2.206   -5.773  1.437   1.00 0.00 ? 39  PRO A HA   6  
ATOM   6376  H  HB2  . PRO A 1 39 ? 2.530   -8.264  0.408   1.00 0.00 ? 39  PRO A HB2  6  
ATOM   6377  H  HB3  . PRO A 1 39 ? 1.461   -7.920  1.773   1.00 0.00 ? 39  PRO A HB3  6  
ATOM   6378  H  HG2  . PRO A 1 39 ? 0.782   -8.277  -1.121  1.00 0.00 ? 39  PRO A HG2  6  
ATOM   6379  H  HG3  . PRO A 1 39 ? -0.054  -8.906  0.311   1.00 0.00 ? 39  PRO A HG3  6  
ATOM   6380  H  HD2  . PRO A 1 39 ? -0.918  -6.724  -1.039  1.00 0.00 ? 39  PRO A HD2  6  
ATOM   6381  H  HD3  . PRO A 1 39 ? -1.133  -6.910  0.713   1.00 0.00 ? 39  PRO A HD3  6  
ATOM   6382  N  N    . ASP A 1 40 ? 2.439   -5.457  -1.711  1.00 0.00 ? 40  ASP A N    6  
ATOM   6383  C  CA   . ASP A 1 40 ? 3.323   -5.176  -2.836  1.00 0.00 ? 40  ASP A CA   6  
ATOM   6384  C  C    . ASP A 1 40 ? 3.170   -3.731  -3.300  1.00 0.00 ? 40  ASP A C    6  
ATOM   6385  O  O    . ASP A 1 40 ? 3.953   -3.243  -4.116  1.00 0.00 ? 40  ASP A O    6  
ATOM   6386  C  CB   . ASP A 1 40 ? 3.029   -6.131  -3.995  1.00 0.00 ? 40  ASP A CB   6  
ATOM   6387  C  CG   . ASP A 1 40 ? 2.687   -7.529  -3.520  1.00 0.00 ? 40  ASP A CG   6  
ATOM   6388  O  OD1  . ASP A 1 40 ? 3.601   -8.234  -3.043  1.00 0.00 ? 40  ASP A OD1  6  
ATOM   6389  O  OD2  . ASP A 1 40 ? 1.505   -7.920  -3.626  1.00 0.00 ? 40  ASP A OD2  6  
ATOM   6390  H  H    . ASP A 1 40 ? 1.483   -5.254  -1.792  1.00 0.00 ? 40  ASP A H    6  
ATOM   6391  H  HA   . ASP A 1 40 ? 4.340   -5.329  -2.505  1.00 0.00 ? 40  ASP A HA   6  
ATOM   6392  H  HB2  . ASP A 1 40 ? 2.194   -5.750  -4.564  1.00 0.00 ? 40  ASP A HB2  6  
ATOM   6393  H  HB3  . ASP A 1 40 ? 3.898   -6.189  -4.634  1.00 0.00 ? 40  ASP A HB3  6  
ATOM   6394  N  N    . CYS A 1 41 ? 2.156   -3.051  -2.776  1.00 0.00 ? 41  CYS A N    6  
ATOM   6395  C  CA   . CYS A 1 41 ? 1.898   -1.663  -3.137  1.00 0.00 ? 41  CYS A CA   6  
ATOM   6396  C  C    . CYS A 1 41 ? 2.621   -0.711  -2.188  1.00 0.00 ? 41  CYS A C    6  
ATOM   6397  O  O    . CYS A 1 41 ? 3.030   0.382   -2.580  1.00 0.00 ? 41  CYS A O    6  
ATOM   6398  C  CB   . CYS A 1 41 ? 0.395   -1.379  -3.114  1.00 0.00 ? 41  CYS A CB   6  
ATOM   6399  S  SG   . CYS A 1 41 ? -0.518  -2.088  -4.522  1.00 0.00 ? 41  CYS A SG   6  
ATOM   6400  H  H    . CYS A 1 41 ? 1.565   -3.495  -2.130  1.00 0.00 ? 41  CYS A H    6  
ATOM   6401  H  HA   . CYS A 1 41 ? 2.270   -1.505  -4.138  1.00 0.00 ? 41  CYS A HA   6  
ATOM   6402  H  HB2  . CYS A 1 41 ? -0.028  -1.790  -2.209  1.00 0.00 ? 41  CYS A HB2  6  
ATOM   6403  H  HB3  . CYS A 1 41 ? 0.238   -0.310  -3.125  1.00 0.00 ? 41  CYS A HB3  6  
ATOM   6404  N  N    . PHE A 1 42 ? 2.776   -1.135  -0.938  1.00 0.00 ? 42  PHE A N    6  
ATOM   6405  C  CA   . PHE A 1 42 ? 3.449   -0.321  0.067   1.00 0.00 ? 42  PHE A CA   6  
ATOM   6406  C  C    . PHE A 1 42 ? 4.964   -0.392  -0.100  1.00 0.00 ? 42  PHE A C    6  
ATOM   6407  O  O    . PHE A 1 42 ? 5.701   -0.550  0.873   1.00 0.00 ? 42  PHE A O    6  
ATOM   6408  C  CB   . PHE A 1 42 ? 3.058   -0.782  1.473   1.00 0.00 ? 42  PHE A CB   6  
ATOM   6409  C  CG   . PHE A 1 42 ? 3.370   0.225   2.543   1.00 0.00 ? 42  PHE A CG   6  
ATOM   6410  C  CD1  . PHE A 1 42 ? 2.894   1.523   2.451   1.00 0.00 ? 42  PHE A CD1  6  
ATOM   6411  C  CD2  . PHE A 1 42 ? 4.140   -0.126  3.640   1.00 0.00 ? 42  PHE A CD2  6  
ATOM   6412  C  CE1  . PHE A 1 42 ? 3.180   2.452   3.434   1.00 0.00 ? 42  PHE A CE1  6  
ATOM   6413  C  CE2  . PHE A 1 42 ? 4.430   0.798   4.626   1.00 0.00 ? 42  PHE A CE2  6  
ATOM   6414  C  CZ   . PHE A 1 42 ? 3.948   2.088   4.523   1.00 0.00 ? 42  PHE A CZ   6  
ATOM   6415  H  H    . PHE A 1 42 ? 2.428   -2.016  -0.686  1.00 0.00 ? 42  PHE A H    6  
ATOM   6416  H  HA   . PHE A 1 42 ? 3.131   0.702   -0.068  1.00 0.00 ? 42  PHE A HA   6  
ATOM   6417  H  HB2  . PHE A 1 42 ? 1.996   -0.973  1.499   1.00 0.00 ? 42  PHE A HB2  6  
ATOM   6418  H  HB3  . PHE A 1 42 ? 3.590   -1.692  1.706   1.00 0.00 ? 42  PHE A HB3  6  
ATOM   6419  H  HD1  . PHE A 1 42 ? 2.292   1.809   1.601   1.00 0.00 ? 42  PHE A HD1  6  
ATOM   6420  H  HD2  . PHE A 1 42 ? 4.517   -1.136  3.721   1.00 0.00 ? 42  PHE A HD2  6  
ATOM   6421  H  HE1  . PHE A 1 42 ? 2.803   3.460   3.352   1.00 0.00 ? 42  PHE A HE1  6  
ATOM   6422  H  HE2  . PHE A 1 42 ? 5.030   0.510   5.476   1.00 0.00 ? 42  PHE A HE2  6  
ATOM   6423  H  HZ   . PHE A 1 42 ? 4.174   2.812   5.292   1.00 0.00 ? 42  PHE A HZ   6  
ATOM   6424  N  N    . VAL A 1 43 ? 5.422   -0.274  -1.343  1.00 0.00 ? 43  VAL A N    6  
ATOM   6425  C  CA   . VAL A 1 43 ? 6.849   -0.325  -1.639  1.00 0.00 ? 43  VAL A CA   6  
ATOM   6426  C  C    . VAL A 1 43 ? 7.315   0.961   -2.314  1.00 0.00 ? 43  VAL A C    6  
ATOM   6427  O  O    . VAL A 1 43 ? 6.506   1.820   -2.665  1.00 0.00 ? 43  VAL A O    6  
ATOM   6428  C  CB   . VAL A 1 43 ? 7.191   -1.521  -2.547  1.00 0.00 ? 43  VAL A CB   6  
ATOM   6429  C  CG1  . VAL A 1 43 ? 6.684   -2.818  -1.935  1.00 0.00 ? 43  VAL A CG1  6  
ATOM   6430  C  CG2  . VAL A 1 43 ? 6.612   -1.317  -3.939  1.00 0.00 ? 43  VAL A CG2  6  
ATOM   6431  H  H    . VAL A 1 43 ? 4.785   -0.150  -2.077  1.00 0.00 ? 43  VAL A H    6  
ATOM   6432  H  HA   . VAL A 1 43 ? 7.380   -0.444  -0.706  1.00 0.00 ? 43  VAL A HA   6  
ATOM   6433  H  HB   . VAL A 1 43 ? 8.266   -1.586  -2.633  1.00 0.00 ? 43  VAL A HB   6  
ATOM   6434  H  HG11 . VAL A 1 43 ? 7.397   -3.608  -2.124  1.00 0.00 ? 43  VAL A HG11 6  
ATOM   6435  H  HG12 . VAL A 1 43 ? 6.561   -2.690  -0.869  1.00 0.00 ? 43  VAL A HG12 6  
ATOM   6436  H  HG13 . VAL A 1 43 ? 5.734   -3.078  -2.379  1.00 0.00 ? 43  VAL A HG13 6  
ATOM   6437  H  HG21 . VAL A 1 43 ? 5.678   -0.781  -3.864  1.00 0.00 ? 43  VAL A HG21 6  
ATOM   6438  H  HG22 . VAL A 1 43 ? 7.307   -0.745  -4.538  1.00 0.00 ? 43  VAL A HG22 6  
ATOM   6439  H  HG23 . VAL A 1 43 ? 6.442   -2.276  -4.403  1.00 0.00 ? 43  VAL A HG23 6  
ATOM   6440  N  N    . CYS A 1 44 ? 8.626   1.086   -2.493  1.00 0.00 ? 44  CYS A N    6  
ATOM   6441  C  CA   . CYS A 1 44 ? 9.203   2.266   -3.125  1.00 0.00 ? 44  CYS A CA   6  
ATOM   6442  C  C    . CYS A 1 44 ? 8.498   2.576   -4.443  1.00 0.00 ? 44  CYS A C    6  
ATOM   6443  O  O    . CYS A 1 44 ? 7.788   1.734   -4.992  1.00 0.00 ? 44  CYS A O    6  
ATOM   6444  C  CB   . CYS A 1 44 ? 10.699  2.060   -3.371  1.00 0.00 ? 44  CYS A CB   6  
ATOM   6445  S  SG   . CYS A 1 44 ? 11.577  3.560   -3.915  1.00 0.00 ? 44  CYS A SG   6  
ATOM   6446  H  H    . CYS A 1 44 ? 9.221   0.367   -2.192  1.00 0.00 ? 44  CYS A H    6  
ATOM   6447  H  HA   . CYS A 1 44 ? 9.069   3.101   -2.454  1.00 0.00 ? 44  CYS A HA   6  
ATOM   6448  H  HB2  . CYS A 1 44 ? 11.162  1.722   -2.455  1.00 0.00 ? 44  CYS A HB2  6  
ATOM   6449  H  HB3  . CYS A 1 44 ? 10.830  1.306   -4.133  1.00 0.00 ? 44  CYS A HB3  6  
ATOM   6450  N  N    . ALA A 1 45 ? 8.699   3.791   -4.944  1.00 0.00 ? 45  ALA A N    6  
ATOM   6451  C  CA   . ALA A 1 45 ? 8.086   4.212   -6.197  1.00 0.00 ? 45  ALA A CA   6  
ATOM   6452  C  C    . ALA A 1 45 ? 9.079   4.124   -7.351  1.00 0.00 ? 45  ALA A C    6  
ATOM   6453  O  O    . ALA A 1 45 ? 8.689   3.965   -8.508  1.00 0.00 ? 45  ALA A O    6  
ATOM   6454  C  CB   . ALA A 1 45 ? 7.544   5.628   -6.070  1.00 0.00 ? 45  ALA A CB   6  
ATOM   6455  H  H    . ALA A 1 45 ? 9.276   4.418   -4.459  1.00 0.00 ? 45  ALA A H    6  
ATOM   6456  H  HA   . ALA A 1 45 ? 7.255   3.551   -6.400  1.00 0.00 ? 45  ALA A HA   6  
ATOM   6457  H  HB1  . ALA A 1 45 ? 8.360   6.308   -5.871  1.00 0.00 ? 45  ALA A HB1  6  
ATOM   6458  H  HB2  . ALA A 1 45 ? 7.056   5.910   -6.991  1.00 0.00 ? 45  ALA A HB2  6  
ATOM   6459  H  HB3  . ALA A 1 45 ? 6.835   5.670   -5.258  1.00 0.00 ? 45  ALA A HB3  6  
ATOM   6460  N  N    . VAL A 1 46 ? 10.364  4.230   -7.029  1.00 0.00 ? 46  VAL A N    6  
ATOM   6461  C  CA   . VAL A 1 46 ? 11.414  4.162   -8.039  1.00 0.00 ? 46  VAL A CA   6  
ATOM   6462  C  C    . VAL A 1 46 ? 11.909  2.732   -8.222  1.00 0.00 ? 46  VAL A C    6  
ATOM   6463  O  O    . VAL A 1 46 ? 11.670  2.108   -9.257  1.00 0.00 ? 46  VAL A O    6  
ATOM   6464  C  CB   . VAL A 1 46 ? 12.607  5.063   -7.670  1.00 0.00 ? 46  VAL A CB   6  
ATOM   6465  C  CG1  . VAL A 1 46 ? 13.609  5.118   -8.813  1.00 0.00 ? 46  VAL A CG1  6  
ATOM   6466  C  CG2  . VAL A 1 46 ? 12.126  6.459   -7.304  1.00 0.00 ? 46  VAL A CG2  6  
ATOM   6467  H  H    . VAL A 1 46 ? 10.613  4.355   -6.089  1.00 0.00 ? 46  VAL A H    6  
ATOM   6468  H  HA   . VAL A 1 46 ? 11.000  4.512   -8.973  1.00 0.00 ? 46  VAL A HA   6  
ATOM   6469  H  HB   . VAL A 1 46 ? 13.100  4.638   -6.808  1.00 0.00 ? 46  VAL A HB   6  
ATOM   6470  H  HG11 . VAL A 1 46 ? 13.941  6.136   -8.951  1.00 0.00 ? 46  VAL A HG11 6  
ATOM   6471  H  HG12 . VAL A 1 46 ? 14.456  4.490   -8.580  1.00 0.00 ? 46  VAL A HG12 6  
ATOM   6472  H  HG13 . VAL A 1 46 ? 13.139  4.767   -9.720  1.00 0.00 ? 46  VAL A HG13 6  
ATOM   6473  H  HG21 . VAL A 1 46 ? 12.882  6.956   -6.714  1.00 0.00 ? 46  VAL A HG21 6  
ATOM   6474  H  HG22 . VAL A 1 46 ? 11.943  7.026   -8.205  1.00 0.00 ? 46  VAL A HG22 6  
ATOM   6475  H  HG23 . VAL A 1 46 ? 11.213  6.388   -6.732  1.00 0.00 ? 46  VAL A HG23 6  
ATOM   6476  N  N    . CYS A 1 47 ? 12.599  2.216   -7.211  1.00 0.00 ? 47  CYS A N    6  
ATOM   6477  C  CA   . CYS A 1 47 ? 13.129  0.859   -7.259  1.00 0.00 ? 47  CYS A CA   6  
ATOM   6478  C  C    . CYS A 1 47 ? 12.019  -0.166  -7.041  1.00 0.00 ? 47  CYS A C    6  
ATOM   6479  O  O    . CYS A 1 47 ? 12.186  -1.349  -7.336  1.00 0.00 ? 47  CYS A O    6  
ATOM   6480  C  CB   . CYS A 1 47 ? 14.220  0.677   -6.202  1.00 0.00 ? 47  CYS A CB   6  
ATOM   6481  S  SG   . CYS A 1 47 ? 13.630  0.844   -4.487  1.00 0.00 ? 47  CYS A SG   6  
ATOM   6482  H  H    . CYS A 1 47 ? 12.757  2.763   -6.411  1.00 0.00 ? 47  CYS A H    6  
ATOM   6483  H  HA   . CYS A 1 47 ? 13.558  0.704   -8.237  1.00 0.00 ? 47  CYS A HA   6  
ATOM   6484  H  HB2  . CYS A 1 47 ? 14.651  -0.308  -6.306  1.00 0.00 ? 47  CYS A HB2  6  
ATOM   6485  H  HB3  . CYS A 1 47 ? 14.990  1.419   -6.359  1.00 0.00 ? 47  CYS A HB3  6  
ATOM   6486  N  N    . ARG A 1 48 ? 10.887  0.298   -6.523  1.00 0.00 ? 48  ARG A N    6  
ATOM   6487  C  CA   . ARG A 1 48 ? 9.750   -0.578  -6.264  1.00 0.00 ? 48  ARG A CA   6  
ATOM   6488  C  C    . ARG A 1 48 ? 10.154  -1.742  -5.364  1.00 0.00 ? 48  ARG A C    6  
ATOM   6489  O  O    . ARG A 1 48 ? 9.699   -2.872  -5.550  1.00 0.00 ? 48  ARG A O    6  
ATOM   6490  C  CB   . ARG A 1 48 ? 9.180   -1.111  -7.580  1.00 0.00 ? 48  ARG A CB   6  
ATOM   6491  C  CG   . ARG A 1 48 ? 8.628   -0.025  -8.489  1.00 0.00 ? 48  ARG A CG   6  
ATOM   6492  C  CD   . ARG A 1 48 ? 7.158   0.243   -8.208  1.00 0.00 ? 48  ARG A CD   6  
ATOM   6493  N  NE   . ARG A 1 48 ? 6.484   0.855   -9.350  1.00 0.00 ? 48  ARG A NE   6  
ATOM   6494  C  CZ   . ARG A 1 48 ? 6.060   0.170   -10.406 1.00 0.00 ? 48  ARG A CZ   6  
ATOM   6495  N  NH1  . ARG A 1 48 ? 6.239   -1.143  -10.465 1.00 0.00 ? 48  ARG A NH1  6  
ATOM   6496  N  NH2  . ARG A 1 48 ? 5.456   0.798   -11.407 1.00 0.00 ? 48  ARG A NH2  6  
ATOM   6497  H  H    . ARG A 1 48 ? 10.814  1.251   -6.308  1.00 0.00 ? 48  ARG A H    6  
ATOM   6498  H  HA   . ARG A 1 48 ? 8.991   0.003   -5.763  1.00 0.00 ? 48  ARG A HA   6  
ATOM   6499  H  HB2  . ARG A 1 48 ? 9.962   -1.632  -8.113  1.00 0.00 ? 48  ARG A HB2  6  
ATOM   6500  H  HB3  . ARG A 1 48 ? 8.383   -1.804  -7.359  1.00 0.00 ? 48  ARG A HB3  6  
ATOM   6501  H  HG2  . ARG A 1 48 ? 9.186   0.886   -8.326  1.00 0.00 ? 48  ARG A HG2  6  
ATOM   6502  H  HG3  . ARG A 1 48 ? 8.738   -0.338  -9.516  1.00 0.00 ? 48  ARG A HG3  6  
ATOM   6503  H  HD2  . ARG A 1 48 ? 6.673   -0.694  -7.976  1.00 0.00 ? 48  ARG A HD2  6  
ATOM   6504  H  HD3  . ARG A 1 48 ? 7.083   0.906   -7.359  1.00 0.00 ? 48  ARG A HD3  6  
ATOM   6505  H  HE   . ARG A 1 48 ? 6.342   1.824   -9.328  1.00 0.00 ? 48  ARG A HE   6  
ATOM   6506  H  HH11 . ARG A 1 48 ? 6.693   -1.619  -9.712  1.00 0.00 ? 48  ARG A HH11 6  
ATOM   6507  H  HH12 . ARG A 1 48 ? 5.917   -1.656  -11.261 1.00 0.00 ? 48  ARG A HH12 6  
ATOM   6508  H  HH21 . ARG A 1 48 ? 5.320   1.787   -11.366 1.00 0.00 ? 48  ARG A HH21 6  
ATOM   6509  H  HH22 . ARG A 1 48 ? 5.137   0.282   -12.201 1.00 0.00 ? 48  ARG A HH22 6  
ATOM   6510  N  N    . LEU A 1 49 ? 11.010  -1.459  -4.389  1.00 0.00 ? 49  LEU A N    6  
ATOM   6511  C  CA   . LEU A 1 49 ? 11.476  -2.482  -3.459  1.00 0.00 ? 49  LEU A CA   6  
ATOM   6512  C  C    . LEU A 1 49 ? 10.731  -2.392  -2.132  1.00 0.00 ? 49  LEU A C    6  
ATOM   6513  O  O    . LEU A 1 49 ? 10.417  -1.308  -1.640  1.00 0.00 ? 49  LEU A O    6  
ATOM   6514  C  CB   . LEU A 1 49 ? 12.981  -2.338  -3.223  1.00 0.00 ? 49  LEU A CB   6  
ATOM   6515  C  CG   . LEU A 1 49 ? 13.879  -2.617  -4.429  1.00 0.00 ? 49  LEU A CG   6  
ATOM   6516  C  CD1  . LEU A 1 49 ? 15.330  -2.304  -4.097  1.00 0.00 ? 49  LEU A CD1  6  
ATOM   6517  C  CD2  . LEU A 1 49 ? 13.733  -4.063  -4.880  1.00 0.00 ? 49  LEU A CD2  6  
ATOM   6518  H  H    . LEU A 1 49 ? 11.337  -0.541  -4.290  1.00 0.00 ? 49  LEU A H    6  
ATOM   6519  H  HA   . LEU A 1 49 ? 11.281  -3.447  -3.903  1.00 0.00 ? 49  LEU A HA   6  
ATOM   6520  H  HB2  . LEU A 1 49 ? 13.169  -1.326  -2.898  1.00 0.00 ? 49  LEU A HB2  6  
ATOM   6521  H  HB3  . LEU A 1 49 ? 13.259  -3.024  -2.436  1.00 0.00 ? 49  LEU A HB3  6  
ATOM   6522  H  HG   . LEU A 1 49 ? 13.579  -1.978  -5.248  1.00 0.00 ? 49  LEU A HG   6  
ATOM   6523  H  HD11 . LEU A 1 49 ? 15.541  -1.274  -4.341  1.00 0.00 ? 49  LEU A HD11 6  
ATOM   6524  H  HD12 . LEU A 1 49 ? 15.978  -2.950  -4.671  1.00 0.00 ? 49  LEU A HD12 6  
ATOM   6525  H  HD13 . LEU A 1 49 ? 15.501  -2.468  -3.043  1.00 0.00 ? 49  LEU A HD13 6  
ATOM   6526  H  HD21 . LEU A 1 49 ? 14.632  -4.372  -5.392  1.00 0.00 ? 49  LEU A HD21 6  
ATOM   6527  H  HD22 . LEU A 1 49 ? 12.890  -4.147  -5.551  1.00 0.00 ? 49  LEU A HD22 6  
ATOM   6528  H  HD23 . LEU A 1 49 ? 13.573  -4.694  -4.019  1.00 0.00 ? 49  LEU A HD23 6  
ATOM   6529  N  N    . PRO A 1 50 ? 10.442  -3.558  -1.535  1.00 0.00 ? 50  PRO A N    6  
ATOM   6530  C  CA   . PRO A 1 50 ? 9.732   -3.637  -0.254  1.00 0.00 ? 50  PRO A CA   6  
ATOM   6531  C  C    . PRO A 1 50 ? 10.581  -3.139  0.911   1.00 0.00 ? 50  PRO A C    6  
ATOM   6532  O  O    . PRO A 1 50 ? 11.784  -3.394  0.969   1.00 0.00 ? 50  PRO A O    6  
ATOM   6533  C  CB   . PRO A 1 50 ? 9.441   -5.132  -0.102  1.00 0.00 ? 50  PRO A CB   6  
ATOM   6534  C  CG   . PRO A 1 50 ? 10.495  -5.808  -0.909  1.00 0.00 ? 50  PRO A CG   6  
ATOM   6535  C  CD   . PRO A 1 50 ? 10.786  -4.889  -2.063  1.00 0.00 ? 50  PRO A CD   6  
ATOM   6536  H  HA   . PRO A 1 50 ? 8.803   -3.088  -0.281  1.00 0.00 ? 50  PRO A HA   6  
ATOM   6537  H  HB2  . PRO A 1 50 ? 9.502   -5.409  0.941   1.00 0.00 ? 50  PRO A HB2  6  
ATOM   6538  H  HB3  . PRO A 1 50 ? 8.454   -5.350  -0.481  1.00 0.00 ? 50  PRO A HB3  6  
ATOM   6539  H  HG2  . PRO A 1 50 ? 11.382  -5.950  -0.310  1.00 0.00 ? 50  PRO A HG2  6  
ATOM   6540  H  HG3  . PRO A 1 50 ? 10.128  -6.757  -1.270  1.00 0.00 ? 50  PRO A HG3  6  
ATOM   6541  H  HD2  . PRO A 1 50 ? 11.831  -4.939  -2.332  1.00 0.00 ? 50  PRO A HD2  6  
ATOM   6542  H  HD3  . PRO A 1 50 ? 10.164  -5.139  -2.910  1.00 0.00 ? 50  PRO A HD3  6  
ATOM   6543  N  N    . PHE A 1 51 ? 9.947   -2.427  1.837   1.00 0.00 ? 51  PHE A N    6  
ATOM   6544  C  CA   . PHE A 1 51 ? 10.645  -1.892  3.000   1.00 0.00 ? 51  PHE A CA   6  
ATOM   6545  C  C    . PHE A 1 51 ? 10.698  -2.923  4.124   1.00 0.00 ? 51  PHE A C    6  
ATOM   6546  O  O    . PHE A 1 51 ? 9.681   -3.483  4.535   1.00 0.00 ? 51  PHE A O    6  
ATOM   6547  C  CB   . PHE A 1 51 ? 9.956   -0.619  3.494   1.00 0.00 ? 51  PHE A CB   6  
ATOM   6548  C  CG   . PHE A 1 51 ? 9.554   0.313   2.386   1.00 0.00 ? 51  PHE A CG   6  
ATOM   6549  C  CD1  . PHE A 1 51 ? 10.513  0.960   1.624   1.00 0.00 ? 51  PHE A CD1  6  
ATOM   6550  C  CD2  . PHE A 1 51 ? 8.216   0.541   2.106   1.00 0.00 ? 51  PHE A CD2  6  
ATOM   6551  C  CE1  . PHE A 1 51 ? 10.146  1.818   0.605   1.00 0.00 ? 51  PHE A CE1  6  
ATOM   6552  C  CE2  . PHE A 1 51 ? 7.843   1.398   1.088   1.00 0.00 ? 51  PHE A CE2  6  
ATOM   6553  C  CZ   . PHE A 1 51 ? 8.809   2.036   0.336   1.00 0.00 ? 51  PHE A CZ   6  
ATOM   6554  H  H    . PHE A 1 51 ? 8.987   -2.257  1.734   1.00 0.00 ? 51  PHE A H    6  
ATOM   6555  H  HA   . PHE A 1 51 ? 11.653  -1.653  2.700   1.00 0.00 ? 51  PHE A HA   6  
ATOM   6556  H  HB2  . PHE A 1 51 ? 9.064   -0.888  4.039   1.00 0.00 ? 51  PHE A HB2  6  
ATOM   6557  H  HB3  . PHE A 1 51 ? 10.627  -0.086  4.150   1.00 0.00 ? 51  PHE A HB3  6  
ATOM   6558  H  HD1  . PHE A 1 51 ? 11.559  0.789   1.833   1.00 0.00 ? 51  PHE A HD1  6  
ATOM   6559  H  HD2  . PHE A 1 51 ? 7.459   0.042   2.695   1.00 0.00 ? 51  PHE A HD2  6  
ATOM   6560  H  HE1  . PHE A 1 51 ? 10.904  2.315   0.018   1.00 0.00 ? 51  PHE A HE1  6  
ATOM   6561  H  HE2  . PHE A 1 51 ? 6.796   1.567   0.881   1.00 0.00 ? 51  PHE A HE2  6  
ATOM   6562  H  HZ   . PHE A 1 51 ? 8.520   2.707   -0.460  1.00 0.00 ? 51  PHE A HZ   6  
ATOM   6563  N  N    . PRO A 1 52 ? 11.912  -3.182  4.633   1.00 0.00 ? 52  PRO A N    6  
ATOM   6564  C  CA   . PRO A 1 52 ? 12.127  -4.146  5.715   1.00 0.00 ? 52  PRO A CA   6  
ATOM   6565  C  C    . PRO A 1 52 ? 11.565  -3.659  7.046   1.00 0.00 ? 52  PRO A C    6  
ATOM   6566  O  O    . PRO A 1 52 ? 11.188  -2.497  7.200   1.00 0.00 ? 52  PRO A O    6  
ATOM   6567  C  CB   . PRO A 1 52 ? 13.652  -4.262  5.789   1.00 0.00 ? 52  PRO A CB   6  
ATOM   6568  C  CG   . PRO A 1 52 ? 14.156  -2.971  5.242   1.00 0.00 ? 52  PRO A CG   6  
ATOM   6569  C  CD   . PRO A 1 52 ? 13.167  -2.552  4.191   1.00 0.00 ? 52  PRO A CD   6  
ATOM   6570  H  HA   . PRO A 1 52 ? 11.703  -5.111  5.478   1.00 0.00 ? 52  PRO A HA   6  
ATOM   6571  H  HB2  . PRO A 1 52 ? 13.956  -4.402  6.817   1.00 0.00 ? 52  PRO A HB2  6  
ATOM   6572  H  HB3  . PRO A 1 52 ? 13.982  -5.099  5.192   1.00 0.00 ? 52  PRO A HB3  6  
ATOM   6573  H  HG2  . PRO A 1 52 ? 14.204  -2.233  6.028   1.00 0.00 ? 52  PRO A HG2  6  
ATOM   6574  H  HG3  . PRO A 1 52 ? 15.132  -3.115  4.802   1.00 0.00 ? 52  PRO A HG3  6  
ATOM   6575  H  HD2  . PRO A 1 52 ? 13.072  -1.476  4.169   1.00 0.00 ? 52  PRO A HD2  6  
ATOM   6576  H  HD3  . PRO A 1 52 ? 13.465  -2.925  3.222   1.00 0.00 ? 52  PRO A HD3  6  
ATOM   6577  N  N    . PRO A 1 53 ? 11.508  -4.566  8.033   1.00 0.00 ? 53  PRO A N    6  
ATOM   6578  C  CA   . PRO A 1 53 ? 10.994  -4.250  9.369   1.00 0.00 ? 53  PRO A CA   6  
ATOM   6579  C  C    . PRO A 1 53 ? 11.924  -3.323  10.144  1.00 0.00 ? 53  PRO A C    6  
ATOM   6580  O  O    . PRO A 1 53 ? 12.959  -3.749  10.652  1.00 0.00 ? 53  PRO A O    6  
ATOM   6581  C  CB   . PRO A 1 53 ? 10.914  -5.619  10.051  1.00 0.00 ? 53  PRO A CB   6  
ATOM   6582  C  CG   . PRO A 1 53 ? 11.925  -6.453  9.343   1.00 0.00 ? 53  PRO A CG   6  
ATOM   6583  C  CD   . PRO A 1 53 ? 11.940  -5.969  7.920   1.00 0.00 ? 53  PRO A CD   6  
ATOM   6584  H  HA   . PRO A 1 53 ? 10.008  -3.812  9.322   1.00 0.00 ? 53  PRO A HA   6  
ATOM   6585  H  HB2  . PRO A 1 53 ? 11.151  -5.515  11.100  1.00 0.00 ? 53  PRO A HB2  6  
ATOM   6586  H  HB3  . PRO A 1 53 ? 9.920   -6.024  9.938   1.00 0.00 ? 53  PRO A HB3  6  
ATOM   6587  H  HG2  . PRO A 1 53 ? 12.896  -6.317  9.796   1.00 0.00 ? 53  PRO A HG2  6  
ATOM   6588  H  HG3  . PRO A 1 53 ? 11.635  -7.493  9.382   1.00 0.00 ? 53  PRO A HG3  6  
ATOM   6589  H  HD2  . PRO A 1 53 ? 12.937  -6.033  7.510   1.00 0.00 ? 53  PRO A HD2  6  
ATOM   6590  H  HD3  . PRO A 1 53 ? 11.246  -6.539  7.320   1.00 0.00 ? 53  PRO A HD3  6  
ATOM   6591  N  N    . GLY A 1 54 ? 11.546  -2.051  10.230  1.00 0.00 ? 54  GLY A N    6  
ATOM   6592  C  CA   . GLY A 1 54 ? 12.357  -1.083  10.945  1.00 0.00 ? 54  GLY A CA   6  
ATOM   6593  C  C    . GLY A 1 54 ? 12.697  0.127   10.098  1.00 0.00 ? 54  GLY A C    6  
ATOM   6594  O  O    . GLY A 1 54 ? 12.342  1.254   10.442  1.00 0.00 ? 54  GLY A O    6  
ATOM   6595  H  H    . GLY A 1 54 ? 10.710  -1.767  9.805   1.00 0.00 ? 54  GLY A H    6  
ATOM   6596  H  HA2  . GLY A 1 54 ? 11.819  -0.756  11.822  1.00 0.00 ? 54  GLY A HA2  6  
ATOM   6597  H  HA3  . GLY A 1 54 ? 13.276  -1.560  11.255  1.00 0.00 ? 54  GLY A HA3  6  
ATOM   6598  N  N    . ASP A 1 55 ? 13.388  -0.106  8.987   1.00 0.00 ? 55  ASP A N    6  
ATOM   6599  C  CA   . ASP A 1 55 ? 13.778  0.975   8.088   1.00 0.00 ? 55  ASP A CA   6  
ATOM   6600  C  C    . ASP A 1 55 ? 12.648  1.989   7.937   1.00 0.00 ? 55  ASP A C    6  
ATOM   6601  O  O    . ASP A 1 55 ? 11.476  1.621   7.862   1.00 0.00 ? 55  ASP A O    6  
ATOM   6602  C  CB   . ASP A 1 55 ? 14.162  0.414   6.718   1.00 0.00 ? 55  ASP A CB   6  
ATOM   6603  C  CG   . ASP A 1 55 ? 14.739  1.473   5.800   1.00 0.00 ? 55  ASP A CG   6  
ATOM   6604  O  OD1  . ASP A 1 55 ? 15.611  2.242   6.255   1.00 0.00 ? 55  ASP A OD1  6  
ATOM   6605  O  OD2  . ASP A 1 55 ? 14.319  1.532   4.626   1.00 0.00 ? 55  ASP A OD2  6  
ATOM   6606  H  H    . ASP A 1 55 ? 13.642  -1.026  8.766   1.00 0.00 ? 55  ASP A H    6  
ATOM   6607  H  HA   . ASP A 1 55 ? 14.635  1.471   8.517   1.00 0.00 ? 55  ASP A HA   6  
ATOM   6608  H  HB2  . ASP A 1 55 ? 14.902  -0.363  6.850   1.00 0.00 ? 55  ASP A HB2  6  
ATOM   6609  H  HB3  . ASP A 1 55 ? 13.285  -0.006  6.249   1.00 0.00 ? 55  ASP A HB3  6  
ATOM   6610  N  N    . ARG A 1 56 ? 13.010  3.267   7.894   1.00 0.00 ? 56  ARG A N    6  
ATOM   6611  C  CA   . ARG A 1 56 ? 12.027  4.335   7.754   1.00 0.00 ? 56  ARG A CA   6  
ATOM   6612  C  C    . ARG A 1 56 ? 11.642  4.532   6.290   1.00 0.00 ? 56  ARG A C    6  
ATOM   6613  O  O    . ARG A 1 56 ? 12.382  4.145   5.386   1.00 0.00 ? 56  ARG A O    6  
ATOM   6614  C  CB   . ARG A 1 56 ? 12.577  5.642   8.328   1.00 0.00 ? 56  ARG A CB   6  
ATOM   6615  C  CG   . ARG A 1 56 ? 12.289  5.825   9.810   1.00 0.00 ? 56  ARG A CG   6  
ATOM   6616  C  CD   . ARG A 1 56 ? 13.063  4.825   10.655  1.00 0.00 ? 56  ARG A CD   6  
ATOM   6617  N  NE   . ARG A 1 56 ? 13.299  5.319   12.009  1.00 0.00 ? 56  ARG A NE   6  
ATOM   6618  C  CZ   . ARG A 1 56 ? 13.601  4.533   13.036  1.00 0.00 ? 56  ARG A CZ   6  
ATOM   6619  N  NH1  . ARG A 1 56 ? 13.703  3.222   12.864  1.00 0.00 ? 56  ARG A NH1  6  
ATOM   6620  N  NH2  . ARG A 1 56 ? 13.801  5.058   14.238  1.00 0.00 ? 56  ARG A NH2  6  
ATOM   6621  H  H    . ARG A 1 56 ? 13.960  3.498   7.958   1.00 0.00 ? 56  ARG A H    6  
ATOM   6622  H  HA   . ARG A 1 56 ? 11.146  4.050   8.310   1.00 0.00 ? 56  ARG A HA   6  
ATOM   6623  H  HB2  . ARG A 1 56 ? 13.647  5.662   8.187   1.00 0.00 ? 56  ARG A HB2  6  
ATOM   6624  H  HB3  . ARG A 1 56 ? 12.136  6.469   7.794   1.00 0.00 ? 56  ARG A HB3  6  
ATOM   6625  H  HG2  . ARG A 1 56 ? 12.576  6.824   10.102  1.00 0.00 ? 56  ARG A HG2  6  
ATOM   6626  H  HG3  . ARG A 1 56 ? 11.232  5.687   9.981   1.00 0.00 ? 56  ARG A HG3  6  
ATOM   6627  H  HD2  . ARG A 1 56 ? 12.497  3.907   10.711  1.00 0.00 ? 56  ARG A HD2  6  
ATOM   6628  H  HD3  . ARG A 1 56 ? 14.013  4.633   10.181  1.00 0.00 ? 56  ARG A HD3  6  
ATOM   6629  H  HE   . ARG A 1 56 ? 13.228  6.285   12.158  1.00 0.00 ? 56  ARG A HE   6  
ATOM   6630  H  HH11 . ARG A 1 56 ? 13.554  2.824   11.959  1.00 0.00 ? 56  ARG A HH11 6  
ATOM   6631  H  HH12 . ARG A 1 56 ? 13.932  2.632   13.639  1.00 0.00 ? 56  ARG A HH12 6  
ATOM   6632  H  HH21 . ARG A 1 56 ? 13.725  6.045   14.371  1.00 0.00 ? 56  ARG A HH21 6  
ATOM   6633  H  HH22 . ARG A 1 56 ? 14.028  4.465   15.010  1.00 0.00 ? 56  ARG A HH22 6  
ATOM   6634  N  N    . VAL A 1 57 ? 10.480  5.137   6.065   1.00 0.00 ? 57  VAL A N    6  
ATOM   6635  C  CA   . VAL A 1 57 ? 9.997   5.386   4.712   1.00 0.00 ? 57  VAL A CA   6  
ATOM   6636  C  C    . VAL A 1 57 ? 9.641   6.855   4.518   1.00 0.00 ? 57  VAL A C    6  
ATOM   6637  O  O    . VAL A 1 57 ? 8.995   7.467   5.370   1.00 0.00 ? 57  VAL A O    6  
ATOM   6638  C  CB   . VAL A 1 57 ? 8.764   4.522   4.388   1.00 0.00 ? 57  VAL A CB   6  
ATOM   6639  C  CG1  . VAL A 1 57 ? 8.281   4.791   2.972   1.00 0.00 ? 57  VAL A CG1  6  
ATOM   6640  C  CG2  . VAL A 1 57 ? 9.082   3.047   4.581   1.00 0.00 ? 57  VAL A CG2  6  
ATOM   6641  H  H    . VAL A 1 57 ? 9.935   5.422   6.828   1.00 0.00 ? 57  VAL A H    6  
ATOM   6642  H  HA   . VAL A 1 57 ? 10.786  5.122   4.023   1.00 0.00 ? 57  VAL A HA   6  
ATOM   6643  H  HB   . VAL A 1 57 ? 7.972   4.791   5.072   1.00 0.00 ? 57  VAL A HB   6  
ATOM   6644  H  HG11 . VAL A 1 57 ? 8.902   5.549   2.518   1.00 0.00 ? 57  VAL A HG11 6  
ATOM   6645  H  HG12 . VAL A 1 57 ? 8.339   3.881   2.392   1.00 0.00 ? 57  VAL A HG12 6  
ATOM   6646  H  HG13 . VAL A 1 57 ? 7.257   5.135   3.000   1.00 0.00 ? 57  VAL A HG13 6  
ATOM   6647  H  HG21 . VAL A 1 57 ? 8.613   2.473   3.796   1.00 0.00 ? 57  VAL A HG21 6  
ATOM   6648  H  HG22 . VAL A 1 57 ? 10.152  2.901   4.545   1.00 0.00 ? 57  VAL A HG22 6  
ATOM   6649  H  HG23 . VAL A 1 57 ? 8.707   2.720   5.539   1.00 0.00 ? 57  VAL A HG23 6  
ATOM   6650  N  N    . THR A 1 58 ? 10.065  7.417   3.390   1.00 0.00 ? 58  THR A N    6  
ATOM   6651  C  CA   . THR A 1 58 ? 9.791   8.816   3.083   1.00 0.00 ? 58  THR A CA   6  
ATOM   6652  C  C    . THR A 1 58 ? 8.581   8.950   2.165   1.00 0.00 ? 58  THR A C    6  
ATOM   6653  O  O    . THR A 1 58 ? 8.537   8.353   1.089   1.00 0.00 ? 58  THR A O    6  
ATOM   6654  C  CB   . THR A 1 58 ? 11.004  9.493   2.419   1.00 0.00 ? 58  THR A CB   6  
ATOM   6655  O  OG1  . THR A 1 58 ? 12.129  9.460   3.304   1.00 0.00 ? 58  THR A OG1  6  
ATOM   6656  C  CG2  . THR A 1 58 ? 10.685  10.934  2.050   1.00 0.00 ? 58  THR A CG2  6  
ATOM   6657  H  H    . THR A 1 58 ? 10.574  6.878   2.751   1.00 0.00 ? 58  THR A H    6  
ATOM   6658  H  HA   . THR A 1 58 ? 9.584   9.327   4.013   1.00 0.00 ? 58  THR A HA   6  
ATOM   6659  H  HB   . THR A 1 58 ? 11.249  8.952   1.516   1.00 0.00 ? 58  THR A HB   6  
ATOM   6660  H  HG1  . THR A 1 58 ? 12.244  10.323  3.709   1.00 0.00 ? 58  THR A HG1  6  
ATOM   6661  H  HG21 . THR A 1 58 ? 11.524  11.366  1.526   1.00 0.00 ? 58  THR A HG21 6  
ATOM   6662  H  HG22 . THR A 1 58 ? 10.490  11.501  2.949   1.00 0.00 ? 58  THR A HG22 6  
ATOM   6663  H  HG23 . THR A 1 58 ? 9.813   10.957  1.414   1.00 0.00 ? 58  THR A HG23 6  
ATOM   6664  N  N    . PHE A 1 59 ? 7.602   9.739   2.595   1.00 0.00 ? 59  PHE A N    6  
ATOM   6665  C  CA   . PHE A 1 59 ? 6.392   9.952   1.811   1.00 0.00 ? 59  PHE A CA   6  
ATOM   6666  C  C    . PHE A 1 59 ? 6.557   11.140  0.867   1.00 0.00 ? 59  PHE A C    6  
ATOM   6667  O  O    . PHE A 1 59 ? 6.662   12.284  1.306   1.00 0.00 ? 59  PHE A O    6  
ATOM   6668  C  CB   . PHE A 1 59 ? 5.194   10.183  2.735   1.00 0.00 ? 59  PHE A CB   6  
ATOM   6669  C  CG   . PHE A 1 59 ? 5.513   11.041  3.926   1.00 0.00 ? 59  PHE A CG   6  
ATOM   6670  C  CD1  . PHE A 1 59 ? 5.459   12.422  3.836   1.00 0.00 ? 59  PHE A CD1  6  
ATOM   6671  C  CD2  . PHE A 1 59 ? 5.866   10.465  5.136   1.00 0.00 ? 59  PHE A CD2  6  
ATOM   6672  C  CE1  . PHE A 1 59 ? 5.752   13.214  4.930   1.00 0.00 ? 59  PHE A CE1  6  
ATOM   6673  C  CE2  . PHE A 1 59 ? 6.158   11.252  6.234   1.00 0.00 ? 59  PHE A CE2  6  
ATOM   6674  C  CZ   . PHE A 1 59 ? 6.103   12.628  6.130   1.00 0.00 ? 59  PHE A CZ   6  
ATOM   6675  H  H    . PHE A 1 59 ? 7.696   10.188  3.462   1.00 0.00 ? 59  PHE A H    6  
ATOM   6676  H  HA   . PHE A 1 59 ? 6.217   9.063   1.225   1.00 0.00 ? 59  PHE A HA   6  
ATOM   6677  H  HB2  . PHE A 1 59 ? 4.407   10.669  2.178   1.00 0.00 ? 59  PHE A HB2  6  
ATOM   6678  H  HB3  . PHE A 1 59 ? 4.838   9.230   3.096   1.00 0.00 ? 59  PHE A HB3  6  
ATOM   6679  H  HD1  . PHE A 1 59 ? 5.185   12.882  2.897   1.00 0.00 ? 59  PHE A HD1  6  
ATOM   6680  H  HD2  . PHE A 1 59 ? 5.911   9.389   5.219   1.00 0.00 ? 59  PHE A HD2  6  
ATOM   6681  H  HE1  . PHE A 1 59 ? 5.707   14.290  4.846   1.00 0.00 ? 59  PHE A HE1  6  
ATOM   6682  H  HE2  . PHE A 1 59 ? 6.433   10.791  7.171   1.00 0.00 ? 59  PHE A HE2  6  
ATOM   6683  H  HZ   . PHE A 1 59 ? 6.330   13.245  6.987   1.00 0.00 ? 59  PHE A HZ   6  
ATOM   6684  N  N    . ASN A 1 60 ? 6.578   10.857  -0.431  1.00 0.00 ? 60  ASN A N    6  
ATOM   6685  C  CA   . ASN A 1 60 ? 6.732   11.901  -1.438  1.00 0.00 ? 60  ASN A CA   6  
ATOM   6686  C  C    . ASN A 1 60 ? 5.578   11.869  -2.436  1.00 0.00 ? 60  ASN A C    6  
ATOM   6687  O  O    . ASN A 1 60 ? 5.606   11.117  -3.409  1.00 0.00 ? 60  ASN A O    6  
ATOM   6688  C  CB   . ASN A 1 60 ? 8.063   11.737  -2.175  1.00 0.00 ? 60  ASN A CB   6  
ATOM   6689  C  CG   . ASN A 1 60 ? 8.479   10.284  -2.298  1.00 0.00 ? 60  ASN A CG   6  
ATOM   6690  O  OD1  . ASN A 1 60 ? 9.175   9.751   -1.433  1.00 0.00 ? 60  ASN A OD1  6  
ATOM   6691  N  ND2  . ASN A 1 60 ? 8.055   9.637   -3.377  1.00 0.00 ? 60  ASN A ND2  6  
ATOM   6692  H  H    . ASN A 1 60 ? 6.489   9.925   -0.720  1.00 0.00 ? 60  ASN A H    6  
ATOM   6693  H  HA   . ASN A 1 60 ? 6.727   12.854  -0.930  1.00 0.00 ? 60  ASN A HA   6  
ATOM   6694  H  HB2  . ASN A 1 60 ? 7.970   12.150  -3.169  1.00 0.00 ? 60  ASN A HB2  6  
ATOM   6695  H  HB3  . ASN A 1 60 ? 8.833   12.269  -1.638  1.00 0.00 ? 60  ASN A HB3  6  
ATOM   6696  H  HD21 . ASN A 1 60 ? 7.505   10.125  -4.024  1.00 0.00 ? 60  ASN A HD21 6  
ATOM   6697  H  HD22 . ASN A 1 60 ? 8.309   8.696   -3.481  1.00 0.00 ? 60  ASN A HD22 6  
ATOM   6698  N  N    . GLY A 1 61 ? 4.563   12.691  -2.186  1.00 0.00 ? 61  GLY A N    6  
ATOM   6699  C  CA   . GLY A 1 61 ? 3.414   12.742  -3.071  1.00 0.00 ? 61  GLY A CA   6  
ATOM   6700  C  C    . GLY A 1 61 ? 2.399   11.659  -2.765  1.00 0.00 ? 61  GLY A C    6  
ATOM   6701  O  O    . GLY A 1 61 ? 1.910   11.556  -1.639  1.00 0.00 ? 61  GLY A O    6  
ATOM   6702  H  H    . GLY A 1 61 ? 4.595   13.269  -1.395  1.00 0.00 ? 61  GLY A H    6  
ATOM   6703  H  HA2  . GLY A 1 61 ? 2.939   13.706  -2.971  1.00 0.00 ? 61  GLY A HA2  6  
ATOM   6704  H  HA3  . GLY A 1 61 ? 3.754   12.623  -4.090  1.00 0.00 ? 61  GLY A HA3  6  
ATOM   6705  N  N    . LYS A 1 62 ? 2.078   10.850  -3.768  1.00 0.00 ? 62  LYS A N    6  
ATOM   6706  C  CA   . LYS A 1 62 ? 1.113   9.769   -3.602  1.00 0.00 ? 62  LYS A CA   6  
ATOM   6707  C  C    . LYS A 1 62 ? 1.792   8.511   -3.070  1.00 0.00 ? 62  LYS A C    6  
ATOM   6708  O  O    . LYS A 1 62 ? 1.301   7.878   -2.136  1.00 0.00 ? 62  LYS A O    6  
ATOM   6709  C  CB   . LYS A 1 62 ? 0.423   9.465   -4.933  1.00 0.00 ? 62  LYS A CB   6  
ATOM   6710  C  CG   . LYS A 1 62 ? -0.639  10.482  -5.314  1.00 0.00 ? 62  LYS A CG   6  
ATOM   6711  C  CD   . LYS A 1 62 ? -0.049  11.628  -6.120  1.00 0.00 ? 62  LYS A CD   6  
ATOM   6712  C  CE   . LYS A 1 62 ? 0.190   11.227  -7.567  1.00 0.00 ? 62  LYS A CE   6  
ATOM   6713  N  NZ   . LYS A 1 62 ? 0.572   12.393  -8.410  1.00 0.00 ? 62  LYS A NZ   6  
ATOM   6714  H  H    . LYS A 1 62 ? 2.502   10.982  -4.643  1.00 0.00 ? 62  LYS A H    6  
ATOM   6715  H  HA   . LYS A 1 62 ? 0.372   10.093  -2.887  1.00 0.00 ? 62  LYS A HA   6  
ATOM   6716  H  HB2  . LYS A 1 62 ? 1.168   9.443   -5.715  1.00 0.00 ? 62  LYS A HB2  6  
ATOM   6717  H  HB3  . LYS A 1 62 ? -0.047  8.494   -4.868  1.00 0.00 ? 62  LYS A HB3  6  
ATOM   6718  H  HG2  . LYS A 1 62 ? -1.398  9.993   -5.907  1.00 0.00 ? 62  LYS A HG2  6  
ATOM   6719  H  HG3  . LYS A 1 62 ? -1.083  10.879  -4.413  1.00 0.00 ? 62  LYS A HG3  6  
ATOM   6720  H  HD2  . LYS A 1 62 ? -0.735  12.462  -6.098  1.00 0.00 ? 62  LYS A HD2  6  
ATOM   6721  H  HD3  . LYS A 1 62 ? 0.892   11.922  -5.676  1.00 0.00 ? 62  LYS A HD3  6  
ATOM   6722  H  HE2  . LYS A 1 62 ? 0.984   10.496  -7.598  1.00 0.00 ? 62  LYS A HE2  6  
ATOM   6723  H  HE3  . LYS A 1 62 ? -0.716  10.790  -7.960  1.00 0.00 ? 62  LYS A HE3  6  
ATOM   6724  H  HZ1  . LYS A 1 62 ? 1.547   12.281  -8.755  1.00 0.00 ? 62  LYS A HZ1  6  
ATOM   6725  H  HZ2  . LYS A 1 62 ? 0.512   13.270  -7.855  1.00 0.00 ? 62  LYS A HZ2  6  
ATOM   6726  H  HZ3  . LYS A 1 62 ? -0.067  12.468  -9.227  1.00 0.00 ? 62  LYS A HZ3  6  
ATOM   6727  N  N    . GLU A 1 63 ? 2.923   8.155   -3.671  1.00 0.00 ? 63  GLU A N    6  
ATOM   6728  C  CA   . GLU A 1 63 ? 3.669   6.972   -3.257  1.00 0.00 ? 63  GLU A CA   6  
ATOM   6729  C  C    . GLU A 1 63 ? 4.801   7.348   -2.305  1.00 0.00 ? 63  GLU A C    6  
ATOM   6730  O  O    . GLU A 1 63 ? 5.075   8.529   -2.086  1.00 0.00 ? 63  GLU A O    6  
ATOM   6731  C  CB   . GLU A 1 63 ? 4.234   6.244   -4.478  1.00 0.00 ? 63  GLU A CB   6  
ATOM   6732  C  CG   . GLU A 1 63 ? 3.168   5.753   -5.442  1.00 0.00 ? 63  GLU A CG   6  
ATOM   6733  C  CD   . GLU A 1 63 ? 3.694   4.716   -6.415  1.00 0.00 ? 63  GLU A CD   6  
ATOM   6734  O  OE1  . GLU A 1 63 ? 4.709   4.063   -6.096  1.00 0.00 ? 63  GLU A OE1  6  
ATOM   6735  O  OE2  . GLU A 1 63 ? 3.089   4.557   -7.496  1.00 0.00 ? 63  GLU A OE2  6  
ATOM   6736  H  H    . GLU A 1 63 ? 3.264   8.700   -4.411  1.00 0.00 ? 63  GLU A H    6  
ATOM   6737  H  HA   . GLU A 1 63 ? 2.986   6.314   -2.741  1.00 0.00 ? 63  GLU A HA   6  
ATOM   6738  H  HB2  . GLU A 1 63 ? 4.890   6.917   -5.011  1.00 0.00 ? 63  GLU A HB2  6  
ATOM   6739  H  HB3  . GLU A 1 63 ? 4.805   5.392   -4.141  1.00 0.00 ? 63  GLU A HB3  6  
ATOM   6740  H  HG2  . GLU A 1 63 ? 2.361   5.314   -4.873  1.00 0.00 ? 63  GLU A HG2  6  
ATOM   6741  H  HG3  . GLU A 1 63 ? 2.793   6.595   -6.004  1.00 0.00 ? 63  GLU A HG3  6  
ATOM   6742  N  N    . CYS A 1 64 ? 5.454   6.337   -1.744  1.00 0.00 ? 64  CYS A N    6  
ATOM   6743  C  CA   . CYS A 1 64 ? 6.557   6.561   -0.815  1.00 0.00 ? 64  CYS A CA   6  
ATOM   6744  C  C    . CYS A 1 64 ? 7.844   5.930   -1.336  1.00 0.00 ? 64  CYS A C    6  
ATOM   6745  O  O    . CYS A 1 64 ? 7.832   4.818   -1.863  1.00 0.00 ? 64  CYS A O    6  
ATOM   6746  C  CB   . CYS A 1 64 ? 6.214   5.989   0.561   1.00 0.00 ? 64  CYS A CB   6  
ATOM   6747  S  SG   . CYS A 1 64 ? 4.698   6.659   1.283   1.00 0.00 ? 64  CYS A SG   6  
ATOM   6748  H  H    . CYS A 1 64 ? 5.190   5.418   -1.959  1.00 0.00 ? 64  CYS A H    6  
ATOM   6749  H  HA   . CYS A 1 64 ? 6.703   7.627   -0.727  1.00 0.00 ? 64  CYS A HA   6  
ATOM   6750  H  HB2  . CYS A 1 64 ? 6.093   4.919   0.479   1.00 0.00 ? 64  CYS A HB2  6  
ATOM   6751  H  HB3  . CYS A 1 64 ? 7.025   6.201   1.242   1.00 0.00 ? 64  CYS A HB3  6  
ATOM   6752  H  HG   . CYS A 1 64 ? 3.795   5.690   1.309   1.00 0.00 ? 64  CYS A HG   6  
ATOM   6753  N  N    . MET A 1 65 ? 8.952   6.648   -1.186  1.00 0.00 ? 65  MET A N    6  
ATOM   6754  C  CA   . MET A 1 65 ? 10.247  6.157   -1.642  1.00 0.00 ? 65  MET A CA   6  
ATOM   6755  C  C    . MET A 1 65 ? 11.109  5.720   -0.462  1.00 0.00 ? 65  MET A C    6  
ATOM   6756  O  O    . MET A 1 65 ? 10.948  6.215   0.655   1.00 0.00 ? 65  MET A O    6  
ATOM   6757  C  CB   . MET A 1 65 ? 10.972  7.239   -2.445  1.00 0.00 ? 65  MET A CB   6  
ATOM   6758  C  CG   . MET A 1 65 ? 10.558  7.290   -3.907  1.00 0.00 ? 65  MET A CG   6  
ATOM   6759  S  SD   . MET A 1 65 ? 10.616  8.959   -4.587  1.00 0.00 ? 65  MET A SD   6  
ATOM   6760  C  CE   . MET A 1 65 ? 12.158  9.553   -3.896  1.00 0.00 ? 65  MET A CE   6  
ATOM   6761  H  H    . MET A 1 65 ? 8.898   7.528   -0.758  1.00 0.00 ? 65  MET A H    6  
ATOM   6762  H  HA   . MET A 1 65 ? 10.072  5.304   -2.280  1.00 0.00 ? 65  MET A HA   6  
ATOM   6763  H  HB2  . MET A 1 65 ? 10.765  8.201   -2.000  1.00 0.00 ? 65  MET A HB2  6  
ATOM   6764  H  HB3  . MET A 1 65 ? 12.035  7.052   -2.401  1.00 0.00 ? 65  MET A HB3  6  
ATOM   6765  H  HG2  . MET A 1 65 ? 11.224  6.661   -4.479  1.00 0.00 ? 65  MET A HG2  6  
ATOM   6766  H  HG3  . MET A 1 65 ? 9.549   6.915   -3.994  1.00 0.00 ? 65  MET A HG3  6  
ATOM   6767  H  HE1  . MET A 1 65 ? 12.263  10.608  -4.104  1.00 0.00 ? 65  MET A HE1  6  
ATOM   6768  H  HE2  . MET A 1 65 ? 12.157  9.395   -2.827  1.00 0.00 ? 65  MET A HE2  6  
ATOM   6769  H  HE3  . MET A 1 65 ? 12.982  9.014   -4.340  1.00 0.00 ? 65  MET A HE3  6  
ATOM   6770  N  N    . CYS A 1 66 ? 12.025  4.792   -0.715  1.00 0.00 ? 66  CYS A N    6  
ATOM   6771  C  CA   . CYS A 1 66 ? 12.912  4.287   0.326   1.00 0.00 ? 66  CYS A CA   6  
ATOM   6772  C  C    . CYS A 1 66 ? 13.930  5.349   0.735   1.00 0.00 ? 66  CYS A C    6  
ATOM   6773  O  O    . CYS A 1 66 ? 13.892  6.478   0.247   1.00 0.00 ? 66  CYS A O    6  
ATOM   6774  C  CB   . CYS A 1 66 ? 13.637  3.030   -0.158  1.00 0.00 ? 66  CYS A CB   6  
ATOM   6775  S  SG   . CYS A 1 66 ? 14.772  3.316   -1.553  1.00 0.00 ? 66  CYS A SG   6  
ATOM   6776  H  H    . CYS A 1 66 ? 12.106  4.436   -1.626  1.00 0.00 ? 66  CYS A H    6  
ATOM   6777  H  HA   . CYS A 1 66 ? 12.308  4.036   1.184   1.00 0.00 ? 66  CYS A HA   6  
ATOM   6778  H  HB2  . CYS A 1 66 ? 14.217  2.622   0.658   1.00 0.00 ? 66  CYS A HB2  6  
ATOM   6779  H  HB3  . CYS A 1 66 ? 12.905  2.300   -0.472  1.00 0.00 ? 66  CYS A HB3  6  
ATOM   6780  N  N    . GLN A 1 67 ? 14.837  4.976   1.632   1.00 0.00 ? 67  GLN A N    6  
ATOM   6781  C  CA   . GLN A 1 67 ? 15.864  5.897   2.106   1.00 0.00 ? 67  GLN A CA   6  
ATOM   6782  C  C    . GLN A 1 67 ? 16.904  6.157   1.021   1.00 0.00 ? 67  GLN A C    6  
ATOM   6783  O  O    . GLN A 1 67 ? 17.225  7.306   0.717   1.00 0.00 ? 67  GLN A O    6  
ATOM   6784  C  CB   . GLN A 1 67 ? 16.543  5.335   3.356   1.00 0.00 ? 67  GLN A CB   6  
ATOM   6785  C  CG   . GLN A 1 67 ? 15.704  5.470   4.617   1.00 0.00 ? 67  GLN A CG   6  
ATOM   6786  C  CD   . GLN A 1 67 ? 15.546  6.910   5.062   1.00 0.00 ? 67  GLN A CD   6  
ATOM   6787  O  OE1  . GLN A 1 67 ? 16.523  7.578   5.400   1.00 0.00 ? 67  GLN A OE1  6  
ATOM   6788  N  NE2  . GLN A 1 67 ? 14.310  7.397   5.064   1.00 0.00 ? 67  GLN A NE2  6  
ATOM   6789  H  H    . GLN A 1 67 ? 14.815  4.063   1.983   1.00 0.00 ? 67  GLN A H    6  
ATOM   6790  H  HA   . GLN A 1 67 ? 15.382  6.829   2.357   1.00 0.00 ? 67  GLN A HA   6  
ATOM   6791  H  HB2  . GLN A 1 67 ? 16.752  4.288   3.199   1.00 0.00 ? 67  GLN A HB2  6  
ATOM   6792  H  HB3  . GLN A 1 67 ? 17.474  5.861   3.512   1.00 0.00 ? 67  GLN A HB3  6  
ATOM   6793  H  HG2  . GLN A 1 67 ? 14.724  5.058   4.427   1.00 0.00 ? 67  GLN A HG2  6  
ATOM   6794  H  HG3  . GLN A 1 67 ? 16.179  4.913   5.411   1.00 0.00 ? 67  GLN A HG3  6  
ATOM   6795  H  HE21 . GLN A 1 67 ? 13.580  6.806   4.783   1.00 0.00 ? 67  GLN A HE21 6  
ATOM   6796  H  HE22 . GLN A 1 67 ? 14.179  8.325   5.348   1.00 0.00 ? 67  GLN A HE22 6  
ATOM   6797  N  N    . LYS A 1 68 ? 17.428  5.083   0.441   1.00 0.00 ? 68  LYS A N    6  
ATOM   6798  C  CA   . LYS A 1 68 ? 18.432  5.194   -0.611  1.00 0.00 ? 68  LYS A CA   6  
ATOM   6799  C  C    . LYS A 1 68 ? 17.975  6.162   -1.698  1.00 0.00 ? 68  LYS A C    6  
ATOM   6800  O  O    . LYS A 1 68 ? 18.526  7.253   -1.844  1.00 0.00 ? 68  LYS A O    6  
ATOM   6801  C  CB   . LYS A 1 68 ? 18.715  3.820   -1.221  1.00 0.00 ? 68  LYS A CB   6  
ATOM   6802  C  CG   . LYS A 1 68 ? 19.694  3.860   -2.382  1.00 0.00 ? 68  LYS A CG   6  
ATOM   6803  C  CD   . LYS A 1 68 ? 19.845  2.495   -3.032  1.00 0.00 ? 68  LYS A CD   6  
ATOM   6804  C  CE   . LYS A 1 68 ? 20.646  2.577   -4.322  1.00 0.00 ? 68  LYS A CE   6  
ATOM   6805  N  NZ   . LYS A 1 68 ? 21.232  1.260   -4.696  1.00 0.00 ? 68  LYS A NZ   6  
ATOM   6806  H  H    . LYS A 1 68 ? 17.132  4.193   0.727   1.00 0.00 ? 68  LYS A H    6  
ATOM   6807  H  HA   . LYS A 1 68 ? 19.338  5.575   -0.165  1.00 0.00 ? 68  LYS A HA   6  
ATOM   6808  H  HB2  . LYS A 1 68 ? 19.122  3.176   -0.456  1.00 0.00 ? 68  LYS A HB2  6  
ATOM   6809  H  HB3  . LYS A 1 68 ? 17.785  3.399   -1.577  1.00 0.00 ? 68  LYS A HB3  6  
ATOM   6810  H  HG2  . LYS A 1 68 ? 19.335  4.561   -3.121  1.00 0.00 ? 68  LYS A HG2  6  
ATOM   6811  H  HG3  . LYS A 1 68 ? 20.659  4.183   -2.016  1.00 0.00 ? 68  LYS A HG3  6  
ATOM   6812  H  HD2  . LYS A 1 68 ? 20.354  1.834   -2.347  1.00 0.00 ? 68  LYS A HD2  6  
ATOM   6813  H  HD3  . LYS A 1 68 ? 18.863  2.101   -3.252  1.00 0.00 ? 68  LYS A HD3  6  
ATOM   6814  H  HE2  . LYS A 1 68 ? 19.993  2.909   -5.115  1.00 0.00 ? 68  LYS A HE2  6  
ATOM   6815  H  HE3  . LYS A 1 68 ? 21.444  3.293   -4.189  1.00 0.00 ? 68  LYS A HE3  6  
ATOM   6816  H  HZ1  . LYS A 1 68 ? 20.945  1.002   -5.661  1.00 0.00 ? 68  LYS A HZ1  6  
ATOM   6817  H  HZ2  . LYS A 1 68 ? 20.903  0.523   -4.040  1.00 0.00 ? 68  LYS A HZ2  6  
ATOM   6818  H  HZ3  . LYS A 1 68 ? 22.270  1.307   -4.655  1.00 0.00 ? 68  LYS A HZ3  6  
ATOM   6819  N  N    . CYS A 1 69 ? 16.964  5.755   -2.459  1.00 0.00 ? 69  CYS A N    6  
ATOM   6820  C  CA   . CYS A 1 69 ? 16.432  6.585   -3.533  1.00 0.00 ? 69  CYS A CA   6  
ATOM   6821  C  C    . CYS A 1 69 ? 16.368  8.049   -3.107  1.00 0.00 ? 69  CYS A C    6  
ATOM   6822  O  O    . CYS A 1 69 ? 16.704  8.946   -3.880  1.00 0.00 ? 69  CYS A O    6  
ATOM   6823  C  CB   . CYS A 1 69 ? 15.040  6.099   -3.939  1.00 0.00 ? 69  CYS A CB   6  
ATOM   6824  S  SG   . CYS A 1 69 ? 15.045  4.560   -4.913  1.00 0.00 ? 69  CYS A SG   6  
ATOM   6825  H  H    . CYS A 1 69 ? 16.566  4.874   -2.294  1.00 0.00 ? 69  CYS A H    6  
ATOM   6826  H  HA   . CYS A 1 69 ? 17.096  6.498   -4.379  1.00 0.00 ? 69  CYS A HA   6  
ATOM   6827  H  HB2  . CYS A 1 69 ? 14.455  5.922   -3.049  1.00 0.00 ? 69  CYS A HB2  6  
ATOM   6828  H  HB3  . CYS A 1 69 ? 14.559  6.863   -4.533  1.00 0.00 ? 69  CYS A HB3  6  
ATOM   6829  N  N    . SER A 1 70 ? 15.933  8.282   -1.873  1.00 0.00 ? 70  SER A N    6  
ATOM   6830  C  CA   . SER A 1 70 ? 15.821  9.637   -1.345  1.00 0.00 ? 70  SER A CA   6  
ATOM   6831  C  C    . SER A 1 70 ? 17.200  10.224  -1.059  1.00 0.00 ? 70  SER A C    6  
ATOM   6832  O  O    . SER A 1 70 ? 17.422  11.425  -1.219  1.00 0.00 ? 70  SER A O    6  
ATOM   6833  C  CB   . SER A 1 70 ? 14.977  9.642   -0.069  1.00 0.00 ? 70  SER A CB   6  
ATOM   6834  O  OG   . SER A 1 70 ? 14.278  10.866  0.075   1.00 0.00 ? 70  SER A OG   6  
ATOM   6835  H  H    . SER A 1 70 ? 15.680  7.525   -1.305  1.00 0.00 ? 70  SER A H    6  
ATOM   6836  H  HA   . SER A 1 70 ? 15.332  10.245  -2.092  1.00 0.00 ? 70  SER A HA   6  
ATOM   6837  H  HB2  . SER A 1 70 ? 14.261  8.835   -0.111  1.00 0.00 ? 70  SER A HB2  6  
ATOM   6838  H  HB3  . SER A 1 70 ? 15.623  9.506   0.787   1.00 0.00 ? 70  SER A HB3  6  
ATOM   6839  H  HG   . SER A 1 70 ? 14.118  11.036  1.006   1.00 0.00 ? 70  SER A HG   6  
ATOM   6840  N  N    . LEU A 1 71 ? 18.123  9.369   -0.633  1.00 0.00 ? 71  LEU A N    6  
ATOM   6841  C  CA   . LEU A 1 71 ? 19.482  9.802   -0.323  1.00 0.00 ? 71  LEU A CA   6  
ATOM   6842  C  C    . LEU A 1 71 ? 20.311  9.943   -1.596  1.00 0.00 ? 71  LEU A C    6  
ATOM   6843  O  O    . LEU A 1 71 ? 20.084  9.259   -2.594  1.00 0.00 ? 71  LEU A O    6  
ATOM   6844  C  CB   . LEU A 1 71 ? 20.150  8.807   0.627   1.00 0.00 ? 71  LEU A CB   6  
ATOM   6845  C  CG   . LEU A 1 71 ? 19.654  8.824   2.074   1.00 0.00 ? 71  LEU A CG   6  
ATOM   6846  C  CD1  . LEU A 1 71 ? 20.612  8.060   2.975   1.00 0.00 ? 71  LEU A CD1  6  
ATOM   6847  C  CD2  . LEU A 1 71 ? 19.485  10.255  2.563   1.00 0.00 ? 71  LEU A CD2  6  
ATOM   6848  H  H    . LEU A 1 71 ? 17.887  8.425   -0.524  1.00 0.00 ? 71  LEU A H    6  
ATOM   6849  H  HA   . LEU A 1 71 ? 19.420  10.765  0.161   1.00 0.00 ? 71  LEU A HA   6  
ATOM   6850  H  HB2  . LEU A 1 71 ? 19.989  7.815   0.234   1.00 0.00 ? 71  LEU A HB2  6  
ATOM   6851  H  HB3  . LEU A 1 71 ? 21.210  9.021   0.637   1.00 0.00 ? 71  LEU A HB3  6  
ATOM   6852  H  HG   . LEU A 1 71 ? 18.690  8.336   2.122   1.00 0.00 ? 71  LEU A HG   6  
ATOM   6853  H  HD11 . LEU A 1 71 ? 20.375  8.266   4.008   1.00 0.00 ? 71  LEU A HD11 6  
ATOM   6854  H  HD12 . LEU A 1 71 ? 21.625  8.372   2.769   1.00 0.00 ? 71  LEU A HD12 6  
ATOM   6855  H  HD13 . LEU A 1 71 ? 20.516  7.001   2.786   1.00 0.00 ? 71  LEU A HD13 6  
ATOM   6856  H  HD21 . LEU A 1 71 ? 19.422  10.261  3.641   1.00 0.00 ? 71  LEU A HD21 6  
ATOM   6857  H  HD22 . LEU A 1 71 ? 18.580  10.673  2.147   1.00 0.00 ? 71  LEU A HD22 6  
ATOM   6858  H  HD23 . LEU A 1 71 ? 20.332  10.845  2.248   1.00 0.00 ? 71  LEU A HD23 6  
ATOM   6859  N  N    . PRO A 1 72 ? 21.298  10.851  -1.561  1.00 0.00 ? 72  PRO A N    6  
ATOM   6860  C  CA   . PRO A 1 72 ? 22.184  11.101  -2.702  1.00 0.00 ? 72  PRO A CA   6  
ATOM   6861  C  C    . PRO A 1 72 ? 23.132  9.937   -2.967  1.00 0.00 ? 72  PRO A C    6  
ATOM   6862  O  O    . PRO A 1 72 ? 23.990  9.621   -2.142  1.00 0.00 ? 72  PRO A O    6  
ATOM   6863  C  CB   . PRO A 1 72 ? 22.970  12.344  -2.275  1.00 0.00 ? 72  PRO A CB   6  
ATOM   6864  C  CG   . PRO A 1 72 ? 22.946  12.313  -0.785  1.00 0.00 ? 72  PRO A CG   6  
ATOM   6865  C  CD   . PRO A 1 72 ? 21.626  11.702  -0.404  1.00 0.00 ? 72  PRO A CD   6  
ATOM   6866  H  HA   . PRO A 1 72 ? 21.623  11.319  -3.599  1.00 0.00 ? 72  PRO A HA   6  
ATOM   6867  H  HB2  . PRO A 1 72 ? 23.980  12.282  -2.656  1.00 0.00 ? 72  PRO A HB2  6  
ATOM   6868  H  HB3  . PRO A 1 72 ? 22.487  13.229  -2.659  1.00 0.00 ? 72  PRO A HB3  6  
ATOM   6869  H  HG2  . PRO A 1 72 ? 23.760  11.708  -0.417  1.00 0.00 ? 72  PRO A HG2  6  
ATOM   6870  H  HG3  . PRO A 1 72 ? 23.019  13.318  -0.397  1.00 0.00 ? 72  PRO A HG3  6  
ATOM   6871  H  HD2  . PRO A 1 72 ? 21.729  11.110  0.493   1.00 0.00 ? 72  PRO A HD2  6  
ATOM   6872  H  HD3  . PRO A 1 72 ? 20.880  12.470  -0.268  1.00 0.00 ? 72  PRO A HD3  6  
ATOM   6873  N  N    . VAL A 1 73 ? 22.971  9.300   -4.122  1.00 0.00 ? 73  VAL A N    6  
ATOM   6874  C  CA   . VAL A 1 73 ? 23.813  8.170   -4.497  1.00 0.00 ? 73  VAL A CA   6  
ATOM   6875  C  C    . VAL A 1 73 ? 24.306  8.304   -5.934  1.00 0.00 ? 73  VAL A C    6  
ATOM   6876  O  O    . VAL A 1 73 ? 23.663  8.947   -6.763  1.00 0.00 ? 73  VAL A O    6  
ATOM   6877  C  CB   . VAL A 1 73 ? 23.061  6.835   -4.346  1.00 0.00 ? 73  VAL A CB   6  
ATOM   6878  C  CG1  . VAL A 1 73 ? 24.035  5.667   -4.378  1.00 0.00 ? 73  VAL A CG1  6  
ATOM   6879  C  CG2  . VAL A 1 73 ? 22.247  6.825   -3.061  1.00 0.00 ? 73  VAL A CG2  6  
ATOM   6880  H  H    . VAL A 1 73 ? 22.269  9.598   -4.738  1.00 0.00 ? 73  VAL A H    6  
ATOM   6881  H  HA   . VAL A 1 73 ? 24.667  8.156   -3.834  1.00 0.00 ? 73  VAL A HA   6  
ATOM   6882  H  HB   . VAL A 1 73 ? 22.382  6.731   -5.179  1.00 0.00 ? 73  VAL A HB   6  
ATOM   6883  H  HG11 . VAL A 1 73 ? 23.984  5.183   -5.342  1.00 0.00 ? 73  VAL A HG11 6  
ATOM   6884  H  HG12 . VAL A 1 73 ? 25.039  6.029   -4.208  1.00 0.00 ? 73  VAL A HG12 6  
ATOM   6885  H  HG13 . VAL A 1 73 ? 23.773  4.958   -3.606  1.00 0.00 ? 73  VAL A HG13 6  
ATOM   6886  H  HG21 . VAL A 1 73 ? 22.893  6.593   -2.228  1.00 0.00 ? 73  VAL A HG21 6  
ATOM   6887  H  HG22 . VAL A 1 73 ? 21.800  7.797   -2.910  1.00 0.00 ? 73  VAL A HG22 6  
ATOM   6888  H  HG23 . VAL A 1 73 ? 21.469  6.079   -3.133  1.00 0.00 ? 73  VAL A HG23 6  
ATOM   6889  N  N    . SER A 1 74 ? 25.450  7.692   -6.221  1.00 0.00 ? 74  SER A N    6  
ATOM   6890  C  CA   . SER A 1 74 ? 26.031  7.746   -7.557  1.00 0.00 ? 74  SER A CA   6  
ATOM   6891  C  C    . SER A 1 74 ? 25.070  7.165   -8.591  1.00 0.00 ? 74  SER A C    6  
ATOM   6892  O  O    . SER A 1 74 ? 25.071  7.571   -9.753  1.00 0.00 ? 74  SER A O    6  
ATOM   6893  C  CB   . SER A 1 74 ? 27.356  6.982   -7.591  1.00 0.00 ? 74  SER A CB   6  
ATOM   6894  O  OG   . SER A 1 74 ? 28.228  7.428   -6.566  1.00 0.00 ? 74  SER A OG   6  
ATOM   6895  H  H    . SER A 1 74 ? 25.916  7.195   -5.516  1.00 0.00 ? 74  SER A H    6  
ATOM   6896  H  HA   . SER A 1 74 ? 26.216  8.782   -7.797  1.00 0.00 ? 74  SER A HA   6  
ATOM   6897  H  HB2  . SER A 1 74 ? 27.166  5.929   -7.452  1.00 0.00 ? 74  SER A HB2  6  
ATOM   6898  H  HB3  . SER A 1 74 ? 27.834  7.139   -8.547  1.00 0.00 ? 74  SER A HB3  6  
ATOM   6899  H  HG   . SER A 1 74 ? 27.959  7.045   -5.728  1.00 0.00 ? 74  SER A HG   6  
ATOM   6900  N  N    . VAL A 1 75 ? 24.251  6.212   -8.158  1.00 0.00 ? 75  VAL A N    6  
ATOM   6901  C  CA   . VAL A 1 75 ? 23.284  5.575   -9.044  1.00 0.00 ? 75  VAL A CA   6  
ATOM   6902  C  C    . VAL A 1 75 ? 23.738  5.649   -10.498 1.00 0.00 ? 75  VAL A C    6  
ATOM   6903  O  O    . VAL A 1 75 ? 23.000  6.115   -11.366 1.00 0.00 ? 75  VAL A O    6  
ATOM   6904  C  CB   . VAL A 1 75 ? 21.894  6.226   -8.918  1.00 0.00 ? 75  VAL A CB   6  
ATOM   6905  C  CG1  . VAL A 1 75 ? 21.207  5.774   -7.638  1.00 0.00 ? 75  VAL A CG1  6  
ATOM   6906  C  CG2  . VAL A 1 75 ? 22.010  7.742   -8.965  1.00 0.00 ? 75  VAL A CG2  6  
ATOM   6907  H  H    . VAL A 1 75 ? 24.298  5.930   -7.221  1.00 0.00 ? 75  VAL A H    6  
ATOM   6908  H  HA   . VAL A 1 75 ? 23.200  4.537   -8.756  1.00 0.00 ? 75  VAL A HA   6  
ATOM   6909  H  HB   . VAL A 1 75 ? 21.291  5.905   -9.755  1.00 0.00 ? 75  VAL A HB   6  
ATOM   6910  H  HG11 . VAL A 1 75 ? 20.185  5.501   -7.855  1.00 0.00 ? 75  VAL A HG11 6  
ATOM   6911  H  HG12 . VAL A 1 75 ? 21.730  4.922   -7.230  1.00 0.00 ? 75  VAL A HG12 6  
ATOM   6912  H  HG13 . VAL A 1 75 ? 21.218  6.582   -6.920  1.00 0.00 ? 75  VAL A HG13 6  
ATOM   6913  H  HG21 . VAL A 1 75 ? 21.818  8.147   -7.983  1.00 0.00 ? 75  VAL A HG21 6  
ATOM   6914  H  HG22 . VAL A 1 75 ? 23.006  8.018   -9.280  1.00 0.00 ? 75  VAL A HG22 6  
ATOM   6915  H  HG23 . VAL A 1 75 ? 21.289  8.137   -9.665  1.00 0.00 ? 75  VAL A HG23 6  
ATOM   6916  N  N    . SER A 1 76 ? 24.957  5.187   -10.756 1.00 0.00 ? 76  SER A N    6  
ATOM   6917  C  CA   . SER A 1 76 ? 25.512  5.204   -12.104 1.00 0.00 ? 76  SER A CA   6  
ATOM   6918  C  C    . SER A 1 76 ? 25.233  3.887   -12.823 1.00 0.00 ? 76  SER A C    6  
ATOM   6919  O  O    . SER A 1 76 ? 25.329  2.812   -12.232 1.00 0.00 ? 76  SER A O    6  
ATOM   6920  C  CB   . SER A 1 76 ? 27.019  5.463   -12.055 1.00 0.00 ? 76  SER A CB   6  
ATOM   6921  O  OG   . SER A 1 76 ? 27.602  5.322   -13.339 1.00 0.00 ? 76  SER A OG   6  
ATOM   6922  H  H    . SER A 1 76 ? 25.498  4.828   -10.021 1.00 0.00 ? 76  SER A H    6  
ATOM   6923  H  HA   . SER A 1 76 ? 25.035  6.005   -12.649 1.00 0.00 ? 76  SER A HA   6  
ATOM   6924  H  HB2  . SER A 1 76 ? 27.198  6.466   -11.700 1.00 0.00 ? 76  SER A HB2  6  
ATOM   6925  H  HB3  . SER A 1 76 ? 27.481  4.755   -11.383 1.00 0.00 ? 76  SER A HB3  6  
ATOM   6926  H  HG   . SER A 1 76 ? 28.113  4.510   -13.372 1.00 0.00 ? 76  SER A HG   6  
ATOM   6927  N  N    . GLY A 1 77 ? 24.889  3.981   -14.104 1.00 0.00 ? 77  GLY A N    6  
ATOM   6928  C  CA   . GLY A 1 77 ? 24.601  2.791   -14.883 1.00 0.00 ? 77  GLY A CA   6  
ATOM   6929  C  C    . GLY A 1 77 ? 24.279  3.109   -16.330 1.00 0.00 ? 77  GLY A C    6  
ATOM   6930  O  O    . GLY A 1 77 ? 23.169  3.521   -16.665 1.00 0.00 ? 77  GLY A O    6  
ATOM   6931  H  H    . GLY A 1 77 ? 24.829  4.865   -14.523 1.00 0.00 ? 77  GLY A H    6  
ATOM   6932  H  HA2  . GLY A 1 77 ? 25.460  2.137   -14.851 1.00 0.00 ? 77  GLY A HA2  6  
ATOM   6933  H  HA3  . GLY A 1 77 ? 23.757  2.281   -14.442 1.00 0.00 ? 77  GLY A HA3  6  
ATOM   6934  N  N    . PRO A 1 78 ? 25.268  2.918   -17.216 1.00 0.00 ? 78  PRO A N    6  
ATOM   6935  C  CA   . PRO A 1 78 ? 25.109  3.183   -18.649 1.00 0.00 ? 78  PRO A CA   6  
ATOM   6936  C  C    . PRO A 1 78 ? 24.179  2.180   -19.323 1.00 0.00 ? 78  PRO A C    6  
ATOM   6937  O  O    . PRO A 1 78 ? 23.842  1.146   -18.747 1.00 0.00 ? 78  PRO A O    6  
ATOM   6938  C  CB   . PRO A 1 78 ? 26.532  3.043   -19.195 1.00 0.00 ? 78  PRO A CB   6  
ATOM   6939  C  CG   . PRO A 1 78 ? 27.221  2.138   -18.233 1.00 0.00 ? 78  PRO A CG   6  
ATOM   6940  C  CD   . PRO A 1 78 ? 26.618  2.429   -16.887 1.00 0.00 ? 78  PRO A CD   6  
ATOM   6941  H  HA   . PRO A 1 78 ? 24.749  4.185   -18.829 1.00 0.00 ? 78  PRO A HA   6  
ATOM   6942  H  HB2  . PRO A 1 78 ? 26.499  2.615   -20.187 1.00 0.00 ? 78  PRO A HB2  6  
ATOM   6943  H  HB3  . PRO A 1 78 ? 27.005  4.013   -19.231 1.00 0.00 ? 78  PRO A HB3  6  
ATOM   6944  H  HG2  . PRO A 1 78 ? 27.046  1.109   -18.508 1.00 0.00 ? 78  PRO A HG2  6  
ATOM   6945  H  HG3  . PRO A 1 78 ? 28.279  2.350   -18.223 1.00 0.00 ? 78  PRO A HG3  6  
ATOM   6946  H  HD2  . PRO A 1 78 ? 26.567  1.528   -16.293 1.00 0.00 ? 78  PRO A HD2  6  
ATOM   6947  H  HD3  . PRO A 1 78 ? 27.188  3.189   -16.374 1.00 0.00 ? 78  PRO A HD3  6  
ATOM   6948  N  N    . SER A 1 79 ? 23.768  2.493   -20.548 1.00 0.00 ? 79  SER A N    6  
ATOM   6949  C  CA   . SER A 1 79 ? 22.873  1.621   -21.300 1.00 0.00 ? 79  SER A CA   6  
ATOM   6950  C  C    . SER A 1 79 ? 23.664  0.576   -22.082 1.00 0.00 ? 79  SER A C    6  
ATOM   6951  O  O    . SER A 1 79 ? 23.346  0.274   -23.232 1.00 0.00 ? 79  SER A O    6  
ATOM   6952  C  CB   . SER A 1 79 ? 22.009  2.444   -22.257 1.00 0.00 ? 79  SER A CB   6  
ATOM   6953  O  OG   . SER A 1 79 ? 22.811  3.178   -23.165 1.00 0.00 ? 79  SER A OG   6  
ATOM   6954  H  H    . SER A 1 79 ? 24.071  3.332   -20.954 1.00 0.00 ? 79  SER A H    6  
ATOM   6955  H  HA   . SER A 1 79 ? 22.232  1.115   -20.594 1.00 0.00 ? 79  SER A HA   6  
ATOM   6956  H  HB2  . SER A 1 79 ? 21.366  1.783   -22.817 1.00 0.00 ? 79  SER A HB2  6  
ATOM   6957  H  HB3  . SER A 1 79 ? 21.405  3.136   -21.687 1.00 0.00 ? 79  SER A HB3  6  
ATOM   6958  H  HG   . SER A 1 79 ? 22.521  4.093   -23.181 1.00 0.00 ? 79  SER A HG   6  
ATOM   6959  N  N    . SER A 1 80 ? 24.696  0.028   -21.449 1.00 0.00 ? 80  SER A N    6  
ATOM   6960  C  CA   . SER A 1 80 ? 25.536  -0.980  -22.085 1.00 0.00 ? 80  SER A CA   6  
ATOM   6961  C  C    . SER A 1 80 ? 26.188  -0.425  -23.347 1.00 0.00 ? 80  SER A C    6  
ATOM   6962  O  O    . SER A 1 80 ? 26.240  -1.094  -24.379 1.00 0.00 ? 80  SER A O    6  
ATOM   6963  C  CB   . SER A 1 80 ? 24.708  -2.220  -22.428 1.00 0.00 ? 80  SER A CB   6  
ATOM   6964  O  OG   . SER A 1 80 ? 25.519  -3.382  -22.455 1.00 0.00 ? 80  SER A OG   6  
ATOM   6965  H  H    . SER A 1 80 ? 24.899  0.311   -20.532 1.00 0.00 ? 80  SER A H    6  
ATOM   6966  H  HA   . SER A 1 80 ? 26.310  -1.256  -21.385 1.00 0.00 ? 80  SER A HA   6  
ATOM   6967  H  HB2  . SER A 1 80 ? 23.937  -2.352  -21.685 1.00 0.00 ? 80  SER A HB2  6  
ATOM   6968  H  HB3  . SER A 1 80 ? 24.254  -2.089  -23.399 1.00 0.00 ? 80  SER A HB3  6  
ATOM   6969  H  HG   . SER A 1 80 ? 26.166  -3.305  -23.160 1.00 0.00 ? 80  SER A HG   6  
ATOM   6970  N  N    . GLY A 1 81 ? 26.686  0.804   -23.257 1.00 0.00 ? 81  GLY A N    6  
ATOM   6971  C  CA   . GLY A 1 81 ? 27.329  1.430   -24.398 1.00 0.00 ? 81  GLY A CA   6  
ATOM   6972  C  C    . GLY A 1 81 ? 26.766  2.804   -24.700 1.00 0.00 ? 81  GLY A C    6  
ATOM   6973  O  O    . GLY A 1 81 ? 26.525  3.571   -23.768 1.00 0.00 ? 81  GLY A O    6  
ATOM   6974  H  H    . GLY A 1 81 ? 26.617  1.291   -22.409 1.00 0.00 ? 81  GLY A H    6  
ATOM   6975  H  HA2  . GLY A 1 81 ? 28.386  1.522   -24.197 1.00 0.00 ? 81  GLY A HA2  6  
ATOM   6976  H  HA3  . GLY A 1 81 ? 27.192  0.799   -25.265 1.00 0.00 ? 81  GLY A HA3  6  
HETATM 6977  ZN ZN   . ZN  B 2 .  ? -2.777  -2.140  -4.001  1.00 0.00 ? 201 ZN  A ZN   6  
HETATM 6978  ZN ZN   . ZN  C 2 .  ? 13.829  3.013   -3.664  1.00 0.00 ? 401 ZN  A ZN   6  
ATOM   6979  N  N    . GLY A 1 1  ? -32.181 2.529   -18.490 1.00 0.00 ? 1   GLY A N    7  
ATOM   6980  C  CA   . GLY A 1 1  ? -32.326 1.086   -18.440 1.00 0.00 ? 1   GLY A CA   7  
ATOM   6981  C  C    . GLY A 1 1  ? -32.432 0.563   -17.021 1.00 0.00 ? 1   GLY A C    7  
ATOM   6982  O  O    . GLY A 1 1  ? -31.654 0.950   -16.150 1.00 0.00 ? 1   GLY A O    7  
ATOM   6983  H  H1   . GLY A 1 1  ? -32.978 3.099   -18.503 1.00 0.00 ? 1   GLY A H1   7  
ATOM   6984  H  HA2  . GLY A 1 1  ? -33.215 0.805   -18.984 1.00 0.00 ? 1   GLY A HA2  7  
ATOM   6985  H  HA3  . GLY A 1 1  ? -31.467 0.633   -18.914 1.00 0.00 ? 1   GLY A HA3  7  
ATOM   6986  N  N    . SER A 1 2  ? -33.400 -0.318  -16.788 1.00 0.00 ? 2   SER A N    7  
ATOM   6987  C  CA   . SER A 1 2  ? -33.610 -0.890  -15.463 1.00 0.00 ? 2   SER A CA   7  
ATOM   6988  C  C    . SER A 1 2  ? -32.898 -2.234  -15.333 1.00 0.00 ? 2   SER A C    7  
ATOM   6989  O  O    . SER A 1 2  ? -33.295 -3.221  -15.951 1.00 0.00 ? 2   SER A O    7  
ATOM   6990  C  CB   . SER A 1 2  ? -35.105 -1.064  -15.190 1.00 0.00 ? 2   SER A CB   7  
ATOM   6991  O  OG   . SER A 1 2  ? -35.341 -1.388  -13.831 1.00 0.00 ? 2   SER A OG   7  
ATOM   6992  H  H    . SER A 1 2  ? -33.989 -0.587  -17.524 1.00 0.00 ? 2   SER A H    7  
ATOM   6993  H  HA   . SER A 1 2  ? -33.197 -0.206  -14.737 1.00 0.00 ? 2   SER A HA   7  
ATOM   6994  H  HB2  . SER A 1 2  ? -35.620 -0.144  -15.422 1.00 0.00 ? 2   SER A HB2  7  
ATOM   6995  H  HB3  . SER A 1 2  ? -35.491 -1.859  -15.810 1.00 0.00 ? 2   SER A HB3  7  
ATOM   6996  H  HG   . SER A 1 2  ? -34.557 -1.801  -13.459 1.00 0.00 ? 2   SER A HG   7  
ATOM   6997  N  N    . SER A 1 3  ? -31.844 -2.262  -14.524 1.00 0.00 ? 3   SER A N    7  
ATOM   6998  C  CA   . SER A 1 3  ? -31.073 -3.482  -14.315 1.00 0.00 ? 3   SER A CA   7  
ATOM   6999  C  C    . SER A 1 3  ? -31.637 -4.287  -13.148 1.00 0.00 ? 3   SER A C    7  
ATOM   7000  O  O    . SER A 1 3  ? -32.011 -3.729  -12.117 1.00 0.00 ? 3   SER A O    7  
ATOM   7001  C  CB   . SER A 1 3  ? -29.604 -3.145  -14.054 1.00 0.00 ? 3   SER A CB   7  
ATOM   7002  O  OG   . SER A 1 3  ? -29.446 -2.484  -12.810 1.00 0.00 ? 3   SER A OG   7  
ATOM   7003  H  H    . SER A 1 3  ? -31.576 -1.442  -14.059 1.00 0.00 ? 3   SER A H    7  
ATOM   7004  H  HA   . SER A 1 3  ? -31.143 -4.077  -15.214 1.00 0.00 ? 3   SER A HA   7  
ATOM   7005  H  HB2  . SER A 1 3  ? -29.025 -4.056  -14.040 1.00 0.00 ? 3   SER A HB2  7  
ATOM   7006  H  HB3  . SER A 1 3  ? -29.241 -2.499  -14.840 1.00 0.00 ? 3   SER A HB3  7  
ATOM   7007  H  HG   . SER A 1 3  ? -29.255 -3.130  -12.126 1.00 0.00 ? 3   SER A HG   7  
ATOM   7008  N  N    . GLY A 1 4  ? -31.696 -5.605  -13.320 1.00 0.00 ? 4   GLY A N    7  
ATOM   7009  C  CA   . GLY A 1 4  ? -32.215 -6.466  -12.274 1.00 0.00 ? 4   GLY A CA   7  
ATOM   7010  C  C    . GLY A 1 4  ? -31.122 -7.018  -11.381 1.00 0.00 ? 4   GLY A C    7  
ATOM   7011  O  O    . GLY A 1 4  ? -30.244 -7.747  -11.841 1.00 0.00 ? 4   GLY A O    7  
ATOM   7012  H  H    . GLY A 1 4  ? -31.384 -5.995  -14.163 1.00 0.00 ? 4   GLY A H    7  
ATOM   7013  H  HA2  . GLY A 1 4  ? -32.910 -5.902  -11.669 1.00 0.00 ? 4   GLY A HA2  7  
ATOM   7014  H  HA3  . GLY A 1 4  ? -32.741 -7.292  -12.731 1.00 0.00 ? 4   GLY A HA3  7  
ATOM   7015  N  N    . SER A 1 5  ? -31.174 -6.668  -10.099 1.00 0.00 ? 5   SER A N    7  
ATOM   7016  C  CA   . SER A 1 5  ? -30.177 -7.129  -9.140  1.00 0.00 ? 5   SER A CA   7  
ATOM   7017  C  C    . SER A 1 5  ? -30.761 -8.194  -8.218  1.00 0.00 ? 5   SER A C    7  
ATOM   7018  O  O    . SER A 1 5  ? -31.905 -8.088  -7.775  1.00 0.00 ? 5   SER A O    7  
ATOM   7019  C  CB   . SER A 1 5  ? -29.654 -5.953  -8.312  1.00 0.00 ? 5   SER A CB   7  
ATOM   7020  O  OG   . SER A 1 5  ? -29.165 -4.918  -9.148  1.00 0.00 ? 5   SER A OG   7  
ATOM   7021  H  H    . SER A 1 5  ? -31.899 -6.084  -9.793  1.00 0.00 ? 5   SER A H    7  
ATOM   7022  H  HA   . SER A 1 5  ? -29.357 -7.560  -9.695  1.00 0.00 ? 5   SER A HA   7  
ATOM   7023  H  HB2  . SER A 1 5  ? -30.454 -5.560  -7.704  1.00 0.00 ? 5   SER A HB2  7  
ATOM   7024  H  HB3  . SER A 1 5  ? -28.851 -6.294  -7.675  1.00 0.00 ? 5   SER A HB3  7  
ATOM   7025  H  HG   . SER A 1 5  ? -28.795 -4.217  -8.606  1.00 0.00 ? 5   SER A HG   7  
ATOM   7026  N  N    . SER A 1 6  ? -29.968 -9.222  -7.934  1.00 0.00 ? 6   SER A N    7  
ATOM   7027  C  CA   . SER A 1 6  ? -30.406 -10.310 -7.068  1.00 0.00 ? 6   SER A CA   7  
ATOM   7028  C  C    . SER A 1 6  ? -30.254 -9.930  -5.599  1.00 0.00 ? 6   SER A C    7  
ATOM   7029  O  O    . SER A 1 6  ? -31.161 -10.140 -4.794  1.00 0.00 ? 6   SER A O    7  
ATOM   7030  C  CB   . SER A 1 6  ? -29.606 -11.580 -7.364  1.00 0.00 ? 6   SER A CB   7  
ATOM   7031  O  OG   . SER A 1 6  ? -28.217 -11.359 -7.192  1.00 0.00 ? 6   SER A OG   7  
ATOM   7032  H  H    . SER A 1 6  ? -29.066 -9.250  -8.318  1.00 0.00 ? 6   SER A H    7  
ATOM   7033  H  HA   . SER A 1 6  ? -31.450 -10.497 -7.273  1.00 0.00 ? 6   SER A HA   7  
ATOM   7034  H  HB2  . SER A 1 6  ? -29.919 -12.365 -6.692  1.00 0.00 ? 6   SER A HB2  7  
ATOM   7035  H  HB3  . SER A 1 6  ? -29.786 -11.886 -8.385  1.00 0.00 ? 6   SER A HB3  7  
ATOM   7036  H  HG   . SER A 1 6  ? -27.732 -12.143 -7.460  1.00 0.00 ? 6   SER A HG   7  
ATOM   7037  N  N    . GLY A 1 7  ? -29.098 -9.369  -5.255  1.00 0.00 ? 7   GLY A N    7  
ATOM   7038  C  CA   . GLY A 1 7  ? -28.847 -8.969  -3.883  1.00 0.00 ? 7   GLY A CA   7  
ATOM   7039  C  C    . GLY A 1 7  ? -27.371 -8.984  -3.537  1.00 0.00 ? 7   GLY A C    7  
ATOM   7040  O  O    . GLY A 1 7  ? -26.838 -10.005 -3.102  1.00 0.00 ? 7   GLY A O    7  
ATOM   7041  H  H    . GLY A 1 7  ? -28.411 -9.226  -5.940  1.00 0.00 ? 7   GLY A H    7  
ATOM   7042  H  HA2  . GLY A 1 7  ? -29.231 -7.971  -3.735  1.00 0.00 ? 7   GLY A HA2  7  
ATOM   7043  H  HA3  . GLY A 1 7  ? -29.367 -9.646  -3.222  1.00 0.00 ? 7   GLY A HA3  7  
ATOM   7044  N  N    . LEU A 1 8  ? -26.708 -7.849  -3.730  1.00 0.00 ? 8   LEU A N    7  
ATOM   7045  C  CA   . LEU A 1 8  ? -25.284 -7.735  -3.436  1.00 0.00 ? 8   LEU A CA   7  
ATOM   7046  C  C    . LEU A 1 8  ? -25.052 -6.904  -2.179  1.00 0.00 ? 8   LEU A C    7  
ATOM   7047  O  O    . LEU A 1 8  ? -24.544 -5.784  -2.247  1.00 0.00 ? 8   LEU A O    7  
ATOM   7048  C  CB   . LEU A 1 8  ? -24.547 -7.106  -4.620  1.00 0.00 ? 8   LEU A CB   7  
ATOM   7049  C  CG   . LEU A 1 8  ? -25.061 -7.486  -6.009  1.00 0.00 ? 8   LEU A CG   7  
ATOM   7050  C  CD1  . LEU A 1 8  ? -24.708 -6.408  -7.022  1.00 0.00 ? 8   LEU A CD1  7  
ATOM   7051  C  CD2  . LEU A 1 8  ? -24.493 -8.831  -6.438  1.00 0.00 ? 8   LEU A CD2  7  
ATOM   7052  H  H    . LEU A 1 8  ? -27.187 -7.068  -4.079  1.00 0.00 ? 8   LEU A H    7  
ATOM   7053  H  HA   . LEU A 1 8  ? -24.899 -8.730  -3.271  1.00 0.00 ? 8   LEU A HA   7  
ATOM   7054  H  HB2  . LEU A 1 8  ? -24.620 -6.034  -4.523  1.00 0.00 ? 8   LEU A HB2  7  
ATOM   7055  H  HB3  . LEU A 1 8  ? -23.510 -7.402  -4.558  1.00 0.00 ? 8   LEU A HB3  7  
ATOM   7056  H  HG   . LEU A 1 8  ? -26.139 -7.572  -5.976  1.00 0.00 ? 8   LEU A HG   7  
ATOM   7057  H  HD11 . LEU A 1 8  ? -23.635 -6.311  -7.085  1.00 0.00 ? 8   LEU A HD11 7  
ATOM   7058  H  HD12 . LEU A 1 8  ? -25.138 -5.468  -6.712  1.00 0.00 ? 8   LEU A HD12 7  
ATOM   7059  H  HD13 . LEU A 1 8  ? -25.102 -6.682  -7.990  1.00 0.00 ? 8   LEU A HD13 7  
ATOM   7060  H  HD21 . LEU A 1 8  ? -25.246 -9.381  -6.984  1.00 0.00 ? 8   LEU A HD21 7  
ATOM   7061  H  HD22 . LEU A 1 8  ? -24.200 -9.394  -5.564  1.00 0.00 ? 8   LEU A HD22 7  
ATOM   7062  H  HD23 . LEU A 1 8  ? -23.632 -8.673  -7.071  1.00 0.00 ? 8   LEU A HD23 7  
ATOM   7063  N  N    . ASP A 1 9  ? -25.426 -7.459  -1.031  1.00 0.00 ? 9   ASP A N    7  
ATOM   7064  C  CA   . ASP A 1 9  ? -25.256 -6.771  0.243   1.00 0.00 ? 9   ASP A CA   7  
ATOM   7065  C  C    . ASP A 1 9  ? -24.000 -7.256  0.959   1.00 0.00 ? 9   ASP A C    7  
ATOM   7066  O  O    . ASP A 1 9  ? -23.174 -6.455  1.398   1.00 0.00 ? 9   ASP A O    7  
ATOM   7067  C  CB   . ASP A 1 9  ? -26.481 -6.988  1.132   1.00 0.00 ? 9   ASP A CB   7  
ATOM   7068  C  CG   . ASP A 1 9  ? -26.636 -5.904  2.180   1.00 0.00 ? 9   ASP A CG   7  
ATOM   7069  O  OD1  . ASP A 1 9  ? -27.168 -4.826  1.844   1.00 0.00 ? 9   ASP A OD1  7  
ATOM   7070  O  OD2  . ASP A 1 9  ? -26.223 -6.133  3.337   1.00 0.00 ? 9   ASP A OD2  7  
ATOM   7071  H  H    . ASP A 1 9  ? -25.825 -8.354  -1.042  1.00 0.00 ? 9   ASP A H    7  
ATOM   7072  H  HA   . ASP A 1 9  ? -25.153 -5.716  0.039   1.00 0.00 ? 9   ASP A HA   7  
ATOM   7073  H  HB2  . ASP A 1 9  ? -27.369 -6.996  0.515   1.00 0.00 ? 9   ASP A HB2  7  
ATOM   7074  H  HB3  . ASP A 1 9  ? -26.389 -7.939  1.635   1.00 0.00 ? 9   ASP A HB3  7  
ATOM   7075  N  N    . TYR A 1 10 ? -23.862 -8.572  1.075   1.00 0.00 ? 10  TYR A N    7  
ATOM   7076  C  CA   . TYR A 1 10 ? -22.708 -9.164  1.742   1.00 0.00 ? 10  TYR A CA   7  
ATOM   7077  C  C    . TYR A 1 10 ? -21.457 -8.320  1.518   1.00 0.00 ? 10  TYR A C    7  
ATOM   7078  O  O    . TYR A 1 10 ? -20.604 -8.212  2.398   1.00 0.00 ? 10  TYR A O    7  
ATOM   7079  C  CB   . TYR A 1 10 ? -22.475 -10.588 1.233   1.00 0.00 ? 10  TYR A CB   7  
ATOM   7080  C  CG   . TYR A 1 10 ? -22.083 -10.653 -0.226  1.00 0.00 ? 10  TYR A CG   7  
ATOM   7081  C  CD1  . TYR A 1 10 ? -22.935 -10.181 -1.216  1.00 0.00 ? 10  TYR A CD1  7  
ATOM   7082  C  CD2  . TYR A 1 10 ? -20.860 -11.186 -0.614  1.00 0.00 ? 10  TYR A CD2  7  
ATOM   7083  C  CE1  . TYR A 1 10 ? -22.582 -10.239 -2.550  1.00 0.00 ? 10  TYR A CE1  7  
ATOM   7084  C  CE2  . TYR A 1 10 ? -20.498 -11.247 -1.945  1.00 0.00 ? 10  TYR A CE2  7  
ATOM   7085  C  CZ   . TYR A 1 10 ? -21.362 -10.773 -2.910  1.00 0.00 ? 10  TYR A CZ   7  
ATOM   7086  O  OH   . TYR A 1 10 ? -21.006 -10.832 -4.238  1.00 0.00 ? 10  TYR A OH   7  
ATOM   7087  H  H    . TYR A 1 10 ? -24.554 -9.160  0.705   1.00 0.00 ? 10  TYR A H    7  
ATOM   7088  H  HA   . TYR A 1 10 ? -22.920 -9.201  2.800   1.00 0.00 ? 10  TYR A HA   7  
ATOM   7089  H  HB2  . TYR A 1 10 ? -21.683 -11.043 1.809   1.00 0.00 ? 10  TYR A HB2  7  
ATOM   7090  H  HB3  . TYR A 1 10 ? -23.381 -11.161 1.360   1.00 0.00 ? 10  TYR A HB3  7  
ATOM   7091  H  HD1  . TYR A 1 10 ? -23.890 -9.763  -0.931  1.00 0.00 ? 10  TYR A HD1  7  
ATOM   7092  H  HD2  . TYR A 1 10 ? -20.185 -11.557 0.144   1.00 0.00 ? 10  TYR A HD2  7  
ATOM   7093  H  HE1  . TYR A 1 10 ? -23.259 -9.868  -3.305  1.00 0.00 ? 10  TYR A HE1  7  
ATOM   7094  H  HE2  . TYR A 1 10 ? -19.542 -11.665 -2.228  1.00 0.00 ? 10  TYR A HE2  7  
ATOM   7095  H  HH   . TYR A 1 10 ? -21.264 -11.682 -4.601  1.00 0.00 ? 10  TYR A HH   7  
ATOM   7096  N  N    . GLN A 1 11 ? -21.357 -7.725  0.334   1.00 0.00 ? 11  GLN A N    7  
ATOM   7097  C  CA   . GLN A 1 11 ? -20.211 -6.890  -0.007  1.00 0.00 ? 11  GLN A CA   7  
ATOM   7098  C  C    . GLN A 1 11 ? -20.411 -5.462  0.489   1.00 0.00 ? 11  GLN A C    7  
ATOM   7099  O  O    . GLN A 1 11 ? -19.491 -4.848  1.029   1.00 0.00 ? 11  GLN A O    7  
ATOM   7100  C  CB   . GLN A 1 11 ? -19.985 -6.891  -1.519  1.00 0.00 ? 11  GLN A CB   7  
ATOM   7101  C  CG   . GLN A 1 11 ? -19.867 -8.284  -2.117  1.00 0.00 ? 11  GLN A CG   7  
ATOM   7102  C  CD   . GLN A 1 11 ? -18.449 -8.819  -2.074  1.00 0.00 ? 11  GLN A CD   7  
ATOM   7103  O  OE1  . GLN A 1 11 ? -17.949 -9.202  -1.016  1.00 0.00 ? 11  GLN A OE1  7  
ATOM   7104  N  NE2  . GLN A 1 11 ? -17.792 -8.848  -3.228  1.00 0.00 ? 11  GLN A NE2  7  
ATOM   7105  H  H    . GLN A 1 11 ? -22.070 -7.850  -0.326  1.00 0.00 ? 11  GLN A H    7  
ATOM   7106  H  HA   . GLN A 1 11 ? -19.342 -7.308  0.478   1.00 0.00 ? 11  GLN A HA   7  
ATOM   7107  H  HB2  . GLN A 1 11 ? -20.812 -6.387  -1.995  1.00 0.00 ? 11  GLN A HB2  7  
ATOM   7108  H  HB3  . GLN A 1 11 ? -19.074 -6.352  -1.735  1.00 0.00 ? 11  GLN A HB3  7  
ATOM   7109  H  HG2  . GLN A 1 11 ? -20.505 -8.955  -1.561  1.00 0.00 ? 11  GLN A HG2  7  
ATOM   7110  H  HG3  . GLN A 1 11 ? -20.193 -8.249  -3.146  1.00 0.00 ? 11  GLN A HG3  7  
ATOM   7111  H  HE21 . GLN A 1 11 ? -18.254 -8.525  -4.031  1.00 0.00 ? 11  GLN A HE21 7  
ATOM   7112  H  HE22 . GLN A 1 11 ? -16.874 -9.188  -3.230  1.00 0.00 ? 11  GLN A HE22 7  
ATOM   7113  N  N    . ARG A 1 12 ? -21.619 -4.940  0.302   1.00 0.00 ? 12  ARG A N    7  
ATOM   7114  C  CA   . ARG A 1 12 ? -21.939 -3.583  0.729   1.00 0.00 ? 12  ARG A CA   7  
ATOM   7115  C  C    . ARG A 1 12 ? -21.187 -3.224  2.007   1.00 0.00 ? 12  ARG A C    7  
ATOM   7116  O  O    . ARG A 1 12 ? -20.823 -2.067  2.222   1.00 0.00 ? 12  ARG A O    7  
ATOM   7117  C  CB   . ARG A 1 12 ? -23.445 -3.438  0.952   1.00 0.00 ? 12  ARG A CB   7  
ATOM   7118  C  CG   . ARG A 1 12 ? -24.202 -2.974  -0.282  1.00 0.00 ? 12  ARG A CG   7  
ATOM   7119  C  CD   . ARG A 1 12 ? -24.304 -1.458  -0.337  1.00 0.00 ? 12  ARG A CD   7  
ATOM   7120  N  NE   . ARG A 1 12 ? -23.000 -0.828  -0.526  1.00 0.00 ? 12  ARG A NE   7  
ATOM   7121  C  CZ   . ARG A 1 12 ? -22.409 -0.704  -1.710  1.00 0.00 ? 12  ARG A CZ   7  
ATOM   7122  N  NH1  . ARG A 1 12 ? -23.002 -1.164  -2.802  1.00 0.00 ? 12  ARG A NH1  7  
ATOM   7123  N  NH2  . ARG A 1 12 ? -21.221 -0.119  -1.801  1.00 0.00 ? 12  ARG A NH2  7  
ATOM   7124  H  H    . ARG A 1 12 ? -22.311 -5.479  -0.135  1.00 0.00 ? 12  ARG A H    7  
ATOM   7125  H  HA   . ARG A 1 12 ? -21.633 -2.907  -0.056  1.00 0.00 ? 12  ARG A HA   7  
ATOM   7126  H  HB2  . ARG A 1 12 ? -23.846 -4.394  1.255   1.00 0.00 ? 12  ARG A HB2  7  
ATOM   7127  H  HB3  . ARG A 1 12 ? -23.612 -2.720  1.740   1.00 0.00 ? 12  ARG A HB3  7  
ATOM   7128  H  HG2  . ARG A 1 12 ? -23.682 -3.321  -1.163  1.00 0.00 ? 12  ARG A HG2  7  
ATOM   7129  H  HG3  . ARG A 1 12 ? -25.197 -3.393  -0.261  1.00 0.00 ? 12  ARG A HG3  7  
ATOM   7130  H  HD2  . ARG A 1 12 ? -24.948 -1.183  -1.158  1.00 0.00 ? 12  ARG A HD2  7  
ATOM   7131  H  HD3  . ARG A 1 12 ? -24.732 -1.106  0.590   1.00 0.00 ? 12  ARG A HD3  7  
ATOM   7132  H  HE   . ARG A 1 12 ? -22.543 -0.482  0.268   1.00 0.00 ? 12  ARG A HE   7  
ATOM   7133  H  HH11 . ARG A 1 12 ? -23.897 -1.604  -2.736  1.00 0.00 ? 12  ARG A HH11 7  
ATOM   7134  H  HH12 . ARG A 1 12 ? -22.556 -1.068  -3.692  1.00 0.00 ? 12  ARG A HH12 7  
ATOM   7135  H  HH21 . ARG A 1 12 ? -20.771 0.229   -0.980  1.00 0.00 ? 12  ARG A HH21 7  
ATOM   7136  H  HH22 . ARG A 1 12 ? -20.777 -0.026  -2.692  1.00 0.00 ? 12  ARG A HH22 7  
ATOM   7137  N  N    . LEU A 1 13 ? -20.959 -4.222  2.853   1.00 0.00 ? 13  LEU A N    7  
ATOM   7138  C  CA   . LEU A 1 13 ? -20.252 -4.012  4.112   1.00 0.00 ? 13  LEU A CA   7  
ATOM   7139  C  C    . LEU A 1 13 ? -19.062 -3.077  3.918   1.00 0.00 ? 13  LEU A C    7  
ATOM   7140  O  O    . LEU A 1 13 ? -18.638 -2.821  2.790   1.00 0.00 ? 13  LEU A O    7  
ATOM   7141  C  CB   . LEU A 1 13 ? -19.777 -5.349  4.682   1.00 0.00 ? 13  LEU A CB   7  
ATOM   7142  C  CG   . LEU A 1 13 ? -18.994 -6.247  3.723   1.00 0.00 ? 13  LEU A CG   7  
ATOM   7143  C  CD1  . LEU A 1 13 ? -17.595 -5.695  3.497   1.00 0.00 ? 13  LEU A CD1  7  
ATOM   7144  C  CD2  . LEU A 1 13 ? -18.927 -7.670  4.259   1.00 0.00 ? 13  LEU A CD2  7  
ATOM   7145  H  H    . LEU A 1 13 ? -21.274 -5.122  2.628   1.00 0.00 ? 13  LEU A H    7  
ATOM   7146  H  HA   . LEU A 1 13 ? -20.941 -3.558  4.808   1.00 0.00 ? 13  LEU A HA   7  
ATOM   7147  H  HB2  . LEU A 1 13 ? -19.143 -5.141  5.530   1.00 0.00 ? 13  LEU A HB2  7  
ATOM   7148  H  HB3  . LEU A 1 13 ? -20.649 -5.896  5.011   1.00 0.00 ? 13  LEU A HB3  7  
ATOM   7149  H  HG   . LEU A 1 13 ? -19.501 -6.272  2.768   1.00 0.00 ? 13  LEU A HG   7  
ATOM   7150  H  HD11 . LEU A 1 13 ? -17.024 -6.394  2.904   1.00 0.00 ? 13  LEU A HD11 7  
ATOM   7151  H  HD12 . LEU A 1 13 ? -17.107 -5.549  4.449   1.00 0.00 ? 13  LEU A HD12 7  
ATOM   7152  H  HD13 . LEU A 1 13 ? -17.661 -4.750  2.977   1.00 0.00 ? 13  LEU A HD13 7  
ATOM   7153  H  HD21 . LEU A 1 13 ? -18.172 -7.729  5.029   1.00 0.00 ? 13  LEU A HD21 7  
ATOM   7154  H  HD22 . LEU A 1 13 ? -18.676 -8.346  3.455   1.00 0.00 ? 13  LEU A HD22 7  
ATOM   7155  H  HD23 . LEU A 1 13 ? -19.886 -7.943  4.674   1.00 0.00 ? 13  LEU A HD23 7  
ATOM   7156  N  N    . TYR A 1 14 ? -18.526 -2.573  5.024   1.00 0.00 ? 14  TYR A N    7  
ATOM   7157  C  CA   . TYR A 1 14 ? -17.385 -1.667  4.976   1.00 0.00 ? 14  TYR A CA   7  
ATOM   7158  C  C    . TYR A 1 14 ? -16.450 -2.029  3.826   1.00 0.00 ? 14  TYR A C    7  
ATOM   7159  O  O    . TYR A 1 14 ? -16.167 -1.205  2.957   1.00 0.00 ? 14  TYR A O    7  
ATOM   7160  C  CB   . TYR A 1 14 ? -16.622 -1.704  6.300   1.00 0.00 ? 14  TYR A CB   7  
ATOM   7161  C  CG   . TYR A 1 14 ? -16.147 -3.086  6.687   1.00 0.00 ? 14  TYR A CG   7  
ATOM   7162  C  CD1  . TYR A 1 14 ? -17.026 -4.019  7.224   1.00 0.00 ? 14  TYR A CD1  7  
ATOM   7163  C  CD2  . TYR A 1 14 ? -14.819 -3.459  6.518   1.00 0.00 ? 14  TYR A CD2  7  
ATOM   7164  C  CE1  . TYR A 1 14 ? -16.597 -5.283  7.579   1.00 0.00 ? 14  TYR A CE1  7  
ATOM   7165  C  CE2  . TYR A 1 14 ? -14.382 -4.721  6.869   1.00 0.00 ? 14  TYR A CE2  7  
ATOM   7166  C  CZ   . TYR A 1 14 ? -15.274 -5.630  7.399   1.00 0.00 ? 14  TYR A CZ   7  
ATOM   7167  O  OH   . TYR A 1 14 ? -14.841 -6.887  7.752   1.00 0.00 ? 14  TYR A OH   7  
ATOM   7168  H  H    . TYR A 1 14 ? -18.908 -2.814  5.893   1.00 0.00 ? 14  TYR A H    7  
ATOM   7169  H  HA   . TYR A 1 14 ? -17.762 -0.667  4.816   1.00 0.00 ? 14  TYR A HA   7  
ATOM   7170  H  HB2  . TYR A 1 14 ? -15.755 -1.065  6.227   1.00 0.00 ? 14  TYR A HB2  7  
ATOM   7171  H  HB3  . TYR A 1 14 ? -17.265 -1.341  7.089   1.00 0.00 ? 14  TYR A HB3  7  
ATOM   7172  H  HD1  . TYR A 1 14 ? -18.062 -3.745  7.363   1.00 0.00 ? 14  TYR A HD1  7  
ATOM   7173  H  HD2  . TYR A 1 14 ? -14.123 -2.745  6.102   1.00 0.00 ? 14  TYR A HD2  7  
ATOM   7174  H  HE1  . TYR A 1 14 ? -17.295 -5.995  7.995   1.00 0.00 ? 14  TYR A HE1  7  
ATOM   7175  H  HE2  . TYR A 1 14 ? -13.346 -4.993  6.729   1.00 0.00 ? 14  TYR A HE2  7  
ATOM   7176  H  HH   . TYR A 1 14 ? -14.001 -7.068  7.325   1.00 0.00 ? 14  TYR A HH   7  
ATOM   7177  N  N    . GLY A 1 15 ? -15.972 -3.270  3.829   1.00 0.00 ? 15  GLY A N    7  
ATOM   7178  C  CA   . GLY A 1 15 ? -15.074 -3.722  2.782   1.00 0.00 ? 15  GLY A CA   7  
ATOM   7179  C  C    . GLY A 1 15 ? -13.794 -2.912  2.727   1.00 0.00 ? 15  GLY A C    7  
ATOM   7180  O  O    . GLY A 1 15 ? -13.819 -1.687  2.850   1.00 0.00 ? 15  GLY A O    7  
ATOM   7181  H  H    . GLY A 1 15 ? -16.232 -3.884  4.548   1.00 0.00 ? 15  GLY A H    7  
ATOM   7182  H  HA2  . GLY A 1 15 ? -14.825 -4.757  2.959   1.00 0.00 ? 15  GLY A HA2  7  
ATOM   7183  H  HA3  . GLY A 1 15 ? -15.579 -3.640  1.831   1.00 0.00 ? 15  GLY A HA3  7  
ATOM   7184  N  N    . THR A 1 16 ? -12.670 -3.596  2.543   1.00 0.00 ? 16  THR A N    7  
ATOM   7185  C  CA   . THR A 1 16 ? -11.374 -2.933  2.475   1.00 0.00 ? 16  THR A CA   7  
ATOM   7186  C  C    . THR A 1 16 ? -10.787 -3.015  1.070   1.00 0.00 ? 16  THR A C    7  
ATOM   7187  O  O    . THR A 1 16 ? -10.398 -4.089  0.611   1.00 0.00 ? 16  THR A O    7  
ATOM   7188  C  CB   . THR A 1 16 ? -10.374 -3.549  3.472   1.00 0.00 ? 16  THR A CB   7  
ATOM   7189  O  OG1  . THR A 1 16 ? -10.862 -3.398  4.810   1.00 0.00 ? 16  THR A OG1  7  
ATOM   7190  C  CG2  . THR A 1 16 ? -9.009  -2.890  3.347   1.00 0.00 ? 16  THR A CG2  7  
ATOM   7191  H  H    . THR A 1 16 ? -12.714 -4.571  2.452   1.00 0.00 ? 16  THR A H    7  
ATOM   7192  H  HA   . THR A 1 16 ? -11.516 -1.895  2.735   1.00 0.00 ? 16  THR A HA   7  
ATOM   7193  H  HB   . THR A 1 16 ? -10.271 -4.602  3.251   1.00 0.00 ? 16  THR A HB   7  
ATOM   7194  H  HG1  . THR A 1 16 ? -10.586 -2.546  5.157   1.00 0.00 ? 16  THR A HG1  7  
ATOM   7195  H  HG21 . THR A 1 16 ? -8.825  -2.636  2.314   1.00 0.00 ? 16  THR A HG21 7  
ATOM   7196  H  HG22 . THR A 1 16 ? -8.247  -3.573  3.691   1.00 0.00 ? 16  THR A HG22 7  
ATOM   7197  H  HG23 . THR A 1 16 ? -8.986  -1.993  3.948   1.00 0.00 ? 16  THR A HG23 7  
ATOM   7198  N  N    . ARG A 1 17 ? -10.726 -1.874  0.392   1.00 0.00 ? 17  ARG A N    7  
ATOM   7199  C  CA   . ARG A 1 17 ? -10.188 -1.817  -0.961  1.00 0.00 ? 17  ARG A CA   7  
ATOM   7200  C  C    . ARG A 1 17 ? -8.857  -1.071  -0.986  1.00 0.00 ? 17  ARG A C    7  
ATOM   7201  O  O    . ARG A 1 17 ? -8.797  0.123   -0.691  1.00 0.00 ? 17  ARG A O    7  
ATOM   7202  C  CB   . ARG A 1 17 ? -11.184 -1.136  -1.902  1.00 0.00 ? 17  ARG A CB   7  
ATOM   7203  C  CG   . ARG A 1 17 ? -11.083 -1.609  -3.342  1.00 0.00 ? 17  ARG A CG   7  
ATOM   7204  C  CD   . ARG A 1 17 ? -12.239 -1.088  -4.182  1.00 0.00 ? 17  ARG A CD   7  
ATOM   7205  N  NE   . ARG A 1 17 ? -12.387 -1.831  -5.431  1.00 0.00 ? 17  ARG A NE   7  
ATOM   7206  C  CZ   . ARG A 1 17 ? -13.377 -1.629  -6.293  1.00 0.00 ? 17  ARG A CZ   7  
ATOM   7207  N  NH1  . ARG A 1 17 ? -14.300 -0.711  -6.044  1.00 0.00 ? 17  ARG A NH1  7  
ATOM   7208  N  NH2  . ARG A 1 17 ? -13.443 -2.346  -7.408  1.00 0.00 ? 17  ARG A NH2  7  
ATOM   7209  H  H    . ARG A 1 17 ? -11.052 -1.050  0.812   1.00 0.00 ? 17  ARG A H    7  
ATOM   7210  H  HA   . ARG A 1 17 ? -10.025 -2.830  -1.297  1.00 0.00 ? 17  ARG A HA   7  
ATOM   7211  H  HB2  . ARG A 1 17 ? -12.186 -1.334  -1.550  1.00 0.00 ? 17  ARG A HB2  7  
ATOM   7212  H  HB3  . ARG A 1 17 ? -11.008 -0.071  -1.882  1.00 0.00 ? 17  ARG A HB3  7  
ATOM   7213  H  HG2  . ARG A 1 17 ? -10.156 -1.252  -3.765  1.00 0.00 ? 17  ARG A HG2  7  
ATOM   7214  H  HG3  . ARG A 1 17 ? -11.096 -2.689  -3.358  1.00 0.00 ? 17  ARG A HG3  7  
ATOM   7215  H  HD2  . ARG A 1 17 ? -13.151 -1.178  -3.611  1.00 0.00 ? 17  ARG A HD2  7  
ATOM   7216  H  HD3  . ARG A 1 17 ? -12.059 -0.049  -4.412  1.00 0.00 ? 17  ARG A HD3  7  
ATOM   7217  H  HE   . ARG A 1 17 ? -11.715 -2.515  -5.634  1.00 0.00 ? 17  ARG A HE   7  
ATOM   7218  H  HH11 . ARG A 1 17 ? -14.252 -0.169  -5.206  1.00 0.00 ? 17  ARG A HH11 7  
ATOM   7219  H  HH12 . ARG A 1 17 ? -15.044 -0.560  -6.696  1.00 0.00 ? 17  ARG A HH12 7  
ATOM   7220  H  HH21 . ARG A 1 17 ? -12.749 -3.038  -7.599  1.00 0.00 ? 17  ARG A HH21 7  
ATOM   7221  H  HH22 . ARG A 1 17 ? -14.188 -2.193  -8.057  1.00 0.00 ? 17  ARG A HH22 7  
ATOM   7222  N  N    . CYS A 1 18 ? -7.792  -1.782  -1.339  1.00 0.00 ? 18  CYS A N    7  
ATOM   7223  C  CA   . CYS A 1 18 ? -6.462  -1.189  -1.402  1.00 0.00 ? 18  CYS A CA   7  
ATOM   7224  C  C    . CYS A 1 18 ? -6.502  0.163   -2.107  1.00 0.00 ? 18  CYS A C    7  
ATOM   7225  O  O    . CYS A 1 18 ? -7.090  0.299   -3.180  1.00 0.00 ? 18  CYS A O    7  
ATOM   7226  C  CB   . CYS A 1 18 ? -5.496  -2.127  -2.128  1.00 0.00 ? 18  CYS A CB   7  
ATOM   7227  S  SG   . CYS A 1 18 ? -3.811  -1.460  -2.316  1.00 0.00 ? 18  CYS A SG   7  
ATOM   7228  H  H    . CYS A 1 18 ? -7.903  -2.731  -1.563  1.00 0.00 ? 18  CYS A H    7  
ATOM   7229  H  HA   . CYS A 1 18 ? -6.115  -1.044  -0.390  1.00 0.00 ? 18  CYS A HA   7  
ATOM   7230  H  HB2  . CYS A 1 18 ? -5.422  -3.053  -1.576  1.00 0.00 ? 18  CYS A HB2  7  
ATOM   7231  H  HB3  . CYS A 1 18 ? -5.880  -2.333  -3.116  1.00 0.00 ? 18  CYS A HB3  7  
ATOM   7232  N  N    . PHE A 1 19 ? -5.871  1.161   -1.497  1.00 0.00 ? 19  PHE A N    7  
ATOM   7233  C  CA   . PHE A 1 19 ? -5.835  2.504   -2.066  1.00 0.00 ? 19  PHE A CA   7  
ATOM   7234  C  C    . PHE A 1 19 ? -4.711  2.630   -3.090  1.00 0.00 ? 19  PHE A C    7  
ATOM   7235  O  O    . PHE A 1 19 ? -4.232  3.729   -3.369  1.00 0.00 ? 19  PHE A O    7  
ATOM   7236  C  CB   . PHE A 1 19 ? -5.651  3.544   -0.959  1.00 0.00 ? 19  PHE A CB   7  
ATOM   7237  C  CG   . PHE A 1 19 ? -6.937  4.179   -0.513  1.00 0.00 ? 19  PHE A CG   7  
ATOM   7238  C  CD1  . PHE A 1 19 ? -7.594  5.089   -1.325  1.00 0.00 ? 19  PHE A CD1  7  
ATOM   7239  C  CD2  . PHE A 1 19 ? -7.490  3.865   0.718   1.00 0.00 ? 19  PHE A CD2  7  
ATOM   7240  C  CE1  . PHE A 1 19 ? -8.778  5.675   -0.918  1.00 0.00 ? 19  PHE A CE1  7  
ATOM   7241  C  CE2  . PHE A 1 19 ? -8.674  4.447   1.130   1.00 0.00 ? 19  PHE A CE2  7  
ATOM   7242  C  CZ   . PHE A 1 19 ? -9.318  5.354   0.312   1.00 0.00 ? 19  PHE A CZ   7  
ATOM   7243  H  H    . PHE A 1 19 ? -5.420  0.991   -0.643  1.00 0.00 ? 19  PHE A H    7  
ATOM   7244  H  HA   . PHE A 1 19 ? -6.778  2.679   -2.560  1.00 0.00 ? 19  PHE A HA   7  
ATOM   7245  H  HB2  . PHE A 1 19 ? -5.201  3.070   -0.100  1.00 0.00 ? 19  PHE A HB2  7  
ATOM   7246  H  HB3  . PHE A 1 19 ? -4.999  4.327   -1.316  1.00 0.00 ? 19  PHE A HB3  7  
ATOM   7247  H  HD1  . PHE A 1 19 ? -7.172  5.342   -2.288  1.00 0.00 ? 19  PHE A HD1  7  
ATOM   7248  H  HD2  . PHE A 1 19 ? -6.987  3.157   1.360   1.00 0.00 ? 19  PHE A HD2  7  
ATOM   7249  H  HE1  . PHE A 1 19 ? -9.279  6.384   -1.561  1.00 0.00 ? 19  PHE A HE1  7  
ATOM   7250  H  HE2  . PHE A 1 19 ? -9.094  4.194   2.092   1.00 0.00 ? 19  PHE A HE2  7  
ATOM   7251  H  HZ   . PHE A 1 19 ? -10.243 5.809   0.631   1.00 0.00 ? 19  PHE A HZ   7  
ATOM   7252  N  N    . SER A 1 20 ? -4.295  1.497   -3.646  1.00 0.00 ? 20  SER A N    7  
ATOM   7253  C  CA   . SER A 1 20 ? -3.224  1.479   -4.636  1.00 0.00 ? 20  SER A CA   7  
ATOM   7254  C  C    . SER A 1 20 ? -3.723  0.920   -5.965  1.00 0.00 ? 20  SER A C    7  
ATOM   7255  O  O    . SER A 1 20 ? -3.781  1.632   -6.969  1.00 0.00 ? 20  SER A O    7  
ATOM   7256  C  CB   . SER A 1 20 ? -2.046  0.646   -4.129  1.00 0.00 ? 20  SER A CB   7  
ATOM   7257  O  OG   . SER A 1 20 ? -0.832  1.060   -4.731  1.00 0.00 ? 20  SER A OG   7  
ATOM   7258  H  H    . SER A 1 20 ? -4.716  0.652   -3.382  1.00 0.00 ? 20  SER A H    7  
ATOM   7259  H  HA   . SER A 1 20 ? -2.896  2.497   -4.787  1.00 0.00 ? 20  SER A HA   7  
ATOM   7260  H  HB2  . SER A 1 20 ? -1.961  0.761   -3.059  1.00 0.00 ? 20  SER A HB2  7  
ATOM   7261  H  HB3  . SER A 1 20 ? -2.216  -0.394  -4.367  1.00 0.00 ? 20  SER A HB3  7  
ATOM   7262  H  HG   . SER A 1 20 ? -0.561  1.902   -4.359  1.00 0.00 ? 20  SER A HG   7  
ATOM   7263  N  N    . CYS A 1 21 ? -4.082  -0.359  -5.964  1.00 0.00 ? 21  CYS A N    7  
ATOM   7264  C  CA   . CYS A 1 21 ? -4.576  -1.016  -7.168  1.00 0.00 ? 21  CYS A CA   7  
ATOM   7265  C  C    . CYS A 1 21 ? -6.101  -1.051  -7.183  1.00 0.00 ? 21  CYS A C    7  
ATOM   7266  O  O    . CYS A 1 21 ? -6.711  -1.600  -8.100  1.00 0.00 ? 21  CYS A O    7  
ATOM   7267  C  CB   . CYS A 1 21 ? -4.021  -2.439  -7.262  1.00 0.00 ? 21  CYS A CB   7  
ATOM   7268  S  SG   . CYS A 1 21 ? -4.281  -3.438  -5.761  1.00 0.00 ? 21  CYS A SG   7  
ATOM   7269  H  H    . CYS A 1 21 ? -4.013  -0.875  -5.133  1.00 0.00 ? 21  CYS A H    7  
ATOM   7270  H  HA   . CYS A 1 21 ? -4.233  -0.449  -8.020  1.00 0.00 ? 21  CYS A HA   7  
ATOM   7271  H  HB2  . CYS A 1 21 ? -4.501  -2.951  -8.083  1.00 0.00 ? 21  CYS A HB2  7  
ATOM   7272  H  HB3  . CYS A 1 21 ? -2.958  -2.392  -7.446  1.00 0.00 ? 21  CYS A HB3  7  
ATOM   7273  N  N    . ASP A 1 22 ? -6.710  -0.461  -6.160  1.00 0.00 ? 22  ASP A N    7  
ATOM   7274  C  CA   . ASP A 1 22 ? -8.164  -0.422  -6.055  1.00 0.00 ? 22  ASP A CA   7  
ATOM   7275  C  C    . ASP A 1 22 ? -8.747  -1.832  -6.067  1.00 0.00 ? 22  ASP A C    7  
ATOM   7276  O  O    . ASP A 1 22 ? -9.672  -2.124  -6.825  1.00 0.00 ? 22  ASP A O    7  
ATOM   7277  C  CB   . ASP A 1 22 ? -8.758  0.399   -7.201  1.00 0.00 ? 22  ASP A CB   7  
ATOM   7278  C  CG   . ASP A 1 22 ? -10.066 1.064   -6.819  1.00 0.00 ? 22  ASP A CG   7  
ATOM   7279  O  OD1  . ASP A 1 22 ? -10.124 1.675   -5.731  1.00 0.00 ? 22  ASP A OD1  7  
ATOM   7280  O  OD2  . ASP A 1 22 ? -11.031 0.974   -7.607  1.00 0.00 ? 22  ASP A OD2  7  
ATOM   7281  H  H    . ASP A 1 22 ? -6.169  -0.040  -5.460  1.00 0.00 ? 22  ASP A H    7  
ATOM   7282  H  HA   . ASP A 1 22 ? -8.417  0.050   -5.118  1.00 0.00 ? 22  ASP A HA   7  
ATOM   7283  H  HB2  . ASP A 1 22 ? -8.055  1.167   -7.487  1.00 0.00 ? 22  ASP A HB2  7  
ATOM   7284  H  HB3  . ASP A 1 22 ? -8.939  -0.251  -8.045  1.00 0.00 ? 22  ASP A HB3  7  
ATOM   7285  N  N    . GLN A 1 23 ? -8.199  -2.701  -5.224  1.00 0.00 ? 23  GLN A N    7  
ATOM   7286  C  CA   . GLN A 1 23 ? -8.664  -4.080  -5.140  1.00 0.00 ? 23  GLN A CA   7  
ATOM   7287  C  C    . GLN A 1 23 ? -8.890  -4.491  -3.689  1.00 0.00 ? 23  GLN A C    7  
ATOM   7288  O  O    . GLN A 1 23 ? -8.146  -4.085  -2.795  1.00 0.00 ? 23  GLN A O    7  
ATOM   7289  C  CB   . GLN A 1 23 ? -7.655  -5.022  -5.798  1.00 0.00 ? 23  GLN A CB   7  
ATOM   7290  C  CG   . GLN A 1 23 ? -7.437  -4.744  -7.277  1.00 0.00 ? 23  GLN A CG   7  
ATOM   7291  C  CD   . GLN A 1 23 ? -8.705  -4.905  -8.093  1.00 0.00 ? 23  GLN A CD   7  
ATOM   7292  O  OE1  . GLN A 1 23 ? -9.225  -6.011  -8.241  1.00 0.00 ? 23  GLN A OE1  7  
ATOM   7293  N  NE2  . GLN A 1 23 ? -9.209  -3.800  -8.628  1.00 0.00 ? 23  GLN A NE2  7  
ATOM   7294  H  H    . GLN A 1 23 ? -7.465  -2.408  -4.646  1.00 0.00 ? 23  GLN A H    7  
ATOM   7295  H  HA   . GLN A 1 23 ? -9.603  -4.147  -5.670  1.00 0.00 ? 23  GLN A HA   7  
ATOM   7296  H  HB2  . GLN A 1 23 ? -6.706  -4.924  -5.292  1.00 0.00 ? 23  GLN A HB2  7  
ATOM   7297  H  HB3  . GLN A 1 23 ? -8.006  -6.038  -5.693  1.00 0.00 ? 23  GLN A HB3  7  
ATOM   7298  H  HG2  . GLN A 1 23 ? -7.081  -3.731  -7.391  1.00 0.00 ? 23  GLN A HG2  7  
ATOM   7299  H  HG3  . GLN A 1 23 ? -6.694  -5.431  -7.654  1.00 0.00 ? 23  GLN A HG3  7  
ATOM   7300  H  HE21 . GLN A 1 23 ? -8.740  -2.953  -8.469  1.00 0.00 ? 23  GLN A HE21 7  
ATOM   7301  H  HE22 . GLN A 1 23 ? -10.027 -3.875  -9.162  1.00 0.00 ? 23  GLN A HE22 7  
ATOM   7302  N  N    . PHE A 1 24 ? -9.920  -5.299  -3.461  1.00 0.00 ? 24  PHE A N    7  
ATOM   7303  C  CA   . PHE A 1 24 ? -10.245 -5.764  -2.117  1.00 0.00 ? 24  PHE A CA   7  
ATOM   7304  C  C    . PHE A 1 24 ? -9.073  -6.529  -1.509  1.00 0.00 ? 24  PHE A C    7  
ATOM   7305  O  O    . PHE A 1 24 ? -8.483  -7.397  -2.154  1.00 0.00 ? 24  PHE A O    7  
ATOM   7306  C  CB   . PHE A 1 24 ? -11.489 -6.654  -2.149  1.00 0.00 ? 24  PHE A CB   7  
ATOM   7307  C  CG   . PHE A 1 24 ? -12.774 -5.885  -2.260  1.00 0.00 ? 24  PHE A CG   7  
ATOM   7308  C  CD1  . PHE A 1 24 ? -12.897 -4.843  -3.165  1.00 0.00 ? 24  PHE A CD1  7  
ATOM   7309  C  CD2  . PHE A 1 24 ? -13.859 -6.204  -1.460  1.00 0.00 ? 24  PHE A CD2  7  
ATOM   7310  C  CE1  . PHE A 1 24 ? -14.078 -4.133  -3.269  1.00 0.00 ? 24  PHE A CE1  7  
ATOM   7311  C  CE2  . PHE A 1 24 ? -15.043 -5.498  -1.560  1.00 0.00 ? 24  PHE A CE2  7  
ATOM   7312  C  CZ   . PHE A 1 24 ? -15.153 -4.461  -2.466  1.00 0.00 ? 24  PHE A CZ   7  
ATOM   7313  H  H    . PHE A 1 24 ? -10.476 -5.588  -4.214  1.00 0.00 ? 24  PHE A H    7  
ATOM   7314  H  HA   . PHE A 1 24 ? -10.448 -4.897  -1.508  1.00 0.00 ? 24  PHE A HA   7  
ATOM   7315  H  HB2  . PHE A 1 24 ? -11.426 -7.318  -2.998  1.00 0.00 ? 24  PHE A HB2  7  
ATOM   7316  H  HB3  . PHE A 1 24 ? -11.527 -7.239  -1.242  1.00 0.00 ? 24  PHE A HB3  7  
ATOM   7317  H  HD1  . PHE A 1 24 ? -12.057 -4.585  -3.794  1.00 0.00 ? 24  PHE A HD1  7  
ATOM   7318  H  HD2  . PHE A 1 24 ? -13.774 -7.015  -0.751  1.00 0.00 ? 24  PHE A HD2  7  
ATOM   7319  H  HE1  . PHE A 1 24 ? -14.161 -3.323  -3.978  1.00 0.00 ? 24  PHE A HE1  7  
ATOM   7320  H  HE2  . PHE A 1 24 ? -15.881 -5.758  -0.931  1.00 0.00 ? 24  PHE A HE2  7  
ATOM   7321  H  HZ   . PHE A 1 24 ? -16.077 -3.908  -2.545  1.00 0.00 ? 24  PHE A HZ   7  
ATOM   7322  N  N    . ILE A 1 25 ? -8.741  -6.200  -0.265  1.00 0.00 ? 25  ILE A N    7  
ATOM   7323  C  CA   . ILE A 1 25 ? -7.641  -6.856  0.430   1.00 0.00 ? 25  ILE A CA   7  
ATOM   7324  C  C    . ILE A 1 25 ? -8.143  -8.021  1.278   1.00 0.00 ? 25  ILE A C    7  
ATOM   7325  O  O    . ILE A 1 25 ? -8.707  -7.820  2.353   1.00 0.00 ? 25  ILE A O    7  
ATOM   7326  C  CB   . ILE A 1 25 ? -6.878  -5.870  1.334   1.00 0.00 ? 25  ILE A CB   7  
ATOM   7327  C  CG1  . ILE A 1 25 ? -6.540  -4.594  0.561   1.00 0.00 ? 25  ILE A CG1  7  
ATOM   7328  C  CG2  . ILE A 1 25 ? -5.613  -6.518  1.877   1.00 0.00 ? 25  ILE A CG2  7  
ATOM   7329  C  CD1  . ILE A 1 25 ? -5.960  -3.498  1.428   1.00 0.00 ? 25  ILE A CD1  7  
ATOM   7330  H  H    . ILE A 1 25 ? -9.249  -5.501  0.196   1.00 0.00 ? 25  ILE A H    7  
ATOM   7331  H  HA   . ILE A 1 25 ? -6.956  -7.236  -0.314  1.00 0.00 ? 25  ILE A HA   7  
ATOM   7332  H  HB   . ILE A 1 25 ? -7.512  -5.618  2.170   1.00 0.00 ? 25  ILE A HB   7  
ATOM   7333  H  HG12 . ILE A 1 25 ? -5.818  -4.826  -0.206  1.00 0.00 ? 25  ILE A HG12 7  
ATOM   7334  H  HG13 . ILE A 1 25 ? -7.439  -4.212  0.100   1.00 0.00 ? 25  ILE A HG13 7  
ATOM   7335  H  HG21 . ILE A 1 25 ? -4.799  -6.350  1.188   1.00 0.00 ? 25  ILE A HG21 7  
ATOM   7336  H  HG22 . ILE A 1 25 ? -5.369  -6.084  2.834   1.00 0.00 ? 25  ILE A HG22 7  
ATOM   7337  H  HG23 . ILE A 1 25 ? -5.774  -7.579  1.992   1.00 0.00 ? 25  ILE A HG23 7  
ATOM   7338  H  HD11 . ILE A 1 25 ? -5.512  -2.741  0.801   1.00 0.00 ? 25  ILE A HD11 7  
ATOM   7339  H  HD12 . ILE A 1 25 ? -6.745  -3.056  2.023   1.00 0.00 ? 25  ILE A HD12 7  
ATOM   7340  H  HD13 . ILE A 1 25 ? -5.206  -3.916  2.080   1.00 0.00 ? 25  ILE A HD13 7  
ATOM   7341  N  N    . GLU A 1 26 ? -7.931  -9.238  0.787   1.00 0.00 ? 26  GLU A N    7  
ATOM   7342  C  CA   . GLU A 1 26 ? -8.362  -10.434 1.500   1.00 0.00 ? 26  GLU A CA   7  
ATOM   7343  C  C    . GLU A 1 26 ? -7.273  -10.922 2.451   1.00 0.00 ? 26  GLU A C    7  
ATOM   7344  O  O    . GLU A 1 26 ? -6.089  -10.657 2.245   1.00 0.00 ? 26  GLU A O    7  
ATOM   7345  C  CB   . GLU A 1 26 ? -8.723  -11.543 0.510   1.00 0.00 ? 26  GLU A CB   7  
ATOM   7346  C  CG   . GLU A 1 26 ? -8.886  -12.908 1.157   1.00 0.00 ? 26  GLU A CG   7  
ATOM   7347  C  CD   . GLU A 1 26 ? -9.081  -14.016 0.141   1.00 0.00 ? 26  GLU A CD   7  
ATOM   7348  O  OE1  . GLU A 1 26 ? -10.020 -13.915 -0.676  1.00 0.00 ? 26  GLU A OE1  7  
ATOM   7349  O  OE2  . GLU A 1 26 ? -8.294  -14.985 0.163   1.00 0.00 ? 26  GLU A OE2  7  
ATOM   7350  H  H    . GLU A 1 26 ? -7.476  -9.333  -0.076  1.00 0.00 ? 26  GLU A H    7  
ATOM   7351  H  HA   . GLU A 1 26 ? -9.238  -10.179 2.076   1.00 0.00 ? 26  GLU A HA   7  
ATOM   7352  H  HB2  . GLU A 1 26 ? -9.652  -11.285 0.022   1.00 0.00 ? 26  GLU A HB2  7  
ATOM   7353  H  HB3  . GLU A 1 26 ? -7.943  -11.612 -0.234  1.00 0.00 ? 26  GLU A HB3  7  
ATOM   7354  H  HG2  . GLU A 1 26 ? -8.003  -13.125 1.738   1.00 0.00 ? 26  GLU A HG2  7  
ATOM   7355  H  HG3  . GLU A 1 26 ? -9.747  -12.882 1.810   1.00 0.00 ? 26  GLU A HG3  7  
ATOM   7356  N  N    . GLY A 1 27 ? -7.683  -11.635 3.496   1.00 0.00 ? 27  GLY A N    7  
ATOM   7357  C  CA   . GLY A 1 27 ? -6.731  -12.148 4.464   1.00 0.00 ? 27  GLY A CA   7  
ATOM   7358  C  C    . GLY A 1 27 ? -6.313  -11.100 5.476   1.00 0.00 ? 27  GLY A C    7  
ATOM   7359  O  O    . GLY A 1 27 ? -6.915  -10.983 6.542   1.00 0.00 ? 27  GLY A O    7  
ATOM   7360  H  H    . GLY A 1 27 ? -8.640  -11.815 3.609   1.00 0.00 ? 27  GLY A H    7  
ATOM   7361  H  HA2  . GLY A 1 27 ? -7.179  -12.980 4.987   1.00 0.00 ? 27  GLY A HA2  7  
ATOM   7362  H  HA3  . GLY A 1 27 ? -5.853  -12.496 3.939   1.00 0.00 ? 27  GLY A HA3  7  
ATOM   7363  N  N    . GLU A 1 28 ? -5.276  -10.338 5.142   1.00 0.00 ? 28  GLU A N    7  
ATOM   7364  C  CA   . GLU A 1 28 ? -4.777  -9.296  6.032   1.00 0.00 ? 28  GLU A CA   7  
ATOM   7365  C  C    . GLU A 1 28 ? -4.548  -7.994  5.271   1.00 0.00 ? 28  GLU A C    7  
ATOM   7366  O  O    . GLU A 1 28 ? -4.258  -8.003  4.075   1.00 0.00 ? 28  GLU A O    7  
ATOM   7367  C  CB   . GLU A 1 28 ? -3.474  -9.745  6.699   1.00 0.00 ? 28  GLU A CB   7  
ATOM   7368  C  CG   . GLU A 1 28 ? -2.881  -8.707  7.636   1.00 0.00 ? 28  GLU A CG   7  
ATOM   7369  C  CD   . GLU A 1 28 ? -2.028  -9.326  8.727   1.00 0.00 ? 28  GLU A CD   7  
ATOM   7370  O  OE1  . GLU A 1 28 ? -2.549  -10.184 9.470   1.00 0.00 ? 28  GLU A OE1  7  
ATOM   7371  O  OE2  . GLU A 1 28 ? -0.842  -8.952  8.838   1.00 0.00 ? 28  GLU A OE2  7  
ATOM   7372  H  H    . GLU A 1 28 ? -4.837  -10.479 4.278   1.00 0.00 ? 28  GLU A H    7  
ATOM   7373  H  HA   . GLU A 1 28 ? -5.521  -9.128  6.796   1.00 0.00 ? 28  GLU A HA   7  
ATOM   7374  H  HB2  . GLU A 1 28 ? -3.665  -10.645 7.265   1.00 0.00 ? 28  GLU A HB2  7  
ATOM   7375  H  HB3  . GLU A 1 28 ? -2.748  -9.963  5.930   1.00 0.00 ? 28  GLU A HB3  7  
ATOM   7376  H  HG2  . GLU A 1 28 ? -2.266  -8.031  7.061   1.00 0.00 ? 28  GLU A HG2  7  
ATOM   7377  H  HG3  . GLU A 1 28 ? -3.686  -8.156  8.098   1.00 0.00 ? 28  GLU A HG3  7  
ATOM   7378  N  N    . VAL A 1 29 ? -4.683  -6.873  5.974   1.00 0.00 ? 29  VAL A N    7  
ATOM   7379  C  CA   . VAL A 1 29 ? -4.491  -5.562  5.366   1.00 0.00 ? 29  VAL A CA   7  
ATOM   7380  C  C    . VAL A 1 29 ? -3.551  -4.701  6.202   1.00 0.00 ? 29  VAL A C    7  
ATOM   7381  O  O    . VAL A 1 29 ? -3.478  -4.847  7.423   1.00 0.00 ? 29  VAL A O    7  
ATOM   7382  C  CB   . VAL A 1 29 ? -5.831  -4.822  5.194   1.00 0.00 ? 29  VAL A CB   7  
ATOM   7383  C  CG1  . VAL A 1 29 ? -6.675  -4.946  6.454   1.00 0.00 ? 29  VAL A CG1  7  
ATOM   7384  C  CG2  . VAL A 1 29 ? -5.591  -3.361  4.845   1.00 0.00 ? 29  VAL A CG2  7  
ATOM   7385  H  H    . VAL A 1 29 ? -4.916  -6.930  6.924   1.00 0.00 ? 29  VAL A H    7  
ATOM   7386  H  HA   . VAL A 1 29 ? -4.056  -5.707  4.388   1.00 0.00 ? 29  VAL A HA   7  
ATOM   7387  H  HB   . VAL A 1 29 ? -6.371  -5.281  4.379   1.00 0.00 ? 29  VAL A HB   7  
ATOM   7388  H  HG11 . VAL A 1 29 ? -7.704  -4.709  6.222   1.00 0.00 ? 29  VAL A HG11 7  
ATOM   7389  H  HG12 . VAL A 1 29 ? -6.613  -5.956  6.831   1.00 0.00 ? 29  VAL A HG12 7  
ATOM   7390  H  HG13 . VAL A 1 29 ? -6.308  -4.258  7.202   1.00 0.00 ? 29  VAL A HG13 7  
ATOM   7391  H  HG21 . VAL A 1 29 ? -5.401  -2.802  5.749   1.00 0.00 ? 29  VAL A HG21 7  
ATOM   7392  H  HG22 . VAL A 1 29 ? -4.738  -3.283  4.187   1.00 0.00 ? 29  VAL A HG22 7  
ATOM   7393  H  HG23 . VAL A 1 29 ? -6.464  -2.960  4.351   1.00 0.00 ? 29  VAL A HG23 7  
ATOM   7394  N  N    . VAL A 1 30 ? -2.833  -3.801  5.538   1.00 0.00 ? 30  VAL A N    7  
ATOM   7395  C  CA   . VAL A 1 30 ? -1.898  -2.914  6.219   1.00 0.00 ? 30  VAL A CA   7  
ATOM   7396  C  C    . VAL A 1 30 ? -2.425  -1.484  6.257   1.00 0.00 ? 30  VAL A C    7  
ATOM   7397  O  O    . VAL A 1 30 ? -2.446  -0.792  5.239   1.00 0.00 ? 30  VAL A O    7  
ATOM   7398  C  CB   . VAL A 1 30 ? -0.517  -2.923  5.537   1.00 0.00 ? 30  VAL A CB   7  
ATOM   7399  C  CG1  . VAL A 1 30 ? 0.451   -2.013  6.278   1.00 0.00 ? 30  VAL A CG1  7  
ATOM   7400  C  CG2  . VAL A 1 30 ? 0.027   -4.341  5.456   1.00 0.00 ? 30  VAL A CG2  7  
ATOM   7401  H  H    . VAL A 1 30 ? -2.935  -3.732  4.565   1.00 0.00 ? 30  VAL A H    7  
ATOM   7402  H  HA   . VAL A 1 30 ? -1.778  -3.270  7.232   1.00 0.00 ? 30  VAL A HA   7  
ATOM   7403  H  HB   . VAL A 1 30 ? -0.633  -2.546  4.531   1.00 0.00 ? 30  VAL A HB   7  
ATOM   7404  H  HG11 . VAL A 1 30 ? 0.994   -2.589  7.013   1.00 0.00 ? 30  VAL A HG11 7  
ATOM   7405  H  HG12 . VAL A 1 30 ? 1.145   -1.577  5.575   1.00 0.00 ? 30  VAL A HG12 7  
ATOM   7406  H  HG13 . VAL A 1 30 ? -0.102  -1.228  6.774   1.00 0.00 ? 30  VAL A HG13 7  
ATOM   7407  H  HG21 . VAL A 1 30 ? 0.953   -4.339  4.900   1.00 0.00 ? 30  VAL A HG21 7  
ATOM   7408  H  HG22 . VAL A 1 30 ? 0.207   -4.716  6.453   1.00 0.00 ? 30  VAL A HG22 7  
ATOM   7409  H  HG23 . VAL A 1 30 ? -0.691  -4.975  4.957   1.00 0.00 ? 30  VAL A HG23 7  
ATOM   7410  N  N    . SER A 1 31 ? -2.850  -1.047  7.438   1.00 0.00 ? 31  SER A N    7  
ATOM   7411  C  CA   . SER A 1 31 ? -3.381  0.301   7.608   1.00 0.00 ? 31  SER A CA   7  
ATOM   7412  C  C    . SER A 1 31 ? -2.254  1.329   7.629   1.00 0.00 ? 31  SER A C    7  
ATOM   7413  O  O    . SER A 1 31 ? -1.414  1.328   8.529   1.00 0.00 ? 31  SER A O    7  
ATOM   7414  C  CB   . SER A 1 31 ? -4.194  0.392   8.901   1.00 0.00 ? 31  SER A CB   7  
ATOM   7415  O  OG   . SER A 1 31 ? -5.557  0.080   8.669   1.00 0.00 ? 31  SER A OG   7  
ATOM   7416  H  H    . SER A 1 31 ? -2.808  -1.646  8.213   1.00 0.00 ? 31  SER A H    7  
ATOM   7417  H  HA   . SER A 1 31 ? -4.028  0.510   6.770   1.00 0.00 ? 31  SER A HA   7  
ATOM   7418  H  HB2  . SER A 1 31 ? -3.796  -0.304  9.624   1.00 0.00 ? 31  SER A HB2  7  
ATOM   7419  H  HB3  . SER A 1 31 ? -4.128  1.396   9.294   1.00 0.00 ? 31  SER A HB3  7  
ATOM   7420  H  HG   . SER A 1 31 ? -5.866  0.555   7.895   1.00 0.00 ? 31  SER A HG   7  
ATOM   7421  N  N    . ALA A 1 32 ? -2.243  2.206   6.631   1.00 0.00 ? 32  ALA A N    7  
ATOM   7422  C  CA   . ALA A 1 32 ? -1.222  3.242   6.534   1.00 0.00 ? 32  ALA A CA   7  
ATOM   7423  C  C    . ALA A 1 32 ? -1.838  4.632   6.654   1.00 0.00 ? 32  ALA A C    7  
ATOM   7424  O  O    . ALA A 1 32 ? -2.597  5.063   5.784   1.00 0.00 ? 32  ALA A O    7  
ATOM   7425  C  CB   . ALA A 1 32 ? -0.460  3.111   5.224   1.00 0.00 ? 32  ALA A CB   7  
ATOM   7426  H  H    . ALA A 1 32 ? -2.940  2.156   5.943   1.00 0.00 ? 32  ALA A H    7  
ATOM   7427  H  HA   . ALA A 1 32 ? -0.523  3.098   7.346   1.00 0.00 ? 32  ALA A HA   7  
ATOM   7428  H  HB1  . ALA A 1 32 ? -0.922  3.737   4.475   1.00 0.00 ? 32  ALA A HB1  7  
ATOM   7429  H  HB2  . ALA A 1 32 ? 0.564   3.422   5.372   1.00 0.00 ? 32  ALA A HB2  7  
ATOM   7430  H  HB3  . ALA A 1 32 ? -0.481  2.082   4.897   1.00 0.00 ? 32  ALA A HB3  7  
ATOM   7431  N  N    . LEU A 1 33 ? -1.507  5.330   7.735   1.00 0.00 ? 33  LEU A N    7  
ATOM   7432  C  CA   . LEU A 1 33 ? -2.028  6.672   7.968   1.00 0.00 ? 33  LEU A CA   7  
ATOM   7433  C  C    . LEU A 1 33 ? -3.553  6.679   7.927   1.00 0.00 ? 33  LEU A C    7  
ATOM   7434  O  O    . LEU A 1 33 ? -4.169  7.671   7.539   1.00 0.00 ? 33  LEU A O    7  
ATOM   7435  C  CB   . LEU A 1 33 ? -1.473  7.644   6.925   1.00 0.00 ? 33  LEU A CB   7  
ATOM   7436  C  CG   . LEU A 1 33 ? -0.010  8.052   7.099   1.00 0.00 ? 33  LEU A CG   7  
ATOM   7437  C  CD1  . LEU A 1 33 ? 0.587   8.481   5.768   1.00 0.00 ? 33  LEU A CD1  7  
ATOM   7438  C  CD2  . LEU A 1 33 ? 0.114   9.168   8.126   1.00 0.00 ? 33  LEU A CD2  7  
ATOM   7439  H  H    . LEU A 1 33 ? -0.898  4.934   8.392   1.00 0.00 ? 33  LEU A H    7  
ATOM   7440  H  HA   . LEU A 1 33 ? -1.705  6.987   8.949   1.00 0.00 ? 33  LEU A HA   7  
ATOM   7441  H  HB2  . LEU A 1 33 ? -1.574  7.182   5.956   1.00 0.00 ? 33  LEU A HB2  7  
ATOM   7442  H  HB3  . LEU A 1 33 ? -2.074  8.542   6.959   1.00 0.00 ? 33  LEU A HB3  7  
ATOM   7443  H  HG   . LEU A 1 33 ? 0.554   7.202   7.459   1.00 0.00 ? 33  LEU A HG   7  
ATOM   7444  H  HD11 . LEU A 1 33 ? 0.471   9.548   5.649   1.00 0.00 ? 33  LEU A HD11 7  
ATOM   7445  H  HD12 . LEU A 1 33 ? 0.076   7.972   4.964   1.00 0.00 ? 33  LEU A HD12 7  
ATOM   7446  H  HD13 . LEU A 1 33 ? 1.636   8.227   5.745   1.00 0.00 ? 33  LEU A HD13 7  
ATOM   7447  H  HD21 . LEU A 1 33 ? 0.500   8.765   9.051   1.00 0.00 ? 33  LEU A HD21 7  
ATOM   7448  H  HD22 . LEU A 1 33 ? -0.858  9.605   8.302   1.00 0.00 ? 33  LEU A HD22 7  
ATOM   7449  H  HD23 . LEU A 1 33 ? 0.788   9.926   7.754   1.00 0.00 ? 33  LEU A HD23 7  
ATOM   7450  N  N    . GLY A 1 34 ? -4.156  5.566   8.331   1.00 0.00 ? 34  GLY A N    7  
ATOM   7451  C  CA   . GLY A 1 34 ? -5.604  5.466   8.335   1.00 0.00 ? 34  GLY A CA   7  
ATOM   7452  C  C    . GLY A 1 34 ? -6.141  4.785   7.091   1.00 0.00 ? 34  GLY A C    7  
ATOM   7453  O  O    . GLY A 1 34 ? -7.242  4.234   7.101   1.00 0.00 ? 34  GLY A O    7  
ATOM   7454  H  H    . GLY A 1 34 ? -3.614  4.806   8.630   1.00 0.00 ? 34  GLY A H    7  
ATOM   7455  H  HA2  . GLY A 1 34 ? -5.913  4.902   9.202   1.00 0.00 ? 34  GLY A HA2  7  
ATOM   7456  H  HA3  . GLY A 1 34 ? -6.022  6.460   8.395   1.00 0.00 ? 34  GLY A HA3  7  
ATOM   7457  N  N    . LYS A 1 35 ? -5.363  4.825   6.014   1.00 0.00 ? 35  LYS A N    7  
ATOM   7458  C  CA   . LYS A 1 35 ? -5.766  4.208   4.756   1.00 0.00 ? 35  LYS A CA   7  
ATOM   7459  C  C    . LYS A 1 35 ? -5.386  2.731   4.728   1.00 0.00 ? 35  LYS A C    7  
ATOM   7460  O  O    . LYS A 1 35 ? -4.723  2.232   5.638   1.00 0.00 ? 35  LYS A O    7  
ATOM   7461  C  CB   . LYS A 1 35 ? -5.115  4.935   3.577   1.00 0.00 ? 35  LYS A CB   7  
ATOM   7462  C  CG   . LYS A 1 35 ? -5.276  6.445   3.629   1.00 0.00 ? 35  LYS A CG   7  
ATOM   7463  C  CD   . LYS A 1 35 ? -6.564  6.892   2.960   1.00 0.00 ? 35  LYS A CD   7  
ATOM   7464  C  CE   . LYS A 1 35 ? -7.704  7.000   3.960   1.00 0.00 ? 35  LYS A CE   7  
ATOM   7465  N  NZ   . LYS A 1 35 ? -7.802  8.366   4.544   1.00 0.00 ? 35  LYS A NZ   7  
ATOM   7466  H  H    . LYS A 1 35 ? -4.496  5.280   6.068   1.00 0.00 ? 35  LYS A H    7  
ATOM   7467  H  HA   . LYS A 1 35 ? -6.838  4.294   4.673   1.00 0.00 ? 35  LYS A HA   7  
ATOM   7468  H  HB2  . LYS A 1 35 ? -4.059  4.707   3.566   1.00 0.00 ? 35  LYS A HB2  7  
ATOM   7469  H  HB3  . LYS A 1 35 ? -5.561  4.579   2.659   1.00 0.00 ? 35  LYS A HB3  7  
ATOM   7470  H  HG2  . LYS A 1 35 ? -5.291  6.760   4.662   1.00 0.00 ? 35  LYS A HG2  7  
ATOM   7471  H  HG3  . LYS A 1 35 ? -4.439  6.905   3.123   1.00 0.00 ? 35  LYS A HG3  7  
ATOM   7472  H  HD2  . LYS A 1 35 ? -6.407  7.859   2.505   1.00 0.00 ? 35  LYS A HD2  7  
ATOM   7473  H  HD3  . LYS A 1 35 ? -6.832  6.173   2.198   1.00 0.00 ? 35  LYS A HD3  7  
ATOM   7474  H  HE2  . LYS A 1 35 ? -8.630  6.765   3.458   1.00 0.00 ? 35  LYS A HE2  7  
ATOM   7475  H  HE3  . LYS A 1 35 ? -7.536  6.289   4.756   1.00 0.00 ? 35  LYS A HE3  7  
ATOM   7476  H  HZ1  . LYS A 1 35 ? -7.303  8.402   5.456   1.00 0.00 ? 35  LYS A HZ1  7  
ATOM   7477  H  HZ2  . LYS A 1 35 ? -8.799  8.619   4.698   1.00 0.00 ? 35  LYS A HZ2  7  
ATOM   7478  H  HZ3  . LYS A 1 35 ? -7.375  9.062   3.900   1.00 0.00 ? 35  LYS A HZ3  7  
ATOM   7479  N  N    . THR A 1 36 ? -5.809  2.036   3.677   1.00 0.00 ? 36  THR A N    7  
ATOM   7480  C  CA   . THR A 1 36 ? -5.513  0.616   3.530   1.00 0.00 ? 36  THR A CA   7  
ATOM   7481  C  C    . THR A 1 36 ? -4.663  0.357   2.292   1.00 0.00 ? 36  THR A C    7  
ATOM   7482  O  O    . THR A 1 36 ? -4.910  0.924   1.227   1.00 0.00 ? 36  THR A O    7  
ATOM   7483  C  CB   . THR A 1 36 ? -6.804  -0.220  3.437   1.00 0.00 ? 36  THR A CB   7  
ATOM   7484  O  OG1  . THR A 1 36 ? -7.719  0.392   2.522   1.00 0.00 ? 36  THR A OG1  7  
ATOM   7485  C  CG2  . THR A 1 36 ? -7.459  -0.356  4.803   1.00 0.00 ? 36  THR A CG2  7  
ATOM   7486  H  H    . THR A 1 36 ? -6.333  2.490   2.984   1.00 0.00 ? 36  THR A H    7  
ATOM   7487  H  HA   . THR A 1 36 ? -4.965  0.298   4.405   1.00 0.00 ? 36  THR A HA   7  
ATOM   7488  H  HB   . THR A 1 36 ? -6.550  -1.206  3.076   1.00 0.00 ? 36  THR A HB   7  
ATOM   7489  H  HG1  . THR A 1 36 ? -7.410  0.259   1.623   1.00 0.00 ? 36  THR A HG1  7  
ATOM   7490  H  HG21 . THR A 1 36 ? -8.481  -0.010  4.749   1.00 0.00 ? 36  THR A HG21 7  
ATOM   7491  H  HG22 . THR A 1 36 ? -6.916  0.236   5.524   1.00 0.00 ? 36  THR A HG22 7  
ATOM   7492  H  HG23 . THR A 1 36 ? -7.446  -1.392  5.106   1.00 0.00 ? 36  THR A HG23 7  
ATOM   7493  N  N    . TYR A 1 37 ? -3.662  -0.504  2.437   1.00 0.00 ? 37  TYR A N    7  
ATOM   7494  C  CA   . TYR A 1 37 ? -2.774  -0.837  1.330   1.00 0.00 ? 37  TYR A CA   7  
ATOM   7495  C  C    . TYR A 1 37 ? -2.377  -2.310  1.374   1.00 0.00 ? 37  TYR A C    7  
ATOM   7496  O  O    . TYR A 1 37 ? -2.409  -2.942  2.430   1.00 0.00 ? 37  TYR A O    7  
ATOM   7497  C  CB   . TYR A 1 37 ? -1.522  0.041   1.370   1.00 0.00 ? 37  TYR A CB   7  
ATOM   7498  C  CG   . TYR A 1 37 ? -1.782  1.483   0.993   1.00 0.00 ? 37  TYR A CG   7  
ATOM   7499  C  CD1  . TYR A 1 37 ? -1.940  1.856   -0.336  1.00 0.00 ? 37  TYR A CD1  7  
ATOM   7500  C  CD2  . TYR A 1 37 ? -1.869  2.471   1.966   1.00 0.00 ? 37  TYR A CD2  7  
ATOM   7501  C  CE1  . TYR A 1 37 ? -2.176  3.172   -0.685  1.00 0.00 ? 37  TYR A CE1  7  
ATOM   7502  C  CE2  . TYR A 1 37 ? -2.107  3.789   1.626   1.00 0.00 ? 37  TYR A CE2  7  
ATOM   7503  C  CZ   . TYR A 1 37 ? -2.259  4.134   0.299   1.00 0.00 ? 37  TYR A CZ   7  
ATOM   7504  O  OH   . TYR A 1 37 ? -2.495  5.446   -0.043  1.00 0.00 ? 37  TYR A OH   7  
ATOM   7505  H  H    . TYR A 1 37 ? -3.515  -0.924  3.310   1.00 0.00 ? 37  TYR A H    7  
ATOM   7506  H  HA   . TYR A 1 37 ? -3.306  -0.647  0.409   1.00 0.00 ? 37  TYR A HA   7  
ATOM   7507  H  HB2  . TYR A 1 37 ? -1.114  0.029   2.368   1.00 0.00 ? 37  TYR A HB2  7  
ATOM   7508  H  HB3  . TYR A 1 37 ? -0.790  -0.355  0.681   1.00 0.00 ? 37  TYR A HB3  7  
ATOM   7509  H  HD1  . TYR A 1 37 ? -1.874  1.100   -1.105  1.00 0.00 ? 37  TYR A HD1  7  
ATOM   7510  H  HD2  . TYR A 1 37 ? -1.748  2.197   3.004   1.00 0.00 ? 37  TYR A HD2  7  
ATOM   7511  H  HE1  . TYR A 1 37 ? -2.296  3.442   -1.724  1.00 0.00 ? 37  TYR A HE1  7  
ATOM   7512  H  HE2  . TYR A 1 37 ? -2.171  4.542   2.397   1.00 0.00 ? 37  TYR A HE2  7  
ATOM   7513  H  HH   . TYR A 1 37 ? -2.031  5.652   -0.858  1.00 0.00 ? 37  TYR A HH   7  
ATOM   7514  N  N    . HIS A 1 38 ? -2.001  -2.850  0.219   1.00 0.00 ? 38  HIS A N    7  
ATOM   7515  C  CA   . HIS A 1 38 ? -1.596  -4.248  0.124   1.00 0.00 ? 38  HIS A CA   7  
ATOM   7516  C  C    . HIS A 1 38 ? -0.178  -4.439  0.654   1.00 0.00 ? 38  HIS A C    7  
ATOM   7517  O  O    . HIS A 1 38 ? 0.610   -3.497  0.743   1.00 0.00 ? 38  HIS A O    7  
ATOM   7518  C  CB   . HIS A 1 38 ? -1.681  -4.728  -1.324  1.00 0.00 ? 38  HIS A CB   7  
ATOM   7519  C  CG   . HIS A 1 38 ? -3.031  -5.259  -1.701  1.00 0.00 ? 38  HIS A CG   7  
ATOM   7520  N  ND1  . HIS A 1 38 ? -3.793  -4.723  -2.717  1.00 0.00 ? 38  HIS A ND1  7  
ATOM   7521  C  CD2  . HIS A 1 38 ? -3.753  -6.284  -1.192  1.00 0.00 ? 38  HIS A CD2  7  
ATOM   7522  C  CE1  . HIS A 1 38 ? -4.926  -5.395  -2.816  1.00 0.00 ? 38  HIS A CE1  7  
ATOM   7523  N  NE2  . HIS A 1 38 ? -4.926  -6.348  -1.901  1.00 0.00 ? 38  HIS A NE2  7  
ATOM   7524  H  H    . HIS A 1 38 ? -1.996  -2.295  -0.589  1.00 0.00 ? 38  HIS A H    7  
ATOM   7525  H  HA   . HIS A 1 38 ? -2.274  -4.831  0.729   1.00 0.00 ? 38  HIS A HA   7  
ATOM   7526  H  HB2  . HIS A 1 38 ? -1.454  -3.904  -1.984  1.00 0.00 ? 38  HIS A HB2  7  
ATOM   7527  H  HB3  . HIS A 1 38 ? -0.959  -5.517  -1.479  1.00 0.00 ? 38  HIS A HB3  7  
ATOM   7528  H  HD2  . HIS A 1 38 ? -3.460  -6.932  -0.377  1.00 0.00 ? 38  HIS A HD2  7  
ATOM   7529  H  HE1  . HIS A 1 38 ? -5.718  -5.199  -3.523  1.00 0.00 ? 38  HIS A HE1  7  
ATOM   7530  H  HE2  . HIS A 1 38 ? -5.683  -6.937  -1.700  1.00 0.00 ? 38  HIS A HE2  7  
ATOM   7531  N  N    . PRO A 1 39 ? 0.157   -5.687  1.014   1.00 0.00 ? 39  PRO A N    7  
ATOM   7532  C  CA   . PRO A 1 39 ? 1.481   -6.031  1.541   1.00 0.00 ? 39  PRO A CA   7  
ATOM   7533  C  C    . PRO A 1 39 ? 2.569   -5.942  0.476   1.00 0.00 ? 39  PRO A C    7  
ATOM   7534  O  O    . PRO A 1 39 ? 3.744   -6.179  0.755   1.00 0.00 ? 39  PRO A O    7  
ATOM   7535  C  CB   . PRO A 1 39 ? 1.310   -7.477  2.012   1.00 0.00 ? 39  PRO A CB   7  
ATOM   7536  C  CG   . PRO A 1 39 ? 0.194   -8.016  1.185   1.00 0.00 ? 39  PRO A CG   7  
ATOM   7537  C  CD   . PRO A 1 39 ? -0.732  -6.858  0.935   1.00 0.00 ? 39  PRO A CD   7  
ATOM   7538  H  HA   . PRO A 1 39 ? 1.748   -5.406  2.380   1.00 0.00 ? 39  PRO A HA   7  
ATOM   7539  H  HB2  . PRO A 1 39 ? 2.227   -8.024  1.843   1.00 0.00 ? 39  PRO A HB2  7  
ATOM   7540  H  HB3  . PRO A 1 39 ? 1.064   -7.491  3.063   1.00 0.00 ? 39  PRO A HB3  7  
ATOM   7541  H  HG2  . PRO A 1 39 ? 0.580   -8.396  0.251   1.00 0.00 ? 39  PRO A HG2  7  
ATOM   7542  H  HG3  . PRO A 1 39 ? -0.320  -8.797  1.726   1.00 0.00 ? 39  PRO A HG3  7  
ATOM   7543  H  HD2  . PRO A 1 39 ? -1.179  -6.938  -0.045  1.00 0.00 ? 39  PRO A HD2  7  
ATOM   7544  H  HD3  . PRO A 1 39 ? -1.496  -6.815  1.697   1.00 0.00 ? 39  PRO A HD3  7  
ATOM   7545  N  N    . ASP A 1 40 ? 2.170   -5.599  -0.743  1.00 0.00 ? 40  ASP A N    7  
ATOM   7546  C  CA   . ASP A 1 40 ? 3.112   -5.477  -1.850  1.00 0.00 ? 40  ASP A CA   7  
ATOM   7547  C  C    . ASP A 1 40 ? 2.936   -4.144  -2.570  1.00 0.00 ? 40  ASP A C    7  
ATOM   7548  O  O    . ASP A 1 40 ? 3.701   -3.808  -3.474  1.00 0.00 ? 40  ASP A O    7  
ATOM   7549  C  CB   . ASP A 1 40 ? 2.927   -6.631  -2.835  1.00 0.00 ? 40  ASP A CB   7  
ATOM   7550  C  CG   . ASP A 1 40 ? 4.156   -6.866  -3.691  1.00 0.00 ? 40  ASP A CG   7  
ATOM   7551  O  OD1  . ASP A 1 40 ? 5.009   -5.957  -3.765  1.00 0.00 ? 40  ASP A OD1  7  
ATOM   7552  O  OD2  . ASP A 1 40 ? 4.265   -7.958  -4.287  1.00 0.00 ? 40  ASP A OD2  7  
ATOM   7553  H  H    . ASP A 1 40 ? 1.219   -5.422  -0.903  1.00 0.00 ? 40  ASP A H    7  
ATOM   7554  H  HA   . ASP A 1 40 ? 4.111   -5.521  -1.442  1.00 0.00 ? 40  ASP A HA   7  
ATOM   7555  H  HB2  . ASP A 1 40 ? 2.717   -7.537  -2.284  1.00 0.00 ? 40  ASP A HB2  7  
ATOM   7556  H  HB3  . ASP A 1 40 ? 2.094   -6.410  -3.486  1.00 0.00 ? 40  ASP A HB3  7  
ATOM   7557  N  N    . CYS A 1 41 ? 1.921   -3.388  -2.164  1.00 0.00 ? 41  CYS A N    7  
ATOM   7558  C  CA   . CYS A 1 41 ? 1.641   -2.092  -2.771  1.00 0.00 ? 41  CYS A CA   7  
ATOM   7559  C  C    . CYS A 1 41 ? 2.227   -0.961  -1.931  1.00 0.00 ? 41  CYS A C    7  
ATOM   7560  O  O    . CYS A 1 41 ? 2.429   0.151   -2.421  1.00 0.00 ? 41  CYS A O    7  
ATOM   7561  C  CB   . CYS A 1 41 ? 0.132   -1.895  -2.930  1.00 0.00 ? 41  CYS A CB   7  
ATOM   7562  S  SG   . CYS A 1 41 ? -0.616  -2.916  -4.240  1.00 0.00 ? 41  CYS A SG   7  
ATOM   7563  H  H    . CYS A 1 41 ? 1.345   -3.710  -1.438  1.00 0.00 ? 41  CYS A H    7  
ATOM   7564  H  HA   . CYS A 1 41 ? 2.103   -2.076  -3.746  1.00 0.00 ? 41  CYS A HA   7  
ATOM   7565  H  HB2  . CYS A 1 41 ? -0.356  -2.146  -2.000  1.00 0.00 ? 41  CYS A HB2  7  
ATOM   7566  H  HB3  . CYS A 1 41 ? -0.065  -0.860  -3.167  1.00 0.00 ? 41  CYS A HB3  7  
ATOM   7567  N  N    . PHE A 1 42 ? 2.498   -1.252  -0.663  1.00 0.00 ? 42  PHE A N    7  
ATOM   7568  C  CA   . PHE A 1 42 ? 3.060   -0.260  0.246   1.00 0.00 ? 42  PHE A CA   7  
ATOM   7569  C  C    . PHE A 1 42 ? 4.582   -0.230  0.145   1.00 0.00 ? 42  PHE A C    7  
ATOM   7570  O  O    . PHE A 1 42 ? 5.277   -0.014  1.138   1.00 0.00 ? 42  PHE A O    7  
ATOM   7571  C  CB   . PHE A 1 42 ? 2.639   -0.560  1.687   1.00 0.00 ? 42  PHE A CB   7  
ATOM   7572  C  CG   . PHE A 1 42 ? 3.132   0.454   2.679   1.00 0.00 ? 42  PHE A CG   7  
ATOM   7573  C  CD1  . PHE A 1 42 ? 2.877   1.803   2.496   1.00 0.00 ? 42  PHE A CD1  7  
ATOM   7574  C  CD2  . PHE A 1 42 ? 3.851   0.057   3.795   1.00 0.00 ? 42  PHE A CD2  7  
ATOM   7575  C  CE1  . PHE A 1 42 ? 3.330   2.738   3.407   1.00 0.00 ? 42  PHE A CE1  7  
ATOM   7576  C  CE2  . PHE A 1 42 ? 4.307   0.988   4.710   1.00 0.00 ? 42  PHE A CE2  7  
ATOM   7577  C  CZ   . PHE A 1 42 ? 4.045   2.330   4.516   1.00 0.00 ? 42  PHE A CZ   7  
ATOM   7578  H  H    . PHE A 1 42 ? 2.315   -2.156  -0.330  1.00 0.00 ? 42  PHE A H    7  
ATOM   7579  H  HA   . PHE A 1 42 ? 2.673   0.707   -0.039  1.00 0.00 ? 42  PHE A HA   7  
ATOM   7580  H  HB2  . PHE A 1 42 ? 1.561   -0.580  1.742   1.00 0.00 ? 42  PHE A HB2  7  
ATOM   7581  H  HB3  . PHE A 1 42 ? 3.028   -1.525  1.974   1.00 0.00 ? 42  PHE A HB3  7  
ATOM   7582  H  HD1  . PHE A 1 42 ? 2.317   2.124   1.630   1.00 0.00 ? 42  PHE A HD1  7  
ATOM   7583  H  HD2  . PHE A 1 42 ? 4.056   -0.993  3.948   1.00 0.00 ? 42  PHE A HD2  7  
ATOM   7584  H  HE1  . PHE A 1 42 ? 3.124   3.787   3.254   1.00 0.00 ? 42  PHE A HE1  7  
ATOM   7585  H  HE2  . PHE A 1 42 ? 4.865   0.664   5.576   1.00 0.00 ? 42  PHE A HE2  7  
ATOM   7586  H  HZ   . PHE A 1 42 ? 4.401   3.058   5.230   1.00 0.00 ? 42  PHE A HZ   7  
ATOM   7587  N  N    . VAL A 1 43 ? 5.093   -0.449  -1.062  1.00 0.00 ? 43  VAL A N    7  
ATOM   7588  C  CA   . VAL A 1 43 ? 6.533   -0.447  -1.294  1.00 0.00 ? 43  VAL A CA   7  
ATOM   7589  C  C    . VAL A 1 43 ? 6.988   0.871   -1.912  1.00 0.00 ? 43  VAL A C    7  
ATOM   7590  O  O    . VAL A 1 43 ? 6.177   1.760   -2.174  1.00 0.00 ? 43  VAL A O    7  
ATOM   7591  C  CB   . VAL A 1 43 ? 6.954   -1.606  -2.217  1.00 0.00 ? 43  VAL A CB   7  
ATOM   7592  C  CG1  . VAL A 1 43 ? 6.620   -2.945  -1.578  1.00 0.00 ? 43  VAL A CG1  7  
ATOM   7593  C  CG2  . VAL A 1 43 ? 6.286   -1.473  -3.577  1.00 0.00 ? 43  VAL A CG2  7  
ATOM   7594  H  H    . VAL A 1 43 ? 4.488   -0.614  -1.814  1.00 0.00 ? 43  VAL A H    7  
ATOM   7595  H  HA   . VAL A 1 43 ? 7.025   -0.576  -0.341  1.00 0.00 ? 43  VAL A HA   7  
ATOM   7596  H  HB   . VAL A 1 43 ? 8.024   -1.556  -2.358  1.00 0.00 ? 43  VAL A HB   7  
ATOM   7597  H  HG11 . VAL A 1 43 ? 6.093   -2.779  -0.650  1.00 0.00 ? 43  VAL A HG11 7  
ATOM   7598  H  HG12 . VAL A 1 43 ? 5.998   -3.519  -2.249  1.00 0.00 ? 43  VAL A HG12 7  
ATOM   7599  H  HG13 . VAL A 1 43 ? 7.533   -3.487  -1.381  1.00 0.00 ? 43  VAL A HG13 7  
ATOM   7600  H  HG21 . VAL A 1 43 ? 7.015   -1.151  -4.306  1.00 0.00 ? 43  VAL A HG21 7  
ATOM   7601  H  HG22 . VAL A 1 43 ? 5.879   -2.429  -3.874  1.00 0.00 ? 43  VAL A HG22 7  
ATOM   7602  H  HG23 . VAL A 1 43 ? 5.490   -0.746  -3.519  1.00 0.00 ? 43  VAL A HG23 7  
ATOM   7603  N  N    . CYS A 1 44 ? 8.291   0.991   -2.143  1.00 0.00 ? 44  CYS A N    7  
ATOM   7604  C  CA   . CYS A 1 44 ? 8.856   2.200   -2.730  1.00 0.00 ? 44  CYS A CA   7  
ATOM   7605  C  C    . CYS A 1 44 ? 8.011   2.679   -3.907  1.00 0.00 ? 44  CYS A C    7  
ATOM   7606  O  O    . CYS A 1 44 ? 7.158   1.949   -4.409  1.00 0.00 ? 44  CYS A O    7  
ATOM   7607  C  CB   . CYS A 1 44 ? 10.293  1.945   -3.189  1.00 0.00 ? 44  CYS A CB   7  
ATOM   7608  S  SG   . CYS A 1 44 ? 11.242  3.461   -3.536  1.00 0.00 ? 44  CYS A SG   7  
ATOM   7609  H  H    . CYS A 1 44 ? 8.888   0.247   -1.912  1.00 0.00 ? 44  CYS A H    7  
ATOM   7610  H  HA   . CYS A 1 44 ? 8.861   2.967   -1.970  1.00 0.00 ? 44  CYS A HA   7  
ATOM   7611  H  HB2  . CYS A 1 44 ? 10.818  1.399   -2.419  1.00 0.00 ? 44  CYS A HB2  7  
ATOM   7612  H  HB3  . CYS A 1 44 ? 10.275  1.354   -4.093  1.00 0.00 ? 44  CYS A HB3  7  
ATOM   7613  N  N    . ALA A 1 45 ? 8.257   3.911   -4.341  1.00 0.00 ? 45  ALA A N    7  
ATOM   7614  C  CA   . ALA A 1 45 ? 7.521   4.487   -5.460  1.00 0.00 ? 45  ALA A CA   7  
ATOM   7615  C  C    . ALA A 1 45 ? 8.347   4.441   -6.742  1.00 0.00 ? 45  ALA A C    7  
ATOM   7616  O  O    . ALA A 1 45 ? 7.802   4.332   -7.840  1.00 0.00 ? 45  ALA A O    7  
ATOM   7617  C  CB   . ALA A 1 45 ? 7.114   5.918   -5.143  1.00 0.00 ? 45  ALA A CB   7  
ATOM   7618  H  H    . ALA A 1 45 ? 8.950   4.444   -3.900  1.00 0.00 ? 45  ALA A H    7  
ATOM   7619  H  HA   . ALA A 1 45 ? 6.622   3.905   -5.603  1.00 0.00 ? 45  ALA A HA   7  
ATOM   7620  H  HB1  . ALA A 1 45 ? 7.851   6.598   -5.545  1.00 0.00 ? 45  ALA A HB1  7  
ATOM   7621  H  HB2  . ALA A 1 45 ? 6.152   6.125   -5.588  1.00 0.00 ? 45  ALA A HB2  7  
ATOM   7622  H  HB3  . ALA A 1 45 ? 7.051   6.045   -4.073  1.00 0.00 ? 45  ALA A HB3  7  
ATOM   7623  N  N    . VAL A 1 46 ? 9.665   4.526   -6.594  1.00 0.00 ? 46  VAL A N    7  
ATOM   7624  C  CA   . VAL A 1 46 ? 10.566  4.495   -7.740  1.00 0.00 ? 46  VAL A CA   7  
ATOM   7625  C  C    . VAL A 1 46 ? 10.934  3.062   -8.110  1.00 0.00 ? 46  VAL A C    7  
ATOM   7626  O  O    . VAL A 1 46 ? 10.493  2.542   -9.136  1.00 0.00 ? 46  VAL A O    7  
ATOM   7627  C  CB   . VAL A 1 46 ? 11.857  5.288   -7.461  1.00 0.00 ? 46  VAL A CB   7  
ATOM   7628  C  CG1  . VAL A 1 46 ? 12.681  5.432   -8.732  1.00 0.00 ? 46  VAL A CG1  7  
ATOM   7629  C  CG2  . VAL A 1 46 ? 11.527  6.652   -6.873  1.00 0.00 ? 46  VAL A CG2  7  
ATOM   7630  H  H    . VAL A 1 46 ? 10.041  4.612   -5.693  1.00 0.00 ? 46  VAL A H    7  
ATOM   7631  H  HA   . VAL A 1 46 ? 10.060  4.954   -8.576  1.00 0.00 ? 46  VAL A HA   7  
ATOM   7632  H  HB   . VAL A 1 46 ? 12.443  4.740   -6.738  1.00 0.00 ? 46  VAL A HB   7  
ATOM   7633  H  HG11 . VAL A 1 46 ? 13.711  5.628   -8.472  1.00 0.00 ? 46  VAL A HG11 7  
ATOM   7634  H  HG12 . VAL A 1 46 ? 12.621  4.518   -9.305  1.00 0.00 ? 46  VAL A HG12 7  
ATOM   7635  H  HG13 . VAL A 1 46 ? 12.296  6.252   -9.319  1.00 0.00 ? 46  VAL A HG13 7  
ATOM   7636  H  HG21 . VAL A 1 46 ? 12.441  7.151   -6.588  1.00 0.00 ? 46  VAL A HG21 7  
ATOM   7637  H  HG22 . VAL A 1 46 ? 11.007  7.246   -7.611  1.00 0.00 ? 46  VAL A HG22 7  
ATOM   7638  H  HG23 . VAL A 1 46 ? 10.898  6.527   -6.004  1.00 0.00 ? 46  VAL A HG23 7  
ATOM   7639  N  N    . CYS A 1 47 ? 11.744  2.428   -7.269  1.00 0.00 ? 47  CYS A N    7  
ATOM   7640  C  CA   . CYS A 1 47 ? 12.171  1.055   -7.507  1.00 0.00 ? 47  CYS A CA   7  
ATOM   7641  C  C    . CYS A 1 47 ? 11.049  0.072   -7.185  1.00 0.00 ? 47  CYS A C    7  
ATOM   7642  O  O    . CYS A 1 47 ? 11.059  -1.069  -7.646  1.00 0.00 ? 47  CYS A O    7  
ATOM   7643  C  CB   . CYS A 1 47 ? 13.406  0.730   -6.663  1.00 0.00 ? 47  CYS A CB   7  
ATOM   7644  S  SG   . CYS A 1 47 ? 13.093  0.698   -4.869  1.00 0.00 ? 47  CYS A SG   7  
ATOM   7645  H  H    . CYS A 1 47 ? 12.062  2.896   -6.468  1.00 0.00 ? 47  CYS A H    7  
ATOM   7646  H  HA   . CYS A 1 47 ? 12.426  0.963   -8.552  1.00 0.00 ? 47  CYS A HA   7  
ATOM   7647  H  HB2  . CYS A 1 47 ? 13.781  -0.242  -6.948  1.00 0.00 ? 47  CYS A HB2  7  
ATOM   7648  H  HB3  . CYS A 1 47 ? 14.167  1.473   -6.852  1.00 0.00 ? 47  CYS A HB3  7  
ATOM   7649  N  N    . ARG A 1 48 ? 10.083  0.525   -6.393  1.00 0.00 ? 48  ARG A N    7  
ATOM   7650  C  CA   . ARG A 1 48 ? 8.954   -0.314  -6.009  1.00 0.00 ? 48  ARG A CA   7  
ATOM   7651  C  C    . ARG A 1 48 ? 9.434   -1.594  -5.330  1.00 0.00 ? 48  ARG A C    7  
ATOM   7652  O  O    . ARG A 1 48 ? 9.066   -2.699  -5.732  1.00 0.00 ? 48  ARG A O    7  
ATOM   7653  C  CB   . ARG A 1 48 ? 8.109   -0.661  -7.236  1.00 0.00 ? 48  ARG A CB   7  
ATOM   7654  C  CG   . ARG A 1 48 ? 7.731   0.547   -8.076  1.00 0.00 ? 48  ARG A CG   7  
ATOM   7655  C  CD   . ARG A 1 48 ? 6.474   1.222   -7.549  1.00 0.00 ? 48  ARG A CD   7  
ATOM   7656  N  NE   . ARG A 1 48 ? 5.706   1.857   -8.616  1.00 0.00 ? 48  ARG A NE   7  
ATOM   7657  C  CZ   . ARG A 1 48 ? 4.923   1.190   -9.456  1.00 0.00 ? 48  ARG A CZ   7  
ATOM   7658  N  NH1  . ARG A 1 48 ? 4.805   -0.127  -9.353  1.00 0.00 ? 48  ARG A NH1  7  
ATOM   7659  N  NH2  . ARG A 1 48 ? 4.255   1.839   -10.401 1.00 0.00 ? 48  ARG A NH2  7  
ATOM   7660  H  H    . ARG A 1 48 ? 10.131  1.444   -6.057  1.00 0.00 ? 48  ARG A H    7  
ATOM   7661  H  HA   . ARG A 1 48 ? 8.348   0.244   -5.311  1.00 0.00 ? 48  ARG A HA   7  
ATOM   7662  H  HB2  . ARG A 1 48 ? 8.664   -1.346  -7.859  1.00 0.00 ? 48  ARG A HB2  7  
ATOM   7663  H  HB3  . ARG A 1 48 ? 7.200   -1.142  -6.907  1.00 0.00 ? 48  ARG A HB3  7  
ATOM   7664  H  HG2  . ARG A 1 48 ? 8.544   1.258   -8.054  1.00 0.00 ? 48  ARG A HG2  7  
ATOM   7665  H  HG3  . ARG A 1 48 ? 7.559   0.227   -9.093  1.00 0.00 ? 48  ARG A HG3  7  
ATOM   7666  H  HD2  . ARG A 1 48 ? 5.857   0.477   -7.069  1.00 0.00 ? 48  ARG A HD2  7  
ATOM   7667  H  HD3  . ARG A 1 48 ? 6.760   1.972   -6.828  1.00 0.00 ? 48  ARG A HD3  7  
ATOM   7668  H  HE   . ARG A 1 48 ? 5.778   2.830   -8.710  1.00 0.00 ? 48  ARG A HE   7  
ATOM   7669  H  HH11 . ARG A 1 48 ? 5.306   -0.619  -8.641  1.00 0.00 ? 48  ARG A HH11 7  
ATOM   7670  H  HH12 . ARG A 1 48 ? 4.213   -0.627  -9.986  1.00 0.00 ? 48  ARG A HH12 7  
ATOM   7671  H  HH21 . ARG A 1 48 ? 4.341   2.832   -10.482 1.00 0.00 ? 48  ARG A HH21 7  
ATOM   7672  H  HH22 . ARG A 1 48 ? 3.666   1.336   -11.033 1.00 0.00 ? 48  ARG A HH22 7  
ATOM   7673  N  N    . LEU A 1 49 ? 10.257  -1.438  -4.299  1.00 0.00 ? 49  LEU A N    7  
ATOM   7674  C  CA   . LEU A 1 49 ? 10.788  -2.581  -3.564  1.00 0.00 ? 49  LEU A CA   7  
ATOM   7675  C  C    . LEU A 1 49 ? 10.366  -2.530  -2.099  1.00 0.00 ? 49  LEU A C    7  
ATOM   7676  O  O    . LEU A 1 49 ? 10.206  -1.460  -1.511  1.00 0.00 ? 49  LEU A O    7  
ATOM   7677  C  CB   . LEU A 1 49 ? 12.314  -2.613  -3.666  1.00 0.00 ? 49  LEU A CB   7  
ATOM   7678  C  CG   . LEU A 1 49 ? 13.074  -1.785  -2.629  1.00 0.00 ? 49  LEU A CG   7  
ATOM   7679  C  CD1  . LEU A 1 49 ? 13.087  -2.494  -1.284  1.00 0.00 ? 49  LEU A CD1  7  
ATOM   7680  C  CD2  . LEU A 1 49 ? 14.494  -1.510  -3.103  1.00 0.00 ? 49  LEU A CD2  7  
ATOM   7681  H  H    . LEU A 1 49 ? 10.515  -0.533  -4.025  1.00 0.00 ? 49  LEU A H    7  
ATOM   7682  H  HA   . LEU A 1 49 ? 10.387  -3.478  -4.011  1.00 0.00 ? 49  LEU A HA   7  
ATOM   7683  H  HB2  . LEU A 1 49 ? 12.631  -3.640  -3.565  1.00 0.00 ? 49  LEU A HB2  7  
ATOM   7684  H  HB3  . LEU A 1 49 ? 12.587  -2.249  -4.646  1.00 0.00 ? 49  LEU A HB3  7  
ATOM   7685  H  HG   . LEU A 1 49 ? 12.574  -0.835  -2.500  1.00 0.00 ? 49  LEU A HG   7  
ATOM   7686  H  HD11 . LEU A 1 49 ? 12.718  -3.502  -1.405  1.00 0.00 ? 49  LEU A HD11 7  
ATOM   7687  H  HD12 . LEU A 1 49 ? 12.455  -1.961  -0.590  1.00 0.00 ? 49  LEU A HD12 7  
ATOM   7688  H  HD13 . LEU A 1 49 ? 14.097  -2.523  -0.902  1.00 0.00 ? 49  LEU A HD13 7  
ATOM   7689  H  HD21 . LEU A 1 49 ? 15.186  -2.107  -2.528  1.00 0.00 ? 49  LEU A HD21 7  
ATOM   7690  H  HD22 . LEU A 1 49 ? 14.722  -0.462  -2.966  1.00 0.00 ? 49  LEU A HD22 7  
ATOM   7691  H  HD23 . LEU A 1 49 ? 14.580  -1.764  -4.148  1.00 0.00 ? 49  LEU A HD23 7  
ATOM   7692  N  N    . PRO A 1 50 ? 10.183  -3.713  -1.495  1.00 0.00 ? 50  PRO A N    7  
ATOM   7693  C  CA   . PRO A 1 50 ? 9.779   -3.830  -0.090  1.00 0.00 ? 50  PRO A CA   7  
ATOM   7694  C  C    . PRO A 1 50 ? 10.885  -3.401  0.868   1.00 0.00 ? 50  PRO A C    7  
ATOM   7695  O  O    . PRO A 1 50 ? 11.964  -3.995  0.893   1.00 0.00 ? 50  PRO A O    7  
ATOM   7696  C  CB   . PRO A 1 50 ? 9.482   -5.323  0.070   1.00 0.00 ? 50  PRO A CB   7  
ATOM   7697  C  CG   . PRO A 1 50 ? 10.304  -5.988  -0.980  1.00 0.00 ? 50  PRO A CG   7  
ATOM   7698  C  CD   . PRO A 1 50 ? 10.356  -5.028  -2.136  1.00 0.00 ? 50  PRO A CD   7  
ATOM   7699  H  HA   . PRO A 1 50 ? 8.885   -3.259  0.115   1.00 0.00 ? 50  PRO A HA   7  
ATOM   7700  H  HB2  . PRO A 1 50 ? 9.769   -5.646  1.061   1.00 0.00 ? 50  PRO A HB2  7  
ATOM   7701  H  HB3  . PRO A 1 50 ? 8.429   -5.503  -0.082  1.00 0.00 ? 50  PRO A HB3  7  
ATOM   7702  H  HG2  . PRO A 1 50 ? 11.299  -6.175  -0.603  1.00 0.00 ? 50  PRO A HG2  7  
ATOM   7703  H  HG3  . PRO A 1 50 ? 9.836   -6.913  -1.282  1.00 0.00 ? 50  PRO A HG3  7  
ATOM   7704  H  HD2  . PRO A 1 50 ? 11.310  -5.090  -2.636  1.00 0.00 ? 50  PRO A HD2  7  
ATOM   7705  H  HD3  . PRO A 1 50 ? 9.551   -5.227  -2.828  1.00 0.00 ? 50  PRO A HD3  7  
ATOM   7706  N  N    . PHE A 1 51 ? 10.610  -2.367  1.656   1.00 0.00 ? 51  PHE A N    7  
ATOM   7707  C  CA   . PHE A 1 51 ? 11.583  -1.858  2.617   1.00 0.00 ? 51  PHE A CA   7  
ATOM   7708  C  C    . PHE A 1 51 ? 12.024  -2.958  3.578   1.00 0.00 ? 51  PHE A C    7  
ATOM   7709  O  O    . PHE A 1 51 ? 11.209  -3.620  4.220   1.00 0.00 ? 51  PHE A O    7  
ATOM   7710  C  CB   . PHE A 1 51 ? 10.990  -0.686  3.402   1.00 0.00 ? 51  PHE A CB   7  
ATOM   7711  C  CG   . PHE A 1 51 ? 10.411  0.389   2.528   1.00 0.00 ? 51  PHE A CG   7  
ATOM   7712  C  CD1  . PHE A 1 51 ? 11.200  1.040   1.593   1.00 0.00 ? 51  PHE A CD1  7  
ATOM   7713  C  CD2  . PHE A 1 51 ? 9.078   0.748   2.640   1.00 0.00 ? 51  PHE A CD2  7  
ATOM   7714  C  CE1  . PHE A 1 51 ? 10.669  2.030   0.788   1.00 0.00 ? 51  PHE A CE1  7  
ATOM   7715  C  CE2  . PHE A 1 51 ? 8.541   1.738   1.838   1.00 0.00 ? 51  PHE A CE2  7  
ATOM   7716  C  CZ   . PHE A 1 51 ? 9.338   2.379   0.909   1.00 0.00 ? 51  PHE A CZ   7  
ATOM   7717  H  H    . PHE A 1 51 ? 9.733   -1.935  1.590   1.00 0.00 ? 51  PHE A H    7  
ATOM   7718  H  HA   . PHE A 1 51 ? 12.443  -1.513  2.065   1.00 0.00 ? 51  PHE A HA   7  
ATOM   7719  H  HB2  . PHE A 1 51 ? 10.202  -1.053  4.042   1.00 0.00 ? 51  PHE A HB2  7  
ATOM   7720  H  HB3  . PHE A 1 51 ? 11.764  -0.241  4.008   1.00 0.00 ? 51  PHE A HB3  7  
ATOM   7721  H  HD1  . PHE A 1 51 ? 12.240  0.768   1.495   1.00 0.00 ? 51  PHE A HD1  7  
ATOM   7722  H  HD2  . PHE A 1 51 ? 8.453   0.247   3.366   1.00 0.00 ? 51  PHE A HD2  7  
ATOM   7723  H  HE1  . PHE A 1 51 ? 11.294  2.530   0.063   1.00 0.00 ? 51  PHE A HE1  7  
ATOM   7724  H  HE2  . PHE A 1 51 ? 7.500   2.007   1.936   1.00 0.00 ? 51  PHE A HE2  7  
ATOM   7725  H  HZ   . PHE A 1 51 ? 8.921   3.152   0.282   1.00 0.00 ? 51  PHE A HZ   7  
ATOM   7726  N  N    . PRO A 1 52 ? 13.346  -3.158  3.680   1.00 0.00 ? 52  PRO A N    7  
ATOM   7727  C  CA   . PRO A 1 52 ? 13.927  -4.176  4.561   1.00 0.00 ? 52  PRO A CA   7  
ATOM   7728  C  C    . PRO A 1 52 ? 13.767  -3.827  6.036   1.00 0.00 ? 52  PRO A C    7  
ATOM   7729  O  O    . PRO A 1 52 ? 13.391  -2.711  6.397   1.00 0.00 ? 52  PRO A O    7  
ATOM   7730  C  CB   . PRO A 1 52 ? 15.407  -4.181  4.170   1.00 0.00 ? 52  PRO A CB   7  
ATOM   7731  C  CG   . PRO A 1 52 ? 15.657  -2.821  3.615   1.00 0.00 ? 52  PRO A CG   7  
ATOM   7732  C  CD   . PRO A 1 52 ? 14.376  -2.405  2.945   1.00 0.00 ? 52  PRO A CD   7  
ATOM   7733  H  HA   . PRO A 1 52 ? 13.501  -5.151  4.374   1.00 0.00 ? 52  PRO A HA   7  
ATOM   7734  H  HB2  . PRO A 1 52 ? 16.013  -4.369  5.045   1.00 0.00 ? 52  PRO A HB2  7  
ATOM   7735  H  HB3  . PRO A 1 52 ? 15.585  -4.947  3.430   1.00 0.00 ? 52  PRO A HB3  7  
ATOM   7736  H  HG2  . PRO A 1 52 ? 15.900  -2.137  4.415   1.00 0.00 ? 52  PRO A HG2  7  
ATOM   7737  H  HG3  . PRO A 1 52 ? 16.461  -2.860  2.895   1.00 0.00 ? 52  PRO A HG3  7  
ATOM   7738  H  HD2  . PRO A 1 52 ? 14.224  -1.341  3.048   1.00 0.00 ? 52  PRO A HD2  7  
ATOM   7739  H  HD3  . PRO A 1 52 ? 14.388  -2.687  1.902   1.00 0.00 ? 52  PRO A HD3  7  
ATOM   7740  N  N    . PRO A 1 53 ? 14.059  -4.801  6.911   1.00 0.00 ? 53  PRO A N    7  
ATOM   7741  C  CA   . PRO A 1 53 ? 13.955  -4.619  8.362   1.00 0.00 ? 53  PRO A CA   7  
ATOM   7742  C  C    . PRO A 1 53 ? 15.024  -3.676  8.905   1.00 0.00 ? 53  PRO A C    7  
ATOM   7743  O  O    . PRO A 1 53 ? 16.188  -3.752  8.516   1.00 0.00 ? 53  PRO A O    7  
ATOM   7744  C  CB   . PRO A 1 53 ? 14.159  -6.032  8.912   1.00 0.00 ? 53  PRO A CB   7  
ATOM   7745  C  CG   . PRO A 1 53 ? 14.953  -6.735  7.866   1.00 0.00 ? 53  PRO A CG   7  
ATOM   7746  C  CD   . PRO A 1 53 ? 14.512  -6.155  6.551   1.00 0.00 ? 53  PRO A CD   7  
ATOM   7747  H  HA   . PRO A 1 53 ? 12.978  -4.256  8.648   1.00 0.00 ? 53  PRO A HA   7  
ATOM   7748  H  HB2  . PRO A 1 53 ? 14.695  -5.983  9.850   1.00 0.00 ? 53  PRO A HB2  7  
ATOM   7749  H  HB3  . PRO A 1 53 ? 13.200  -6.505  9.064   1.00 0.00 ? 53  PRO A HB3  7  
ATOM   7750  H  HG2  . PRO A 1 53 ? 16.006  -6.555  8.021   1.00 0.00 ? 53  PRO A HG2  7  
ATOM   7751  H  HG3  . PRO A 1 53 ? 14.744  -7.794  7.897   1.00 0.00 ? 53  PRO A HG3  7  
ATOM   7752  H  HD2  . PRO A 1 53 ? 15.341  -6.113  5.860   1.00 0.00 ? 53  PRO A HD2  7  
ATOM   7753  H  HD3  . PRO A 1 53 ? 13.701  -6.734  6.136   1.00 0.00 ? 53  PRO A HD3  7  
ATOM   7754  N  N    . GLY A 1 54 ? 14.619  -2.788  9.809   1.00 0.00 ? 54  GLY A N    7  
ATOM   7755  C  CA   . GLY A 1 54 ? 15.555  -1.844  10.391  1.00 0.00 ? 54  GLY A CA   7  
ATOM   7756  C  C    . GLY A 1 54 ? 15.634  -0.548  9.608   1.00 0.00 ? 54  GLY A C    7  
ATOM   7757  O  O    . GLY A 1 54 ? 15.772  0.528   10.189  1.00 0.00 ? 54  GLY A O    7  
ATOM   7758  H  H    . GLY A 1 54 ? 13.678  -2.774  10.081  1.00 0.00 ? 54  GLY A H    7  
ATOM   7759  H  HA2  . GLY A 1 54 ? 15.245  -1.623  11.402  1.00 0.00 ? 54  GLY A HA2  7  
ATOM   7760  H  HA3  . GLY A 1 54 ? 16.535  -2.296  10.417  1.00 0.00 ? 54  GLY A HA3  7  
ATOM   7761  N  N    . ASP A 1 55 ? 15.550  -0.652  8.286   1.00 0.00 ? 55  ASP A N    7  
ATOM   7762  C  CA   . ASP A 1 55 ? 15.614  0.521   7.422   1.00 0.00 ? 55  ASP A CA   7  
ATOM   7763  C  C    . ASP A 1 55 ? 14.467  1.481   7.723   1.00 0.00 ? 55  ASP A C    7  
ATOM   7764  O  O    . ASP A 1 55 ? 13.458  1.093   8.313   1.00 0.00 ? 55  ASP A O    7  
ATOM   7765  C  CB   . ASP A 1 55 ? 15.571  0.100   5.952   1.00 0.00 ? 55  ASP A CB   7  
ATOM   7766  C  CG   . ASP A 1 55 ? 15.951  1.231   5.015   1.00 0.00 ? 55  ASP A CG   7  
ATOM   7767  O  OD1  . ASP A 1 55 ? 17.085  1.741   5.130   1.00 0.00 ? 55  ASP A OD1  7  
ATOM   7768  O  OD2  . ASP A 1 55 ? 15.113  1.604   4.168   1.00 0.00 ? 55  ASP A OD2  7  
ATOM   7769  H  H    . ASP A 1 55 ? 15.441  -1.538  7.882   1.00 0.00 ? 55  ASP A H    7  
ATOM   7770  H  HA   . ASP A 1 55 ? 16.548  1.025   7.616   1.00 0.00 ? 55  ASP A HA   7  
ATOM   7771  H  HB2  . ASP A 1 55 ? 16.261  -0.717  5.798   1.00 0.00 ? 55  ASP A HB2  7  
ATOM   7772  H  HB3  . ASP A 1 55 ? 14.572  -0.227  5.707   1.00 0.00 ? 55  ASP A HB3  7  
ATOM   7773  N  N    . ARG A 1 56 ? 14.629  2.735   7.314   1.00 0.00 ? 56  ARG A N    7  
ATOM   7774  C  CA   . ARG A 1 56 ? 13.608  3.750   7.541   1.00 0.00 ? 56  ARG A CA   7  
ATOM   7775  C  C    . ARG A 1 56 ? 12.859  4.067   6.250   1.00 0.00 ? 56  ARG A C    7  
ATOM   7776  O  O    . ARG A 1 56 ? 13.156  3.509   5.194   1.00 0.00 ? 56  ARG A O    7  
ATOM   7777  C  CB   . ARG A 1 56 ? 14.242  5.025   8.101   1.00 0.00 ? 56  ARG A CB   7  
ATOM   7778  C  CG   . ARG A 1 56 ? 14.521  4.961   9.594   1.00 0.00 ? 56  ARG A CG   7  
ATOM   7779  C  CD   . ARG A 1 56 ? 15.063  6.282   10.117  1.00 0.00 ? 56  ARG A CD   7  
ATOM   7780  N  NE   . ARG A 1 56 ? 16.522  6.330   10.073  1.00 0.00 ? 56  ARG A NE   7  
ATOM   7781  C  CZ   . ARG A 1 56 ? 17.301  5.897   11.058  1.00 0.00 ? 56  ARG A CZ   7  
ATOM   7782  N  NH1  . ARG A 1 56 ? 16.764  5.386   12.157  1.00 0.00 ? 56  ARG A NH1  7  
ATOM   7783  N  NH2  . ARG A 1 56 ? 18.621  5.974   10.944  1.00 0.00 ? 56  ARG A NH2  7  
ATOM   7784  H  H    . ARG A 1 56 ? 15.455  2.983   6.848   1.00 0.00 ? 56  ARG A H    7  
ATOM   7785  H  HA   . ARG A 1 56 ? 12.907  3.360   8.264   1.00 0.00 ? 56  ARG A HA   7  
ATOM   7786  H  HB2  . ARG A 1 56 ? 15.177  5.202   7.591   1.00 0.00 ? 56  ARG A HB2  7  
ATOM   7787  H  HB3  . ARG A 1 56 ? 13.577  5.855   7.916   1.00 0.00 ? 56  ARG A HB3  7  
ATOM   7788  H  HG2  . ARG A 1 56 ? 13.602  4.732   10.113  1.00 0.00 ? 56  ARG A HG2  7  
ATOM   7789  H  HG3  . ARG A 1 56 ? 15.246  4.184   9.783   1.00 0.00 ? 56  ARG A HG3  7  
ATOM   7790  H  HD2  . ARG A 1 56 ? 14.668  7.084   9.510   1.00 0.00 ? 56  ARG A HD2  7  
ATOM   7791  H  HD3  . ARG A 1 56 ? 14.738  6.411   11.138  1.00 0.00 ? 56  ARG A HD3  7  
ATOM   7792  H  HE   . ARG A 1 56 ? 16.940  6.705   9.270   1.00 0.00 ? 56  ARG A HE   7  
ATOM   7793  H  HH11 . ARG A 1 56 ? 15.770  5.325   12.245  1.00 0.00 ? 56  ARG A HH11 7  
ATOM   7794  H  HH12 . ARG A 1 56 ? 17.353  5.059   12.897  1.00 0.00 ? 56  ARG A HH12 7  
ATOM   7795  H  HH21 . ARG A 1 56 ? 19.030  6.359   10.117  1.00 0.00 ? 56  ARG A HH21 7  
ATOM   7796  H  HH22 . ARG A 1 56 ? 19.207  5.648   11.686  1.00 0.00 ? 56  ARG A HH22 7  
ATOM   7797  N  N    . VAL A 1 57 ? 11.885  4.967   6.343   1.00 0.00 ? 57  VAL A N    7  
ATOM   7798  C  CA   . VAL A 1 57 ? 11.093  5.359   5.183   1.00 0.00 ? 57  VAL A CA   7  
ATOM   7799  C  C    . VAL A 1 57 ? 10.982  6.876   5.080   1.00 0.00 ? 57  VAL A C    7  
ATOM   7800  O  O    . VAL A 1 57 ? 10.703  7.558   6.067   1.00 0.00 ? 57  VAL A O    7  
ATOM   7801  C  CB   . VAL A 1 57 ? 9.678   4.754   5.239   1.00 0.00 ? 57  VAL A CB   7  
ATOM   7802  C  CG1  . VAL A 1 57 ? 8.869   5.173   4.021   1.00 0.00 ? 57  VAL A CG1  7  
ATOM   7803  C  CG2  . VAL A 1 57 ? 9.750   3.239   5.346   1.00 0.00 ? 57  VAL A CG2  7  
ATOM   7804  H  H    . VAL A 1 57 ? 11.695  5.378   7.212   1.00 0.00 ? 57  VAL A H    7  
ATOM   7805  H  HA   . VAL A 1 57 ? 11.588  4.983   4.299   1.00 0.00 ? 57  VAL A HA   7  
ATOM   7806  H  HB   . VAL A 1 57 ? 9.181   5.133   6.121   1.00 0.00 ? 57  VAL A HB   7  
ATOM   7807  H  HG11 . VAL A 1 57 ? 7.828   5.261   4.293   1.00 0.00 ? 57  VAL A HG11 7  
ATOM   7808  H  HG12 . VAL A 1 57 ? 9.230   6.125   3.659   1.00 0.00 ? 57  VAL A HG12 7  
ATOM   7809  H  HG13 . VAL A 1 57 ? 8.976   4.429   3.245   1.00 0.00 ? 57  VAL A HG13 7  
ATOM   7810  H  HG21 . VAL A 1 57 ? 8.829   2.864   5.766   1.00 0.00 ? 57  VAL A HG21 7  
ATOM   7811  H  HG22 . VAL A 1 57 ? 9.896   2.815   4.363   1.00 0.00 ? 57  VAL A HG22 7  
ATOM   7812  H  HG23 . VAL A 1 57 ? 10.577  2.961   5.983   1.00 0.00 ? 57  VAL A HG23 7  
ATOM   7813  N  N    . THR A 1 58 ? 11.202  7.400   3.879   1.00 0.00 ? 58  THR A N    7  
ATOM   7814  C  CA   . THR A 1 58 ? 11.127  8.837   3.646   1.00 0.00 ? 58  THR A CA   7  
ATOM   7815  C  C    . THR A 1 58 ? 9.791   9.225   3.024   1.00 0.00 ? 58  THR A C    7  
ATOM   7816  O  O    . THR A 1 58 ? 9.410   8.708   1.973   1.00 0.00 ? 58  THR A O    7  
ATOM   7817  C  CB   . THR A 1 58 ? 12.267  9.318   2.728   1.00 0.00 ? 58  THR A CB   7  
ATOM   7818  O  OG1  . THR A 1 58 ? 13.521  8.814   3.199   1.00 0.00 ? 58  THR A OG1  7  
ATOM   7819  C  CG2  . THR A 1 58 ? 12.313  10.837  2.673   1.00 0.00 ? 58  THR A CG2  7  
ATOM   7820  H  H    . THR A 1 58 ? 11.420  6.805   3.131   1.00 0.00 ? 58  THR A H    7  
ATOM   7821  H  HA   . THR A 1 58 ? 11.227  9.335   4.600   1.00 0.00 ? 58  THR A HA   7  
ATOM   7822  H  HB   . THR A 1 58 ? 12.088  8.941   1.731   1.00 0.00 ? 58  THR A HB   7  
ATOM   7823  H  HG1  . THR A 1 58 ? 13.764  8.035   2.693   1.00 0.00 ? 58  THR A HG1  7  
ATOM   7824  H  HG21 . THR A 1 58 ? 11.785  11.182  1.796   1.00 0.00 ? 58  THR A HG21 7  
ATOM   7825  H  HG22 . THR A 1 58 ? 13.341  11.164  2.626   1.00 0.00 ? 58  THR A HG22 7  
ATOM   7826  H  HG23 . THR A 1 58 ? 11.846  11.243  3.557   1.00 0.00 ? 58  THR A HG23 7  
ATOM   7827  N  N    . PHE A 1 59 ? 9.081   10.138  3.679   1.00 0.00 ? 59  PHE A N    7  
ATOM   7828  C  CA   . PHE A 1 59 ? 7.786   10.595  3.189   1.00 0.00 ? 59  PHE A CA   7  
ATOM   7829  C  C    . PHE A 1 59 ? 7.931   11.889  2.393   1.00 0.00 ? 59  PHE A C    7  
ATOM   7830  O  O    . PHE A 1 59 ? 8.241   12.941  2.949   1.00 0.00 ? 59  PHE A O    7  
ATOM   7831  C  CB   . PHE A 1 59 ? 6.822   10.809  4.358   1.00 0.00 ? 59  PHE A CB   7  
ATOM   7832  C  CG   . PHE A 1 59 ? 6.777   9.653   5.317   1.00 0.00 ? 59  PHE A CG   7  
ATOM   7833  C  CD1  . PHE A 1 59 ? 7.659   9.587   6.383   1.00 0.00 ? 59  PHE A CD1  7  
ATOM   7834  C  CD2  . PHE A 1 59 ? 5.854   8.634   5.151   1.00 0.00 ? 59  PHE A CD2  7  
ATOM   7835  C  CE1  . PHE A 1 59 ? 7.621   8.525   7.268   1.00 0.00 ? 59  PHE A CE1  7  
ATOM   7836  C  CE2  . PHE A 1 59 ? 5.810   7.570   6.032   1.00 0.00 ? 59  PHE A CE2  7  
ATOM   7837  C  CZ   . PHE A 1 59 ? 6.695   7.515   7.091   1.00 0.00 ? 59  PHE A CZ   7  
ATOM   7838  H  H    . PHE A 1 59 ? 9.438   10.514  4.511   1.00 0.00 ? 59  PHE A H    7  
ATOM   7839  H  HA   . PHE A 1 59 ? 7.389   9.830   2.541   1.00 0.00 ? 59  PHE A HA   7  
ATOM   7840  H  HB2  . PHE A 1 59 ? 7.125   11.686  4.910   1.00 0.00 ? 59  PHE A HB2  7  
ATOM   7841  H  HB3  . PHE A 1 59 ? 5.825   10.958  3.970   1.00 0.00 ? 59  PHE A HB3  7  
ATOM   7842  H  HD1  . PHE A 1 59 ? 8.384   10.377  6.522   1.00 0.00 ? 59  PHE A HD1  7  
ATOM   7843  H  HD2  . PHE A 1 59 ? 5.162   8.675   4.323   1.00 0.00 ? 59  PHE A HD2  7  
ATOM   7844  H  HE1  . PHE A 1 59 ? 8.314   8.485   8.094   1.00 0.00 ? 59  PHE A HE1  7  
ATOM   7845  H  HE2  . PHE A 1 59 ? 5.086   6.781   5.892   1.00 0.00 ? 59  PHE A HE2  7  
ATOM   7846  H  HZ   . PHE A 1 59 ? 6.663   6.685   7.781   1.00 0.00 ? 59  PHE A HZ   7  
ATOM   7847  N  N    . ASN A 1 60 ? 7.705   11.800  1.086   1.00 0.00 ? 60  ASN A N    7  
ATOM   7848  C  CA   . ASN A 1 60 ? 7.812   12.962  0.211   1.00 0.00 ? 60  ASN A CA   7  
ATOM   7849  C  C    . ASN A 1 60 ? 6.525   13.165  -0.584  1.00 0.00 ? 60  ASN A C    7  
ATOM   7850  O  O    . ASN A 1 60 ? 6.315   12.530  -1.616  1.00 0.00 ? 60  ASN A O    7  
ATOM   7851  C  CB   . ASN A 1 60 ? 8.995   12.801  -0.745  1.00 0.00 ? 60  ASN A CB   7  
ATOM   7852  C  CG   . ASN A 1 60 ? 9.105   13.949  -1.729  1.00 0.00 ? 60  ASN A CG   7  
ATOM   7853  O  OD1  . ASN A 1 60 ? 8.099   14.433  -2.249  1.00 0.00 ? 60  ASN A OD1  7  
ATOM   7854  N  ND2  . ASN A 1 60 ? 10.330  14.391  -1.989  1.00 0.00 ? 60  ASN A ND2  7  
ATOM   7855  H  H    . ASN A 1 60 ? 7.462   10.933  0.700   1.00 0.00 ? 60  ASN A H    7  
ATOM   7856  H  HA   . ASN A 1 60 ? 7.978   13.830  0.832   1.00 0.00 ? 60  ASN A HA   7  
ATOM   7857  H  HB2  . ASN A 1 60 ? 9.910   12.756  -0.171  1.00 0.00 ? 60  ASN A HB2  7  
ATOM   7858  H  HB3  . ASN A 1 60 ? 8.879   11.883  -1.301  1.00 0.00 ? 60  ASN A HB3  7  
ATOM   7859  H  HD21 . ASN A 1 60 ? 11.084  13.957  -1.538  1.00 0.00 ? 60  ASN A HD21 7  
ATOM   7860  H  HD22 . ASN A 1 60 ? 10.430  15.133  -2.621  1.00 0.00 ? 60  ASN A HD22 7  
ATOM   7861  N  N    . GLY A 1 61 ? 5.667   14.055  -0.095  1.00 0.00 ? 61  GLY A N    7  
ATOM   7862  C  CA   . GLY A 1 61 ? 4.413   14.326  -0.772  1.00 0.00 ? 61  GLY A CA   7  
ATOM   7863  C  C    . GLY A 1 61 ? 3.393   13.223  -0.566  1.00 0.00 ? 61  GLY A C    7  
ATOM   7864  O  O    . GLY A 1 61 ? 2.829   13.083  0.519   1.00 0.00 ? 61  GLY A O    7  
ATOM   7865  H  H    . GLY A 1 61 ? 5.888   14.532  0.733   1.00 0.00 ? 61  GLY A H    7  
ATOM   7866  H  HA2  . GLY A 1 61 ? 4.006   15.253  -0.396  1.00 0.00 ? 61  GLY A HA2  7  
ATOM   7867  H  HA3  . GLY A 1 61 ? 4.603   14.430  -1.830  1.00 0.00 ? 61  GLY A HA3  7  
ATOM   7868  N  N    . LYS A 1 62 ? 3.154   12.438  -1.611  1.00 0.00 ? 62  LYS A N    7  
ATOM   7869  C  CA   . LYS A 1 62 ? 2.195   11.341  -1.542  1.00 0.00 ? 62  LYS A CA   7  
ATOM   7870  C  C    . LYS A 1 62 ? 2.907   9.993   -1.575  1.00 0.00 ? 62  LYS A C    7  
ATOM   7871  O  O    . LYS A 1 62 ? 2.623   9.111   -0.765  1.00 0.00 ? 62  LYS A O    7  
ATOM   7872  C  CB   . LYS A 1 62 ? 1.200   11.433  -2.700  1.00 0.00 ? 62  LYS A CB   7  
ATOM   7873  C  CG   . LYS A 1 62 ? 0.405   12.728  -2.718  1.00 0.00 ? 62  LYS A CG   7  
ATOM   7874  C  CD   . LYS A 1 62 ? -0.902  12.569  -3.476  1.00 0.00 ? 62  LYS A CD   7  
ATOM   7875  C  CE   . LYS A 1 62 ? -1.854  13.722  -3.194  1.00 0.00 ? 62  LYS A CE   7  
ATOM   7876  N  NZ   . LYS A 1 62 ? -1.384  14.992  -3.813  1.00 0.00 ? 62  LYS A NZ   7  
ATOM   7877  H  H    . LYS A 1 62 ? 3.636   12.599  -2.450  1.00 0.00 ? 62  LYS A H    7  
ATOM   7878  H  HA   . LYS A 1 62 ? 1.659   11.429  -0.609  1.00 0.00 ? 62  LYS A HA   7  
ATOM   7879  H  HB2  . LYS A 1 62 ? 1.741   11.355  -3.631  1.00 0.00 ? 62  LYS A HB2  7  
ATOM   7880  H  HB3  . LYS A 1 62 ? 0.504   10.610  -2.627  1.00 0.00 ? 62  LYS A HB3  7  
ATOM   7881  H  HG2  . LYS A 1 62 ? 0.186   13.019  -1.701  1.00 0.00 ? 62  LYS A HG2  7  
ATOM   7882  H  HG3  . LYS A 1 62 ? 0.997   13.496  -3.195  1.00 0.00 ? 62  LYS A HG3  7  
ATOM   7883  H  HD2  . LYS A 1 62 ? -0.693  12.540  -4.535  1.00 0.00 ? 62  LYS A HD2  7  
ATOM   7884  H  HD3  . LYS A 1 62 ? -1.373  11.643  -3.175  1.00 0.00 ? 62  LYS A HD3  7  
ATOM   7885  H  HE2  . LYS A 1 62 ? -2.826  13.475  -3.593  1.00 0.00 ? 62  LYS A HE2  7  
ATOM   7886  H  HE3  . LYS A 1 62 ? -1.927  13.858  -2.125  1.00 0.00 ? 62  LYS A HE3  7  
ATOM   7887  H  HZ1  . LYS A 1 62 ? -1.205  15.704  -3.076  1.00 0.00 ? 62  LYS A HZ1  7  
ATOM   7888  H  HZ2  . LYS A 1 62 ? -2.106  15.360  -4.465  1.00 0.00 ? 62  LYS A HZ2  7  
ATOM   7889  H  HZ3  . LYS A 1 62 ? -0.505  14.828  -4.343  1.00 0.00 ? 62  LYS A HZ3  7  
ATOM   7890  N  N    . GLU A 1 63 ? 3.834   9.841   -2.516  1.00 0.00 ? 63  GLU A N    7  
ATOM   7891  C  CA   . GLU A 1 63 ? 4.586   8.599   -2.653  1.00 0.00 ? 63  GLU A CA   7  
ATOM   7892  C  C    . GLU A 1 63 ? 5.887   8.660   -1.857  1.00 0.00 ? 63  GLU A C    7  
ATOM   7893  O  O    . GLU A 1 63 ? 6.545   9.700   -1.802  1.00 0.00 ? 63  GLU A O    7  
ATOM   7894  C  CB   . GLU A 1 63 ? 4.890   8.321   -4.126  1.00 0.00 ? 63  GLU A CB   7  
ATOM   7895  C  CG   . GLU A 1 63 ? 5.764   9.380   -4.778  1.00 0.00 ? 63  GLU A CG   7  
ATOM   7896  C  CD   . GLU A 1 63 ? 6.084   9.062   -6.226  1.00 0.00 ? 63  GLU A CD   7  
ATOM   7897  O  OE1  . GLU A 1 63 ? 5.171   8.617   -6.952  1.00 0.00 ? 63  GLU A OE1  7  
ATOM   7898  O  OE2  . GLU A 1 63 ? 7.248   9.259   -6.632  1.00 0.00 ? 63  GLU A OE2  7  
ATOM   7899  H  H    . GLU A 1 63 ? 4.016   10.581  -3.132  1.00 0.00 ? 63  GLU A H    7  
ATOM   7900  H  HA   . GLU A 1 63 ? 3.977   7.798   -2.263  1.00 0.00 ? 63  GLU A HA   7  
ATOM   7901  H  HB2  . GLU A 1 63 ? 5.395   7.369   -4.204  1.00 0.00 ? 63  GLU A HB2  7  
ATOM   7902  H  HB3  . GLU A 1 63 ? 3.958   8.270   -4.670  1.00 0.00 ? 63  GLU A HB3  7  
ATOM   7903  H  HG2  . GLU A 1 63 ? 5.248   10.328  -4.739  1.00 0.00 ? 63  GLU A HG2  7  
ATOM   7904  H  HG3  . GLU A 1 63 ? 6.690   9.452   -4.228  1.00 0.00 ? 63  GLU A HG3  7  
ATOM   7905  N  N    . CYS A 1 64 ? 6.249   7.541   -1.240  1.00 0.00 ? 64  CYS A N    7  
ATOM   7906  C  CA   . CYS A 1 64 ? 7.470   7.466   -0.445  1.00 0.00 ? 64  CYS A CA   7  
ATOM   7907  C  C    . CYS A 1 64 ? 8.606   6.845   -1.251  1.00 0.00 ? 64  CYS A C    7  
ATOM   7908  O  O    . CYS A 1 64 ? 8.377   6.226   -2.290  1.00 0.00 ? 64  CYS A O    7  
ATOM   7909  C  CB   . CYS A 1 64 ? 7.226   6.653   0.826   1.00 0.00 ? 64  CYS A CB   7  
ATOM   7910  S  SG   . CYS A 1 64 ? 5.803   7.206   1.796   1.00 0.00 ? 64  CYS A SG   7  
ATOM   7911  H  H    . CYS A 1 64 ? 5.683   6.745   -1.321  1.00 0.00 ? 64  CYS A H    7  
ATOM   7912  H  HA   . CYS A 1 64 ? 7.748   8.473   -0.171  1.00 0.00 ? 64  CYS A HA   7  
ATOM   7913  H  HB2  . CYS A 1 64 ? 7.057   5.620   0.558   1.00 0.00 ? 64  CYS A HB2  7  
ATOM   7914  H  HB3  . CYS A 1 64 ? 8.100   6.715   1.457   1.00 0.00 ? 64  CYS A HB3  7  
ATOM   7915  H  HG   . CYS A 1 64 ? 6.216   7.433   3.033   1.00 0.00 ? 64  CYS A HG   7  
ATOM   7916  N  N    . MET A 1 65 ? 9.831   7.016   -0.765  1.00 0.00 ? 65  MET A N    7  
ATOM   7917  C  CA   . MET A 1 65 ? 11.004  6.473   -1.441  1.00 0.00 ? 65  MET A CA   7  
ATOM   7918  C  C    . MET A 1 65 ? 12.009  5.928   -0.432  1.00 0.00 ? 65  MET A C    7  
ATOM   7919  O  O    . MET A 1 65 ? 12.085  6.403   0.702   1.00 0.00 ? 65  MET A O    7  
ATOM   7920  C  CB   . MET A 1 65 ? 11.664  7.547   -2.307  1.00 0.00 ? 65  MET A CB   7  
ATOM   7921  C  CG   . MET A 1 65 ? 10.885  7.873   -3.571  1.00 0.00 ? 65  MET A CG   7  
ATOM   7922  S  SD   . MET A 1 65 ? 9.695   9.205   -3.329  1.00 0.00 ? 65  MET A SD   7  
ATOM   7923  C  CE   . MET A 1 65 ? 10.791  10.605  -3.115  1.00 0.00 ? 65  MET A CE   7  
ATOM   7924  H  H    . MET A 1 65 ? 9.950   7.520   0.067   1.00 0.00 ? 65  MET A H    7  
ATOM   7925  H  HA   . MET A 1 65 ? 10.674  5.664   -2.076  1.00 0.00 ? 65  MET A HA   7  
ATOM   7926  H  HB2  . MET A 1 65 ? 11.760  8.452   -1.725  1.00 0.00 ? 65  MET A HB2  7  
ATOM   7927  H  HB3  . MET A 1 65 ? 12.648  7.208   -2.594  1.00 0.00 ? 65  MET A HB3  7  
ATOM   7928  H  HG2  . MET A 1 65 ? 11.582  8.168   -4.341  1.00 0.00 ? 65  MET A HG2  7  
ATOM   7929  H  HG3  . MET A 1 65 ? 10.355  6.987   -3.888  1.00 0.00 ? 65  MET A HG3  7  
ATOM   7930  H  HE1  . MET A 1 65 ? 10.636  11.311  -3.917  1.00 0.00 ? 65  MET A HE1  7  
ATOM   7931  H  HE2  . MET A 1 65 ? 10.583  11.083  -2.169  1.00 0.00 ? 65  MET A HE2  7  
ATOM   7932  H  HE3  . MET A 1 65 ? 11.817  10.264  -3.128  1.00 0.00 ? 65  MET A HE3  7  
ATOM   7933  N  N    . CYS A 1 66 ? 12.778  4.928   -0.850  1.00 0.00 ? 66  CYS A N    7  
ATOM   7934  C  CA   . CYS A 1 66 ? 13.778  4.318   0.017   1.00 0.00 ? 66  CYS A CA   7  
ATOM   7935  C  C    . CYS A 1 66 ? 15.050  5.161   0.059   1.00 0.00 ? 66  CYS A C    7  
ATOM   7936  O  O    . CYS A 1 66 ? 15.408  5.810   -0.923  1.00 0.00 ? 66  CYS A O    7  
ATOM   7937  C  CB   . CYS A 1 66 ? 14.107  2.903   -0.465  1.00 0.00 ? 66  CYS A CB   7  
ATOM   7938  S  SG   . CYS A 1 66 ? 14.921  2.843   -2.093  1.00 0.00 ? 66  CYS A SG   7  
ATOM   7939  H  H    . CYS A 1 66 ? 12.671  4.592   -1.765  1.00 0.00 ? 66  CYS A H    7  
ATOM   7940  H  HA   . CYS A 1 66 ? 13.365  4.262   1.013   1.00 0.00 ? 66  CYS A HA   7  
ATOM   7941  H  HB2  . CYS A 1 66 ? 14.767  2.432   0.249   1.00 0.00 ? 66  CYS A HB2  7  
ATOM   7942  H  HB3  . CYS A 1 66 ? 13.192  2.333   -0.532  1.00 0.00 ? 66  CYS A HB3  7  
ATOM   7943  N  N    . GLN A 1 67 ? 15.726  5.145   1.203   1.00 0.00 ? 67  GLN A N    7  
ATOM   7944  C  CA   . GLN A 1 67 ? 16.957  5.908   1.373   1.00 0.00 ? 67  GLN A CA   7  
ATOM   7945  C  C    . GLN A 1 67 ? 17.755  5.949   0.074   1.00 0.00 ? 67  GLN A C    7  
ATOM   7946  O  O    . GLN A 1 67 ? 18.130  7.021   -0.404  1.00 0.00 ? 67  GLN A O    7  
ATOM   7947  C  CB   . GLN A 1 67 ? 17.808  5.302   2.489   1.00 0.00 ? 67  GLN A CB   7  
ATOM   7948  C  CG   . GLN A 1 67 ? 17.507  5.876   3.864   1.00 0.00 ? 67  GLN A CG   7  
ATOM   7949  C  CD   . GLN A 1 67 ? 16.266  5.272   4.490   1.00 0.00 ? 67  GLN A CD   7  
ATOM   7950  O  OE1  . GLN A 1 67 ? 16.269  4.113   4.908   1.00 0.00 ? 67  GLN A OE1  7  
ATOM   7951  N  NE2  . GLN A 1 67 ? 15.196  6.055   4.559   1.00 0.00 ? 67  GLN A NE2  7  
ATOM   7952  H  H    . GLN A 1 67 ? 15.390  4.608   1.950   1.00 0.00 ? 67  GLN A H    7  
ATOM   7953  H  HA   . GLN A 1 67 ? 16.686  6.917   1.646   1.00 0.00 ? 67  GLN A HA   7  
ATOM   7954  H  HB2  . GLN A 1 67 ? 17.633  4.237   2.521   1.00 0.00 ? 67  GLN A HB2  7  
ATOM   7955  H  HB3  . GLN A 1 67 ? 18.850  5.481   2.269   1.00 0.00 ? 67  GLN A HB3  7  
ATOM   7956  H  HG2  . GLN A 1 67 ? 18.349  5.683   4.513   1.00 0.00 ? 67  GLN A HG2  7  
ATOM   7957  H  HG3  . GLN A 1 67 ? 17.363  6.942   3.771   1.00 0.00 ? 67  GLN A HG3  7  
ATOM   7958  H  HE21 . GLN A 1 67 ? 15.267  6.967   4.205   1.00 0.00 ? 67  GLN A HE21 7  
ATOM   7959  H  HE22 . GLN A 1 67 ? 14.380  5.690   4.958   1.00 0.00 ? 67  GLN A HE22 7  
ATOM   7960  N  N    . LYS A 1 68 ? 18.014  4.776   -0.493  1.00 0.00 ? 68  LYS A N    7  
ATOM   7961  C  CA   . LYS A 1 68 ? 18.767  4.676   -1.738  1.00 0.00 ? 68  LYS A CA   7  
ATOM   7962  C  C    . LYS A 1 68 ? 18.224  5.647   -2.782  1.00 0.00 ? 68  LYS A C    7  
ATOM   7963  O  O    . LYS A 1 68 ? 18.943  6.522   -3.265  1.00 0.00 ? 68  LYS A O    7  
ATOM   7964  C  CB   . LYS A 1 68 ? 18.712  3.246   -2.278  1.00 0.00 ? 68  LYS A CB   7  
ATOM   7965  C  CG   . LYS A 1 68 ? 19.869  2.376   -1.817  1.00 0.00 ? 68  LYS A CG   7  
ATOM   7966  C  CD   . LYS A 1 68 ? 19.596  1.760   -0.455  1.00 0.00 ? 68  LYS A CD   7  
ATOM   7967  C  CE   . LYS A 1 68 ? 20.089  2.656   0.671   1.00 0.00 ? 68  LYS A CE   7  
ATOM   7968  N  NZ   . LYS A 1 68 ? 19.920  2.015   2.004   1.00 0.00 ? 68  LYS A NZ   7  
ATOM   7969  H  H    . LYS A 1 68 ? 17.689  3.956   -0.065  1.00 0.00 ? 68  LYS A H    7  
ATOM   7970  H  HA   . LYS A 1 68 ? 19.794  4.933   -1.525  1.00 0.00 ? 68  LYS A HA   7  
ATOM   7971  H  HB2  . LYS A 1 68 ? 17.791  2.786   -1.952  1.00 0.00 ? 68  LYS A HB2  7  
ATOM   7972  H  HB3  . LYS A 1 68 ? 18.724  3.281   -3.358  1.00 0.00 ? 68  LYS A HB3  7  
ATOM   7973  H  HG2  . LYS A 1 68 ? 20.021  1.584   -2.535  1.00 0.00 ? 68  LYS A HG2  7  
ATOM   7974  H  HG3  . LYS A 1 68 ? 20.761  2.984   -1.755  1.00 0.00 ? 68  LYS A HG3  7  
ATOM   7975  H  HD2  . LYS A 1 68 ? 18.532  1.614   -0.343  1.00 0.00 ? 68  LYS A HD2  7  
ATOM   7976  H  HD3  . LYS A 1 68 ? 20.101  0.807   -0.393  1.00 0.00 ? 68  LYS A HD3  7  
ATOM   7977  H  HE2  . LYS A 1 68 ? 21.135  2.868   0.513   1.00 0.00 ? 68  LYS A HE2  7  
ATOM   7978  H  HE3  . LYS A 1 68 ? 19.528  3.579   0.651   1.00 0.00 ? 68  LYS A HE3  7  
ATOM   7979  H  HZ1  . LYS A 1 68 ? 20.588  2.428   2.686   1.00 0.00 ? 68  LYS A HZ1  7  
ATOM   7980  H  HZ2  . LYS A 1 68 ? 20.101  0.993   1.934   1.00 0.00 ? 68  LYS A HZ2  7  
ATOM   7981  H  HZ3  . LYS A 1 68 ? 18.951  2.162   2.351   1.00 0.00 ? 68  LYS A HZ3  7  
ATOM   7982  N  N    . CYS A 1 69 ? 16.950  5.487   -3.125  1.00 0.00 ? 69  CYS A N    7  
ATOM   7983  C  CA   . CYS A 1 69 ? 16.309  6.349   -4.111  1.00 0.00 ? 69  CYS A CA   7  
ATOM   7984  C  C    . CYS A 1 69 ? 16.428  7.816   -3.709  1.00 0.00 ? 69  CYS A C    7  
ATOM   7985  O  O    . CYS A 1 69 ? 16.757  8.671   -4.531  1.00 0.00 ? 69  CYS A O    7  
ATOM   7986  C  CB   . CYS A 1 69 ? 14.836  5.970   -4.270  1.00 0.00 ? 69  CYS A CB   7  
ATOM   7987  S  SG   . CYS A 1 69 ? 14.563  4.405   -5.163  1.00 0.00 ? 69  CYS A SG   7  
ATOM   7988  H  H    . CYS A 1 69 ? 16.428  4.771   -2.705  1.00 0.00 ? 69  CYS A H    7  
ATOM   7989  H  HA   . CYS A 1 69 ? 16.813  6.205   -5.055  1.00 0.00 ? 69  CYS A HA   7  
ATOM   7990  H  HB2  . CYS A 1 69 ? 14.390  5.870   -3.291  1.00 0.00 ? 69  CYS A HB2  7  
ATOM   7991  H  HB3  . CYS A 1 69 ? 14.327  6.752   -4.813  1.00 0.00 ? 69  CYS A HB3  7  
ATOM   7992  N  N    . SER A 1 70 ? 16.157  8.100   -2.439  1.00 0.00 ? 70  SER A N    7  
ATOM   7993  C  CA   . SER A 1 70 ? 16.229  9.464   -1.928  1.00 0.00 ? 70  SER A CA   7  
ATOM   7994  C  C    . SER A 1 70 ? 17.600  10.075  -2.203  1.00 0.00 ? 70  SER A C    7  
ATOM   7995  O  O    . SER A 1 70 ? 17.706  11.153  -2.790  1.00 0.00 ? 70  SER A O    7  
ATOM   7996  C  CB   . SER A 1 70 ? 15.942  9.484   -0.426  1.00 0.00 ? 70  SER A CB   7  
ATOM   7997  O  OG   . SER A 1 70 ? 15.338  10.707  -0.038  1.00 0.00 ? 70  SER A OG   7  
ATOM   7998  H  H    . SER A 1 70 ? 15.900  7.375   -1.832  1.00 0.00 ? 70  SER A H    7  
ATOM   7999  H  HA   . SER A 1 70 ? 15.478  10.049  -2.438  1.00 0.00 ? 70  SER A HA   7  
ATOM   8000  H  HB2  . SER A 1 70 ? 15.274  8.673   -0.179  1.00 0.00 ? 70  SER A HB2  7  
ATOM   8001  H  HB3  . SER A 1 70 ? 16.868  9.366   0.117   1.00 0.00 ? 70  SER A HB3  7  
ATOM   8002  H  HG   . SER A 1 70 ? 15.954  11.212  0.498   1.00 0.00 ? 70  SER A HG   7  
ATOM   8003  N  N    . LEU A 1 71 ? 18.647  9.379   -1.776  1.00 0.00 ? 71  LEU A N    7  
ATOM   8004  C  CA   . LEU A 1 71 ? 20.013  9.852   -1.975  1.00 0.00 ? 71  LEU A CA   7  
ATOM   8005  C  C    . LEU A 1 71 ? 20.190  10.430  -3.375  1.00 0.00 ? 71  LEU A C    7  
ATOM   8006  O  O    . LEU A 1 71 ? 19.479  10.074  -4.315  1.00 0.00 ? 71  LEU A O    7  
ATOM   8007  C  CB   . LEU A 1 71 ? 21.006  8.709   -1.754  1.00 0.00 ? 71  LEU A CB   7  
ATOM   8008  C  CG   . LEU A 1 71 ? 21.209  8.267   -0.304  1.00 0.00 ? 71  LEU A CG   7  
ATOM   8009  C  CD1  . LEU A 1 71 ? 22.591  7.661   -0.119  1.00 0.00 ? 71  LEU A CD1  7  
ATOM   8010  C  CD2  . LEU A 1 71 ? 21.008  9.440   0.644   1.00 0.00 ? 71  LEU A CD2  7  
ATOM   8011  H  H    . LEU A 1 71 ? 18.500  8.527   -1.315  1.00 0.00 ? 71  LEU A H    7  
ATOM   8012  H  HA   . LEU A 1 71 ? 20.204  10.629  -1.250  1.00 0.00 ? 71  LEU A HA   7  
ATOM   8013  H  HB2  . LEU A 1 71 ? 20.658  7.855   -2.314  1.00 0.00 ? 71  LEU A HB2  7  
ATOM   8014  H  HB3  . LEU A 1 71 ? 21.964  9.026   -2.141  1.00 0.00 ? 71  LEU A HB3  7  
ATOM   8015  H  HG   . LEU A 1 71 ? 20.477  7.510   -0.060  1.00 0.00 ? 71  LEU A HG   7  
ATOM   8016  H  HD11 . LEU A 1 71 ? 23.325  8.281   -0.610  1.00 0.00 ? 71  LEU A HD11 7  
ATOM   8017  H  HD12 . LEU A 1 71 ? 22.610  6.671   -0.550  1.00 0.00 ? 71  LEU A HD12 7  
ATOM   8018  H  HD13 . LEU A 1 71 ? 22.818  7.598   0.936   1.00 0.00 ? 71  LEU A HD13 7  
ATOM   8019  H  HD21 . LEU A 1 71 ? 19.962  9.709   0.667   1.00 0.00 ? 71  LEU A HD21 7  
ATOM   8020  H  HD22 . LEU A 1 71 ? 21.588  10.285  0.301   1.00 0.00 ? 71  LEU A HD22 7  
ATOM   8021  H  HD23 . LEU A 1 71 ? 21.330  9.161   1.636   1.00 0.00 ? 71  LEU A HD23 7  
ATOM   8022  N  N    . PRO A 1 72 ? 21.162  11.343  -3.520  1.00 0.00 ? 72  PRO A N    7  
ATOM   8023  C  CA   . PRO A 1 72 ? 21.457  11.989  -4.803  1.00 0.00 ? 72  PRO A CA   7  
ATOM   8024  C  C    . PRO A 1 72 ? 22.079  11.024  -5.807  1.00 0.00 ? 72  PRO A C    7  
ATOM   8025  O  O    . PRO A 1 72 ? 23.218  10.589  -5.642  1.00 0.00 ? 72  PRO A O    7  
ATOM   8026  C  CB   . PRO A 1 72 ? 22.456  13.086  -4.426  1.00 0.00 ? 72  PRO A CB   7  
ATOM   8027  C  CG   . PRO A 1 72 ? 23.103  12.597  -3.176  1.00 0.00 ? 72  PRO A CG   7  
ATOM   8028  C  CD   . PRO A 1 72 ? 22.048  11.815  -2.443  1.00 0.00 ? 72  PRO A CD   7  
ATOM   8029  H  HA   . PRO A 1 72 ? 20.574  12.436  -5.234  1.00 0.00 ? 72  PRO A HA   7  
ATOM   8030  H  HB2  . PRO A 1 72 ? 23.176  13.209  -5.223  1.00 0.00 ? 72  PRO A HB2  7  
ATOM   8031  H  HB3  . PRO A 1 72 ? 21.931  14.015  -4.261  1.00 0.00 ? 72  PRO A HB3  7  
ATOM   8032  H  HG2  . PRO A 1 72 ? 23.939  11.960  -3.421  1.00 0.00 ? 72  PRO A HG2  7  
ATOM   8033  H  HG3  . PRO A 1 72 ? 23.430  13.436  -2.580  1.00 0.00 ? 72  PRO A HG3  7  
ATOM   8034  H  HD2  . PRO A 1 72 ? 22.492  10.984  -1.916  1.00 0.00 ? 72  PRO A HD2  7  
ATOM   8035  H  HD3  . PRO A 1 72 ? 21.513  12.456  -1.757  1.00 0.00 ? 72  PRO A HD3  7  
ATOM   8036  N  N    . VAL A 1 73 ? 21.323  10.695  -6.850  1.00 0.00 ? 73  VAL A N    7  
ATOM   8037  C  CA   . VAL A 1 73 ? 21.800  9.783   -7.882  1.00 0.00 ? 73  VAL A CA   7  
ATOM   8038  C  C    . VAL A 1 73 ? 22.464  10.545  -9.024  1.00 0.00 ? 73  VAL A C    7  
ATOM   8039  O  O    . VAL A 1 73 ? 21.979  11.593  -9.449  1.00 0.00 ? 73  VAL A O    7  
ATOM   8040  C  CB   . VAL A 1 73 ? 20.653  8.927   -8.450  1.00 0.00 ? 73  VAL A CB   7  
ATOM   8041  C  CG1  . VAL A 1 73 ? 21.198  7.842   -9.366  1.00 0.00 ? 73  VAL A CG1  7  
ATOM   8042  C  CG2  . VAL A 1 73 ? 19.832  8.321   -7.321  1.00 0.00 ? 73  VAL A CG2  7  
ATOM   8043  H  H    . VAL A 1 73 ? 20.423  11.074  -6.927  1.00 0.00 ? 73  VAL A H    7  
ATOM   8044  H  HA   . VAL A 1 73 ? 22.527  9.121   -7.434  1.00 0.00 ? 73  VAL A HA   7  
ATOM   8045  H  HB   . VAL A 1 73 ? 20.007  9.567   -9.032  1.00 0.00 ? 73  VAL A HB   7  
ATOM   8046  H  HG11 . VAL A 1 73 ? 22.248  8.018   -9.547  1.00 0.00 ? 73  VAL A HG11 7  
ATOM   8047  H  HG12 . VAL A 1 73 ? 21.070  6.877   -8.897  1.00 0.00 ? 73  VAL A HG12 7  
ATOM   8048  H  HG13 . VAL A 1 73 ? 20.663  7.861   -10.304 1.00 0.00 ? 73  VAL A HG13 7  
ATOM   8049  H  HG21 . VAL A 1 73 ? 20.227  7.347   -7.073  1.00 0.00 ? 73  VAL A HG21 7  
ATOM   8050  H  HG22 . VAL A 1 73 ? 19.884  8.962   -6.453  1.00 0.00 ? 73  VAL A HG22 7  
ATOM   8051  H  HG23 . VAL A 1 73 ? 18.804  8.224   -7.635  1.00 0.00 ? 73  VAL A HG23 7  
ATOM   8052  N  N    . SER A 1 74 ? 23.577  10.010  -9.517  1.00 0.00 ? 74  SER A N    7  
ATOM   8053  C  CA   . SER A 1 74 ? 24.310  10.642  -10.608 1.00 0.00 ? 74  SER A CA   7  
ATOM   8054  C  C    . SER A 1 74 ? 23.401  10.871  -11.812 1.00 0.00 ? 74  SER A C    7  
ATOM   8055  O  O    . SER A 1 74 ? 23.410  11.944  -12.416 1.00 0.00 ? 74  SER A O    7  
ATOM   8056  C  CB   . SER A 1 74 ? 25.505  9.778   -11.014 1.00 0.00 ? 74  SER A CB   7  
ATOM   8057  O  OG   . SER A 1 74 ? 26.492  9.761   -9.997  1.00 0.00 ? 74  SER A OG   7  
ATOM   8058  H  H    . SER A 1 74 ? 23.914  9.173   -9.135  1.00 0.00 ? 74  SER A H    7  
ATOM   8059  H  HA   . SER A 1 74 ? 24.670  11.597  -10.256 1.00 0.00 ? 74  SER A HA   7  
ATOM   8060  H  HB2  . SER A 1 74 ? 25.172  8.767   -11.192 1.00 0.00 ? 74  SER A HB2  7  
ATOM   8061  H  HB3  . SER A 1 74 ? 25.944  10.177  -11.918 1.00 0.00 ? 74  SER A HB3  7  
ATOM   8062  H  HG   . SER A 1 74 ? 26.083  9.537   -9.158  1.00 0.00 ? 74  SER A HG   7  
ATOM   8063  N  N    . VAL A 1 75 ? 22.617  9.854   -12.156 1.00 0.00 ? 75  VAL A N    7  
ATOM   8064  C  CA   . VAL A 1 75 ? 21.701  9.943   -13.286 1.00 0.00 ? 75  VAL A CA   7  
ATOM   8065  C  C    . VAL A 1 75 ? 20.328  10.436  -12.844 1.00 0.00 ? 75  VAL A C    7  
ATOM   8066  O  O    . VAL A 1 75 ? 19.914  10.214  -11.706 1.00 0.00 ? 75  VAL A O    7  
ATOM   8067  C  CB   . VAL A 1 75 ? 21.543  8.582   -13.990 1.00 0.00 ? 75  VAL A CB   7  
ATOM   8068  C  CG1  . VAL A 1 75 ? 22.850  8.166   -14.647 1.00 0.00 ? 75  VAL A CG1  7  
ATOM   8069  C  CG2  . VAL A 1 75 ? 21.073  7.524   -13.003 1.00 0.00 ? 75  VAL A CG2  7  
ATOM   8070  H  H    . VAL A 1 75 ? 22.655  9.024   -11.636 1.00 0.00 ? 75  VAL A H    7  
ATOM   8071  H  HA   . VAL A 1 75 ? 22.114  10.645  -13.996 1.00 0.00 ? 75  VAL A HA   7  
ATOM   8072  H  HB   . VAL A 1 75 ? 20.794  8.682   -14.761 1.00 0.00 ? 75  VAL A HB   7  
ATOM   8073  H  HG11 . VAL A 1 75 ? 23.521  7.773   -13.897 1.00 0.00 ? 75  VAL A HG11 7  
ATOM   8074  H  HG12 . VAL A 1 75 ? 22.654  7.406   -15.390 1.00 0.00 ? 75  VAL A HG12 7  
ATOM   8075  H  HG13 . VAL A 1 75 ? 23.304  9.024   -15.120 1.00 0.00 ? 75  VAL A HG13 7  
ATOM   8076  H  HG21 . VAL A 1 75 ? 20.381  7.968   -12.303 1.00 0.00 ? 75  VAL A HG21 7  
ATOM   8077  H  HG22 . VAL A 1 75 ? 20.581  6.725   -13.538 1.00 0.00 ? 75  VAL A HG22 7  
ATOM   8078  H  HG23 . VAL A 1 75 ? 21.923  7.128   -12.467 1.00 0.00 ? 75  VAL A HG23 7  
ATOM   8079  N  N    . SER A 1 76 ? 19.625  11.106  -13.751 1.00 0.00 ? 76  SER A N    7  
ATOM   8080  C  CA   . SER A 1 76 ? 18.299  11.634  -13.454 1.00 0.00 ? 76  SER A CA   7  
ATOM   8081  C  C    . SER A 1 76 ? 17.264  11.087  -14.432 1.00 0.00 ? 76  SER A C    7  
ATOM   8082  O  O    . SER A 1 76 ? 16.234  10.549  -14.027 1.00 0.00 ? 76  SER A O    7  
ATOM   8083  C  CB   . SER A 1 76 ? 18.311  13.163  -13.510 1.00 0.00 ? 76  SER A CB   7  
ATOM   8084  O  OG   . SER A 1 76 ? 17.149  13.705  -12.907 1.00 0.00 ? 76  SER A OG   7  
ATOM   8085  H  H    . SER A 1 76 ? 20.009  11.251  -14.641 1.00 0.00 ? 76  SER A H    7  
ATOM   8086  H  HA   . SER A 1 76 ? 18.034  11.321  -12.455 1.00 0.00 ? 76  SER A HA   7  
ATOM   8087  H  HB2  . SER A 1 76 ? 19.180  13.533  -12.986 1.00 0.00 ? 76  SER A HB2  7  
ATOM   8088  H  HB3  . SER A 1 76 ? 18.350  13.483  -14.541 1.00 0.00 ? 76  SER A HB3  7  
ATOM   8089  H  HG   . SER A 1 76 ? 17.149  14.659  -13.011 1.00 0.00 ? 76  SER A HG   7  
ATOM   8090  N  N    . GLY A 1 77 ? 17.547  11.228  -15.723 1.00 0.00 ? 77  GLY A N    7  
ATOM   8091  C  CA   . GLY A 1 77 ? 16.632  10.743  -16.740 1.00 0.00 ? 77  GLY A CA   7  
ATOM   8092  C  C    . GLY A 1 77 ? 16.679  11.575  -18.007 1.00 0.00 ? 77  GLY A C    7  
ATOM   8093  O  O    . GLY A 1 77 ? 17.182  12.699  -18.019 1.00 0.00 ? 77  GLY A O    7  
ATOM   8094  H  H    . GLY A 1 77 ? 18.383  11.665  -15.988 1.00 0.00 ? 77  GLY A H    7  
ATOM   8095  H  HA2  . GLY A 1 77 ? 16.888  9.722   -16.983 1.00 0.00 ? 77  GLY A HA2  7  
ATOM   8096  H  HA3  . GLY A 1 77 ? 15.627  10.767  -16.345 1.00 0.00 ? 77  GLY A HA3  7  
ATOM   8097  N  N    . PRO A 1 78 ? 16.146  11.019  -19.105 1.00 0.00 ? 78  PRO A N    7  
ATOM   8098  C  CA   . PRO A 1 78 ? 16.118  11.699  -20.403 1.00 0.00 ? 78  PRO A CA   7  
ATOM   8099  C  C    . PRO A 1 78 ? 15.157  12.883  -20.416 1.00 0.00 ? 78  PRO A C    7  
ATOM   8100  O  O    . PRO A 1 78 ? 15.516  13.981  -20.839 1.00 0.00 ? 78  PRO A O    7  
ATOM   8101  C  CB   . PRO A 1 78 ? 15.638  10.609  -21.365 1.00 0.00 ? 78  PRO A CB   7  
ATOM   8102  C  CG   . PRO A 1 78 ? 14.863  9.666   -20.511 1.00 0.00 ? 78  PRO A CG   7  
ATOM   8103  C  CD   . PRO A 1 78 ? 15.529  9.683   -19.164 1.00 0.00 ? 78  PRO A CD   7  
ATOM   8104  H  HA   . PRO A 1 78 ? 17.102  12.033  -20.697 1.00 0.00 ? 78  PRO A HA   7  
ATOM   8105  H  HB2  . PRO A 1 78 ? 15.018  11.050  -22.132 1.00 0.00 ? 78  PRO A HB2  7  
ATOM   8106  H  HB3  . PRO A 1 78 ? 16.489  10.123  -21.817 1.00 0.00 ? 78  PRO A HB3  7  
ATOM   8107  H  HG2  . PRO A 1 78 ? 13.840  10.002  -20.428 1.00 0.00 ? 78  PRO A HG2  7  
ATOM   8108  H  HG3  . PRO A 1 78 ? 14.900  8.673   -20.935 1.00 0.00 ? 78  PRO A HG3  7  
ATOM   8109  H  HD2  . PRO A 1 78 ? 14.797  9.561   -18.379 1.00 0.00 ? 78  PRO A HD2  7  
ATOM   8110  H  HD3  . PRO A 1 78 ? 16.280  8.909   -19.104 1.00 0.00 ? 78  PRO A HD3  7  
ATOM   8111  N  N    . SER A 1 79 ? 13.933  12.651  -19.951 1.00 0.00 ? 79  SER A N    7  
ATOM   8112  C  CA   . SER A 1 79 ? 12.919  13.697  -19.912 1.00 0.00 ? 79  SER A CA   7  
ATOM   8113  C  C    . SER A 1 79 ? 11.708  13.251  -19.099 1.00 0.00 ? 79  SER A C    7  
ATOM   8114  O  O    . SER A 1 79 ? 11.091  12.228  -19.396 1.00 0.00 ? 79  SER A O    7  
ATOM   8115  C  CB   . SER A 1 79 ? 12.486  14.069  -21.332 1.00 0.00 ? 79  SER A CB   7  
ATOM   8116  O  OG   . SER A 1 79 ? 11.596  13.103  -21.863 1.00 0.00 ? 79  SER A OG   7  
ATOM   8117  H  H    . SER A 1 79 ? 13.708  11.753  -19.627 1.00 0.00 ? 79  SER A H    7  
ATOM   8118  H  HA   . SER A 1 79 ? 13.355  14.565  -19.440 1.00 0.00 ? 79  SER A HA   7  
ATOM   8119  H  HB2  . SER A 1 79 ? 11.989  15.027  -21.315 1.00 0.00 ? 79  SER A HB2  7  
ATOM   8120  H  HB3  . SER A 1 79 ? 13.357  14.127  -21.968 1.00 0.00 ? 79  SER A HB3  7  
ATOM   8121  H  HG   . SER A 1 79 ? 11.138  13.471  -22.622 1.00 0.00 ? 79  SER A HG   7  
ATOM   8122  N  N    . SER A 1 80 ? 11.373  14.026  -18.073 1.00 0.00 ? 80  SER A N    7  
ATOM   8123  C  CA   . SER A 1 80 ? 10.239  13.709  -17.214 1.00 0.00 ? 80  SER A CA   7  
ATOM   8124  C  C    . SER A 1 80 ? 8.992   14.467  -17.659 1.00 0.00 ? 80  SER A C    7  
ATOM   8125  O  O    . SER A 1 80 ? 8.246   14.996  -16.837 1.00 0.00 ? 80  SER A O    7  
ATOM   8126  C  CB   . SER A 1 80 ? 10.563  14.050  -15.758 1.00 0.00 ? 80  SER A CB   7  
ATOM   8127  O  OG   . SER A 1 80 ? 11.606  13.229  -15.262 1.00 0.00 ? 80  SER A OG   7  
ATOM   8128  H  H    . SER A 1 80 ? 11.905  14.829  -17.887 1.00 0.00 ? 80  SER A H    7  
ATOM   8129  H  HA   . SER A 1 80 ? 10.049  12.649  -17.292 1.00 0.00 ? 80  SER A HA   7  
ATOM   8130  H  HB2  . SER A 1 80 ? 10.872  15.082  -15.693 1.00 0.00 ? 80  SER A HB2  7  
ATOM   8131  H  HB3  . SER A 1 80 ? 9.682   13.899  -15.151 1.00 0.00 ? 80  SER A HB3  7  
ATOM   8132  H  HG   . SER A 1 80 ? 12.446  13.527  -15.620 1.00 0.00 ? 80  SER A HG   7  
ATOM   8133  N  N    . GLY A 1 81 ? 8.772   14.514  -18.970 1.00 0.00 ? 81  GLY A N    7  
ATOM   8134  C  CA   . GLY A 1 81 ? 7.615   15.208  -19.504 1.00 0.00 ? 81  GLY A CA   7  
ATOM   8135  C  C    . GLY A 1 81 ? 6.334   14.840  -18.783 1.00 0.00 ? 81  GLY A C    7  
ATOM   8136  O  O    . GLY A 1 81 ? 6.032   13.653  -18.667 1.00 0.00 ? 81  GLY A O    7  
ATOM   8137  H  H    . GLY A 1 81 ? 9.401   14.073  -19.579 1.00 0.00 ? 81  GLY A H    7  
ATOM   8138  H  HA2  . GLY A 1 81 ? 7.774   16.272  -19.413 1.00 0.00 ? 81  GLY A HA2  7  
ATOM   8139  H  HA3  . GLY A 1 81 ? 7.511   14.958  -20.550 1.00 0.00 ? 81  GLY A HA3  7  
HETATM 8140  ZN ZN   . ZN  B 2 .  ? -2.924  -2.894  -3.955  1.00 0.00 ? 201 ZN  A ZN   7  
HETATM 8141  ZN ZN   . ZN  C 2 .  ? 13.447  2.785   -3.899  1.00 0.00 ? 401 ZN  A ZN   7  
ATOM   8142  N  N    . GLY A 1 1  ? -31.754 -15.406 -20.423 1.00 0.00 ? 1   GLY A N    8  
ATOM   8143  C  CA   . GLY A 1 1  ? -32.846 -15.563 -19.480 1.00 0.00 ? 1   GLY A CA   8  
ATOM   8144  C  C    . GLY A 1 1  ? -32.958 -14.393 -18.523 1.00 0.00 ? 1   GLY A C    8  
ATOM   8145  O  O    . GLY A 1 1  ? -33.939 -13.650 -18.552 1.00 0.00 ? 1   GLY A O    8  
ATOM   8146  H  H1   . GLY A 1 1  ? -31.939 -15.115 -21.340 1.00 0.00 ? 1   GLY A H1   8  
ATOM   8147  H  HA2  . GLY A 1 1  ? -33.771 -15.655 -20.030 1.00 0.00 ? 1   GLY A HA2  8  
ATOM   8148  H  HA3  . GLY A 1 1  ? -32.687 -16.466 -18.909 1.00 0.00 ? 1   GLY A HA3  8  
ATOM   8149  N  N    . SER A 1 2  ? -31.951 -14.230 -17.670 1.00 0.00 ? 2   SER A N    8  
ATOM   8150  C  CA   . SER A 1 2  ? -31.944 -13.145 -16.695 1.00 0.00 ? 2   SER A CA   8  
ATOM   8151  C  C    . SER A 1 2  ? -30.636 -12.362 -16.765 1.00 0.00 ? 2   SER A C    8  
ATOM   8152  O  O    . SER A 1 2  ? -29.684 -12.657 -16.043 1.00 0.00 ? 2   SER A O    8  
ATOM   8153  C  CB   . SER A 1 2  ? -32.145 -13.699 -15.283 1.00 0.00 ? 2   SER A CB   8  
ATOM   8154  O  OG   . SER A 1 2  ? -33.503 -14.037 -15.057 1.00 0.00 ? 2   SER A OG   8  
ATOM   8155  H  H    . SER A 1 2  ? -31.197 -14.855 -17.696 1.00 0.00 ? 2   SER A H    8  
ATOM   8156  H  HA   . SER A 1 2  ? -32.761 -12.481 -16.932 1.00 0.00 ? 2   SER A HA   8  
ATOM   8157  H  HB2  . SER A 1 2  ? -31.541 -14.584 -15.157 1.00 0.00 ? 2   SER A HB2  8  
ATOM   8158  H  HB3  . SER A 1 2  ? -31.847 -12.952 -14.561 1.00 0.00 ? 2   SER A HB3  8  
ATOM   8159  H  HG   . SER A 1 2  ? -33.550 -14.817 -14.500 1.00 0.00 ? 2   SER A HG   8  
ATOM   8160  N  N    . SER A 1 3  ? -30.599 -11.361 -17.639 1.00 0.00 ? 3   SER A N    8  
ATOM   8161  C  CA   . SER A 1 3  ? -29.408 -10.537 -17.806 1.00 0.00 ? 3   SER A CA   8  
ATOM   8162  C  C    . SER A 1 3  ? -29.016 -9.874  -16.489 1.00 0.00 ? 3   SER A C    8  
ATOM   8163  O  O    . SER A 1 3  ? -29.747 -9.036  -15.962 1.00 0.00 ? 3   SER A O    8  
ATOM   8164  C  CB   . SER A 1 3  ? -29.647 -9.469  -18.876 1.00 0.00 ? 3   SER A CB   8  
ATOM   8165  O  OG   . SER A 1 3  ? -29.991 -10.060 -20.118 1.00 0.00 ? 3   SER A OG   8  
ATOM   8166  H  H    . SER A 1 3  ? -31.391 -11.175 -18.186 1.00 0.00 ? 3   SER A H    8  
ATOM   8167  H  HA   . SER A 1 3  ? -28.602 -11.180 -18.126 1.00 0.00 ? 3   SER A HA   8  
ATOM   8168  H  HB2  . SER A 1 3  ? -30.453 -8.824  -18.563 1.00 0.00 ? 3   SER A HB2  8  
ATOM   8169  H  HB3  . SER A 1 3  ? -28.747 -8.885  -19.006 1.00 0.00 ? 3   SER A HB3  8  
ATOM   8170  H  HG   . SER A 1 3  ? -29.279 -9.921  -20.747 1.00 0.00 ? 3   SER A HG   8  
ATOM   8171  N  N    . GLY A 1 4  ? -27.857 -10.256 -15.963 1.00 0.00 ? 4   GLY A N    8  
ATOM   8172  C  CA   . GLY A 1 4  ? -27.387 -9.690  -14.712 1.00 0.00 ? 4   GLY A CA   8  
ATOM   8173  C  C    . GLY A 1 4  ? -27.512 -10.660 -13.554 1.00 0.00 ? 4   GLY A C    8  
ATOM   8174  O  O    . GLY A 1 4  ? -27.571 -11.873 -13.754 1.00 0.00 ? 4   GLY A O    8  
ATOM   8175  H  H    . GLY A 1 4  ? -27.316 -10.929 -16.428 1.00 0.00 ? 4   GLY A H    8  
ATOM   8176  H  HA2  . GLY A 1 4  ? -26.350 -9.410  -14.823 1.00 0.00 ? 4   GLY A HA2  8  
ATOM   8177  H  HA3  . GLY A 1 4  ? -27.967 -8.806  -14.490 1.00 0.00 ? 4   GLY A HA3  8  
ATOM   8178  N  N    . SER A 1 5  ? -27.551 -10.125 -12.338 1.00 0.00 ? 5   SER A N    8  
ATOM   8179  C  CA   . SER A 1 5  ? -27.664 -10.952 -11.142 1.00 0.00 ? 5   SER A CA   8  
ATOM   8180  C  C    . SER A 1 5  ? -27.926 -10.091 -9.909  1.00 0.00 ? 5   SER A C    8  
ATOM   8181  O  O    . SER A 1 5  ? -27.459 -8.956  -9.821  1.00 0.00 ? 5   SER A O    8  
ATOM   8182  C  CB   . SER A 1 5  ? -26.390 -11.775 -10.943 1.00 0.00 ? 5   SER A CB   8  
ATOM   8183  O  OG   . SER A 1 5  ? -25.254 -10.936 -10.824 1.00 0.00 ? 5   SER A OG   8  
ATOM   8184  H  H    . SER A 1 5  ? -27.500 -9.150  -12.243 1.00 0.00 ? 5   SER A H    8  
ATOM   8185  H  HA   . SER A 1 5  ? -28.498 -11.623 -11.281 1.00 0.00 ? 5   SER A HA   8  
ATOM   8186  H  HB2  . SER A 1 5  ? -26.482 -12.364 -10.043 1.00 0.00 ? 5   SER A HB2  8  
ATOM   8187  H  HB3  . SER A 1 5  ? -26.252 -12.430 -11.790 1.00 0.00 ? 5   SER A HB3  8  
ATOM   8188  H  HG   . SER A 1 5  ? -24.743 -10.972 -11.636 1.00 0.00 ? 5   SER A HG   8  
ATOM   8189  N  N    . SER A 1 6  ? -28.675 -10.642 -8.959  1.00 0.00 ? 6   SER A N    8  
ATOM   8190  C  CA   . SER A 1 6  ? -29.003 -9.925  -7.733  1.00 0.00 ? 6   SER A CA   8  
ATOM   8191  C  C    . SER A 1 6  ? -28.109 -10.379 -6.583  1.00 0.00 ? 6   SER A C    8  
ATOM   8192  O  O    . SER A 1 6  ? -27.450 -11.415 -6.665  1.00 0.00 ? 6   SER A O    8  
ATOM   8193  C  CB   . SER A 1 6  ? -30.473 -10.140 -7.367  1.00 0.00 ? 6   SER A CB   8  
ATOM   8194  O  OG   . SER A 1 6  ? -31.327 -9.674  -8.397  1.00 0.00 ? 6   SER A OG   8  
ATOM   8195  H  H    . SER A 1 6  ? -29.018 -11.551 -9.088  1.00 0.00 ? 6   SER A H    8  
ATOM   8196  H  HA   . SER A 1 6  ? -28.835 -8.873  -7.909  1.00 0.00 ? 6   SER A HA   8  
ATOM   8197  H  HB2  . SER A 1 6  ? -30.652 -11.194 -7.216  1.00 0.00 ? 6   SER A HB2  8  
ATOM   8198  H  HB3  . SER A 1 6  ? -30.697 -9.603  -6.458  1.00 0.00 ? 6   SER A HB3  8  
ATOM   8199  H  HG   . SER A 1 6  ? -32.110 -10.229 -8.439  1.00 0.00 ? 6   SER A HG   8  
ATOM   8200  N  N    . GLY A 1 7  ? -28.093 -9.595  -5.509  1.00 0.00 ? 7   GLY A N    8  
ATOM   8201  C  CA   . GLY A 1 7  ? -27.277 -9.933  -4.356  1.00 0.00 ? 7   GLY A CA   8  
ATOM   8202  C  C    . GLY A 1 7  ? -26.119 -8.973  -4.165  1.00 0.00 ? 7   GLY A C    8  
ATOM   8203  O  O    . GLY A 1 7  ? -26.292 -7.756  -4.240  1.00 0.00 ? 7   GLY A O    8  
ATOM   8204  H  H    . GLY A 1 7  ? -28.639 -8.781  -5.499  1.00 0.00 ? 7   GLY A H    8  
ATOM   8205  H  HA2  . GLY A 1 7  ? -27.897 -9.914  -3.472  1.00 0.00 ? 7   GLY A HA2  8  
ATOM   8206  H  HA3  . GLY A 1 7  ? -26.885 -10.931 -4.487  1.00 0.00 ? 7   GLY A HA3  8  
ATOM   8207  N  N    . LEU A 1 8  ? -24.935 -9.521  -3.915  1.00 0.00 ? 8   LEU A N    8  
ATOM   8208  C  CA   . LEU A 1 8  ? -23.743 -8.705  -3.710  1.00 0.00 ? 8   LEU A CA   8  
ATOM   8209  C  C    . LEU A 1 8  ? -23.971 -7.674  -2.610  1.00 0.00 ? 8   LEU A C    8  
ATOM   8210  O  O    . LEU A 1 8  ? -23.780 -6.476  -2.818  1.00 0.00 ? 8   LEU A O    8  
ATOM   8211  C  CB   . LEU A 1 8  ? -23.353 -8.001  -5.011  1.00 0.00 ? 8   LEU A CB   8  
ATOM   8212  C  CG   . LEU A 1 8  ? -23.202 -8.898  -6.240  1.00 0.00 ? 8   LEU A CG   8  
ATOM   8213  C  CD1  . LEU A 1 8  ? -23.325 -8.080  -7.516  1.00 0.00 ? 8   LEU A CD1  8  
ATOM   8214  C  CD2  . LEU A 1 8  ? -21.872 -9.635  -6.203  1.00 0.00 ? 8   LEU A CD2  8  
ATOM   8215  H  H    . LEU A 1 8  ? -24.859 -10.496 -3.867  1.00 0.00 ? 8   LEU A H    8  
ATOM   8216  H  HA   . LEU A 1 8  ? -22.940 -9.362  -3.410  1.00 0.00 ? 8   LEU A HA   8  
ATOM   8217  H  HB2  . LEU A 1 8  ? -24.111 -7.266  -5.229  1.00 0.00 ? 8   LEU A HB2  8  
ATOM   8218  H  HB3  . LEU A 1 8  ? -22.407 -7.504  -4.846  1.00 0.00 ? 8   LEU A HB3  8  
ATOM   8219  H  HG   . LEU A 1 8  ? -23.994 -9.635  -6.239  1.00 0.00 ? 8   LEU A HG   8  
ATOM   8220  H  HD11 . LEU A 1 8  ? -22.667 -7.227  -7.461  1.00 0.00 ? 8   LEU A HD11 8  
ATOM   8221  H  HD12 . LEU A 1 8  ? -24.345 -7.742  -7.630  1.00 0.00 ? 8   LEU A HD12 8  
ATOM   8222  H  HD13 . LEU A 1 8  ? -23.053 -8.692  -8.364  1.00 0.00 ? 8   LEU A HD13 8  
ATOM   8223  H  HD21 . LEU A 1 8  ? -21.981 -10.598 -6.681  1.00 0.00 ? 8   LEU A HD21 8  
ATOM   8224  H  HD22 . LEU A 1 8  ? -21.566 -9.776  -5.176  1.00 0.00 ? 8   LEU A HD22 8  
ATOM   8225  H  HD23 . LEU A 1 8  ? -21.125 -9.057  -6.726  1.00 0.00 ? 8   LEU A HD23 8  
ATOM   8226  N  N    . ASP A 1 9  ? -24.379 -8.148  -1.437  1.00 0.00 ? 9   ASP A N    8  
ATOM   8227  C  CA   . ASP A 1 9  ? -24.631 -7.267  -0.302  1.00 0.00 ? 9   ASP A CA   8  
ATOM   8228  C  C    . ASP A 1 9  ? -23.602 -7.496  0.801   1.00 0.00 ? 9   ASP A C    8  
ATOM   8229  O  O    . ASP A 1 9  ? -23.354 -6.615  1.625   1.00 0.00 ? 9   ASP A O    8  
ATOM   8230  C  CB   . ASP A 1 9  ? -26.041 -7.494  0.244   1.00 0.00 ? 9   ASP A CB   8  
ATOM   8231  C  CG   . ASP A 1 9  ? -26.192 -8.846  0.913   1.00 0.00 ? 9   ASP A CG   8  
ATOM   8232  O  OD1  . ASP A 1 9  ? -25.881 -9.867  0.266   1.00 0.00 ? 9   ASP A OD1  8  
ATOM   8233  O  OD2  . ASP A 1 9  ? -26.621 -8.882  2.086   1.00 0.00 ? 9   ASP A OD2  8  
ATOM   8234  H  H    . ASP A 1 9  ? -24.514 -9.113  -1.333  1.00 0.00 ? 9   ASP A H    8  
ATOM   8235  H  HA   . ASP A 1 9  ? -24.548 -6.248  -0.649  1.00 0.00 ? 9   ASP A HA   8  
ATOM   8236  H  HB2  . ASP A 1 9  ? -26.267 -6.726  0.970   1.00 0.00 ? 9   ASP A HB2  8  
ATOM   8237  H  HB3  . ASP A 1 9  ? -26.749 -7.434  -0.570  1.00 0.00 ? 9   ASP A HB3  8  
ATOM   8238  N  N    . TYR A 1 10 ? -23.006 -8.683  0.811   1.00 0.00 ? 10  TYR A N    8  
ATOM   8239  C  CA   . TYR A 1 10 ? -22.007 -9.029  1.814   1.00 0.00 ? 10  TYR A CA   8  
ATOM   8240  C  C    . TYR A 1 10 ? -20.861 -8.022  1.812   1.00 0.00 ? 10  TYR A C    8  
ATOM   8241  O  O    . TYR A 1 10 ? -20.040 -7.998  2.728   1.00 0.00 ? 10  TYR A O    8  
ATOM   8242  C  CB   . TYR A 1 10 ? -21.464 -10.436 1.561   1.00 0.00 ? 10  TYR A CB   8  
ATOM   8243  C  CG   . TYR A 1 10 ? -21.475 -10.836 0.103   1.00 0.00 ? 10  TYR A CG   8  
ATOM   8244  C  CD1  . TYR A 1 10 ? -21.155 -9.919  -0.891  1.00 0.00 ? 10  TYR A CD1  8  
ATOM   8245  C  CD2  . TYR A 1 10 ? -21.805 -12.130 -0.281  1.00 0.00 ? 10  TYR A CD2  8  
ATOM   8246  C  CE1  . TYR A 1 10 ? -21.164 -10.280 -2.225  1.00 0.00 ? 10  TYR A CE1  8  
ATOM   8247  C  CE2  . TYR A 1 10 ? -21.815 -12.500 -1.612  1.00 0.00 ? 10  TYR A CE2  8  
ATOM   8248  C  CZ   . TYR A 1 10 ? -21.495 -11.571 -2.580  1.00 0.00 ? 10  TYR A CZ   8  
ATOM   8249  O  OH   . TYR A 1 10 ? -21.504 -11.935 -3.907  1.00 0.00 ? 10  TYR A OH   8  
ATOM   8250  H  H    . TYR A 1 10 ? -23.246 -9.344  0.128   1.00 0.00 ? 10  TYR A H    8  
ATOM   8251  H  HA   . TYR A 1 10 ? -22.487 -9.008  2.782   1.00 0.00 ? 10  TYR A HA   8  
ATOM   8252  H  HB2  . TYR A 1 10 ? -20.445 -10.490 1.911   1.00 0.00 ? 10  TYR A HB2  8  
ATOM   8253  H  HB3  . TYR A 1 10 ? -22.066 -11.150 2.105   1.00 0.00 ? 10  TYR A HB3  8  
ATOM   8254  H  HD1  . TYR A 1 10 ? -20.896 -8.909  -0.610  1.00 0.00 ? 10  TYR A HD1  8  
ATOM   8255  H  HD2  . TYR A 1 10 ? -22.056 -12.855 0.480   1.00 0.00 ? 10  TYR A HD2  8  
ATOM   8256  H  HE1  . TYR A 1 10 ? -20.913 -9.553  -2.983  1.00 0.00 ? 10  TYR A HE1  8  
ATOM   8257  H  HE2  . TYR A 1 10 ? -22.074 -13.511 -1.891  1.00 0.00 ? 10  TYR A HE2  8  
ATOM   8258  H  HH   . TYR A 1 10 ? -20.872 -12.643 -4.049  1.00 0.00 ? 10  TYR A HH   8  
ATOM   8259  N  N    . GLN A 1 11 ? -20.814 -7.191  0.775   1.00 0.00 ? 11  GLN A N    8  
ATOM   8260  C  CA   . GLN A 1 11 ? -19.770 -6.182  0.652   1.00 0.00 ? 11  GLN A CA   8  
ATOM   8261  C  C    . GLN A 1 11 ? -20.054 -4.991  1.561   1.00 0.00 ? 11  GLN A C    8  
ATOM   8262  O  O    . GLN A 1 11 ? -19.143 -4.250  1.933   1.00 0.00 ? 11  GLN A O    8  
ATOM   8263  C  CB   . GLN A 1 11 ? -19.651 -5.714  -0.800  1.00 0.00 ? 11  GLN A CB   8  
ATOM   8264  C  CG   . GLN A 1 11 ? -20.874 -4.959  -1.297  1.00 0.00 ? 11  GLN A CG   8  
ATOM   8265  C  CD   . GLN A 1 11 ? -20.556 -4.029  -2.451  1.00 0.00 ? 11  GLN A CD   8  
ATOM   8266  O  OE1  . GLN A 1 11 ? -20.800 -4.357  -3.613  1.00 0.00 ? 11  GLN A OE1  8  
ATOM   8267  N  NE2  . GLN A 1 11 ? -20.008 -2.861  -2.137  1.00 0.00 ? 11  GLN A NE2  8  
ATOM   8268  H  H    . GLN A 1 11 ? -21.498 -7.260  0.076   1.00 0.00 ? 11  GLN A H    8  
ATOM   8269  H  HA   . GLN A 1 11 ? -18.836 -6.633  0.952   1.00 0.00 ? 11  GLN A HA   8  
ATOM   8270  H  HB2  . GLN A 1 11 ? -18.793 -5.064  -0.888  1.00 0.00 ? 11  GLN A HB2  8  
ATOM   8271  H  HB3  . GLN A 1 11 ? -19.506 -6.577  -1.433  1.00 0.00 ? 11  GLN A HB3  8  
ATOM   8272  H  HG2  . GLN A 1 11 ? -21.614 -5.674  -1.625  1.00 0.00 ? 11  GLN A HG2  8  
ATOM   8273  H  HG3  . GLN A 1 11 ? -21.275 -4.374  -0.483  1.00 0.00 ? 11  GLN A HG3  8  
ATOM   8274  H  HE21 . GLN A 1 11 ? -19.841 -2.668  -1.190  1.00 0.00 ? 11  GLN A HE21 8  
ATOM   8275  H  HE22 . GLN A 1 11 ? -19.791 -2.241  -2.863  1.00 0.00 ? 11  GLN A HE22 8  
ATOM   8276  N  N    . ARG A 1 12 ? -21.323 -4.812  1.914   1.00 0.00 ? 12  ARG A N    8  
ATOM   8277  C  CA   . ARG A 1 12 ? -21.727 -3.710  2.779   1.00 0.00 ? 12  ARG A CA   8  
ATOM   8278  C  C    . ARG A 1 12 ? -20.723 -3.510  3.911   1.00 0.00 ? 12  ARG A C    8  
ATOM   8279  O  O    . ARG A 1 12 ? -20.469 -2.383  4.338   1.00 0.00 ? 12  ARG A O    8  
ATOM   8280  C  CB   . ARG A 1 12 ? -23.119 -3.971  3.357   1.00 0.00 ? 12  ARG A CB   8  
ATOM   8281  C  CG   . ARG A 1 12 ? -23.937 -2.708  3.568   1.00 0.00 ? 12  ARG A CG   8  
ATOM   8282  C  CD   . ARG A 1 12 ? -23.580 -2.025  4.879   1.00 0.00 ? 12  ARG A CD   8  
ATOM   8283  N  NE   . ARG A 1 12 ? -24.290 -0.760  5.048   1.00 0.00 ? 12  ARG A NE   8  
ATOM   8284  C  CZ   . ARG A 1 12 ? -25.518 -0.667  5.547   1.00 0.00 ? 12  ARG A CZ   8  
ATOM   8285  N  NH1  . ARG A 1 12 ? -26.168 -1.760  5.924   1.00 0.00 ? 12  ARG A NH1  8  
ATOM   8286  N  NH2  . ARG A 1 12 ? -26.097 0.520   5.670   1.00 0.00 ? 12  ARG A NH2  8  
ATOM   8287  H  H    . ARG A 1 12 ? -22.003 -5.436  1.585   1.00 0.00 ? 12  ARG A H    8  
ATOM   8288  H  HA   . ARG A 1 12 ? -21.758 -2.812  2.179   1.00 0.00 ? 12  ARG A HA   8  
ATOM   8289  H  HB2  . ARG A 1 12 ? -23.661 -4.616  2.681   1.00 0.00 ? 12  ARG A HB2  8  
ATOM   8290  H  HB3  . ARG A 1 12 ? -23.012 -4.468  4.309   1.00 0.00 ? 12  ARG A HB3  8  
ATOM   8291  H  HG2  . ARG A 1 12 ? -23.744 -2.024  2.755   1.00 0.00 ? 12  ARG A HG2  8  
ATOM   8292  H  HG3  . ARG A 1 12 ? -24.986 -2.967  3.581   1.00 0.00 ? 12  ARG A HG3  8  
ATOM   8293  H  HD2  . ARG A 1 12 ? -23.839 -2.684  5.694   1.00 0.00 ? 12  ARG A HD2  8  
ATOM   8294  H  HD3  . ARG A 1 12 ? -22.517 -1.835  4.892   1.00 0.00 ? 12  ARG A HD3  8  
ATOM   8295  H  HE   . ARG A 1 12 ? -23.828 0.060   4.776   1.00 0.00 ? 12  ARG A HE   8  
ATOM   8296  H  HH11 . ARG A 1 12 ? -25.734 -2.655  5.833   1.00 0.00 ? 12  ARG A HH11 8  
ATOM   8297  H  HH12 . ARG A 1 12 ? -27.092 -1.687  6.300   1.00 0.00 ? 12  ARG A HH12 8  
ATOM   8298  H  HH21 . ARG A 1 12 ? -25.610 1.346   5.388   1.00 0.00 ? 12  ARG A HH21 8  
ATOM   8299  H  HH22 . ARG A 1 12 ? -27.021 0.589   6.046   1.00 0.00 ? 12  ARG A HH22 8  
ATOM   8300  N  N    . LEU A 1 13 ? -20.157 -4.611  4.393   1.00 0.00 ? 13  LEU A N    8  
ATOM   8301  C  CA   . LEU A 1 13 ? -19.182 -4.558  5.476   1.00 0.00 ? 13  LEU A CA   8  
ATOM   8302  C  C    . LEU A 1 13 ? -18.170 -3.440  5.244   1.00 0.00 ? 13  LEU A C    8  
ATOM   8303  O  O    . LEU A 1 13 ? -18.025 -2.943  4.127   1.00 0.00 ? 13  LEU A O    8  
ATOM   8304  C  CB   . LEU A 1 13 ? -18.457 -5.899  5.603   1.00 0.00 ? 13  LEU A CB   8  
ATOM   8305  C  CG   . LEU A 1 13 ? -17.962 -6.520  4.297   1.00 0.00 ? 13  LEU A CG   8  
ATOM   8306  C  CD1  . LEU A 1 13 ? -16.743 -5.773  3.778   1.00 0.00 ? 13  LEU A CD1  8  
ATOM   8307  C  CD2  . LEU A 1 13 ? -17.641 -7.995  4.495   1.00 0.00 ? 13  LEU A CD2  8  
ATOM   8308  H  H    . LEU A 1 13 ? -20.400 -5.480  4.013   1.00 0.00 ? 13  LEU A H    8  
ATOM   8309  H  HA   . LEU A 1 13 ? -19.716 -4.358  6.394   1.00 0.00 ? 13  LEU A HA   8  
ATOM   8310  H  HB2  . LEU A 1 13 ? -17.602 -5.754  6.245   1.00 0.00 ? 13  LEU A HB2  8  
ATOM   8311  H  HB3  . LEU A 1 13 ? -19.138 -6.599  6.067   1.00 0.00 ? 13  LEU A HB3  8  
ATOM   8312  H  HG   . LEU A 1 13 ? -18.742 -6.444  3.551   1.00 0.00 ? 13  LEU A HG   8  
ATOM   8313  H  HD11 . LEU A 1 13 ? -16.292 -5.218  4.586   1.00 0.00 ? 13  LEU A HD11 8  
ATOM   8314  H  HD12 . LEU A 1 13 ? -17.045 -5.091  2.997   1.00 0.00 ? 13  LEU A HD12 8  
ATOM   8315  H  HD13 . LEU A 1 13 ? -16.029 -6.480  3.383   1.00 0.00 ? 13  LEU A HD13 8  
ATOM   8316  H  HD21 . LEU A 1 13 ? -16.706 -8.228  4.009   1.00 0.00 ? 13  LEU A HD21 8  
ATOM   8317  H  HD22 . LEU A 1 13 ? -18.430 -8.596  4.066   1.00 0.00 ? 13  LEU A HD22 8  
ATOM   8318  H  HD23 . LEU A 1 13 ? -17.561 -8.206  5.551   1.00 0.00 ? 13  LEU A HD23 8  
ATOM   8319  N  N    . TYR A 1 14 ? -17.471 -3.052  6.304   1.00 0.00 ? 14  TYR A N    8  
ATOM   8320  C  CA   . TYR A 1 14 ? -16.472 -1.994  6.216   1.00 0.00 ? 14  TYR A CA   8  
ATOM   8321  C  C    . TYR A 1 14 ? -15.845 -1.951  4.826   1.00 0.00 ? 14  TYR A C    8  
ATOM   8322  O  O    . TYR A 1 14 ? -15.940 -0.948  4.119   1.00 0.00 ? 14  TYR A O    8  
ATOM   8323  C  CB   . TYR A 1 14 ? -15.385 -2.200  7.272   1.00 0.00 ? 14  TYR A CB   8  
ATOM   8324  C  CG   . TYR A 1 14 ? -14.760 -3.576  7.237   1.00 0.00 ? 14  TYR A CG   8  
ATOM   8325  C  CD1  . TYR A 1 14 ? -15.425 -4.676  7.765   1.00 0.00 ? 14  TYR A CD1  8  
ATOM   8326  C  CD2  . TYR A 1 14 ? -13.504 -3.777  6.677   1.00 0.00 ? 14  TYR A CD2  8  
ATOM   8327  C  CE1  . TYR A 1 14 ? -14.858 -5.935  7.736   1.00 0.00 ? 14  TYR A CE1  8  
ATOM   8328  C  CE2  . TYR A 1 14 ? -12.930 -5.033  6.642   1.00 0.00 ? 14  TYR A CE2  8  
ATOM   8329  C  CZ   . TYR A 1 14 ? -13.611 -6.109  7.173   1.00 0.00 ? 14  TYR A CZ   8  
ATOM   8330  O  OH   . TYR A 1 14 ? -13.042 -7.361  7.142   1.00 0.00 ? 14  TYR A OH   8  
ATOM   8331  H  H    . TYR A 1 14 ? -17.631 -3.487  7.168   1.00 0.00 ? 14  TYR A H    8  
ATOM   8332  H  HA   . TYR A 1 14 ? -16.968 -1.053  6.403   1.00 0.00 ? 14  TYR A HA   8  
ATOM   8333  H  HB2  . TYR A 1 14 ? -14.600 -1.476  7.116   1.00 0.00 ? 14  TYR A HB2  8  
ATOM   8334  H  HB3  . TYR A 1 14 ? -15.813 -2.054  8.253   1.00 0.00 ? 14  TYR A HB3  8  
ATOM   8335  H  HD1  . TYR A 1 14 ? -16.402 -4.537  8.205   1.00 0.00 ? 14  TYR A HD1  8  
ATOM   8336  H  HD2  . TYR A 1 14 ? -12.974 -2.932  6.262   1.00 0.00 ? 14  TYR A HD2  8  
ATOM   8337  H  HE1  . TYR A 1 14 ? -15.391 -6.778  8.151   1.00 0.00 ? 14  TYR A HE1  8  
ATOM   8338  H  HE2  . TYR A 1 14 ? -11.953 -5.169  6.202   1.00 0.00 ? 14  TYR A HE2  8  
ATOM   8339  H  HH   . TYR A 1 14 ? -13.699 -8.018  7.384   1.00 0.00 ? 14  TYR A HH   8  
ATOM   8340  N  N    . GLY A 1 15 ? -15.203 -3.050  4.439   1.00 0.00 ? 15  GLY A N    8  
ATOM   8341  C  CA   . GLY A 1 15 ? -14.570 -3.119  3.135   1.00 0.00 ? 15  GLY A CA   8  
ATOM   8342  C  C    . GLY A 1 15 ? -13.231 -2.410  3.103   1.00 0.00 ? 15  GLY A C    8  
ATOM   8343  O  O    . GLY A 1 15 ? -13.114 -1.266  3.542   1.00 0.00 ? 15  GLY A O    8  
ATOM   8344  H  H    . GLY A 1 15 ? -15.160 -3.820  5.044   1.00 0.00 ? 15  GLY A H    8  
ATOM   8345  H  HA2  . GLY A 1 15 ? -14.424 -4.156  2.872   1.00 0.00 ? 15  GLY A HA2  8  
ATOM   8346  H  HA3  . GLY A 1 15 ? -15.223 -2.662  2.406   1.00 0.00 ? 15  GLY A HA3  8  
ATOM   8347  N  N    . THR A 1 16 ? -12.214 -3.092  2.582   1.00 0.00 ? 16  THR A N    8  
ATOM   8348  C  CA   . THR A 1 16 ? -10.876 -2.522  2.497   1.00 0.00 ? 16  THR A CA   8  
ATOM   8349  C  C    . THR A 1 16 ? -10.350 -2.565  1.067   1.00 0.00 ? 16  THR A C    8  
ATOM   8350  O  O    . THR A 1 16 ? -9.896  -3.607  0.594   1.00 0.00 ? 16  THR A O    8  
ATOM   8351  C  CB   . THR A 1 16 ? -9.889  -3.265  3.418   1.00 0.00 ? 16  THR A CB   8  
ATOM   8352  O  OG1  . THR A 1 16 ? -10.322 -3.168  4.779   1.00 0.00 ? 16  THR A OG1  8  
ATOM   8353  C  CG2  . THR A 1 16 ? -8.487  -2.691  3.284   1.00 0.00 ? 16  THR A CG2  8  
ATOM   8354  H  H    . THR A 1 16 ? -12.370 -4.000  2.249   1.00 0.00 ? 16  THR A H    8  
ATOM   8355  H  HA   . THR A 1 16 ? -10.931 -1.492  2.820   1.00 0.00 ? 16  THR A HA   8  
ATOM   8356  H  HB   . THR A 1 16 ? -9.865  -4.306  3.129   1.00 0.00 ? 16  THR A HB   8  
ATOM   8357  H  HG1  . THR A 1 16 ? -9.760  -2.548  5.251   1.00 0.00 ? 16  THR A HG1  8  
ATOM   8358  H  HG21 . THR A 1 16 ? -7.964  -3.199  2.487   1.00 0.00 ? 16  THR A HG21 8  
ATOM   8359  H  HG22 . THR A 1 16 ? -7.952  -2.828  4.212   1.00 0.00 ? 16  THR A HG22 8  
ATOM   8360  H  HG23 . THR A 1 16 ? -8.550  -1.637  3.058   1.00 0.00 ? 16  THR A HG23 8  
ATOM   8361  N  N    . ARG A 1 17 ? -10.414 -1.427  0.383   1.00 0.00 ? 17  ARG A N    8  
ATOM   8362  C  CA   . ARG A 1 17 ? -9.944  -1.336  -0.994  1.00 0.00 ? 17  ARG A CA   8  
ATOM   8363  C  C    . ARG A 1 17 ? -8.572  -0.671  -1.057  1.00 0.00 ? 17  ARG A C    8  
ATOM   8364  O  O    . ARG A 1 17 ? -8.423  0.502   -0.713  1.00 0.00 ? 17  ARG A O    8  
ATOM   8365  C  CB   . ARG A 1 17 ? -10.943 -0.551  -1.845  1.00 0.00 ? 17  ARG A CB   8  
ATOM   8366  C  CG   . ARG A 1 17 ? -10.883 -0.893  -3.325  1.00 0.00 ? 17  ARG A CG   8  
ATOM   8367  C  CD   . ARG A 1 17 ? -11.536 0.187   -4.173  1.00 0.00 ? 17  ARG A CD   8  
ATOM   8368  N  NE   . ARG A 1 17 ? -12.973 0.279   -3.931  1.00 0.00 ? 17  ARG A NE   8  
ATOM   8369  C  CZ   . ARG A 1 17 ? -13.693 1.367   -4.182  1.00 0.00 ? 17  ARG A CZ   8  
ATOM   8370  N  NH1  . ARG A 1 17 ? -13.112 2.449   -4.682  1.00 0.00 ? 17  ARG A NH1  8  
ATOM   8371  N  NH2  . ARG A 1 17 ? -14.996 1.374   -3.935  1.00 0.00 ? 17  ARG A NH2  8  
ATOM   8372  H  H    . ARG A 1 17 ? -10.786 -0.630  0.815   1.00 0.00 ? 17  ARG A H    8  
ATOM   8373  H  HA   . ARG A 1 17 ? -9.862  -2.340  -1.384  1.00 0.00 ? 17  ARG A HA   8  
ATOM   8374  H  HB2  . ARG A 1 17 ? -11.942 -0.760  -1.491  1.00 0.00 ? 17  ARG A HB2  8  
ATOM   8375  H  HB3  . ARG A 1 17 ? -10.743 0.503   -1.733  1.00 0.00 ? 17  ARG A HB3  8  
ATOM   8376  H  HG2  . ARG A 1 17 ? -9.849  -0.991  -3.621  1.00 0.00 ? 17  ARG A HG2  8  
ATOM   8377  H  HG3  . ARG A 1 17 ? -11.397 -1.828  -3.490  1.00 0.00 ? 17  ARG A HG3  8  
ATOM   8378  H  HD2  . ARG A 1 17 ? -11.079 1.137   -3.937  1.00 0.00 ? 17  ARG A HD2  8  
ATOM   8379  H  HD3  . ARG A 1 17 ? -11.370 -0.043  -5.215  1.00 0.00 ? 17  ARG A HD3  8  
ATOM   8380  H  HE   . ARG A 1 17 ? -13.423 -0.509  -3.562  1.00 0.00 ? 17  ARG A HE   8  
ATOM   8381  H  HH11 . ARG A 1 17 ? -12.130 2.447   -4.870  1.00 0.00 ? 17  ARG A HH11 8  
ATOM   8382  H  HH12 . ARG A 1 17 ? -13.656 3.267   -4.871  1.00 0.00 ? 17  ARG A HH12 8  
ATOM   8383  H  HH21 . ARG A 1 17 ? -15.438 0.560   -3.558  1.00 0.00 ? 17  ARG A HH21 8  
ATOM   8384  H  HH22 . ARG A 1 17 ? -15.537 2.193   -4.124  1.00 0.00 ? 17  ARG A HH22 8  
ATOM   8385  N  N    . CYS A 1 18 ? -7.573  -1.427  -1.499  1.00 0.00 ? 18  CYS A N    8  
ATOM   8386  C  CA   . CYS A 1 18 ? -6.213  -0.912  -1.607  1.00 0.00 ? 18  CYS A CA   8  
ATOM   8387  C  C    . CYS A 1 18 ? -6.206  0.476   -2.240  1.00 0.00 ? 18  CYS A C    8  
ATOM   8388  O  O    . CYS A 1 18 ? -6.690  0.665   -3.356  1.00 0.00 ? 18  CYS A O    8  
ATOM   8389  C  CB   . CYS A 1 18 ? -5.349  -1.866  -2.435  1.00 0.00 ? 18  CYS A CB   8  
ATOM   8390  S  SG   . CYS A 1 18 ? -3.588  -1.404  -2.502  1.00 0.00 ? 18  CYS A SG   8  
ATOM   8391  H  H    . CYS A 1 18 ? -7.754  -2.355  -1.759  1.00 0.00 ? 18  CYS A H    8  
ATOM   8392  H  HA   . CYS A 1 18 ? -5.805  -0.843  -0.611  1.00 0.00 ? 18  CYS A HA   8  
ATOM   8393  H  HB2  . CYS A 1 18 ? -5.412  -2.857  -2.009  1.00 0.00 ? 18  CYS A HB2  8  
ATOM   8394  H  HB3  . CYS A 1 18 ? -5.722  -1.890  -3.448  1.00 0.00 ? 18  CYS A HB3  8  
ATOM   8395  N  N    . PHE A 1 19 ? -5.654  1.446   -1.518  1.00 0.00 ? 19  PHE A N    8  
ATOM   8396  C  CA   . PHE A 1 19 ? -5.584  2.818   -2.008  1.00 0.00 ? 19  PHE A CA   8  
ATOM   8397  C  C    . PHE A 1 19 ? -4.493  2.963   -3.065  1.00 0.00 ? 19  PHE A C    8  
ATOM   8398  O  O    . PHE A 1 19 ? -4.189  4.070   -3.510  1.00 0.00 ? 19  PHE A O    8  
ATOM   8399  C  CB   . PHE A 1 19 ? -5.319  3.782   -0.849  1.00 0.00 ? 19  PHE A CB   8  
ATOM   8400  C  CG   . PHE A 1 19 ? -6.570  4.255   -0.165  1.00 0.00 ? 19  PHE A CG   8  
ATOM   8401  C  CD1  . PHE A 1 19 ? -7.660  4.684   -0.904  1.00 0.00 ? 19  PHE A CD1  8  
ATOM   8402  C  CD2  . PHE A 1 19 ? -6.655  4.271   1.218   1.00 0.00 ? 19  PHE A CD2  8  
ATOM   8403  C  CE1  . PHE A 1 19 ? -8.813  5.119   -0.277  1.00 0.00 ? 19  PHE A CE1  8  
ATOM   8404  C  CE2  . PHE A 1 19 ? -7.805  4.704   1.850   1.00 0.00 ? 19  PHE A CE2  8  
ATOM   8405  C  CZ   . PHE A 1 19 ? -8.885  5.130   1.102   1.00 0.00 ? 19  PHE A CZ   8  
ATOM   8406  H  H    . PHE A 1 19 ? -5.285  1.234   -0.635  1.00 0.00 ? 19  PHE A H    8  
ATOM   8407  H  HA   . PHE A 1 19 ? -6.536  3.059   -2.454  1.00 0.00 ? 19  PHE A HA   8  
ATOM   8408  H  HB2  . PHE A 1 19 ? -4.705  3.288   -0.112  1.00 0.00 ? 19  PHE A HB2  8  
ATOM   8409  H  HB3  . PHE A 1 19 ? -4.797  4.649   -1.225  1.00 0.00 ? 19  PHE A HB3  8  
ATOM   8410  H  HD1  . PHE A 1 19 ? -7.605  4.676   -1.984  1.00 0.00 ? 19  PHE A HD1  8  
ATOM   8411  H  HD2  . PHE A 1 19 ? -5.811  3.939   1.805   1.00 0.00 ? 19  PHE A HD2  8  
ATOM   8412  H  HE1  . PHE A 1 19 ? -9.655  5.451   -0.866  1.00 0.00 ? 19  PHE A HE1  8  
ATOM   8413  H  HE2  . PHE A 1 19 ? -7.858  4.712   2.929   1.00 0.00 ? 19  PHE A HE2  8  
ATOM   8414  H  HZ   . PHE A 1 19 ? -9.784  5.469   1.593   1.00 0.00 ? 19  PHE A HZ   8  
ATOM   8415  N  N    . SER A 1 20 ? -3.909  1.838   -3.462  1.00 0.00 ? 20  SER A N    8  
ATOM   8416  C  CA   . SER A 1 20 ? -2.849  1.839   -4.463  1.00 0.00 ? 20  SER A CA   8  
ATOM   8417  C  C    . SER A 1 20 ? -3.398  1.462   -5.836  1.00 0.00 ? 20  SER A C    8  
ATOM   8418  O  O    . SER A 1 20 ? -3.500  2.304   -6.729  1.00 0.00 ? 20  SER A O    8  
ATOM   8419  C  CB   . SER A 1 20 ? -1.738  0.867   -4.062  1.00 0.00 ? 20  SER A CB   8  
ATOM   8420  O  OG   . SER A 1 20 ? -0.580  1.058   -4.857  1.00 0.00 ? 20  SER A OG   8  
ATOM   8421  H  H    . SER A 1 20 ? -4.196  0.986   -3.070  1.00 0.00 ? 20  SER A H    8  
ATOM   8422  H  HA   . SER A 1 20 ? -2.441  2.838   -4.513  1.00 0.00 ? 20  SER A HA   8  
ATOM   8423  H  HB2  . SER A 1 20 ? -1.479  1.028   -3.026  1.00 0.00 ? 20  SER A HB2  8  
ATOM   8424  H  HB3  . SER A 1 20 ? -2.086  -0.147  -4.192  1.00 0.00 ? 20  SER A HB3  8  
ATOM   8425  H  HG   . SER A 1 20 ? -0.793  0.890   -5.778  1.00 0.00 ? 20  SER A HG   8  
ATOM   8426  N  N    . CYS A 1 21 ? -3.750  0.191   -5.997  1.00 0.00 ? 21  CYS A N    8  
ATOM   8427  C  CA   . CYS A 1 21 ? -4.288  -0.300  -7.260  1.00 0.00 ? 21  CYS A CA   8  
ATOM   8428  C  C    . CYS A 1 21 ? -5.809  -0.179  -7.286  1.00 0.00 ? 21  CYS A C    8  
ATOM   8429  O  O    . CYS A 1 21 ? -6.451  -0.508  -8.284  1.00 0.00 ? 21  CYS A O    8  
ATOM   8430  C  CB   . CYS A 1 21 ? -3.878  -1.757  -7.481  1.00 0.00 ? 21  CYS A CB   8  
ATOM   8431  S  SG   . CYS A 1 21 ? -4.246  -2.855  -6.075  1.00 0.00 ? 21  CYS A SG   8  
ATOM   8432  H  H    . CYS A 1 21 ? -3.645  -0.433  -5.247  1.00 0.00 ? 21  CYS A H    8  
ATOM   8433  H  HA   . CYS A 1 21 ? -3.878  0.306   -8.053  1.00 0.00 ? 21  CYS A HA   8  
ATOM   8434  H  HB2  . CYS A 1 21 ? -4.401  -2.143  -8.344  1.00 0.00 ? 21  CYS A HB2  8  
ATOM   8435  H  HB3  . CYS A 1 21 ? -2.814  -1.799  -7.662  1.00 0.00 ? 21  CYS A HB3  8  
ATOM   8436  N  N    . ASP A 1 22 ? -6.379  0.296   -6.183  1.00 0.00 ? 22  ASP A N    8  
ATOM   8437  C  CA   . ASP A 1 22 ? -7.824  0.462   -6.080  1.00 0.00 ? 22  ASP A CA   8  
ATOM   8438  C  C    . ASP A 1 22 ? -8.536  -0.881  -6.214  1.00 0.00 ? 22  ASP A C    8  
ATOM   8439  O  O    . ASP A 1 22 ? -9.459  -1.026  -7.015  1.00 0.00 ? 22  ASP A O    8  
ATOM   8440  C  CB   . ASP A 1 22 ? -8.326  1.429   -7.153  1.00 0.00 ? 22  ASP A CB   8  
ATOM   8441  C  CG   . ASP A 1 22 ? -9.828  1.627   -7.097  1.00 0.00 ? 22  ASP A CG   8  
ATOM   8442  O  OD1  . ASP A 1 22 ? -10.307 2.259   -6.132  1.00 0.00 ? 22  ASP A OD1  8  
ATOM   8443  O  OD2  . ASP A 1 22 ? -10.524 1.150   -8.018  1.00 0.00 ? 22  ASP A OD2  8  
ATOM   8444  H  H    . ASP A 1 22 ? -5.813  0.541   -5.421  1.00 0.00 ? 22  ASP A H    8  
ATOM   8445  H  HA   . ASP A 1 22 ? -8.041  0.875   -5.106  1.00 0.00 ? 22  ASP A HA   8  
ATOM   8446  H  HB2  . ASP A 1 22 ? -7.849  2.389   -7.015  1.00 0.00 ? 22  ASP A HB2  8  
ATOM   8447  H  HB3  . ASP A 1 22 ? -8.068  1.040   -8.127  1.00 0.00 ? 22  ASP A HB3  8  
ATOM   8448  N  N    . GLN A 1 23 ? -8.100  -1.857  -5.425  1.00 0.00 ? 23  GLN A N    8  
ATOM   8449  C  CA   . GLN A 1 23 ? -8.696  -3.188  -5.457  1.00 0.00 ? 23  GLN A CA   8  
ATOM   8450  C  C    . GLN A 1 23 ? -8.974  -3.694  -4.046  1.00 0.00 ? 23  GLN A C    8  
ATOM   8451  O  O    . GLN A 1 23 ? -8.198  -3.448  -3.123  1.00 0.00 ? 23  GLN A O    8  
ATOM   8452  C  CB   . GLN A 1 23 ? -7.773  -4.165  -6.190  1.00 0.00 ? 23  GLN A CB   8  
ATOM   8453  C  CG   . GLN A 1 23 ? -7.402  -3.715  -7.593  1.00 0.00 ? 23  GLN A CG   8  
ATOM   8454  C  CD   . GLN A 1 23 ? -8.617  -3.467  -8.467  1.00 0.00 ? 23  GLN A CD   8  
ATOM   8455  O  OE1  . GLN A 1 23 ? -9.541  -4.280  -8.510  1.00 0.00 ? 23  GLN A OE1  8  
ATOM   8456  N  NE2  . GLN A 1 23 ? -8.621  -2.341  -9.170  1.00 0.00 ? 23  GLN A NE2  8  
ATOM   8457  H  H    . GLN A 1 23 ? -7.362  -1.679  -4.807  1.00 0.00 ? 23  GLN A H    8  
ATOM   8458  H  HA   . GLN A 1 23 ? -9.630  -3.120  -5.993  1.00 0.00 ? 23  GLN A HA   8  
ATOM   8459  H  HB2  . GLN A 1 23 ? -6.864  -4.279  -5.619  1.00 0.00 ? 23  GLN A HB2  8  
ATOM   8460  H  HB3  . GLN A 1 23 ? -8.267  -5.122  -6.261  1.00 0.00 ? 23  GLN A HB3  8  
ATOM   8461  H  HG2  . GLN A 1 23 ? -6.835  -2.798  -7.526  1.00 0.00 ? 23  GLN A HG2  8  
ATOM   8462  H  HG3  . GLN A 1 23 ? -6.795  -4.480  -8.054  1.00 0.00 ? 23  GLN A HG3  8  
ATOM   8463  H  HE21 . GLN A 1 23 ? -7.850  -1.741  -9.087  1.00 0.00 ? 23  GLN A HE21 8  
ATOM   8464  H  HE22 . GLN A 1 23 ? -9.393  -2.156  -9.743  1.00 0.00 ? 23  GLN A HE22 8  
ATOM   8465  N  N    . PHE A 1 24 ? -10.087 -4.403  -3.886  1.00 0.00 ? 24  PHE A N    8  
ATOM   8466  C  CA   . PHE A 1 24 ? -10.469 -4.943  -2.586  1.00 0.00 ? 24  PHE A CA   8  
ATOM   8467  C  C    . PHE A 1 24 ? -9.410  -5.911  -2.067  1.00 0.00 ? 24  PHE A C    8  
ATOM   8468  O  O    . PHE A 1 24 ? -9.188  -6.974  -2.647  1.00 0.00 ? 24  PHE A O    8  
ATOM   8469  C  CB   . PHE A 1 24 ? -11.821 -5.653  -2.683  1.00 0.00 ? 24  PHE A CB   8  
ATOM   8470  C  CG   . PHE A 1 24 ? -12.992 -4.712  -2.704  1.00 0.00 ? 24  PHE A CG   8  
ATOM   8471  C  CD1  . PHE A 1 24 ? -13.061 -3.692  -3.639  1.00 0.00 ? 24  PHE A CD1  8  
ATOM   8472  C  CD2  . PHE A 1 24 ? -14.024 -4.848  -1.789  1.00 0.00 ? 24  PHE A CD2  8  
ATOM   8473  C  CE1  . PHE A 1 24 ? -14.137 -2.824  -3.659  1.00 0.00 ? 24  PHE A CE1  8  
ATOM   8474  C  CE2  . PHE A 1 24 ? -15.102 -3.984  -1.806  1.00 0.00 ? 24  PHE A CE2  8  
ATOM   8475  C  CZ   . PHE A 1 24 ? -15.159 -2.971  -2.743  1.00 0.00 ? 24  PHE A CZ   8  
ATOM   8476  H  H    . PHE A 1 24 ? -10.666 -4.566  -4.660  1.00 0.00 ? 24  PHE A H    8  
ATOM   8477  H  HA   . PHE A 1 24 ? -10.554 -4.117  -1.897  1.00 0.00 ? 24  PHE A HA   8  
ATOM   8478  H  HB2  . PHE A 1 24 ? -11.849 -6.237  -3.591  1.00 0.00 ? 24  PHE A HB2  8  
ATOM   8479  H  HB3  . PHE A 1 24 ? -11.936 -6.309  -1.834  1.00 0.00 ? 24  PHE A HB3  8  
ATOM   8480  H  HD1  . PHE A 1 24 ? -12.263 -3.576  -4.357  1.00 0.00 ? 24  PHE A HD1  8  
ATOM   8481  H  HD2  . PHE A 1 24 ? -13.980 -5.641  -1.056  1.00 0.00 ? 24  PHE A HD2  8  
ATOM   8482  H  HE1  . PHE A 1 24 ? -14.179 -2.033  -4.393  1.00 0.00 ? 24  PHE A HE1  8  
ATOM   8483  H  HE2  . PHE A 1 24 ? -15.900 -4.102  -1.087  1.00 0.00 ? 24  PHE A HE2  8  
ATOM   8484  H  HZ   . PHE A 1 24 ? -16.001 -2.295  -2.757  1.00 0.00 ? 24  PHE A HZ   8  
ATOM   8485  N  N    . ILE A 1 25 ? -8.759  -5.534  -0.972  1.00 0.00 ? 25  ILE A N    8  
ATOM   8486  C  CA   . ILE A 1 25 ? -7.724  -6.368  -0.374  1.00 0.00 ? 25  ILE A CA   8  
ATOM   8487  C  C    . ILE A 1 25 ? -8.333  -7.553  0.368   1.00 0.00 ? 25  ILE A C    8  
ATOM   8488  O  O    . ILE A 1 25 ? -9.080  -7.377  1.330   1.00 0.00 ? 25  ILE A O    8  
ATOM   8489  C  CB   . ILE A 1 25 ? -6.846  -5.562  0.602   1.00 0.00 ? 25  ILE A CB   8  
ATOM   8490  C  CG1  . ILE A 1 25 ? -6.298  -4.310  -0.086  1.00 0.00 ? 25  ILE A CG1  8  
ATOM   8491  C  CG2  . ILE A 1 25 ? -5.708  -6.425  1.127   1.00 0.00 ? 25  ILE A CG2  8  
ATOM   8492  C  CD1  . ILE A 1 25 ? -5.616  -3.349  0.863   1.00 0.00 ? 25  ILE A CD1  8  
ATOM   8493  H  H    . ILE A 1 25 ? -8.981  -4.675  -0.555  1.00 0.00 ? 25  ILE A H    8  
ATOM   8494  H  HA   . ILE A 1 25 ? -7.095  -6.740  -1.170  1.00 0.00 ? 25  ILE A HA   8  
ATOM   8495  H  HB   . ILE A 1 25 ? -7.457  -5.265  1.441   1.00 0.00 ? 25  ILE A HB   8  
ATOM   8496  H  HG12 . ILE A 1 25 ? -5.579  -4.603  -0.834  1.00 0.00 ? 25  ILE A HG12 8  
ATOM   8497  H  HG13 . ILE A 1 25 ? -7.114  -3.784  -0.562  1.00 0.00 ? 25  ILE A HG13 8  
ATOM   8498  H  HG21 . ILE A 1 25 ? -5.416  -6.078  2.107   1.00 0.00 ? 25  ILE A HG21 8  
ATOM   8499  H  HG22 . ILE A 1 25 ? -6.036  -7.452  1.192   1.00 0.00 ? 25  ILE A HG22 8  
ATOM   8500  H  HG23 . ILE A 1 25 ? -4.866  -6.358  0.456   1.00 0.00 ? 25  ILE A HG23 8  
ATOM   8501  H  HD11 . ILE A 1 25 ? -4.824  -2.830  0.342   1.00 0.00 ? 25  ILE A HD11 8  
ATOM   8502  H  HD12 . ILE A 1 25 ? -6.335  -2.634  1.231   1.00 0.00 ? 25  ILE A HD12 8  
ATOM   8503  H  HD13 . ILE A 1 25 ? -5.198  -3.900  1.694   1.00 0.00 ? 25  ILE A HD13 8  
ATOM   8504  N  N    . GLU A 1 26 ? -8.007  -8.759  -0.085  1.00 0.00 ? 26  GLU A N    8  
ATOM   8505  C  CA   . GLU A 1 26 ? -8.522  -9.973  0.537   1.00 0.00 ? 26  GLU A CA   8  
ATOM   8506  C  C    . GLU A 1 26 ? -7.419  -10.704 1.298   1.00 0.00 ? 26  GLU A C    8  
ATOM   8507  O  O    . GLU A 1 26 ? -6.237  -10.558 0.991   1.00 0.00 ? 26  GLU A O    8  
ATOM   8508  C  CB   . GLU A 1 26 ? -9.126  -10.898 -0.521  1.00 0.00 ? 26  GLU A CB   8  
ATOM   8509  C  CG   . GLU A 1 26 ? -9.546  -12.253 0.023   1.00 0.00 ? 26  GLU A CG   8  
ATOM   8510  C  CD   . GLU A 1 26 ? -10.286 -13.090 -1.002  1.00 0.00 ? 26  GLU A CD   8  
ATOM   8511  O  OE1  . GLU A 1 26 ? -9.758  -13.259 -2.121  1.00 0.00 ? 26  GLU A OE1  8  
ATOM   8512  O  OE2  . GLU A 1 26 ? -11.393 -13.575 -0.686  1.00 0.00 ? 26  GLU A OE2  8  
ATOM   8513  H  H    . GLU A 1 26 ? -7.407  -8.834  -0.856  1.00 0.00 ? 26  GLU A H    8  
ATOM   8514  H  HA   . GLU A 1 26 ? -9.294  -9.686  1.234   1.00 0.00 ? 26  GLU A HA   8  
ATOM   8515  H  HB2  . GLU A 1 26 ? -9.995  -10.419 -0.948  1.00 0.00 ? 26  GLU A HB2  8  
ATOM   8516  H  HB3  . GLU A 1 26 ? -8.396  -11.058 -1.301  1.00 0.00 ? 26  GLU A HB3  8  
ATOM   8517  H  HG2  . GLU A 1 26 ? -8.663  -12.791 0.334   1.00 0.00 ? 26  GLU A HG2  8  
ATOM   8518  H  HG3  . GLU A 1 26 ? -10.192 -12.100 0.875   1.00 0.00 ? 26  GLU A HG3  8  
ATOM   8519  N  N    . GLY A 1 27 ? -7.816  -11.491 2.293   1.00 0.00 ? 27  GLY A N    8  
ATOM   8520  C  CA   . GLY A 1 27 ? -6.851  -12.233 3.083   1.00 0.00 ? 27  GLY A CA   8  
ATOM   8521  C  C    . GLY A 1 27 ? -6.242  -11.395 4.190   1.00 0.00 ? 27  GLY A C    8  
ATOM   8522  O  O    . GLY A 1 27 ? -6.461  -11.662 5.371   1.00 0.00 ? 27  GLY A O    8  
ATOM   8523  H  H    . GLY A 1 27 ? -8.773  -11.569 2.493   1.00 0.00 ? 27  GLY A H    8  
ATOM   8524  H  HA2  . GLY A 1 27 ? -7.343  -13.088 3.522   1.00 0.00 ? 27  GLY A HA2  8  
ATOM   8525  H  HA3  . GLY A 1 27 ? -6.061  -12.578 2.433   1.00 0.00 ? 27  GLY A HA3  8  
ATOM   8526  N  N    . GLU A 1 28 ? -5.473  -10.380 3.807   1.00 0.00 ? 28  GLU A N    8  
ATOM   8527  C  CA   . GLU A 1 28 ? -4.829  -9.502  4.777   1.00 0.00 ? 28  GLU A CA   8  
ATOM   8528  C  C    . GLU A 1 28 ? -4.587  -8.118  4.183   1.00 0.00 ? 28  GLU A C    8  
ATOM   8529  O  O    . GLU A 1 28 ? -4.287  -7.984  2.996   1.00 0.00 ? 28  GLU A O    8  
ATOM   8530  C  CB   . GLU A 1 28 ? -3.503  -10.108 5.244   1.00 0.00 ? 28  GLU A CB   8  
ATOM   8531  C  CG   . GLU A 1 28 ? -2.708  -9.196  6.163   1.00 0.00 ? 28  GLU A CG   8  
ATOM   8532  C  CD   . GLU A 1 28 ? -1.728  -9.958  7.035   1.00 0.00 ? 28  GLU A CD   8  
ATOM   8533  O  OE1  . GLU A 1 28 ? -0.573  -10.150 6.602   1.00 0.00 ? 28  GLU A OE1  8  
ATOM   8534  O  OE2  . GLU A 1 28 ? -2.118  -10.362 8.151   1.00 0.00 ? 28  GLU A OE2  8  
ATOM   8535  H  H    . GLU A 1 28 ? -5.337  -10.218 2.851   1.00 0.00 ? 28  GLU A H    8  
ATOM   8536  H  HA   . GLU A 1 28 ? -5.488  -9.406  5.626   1.00 0.00 ? 28  GLU A HA   8  
ATOM   8537  H  HB2  . GLU A 1 28 ? -3.707  -11.028 5.770   1.00 0.00 ? 28  GLU A HB2  8  
ATOM   8538  H  HB3  . GLU A 1 28 ? -2.897  -10.327 4.377   1.00 0.00 ? 28  GLU A HB3  8  
ATOM   8539  H  HG2  . GLU A 1 28 ? -2.156  -8.491  5.561   1.00 0.00 ? 28  GLU A HG2  8  
ATOM   8540  H  HG3  . GLU A 1 28 ? -3.396  -8.662  6.802   1.00 0.00 ? 28  GLU A HG3  8  
ATOM   8541  N  N    . VAL A 1 29 ? -4.721  -7.091  5.016   1.00 0.00 ? 29  VAL A N    8  
ATOM   8542  C  CA   . VAL A 1 29 ? -4.517  -5.717  4.574   1.00 0.00 ? 29  VAL A CA   8  
ATOM   8543  C  C    . VAL A 1 29 ? -3.543  -4.984  5.490   1.00 0.00 ? 29  VAL A C    8  
ATOM   8544  O  O    . VAL A 1 29 ? -3.588  -5.137  6.711   1.00 0.00 ? 29  VAL A O    8  
ATOM   8545  C  CB   . VAL A 1 29 ? -5.845  -4.939  4.527   1.00 0.00 ? 29  VAL A CB   8  
ATOM   8546  C  CG1  . VAL A 1 29 ? -6.600  -5.091  5.839   1.00 0.00 ? 29  VAL A CG1  8  
ATOM   8547  C  CG2  . VAL A 1 29 ? -5.593  -3.472  4.214   1.00 0.00 ? 29  VAL A CG2  8  
ATOM   8548  H  H    . VAL A 1 29 ? -4.962  -7.262  5.950   1.00 0.00 ? 29  VAL A H    8  
ATOM   8549  H  HA   . VAL A 1 29 ? -4.105  -5.744  3.575   1.00 0.00 ? 29  VAL A HA   8  
ATOM   8550  H  HB   . VAL A 1 29 ? -6.455  -5.354  3.737   1.00 0.00 ? 29  VAL A HB   8  
ATOM   8551  H  HG11 . VAL A 1 29 ? -6.571  -6.124  6.153   1.00 0.00 ? 29  VAL A HG11 8  
ATOM   8552  H  HG12 . VAL A 1 29 ? -6.138  -4.471  6.594   1.00 0.00 ? 29  VAL A HG12 8  
ATOM   8553  H  HG13 . VAL A 1 29 ? -7.626  -4.785  5.701   1.00 0.00 ? 29  VAL A HG13 8  
ATOM   8554  H  HG21 . VAL A 1 29 ? -4.538  -3.317  4.044   1.00 0.00 ? 29  VAL A HG21 8  
ATOM   8555  H  HG22 . VAL A 1 29 ? -6.145  -3.192  3.328   1.00 0.00 ? 29  VAL A HG22 8  
ATOM   8556  H  HG23 . VAL A 1 29 ? -5.917  -2.865  5.046   1.00 0.00 ? 29  VAL A HG23 8  
ATOM   8557  N  N    . VAL A 1 30 ? -2.664  -4.185  4.893   1.00 0.00 ? 30  VAL A N    8  
ATOM   8558  C  CA   . VAL A 1 30 ? -1.680  -3.426  5.655   1.00 0.00 ? 30  VAL A CA   8  
ATOM   8559  C  C    . VAL A 1 30 ? -2.176  -2.013  5.938   1.00 0.00 ? 30  VAL A C    8  
ATOM   8560  O  O    . VAL A 1 30 ? -2.187  -1.158  5.053   1.00 0.00 ? 30  VAL A O    8  
ATOM   8561  C  CB   . VAL A 1 30 ? -0.334  -3.347  4.911   1.00 0.00 ? 30  VAL A CB   8  
ATOM   8562  C  CG1  . VAL A 1 30 ? 0.665   -2.514  5.700   1.00 0.00 ? 30  VAL A CG1  8  
ATOM   8563  C  CG2  . VAL A 1 30 ? 0.213   -4.742  4.648   1.00 0.00 ? 30  VAL A CG2  8  
ATOM   8564  H  H    . VAL A 1 30 ? -2.678  -4.105  3.916   1.00 0.00 ? 30  VAL A H    8  
ATOM   8565  H  HA   . VAL A 1 30 ? -1.519  -3.936  6.594   1.00 0.00 ? 30  VAL A HA   8  
ATOM   8566  H  HB   . VAL A 1 30 ? -0.499  -2.863  3.959   1.00 0.00 ? 30  VAL A HB   8  
ATOM   8567  H  HG11 . VAL A 1 30 ? 0.491   -2.651  6.758   1.00 0.00 ? 30  VAL A HG11 8  
ATOM   8568  H  HG12 . VAL A 1 30 ? 1.669   -2.828  5.456   1.00 0.00 ? 30  VAL A HG12 8  
ATOM   8569  H  HG13 . VAL A 1 30 ? 0.542   -1.471  5.449   1.00 0.00 ? 30  VAL A HG13 8  
ATOM   8570  H  HG21 . VAL A 1 30 ? 1.281   -4.687  4.497   1.00 0.00 ? 30  VAL A HG21 8  
ATOM   8571  H  HG22 . VAL A 1 30 ? 0.002   -5.377  5.496   1.00 0.00 ? 30  VAL A HG22 8  
ATOM   8572  H  HG23 . VAL A 1 30 ? -0.255  -5.152  3.766   1.00 0.00 ? 30  VAL A HG23 8  
ATOM   8573  N  N    . SER A 1 31 ? -2.585  -1.773  7.180   1.00 0.00 ? 31  SER A N    8  
ATOM   8574  C  CA   . SER A 1 31 ? -3.085  -0.463  7.581   1.00 0.00 ? 31  SER A CA   8  
ATOM   8575  C  C    . SER A 1 31 ? -1.933  0.485   7.898   1.00 0.00 ? 31  SER A C    8  
ATOM   8576  O  O    . SER A 1 31 ? -1.135  0.229   8.799   1.00 0.00 ? 31  SER A O    8  
ATOM   8577  C  CB   . SER A 1 31 ? -4.003  -0.595  8.798   1.00 0.00 ? 31  SER A CB   8  
ATOM   8578  O  OG   . SER A 1 31 ? -5.352  -0.769  8.403   1.00 0.00 ? 31  SER A OG   8  
ATOM   8579  H  H    . SER A 1 31 ? -2.552  -2.496  7.842   1.00 0.00 ? 31  SER A H    8  
ATOM   8580  H  HA   . SER A 1 31 ? -3.652  -0.059  6.756   1.00 0.00 ? 31  SER A HA   8  
ATOM   8581  H  HB2  . SER A 1 31 ? -3.699  -1.449  9.384   1.00 0.00 ? 31  SER A HB2  8  
ATOM   8582  H  HB3  . SER A 1 31 ? -3.928  0.299   9.400   1.00 0.00 ? 31  SER A HB3  8  
ATOM   8583  H  HG   . SER A 1 31 ? -5.433  -1.572  7.883   1.00 0.00 ? 31  SER A HG   8  
ATOM   8584  N  N    . ALA A 1 32 ? -1.854  1.581   7.151   1.00 0.00 ? 32  ALA A N    8  
ATOM   8585  C  CA   . ALA A 1 32 ? -0.801  2.569   7.353   1.00 0.00 ? 32  ALA A CA   8  
ATOM   8586  C  C    . ALA A 1 32 ? -1.366  3.985   7.331   1.00 0.00 ? 32  ALA A C    8  
ATOM   8587  O  O    . ALA A 1 32 ? -2.257  4.297   6.539   1.00 0.00 ? 32  ALA A O    8  
ATOM   8588  C  CB   . ALA A 1 32 ? 0.280   2.413   6.294   1.00 0.00 ? 32  ALA A CB   8  
ATOM   8589  H  H    . ALA A 1 32 ? -2.520  1.729   6.448   1.00 0.00 ? 32  ALA A H    8  
ATOM   8590  H  HA   . ALA A 1 32 ? -0.353  2.386   8.319   1.00 0.00 ? 32  ALA A HA   8  
ATOM   8591  H  HB1  . ALA A 1 32 ? -0.182  2.299   5.324   1.00 0.00 ? 32  ALA A HB1  8  
ATOM   8592  H  HB2  . ALA A 1 32 ? 0.911   3.288   6.292   1.00 0.00 ? 32  ALA A HB2  8  
ATOM   8593  H  HB3  . ALA A 1 32 ? 0.875   1.539   6.513   1.00 0.00 ? 32  ALA A HB3  8  
ATOM   8594  N  N    . LEU A 1 33 ? -0.844  4.839   8.204   1.00 0.00 ? 33  LEU A N    8  
ATOM   8595  C  CA   . LEU A 1 33 ? -1.297  6.223   8.285   1.00 0.00 ? 33  LEU A CA   8  
ATOM   8596  C  C    . LEU A 1 33 ? -2.798  6.321   8.033   1.00 0.00 ? 33  LEU A C    8  
ATOM   8597  O  O    . LEU A 1 33 ? -3.254  7.155   7.252   1.00 0.00 ? 33  LEU A O    8  
ATOM   8598  C  CB   . LEU A 1 33 ? -0.542  7.088   7.274   1.00 0.00 ? 33  LEU A CB   8  
ATOM   8599  C  CG   . LEU A 1 33 ? 0.983   7.074   7.386   1.00 0.00 ? 33  LEU A CG   8  
ATOM   8600  C  CD1  . LEU A 1 33 ? 1.613   7.780   6.195   1.00 0.00 ? 33  LEU A CD1  8  
ATOM   8601  C  CD2  . LEU A 1 33 ? 1.428   7.723   8.689   1.00 0.00 ? 33  LEU A CD2  8  
ATOM   8602  H  H    . LEU A 1 33 ? -0.137  4.533   8.809   1.00 0.00 ? 33  LEU A H    8  
ATOM   8603  H  HA   . LEU A 1 33 ? -1.087  6.583   9.281   1.00 0.00 ? 33  LEU A HA   8  
ATOM   8604  H  HB2  . LEU A 1 33 ? -0.803  6.744   6.285   1.00 0.00 ? 33  LEU A HB2  8  
ATOM   8605  H  HB3  . LEU A 1 33 ? -0.875  8.108   7.398   1.00 0.00 ? 33  LEU A HB3  8  
ATOM   8606  H  HG   . LEU A 1 33 ? 1.329   6.050   7.387   1.00 0.00 ? 33  LEU A HG   8  
ATOM   8607  H  HD11 . LEU A 1 33 ? 2.152   8.650   6.536   1.00 0.00 ? 33  LEU A HD11 8  
ATOM   8608  H  HD12 . LEU A 1 33 ? 0.838   8.084   5.506   1.00 0.00 ? 33  LEU A HD12 8  
ATOM   8609  H  HD13 . LEU A 1 33 ? 2.293   7.106   5.696   1.00 0.00 ? 33  LEU A HD13 8  
ATOM   8610  H  HD21 . LEU A 1 33 ? 1.528   8.789   8.543   1.00 0.00 ? 33  LEU A HD21 8  
ATOM   8611  H  HD22 . LEU A 1 33 ? 2.380   7.310   8.990   1.00 0.00 ? 33  LEU A HD22 8  
ATOM   8612  H  HD23 . LEU A 1 33 ? 0.692   7.532   9.456   1.00 0.00 ? 33  LEU A HD23 8  
ATOM   8613  N  N    . GLY A 1 34 ? -3.562  5.462   8.702   1.00 0.00 ? 34  GLY A N    8  
ATOM   8614  C  CA   . GLY A 1 34 ? -5.004  5.470   8.538   1.00 0.00 ? 34  GLY A CA   8  
ATOM   8615  C  C    . GLY A 1 34 ? -5.428  5.181   7.112   1.00 0.00 ? 34  GLY A C    8  
ATOM   8616  O  O    . GLY A 1 34 ? -6.341  5.818   6.586   1.00 0.00 ? 34  GLY A O    8  
ATOM   8617  H  H    . GLY A 1 34 ? -3.143  4.819   9.311   1.00 0.00 ? 34  GLY A H    8  
ATOM   8618  H  HA2  . GLY A 1 34 ? -5.433  4.722   9.189   1.00 0.00 ? 34  GLY A HA2  8  
ATOM   8619  H  HA3  . GLY A 1 34 ? -5.382  6.440   8.824   1.00 0.00 ? 34  GLY A HA3  8  
ATOM   8620  N  N    . LYS A 1 35 ? -4.762  4.219   6.482   1.00 0.00 ? 35  LYS A N    8  
ATOM   8621  C  CA   . LYS A 1 35 ? -5.073  3.847   5.107   1.00 0.00 ? 35  LYS A CA   8  
ATOM   8622  C  C    . LYS A 1 35 ? -5.037  2.332   4.932   1.00 0.00 ? 35  LYS A C    8  
ATOM   8623  O  O    . LYS A 1 35 ? -4.826  1.590   5.892   1.00 0.00 ? 35  LYS A O    8  
ATOM   8624  C  CB   . LYS A 1 35 ? -4.084  4.506   4.142   1.00 0.00 ? 35  LYS A CB   8  
ATOM   8625  C  CG   . LYS A 1 35 ? -4.056  6.022   4.242   1.00 0.00 ? 35  LYS A CG   8  
ATOM   8626  C  CD   . LYS A 1 35 ? -5.045  6.662   3.282   1.00 0.00 ? 35  LYS A CD   8  
ATOM   8627  C  CE   . LYS A 1 35 ? -6.391  6.902   3.948   1.00 0.00 ? 35  LYS A CE   8  
ATOM   8628  N  NZ   . LYS A 1 35 ? -7.362  7.544   3.019   1.00 0.00 ? 35  LYS A NZ   8  
ATOM   8629  H  H    . LYS A 1 35 ? -4.043  3.747   6.954   1.00 0.00 ? 35  LYS A H    8  
ATOM   8630  H  HA   . LYS A 1 35 ? -6.069  4.200   4.885   1.00 0.00 ? 35  LYS A HA   8  
ATOM   8631  H  HB2  . LYS A 1 35 ? -3.092  4.134   4.352   1.00 0.00 ? 35  LYS A HB2  8  
ATOM   8632  H  HB3  . LYS A 1 35 ? -4.354  4.238   3.131   1.00 0.00 ? 35  LYS A HB3  8  
ATOM   8633  H  HG2  . LYS A 1 35 ? -4.310  6.312   5.250   1.00 0.00 ? 35  LYS A HG2  8  
ATOM   8634  H  HG3  . LYS A 1 35 ? -3.060  6.370   4.004   1.00 0.00 ? 35  LYS A HG3  8  
ATOM   8635  H  HD2  . LYS A 1 35 ? -4.647  7.609   2.948   1.00 0.00 ? 35  LYS A HD2  8  
ATOM   8636  H  HD3  . LYS A 1 35 ? -5.184  6.008   2.433   1.00 0.00 ? 35  LYS A HD3  8  
ATOM   8637  H  HE2  . LYS A 1 35 ? -6.791  5.954   4.274   1.00 0.00 ? 35  LYS A HE2  8  
ATOM   8638  H  HE3  . LYS A 1 35 ? -6.245  7.545   4.803   1.00 0.00 ? 35  LYS A HE3  8  
ATOM   8639  H  HZ1  . LYS A 1 35 ? -7.951  8.229   3.536   1.00 0.00 ? 35  LYS A HZ1  8  
ATOM   8640  H  HZ2  . LYS A 1 35 ? -7.980  6.824   2.595   1.00 0.00 ? 35  LYS A HZ2  8  
ATOM   8641  H  HZ3  . LYS A 1 35 ? -6.855  8.042   2.260   1.00 0.00 ? 35  LYS A HZ3  8  
ATOM   8642  N  N    . THR A 1 36 ? -5.242  1.878   3.699   1.00 0.00 ? 36  THR A N    8  
ATOM   8643  C  CA   . THR A 1 36 ? -5.233  0.452   3.399   1.00 0.00 ? 36  THR A CA   8  
ATOM   8644  C  C    . THR A 1 36 ? -4.542  0.175   2.068   1.00 0.00 ? 36  THR A C    8  
ATOM   8645  O  O    . THR A 1 36 ? -4.945  0.697   1.028   1.00 0.00 ? 36  THR A O    8  
ATOM   8646  C  CB   . THR A 1 36 ? -6.661  -0.121  3.351   1.00 0.00 ? 36  THR A CB   8  
ATOM   8647  O  OG1  . THR A 1 36 ? -7.448  0.601   2.397   1.00 0.00 ? 36  THR A OG1  8  
ATOM   8648  C  CG2  . THR A 1 36 ? -7.320  -0.046  4.720   1.00 0.00 ? 36  THR A CG2  8  
ATOM   8649  H  H    . THR A 1 36 ? -5.404  2.519   2.976   1.00 0.00 ? 36  THR A H    8  
ATOM   8650  H  HA   . THR A 1 36 ? -4.691  -0.051  4.186   1.00 0.00 ? 36  THR A HA   8  
ATOM   8651  H  HB   . THR A 1 36 ? -6.607  -1.158  3.051   1.00 0.00 ? 36  THR A HB   8  
ATOM   8652  H  HG1  . THR A 1 36 ? -8.065  1.174   2.859   1.00 0.00 ? 36  THR A HG1  8  
ATOM   8653  H  HG21 . THR A 1 36 ? -8.027  0.770   4.735   1.00 0.00 ? 36  THR A HG21 8  
ATOM   8654  H  HG22 . THR A 1 36 ? -6.565  0.118   5.475   1.00 0.00 ? 36  THR A HG22 8  
ATOM   8655  H  HG23 . THR A 1 36 ? -7.836  -0.972  4.922   1.00 0.00 ? 36  THR A HG23 8  
ATOM   8656  N  N    . TYR A 1 37 ? -3.500  -0.648  2.108   1.00 0.00 ? 37  TYR A N    8  
ATOM   8657  C  CA   . TYR A 1 37 ? -2.752  -0.993  0.905   1.00 0.00 ? 37  TYR A CA   8  
ATOM   8658  C  C    . TYR A 1 37 ? -2.411  -2.480  0.883   1.00 0.00 ? 37  TYR A C    8  
ATOM   8659  O  O    . TYR A 1 37 ? -2.590  -3.185  1.877   1.00 0.00 ? 37  TYR A O    8  
ATOM   8660  C  CB   . TYR A 1 37 ? -1.471  -0.163  0.820   1.00 0.00 ? 37  TYR A CB   8  
ATOM   8661  C  CG   . TYR A 1 37 ? -1.715  1.330   0.824   1.00 0.00 ? 37  TYR A CG   8  
ATOM   8662  C  CD1  . TYR A 1 37 ? -2.127  1.989   -0.328  1.00 0.00 ? 37  TYR A CD1  8  
ATOM   8663  C  CD2  . TYR A 1 37 ? -1.531  2.081   1.978   1.00 0.00 ? 37  TYR A CD2  8  
ATOM   8664  C  CE1  . TYR A 1 37 ? -2.351  3.352   -0.329  1.00 0.00 ? 37  TYR A CE1  8  
ATOM   8665  C  CE2  . TYR A 1 37 ? -1.754  3.444   1.986   1.00 0.00 ? 37  TYR A CE2  8  
ATOM   8666  C  CZ   . TYR A 1 37 ? -2.163  4.075   0.830   1.00 0.00 ? 37  TYR A CZ   8  
ATOM   8667  O  OH   . TYR A 1 37 ? -2.384  5.433   0.833   1.00 0.00 ? 37  TYR A OH   8  
ATOM   8668  H  H    . TYR A 1 37 ? -3.227  -1.032  2.967   1.00 0.00 ? 37  TYR A H    8  
ATOM   8669  H  HA   . TYR A 1 37 ? -3.374  -0.765  0.051   1.00 0.00 ? 37  TYR A HA   8  
ATOM   8670  H  HB2  . TYR A 1 37 ? -0.841  -0.397  1.665   1.00 0.00 ? 37  TYR A HB2  8  
ATOM   8671  H  HB3  . TYR A 1 37 ? -0.948  -0.411  -0.092  1.00 0.00 ? 37  TYR A HB3  8  
ATOM   8672  H  HD1  . TYR A 1 37 ? -2.274  1.419   -1.234  1.00 0.00 ? 37  TYR A HD1  8  
ATOM   8673  H  HD2  . TYR A 1 37 ? -1.210  1.583   2.882   1.00 0.00 ? 37  TYR A HD2  8  
ATOM   8674  H  HE1  . TYR A 1 37 ? -2.672  3.846   -1.234  1.00 0.00 ? 37  TYR A HE1  8  
ATOM   8675  H  HE2  . TYR A 1 37 ? -1.606  4.011   2.894   1.00 0.00 ? 37  TYR A HE2  8  
ATOM   8676  H  HH   . TYR A 1 37 ? -1.552  5.893   0.701   1.00 0.00 ? 37  TYR A HH   8  
ATOM   8677  N  N    . HIS A 1 38 ? -1.916  -2.950  -0.258  1.00 0.00 ? 38  HIS A N    8  
ATOM   8678  C  CA   . HIS A 1 38 ? -1.548  -4.353  -0.410  1.00 0.00 ? 38  HIS A CA   8  
ATOM   8679  C  C    . HIS A 1 38 ? -0.147  -4.609  0.137   1.00 0.00 ? 38  HIS A C    8  
ATOM   8680  O  O    . HIS A 1 38 ? 0.655   -3.691  0.313   1.00 0.00 ? 38  HIS A O    8  
ATOM   8681  C  CB   . HIS A 1 38 ? -1.616  -4.763  -1.882  1.00 0.00 ? 38  HIS A CB   8  
ATOM   8682  C  CG   . HIS A 1 38 ? -2.967  -5.252  -2.305  1.00 0.00 ? 38  HIS A CG   8  
ATOM   8683  N  ND1  . HIS A 1 38 ? -3.676  -4.696  -3.349  1.00 0.00 ? 38  HIS A ND1  8  
ATOM   8684  C  CD2  . HIS A 1 38 ? -3.738  -6.253  -1.820  1.00 0.00 ? 38  HIS A CD2  8  
ATOM   8685  C  CE1  . HIS A 1 38 ? -4.825  -5.332  -3.486  1.00 0.00 ? 38  HIS A CE1  8  
ATOM   8686  N  NE2  . HIS A 1 38 ? -4.888  -6.282  -2.571  1.00 0.00 ? 38  HIS A NE2  8  
ATOM   8687  H  H    . HIS A 1 38 ? -1.797  -2.339  -1.014  1.00 0.00 ? 38  HIS A H    8  
ATOM   8688  H  HA   . HIS A 1 38 ? -2.254  -4.945  0.152   1.00 0.00 ? 38  HIS A HA   8  
ATOM   8689  H  HB2  . HIS A 1 38 ? -1.364  -3.912  -2.498  1.00 0.00 ? 38  HIS A HB2  8  
ATOM   8690  H  HB3  . HIS A 1 38 ? -0.904  -5.556  -2.061  1.00 0.00 ? 38  HIS A HB3  8  
ATOM   8691  H  HD2  . HIS A 1 38 ? -3.496  -6.908  -0.994  1.00 0.00 ? 38  HIS A HD2  8  
ATOM   8692  H  HE1  . HIS A 1 38 ? -5.585  -5.114  -4.222  1.00 0.00 ? 38  HIS A HE1  8  
ATOM   8693  H  HE2  . HIS A 1 38 ? -5.669  -6.846  -2.396  1.00 0.00 ? 38  HIS A HE2  8  
ATOM   8694  N  N    . PRO A 1 39 ? 0.157   -5.886  0.413   1.00 0.00 ? 39  PRO A N    8  
ATOM   8695  C  CA   . PRO A 1 39 ? 1.462   -6.292  0.945   1.00 0.00 ? 39  PRO A CA   8  
ATOM   8696  C  C    . PRO A 1 39 ? 2.577   -6.147  -0.084  1.00 0.00 ? 39  PRO A C    8  
ATOM   8697  O  O    . PRO A 1 39 ? 3.745   -6.398  0.213   1.00 0.00 ? 39  PRO A O    8  
ATOM   8698  C  CB   . PRO A 1 39 ? 1.255   -7.765  1.305   1.00 0.00 ? 39  PRO A CB   8  
ATOM   8699  C  CG   . PRO A 1 39 ? 0.150   -8.222  0.415   1.00 0.00 ? 39  PRO A CG   8  
ATOM   8700  C  CD   . PRO A 1 39 ? -0.749  -7.032  0.228   1.00 0.00 ? 39  PRO A CD   8  
ATOM   8701  H  HA   . PRO A 1 39 ? 1.719   -5.735  1.834   1.00 0.00 ? 39  PRO A HA   8  
ATOM   8702  H  HB2  . PRO A 1 39 ? 2.166   -8.316  1.119   1.00 0.00 ? 39  PRO A HB2  8  
ATOM   8703  H  HB3  . PRO A 1 39 ? 0.982   -7.850  2.346   1.00 0.00 ? 39  PRO A HB3  8  
ATOM   8704  H  HG2  . PRO A 1 39 ? 0.552   -8.541  -0.535  1.00 0.00 ? 39  PRO A HG2  8  
ATOM   8705  H  HG3  . PRO A 1 39 ? -0.390  -9.029  0.886   1.00 0.00 ? 39  PRO A HG3  8  
ATOM   8706  H  HD2  . PRO A 1 39 ? -1.173  -7.031  -0.765  1.00 0.00 ? 39  PRO A HD2  8  
ATOM   8707  H  HD3  . PRO A 1 39 ? -1.531  -7.029  0.974   1.00 0.00 ? 39  PRO A HD3  8  
ATOM   8708  N  N    . ASP A 1 40 ? 2.210   -5.741  -1.295  1.00 0.00 ? 40  ASP A N    8  
ATOM   8709  C  CA   . ASP A 1 40 ? 3.181   -5.561  -2.368  1.00 0.00 ? 40  ASP A CA   8  
ATOM   8710  C  C    . ASP A 1 40 ? 3.044   -4.178  -2.998  1.00 0.00 ? 40  ASP A C    8  
ATOM   8711  O  O    . ASP A 1 40 ? 3.859   -3.780  -3.831  1.00 0.00 ? 40  ASP A O    8  
ATOM   8712  C  CB   . ASP A 1 40 ? 3.000   -6.641  -3.435  1.00 0.00 ? 40  ASP A CB   8  
ATOM   8713  C  CG   . ASP A 1 40 ? 4.272   -6.900  -4.218  1.00 0.00 ? 40  ASP A CG   8  
ATOM   8714  O  OD1  . ASP A 1 40 ? 5.368   -6.743  -3.640  1.00 0.00 ? 40  ASP A OD1  8  
ATOM   8715  O  OD2  . ASP A 1 40 ? 4.172   -7.261  -5.409  1.00 0.00 ? 40  ASP A OD2  8  
ATOM   8716  H  H    . ASP A 1 40 ? 1.264   -5.556  -1.470  1.00 0.00 ? 40  ASP A H    8  
ATOM   8717  H  HA   . ASP A 1 40 ? 4.168   -5.651  -1.941  1.00 0.00 ? 40  ASP A HA   8  
ATOM   8718  H  HB2  . ASP A 1 40 ? 2.700   -7.563  -2.957  1.00 0.00 ? 40  ASP A HB2  8  
ATOM   8719  H  HB3  . ASP A 1 40 ? 2.230   -6.331  -4.125  1.00 0.00 ? 40  ASP A HB3  8  
ATOM   8720  N  N    . CYS A 1 41 ? 2.008   -3.450  -2.596  1.00 0.00 ? 41  CYS A N    8  
ATOM   8721  C  CA   . CYS A 1 41 ? 1.762   -2.113  -3.122  1.00 0.00 ? 41  CYS A CA   8  
ATOM   8722  C  C    . CYS A 1 41 ? 2.370   -1.050  -2.211  1.00 0.00 ? 41  CYS A C    8  
ATOM   8723  O  O    . CYS A 1 41 ? 2.797   0.009   -2.672  1.00 0.00 ? 41  CYS A O    8  
ATOM   8724  C  CB   . CYS A 1 41 ? 0.259   -1.870  -3.275  1.00 0.00 ? 41  CYS A CB   8  
ATOM   8725  S  SG   . CYS A 1 41 ? -0.503  -2.778  -4.658  1.00 0.00 ? 41  CYS A SG   8  
ATOM   8726  H  H    . CYS A 1 41 ? 1.392   -3.822  -1.929  1.00 0.00 ? 41  CYS A H    8  
ATOM   8727  H  HA   . CYS A 1 41 ? 2.229   -2.046  -4.092  1.00 0.00 ? 41  CYS A HA   8  
ATOM   8728  H  HB2  . CYS A 1 41 ? -0.241  -2.176  -2.367  1.00 0.00 ? 41  CYS A HB2  8  
ATOM   8729  H  HB3  . CYS A 1 41 ? 0.087   -0.816  -3.437  1.00 0.00 ? 41  CYS A HB3  8  
ATOM   8730  N  N    . PHE A 1 42 ? 2.406   -1.340  -0.914  1.00 0.00 ? 42  PHE A N    8  
ATOM   8731  C  CA   . PHE A 1 42 ? 2.960   -0.410  0.062   1.00 0.00 ? 42  PHE A CA   8  
ATOM   8732  C  C    . PHE A 1 42 ? 4.486   -0.442  0.039   1.00 0.00 ? 42  PHE A C    8  
ATOM   8733  O  O    . PHE A 1 42 ? 5.133   -0.502  1.084   1.00 0.00 ? 42  PHE A O    8  
ATOM   8734  C  CB   . PHE A 1 42 ? 2.454   -0.749  1.466   1.00 0.00 ? 42  PHE A CB   8  
ATOM   8735  C  CG   . PHE A 1 42 ? 2.821   0.277   2.500   1.00 0.00 ? 42  PHE A CG   8  
ATOM   8736  C  CD1  . PHE A 1 42 ? 2.416   1.595   2.362   1.00 0.00 ? 42  PHE A CD1  8  
ATOM   8737  C  CD2  . PHE A 1 42 ? 3.570   -0.077  3.610   1.00 0.00 ? 42  PHE A CD2  8  
ATOM   8738  C  CE1  . PHE A 1 42 ? 2.753   2.541   3.311   1.00 0.00 ? 42  PHE A CE1  8  
ATOM   8739  C  CE2  . PHE A 1 42 ? 3.910   0.865   4.563   1.00 0.00 ? 42  PHE A CE2  8  
ATOM   8740  C  CZ   . PHE A 1 42 ? 3.500   2.175   4.414   1.00 0.00 ? 42  PHE A CZ   8  
ATOM   8741  H  H    . PHE A 1 42 ? 2.050   -2.201  -0.607  1.00 0.00 ? 42  PHE A H    8  
ATOM   8742  H  HA   . PHE A 1 42 ? 2.629   0.582   -0.201  1.00 0.00 ? 42  PHE A HA   8  
ATOM   8743  H  HB2  . PHE A 1 42 ? 1.377   -0.826  1.444   1.00 0.00 ? 42  PHE A HB2  8  
ATOM   8744  H  HB3  . PHE A 1 42 ? 2.872   -1.696  1.773   1.00 0.00 ? 42  PHE A HB3  8  
ATOM   8745  H  HD1  . PHE A 1 42 ? 1.831   1.882   1.500   1.00 0.00 ? 42  PHE A HD1  8  
ATOM   8746  H  HD2  . PHE A 1 42 ? 3.892   -1.102  3.728   1.00 0.00 ? 42  PHE A HD2  8  
ATOM   8747  H  HE1  . PHE A 1 42 ? 2.431   3.564   3.192   1.00 0.00 ? 42  PHE A HE1  8  
ATOM   8748  H  HE2  . PHE A 1 42 ? 4.495   0.575   5.424   1.00 0.00 ? 42  PHE A HE2  8  
ATOM   8749  H  HZ   . PHE A 1 42 ? 3.765   2.912   5.157   1.00 0.00 ? 42  PHE A HZ   8  
ATOM   8750  N  N    . VAL A 1 43 ? 5.054   -0.401  -1.162  1.00 0.00 ? 43  VAL A N    8  
ATOM   8751  C  CA   . VAL A 1 43 ? 6.503   -0.425  -1.324  1.00 0.00 ? 43  VAL A CA   8  
ATOM   8752  C  C    . VAL A 1 43 ? 6.992   0.807   -2.077  1.00 0.00 ? 43  VAL A C    8  
ATOM   8753  O  O    . VAL A 1 43 ? 6.194   1.600   -2.578  1.00 0.00 ? 43  VAL A O    8  
ATOM   8754  C  CB   . VAL A 1 43 ? 6.963   -1.688  -2.075  1.00 0.00 ? 43  VAL A CB   8  
ATOM   8755  C  CG1  . VAL A 1 43 ? 6.555   -2.941  -1.314  1.00 0.00 ? 43  VAL A CG1  8  
ATOM   8756  C  CG2  . VAL A 1 43 ? 6.398   -1.704  -3.487  1.00 0.00 ? 43  VAL A CG2  8  
ATOM   8757  H  H    . VAL A 1 43 ? 4.485   -0.354  -1.959  1.00 0.00 ? 43  VAL A H    8  
ATOM   8758  H  HA   . VAL A 1 43 ? 6.948   -0.434  -0.340  1.00 0.00 ? 43  VAL A HA   8  
ATOM   8759  H  HB   . VAL A 1 43 ? 8.041   -1.670  -2.141  1.00 0.00 ? 43  VAL A HB   8  
ATOM   8760  H  HG11 . VAL A 1 43 ? 7.074   -3.795  -1.723  1.00 0.00 ? 43  VAL A HG11 8  
ATOM   8761  H  HG12 . VAL A 1 43 ? 6.810   -2.828  -0.271  1.00 0.00 ? 43  VAL A HG12 8  
ATOM   8762  H  HG13 . VAL A 1 43 ? 5.489   -3.088  -1.411  1.00 0.00 ? 43  VAL A HG13 8  
ATOM   8763  H  HG21 . VAL A 1 43 ? 6.677   -2.626  -3.975  1.00 0.00 ? 43  VAL A HG21 8  
ATOM   8764  H  HG22 . VAL A 1 43 ? 5.321   -1.631  -3.445  1.00 0.00 ? 43  VAL A HG22 8  
ATOM   8765  H  HG23 . VAL A 1 43 ? 6.793   -0.867  -4.043  1.00 0.00 ? 43  VAL A HG23 8  
ATOM   8766  N  N    . CYS A 1 44 ? 8.309   0.963   -2.153  1.00 0.00 ? 44  CYS A N    8  
ATOM   8767  C  CA   . CYS A 1 44 ? 8.907   2.099   -2.845  1.00 0.00 ? 44  CYS A CA   8  
ATOM   8768  C  C    . CYS A 1 44 ? 8.179   2.381   -4.156  1.00 0.00 ? 44  CYS A C    8  
ATOM   8769  O  O    . CYS A 1 44 ? 7.423   1.546   -4.651  1.00 0.00 ? 44  CYS A O    8  
ATOM   8770  C  CB   . CYS A 1 44 ? 10.389  1.834   -3.118  1.00 0.00 ? 44  CYS A CB   8  
ATOM   8771  S  SG   . CYS A 1 44 ? 11.293  3.274   -3.771  1.00 0.00 ? 44  CYS A SG   8  
ATOM   8772  H  H    . CYS A 1 44 ? 8.895   0.297   -1.733  1.00 0.00 ? 44  CYS A H    8  
ATOM   8773  H  HA   . CYS A 1 44 ? 8.817   2.963   -2.204  1.00 0.00 ? 44  CYS A HA   8  
ATOM   8774  H  HB2  . CYS A 1 44 ? 10.869  1.535   -2.198  1.00 0.00 ? 44  CYS A HB2  8  
ATOM   8775  H  HB3  . CYS A 1 44 ? 10.477  1.035   -3.840  1.00 0.00 ? 44  CYS A HB3  8  
ATOM   8776  N  N    . ALA A 1 45 ? 8.413   3.565   -4.713  1.00 0.00 ? 45  ALA A N    8  
ATOM   8777  C  CA   . ALA A 1 45 ? 7.782   3.957   -5.967  1.00 0.00 ? 45  ALA A CA   8  
ATOM   8778  C  C    . ALA A 1 45 ? 8.763   3.857   -7.130  1.00 0.00 ? 45  ALA A C    8  
ATOM   8779  O  O    . ALA A 1 45 ? 8.364   3.647   -8.276  1.00 0.00 ? 45  ALA A O    8  
ATOM   8780  C  CB   . ALA A 1 45 ? 7.230   5.371   -5.860  1.00 0.00 ? 45  ALA A CB   8  
ATOM   8781  H  H    . ALA A 1 45 ? 9.026   4.188   -4.270  1.00 0.00 ? 45  ALA A H    8  
ATOM   8782  H  HA   . ALA A 1 45 ? 6.955   3.287   -6.148  1.00 0.00 ? 45  ALA A HA   8  
ATOM   8783  H  HB1  . ALA A 1 45 ? 6.167   5.328   -5.673  1.00 0.00 ? 45  ALA A HB1  8  
ATOM   8784  H  HB2  . ALA A 1 45 ? 7.718   5.888   -5.048  1.00 0.00 ? 45  ALA A HB2  8  
ATOM   8785  H  HB3  . ALA A 1 45 ? 7.412   5.899   -6.784  1.00 0.00 ? 45  ALA A HB3  8  
ATOM   8786  N  N    . VAL A 1 46 ? 10.049  4.009   -6.828  1.00 0.00 ? 46  VAL A N    8  
ATOM   8787  C  CA   . VAL A 1 46 ? 11.088  3.935   -7.849  1.00 0.00 ? 46  VAL A CA   8  
ATOM   8788  C  C    . VAL A 1 46 ? 11.487  2.489   -8.123  1.00 0.00 ? 46  VAL A C    8  
ATOM   8789  O  O    . VAL A 1 46 ? 11.211  1.949   -9.194  1.00 0.00 ? 46  VAL A O    8  
ATOM   8790  C  CB   . VAL A 1 46 ? 12.339  4.732   -7.436  1.00 0.00 ? 46  VAL A CB   8  
ATOM   8791  C  CG1  . VAL A 1 46 ? 13.355  4.757   -8.567  1.00 0.00 ? 46  VAL A CG1  8  
ATOM   8792  C  CG2  . VAL A 1 46 ? 11.956  6.145   -7.021  1.00 0.00 ? 46  VAL A CG2  8  
ATOM   8793  H  H    . VAL A 1 46 ? 10.305  4.174   -5.897  1.00 0.00 ? 46  VAL A H    8  
ATOM   8794  H  HA   . VAL A 1 46 ? 10.694  4.367   -8.758  1.00 0.00 ? 46  VAL A HA   8  
ATOM   8795  H  HB   . VAL A 1 46 ? 12.790  4.240   -6.587  1.00 0.00 ? 46  VAL A HB   8  
ATOM   8796  H  HG11 . VAL A 1 46 ? 14.279  5.187   -8.211  1.00 0.00 ? 46  VAL A HG11 8  
ATOM   8797  H  HG12 . VAL A 1 46 ? 13.534  3.749   -8.913  1.00 0.00 ? 46  VAL A HG12 8  
ATOM   8798  H  HG13 . VAL A 1 46 ? 12.971  5.354   -9.382  1.00 0.00 ? 46  VAL A HG13 8  
ATOM   8799  H  HG21 . VAL A 1 46 ? 11.175  6.102   -6.276  1.00 0.00 ? 46  VAL A HG21 8  
ATOM   8800  H  HG22 . VAL A 1 46 ? 12.820  6.646   -6.608  1.00 0.00 ? 46  VAL A HG22 8  
ATOM   8801  H  HG23 . VAL A 1 46 ? 11.603  6.691   -7.883  1.00 0.00 ? 46  VAL A HG23 8  
ATOM   8802  N  N    . CYS A 1 47 ? 12.139  1.867   -7.146  1.00 0.00 ? 47  CYS A N    8  
ATOM   8803  C  CA   . CYS A 1 47 ? 12.578  0.483   -7.280  1.00 0.00 ? 47  CYS A CA   8  
ATOM   8804  C  C    . CYS A 1 47 ? 11.431  -0.482  -6.994  1.00 0.00 ? 47  CYS A C    8  
ATOM   8805  O  O    . CYS A 1 47 ? 11.495  -1.660  -7.344  1.00 0.00 ? 47  CYS A O    8  
ATOM   8806  C  CB   . CYS A 1 47 ? 13.744  0.201   -6.331  1.00 0.00 ? 47  CYS A CB   8  
ATOM   8807  S  SG   . CYS A 1 47 ? 13.326  0.381   -4.567  1.00 0.00 ? 47  CYS A SG   8  
ATOM   8808  H  H    . CYS A 1 47 ? 12.331  2.350   -6.315  1.00 0.00 ? 47  CYS A H    8  
ATOM   8809  H  HA   . CYS A 1 47 ? 12.910  0.337   -8.297  1.00 0.00 ? 47  CYS A HA   8  
ATOM   8810  H  HB2  . CYS A 1 47 ? 14.087  -0.812  -6.484  1.00 0.00 ? 47  CYS A HB2  8  
ATOM   8811  H  HB3  . CYS A 1 47 ? 14.550  0.886   -6.550  1.00 0.00 ? 47  CYS A HB3  8  
ATOM   8812  N  N    . ARG A 1 48 ? 10.382  0.028   -6.357  1.00 0.00 ? 48  ARG A N    8  
ATOM   8813  C  CA   . ARG A 1 48 ? 9.220   -0.788  -6.023  1.00 0.00 ? 48  ARG A CA   8  
ATOM   8814  C  C    . ARG A 1 48 ? 9.622   -1.976  -5.154  1.00 0.00 ? 48  ARG A C    8  
ATOM   8815  O  O    . ARG A 1 48 ? 9.151   -3.096  -5.358  1.00 0.00 ? 48  ARG A O    8  
ATOM   8816  C  CB   . ARG A 1 48 ? 8.535   -1.283  -7.298  1.00 0.00 ? 48  ARG A CB   8  
ATOM   8817  C  CG   . ARG A 1 48 ? 7.691   -0.223  -7.987  1.00 0.00 ? 48  ARG A CG   8  
ATOM   8818  C  CD   . ARG A 1 48 ? 6.304   -0.128  -7.370  1.00 0.00 ? 48  ARG A CD   8  
ATOM   8819  N  NE   . ARG A 1 48 ? 5.548   -1.367  -7.529  1.00 0.00 ? 48  ARG A NE   8  
ATOM   8820  C  CZ   . ARG A 1 48 ? 4.248   -1.472  -7.277  1.00 0.00 ? 48  ARG A CZ   8  
ATOM   8821  N  NH1  . ARG A 1 48 ? 3.564   -0.418  -6.856  1.00 0.00 ? 48  ARG A NH1  8  
ATOM   8822  N  NH2  . ARG A 1 48 ? 3.630   -2.635  -7.445  1.00 0.00 ? 48  ARG A NH2  8  
ATOM   8823  H  H    . ARG A 1 48 ? 10.389  0.975   -6.104  1.00 0.00 ? 48  ARG A H    8  
ATOM   8824  H  HA   . ARG A 1 48 ? 8.529   -0.170  -5.470  1.00 0.00 ? 48  ARG A HA   8  
ATOM   8825  H  HB2  . ARG A 1 48 ? 9.291   -1.618  -7.993  1.00 0.00 ? 48  ARG A HB2  8  
ATOM   8826  H  HB3  . ARG A 1 48 ? 7.895   -2.116  -7.047  1.00 0.00 ? 48  ARG A HB3  8  
ATOM   8827  H  HG2  . ARG A 1 48 ? 8.183   0.734   -7.890  1.00 0.00 ? 48  ARG A HG2  8  
ATOM   8828  H  HG3  . ARG A 1 48 ? 7.595   -0.477  -9.032  1.00 0.00 ? 48  ARG A HG3  8  
ATOM   8829  H  HD2  . ARG A 1 48 ? 6.407   0.087   -6.317  1.00 0.00 ? 48  ARG A HD2  8  
ATOM   8830  H  HD3  . ARG A 1 48 ? 5.767   0.676   -7.851  1.00 0.00 ? 48  ARG A HD3  8  
ATOM   8831  H  HE   . ARG A 1 48 ? 6.035   -2.159  -7.839  1.00 0.00 ? 48  ARG A HE   8  
ATOM   8832  H  HH11 . ARG A 1 48 ? 4.027   0.459   -6.728  1.00 0.00 ? 48  ARG A HH11 8  
ATOM   8833  H  HH12 . ARG A 1 48 ? 2.585   -0.500  -6.667  1.00 0.00 ? 48  ARG A HH12 8  
ATOM   8834  H  HH21 . ARG A 1 48 ? 4.143   -3.432  -7.763  1.00 0.00 ? 48  ARG A HH21 8  
ATOM   8835  H  HH22 . ARG A 1 48 ? 2.653   -2.713  -7.255  1.00 0.00 ? 48  ARG A HH22 8  
ATOM   8836  N  N    . LEU A 1 49 ? 10.496  -1.725  -4.185  1.00 0.00 ? 49  LEU A N    8  
ATOM   8837  C  CA   . LEU A 1 49 ? 10.962  -2.774  -3.285  1.00 0.00 ? 49  LEU A CA   8  
ATOM   8838  C  C    . LEU A 1 49 ? 10.430  -2.555  -1.872  1.00 0.00 ? 49  LEU A C    8  
ATOM   8839  O  O    . LEU A 1 49 ? 10.230  -1.425  -1.425  1.00 0.00 ? 49  LEU A O    8  
ATOM   8840  C  CB   . LEU A 1 49 ? 12.491  -2.815  -3.265  1.00 0.00 ? 49  LEU A CB   8  
ATOM   8841  C  CG   . LEU A 1 49 ? 13.166  -3.303  -4.548  1.00 0.00 ? 49  LEU A CG   8  
ATOM   8842  C  CD1  . LEU A 1 49 ? 14.671  -3.101  -4.470  1.00 0.00 ? 49  LEU A CD1  8  
ATOM   8843  C  CD2  . LEU A 1 49 ? 12.835  -4.767  -4.799  1.00 0.00 ? 49  LEU A CD2  8  
ATOM   8844  H  H    . LEU A 1 49 ? 10.836  -0.814  -4.072  1.00 0.00 ? 49  LEU A H    8  
ATOM   8845  H  HA   . LEU A 1 49 ? 10.590  -3.718  -3.654  1.00 0.00 ? 49  LEU A HA   8  
ATOM   8846  H  HB2  . LEU A 1 49 ? 12.846  -1.815  -3.066  1.00 0.00 ? 49  LEU A HB2  8  
ATOM   8847  H  HB3  . LEU A 1 49 ? 12.794  -3.470  -2.461  1.00 0.00 ? 49  LEU A HB3  8  
ATOM   8848  H  HG   . LEU A 1 49 ? 12.795  -2.727  -5.384  1.00 0.00 ? 49  LEU A HG   8  
ATOM   8849  H  HD11 . LEU A 1 49 ? 14.899  -2.399  -3.682  1.00 0.00 ? 49  LEU A HD11 8  
ATOM   8850  H  HD12 . LEU A 1 49 ? 15.031  -2.715  -5.412  1.00 0.00 ? 49  LEU A HD12 8  
ATOM   8851  H  HD13 . LEU A 1 49 ? 15.151  -4.046  -4.261  1.00 0.00 ? 49  LEU A HD13 8  
ATOM   8852  H  HD21 . LEU A 1 49 ? 11.786  -4.863  -5.036  1.00 0.00 ? 49  LEU A HD21 8  
ATOM   8853  H  HD22 . LEU A 1 49 ? 13.059  -5.344  -3.914  1.00 0.00 ? 49  LEU A HD22 8  
ATOM   8854  H  HD23 . LEU A 1 49 ? 13.426  -5.133  -5.626  1.00 0.00 ? 49  LEU A HD23 8  
ATOM   8855  N  N    . PRO A 1 50 ? 10.196  -3.661  -1.149  1.00 0.00 ? 50  PRO A N    8  
ATOM   8856  C  CA   . PRO A 1 50 ? 9.687   -3.616  0.224   1.00 0.00 ? 50  PRO A CA   8  
ATOM   8857  C  C    . PRO A 1 50 ? 10.719  -3.073  1.207   1.00 0.00 ? 50  PRO A C    8  
ATOM   8858  O  O    . PRO A 1 50 ? 11.771  -3.678  1.416   1.00 0.00 ? 50  PRO A O    8  
ATOM   8859  C  CB   . PRO A 1 50 ? 9.372   -5.081  0.534   1.00 0.00 ? 50  PRO A CB   8  
ATOM   8860  C  CG   . PRO A 1 50 ? 10.269  -5.860  -0.365  1.00 0.00 ? 50  PRO A CG   8  
ATOM   8861  C  CD   . PRO A 1 50 ? 10.412  -5.040  -1.618  1.00 0.00 ? 50  PRO A CD   8  
ATOM   8862  H  HA   . PRO A 1 50 ? 8.783   -3.029  0.293   1.00 0.00 ? 50  PRO A HA   8  
ATOM   8863  H  HB2  . PRO A 1 50 ? 9.582   -5.285  1.575   1.00 0.00 ? 50  PRO A HB2  8  
ATOM   8864  H  HB3  . PRO A 1 50 ? 8.332   -5.282  0.325   1.00 0.00 ? 50  PRO A HB3  8  
ATOM   8865  H  HG2  . PRO A 1 50 ? 11.231  -5.998  0.104   1.00 0.00 ? 50  PRO A HG2  8  
ATOM   8866  H  HG3  . PRO A 1 50 ? 9.820   -6.816  -0.592  1.00 0.00 ? 50  PRO A HG3  8  
ATOM   8867  H  HD2  . PRO A 1 50 ? 11.401  -5.156  -2.034  1.00 0.00 ? 50  PRO A HD2  8  
ATOM   8868  H  HD3  . PRO A 1 50 ? 9.661   -5.322  -2.341  1.00 0.00 ? 50  PRO A HD3  8  
ATOM   8869  N  N    . PHE A 1 51 ? 10.411  -1.929  1.810   1.00 0.00 ? 51  PHE A N    8  
ATOM   8870  C  CA   . PHE A 1 51 ? 11.312  -1.305  2.771   1.00 0.00 ? 51  PHE A CA   8  
ATOM   8871  C  C    . PHE A 1 51 ? 11.857  -2.336  3.756   1.00 0.00 ? 51  PHE A C    8  
ATOM   8872  O  O    . PHE A 1 51 ? 11.130  -3.190  4.265   1.00 0.00 ? 51  PHE A O    8  
ATOM   8873  C  CB   . PHE A 1 51 ? 10.589  -0.190  3.531   1.00 0.00 ? 51  PHE A CB   8  
ATOM   8874  C  CG   . PHE A 1 51 ? 9.900   0.797   2.633   1.00 0.00 ? 51  PHE A CG   8  
ATOM   8875  C  CD1  . PHE A 1 51 ? 10.572  1.370   1.566   1.00 0.00 ? 51  PHE A CD1  8  
ATOM   8876  C  CD2  . PHE A 1 51 ? 8.579   1.152   2.857   1.00 0.00 ? 51  PHE A CD2  8  
ATOM   8877  C  CE1  . PHE A 1 51 ? 9.940   2.279   0.739   1.00 0.00 ? 51  PHE A CE1  8  
ATOM   8878  C  CE2  . PHE A 1 51 ? 7.942   2.060   2.033   1.00 0.00 ? 51  PHE A CE2  8  
ATOM   8879  C  CZ   . PHE A 1 51 ? 8.623   2.624   0.972   1.00 0.00 ? 51  PHE A CZ   8  
ATOM   8880  H  H    . PHE A 1 51 ? 9.557   -1.495  1.603   1.00 0.00 ? 51  PHE A H    8  
ATOM   8881  H  HA   . PHE A 1 51 ? 12.137  -0.878  2.222   1.00 0.00 ? 51  PHE A HA   8  
ATOM   8882  H  HB2  . PHE A 1 51 ? 9.843   -0.629  4.176   1.00 0.00 ? 51  PHE A HB2  8  
ATOM   8883  H  HB3  . PHE A 1 51 ? 11.306  0.349   4.131   1.00 0.00 ? 51  PHE A HB3  8  
ATOM   8884  H  HD1  . PHE A 1 51 ? 11.602  1.100   1.381   1.00 0.00 ? 51  PHE A HD1  8  
ATOM   8885  H  HD2  . PHE A 1 51 ? 8.045   0.711   3.687   1.00 0.00 ? 51  PHE A HD2  8  
ATOM   8886  H  HE1  . PHE A 1 51 ? 10.474  2.718   -0.091  1.00 0.00 ? 51  PHE A HE1  8  
ATOM   8887  H  HE2  . PHE A 1 51 ? 6.912   2.327   2.218   1.00 0.00 ? 51  PHE A HE2  8  
ATOM   8888  H  HZ   . PHE A 1 51 ? 8.127   3.334   0.328   1.00 0.00 ? 51  PHE A HZ   8  
ATOM   8889  N  N    . PRO A 1 52 ? 13.167  -2.256  4.031   1.00 0.00 ? 52  PRO A N    8  
ATOM   8890  C  CA   . PRO A 1 52 ? 13.839  -3.174  4.955   1.00 0.00 ? 52  PRO A CA   8  
ATOM   8891  C  C    . PRO A 1 52 ? 13.422  -2.946  6.404   1.00 0.00 ? 52  PRO A C    8  
ATOM   8892  O  O    . PRO A 1 52 ? 12.843  -1.917  6.754   1.00 0.00 ? 52  PRO A O    8  
ATOM   8893  C  CB   . PRO A 1 52 ? 15.322  -2.843  4.768   1.00 0.00 ? 52  PRO A CB   8  
ATOM   8894  C  CG   . PRO A 1 52 ? 15.338  -1.433  4.287   1.00 0.00 ? 52  PRO A CG   8  
ATOM   8895  C  CD   . PRO A 1 52 ? 14.094  -1.264  3.460   1.00 0.00 ? 52  PRO A CD   8  
ATOM   8896  H  HA   . PRO A 1 52 ? 13.662  -4.206  4.689   1.00 0.00 ? 52  PRO A HA   8  
ATOM   8897  H  HB2  . PRO A 1 52 ? 15.838  -2.946  5.712   1.00 0.00 ? 52  PRO A HB2  8  
ATOM   8898  H  HB3  . PRO A 1 52 ? 15.755  -3.513  4.040   1.00 0.00 ? 52  PRO A HB3  8  
ATOM   8899  H  HG2  . PRO A 1 52 ? 15.324  -0.758  5.129   1.00 0.00 ? 52  PRO A HG2  8  
ATOM   8900  H  HG3  . PRO A 1 52 ? 16.216  -1.262  3.682   1.00 0.00 ? 52  PRO A HG3  8  
ATOM   8901  H  HD2  . PRO A 1 52 ? 13.702  -0.263  3.569   1.00 0.00 ? 52  PRO A HD2  8  
ATOM   8902  H  HD3  . PRO A 1 52 ? 14.298  -1.480  2.422   1.00 0.00 ? 52  PRO A HD3  8  
ATOM   8903  N  N    . PRO A 1 53 ? 13.721  -3.928  7.268   1.00 0.00 ? 53  PRO A N    8  
ATOM   8904  C  CA   . PRO A 1 53 ? 13.386  -3.856  8.693   1.00 0.00 ? 53  PRO A CA   8  
ATOM   8905  C  C    . PRO A 1 53 ? 14.221  -2.817  9.434   1.00 0.00 ? 53  PRO A C    8  
ATOM   8906  O  O    . PRO A 1 53 ? 15.407  -2.647  9.157   1.00 0.00 ? 53  PRO A O    8  
ATOM   8907  C  CB   . PRO A 1 53 ? 13.708  -5.263  9.204   1.00 0.00 ? 53  PRO A CB   8  
ATOM   8908  C  CG   . PRO A 1 53 ? 14.736  -5.783  8.259   1.00 0.00 ? 53  PRO A CG   8  
ATOM   8909  C  CD   . PRO A 1 53 ? 14.409  -5.182  6.920   1.00 0.00 ? 53  PRO A CD   8  
ATOM   8910  H  HA   . PRO A 1 53 ? 12.337  -3.648  8.845   1.00 0.00 ? 53  PRO A HA   8  
ATOM   8911  H  HB2  . PRO A 1 53 ? 14.092  -5.203  10.213  1.00 0.00 ? 53  PRO A HB2  8  
ATOM   8912  H  HB3  . PRO A 1 53 ? 12.815  -5.869  9.188   1.00 0.00 ? 53  PRO A HB3  8  
ATOM   8913  H  HG2  . PRO A 1 53 ? 15.719  -5.473  8.580   1.00 0.00 ? 53  PRO A HG2  8  
ATOM   8914  H  HG3  . PRO A 1 53 ? 14.678  -6.860  8.211   1.00 0.00 ? 53  PRO A HG3  8  
ATOM   8915  H  HD2  . PRO A 1 53 ? 15.314  -4.984  6.365   1.00 0.00 ? 53  PRO A HD2  8  
ATOM   8916  H  HD3  . PRO A 1 53 ? 13.757  -5.837  6.362   1.00 0.00 ? 53  PRO A HD3  8  
ATOM   8917  N  N    . GLY A 1 54 ? 13.592  -2.122  10.377  1.00 0.00 ? 54  GLY A N    8  
ATOM   8918  C  CA   . GLY A 1 54 ? 14.292  -1.108  11.143  1.00 0.00 ? 54  GLY A CA   8  
ATOM   8919  C  C    . GLY A 1 54 ? 14.927  -0.051  10.261  1.00 0.00 ? 54  GLY A C    8  
ATOM   8920  O  O    . GLY A 1 54 ? 16.087  0.314   10.454  1.00 0.00 ? 54  GLY A O    8  
ATOM   8921  H  H    . GLY A 1 54 ? 12.644  -2.300  10.555  1.00 0.00 ? 54  GLY A H    8  
ATOM   8922  H  HA2  . GLY A 1 54 ? 13.593  -0.630  11.812  1.00 0.00 ? 54  GLY A HA2  8  
ATOM   8923  H  HA3  . GLY A 1 54 ? 15.066  -1.584  11.727  1.00 0.00 ? 54  GLY A HA3  8  
ATOM   8924  N  N    . ASP A 1 55 ? 14.167  0.441   9.289   1.00 0.00 ? 55  ASP A N    8  
ATOM   8925  C  CA   . ASP A 1 55 ? 14.662  1.462   8.373   1.00 0.00 ? 55  ASP A CA   8  
ATOM   8926  C  C    . ASP A 1 55 ? 13.622  2.559   8.169   1.00 0.00 ? 55  ASP A C    8  
ATOM   8927  O  O    . ASP A 1 55 ? 12.452  2.279   7.910   1.00 0.00 ? 55  ASP A O    8  
ATOM   8928  C  CB   . ASP A 1 55 ? 15.031  0.835   7.027   1.00 0.00 ? 55  ASP A CB   8  
ATOM   8929  C  CG   . ASP A 1 55 ? 16.461  0.334   6.994   1.00 0.00 ? 55  ASP A CG   8  
ATOM   8930  O  OD1  . ASP A 1 55 ? 16.701  -0.809  7.437   1.00 0.00 ? 55  ASP A OD1  8  
ATOM   8931  O  OD2  . ASP A 1 55 ? 17.341  1.085   6.524   1.00 0.00 ? 55  ASP A OD2  8  
ATOM   8932  H  H    . ASP A 1 55 ? 13.250  0.110   9.185   1.00 0.00 ? 55  ASP A H    8  
ATOM   8933  H  HA   . ASP A 1 55 ? 15.547  1.899   8.810   1.00 0.00 ? 55  ASP A HA   8  
ATOM   8934  H  HB2  . ASP A 1 55 ? 14.373  0.000   6.834   1.00 0.00 ? 55  ASP A HB2  8  
ATOM   8935  H  HB3  . ASP A 1 55 ? 14.908  1.572   6.248   1.00 0.00 ? 55  ASP A HB3  8  
ATOM   8936  N  N    . ARG A 1 56 ? 14.058  3.809   8.287   1.00 0.00 ? 56  ARG A N    8  
ATOM   8937  C  CA   . ARG A 1 56 ? 13.164  4.949   8.118   1.00 0.00 ? 56  ARG A CA   8  
ATOM   8938  C  C    . ARG A 1 56 ? 12.641  5.021   6.687   1.00 0.00 ? 56  ARG A C    8  
ATOM   8939  O  O    . ARG A 1 56 ? 13.313  4.598   5.747   1.00 0.00 ? 56  ARG A O    8  
ATOM   8940  C  CB   . ARG A 1 56 ? 13.888  6.249   8.474   1.00 0.00 ? 56  ARG A CB   8  
ATOM   8941  C  CG   . ARG A 1 56 ? 13.810  6.605   9.950   1.00 0.00 ? 56  ARG A CG   8  
ATOM   8942  C  CD   . ARG A 1 56 ? 14.621  5.640   10.800  1.00 0.00 ? 56  ARG A CD   8  
ATOM   8943  N  NE   . ARG A 1 56 ? 16.052  5.926   10.738  1.00 0.00 ? 56  ARG A NE   8  
ATOM   8944  C  CZ   . ARG A 1 56 ? 16.620  6.969   11.334  1.00 0.00 ? 56  ARG A CZ   8  
ATOM   8945  N  NH1  . ARG A 1 56 ? 15.882  7.820   12.033  1.00 0.00 ? 56  ARG A NH1  8  
ATOM   8946  N  NH2  . ARG A 1 56 ? 17.929  7.162   11.231  1.00 0.00 ? 56  ARG A NH2  8  
ATOM   8947  H  H    . ARG A 1 56 ? 15.002  3.969   8.495   1.00 0.00 ? 56  ARG A H    8  
ATOM   8948  H  HA   . ARG A 1 56 ? 12.328  4.818   8.789   1.00 0.00 ? 56  ARG A HA   8  
ATOM   8949  H  HB2  . ARG A 1 56 ? 14.930  6.153   8.205   1.00 0.00 ? 56  ARG A HB2  8  
ATOM   8950  H  HB3  . ARG A 1 56 ? 13.451  7.057   7.907   1.00 0.00 ? 56  ARG A HB3  8  
ATOM   8951  H  HG2  . ARG A 1 56 ? 14.196  7.604   10.091  1.00 0.00 ? 56  ARG A HG2  8  
ATOM   8952  H  HG3  . ARG A 1 56 ? 12.778  6.569   10.265  1.00 0.00 ? 56  ARG A HG3  8  
ATOM   8953  H  HD2  . ARG A 1 56 ? 14.293  5.721   11.825  1.00 0.00 ? 56  ARG A HD2  8  
ATOM   8954  H  HD3  . ARG A 1 56 ? 14.449  4.636   10.444  1.00 0.00 ? 56  ARG A HD3  8  
ATOM   8955  H  HE   . ARG A 1 56 ? 16.616  5.311   10.226  1.00 0.00 ? 56  ARG A HE   8  
ATOM   8956  H  HH11 . ARG A 1 56 ? 14.895  7.676   12.113  1.00 0.00 ? 56  ARG A HH11 8  
ATOM   8957  H  HH12 . ARG A 1 56 ? 16.312  8.604   12.482  1.00 0.00 ? 56  ARG A HH12 8  
ATOM   8958  H  HH21 . ARG A 1 56 ? 18.488  6.523   10.705  1.00 0.00 ? 56  ARG A HH21 8  
ATOM   8959  H  HH22 . ARG A 1 56 ? 18.355  7.947   11.680  1.00 0.00 ? 56  ARG A HH22 8  
ATOM   8960  N  N    . VAL A 1 57 ? 11.435  5.560   6.530   1.00 0.00 ? 57  VAL A N    8  
ATOM   8961  C  CA   . VAL A 1 57 ? 10.821  5.689   5.214   1.00 0.00 ? 57  VAL A CA   8  
ATOM   8962  C  C    . VAL A 1 57 ? 10.573  7.151   4.864   1.00 0.00 ? 57  VAL A C    8  
ATOM   8963  O  O    . VAL A 1 57 ? 9.939   7.885   5.623   1.00 0.00 ? 57  VAL A O    8  
ATOM   8964  C  CB   . VAL A 1 57 ? 9.488   4.921   5.140   1.00 0.00 ? 57  VAL A CB   8  
ATOM   8965  C  CG1  . VAL A 1 57 ? 8.878   5.043   3.751   1.00 0.00 ? 57  VAL A CG1  8  
ATOM   8966  C  CG2  . VAL A 1 57 ? 9.692   3.461   5.515   1.00 0.00 ? 57  VAL A CG2  8  
ATOM   8967  H  H    . VAL A 1 57 ? 10.948  5.879   7.318   1.00 0.00 ? 57  VAL A H    8  
ATOM   8968  H  HA   . VAL A 1 57 ? 11.498  5.264   4.487   1.00 0.00 ? 57  VAL A HA   8  
ATOM   8969  H  HB   . VAL A 1 57 ? 8.802   5.361   5.849   1.00 0.00 ? 57  VAL A HB   8  
ATOM   8970  H  HG11 . VAL A 1 57 ? 7.886   4.615   3.755   1.00 0.00 ? 57  VAL A HG11 8  
ATOM   8971  H  HG12 . VAL A 1 57 ? 8.822   6.085   3.473   1.00 0.00 ? 57  VAL A HG12 8  
ATOM   8972  H  HG13 . VAL A 1 57 ? 9.495   4.513   3.040   1.00 0.00 ? 57  VAL A HG13 8  
ATOM   8973  H  HG21 . VAL A 1 57 ? 9.273   2.830   4.746   1.00 0.00 ? 57  VAL A HG21 8  
ATOM   8974  H  HG22 . VAL A 1 57 ? 10.749  3.258   5.611   1.00 0.00 ? 57  VAL A HG22 8  
ATOM   8975  H  HG23 . VAL A 1 57 ? 9.201   3.259   6.455   1.00 0.00 ? 57  VAL A HG23 8  
ATOM   8976  N  N    . THR A 1 58 ? 11.077  7.571   3.707   1.00 0.00 ? 58  THR A N    8  
ATOM   8977  C  CA   . THR A 1 58 ? 10.911  8.947   3.255   1.00 0.00 ? 58  THR A CA   8  
ATOM   8978  C  C    . THR A 1 58 ? 9.730   9.073   2.300   1.00 0.00 ? 58  THR A C    8  
ATOM   8979  O  O    . THR A 1 58 ? 9.808   8.660   1.143   1.00 0.00 ? 58  THR A O    8  
ATOM   8980  C  CB   . THR A 1 58 ? 12.181  9.465   2.555   1.00 0.00 ? 58  THR A CB   8  
ATOM   8981  O  OG1  . THR A 1 58 ? 13.291  9.423   3.459   1.00 0.00 ? 58  THR A OG1  8  
ATOM   8982  C  CG2  . THR A 1 58 ? 11.982  10.888  2.056   1.00 0.00 ? 58  THR A CG2  8  
ATOM   8983  H  H    . THR A 1 58 ? 11.572  6.939   3.146   1.00 0.00 ? 58  THR A H    8  
ATOM   8984  H  HA   . THR A 1 58 ? 10.727  9.563   4.124   1.00 0.00 ? 58  THR A HA   8  
ATOM   8985  H  HB   . THR A 1 58 ? 12.392  8.828   1.708   1.00 0.00 ? 58  THR A HB   8  
ATOM   8986  H  HG1  . THR A 1 58 ? 14.109  9.534   2.968   1.00 0.00 ? 58  THR A HG1  8  
ATOM   8987  H  HG21 . THR A 1 58 ? 11.107  11.314  2.524   1.00 0.00 ? 58  THR A HG21 8  
ATOM   8988  H  HG22 . THR A 1 58 ? 11.848  10.878  0.984   1.00 0.00 ? 58  THR A HG22 8  
ATOM   8989  H  HG23 . THR A 1 58 ? 12.848  11.482  2.306   1.00 0.00 ? 58  THR A HG23 8  
ATOM   8990  N  N    . PHE A 1 59 ? 8.637   9.647   2.791   1.00 0.00 ? 59  PHE A N    8  
ATOM   8991  C  CA   . PHE A 1 59 ? 7.438   9.828   1.980   1.00 0.00 ? 59  PHE A CA   8  
ATOM   8992  C  C    . PHE A 1 59 ? 7.407   11.221  1.358   1.00 0.00 ? 59  PHE A C    8  
ATOM   8993  O  O    . PHE A 1 59 ? 7.598   12.223  2.045   1.00 0.00 ? 59  PHE A O    8  
ATOM   8994  C  CB   . PHE A 1 59 ? 6.184   9.608   2.828   1.00 0.00 ? 59  PHE A CB   8  
ATOM   8995  C  CG   . PHE A 1 59 ? 5.863   10.762  3.734   1.00 0.00 ? 59  PHE A CG   8  
ATOM   8996  C  CD1  . PHE A 1 59 ? 5.213   11.884  3.244   1.00 0.00 ? 59  PHE A CD1  8  
ATOM   8997  C  CD2  . PHE A 1 59 ? 6.211   10.726  5.074   1.00 0.00 ? 59  PHE A CD2  8  
ATOM   8998  C  CE1  . PHE A 1 59 ? 4.916   12.948  4.075   1.00 0.00 ? 59  PHE A CE1  8  
ATOM   8999  C  CE2  . PHE A 1 59 ? 5.916   11.787  5.909   1.00 0.00 ? 59  PHE A CE2  8  
ATOM   9000  C  CZ   . PHE A 1 59 ? 5.269   12.900  5.409   1.00 0.00 ? 59  PHE A CZ   8  
ATOM   9001  H  H    . PHE A 1 59 ? 8.635   9.956   3.721   1.00 0.00 ? 59  PHE A H    8  
ATOM   9002  H  HA   . PHE A 1 59 ? 7.461   9.094   1.189   1.00 0.00 ? 59  PHE A HA   8  
ATOM   9003  H  HB2  . PHE A 1 59 ? 5.339   9.454   2.175   1.00 0.00 ? 59  PHE A HB2  8  
ATOM   9004  H  HB3  . PHE A 1 59 ? 6.324   8.731   3.443   1.00 0.00 ? 59  PHE A HB3  8  
ATOM   9005  H  HD1  . PHE A 1 59 ? 4.937   11.922  2.200   1.00 0.00 ? 59  PHE A HD1  8  
ATOM   9006  H  HD2  . PHE A 1 59 ? 6.719   9.857   5.467   1.00 0.00 ? 59  PHE A HD2  8  
ATOM   9007  H  HE1  . PHE A 1 59 ? 4.410   13.816  3.679   1.00 0.00 ? 59  PHE A HE1  8  
ATOM   9008  H  HE2  . PHE A 1 59 ? 6.193   11.747  6.952   1.00 0.00 ? 59  PHE A HE2  8  
ATOM   9009  H  HZ   . PHE A 1 59 ? 5.037   13.730  6.059   1.00 0.00 ? 59  PHE A HZ   8  
ATOM   9010  N  N    . ASN A 1 60 ? 7.166   11.274  0.052   1.00 0.00 ? 60  ASN A N    8  
ATOM   9011  C  CA   . ASN A 1 60 ? 7.111   12.543  -0.664  1.00 0.00 ? 60  ASN A CA   8  
ATOM   9012  C  C    . ASN A 1 60 ? 5.723   12.775  -1.254  1.00 0.00 ? 60  ASN A C    8  
ATOM   9013  O  O    . ASN A 1 60 ? 5.421   12.317  -2.355  1.00 0.00 ? 60  ASN A O    8  
ATOM   9014  C  CB   . ASN A 1 60 ? 8.162   12.572  -1.776  1.00 0.00 ? 60  ASN A CB   8  
ATOM   9015  C  CG   . ASN A 1 60 ? 8.652   13.976  -2.072  1.00 0.00 ? 60  ASN A CG   8  
ATOM   9016  O  OD1  . ASN A 1 60 ? 7.975   14.959  -1.770  1.00 0.00 ? 60  ASN A OD1  8  
ATOM   9017  N  ND2  . ASN A 1 60 ? 9.835   14.076  -2.667  1.00 0.00 ? 60  ASN A ND2  8  
ATOM   9018  H  H    . ASN A 1 60 ? 7.021   10.440  -0.442  1.00 0.00 ? 60  ASN A H    8  
ATOM   9019  H  HA   . ASN A 1 60 ? 7.325   13.332  0.042   1.00 0.00 ? 60  ASN A HA   8  
ATOM   9020  H  HB2  . ASN A 1 60 ? 9.009   11.971  -1.477  1.00 0.00 ? 60  ASN A HB2  8  
ATOM   9021  H  HB3  . ASN A 1 60 ? 7.734   12.161  -2.678  1.00 0.00 ? 60  ASN A HB3  8  
ATOM   9022  H  HD21 . ASN A 1 60 ? 10.319  13.250  -2.879  1.00 0.00 ? 60  ASN A HD21 8  
ATOM   9023  H  HD22 . ASN A 1 60 ? 10.176  14.972  -2.870  1.00 0.00 ? 60  ASN A HD22 8  
ATOM   9024  N  N    . GLY A 1 61 ? 4.883   13.491  -0.514  1.00 0.00 ? 61  GLY A N    8  
ATOM   9025  C  CA   . GLY A 1 61 ? 3.538   13.772  -0.980  1.00 0.00 ? 61  GLY A CA   8  
ATOM   9026  C  C    . GLY A 1 61 ? 2.611   12.582  -0.830  1.00 0.00 ? 61  GLY A C    8  
ATOM   9027  O  O    . GLY A 1 61 ? 2.232   12.217  0.283   1.00 0.00 ? 61  GLY A O    8  
ATOM   9028  H  H    . GLY A 1 61 ? 5.179   13.831  0.357   1.00 0.00 ? 61  GLY A H    8  
ATOM   9029  H  HA2  . GLY A 1 61 ? 3.138   14.600  -0.414  1.00 0.00 ? 61  GLY A HA2  8  
ATOM   9030  H  HA3  . GLY A 1 61 ? 3.581   14.050  -2.023  1.00 0.00 ? 61  GLY A HA3  8  
ATOM   9031  N  N    . LYS A 1 62 ? 2.244   11.975  -1.953  1.00 0.00 ? 62  LYS A N    8  
ATOM   9032  C  CA   . LYS A 1 62 ? 1.356   10.819  -1.943  1.00 0.00 ? 62  LYS A CA   8  
ATOM   9033  C  C    . LYS A 1 62 ? 2.153   9.519   -2.007  1.00 0.00 ? 62  LYS A C    8  
ATOM   9034  O  O    . LYS A 1 62 ? 1.824   8.546   -1.329  1.00 0.00 ? 62  LYS A O    8  
ATOM   9035  C  CB   . LYS A 1 62 ? 0.380   10.889  -3.120  1.00 0.00 ? 62  LYS A CB   8  
ATOM   9036  C  CG   . LYS A 1 62 ? 1.064   10.903  -4.477  1.00 0.00 ? 62  LYS A CG   8  
ATOM   9037  C  CD   . LYS A 1 62 ? 0.192   11.561  -5.533  1.00 0.00 ? 62  LYS A CD   8  
ATOM   9038  C  CE   . LYS A 1 62 ? 0.850   11.519  -6.904  1.00 0.00 ? 62  LYS A CE   8  
ATOM   9039  N  NZ   . LYS A 1 62 ? 1.752   12.683  -7.122  1.00 0.00 ? 62  LYS A NZ   8  
ATOM   9040  H  H    . LYS A 1 62 ? 2.579   12.312  -2.811  1.00 0.00 ? 62  LYS A H    8  
ATOM   9041  H  HA   . LYS A 1 62 ? 0.795   10.838  -1.021  1.00 0.00 ? 62  LYS A HA   8  
ATOM   9042  H  HB2  . LYS A 1 62 ? -0.276  10.032  -3.080  1.00 0.00 ? 62  LYS A HB2  8  
ATOM   9043  H  HB3  . LYS A 1 62 ? -0.211  11.789  -3.029  1.00 0.00 ? 62  LYS A HB3  8  
ATOM   9044  H  HG2  . LYS A 1 62 ? 1.990   11.453  -4.397  1.00 0.00 ? 62  LYS A HG2  8  
ATOM   9045  H  HG3  . LYS A 1 62 ? 1.271   9.886   -4.776  1.00 0.00 ? 62  LYS A HG3  8  
ATOM   9046  H  HD2  . LYS A 1 62 ? -0.753  11.039  -5.584  1.00 0.00 ? 62  LYS A HD2  8  
ATOM   9047  H  HD3  . LYS A 1 62 ? 0.021   12.592  -5.257  1.00 0.00 ? 62  LYS A HD3  8  
ATOM   9048  H  HE2  . LYS A 1 62 ? 1.425   10.609  -6.985  1.00 0.00 ? 62  LYS A HE2  8  
ATOM   9049  H  HE3  . LYS A 1 62 ? 0.078   11.525  -7.660  1.00 0.00 ? 62  LYS A HE3  8  
ATOM   9050  H  HZ1  . LYS A 1 62 ? 2.512   12.427  -7.785  1.00 0.00 ? 62  LYS A HZ1  8  
ATOM   9051  H  HZ2  . LYS A 1 62 ? 2.178   12.979  -6.221  1.00 0.00 ? 62  LYS A HZ2  8  
ATOM   9052  H  HZ3  . LYS A 1 62 ? 1.215   13.481  -7.518  1.00 0.00 ? 62  LYS A HZ3  8  
ATOM   9053  N  N    . GLU A 1 63 ? 3.201   9.513   -2.824  1.00 0.00 ? 63  GLU A N    8  
ATOM   9054  C  CA   . GLU A 1 63 ? 4.045   8.333   -2.974  1.00 0.00 ? 63  GLU A CA   8  
ATOM   9055  C  C    . GLU A 1 63 ? 5.211   8.369   -1.990  1.00 0.00 ? 63  GLU A C    8  
ATOM   9056  O  O    . GLU A 1 63 ? 5.572   9.429   -1.477  1.00 0.00 ? 63  GLU A O    8  
ATOM   9057  C  CB   . GLU A 1 63 ? 4.575   8.237   -4.406  1.00 0.00 ? 63  GLU A CB   8  
ATOM   9058  C  CG   . GLU A 1 63 ? 3.520   7.823   -5.419  1.00 0.00 ? 63  GLU A CG   8  
ATOM   9059  C  CD   . GLU A 1 63 ? 3.841   8.300   -6.822  1.00 0.00 ? 63  GLU A CD   8  
ATOM   9060  O  OE1  . GLU A 1 63 ? 4.606   9.277   -6.956  1.00 0.00 ? 63  GLU A OE1  8  
ATOM   9061  O  OE2  . GLU A 1 63 ? 3.326   7.696   -7.786  1.00 0.00 ? 63  GLU A OE2  8  
ATOM   9062  H  H    . GLU A 1 63 ? 3.412   10.321  -3.338  1.00 0.00 ? 63  GLU A H    8  
ATOM   9063  H  HA   . GLU A 1 63 ? 3.440   7.464   -2.765  1.00 0.00 ? 63  GLU A HA   8  
ATOM   9064  H  HB2  . GLU A 1 63 ? 4.967   9.200   -4.698  1.00 0.00 ? 63  GLU A HB2  8  
ATOM   9065  H  HB3  . GLU A 1 63 ? 5.373   7.510   -4.433  1.00 0.00 ? 63  GLU A HB3  8  
ATOM   9066  H  HG2  . GLU A 1 63 ? 3.451   6.746   -5.428  1.00 0.00 ? 63  GLU A HG2  8  
ATOM   9067  H  HG3  . GLU A 1 63 ? 2.570   8.241   -5.121  1.00 0.00 ? 63  GLU A HG3  8  
ATOM   9068  N  N    . CYS A 1 64 ? 5.794   7.204   -1.730  1.00 0.00 ? 64  CYS A N    8  
ATOM   9069  C  CA   . CYS A 1 64 ? 6.918   7.101   -0.807  1.00 0.00 ? 64  CYS A CA   8  
ATOM   9070  C  C    . CYS A 1 64 ? 8.087   6.365   -1.453  1.00 0.00 ? 64  CYS A C    8  
ATOM   9071  O  O    . CYS A 1 64 ? 7.897   5.539   -2.346  1.00 0.00 ? 64  CYS A O    8  
ATOM   9072  C  CB   . CYS A 1 64 ? 6.490   6.379   0.472   1.00 0.00 ? 64  CYS A CB   8  
ATOM   9073  S  SG   . CYS A 1 64 ? 5.502   4.892   0.184   1.00 0.00 ? 64  CYS A SG   8  
ATOM   9074  H  H    . CYS A 1 64 ? 5.461   6.394   -2.170  1.00 0.00 ? 64  CYS A H    8  
ATOM   9075  H  HA   . CYS A 1 64 ? 7.233   8.102   -0.556  1.00 0.00 ? 64  CYS A HA   8  
ATOM   9076  H  HB2  . CYS A 1 64 ? 7.371   6.084   1.023   1.00 0.00 ? 64  CYS A HB2  8  
ATOM   9077  H  HB3  . CYS A 1 64 ? 5.903   7.053   1.078   1.00 0.00 ? 64  CYS A HB3  8  
ATOM   9078  H  HG   . CYS A 1 64 ? 6.269   4.004   -0.430  1.00 0.00 ? 64  CYS A HG   8  
ATOM   9079  N  N    . MET A 1 65 ? 9.297   6.673   -0.998  1.00 0.00 ? 65  MET A N    8  
ATOM   9080  C  CA   . MET A 1 65 ? 10.498  6.041   -1.533  1.00 0.00 ? 65  MET A CA   8  
ATOM   9081  C  C    . MET A 1 65 ? 11.384  5.516   -0.408  1.00 0.00 ? 65  MET A C    8  
ATOM   9082  O  O    . MET A 1 65 ? 11.290  5.971   0.733   1.00 0.00 ? 65  MET A O    8  
ATOM   9083  C  CB   . MET A 1 65 ? 11.282  7.033   -2.394  1.00 0.00 ? 65  MET A CB   8  
ATOM   9084  C  CG   . MET A 1 65 ? 10.633  7.314   -3.740  1.00 0.00 ? 65  MET A CG   8  
ATOM   9085  S  SD   . MET A 1 65 ? 11.549  8.525   -4.713  1.00 0.00 ? 65  MET A SD   8  
ATOM   9086  C  CE   . MET A 1 65 ? 11.490  9.947   -3.627  1.00 0.00 ? 65  MET A CE   8  
ATOM   9087  H  H    . MET A 1 65 ? 9.386   7.339   -0.285  1.00 0.00 ? 65  MET A H    8  
ATOM   9088  H  HA   . MET A 1 65 ? 10.188  5.210   -2.149  1.00 0.00 ? 65  MET A HA   8  
ATOM   9089  H  HB2  . MET A 1 65 ? 11.368  7.967   -1.859  1.00 0.00 ? 65  MET A HB2  8  
ATOM   9090  H  HB3  . MET A 1 65 ? 12.270  6.636   -2.572  1.00 0.00 ? 65  MET A HB3  8  
ATOM   9091  H  HG2  . MET A 1 65 ? 10.580  6.392   -4.299  1.00 0.00 ? 65  MET A HG2  8  
ATOM   9092  H  HG3  . MET A 1 65 ? 9.635   7.689   -3.572  1.00 0.00 ? 65  MET A HG3  8  
ATOM   9093  H  HE1  . MET A 1 65 ? 10.598  9.900   -3.020  1.00 0.00 ? 65  MET A HE1  8  
ATOM   9094  H  HE2  . MET A 1 65 ? 12.361  9.948   -2.988  1.00 0.00 ? 65  MET A HE2  8  
ATOM   9095  H  HE3  . MET A 1 65 ? 11.476  10.851  -4.218  1.00 0.00 ? 65  MET A HE3  8  
ATOM   9096  N  N    . CYS A 1 66 ? 12.243  4.557   -0.735  1.00 0.00 ? 66  CYS A N    8  
ATOM   9097  C  CA   . CYS A 1 66 ? 13.145  3.969   0.248   1.00 0.00 ? 66  CYS A CA   8  
ATOM   9098  C  C    . CYS A 1 66 ? 14.369  4.856   0.461   1.00 0.00 ? 66  CYS A C    8  
ATOM   9099  O  O    . CYS A 1 66 ? 14.658  5.736   -0.349  1.00 0.00 ? 66  CYS A O    8  
ATOM   9100  C  CB   . CYS A 1 66 ? 13.584  2.574   -0.202  1.00 0.00 ? 66  CYS A CB   8  
ATOM   9101  S  SG   . CYS A 1 66 ? 14.640  2.570   -1.687  1.00 0.00 ? 66  CYS A SG   8  
ATOM   9102  H  H    . CYS A 1 66 ? 12.271  4.235   -1.662  1.00 0.00 ? 66  CYS A H    8  
ATOM   9103  H  HA   . CYS A 1 66 ? 12.610  3.885   1.181   1.00 0.00 ? 66  CYS A HA   8  
ATOM   9104  H  HB2  . CYS A 1 66 ? 14.140  2.106   0.597   1.00 0.00 ? 66  CYS A HB2  8  
ATOM   9105  H  HB3  . CYS A 1 66 ? 12.708  1.982   -0.419  1.00 0.00 ? 66  CYS A HB3  8  
ATOM   9106  N  N    . GLN A 1 67 ? 15.083  4.616   1.556   1.00 0.00 ? 67  GLN A N    8  
ATOM   9107  C  CA   . GLN A 1 67 ? 16.274  5.392   1.876   1.00 0.00 ? 67  GLN A CA   8  
ATOM   9108  C  C    . GLN A 1 67 ? 17.292  5.320   0.742   1.00 0.00 ? 67  GLN A C    8  
ATOM   9109  O  O    . GLN A 1 67 ? 17.929  6.317   0.402   1.00 0.00 ? 67  GLN A O    8  
ATOM   9110  C  CB   . GLN A 1 67 ? 16.905  4.887   3.175   1.00 0.00 ? 67  GLN A CB   8  
ATOM   9111  C  CG   . GLN A 1 67 ? 17.776  5.920   3.870   1.00 0.00 ? 67  GLN A CG   8  
ATOM   9112  C  CD   . GLN A 1 67 ? 18.881  5.291   4.696   1.00 0.00 ? 67  GLN A CD   8  
ATOM   9113  O  OE1  . GLN A 1 67 ? 19.914  4.882   4.165   1.00 0.00 ? 67  GLN A OE1  8  
ATOM   9114  N  NE2  . GLN A 1 67 ? 18.669  5.210   6.005   1.00 0.00 ? 67  GLN A NE2  8  
ATOM   9115  H  H    . GLN A 1 67 ? 14.801  3.900   2.163   1.00 0.00 ? 67  GLN A H    8  
ATOM   9116  H  HA   . GLN A 1 67 ? 15.974  6.421   2.009   1.00 0.00 ? 67  GLN A HA   8  
ATOM   9117  H  HB2  . GLN A 1 67 ? 16.117  4.596   3.854   1.00 0.00 ? 67  GLN A HB2  8  
ATOM   9118  H  HB3  . GLN A 1 67 ? 17.515  4.024   2.953   1.00 0.00 ? 67  GLN A HB3  8  
ATOM   9119  H  HG2  . GLN A 1 67 ? 18.226  6.556   3.122   1.00 0.00 ? 67  GLN A HG2  8  
ATOM   9120  H  HG3  . GLN A 1 67 ? 17.155  6.517   4.521   1.00 0.00 ? 67  GLN A HG3  8  
ATOM   9121  H  HE21 . GLN A 1 67 ? 17.822  5.555   6.358   1.00 0.00 ? 67  GLN A HE21 8  
ATOM   9122  H  HE22 . GLN A 1 67 ? 19.366  4.807   6.562   1.00 0.00 ? 67  GLN A HE22 8  
ATOM   9123  N  N    . LYS A 1 68 ? 17.439  4.135   0.160   1.00 0.00 ? 68  LYS A N    8  
ATOM   9124  C  CA   . LYS A 1 68 ? 18.378  3.932   -0.937  1.00 0.00 ? 68  LYS A CA   8  
ATOM   9125  C  C    . LYS A 1 68 ? 18.079  4.883   -2.091  1.00 0.00 ? 68  LYS A C    8  
ATOM   9126  O  O    . LYS A 1 68 ? 18.992  5.450   -2.693  1.00 0.00 ? 68  LYS A O    8  
ATOM   9127  C  CB   . LYS A 1 68 ? 18.316  2.483   -1.426  1.00 0.00 ? 68  LYS A CB   8  
ATOM   9128  C  CG   . LYS A 1 68 ? 18.964  1.492   -0.475  1.00 0.00 ? 68  LYS A CG   8  
ATOM   9129  C  CD   . LYS A 1 68 ? 18.313  0.122   -0.569  1.00 0.00 ? 68  LYS A CD   8  
ATOM   9130  C  CE   . LYS A 1 68 ? 19.130  -0.935  0.159   1.00 0.00 ? 68  LYS A CE   8  
ATOM   9131  N  NZ   . LYS A 1 68 ? 18.483  -2.274  0.100   1.00 0.00 ? 68  LYS A NZ   8  
ATOM   9132  H  H    . LYS A 1 68 ? 16.902  3.378   0.476   1.00 0.00 ? 68  LYS A H    8  
ATOM   9133  H  HA   . LYS A 1 68 ? 19.371  4.136   -0.565  1.00 0.00 ? 68  LYS A HA   8  
ATOM   9134  H  HB2  . LYS A 1 68 ? 17.281  2.203   -1.555  1.00 0.00 ? 68  LYS A HB2  8  
ATOM   9135  H  HB3  . LYS A 1 68 ? 18.819  2.416   -2.380  1.00 0.00 ? 68  LYS A HB3  8  
ATOM   9136  H  HG2  . LYS A 1 68 ? 20.011  1.398   -0.725  1.00 0.00 ? 68  LYS A HG2  8  
ATOM   9137  H  HG3  . LYS A 1 68 ? 18.865  1.859   0.536   1.00 0.00 ? 68  LYS A HG3  8  
ATOM   9138  H  HD2  . LYS A 1 68 ? 17.330  0.169   -0.124  1.00 0.00 ? 68  LYS A HD2  8  
ATOM   9139  H  HD3  . LYS A 1 68 ? 18.227  -0.156  -1.610  1.00 0.00 ? 68  LYS A HD3  8  
ATOM   9140  H  HE2  . LYS A 1 68 ? 20.105  -0.995  -0.299  1.00 0.00 ? 68  LYS A HE2  8  
ATOM   9141  H  HE3  . LYS A 1 68 ? 19.236  -0.640  1.193   1.00 0.00 ? 68  LYS A HE3  8  
ATOM   9142  H  HZ1  . LYS A 1 68 ? 17.461  -2.185  0.271   1.00 0.00 ? 68  LYS A HZ1  8  
ATOM   9143  H  HZ2  . LYS A 1 68 ? 18.890  -2.900  0.824   1.00 0.00 ? 68  LYS A HZ2  8  
ATOM   9144  H  HZ3  . LYS A 1 68 ? 18.631  -2.702  -0.836  1.00 0.00 ? 68  LYS A HZ3  8  
ATOM   9145  N  N    . CYS A 1 69 ? 16.797  5.054   -2.395  1.00 0.00 ? 69  CYS A N    8  
ATOM   9146  C  CA   . CYS A 1 69 ? 16.378  5.937   -3.476  1.00 0.00 ? 69  CYS A CA   8  
ATOM   9147  C  C    . CYS A 1 69 ? 16.468  7.399   -3.050  1.00 0.00 ? 69  CYS A C    8  
ATOM   9148  O  O    . CYS A 1 69 ? 17.038  8.229   -3.758  1.00 0.00 ? 69  CYS A O    8  
ATOM   9149  C  CB   . CYS A 1 69 ? 14.948  5.606   -3.908  1.00 0.00 ? 69  CYS A CB   8  
ATOM   9150  S  SG   . CYS A 1 69 ? 14.802  4.083   -4.895  1.00 0.00 ? 69  CYS A SG   8  
ATOM   9151  H  H    . CYS A 1 69 ? 16.115  4.574   -1.879  1.00 0.00 ? 69  CYS A H    8  
ATOM   9152  H  HA   . CYS A 1 69 ? 17.043  5.777   -4.312  1.00 0.00 ? 69  CYS A HA   8  
ATOM   9153  H  HB2  . CYS A 1 69 ? 14.333  5.486   -3.027  1.00 0.00 ? 69  CYS A HB2  8  
ATOM   9154  H  HB3  . CYS A 1 69 ? 14.561  6.422   -4.501  1.00 0.00 ? 69  CYS A HB3  8  
ATOM   9155  N  N    . SER A 1 70 ? 15.900  7.707   -1.889  1.00 0.00 ? 70  SER A N    8  
ATOM   9156  C  CA   . SER A 1 70 ? 15.912  9.070   -1.369  1.00 0.00 ? 70  SER A CA   8  
ATOM   9157  C  C    . SER A 1 70 ? 17.273  9.723   -1.591  1.00 0.00 ? 70  SER A C    8  
ATOM   9158  O  O    . SER A 1 70 ? 17.364  10.824  -2.135  1.00 0.00 ? 70  SER A O    8  
ATOM   9159  C  CB   . SER A 1 70 ? 15.569  9.073   0.122   1.00 0.00 ? 70  SER A CB   8  
ATOM   9160  O  OG   . SER A 1 70 ? 15.325  10.389  0.586   1.00 0.00 ? 70  SER A OG   8  
ATOM   9161  H  H    . SER A 1 70 ? 15.460  7.001   -1.370  1.00 0.00 ? 70  SER A H    8  
ATOM   9162  H  HA   . SER A 1 70 ? 15.163  9.635   -1.903  1.00 0.00 ? 70  SER A HA   8  
ATOM   9163  H  HB2  . SER A 1 70 ? 14.685  8.476   0.287   1.00 0.00 ? 70  SER A HB2  8  
ATOM   9164  H  HB3  . SER A 1 70 ? 16.395  8.654   0.679   1.00 0.00 ? 70  SER A HB3  8  
ATOM   9165  H  HG   . SER A 1 70 ? 16.012  10.976  0.263   1.00 0.00 ? 70  SER A HG   8  
ATOM   9166  N  N    . LEU A 1 71 ? 18.328  9.038   -1.165  1.00 0.00 ? 71  LEU A N    8  
ATOM   9167  C  CA   . LEU A 1 71 ? 19.685  9.550   -1.316  1.00 0.00 ? 71  LEU A CA   8  
ATOM   9168  C  C    . LEU A 1 71 ? 20.263  9.169   -2.676  1.00 0.00 ? 71  LEU A C    8  
ATOM   9169  O  O    . LEU A 1 71 ? 19.792  8.247   -3.341  1.00 0.00 ? 71  LEU A O    8  
ATOM   9170  C  CB   . LEU A 1 71 ? 20.582  9.013   -0.200  1.00 0.00 ? 71  LEU A CB   8  
ATOM   9171  C  CG   . LEU A 1 71 ? 20.654  9.861   1.070   1.00 0.00 ? 71  LEU A CG   8  
ATOM   9172  C  CD1  . LEU A 1 71 ? 19.602  9.413   2.073   1.00 0.00 ? 71  LEU A CD1  8  
ATOM   9173  C  CD2  . LEU A 1 71 ? 22.045  9.786   1.684   1.00 0.00 ? 71  LEU A CD2  8  
ATOM   9174  H  H    . LEU A 1 71 ? 18.192  8.166   -0.739  1.00 0.00 ? 71  LEU A H    8  
ATOM   9175  H  HA   . LEU A 1 71 ? 19.643  10.627  -1.246  1.00 0.00 ? 71  LEU A HA   8  
ATOM   9176  H  HB2  . LEU A 1 71 ? 20.216  8.036   0.077   1.00 0.00 ? 71  LEU A HB2  8  
ATOM   9177  H  HB3  . LEU A 1 71 ? 21.583  8.922   -0.595  1.00 0.00 ? 71  LEU A HB3  8  
ATOM   9178  H  HG   . LEU A 1 71 ? 20.454  10.894  0.818   1.00 0.00 ? 71  LEU A HG   8  
ATOM   9179  H  HD11 . LEU A 1 71 ? 19.215  8.449   1.781   1.00 0.00 ? 71  LEU A HD11 8  
ATOM   9180  H  HD12 . LEU A 1 71 ? 18.798  10.132  2.097   1.00 0.00 ? 71  LEU A HD12 8  
ATOM   9181  H  HD13 . LEU A 1 71 ? 20.048  9.340   3.054   1.00 0.00 ? 71  LEU A HD13 8  
ATOM   9182  H  HD21 . LEU A 1 71 ? 22.212  8.793   2.074   1.00 0.00 ? 71  LEU A HD21 8  
ATOM   9183  H  HD22 . LEU A 1 71 ? 22.124  10.506  2.486   1.00 0.00 ? 71  LEU A HD22 8  
ATOM   9184  H  HD23 . LEU A 1 71 ? 22.784  10.006  0.928   1.00 0.00 ? 71  LEU A HD23 8  
ATOM   9185  N  N    . PRO A 1 72 ? 21.310  9.893   -3.098  1.00 0.00 ? 72  PRO A N    8  
ATOM   9186  C  CA   . PRO A 1 72 ? 21.977  9.647   -4.380  1.00 0.00 ? 72  PRO A CA   8  
ATOM   9187  C  C    . PRO A 1 72 ? 22.755  8.336   -4.387  1.00 0.00 ? 72  PRO A C    8  
ATOM   9188  O  O    . PRO A 1 72 ? 23.262  7.898   -3.354  1.00 0.00 ? 72  PRO A O    8  
ATOM   9189  C  CB   . PRO A 1 72 ? 22.931  10.836  -4.518  1.00 0.00 ? 72  PRO A CB   8  
ATOM   9190  C  CG   . PRO A 1 72 ? 23.192  11.276  -3.118  1.00 0.00 ? 72  PRO A CG   8  
ATOM   9191  C  CD   . PRO A 1 72 ? 21.924  11.007  -2.356  1.00 0.00 ? 72  PRO A CD   8  
ATOM   9192  H  HA   . PRO A 1 72 ? 21.274  9.651   -5.200  1.00 0.00 ? 72  PRO A HA   8  
ATOM   9193  H  HB2  . PRO A 1 72 ? 23.839  10.517  -5.009  1.00 0.00 ? 72  PRO A HB2  8  
ATOM   9194  H  HB3  . PRO A 1 72 ? 22.458  11.617  -5.095  1.00 0.00 ? 72  PRO A HB3  8  
ATOM   9195  H  HG2  . PRO A 1 72 ? 24.009  10.707  -2.701  1.00 0.00 ? 72  PRO A HG2  8  
ATOM   9196  H  HG3  . PRO A 1 72 ? 23.422  12.331  -3.102  1.00 0.00 ? 72  PRO A HG3  8  
ATOM   9197  H  HD2  . PRO A 1 72 ? 22.149  10.716  -1.341  1.00 0.00 ? 72  PRO A HD2  8  
ATOM   9198  H  HD3  . PRO A 1 72 ? 21.284  11.877  -2.369  1.00 0.00 ? 72  PRO A HD3  8  
ATOM   9199  N  N    . VAL A 1 73 ? 22.847  7.714   -5.558  1.00 0.00 ? 73  VAL A N    8  
ATOM   9200  C  CA   . VAL A 1 73 ? 23.566  6.453   -5.699  1.00 0.00 ? 73  VAL A CA   8  
ATOM   9201  C  C    . VAL A 1 73 ? 24.978  6.681   -6.226  1.00 0.00 ? 73  VAL A C    8  
ATOM   9202  O  O    . VAL A 1 73 ? 25.564  5.805   -6.862  1.00 0.00 ? 73  VAL A O    8  
ATOM   9203  C  CB   . VAL A 1 73 ? 22.827  5.488   -6.645  1.00 0.00 ? 73  VAL A CB   8  
ATOM   9204  C  CG1  . VAL A 1 73 ? 22.906  5.983   -8.081  1.00 0.00 ? 73  VAL A CG1  8  
ATOM   9205  C  CG2  . VAL A 1 73 ? 23.397  4.083   -6.524  1.00 0.00 ? 73  VAL A CG2  8  
ATOM   9206  H  H    . VAL A 1 73 ? 22.422  8.112   -6.346  1.00 0.00 ? 73  VAL A H    8  
ATOM   9207  H  HA   . VAL A 1 73 ? 23.626  5.992   -4.724  1.00 0.00 ? 73  VAL A HA   8  
ATOM   9208  H  HB   . VAL A 1 73 ? 21.787  5.458   -6.354  1.00 0.00 ? 73  VAL A HB   8  
ATOM   9209  H  HG11 . VAL A 1 73 ? 23.803  6.570   -8.210  1.00 0.00 ? 73  VAL A HG11 8  
ATOM   9210  H  HG12 . VAL A 1 73 ? 22.927  5.138   -8.753  1.00 0.00 ? 73  VAL A HG12 8  
ATOM   9211  H  HG13 . VAL A 1 73 ? 22.042  6.595   -8.299  1.00 0.00 ? 73  VAL A HG13 8  
ATOM   9212  H  HG21 . VAL A 1 73 ? 22.758  3.490   -5.887  1.00 0.00 ? 73  VAL A HG21 8  
ATOM   9213  H  HG22 . VAL A 1 73 ? 23.449  3.630   -7.504  1.00 0.00 ? 73  VAL A HG22 8  
ATOM   9214  H  HG23 . VAL A 1 73 ? 24.388  4.131   -6.098  1.00 0.00 ? 73  VAL A HG23 8  
ATOM   9215  N  N    . SER A 1 74 ? 25.520  7.865   -5.957  1.00 0.00 ? 74  SER A N    8  
ATOM   9216  C  CA   . SER A 1 74 ? 26.863  8.211   -6.407  1.00 0.00 ? 74  SER A CA   8  
ATOM   9217  C  C    . SER A 1 74 ? 27.083  7.769   -7.851  1.00 0.00 ? 74  SER A C    8  
ATOM   9218  O  O    . SER A 1 74 ? 28.212  7.510   -8.268  1.00 0.00 ? 74  SER A O    8  
ATOM   9219  C  CB   . SER A 1 74 ? 27.911  7.565   -5.499  1.00 0.00 ? 74  SER A CB   8  
ATOM   9220  O  OG   . SER A 1 74 ? 28.114  8.335   -4.327  1.00 0.00 ? 74  SER A OG   8  
ATOM   9221  H  H    . SER A 1 74 ? 25.003  8.522   -5.446  1.00 0.00 ? 74  SER A H    8  
ATOM   9222  H  HA   . SER A 1 74 ? 26.965  9.285   -6.353  1.00 0.00 ? 74  SER A HA   8  
ATOM   9223  H  HB2  . SER A 1 74 ? 27.577  6.579   -5.213  1.00 0.00 ? 74  SER A HB2  8  
ATOM   9224  H  HB3  . SER A 1 74 ? 28.847  7.487   -6.032  1.00 0.00 ? 74  SER A HB3  8  
ATOM   9225  H  HG   . SER A 1 74 ? 28.999  8.708   -4.339  1.00 0.00 ? 74  SER A HG   8  
ATOM   9226  N  N    . VAL A 1 75 ? 25.995  7.684   -8.609  1.00 0.00 ? 75  VAL A N    8  
ATOM   9227  C  CA   . VAL A 1 75 ? 26.067  7.274   -10.007 1.00 0.00 ? 75  VAL A CA   8  
ATOM   9228  C  C    . VAL A 1 75 ? 25.294  8.236   -10.902 1.00 0.00 ? 75  VAL A C    8  
ATOM   9229  O  O    . VAL A 1 75 ? 24.104  8.045   -11.154 1.00 0.00 ? 75  VAL A O    8  
ATOM   9230  C  CB   . VAL A 1 75 ? 25.514  5.850   -10.203 1.00 0.00 ? 75  VAL A CB   8  
ATOM   9231  C  CG1  . VAL A 1 75 ? 25.644  5.422   -11.657 1.00 0.00 ? 75  VAL A CG1  8  
ATOM   9232  C  CG2  . VAL A 1 75 ? 26.228  4.870   -9.285  1.00 0.00 ? 75  VAL A CG2  8  
ATOM   9233  H  H    . VAL A 1 75 ? 25.123  7.903   -8.220  1.00 0.00 ? 75  VAL A H    8  
ATOM   9234  H  HA   . VAL A 1 75 ? 27.106  7.278   -10.303 1.00 0.00 ? 75  VAL A HA   8  
ATOM   9235  H  HB   . VAL A 1 75 ? 24.465  5.854   -9.945  1.00 0.00 ? 75  VAL A HB   8  
ATOM   9236  H  HG11 . VAL A 1 75 ? 26.669  5.149   -11.861 1.00 0.00 ? 75  VAL A HG11 8  
ATOM   9237  H  HG12 . VAL A 1 75 ? 25.001  4.574   -11.843 1.00 0.00 ? 75  VAL A HG12 8  
ATOM   9238  H  HG13 . VAL A 1 75 ? 25.356  6.241   -12.300 1.00 0.00 ? 75  VAL A HG13 8  
ATOM   9239  H  HG21 . VAL A 1 75 ? 25.519  4.448   -8.589  1.00 0.00 ? 75  VAL A HG21 8  
ATOM   9240  H  HG22 . VAL A 1 75 ? 26.669  4.079   -9.874  1.00 0.00 ? 75  VAL A HG22 8  
ATOM   9241  H  HG23 . VAL A 1 75 ? 27.004  5.387   -8.740  1.00 0.00 ? 75  VAL A HG23 8  
ATOM   9242  N  N    . SER A 1 76 ? 25.978  9.270   -11.381 1.00 0.00 ? 76  SER A N    8  
ATOM   9243  C  CA   . SER A 1 76 ? 25.355  10.264  -12.246 1.00 0.00 ? 76  SER A CA   8  
ATOM   9244  C  C    . SER A 1 76 ? 23.907  10.511  -11.835 1.00 0.00 ? 76  SER A C    8  
ATOM   9245  O  O    . SER A 1 76 ? 23.019  10.615  -12.680 1.00 0.00 ? 76  SER A O    8  
ATOM   9246  C  CB   . SER A 1 76 ? 25.412  9.808   -13.706 1.00 0.00 ? 76  SER A CB   8  
ATOM   9247  O  OG   . SER A 1 76 ? 24.619  8.652   -13.910 1.00 0.00 ? 76  SER A OG   8  
ATOM   9248  H  H    . SER A 1 76 ? 26.925  9.367   -11.144 1.00 0.00 ? 76  SER A H    8  
ATOM   9249  H  HA   . SER A 1 76 ? 25.909  11.186  -12.144 1.00 0.00 ? 76  SER A HA   8  
ATOM   9250  H  HB2  . SER A 1 76 ? 25.045  10.599  -14.342 1.00 0.00 ? 76  SER A HB2  8  
ATOM   9251  H  HB3  . SER A 1 76 ? 26.435  9.580   -13.969 1.00 0.00 ? 76  SER A HB3  8  
ATOM   9252  H  HG   . SER A 1 76 ? 24.935  7.943   -13.346 1.00 0.00 ? 76  SER A HG   8  
ATOM   9253  N  N    . GLY A 1 77 ? 23.677  10.605  -10.529 1.00 0.00 ? 77  GLY A N    8  
ATOM   9254  C  CA   . GLY A 1 77 ? 22.336  10.839  -10.026 1.00 0.00 ? 77  GLY A CA   8  
ATOM   9255  C  C    . GLY A 1 77 ? 21.396  9.687   -10.324 1.00 0.00 ? 77  GLY A C    8  
ATOM   9256  O  O    . GLY A 1 77 ? 21.377  9.143   -11.428 1.00 0.00 ? 77  GLY A O    8  
ATOM   9257  H  H    . GLY A 1 77 ? 24.424  10.514  -9.901  1.00 0.00 ? 77  GLY A H    8  
ATOM   9258  H  HA2  . GLY A 1 77 ? 22.383  10.984  -8.958  1.00 0.00 ? 77  GLY A HA2  8  
ATOM   9259  H  HA3  . GLY A 1 77 ? 21.944  11.735  -10.484 1.00 0.00 ? 77  GLY A HA3  8  
ATOM   9260  N  N    . PRO A 1 78 ? 20.594  9.298   -9.322  1.00 0.00 ? 78  PRO A N    8  
ATOM   9261  C  CA   . PRO A 1 78 ? 19.634  8.199   -9.457  1.00 0.00 ? 78  PRO A CA   8  
ATOM   9262  C  C    . PRO A 1 78 ? 18.472  8.554   -10.379 1.00 0.00 ? 78  PRO A C    8  
ATOM   9263  O  O    . PRO A 1 78 ? 18.100  7.773   -11.254 1.00 0.00 ? 78  PRO A O    8  
ATOM   9264  C  CB   . PRO A 1 78 ? 19.135  7.985   -8.026  1.00 0.00 ? 78  PRO A CB   8  
ATOM   9265  C  CG   . PRO A 1 78 ? 19.335  9.300   -7.355  1.00 0.00 ? 78  PRO A CG   8  
ATOM   9266  C  CD   . PRO A 1 78 ? 20.564  9.901   -7.979  1.00 0.00 ? 78  PRO A CD   8  
ATOM   9267  H  HA   . PRO A 1 78 ? 20.111  7.297   -9.812  1.00 0.00 ? 78  PRO A HA   8  
ATOM   9268  H  HB2  . PRO A 1 78 ? 18.092  7.704   -8.044  1.00 0.00 ? 78  PRO A HB2  8  
ATOM   9269  H  HB3  . PRO A 1 78 ? 19.715  7.208   -7.551  1.00 0.00 ? 78  PRO A HB3  8  
ATOM   9270  H  HG2  . PRO A 1 78 ? 18.478  9.934   -7.528  1.00 0.00 ? 78  PRO A HG2  8  
ATOM   9271  H  HG3  . PRO A 1 78 ? 19.486  9.152   -6.296  1.00 0.00 ? 78  PRO A HG3  8  
ATOM   9272  H  HD2  . PRO A 1 78 ? 20.469  10.975  -8.041  1.00 0.00 ? 78  PRO A HD2  8  
ATOM   9273  H  HD3  . PRO A 1 78 ? 21.444  9.630   -7.415  1.00 0.00 ? 78  PRO A HD3  8  
ATOM   9274  N  N    . SER A 1 79 ? 17.903  9.738   -10.176 1.00 0.00 ? 79  SER A N    8  
ATOM   9275  C  CA   . SER A 1 79 ? 16.781  10.196  -10.987 1.00 0.00 ? 79  SER A CA   8  
ATOM   9276  C  C    . SER A 1 79 ? 17.260  11.112  -12.109 1.00 0.00 ? 79  SER A C    8  
ATOM   9277  O  O    . SER A 1 79 ? 17.002  12.316  -12.095 1.00 0.00 ? 79  SER A O    8  
ATOM   9278  C  CB   . SER A 1 79 ? 15.760  10.929  -10.115 1.00 0.00 ? 79  SER A CB   8  
ATOM   9279  O  OG   . SER A 1 79 ? 14.536  11.109  -10.806 1.00 0.00 ? 79  SER A OG   8  
ATOM   9280  H  H    . SER A 1 79 ? 18.245  10.317  -9.462  1.00 0.00 ? 79  SER A H    8  
ATOM   9281  H  HA   . SER A 1 79 ? 16.312  9.327   -11.423 1.00 0.00 ? 79  SER A HA   8  
ATOM   9282  H  HB2  . SER A 1 79 ? 15.574  10.352  -9.222  1.00 0.00 ? 79  SER A HB2  8  
ATOM   9283  H  HB3  . SER A 1 79 ? 16.152  11.898  -9.843  1.00 0.00 ? 79  SER A HB3  8  
ATOM   9284  H  HG   . SER A 1 79 ? 14.031  10.293  -10.781 1.00 0.00 ? 79  SER A HG   8  
ATOM   9285  N  N    . SER A 1 80 ? 17.958  10.533  -13.080 1.00 0.00 ? 80  SER A N    8  
ATOM   9286  C  CA   . SER A 1 80 ? 18.477  11.297  -14.209 1.00 0.00 ? 80  SER A CA   8  
ATOM   9287  C  C    . SER A 1 80 ? 17.606  11.098  -15.446 1.00 0.00 ? 80  SER A C    8  
ATOM   9288  O  O    . SER A 1 80 ? 17.090  12.058  -16.017 1.00 0.00 ? 80  SER A O    8  
ATOM   9289  C  CB   . SER A 1 80 ? 19.917  10.882  -14.514 1.00 0.00 ? 80  SER A CB   8  
ATOM   9290  O  OG   . SER A 1 80 ? 20.837  11.611  -13.720 1.00 0.00 ? 80  SER A OG   8  
ATOM   9291  H  H    . SER A 1 80 ? 18.131  9.569   -13.035 1.00 0.00 ? 80  SER A H    8  
ATOM   9292  H  HA   . SER A 1 80 ? 18.462  12.342  -13.937 1.00 0.00 ? 80  SER A HA   8  
ATOM   9293  H  HB2  . SER A 1 80 ? 20.038  9.829   -14.308 1.00 0.00 ? 80  SER A HB2  8  
ATOM   9294  H  HB3  . SER A 1 80 ? 20.131  11.071  -15.556 1.00 0.00 ? 80  SER A HB3  8  
ATOM   9295  H  HG   . SER A 1 80 ? 21.387  12.157  -14.286 1.00 0.00 ? 80  SER A HG   8  
ATOM   9296  N  N    . GLY A 1 81 ? 17.446  9.843   -15.854 1.00 0.00 ? 81  GLY A N    8  
ATOM   9297  C  CA   . GLY A 1 81 ? 16.638  9.539   -17.021 1.00 0.00 ? 81  GLY A CA   8  
ATOM   9298  C  C    . GLY A 1 81 ? 17.471  9.370   -18.276 1.00 0.00 ? 81  GLY A C    8  
ATOM   9299  O  O    . GLY A 1 81 ? 17.913  8.256   -18.555 1.00 0.00 ? 81  GLY A O    8  
ATOM   9300  H  H    . GLY A 1 81 ? 17.881  9.117   -15.360 1.00 0.00 ? 81  GLY A H    8  
ATOM   9301  H  HA2  . GLY A 1 81 ? 16.090  8.627   -16.838 1.00 0.00 ? 81  GLY A HA2  8  
ATOM   9302  H  HA3  . GLY A 1 81 ? 15.934  10.344  -17.176 1.00 0.00 ? 81  GLY A HA3  8  
HETATM 9303  ZN ZN   . ZN  B 2 .  ? -2.797  -2.695  -4.271  1.00 0.00 ? 201 ZN  A ZN   8  
HETATM 9304  ZN ZN   . ZN  C 2 .  ? 13.505  2.538   -3.716  1.00 0.00 ? 401 ZN  A ZN   8  
ATOM   9305  N  N    . GLY A 1 1  ? -24.346 -24.572 -6.425  1.00 0.00 ? 1   GLY A N    9  
ATOM   9306  C  CA   . GLY A 1 1  ? -25.239 -24.896 -7.522  1.00 0.00 ? 1   GLY A CA   9  
ATOM   9307  C  C    . GLY A 1 1  ? -25.134 -23.907 -8.666  1.00 0.00 ? 1   GLY A C    9  
ATOM   9308  O  O    . GLY A 1 1  ? -24.043 -23.443 -8.997  1.00 0.00 ? 1   GLY A O    9  
ATOM   9309  H  H1   . GLY A 1 1  ? -23.938 -23.682 -6.374  1.00 0.00 ? 1   GLY A H1   9  
ATOM   9310  H  HA2  . GLY A 1 1  ? -24.998 -25.882 -7.889  1.00 0.00 ? 1   GLY A HA2  9  
ATOM   9311  H  HA3  . GLY A 1 1  ? -26.255 -24.898 -7.156  1.00 0.00 ? 1   GLY A HA3  9  
ATOM   9312  N  N    . SER A 1 2  ? -26.271 -23.585 -9.274  1.00 0.00 ? 2   SER A N    9  
ATOM   9313  C  CA   . SER A 1 2  ? -26.302 -22.649 -10.392 1.00 0.00 ? 2   SER A CA   9  
ATOM   9314  C  C    . SER A 1 2  ? -26.096 -21.217 -9.908  1.00 0.00 ? 2   SER A C    9  
ATOM   9315  O  O    . SER A 1 2  ? -27.043 -20.546 -9.498  1.00 0.00 ? 2   SER A O    9  
ATOM   9316  C  CB   . SER A 1 2  ? -27.631 -22.760 -11.141 1.00 0.00 ? 2   SER A CB   9  
ATOM   9317  O  OG   . SER A 1 2  ? -27.622 -23.858 -12.037 1.00 0.00 ? 2   SER A OG   9  
ATOM   9318  H  H    . SER A 1 2  ? -27.109 -23.988 -8.965  1.00 0.00 ? 2   SER A H    9  
ATOM   9319  H  HA   . SER A 1 2  ? -25.497 -22.909 -11.064 1.00 0.00 ? 2   SER A HA   9  
ATOM   9320  H  HB2  . SER A 1 2  ? -28.432 -22.897 -10.431 1.00 0.00 ? 2   SER A HB2  9  
ATOM   9321  H  HB3  . SER A 1 2  ? -27.801 -21.853 -11.704 1.00 0.00 ? 2   SER A HB3  9  
ATOM   9322  H  HG   . SER A 1 2  ? -27.009 -24.525 -11.720 1.00 0.00 ? 2   SER A HG   9  
ATOM   9323  N  N    . SER A 1 3  ? -24.850 -20.755 -9.958  1.00 0.00 ? 3   SER A N    9  
ATOM   9324  C  CA   . SER A 1 3  ? -24.518 -19.405 -9.521  1.00 0.00 ? 3   SER A CA   9  
ATOM   9325  C  C    . SER A 1 3  ? -25.205 -18.364 -10.400 1.00 0.00 ? 3   SER A C    9  
ATOM   9326  O  O    . SER A 1 3  ? -25.799 -18.696 -11.425 1.00 0.00 ? 3   SER A O    9  
ATOM   9327  C  CB   . SER A 1 3  ? -23.002 -19.195 -9.552  1.00 0.00 ? 3   SER A CB   9  
ATOM   9328  O  OG   . SER A 1 3  ? -22.347 -20.077 -8.658  1.00 0.00 ? 3   SER A OG   9  
ATOM   9329  H  H    . SER A 1 3  ? -24.138 -21.338 -10.295 1.00 0.00 ? 3   SER A H    9  
ATOM   9330  H  HA   . SER A 1 3  ? -24.868 -19.289 -8.506  1.00 0.00 ? 3   SER A HA   9  
ATOM   9331  H  HB2  . SER A 1 3  ? -22.637 -19.376 -10.551 1.00 0.00 ? 3   SER A HB2  9  
ATOM   9332  H  HB3  . SER A 1 3  ? -22.777 -18.177 -9.265  1.00 0.00 ? 3   SER A HB3  9  
ATOM   9333  H  HG   . SER A 1 3  ? -23.001 -20.565 -8.153  1.00 0.00 ? 3   SER A HG   9  
ATOM   9334  N  N    . GLY A 1 4  ? -25.119 -17.102 -9.991  1.00 0.00 ? 4   GLY A N    9  
ATOM   9335  C  CA   . GLY A 1 4  ? -25.736 -16.032 -10.752 1.00 0.00 ? 4   GLY A CA   9  
ATOM   9336  C  C    . GLY A 1 4  ? -24.876 -14.785 -10.801 1.00 0.00 ? 4   GLY A C    9  
ATOM   9337  O  O    . GLY A 1 4  ? -23.777 -14.758 -10.248 1.00 0.00 ? 4   GLY A O    9  
ATOM   9338  H  H    . GLY A 1 4  ? -24.632 -16.896 -9.165  1.00 0.00 ? 4   GLY A H    9  
ATOM   9339  H  HA2  . GLY A 1 4  ? -25.911 -16.376 -11.760 1.00 0.00 ? 4   GLY A HA2  9  
ATOM   9340  H  HA3  . GLY A 1 4  ? -26.684 -15.783 -10.297 1.00 0.00 ? 4   GLY A HA3  9  
ATOM   9341  N  N    . SER A 1 5  ? -25.376 -13.749 -11.467 1.00 0.00 ? 5   SER A N    9  
ATOM   9342  C  CA   . SER A 1 5  ? -24.643 -12.494 -11.592 1.00 0.00 ? 5   SER A CA   9  
ATOM   9343  C  C    . SER A 1 5  ? -25.349 -11.375 -10.833 1.00 0.00 ? 5   SER A C    9  
ATOM   9344  O  O    . SER A 1 5  ? -25.409 -10.236 -11.298 1.00 0.00 ? 5   SER A O    9  
ATOM   9345  C  CB   . SER A 1 5  ? -24.492 -12.111 -13.065 1.00 0.00 ? 5   SER A CB   9  
ATOM   9346  O  OG   . SER A 1 5  ? -23.598 -12.987 -13.730 1.00 0.00 ? 5   SER A OG   9  
ATOM   9347  H  H    . SER A 1 5  ? -26.258 -13.831 -11.887 1.00 0.00 ? 5   SER A H    9  
ATOM   9348  H  HA   . SER A 1 5  ? -23.662 -12.639 -11.164 1.00 0.00 ? 5   SER A HA   9  
ATOM   9349  H  HB2  . SER A 1 5  ? -25.455 -12.164 -13.549 1.00 0.00 ? 5   SER A HB2  9  
ATOM   9350  H  HB3  . SER A 1 5  ? -24.108 -11.104 -13.135 1.00 0.00 ? 5   SER A HB3  9  
ATOM   9351  H  HG   . SER A 1 5  ? -23.832 -13.038 -14.660 1.00 0.00 ? 5   SER A HG   9  
ATOM   9352  N  N    . SER A 1 6  ? -25.884 -11.707 -9.663  1.00 0.00 ? 6   SER A N    9  
ATOM   9353  C  CA   . SER A 1 6  ? -26.591 -10.732 -8.841  1.00 0.00 ? 6   SER A CA   9  
ATOM   9354  C  C    . SER A 1 6  ? -26.636 -11.181 -7.384  1.00 0.00 ? 6   SER A C    9  
ATOM   9355  O  O    . SER A 1 6  ? -26.447 -12.358 -7.079  1.00 0.00 ? 6   SER A O    9  
ATOM   9356  C  CB   . SER A 1 6  ? -28.012 -10.524 -9.367  1.00 0.00 ? 6   SER A CB   9  
ATOM   9357  O  OG   . SER A 1 6  ? -28.817 -11.664 -9.125  1.00 0.00 ? 6   SER A OG   9  
ATOM   9358  H  H    . SER A 1 6  ? -25.804 -12.631 -9.346  1.00 0.00 ? 6   SER A H    9  
ATOM   9359  H  HA   . SER A 1 6  ? -26.054 -9.797  -8.900  1.00 0.00 ? 6   SER A HA   9  
ATOM   9360  H  HB2  . SER A 1 6  ? -28.456 -9.673  -8.872  1.00 0.00 ? 6   SER A HB2  9  
ATOM   9361  H  HB3  . SER A 1 6  ? -27.976 -10.342 -10.431 1.00 0.00 ? 6   SER A HB3  9  
ATOM   9362  H  HG   . SER A 1 6  ? -29.540 -11.686 -9.758  1.00 0.00 ? 6   SER A HG   9  
ATOM   9363  N  N    . GLY A 1 7  ? -26.890 -10.233 -6.486  1.00 0.00 ? 7   GLY A N    9  
ATOM   9364  C  CA   . GLY A 1 7  ? -26.956 -10.550 -5.071  1.00 0.00 ? 7   GLY A CA   9  
ATOM   9365  C  C    . GLY A 1 7  ? -25.648 -10.279 -4.355  1.00 0.00 ? 7   GLY A C    9  
ATOM   9366  O  O    . GLY A 1 7  ? -24.986 -11.206 -3.884  1.00 0.00 ? 7   GLY A O    9  
ATOM   9367  H  H    . GLY A 1 7  ? -27.033 -9.311  -6.787  1.00 0.00 ? 7   GLY A H    9  
ATOM   9368  H  HA2  . GLY A 1 7  ? -27.733 -9.954  -4.616  1.00 0.00 ? 7   GLY A HA2  9  
ATOM   9369  H  HA3  . GLY A 1 7  ? -27.205 -11.595 -4.959  1.00 0.00 ? 7   GLY A HA3  9  
ATOM   9370  N  N    . LEU A 1 8  ? -25.271 -9.008  -4.273  1.00 0.00 ? 8   LEU A N    9  
ATOM   9371  C  CA   . LEU A 1 8  ? -24.032 -8.618  -3.610  1.00 0.00 ? 8   LEU A CA   9  
ATOM   9372  C  C    . LEU A 1 8  ? -24.310 -7.660  -2.456  1.00 0.00 ? 8   LEU A C    9  
ATOM   9373  O  O    . LEU A 1 8  ? -24.155 -6.447  -2.593  1.00 0.00 ? 8   LEU A O    9  
ATOM   9374  C  CB   . LEU A 1 8  ? -23.078 -7.964  -4.612  1.00 0.00 ? 8   LEU A CB   9  
ATOM   9375  C  CG   . LEU A 1 8  ? -22.749 -8.786  -5.859  1.00 0.00 ? 8   LEU A CG   9  
ATOM   9376  C  CD1  . LEU A 1 8  ? -22.306 -7.877  -6.995  1.00 0.00 ? 8   LEU A CD1  9  
ATOM   9377  C  CD2  . LEU A 1 8  ? -21.674 -9.817  -5.549  1.00 0.00 ? 8   LEU A CD2  9  
ATOM   9378  H  H    . LEU A 1 8  ? -25.840 -8.314  -4.667  1.00 0.00 ? 8   LEU A H    9  
ATOM   9379  H  HA   . LEU A 1 8  ? -23.571 -9.512  -3.218  1.00 0.00 ? 8   LEU A HA   9  
ATOM   9380  H  HB2  . LEU A 1 8  ? -23.525 -7.037  -4.936  1.00 0.00 ? 8   LEU A HB2  9  
ATOM   9381  H  HB3  . LEU A 1 8  ? -22.151 -7.756  -4.097  1.00 0.00 ? 8   LEU A HB3  9  
ATOM   9382  H  HG   . LEU A 1 8  ? -23.637 -9.313  -6.181  1.00 0.00 ? 8   LEU A HG   9  
ATOM   9383  H  HD11 . LEU A 1 8  ? -21.747 -7.045  -6.594  1.00 0.00 ? 8   LEU A HD11 9  
ATOM   9384  H  HD12 . LEU A 1 8  ? -23.174 -7.507  -7.520  1.00 0.00 ? 8   LEU A HD12 9  
ATOM   9385  H  HD13 . LEU A 1 8  ? -21.683 -8.434  -7.679  1.00 0.00 ? 8   LEU A HD13 9  
ATOM   9386  H  HD21 . LEU A 1 8  ? -21.182 -9.557  -4.623  1.00 0.00 ? 8   LEU A HD21 9  
ATOM   9387  H  HD22 . LEU A 1 8  ? -20.949 -9.833  -6.350  1.00 0.00 ? 8   LEU A HD22 9  
ATOM   9388  H  HD23 . LEU A 1 8  ? -22.128 -10.793 -5.455  1.00 0.00 ? 8   LEU A HD23 9  
ATOM   9389  N  N    . ASP A 1 9  ? -24.718 -8.214  -1.320  1.00 0.00 ? 9   ASP A N    9  
ATOM   9390  C  CA   . ASP A 1 9  ? -25.014 -7.410  -0.140  1.00 0.00 ? 9   ASP A CA   9  
ATOM   9391  C  C    . ASP A 1 9  ? -23.827 -7.394  0.819   1.00 0.00 ? 9   ASP A C    9  
ATOM   9392  O  O    . ASP A 1 9  ? -23.294 -6.333  1.145   1.00 0.00 ? 9   ASP A O    9  
ATOM   9393  C  CB   . ASP A 1 9  ? -26.254 -7.950  0.573   1.00 0.00 ? 9   ASP A CB   9  
ATOM   9394  C  CG   . ASP A 1 9  ? -27.509 -7.818  -0.268  1.00 0.00 ? 9   ASP A CG   9  
ATOM   9395  O  OD1  . ASP A 1 9  ? -27.537 -6.944  -1.160  1.00 0.00 ? 9   ASP A OD1  9  
ATOM   9396  O  OD2  . ASP A 1 9  ? -28.463 -8.589  -0.034  1.00 0.00 ? 9   ASP A OD2  9  
ATOM   9397  H  H    . ASP A 1 9  ? -24.822 -9.188  -1.273  1.00 0.00 ? 9   ASP A H    9  
ATOM   9398  H  HA   . ASP A 1 9  ? -25.209 -6.400  -0.468  1.00 0.00 ? 9   ASP A HA   9  
ATOM   9399  H  HB2  . ASP A 1 9  ? -26.104 -8.995  0.801   1.00 0.00 ? 9   ASP A HB2  9  
ATOM   9400  H  HB3  . ASP A 1 9  ? -26.399 -7.402  1.493   1.00 0.00 ? 9   ASP A HB3  9  
ATOM   9401  N  N    . TYR A 1 10 ? -23.420 -8.576  1.267   1.00 0.00 ? 10  TYR A N    9  
ATOM   9402  C  CA   . TYR A 1 10 ? -22.299 -8.698  2.191   1.00 0.00 ? 10  TYR A CA   9  
ATOM   9403  C  C    . TYR A 1 10 ? -21.263 -7.606  1.939   1.00 0.00 ? 10  TYR A C    9  
ATOM   9404  O  O    . TYR A 1 10 ? -20.886 -6.871  2.851   1.00 0.00 ? 10  TYR A O    9  
ATOM   9405  C  CB   . TYR A 1 10 ? -21.647 -10.075 2.057   1.00 0.00 ? 10  TYR A CB   9  
ATOM   9406  C  CG   . TYR A 1 10 ? -21.010 -10.314 0.707   1.00 0.00 ? 10  TYR A CG   9  
ATOM   9407  C  CD1  . TYR A 1 10 ? -21.754 -10.217 -0.462  1.00 0.00 ? 10  TYR A CD1  9  
ATOM   9408  C  CD2  . TYR A 1 10 ? -19.662 -10.636 0.600   1.00 0.00 ? 10  TYR A CD2  9  
ATOM   9409  C  CE1  . TYR A 1 10 ? -21.176 -10.435 -1.698  1.00 0.00 ? 10  TYR A CE1  9  
ATOM   9410  C  CE2  . TYR A 1 10 ? -19.075 -10.855 -0.632  1.00 0.00 ? 10  TYR A CE2  9  
ATOM   9411  C  CZ   . TYR A 1 10 ? -19.836 -10.754 -1.777  1.00 0.00 ? 10  TYR A CZ   9  
ATOM   9412  O  OH   . TYR A 1 10 ? -19.256 -10.970 -3.006  1.00 0.00 ? 10  TYR A OH   9  
ATOM   9413  H  H    . TYR A 1 10 ? -23.885 -9.386  0.971   1.00 0.00 ? 10  TYR A H    9  
ATOM   9414  H  HA   . TYR A 1 10 ? -22.683 -8.589  3.195   1.00 0.00 ? 10  TYR A HA   9  
ATOM   9415  H  HB2  . TYR A 1 10 ? -20.879 -10.178 2.808   1.00 0.00 ? 10  TYR A HB2  9  
ATOM   9416  H  HB3  . TYR A 1 10 ? -22.397 -10.837 2.209   1.00 0.00 ? 10  TYR A HB3  9  
ATOM   9417  H  HD1  . TYR A 1 10 ? -22.803 -9.967  -0.396  1.00 0.00 ? 10  TYR A HD1  9  
ATOM   9418  H  HD2  . TYR A 1 10 ? -19.068 -10.715 1.499   1.00 0.00 ? 10  TYR A HD2  9  
ATOM   9419  H  HE1  . TYR A 1 10 ? -21.772 -10.356 -2.595  1.00 0.00 ? 10  TYR A HE1  9  
ATOM   9420  H  HE2  . TYR A 1 10 ? -18.026 -11.104 -0.694  1.00 0.00 ? 10  TYR A HE2  9  
ATOM   9421  H  HH   . TYR A 1 10 ? -19.843 -11.504 -3.547  1.00 0.00 ? 10  TYR A HH   9  
ATOM   9422  N  N    . GLN A 1 11 ? -20.809 -7.507  0.694   1.00 0.00 ? 11  GLN A N    9  
ATOM   9423  C  CA   . GLN A 1 11 ? -19.817 -6.506  0.320   1.00 0.00 ? 11  GLN A CA   9  
ATOM   9424  C  C    . GLN A 1 11 ? -20.072 -5.190  1.048   1.00 0.00 ? 11  GLN A C    9  
ATOM   9425  O  O    . GLN A 1 11 ? -19.150 -4.583  1.594   1.00 0.00 ? 11  GLN A O    9  
ATOM   9426  C  CB   . GLN A 1 11 ? -19.836 -6.278  -1.192  1.00 0.00 ? 11  GLN A CB   9  
ATOM   9427  C  CG   . GLN A 1 11 ? -19.605 -7.543  -2.001  1.00 0.00 ? 11  GLN A CG   9  
ATOM   9428  C  CD   . GLN A 1 11 ? -18.138 -7.790  -2.292  1.00 0.00 ? 11  GLN A CD   9  
ATOM   9429  O  OE1  . GLN A 1 11 ? -17.300 -7.755  -1.391  1.00 0.00 ? 11  GLN A OE1  9  
ATOM   9430  N  NE2  . GLN A 1 11 ? -17.818 -8.042  -3.556  1.00 0.00 ? 11  GLN A NE2  9  
ATOM   9431  H  H    . GLN A 1 11 ? -21.148 -8.122  0.011   1.00 0.00 ? 11  GLN A H    9  
ATOM   9432  H  HA   . GLN A 1 11 ? -18.846 -6.879  0.606   1.00 0.00 ? 11  GLN A HA   9  
ATOM   9433  H  HB2  . GLN A 1 11 ? -20.796 -5.868  -1.470  1.00 0.00 ? 11  GLN A HB2  9  
ATOM   9434  H  HB3  . GLN A 1 11 ? -19.064 -5.567  -1.447  1.00 0.00 ? 11  GLN A HB3  9  
ATOM   9435  H  HG2  . GLN A 1 11 ? -19.992 -8.386  -1.447  1.00 0.00 ? 11  GLN A HG2  9  
ATOM   9436  H  HG3  . GLN A 1 11 ? -20.133 -7.457  -2.939  1.00 0.00 ? 11  GLN A HG3  9  
ATOM   9437  H  HE21 . GLN A 1 11 ? -18.539 -8.052  -4.222  1.00 0.00 ? 11  GLN A HE21 9  
ATOM   9438  H  HE22 . GLN A 1 11 ? -16.877 -8.204  -3.773  1.00 0.00 ? 11  GLN A HE22 9  
ATOM   9439  N  N    . ARG A 1 12 ? -21.327 -4.755  1.052   1.00 0.00 ? 12  ARG A N    9  
ATOM   9440  C  CA   . ARG A 1 12 ? -21.703 -3.510  1.712   1.00 0.00 ? 12  ARG A CA   9  
ATOM   9441  C  C    . ARG A 1 12 ? -20.807 -3.242  2.918   1.00 0.00 ? 12  ARG A C    9  
ATOM   9442  O  O    . ARG A 1 12 ? -20.432 -2.100  3.185   1.00 0.00 ? 12  ARG A O    9  
ATOM   9443  C  CB   . ARG A 1 12 ? -23.167 -3.562  2.152   1.00 0.00 ? 12  ARG A CB   9  
ATOM   9444  C  CG   . ARG A 1 12 ? -24.143 -3.121  1.073   1.00 0.00 ? 12  ARG A CG   9  
ATOM   9445  C  CD   . ARG A 1 12 ? -24.347 -1.614  1.090   1.00 0.00 ? 12  ARG A CD   9  
ATOM   9446  N  NE   . ARG A 1 12 ? -24.870 -1.146  2.371   1.00 0.00 ? 12  ARG A NE   9  
ATOM   9447  C  CZ   . ARG A 1 12 ? -25.283 0.098   2.585   1.00 0.00 ? 12  ARG A CZ   9  
ATOM   9448  N  NH1  . ARG A 1 12 ? -25.235 0.994   1.609   1.00 0.00 ? 12  ARG A NH1  9  
ATOM   9449  N  NH2  . ARG A 1 12 ? -25.746 0.448   3.779   1.00 0.00 ? 12  ARG A NH2  9  
ATOM   9450  H  H    . ARG A 1 12 ? -22.018 -5.283  0.600   1.00 0.00 ? 12  ARG A H    9  
ATOM   9451  H  HA   . ARG A 1 12 ? -21.578 -2.707  1.001   1.00 0.00 ? 12  ARG A HA   9  
ATOM   9452  H  HB2  . ARG A 1 12 ? -23.410 -4.576  2.433   1.00 0.00 ? 12  ARG A HB2  9  
ATOM   9453  H  HB3  . ARG A 1 12 ? -23.295 -2.918  3.009   1.00 0.00 ? 12  ARG A HB3  9  
ATOM   9454  H  HG2  . ARG A 1 12 ? -23.753 -3.409  0.108   1.00 0.00 ? 12  ARG A HG2  9  
ATOM   9455  H  HG3  . ARG A 1 12 ? -25.093 -3.606  1.241   1.00 0.00 ? 12  ARG A HG3  9  
ATOM   9456  H  HD2  . ARG A 1 12 ? -23.398 -1.133  0.902   1.00 0.00 ? 12  ARG A HD2  9  
ATOM   9457  H  HD3  . ARG A 1 12 ? -25.044 -1.350  0.309   1.00 0.00 ? 12  ARG A HD3  9  
ATOM   9458  H  HE   . ARG A 1 12 ? -24.914 -1.792  3.106   1.00 0.00 ? 12  ARG A HE   9  
ATOM   9459  H  HH11 . ARG A 1 12 ? -24.887 0.733   0.709   1.00 0.00 ? 12  ARG A HH11 9  
ATOM   9460  H  HH12 . ARG A 1 12 ? -25.548 1.930   1.774   1.00 0.00 ? 12  ARG A HH12 9  
ATOM   9461  H  HH21 . ARG A 1 12 ? -25.784 -0.225  4.517   1.00 0.00 ? 12  ARG A HH21 9  
ATOM   9462  H  HH22 . ARG A 1 12 ? -26.057 1.384   3.939   1.00 0.00 ? 12  ARG A HH22 9  
ATOM   9463  N  N    . LEU A 1 13 ? -20.468 -4.303  3.643   1.00 0.00 ? 13  LEU A N    9  
ATOM   9464  C  CA   . LEU A 1 13 ? -19.617 -4.183  4.822   1.00 0.00 ? 13  LEU A CA   9  
ATOM   9465  C  C    . LEU A 1 13 ? -18.496 -3.176  4.584   1.00 0.00 ? 13  LEU A C    9  
ATOM   9466  O  O    . LEU A 1 13 ? -18.168 -2.855  3.442   1.00 0.00 ? 13  LEU A O    9  
ATOM   9467  C  CB   . LEU A 1 13 ? -19.025 -5.545  5.188   1.00 0.00 ? 13  LEU A CB   9  
ATOM   9468  C  CG   . LEU A 1 13 ? -18.395 -6.334  4.039   1.00 0.00 ? 13  LEU A CG   9  
ATOM   9469  C  CD1  . LEU A 1 13 ? -16.922 -5.983  3.896   1.00 0.00 ? 13  LEU A CD1  9  
ATOM   9470  C  CD2  . LEU A 1 13 ? -18.570 -7.829  4.260   1.00 0.00 ? 13  LEU A CD2  9  
ATOM   9471  H  H    . LEU A 1 13 ? -20.798 -5.187  3.381   1.00 0.00 ? 13  LEU A H    9  
ATOM   9472  H  HA   . LEU A 1 13 ? -20.230 -3.834  5.639   1.00 0.00 ? 13  LEU A HA   9  
ATOM   9473  H  HB2  . LEU A 1 13 ? -18.263 -5.384  5.935   1.00 0.00 ? 13  LEU A HB2  9  
ATOM   9474  H  HB3  . LEU A 1 13 ? -19.818 -6.147  5.609   1.00 0.00 ? 13  LEU A HB3  9  
ATOM   9475  H  HG   . LEU A 1 13 ? -18.892 -6.071  3.115   1.00 0.00 ? 13  LEU A HG   9  
ATOM   9476  H  HD11 . LEU A 1 13 ? -16.349 -6.888  3.758   1.00 0.00 ? 13  LEU A HD11 9  
ATOM   9477  H  HD12 . LEU A 1 13 ? -16.585 -5.475  4.787   1.00 0.00 ? 13  LEU A HD12 9  
ATOM   9478  H  HD13 . LEU A 1 13 ? -16.788 -5.337  3.040   1.00 0.00 ? 13  LEU A HD13 9  
ATOM   9479  H  HD21 . LEU A 1 13 ? -17.773 -8.195  4.890   1.00 0.00 ? 13  LEU A HD21 9  
ATOM   9480  H  HD22 . LEU A 1 13 ? -18.540 -8.339  3.308   1.00 0.00 ? 13  LEU A HD22 9  
ATOM   9481  H  HD23 . LEU A 1 13 ? -19.521 -8.013  4.738   1.00 0.00 ? 13  LEU A HD23 9  
ATOM   9482  N  N    . TYR A 1 14 ? -17.911 -2.682  5.670   1.00 0.00 ? 14  TYR A N    9  
ATOM   9483  C  CA   . TYR A 1 14 ? -16.827 -1.712  5.580   1.00 0.00 ? 14  TYR A CA   9  
ATOM   9484  C  C    . TYR A 1 14 ? -15.967 -1.969  4.346   1.00 0.00 ? 14  TYR A C    9  
ATOM   9485  O  O    . TYR A 1 14 ? -15.781 -1.086  3.510   1.00 0.00 ? 14  TYR A O    9  
ATOM   9486  C  CB   . TYR A 1 14 ? -15.961 -1.764  6.840   1.00 0.00 ? 14  TYR A CB   9  
ATOM   9487  C  CG   . TYR A 1 14 ? -15.344 -3.121  7.094   1.00 0.00 ? 14  TYR A CG   9  
ATOM   9488  C  CD1  . TYR A 1 14 ? -16.110 -4.175  7.576   1.00 0.00 ? 14  TYR A CD1  9  
ATOM   9489  C  CD2  . TYR A 1 14 ? -13.995 -3.349  6.852   1.00 0.00 ? 14  TYR A CD2  9  
ATOM   9490  C  CE1  . TYR A 1 14 ? -15.550 -5.416  7.811   1.00 0.00 ? 14  TYR A CE1  9  
ATOM   9491  C  CE2  . TYR A 1 14 ? -13.427 -4.587  7.082   1.00 0.00 ? 14  TYR A CE2  9  
ATOM   9492  C  CZ   . TYR A 1 14 ? -14.209 -5.617  7.562   1.00 0.00 ? 14  TYR A CZ   9  
ATOM   9493  O  OH   . TYR A 1 14 ? -13.646 -6.852  7.793   1.00 0.00 ? 14  TYR A OH   9  
ATOM   9494  H  H    . TYR A 1 14 ? -18.217 -2.977  6.553   1.00 0.00 ? 14  TYR A H    9  
ATOM   9495  H  HA   . TYR A 1 14 ? -17.268 -0.729  5.499   1.00 0.00 ? 14  TYR A HA   9  
ATOM   9496  H  HB2  . TYR A 1 14 ? -15.160 -1.048  6.747   1.00 0.00 ? 14  TYR A HB2  9  
ATOM   9497  H  HB3  . TYR A 1 14 ? -16.568 -1.510  7.696   1.00 0.00 ? 14  TYR A HB3  9  
ATOM   9498  H  HD1  . TYR A 1 14 ? -17.161 -4.015  7.770   1.00 0.00 ? 14  TYR A HD1  9  
ATOM   9499  H  HD2  . TYR A 1 14 ? -13.385 -2.539  6.477   1.00 0.00 ? 14  TYR A HD2  9  
ATOM   9500  H  HE1  . TYR A 1 14 ? -16.162 -6.224  8.186   1.00 0.00 ? 14  TYR A HE1  9  
ATOM   9501  H  HE2  . TYR A 1 14 ? -12.376 -4.744  6.888   1.00 0.00 ? 14  TYR A HE2  9  
ATOM   9502  H  HH   . TYR A 1 14 ? -12.819 -6.922  7.311   1.00 0.00 ? 14  TYR A HH   9  
ATOM   9503  N  N    . GLY A 1 15 ? -15.444 -3.187  4.241   1.00 0.00 ? 15  GLY A N    9  
ATOM   9504  C  CA   . GLY A 1 15 ? -14.610 -3.540  3.107   1.00 0.00 ? 15  GLY A CA   9  
ATOM   9505  C  C    . GLY A 1 15 ? -13.342 -2.712  3.040   1.00 0.00 ? 15  GLY A C    9  
ATOM   9506  O  O    . GLY A 1 15 ? -13.375 -1.495  3.228   1.00 0.00 ? 15  GLY A O    9  
ATOM   9507  H  H    . GLY A 1 15 ? -15.626 -3.851  4.939   1.00 0.00 ? 15  GLY A H    9  
ATOM   9508  H  HA2  . GLY A 1 15 ? -14.342 -4.584  3.183   1.00 0.00 ? 15  GLY A HA2  9  
ATOM   9509  H  HA3  . GLY A 1 15 ? -15.174 -3.389  2.199   1.00 0.00 ? 15  GLY A HA3  9  
ATOM   9510  N  N    . THR A 1 16 ? -12.219 -3.371  2.772   1.00 0.00 ? 16  THR A N    9  
ATOM   9511  C  CA   . THR A 1 16 ? -10.935 -2.689  2.682   1.00 0.00 ? 16  THR A CA   9  
ATOM   9512  C  C    . THR A 1 16 ? -10.399 -2.710  1.256   1.00 0.00 ? 16  THR A C    9  
ATOM   9513  O  O    . THR A 1 16 ? -9.984  -3.756  0.754   1.00 0.00 ? 16  THR A O    9  
ATOM   9514  C  CB   . THR A 1 16 ? -9.893  -3.327  3.620   1.00 0.00 ? 16  THR A CB   9  
ATOM   9515  O  OG1  . THR A 1 16 ? -10.312 -3.191  4.983   1.00 0.00 ? 16  THR A OG1  9  
ATOM   9516  C  CG2  . THR A 1 16 ? -8.530  -2.678  3.436   1.00 0.00 ? 16  THR A CG2  9  
ATOM   9517  H  H    . THR A 1 16 ? -12.257 -4.340  2.631   1.00 0.00 ? 16  THR A H    9  
ATOM   9518  H  HA   . THR A 1 16 ? -11.081 -1.662  2.986   1.00 0.00 ? 16  THR A HA   9  
ATOM   9519  H  HB   . THR A 1 16 ? -9.811  -4.377  3.380   1.00 0.00 ? 16  THR A HB   9  
ATOM   9520  H  HG1  . THR A 1 16 ? -11.242 -3.418  5.056   1.00 0.00 ? 16  THR A HG1  9  
ATOM   9521  H  HG21 . THR A 1 16 ? -8.019  -2.637  4.387   1.00 0.00 ? 16  THR A HG21 9  
ATOM   9522  H  HG22 . THR A 1 16 ? -8.656  -1.677  3.052   1.00 0.00 ? 16  THR A HG22 9  
ATOM   9523  H  HG23 . THR A 1 16 ? -7.945  -3.260  2.740   1.00 0.00 ? 16  THR A HG23 9  
ATOM   9524  N  N    . ARG A 1 17 ? -10.409 -1.551  0.607   1.00 0.00 ? 17  ARG A N    9  
ATOM   9525  C  CA   . ARG A 1 17 ? -9.924  -1.438  -0.764  1.00 0.00 ? 17  ARG A CA   9  
ATOM   9526  C  C    . ARG A 1 17 ? -8.550  -0.775  -0.801  1.00 0.00 ? 17  ARG A C    9  
ATOM   9527  O  O    . ARG A 1 17 ? -8.400  0.391   -0.433  1.00 0.00 ? 17  ARG A O    9  
ATOM   9528  C  CB   . ARG A 1 17 ? -10.912 -0.635  -1.612  1.00 0.00 ? 17  ARG A CB   9  
ATOM   9529  C  CG   . ARG A 1 17 ? -10.893 -1.010  -3.085  1.00 0.00 ? 17  ARG A CG   9  
ATOM   9530  C  CD   . ARG A 1 17 ? -11.975 -0.274  -3.861  1.00 0.00 ? 17  ARG A CD   9  
ATOM   9531  N  NE   . ARG A 1 17 ? -11.786 1.174   -3.823  1.00 0.00 ? 17  ARG A NE   9  
ATOM   9532  C  CZ   . ARG A 1 17 ? -12.748 2.047   -4.099  1.00 0.00 ? 17  ARG A CZ   9  
ATOM   9533  N  NH1  . ARG A 1 17 ? -13.959 1.623   -4.430  1.00 0.00 ? 17  ARG A NH1  9  
ATOM   9534  N  NH2  . ARG A 1 17 ? -12.499 3.350   -4.043  1.00 0.00 ? 17  ARG A NH2  9  
ATOM   9535  H  H    . ARG A 1 17 ? -10.752 -0.752  1.059   1.00 0.00 ? 17  ARG A H    9  
ATOM   9536  H  HA   . ARG A 1 17 ? -9.841  -2.434  -1.170  1.00 0.00 ? 17  ARG A HA   9  
ATOM   9537  H  HB2  . ARG A 1 17 ? -11.910 -0.800  -1.234  1.00 0.00 ? 17  ARG A HB2  9  
ATOM   9538  H  HB3  . ARG A 1 17 ? -10.671 0.414   -1.527  1.00 0.00 ? 17  ARG A HB3  9  
ATOM   9539  H  HG2  . ARG A 1 17 ? -9.930  -0.754  -3.501  1.00 0.00 ? 17  ARG A HG2  9  
ATOM   9540  H  HG3  . ARG A 1 17 ? -11.056 -2.074  -3.178  1.00 0.00 ? 17  ARG A HG3  9  
ATOM   9541  H  HD2  . ARG A 1 17 ? -11.950 -0.604  -4.889  1.00 0.00 ? 17  ARG A HD2  9  
ATOM   9542  H  HD3  . ARG A 1 17 ? -12.935 -0.514  -3.429  1.00 0.00 ? 17  ARG A HD3  9  
ATOM   9543  H  HE   . ARG A 1 17 ? -10.898 1.509   -3.581  1.00 0.00 ? 17  ARG A HE   9  
ATOM   9544  H  HH11 . ARG A 1 17 ? -14.150 0.642   -4.471  1.00 0.00 ? 17  ARG A HH11 9  
ATOM   9545  H  HH12 . ARG A 1 17 ? -14.682 2.283   -4.635  1.00 0.00 ? 17  ARG A HH12 9  
ATOM   9546  H  HH21 . ARG A 1 17 ? -11.587 3.674   -3.793  1.00 0.00 ? 17  ARG A HH21 9  
ATOM   9547  H  HH22 . ARG A 1 17 ? -13.223 4.006   -4.250  1.00 0.00 ? 17  ARG A HH22 9  
ATOM   9548  N  N    . CYS A 1 18 ? -7.548  -1.526  -1.246  1.00 0.00 ? 18  CYS A N    9  
ATOM   9549  C  CA   . CYS A 1 18 ? -6.186  -1.014  -1.330  1.00 0.00 ? 18  CYS A CA   9  
ATOM   9550  C  C    . CYS A 1 18 ? -6.171  0.400   -1.905  1.00 0.00 ? 18  CYS A C    9  
ATOM   9551  O  O    . CYS A 1 18 ? -6.729  0.653   -2.974  1.00 0.00 ? 18  CYS A O    9  
ATOM   9552  C  CB   . CYS A 1 18 ? -5.324  -1.936  -2.195  1.00 0.00 ? 18  CYS A CB   9  
ATOM   9553  S  SG   . CYS A 1 18 ? -3.567  -1.461  -2.266  1.00 0.00 ? 18  CYS A SG   9  
ATOM   9554  H  H    . CYS A 1 18 ? -7.729  -2.449  -1.525  1.00 0.00 ? 18  CYS A H    9  
ATOM   9555  H  HA   . CYS A 1 18 ? -5.779  -0.987  -0.331  1.00 0.00 ? 18  CYS A HA   9  
ATOM   9556  H  HB2  . CYS A 1 18 ? -5.376  -2.940  -1.798  1.00 0.00 ? 18  CYS A HB2  9  
ATOM   9557  H  HB3  . CYS A 1 18 ? -5.708  -1.933  -3.204  1.00 0.00 ? 18  CYS A HB3  9  
ATOM   9558  N  N    . PHE A 1 19 ? -5.530  1.317   -1.189  1.00 0.00 ? 19  PHE A N    9  
ATOM   9559  C  CA   . PHE A 1 19 ? -5.443  2.705   -1.627  1.00 0.00 ? 19  PHE A CA   9  
ATOM   9560  C  C    . PHE A 1 19 ? -4.380  2.868   -2.710  1.00 0.00 ? 19  PHE A C    9  
ATOM   9561  O  O    . PHE A 1 19 ? -4.019  3.986   -3.077  1.00 0.00 ? 19  PHE A O    9  
ATOM   9562  C  CB   . PHE A 1 19 ? -5.122  3.617   -0.441  1.00 0.00 ? 19  PHE A CB   9  
ATOM   9563  C  CG   . PHE A 1 19 ? -6.327  3.984   0.377   1.00 0.00 ? 19  PHE A CG   9  
ATOM   9564  C  CD1  . PHE A 1 19 ? -7.199  3.005   0.827   1.00 0.00 ? 19  PHE A CD1  9  
ATOM   9565  C  CD2  . PHE A 1 19 ? -6.589  5.306   0.696   1.00 0.00 ? 19  PHE A CD2  9  
ATOM   9566  C  CE1  . PHE A 1 19 ? -8.309  3.340   1.579   1.00 0.00 ? 19  PHE A CE1  9  
ATOM   9567  C  CE2  . PHE A 1 19 ? -7.697  5.647   1.447   1.00 0.00 ? 19  PHE A CE2  9  
ATOM   9568  C  CZ   . PHE A 1 19 ? -8.558  4.662   1.890   1.00 0.00 ? 19  PHE A CZ   9  
ATOM   9569  H  H    . PHE A 1 19 ? -5.105  1.054   -0.346  1.00 0.00 ? 19  PHE A H    9  
ATOM   9570  H  HA   . PHE A 1 19 ? -6.402  2.984   -2.035  1.00 0.00 ? 19  PHE A HA   9  
ATOM   9571  H  HB2  . PHE A 1 19 ? -4.420  3.117   0.209   1.00 0.00 ? 19  PHE A HB2  9  
ATOM   9572  H  HB3  . PHE A 1 19 ? -4.678  4.530   -0.808  1.00 0.00 ? 19  PHE A HB3  9  
ATOM   9573  H  HD1  . PHE A 1 19 ? -7.005  1.970   0.585   1.00 0.00 ? 19  PHE A HD1  9  
ATOM   9574  H  HD2  . PHE A 1 19 ? -5.915  6.078   0.350   1.00 0.00 ? 19  PHE A HD2  9  
ATOM   9575  H  HE1  . PHE A 1 19 ? -8.981  2.568   1.924   1.00 0.00 ? 19  PHE A HE1  9  
ATOM   9576  H  HE2  . PHE A 1 19 ? -7.889  6.682   1.689   1.00 0.00 ? 19  PHE A HE2  9  
ATOM   9577  H  HZ   . PHE A 1 19 ? -9.425  4.926   2.477   1.00 0.00 ? 19  PHE A HZ   9  
ATOM   9578  N  N    . SER A 1 20 ? -3.884  1.745   -3.218  1.00 0.00 ? 20  SER A N    9  
ATOM   9579  C  CA   . SER A 1 20 ? -2.860  1.762   -4.256  1.00 0.00 ? 20  SER A CA   9  
ATOM   9580  C  C    . SER A 1 20 ? -3.454  1.391   -5.611  1.00 0.00 ? 20  SER A C    9  
ATOM   9581  O  O    . SER A 1 20 ? -3.523  2.219   -6.519  1.00 0.00 ? 20  SER A O    9  
ATOM   9582  C  CB   . SER A 1 20 ? -1.728  0.796   -3.901  1.00 0.00 ? 20  SER A CB   9  
ATOM   9583  O  OG   . SER A 1 20 ? -0.522  1.162   -4.550  1.00 0.00 ? 20  SER A OG   9  
ATOM   9584  H  H    . SER A 1 20 ? -4.213  0.884   -2.884  1.00 0.00 ? 20  SER A H    9  
ATOM   9585  H  HA   . SER A 1 20 ? -2.462  2.764   -4.312  1.00 0.00 ? 20  SER A HA   9  
ATOM   9586  H  HB2  . SER A 1 20 ? -1.566  0.811   -2.833  1.00 0.00 ? 20  SER A HB2  9  
ATOM   9587  H  HB3  . SER A 1 20 ? -2.000  -0.203  -4.210  1.00 0.00 ? 20  SER A HB3  9  
ATOM   9588  H  HG   . SER A 1 20 ? 0.109   1.478   -3.899  1.00 0.00 ? 20  SER A HG   9  
ATOM   9589  N  N    . CYS A 1 21 ? -3.881  0.139   -5.740  1.00 0.00 ? 21  CYS A N    9  
ATOM   9590  C  CA   . CYS A 1 21 ? -4.469  -0.344  -6.983  1.00 0.00 ? 21  CYS A CA   9  
ATOM   9591  C  C    . CYS A 1 21 ? -5.993  -0.303  -6.917  1.00 0.00 ? 21  CYS A C    9  
ATOM   9592  O  O    . CYS A 1 21 ? -6.677  -0.751  -7.836  1.00 0.00 ? 21  CYS A O    9  
ATOM   9593  C  CB   . CYS A 1 21 ? -3.999  -1.771  -7.273  1.00 0.00 ? 21  CYS A CB   9  
ATOM   9594  S  SG   . CYS A 1 21 ? -4.292  -2.942  -5.908  1.00 0.00 ? 21  CYS A SG   9  
ATOM   9595  H  H    . CYS A 1 21 ? -3.799  -0.475  -4.980  1.00 0.00 ? 21  CYS A H    9  
ATOM   9596  H  HA   . CYS A 1 21 ? -4.138  0.303   -7.781  1.00 0.00 ? 21  CYS A HA   9  
ATOM   9597  H  HB2  . CYS A 1 21 ? -4.521  -2.144  -8.142  1.00 0.00 ? 21  CYS A HB2  9  
ATOM   9598  H  HB3  . CYS A 1 21 ? -2.938  -1.759  -7.475  1.00 0.00 ? 21  CYS A HB3  9  
ATOM   9599  N  N    . ASP A 1 22 ? -6.517  0.239   -5.823  1.00 0.00 ? 22  ASP A N    9  
ATOM   9600  C  CA   . ASP A 1 22 ? -7.960  0.341   -5.636  1.00 0.00 ? 22  ASP A CA   9  
ATOM   9601  C  C    . ASP A 1 22 ? -8.617  -1.033  -5.719  1.00 0.00 ? 22  ASP A C    9  
ATOM   9602  O  O    . ASP A 1 22 ? -9.706  -1.178  -6.273  1.00 0.00 ? 22  ASP A O    9  
ATOM   9603  C  CB   . ASP A 1 22 ? -8.566  1.275   -6.684  1.00 0.00 ? 22  ASP A CB   9  
ATOM   9604  C  CG   . ASP A 1 22 ? -8.595  2.719   -6.226  1.00 0.00 ? 22  ASP A CG   9  
ATOM   9605  O  OD1  . ASP A 1 22 ? -9.033  2.971   -5.083  1.00 0.00 ? 22  ASP A OD1  9  
ATOM   9606  O  OD2  . ASP A 1 22 ? -8.179  3.598   -7.009  1.00 0.00 ? 22  ASP A OD2  9  
ATOM   9607  H  H    . ASP A 1 22 ? -5.919  0.579   -5.124  1.00 0.00 ? 22  ASP A H    9  
ATOM   9608  H  HA   . ASP A 1 22 ? -8.139  0.753   -4.654  1.00 0.00 ? 22  ASP A HA   9  
ATOM   9609  H  HB2  . ASP A 1 22 ? -7.982  1.216   -7.591  1.00 0.00 ? 22  ASP A HB2  9  
ATOM   9610  H  HB3  . ASP A 1 22 ? -9.579  0.961   -6.893  1.00 0.00 ? 22  ASP A HB3  9  
ATOM   9611  N  N    . GLN A 1 23 ? -7.947  -2.038  -5.165  1.00 0.00 ? 23  GLN A N    9  
ATOM   9612  C  CA   . GLN A 1 23 ? -8.466  -3.401  -5.178  1.00 0.00 ? 23  GLN A CA   9  
ATOM   9613  C  C    . GLN A 1 23 ? -8.697  -3.909  -3.759  1.00 0.00 ? 23  GLN A C    9  
ATOM   9614  O  O    . GLN A 1 23 ? -7.903  -3.645  -2.857  1.00 0.00 ? 23  GLN A O    9  
ATOM   9615  C  CB   . GLN A 1 23 ? -7.499  -4.330  -5.914  1.00 0.00 ? 23  GLN A CB   9  
ATOM   9616  C  CG   . GLN A 1 23 ? -7.216  -3.904  -7.346  1.00 0.00 ? 23  GLN A CG   9  
ATOM   9617  C  CD   . GLN A 1 23 ? -8.483  -3.685  -8.150  1.00 0.00 ? 23  GLN A CD   9  
ATOM   9618  O  OE1  . GLN A 1 23 ? -9.333  -4.571  -8.245  1.00 0.00 ? 23  GLN A OE1  9  
ATOM   9619  N  NE2  . GLN A 1 23 ? -8.615  -2.501  -8.735  1.00 0.00 ? 23  GLN A NE2  9  
ATOM   9620  H  H    . GLN A 1 23 ? -7.084  -1.860  -4.738  1.00 0.00 ? 23  GLN A H    9  
ATOM   9621  H  HA   . GLN A 1 23 ? -9.409  -3.391  -5.702  1.00 0.00 ? 23  GLN A HA   9  
ATOM   9622  H  HB2  . GLN A 1 23 ? -6.562  -4.354  -5.377  1.00 0.00 ? 23  GLN A HB2  9  
ATOM   9623  H  HB3  . GLN A 1 23 ? -7.919  -5.325  -5.934  1.00 0.00 ? 23  GLN A HB3  9  
ATOM   9624  H  HG2  . GLN A 1 23 ? -6.655  -2.982  -7.330  1.00 0.00 ? 23  GLN A HG2  9  
ATOM   9625  H  HG3  . GLN A 1 23 ? -6.629  -4.673  -7.827  1.00 0.00 ? 23  GLN A HG3  9  
ATOM   9626  H  HE21 . GLN A 1 23 ? -7.897  -1.844  -8.617  1.00 0.00 ? 23  GLN A HE21 9  
ATOM   9627  H  HE22 . GLN A 1 23 ? -9.423  -2.333  -9.262  1.00 0.00 ? 23  GLN A HE22 9  
ATOM   9628  N  N    . PHE A 1 24 ? -9.790  -4.641  -3.569  1.00 0.00 ? 24  PHE A N    9  
ATOM   9629  C  CA   . PHE A 1 24 ? -10.128 -5.185  -2.259  1.00 0.00 ? 24  PHE A CA   9  
ATOM   9630  C  C    . PHE A 1 24 ? -9.008  -6.083  -1.739  1.00 0.00 ? 24  PHE A C    9  
ATOM   9631  O  O    . PHE A 1 24 ? -8.602  -7.035  -2.405  1.00 0.00 ? 24  PHE A O    9  
ATOM   9632  C  CB   . PHE A 1 24 ? -11.437 -5.974  -2.333  1.00 0.00 ? 24  PHE A CB   9  
ATOM   9633  C  CG   . PHE A 1 24 ? -12.660 -5.104  -2.360  1.00 0.00 ? 24  PHE A CG   9  
ATOM   9634  C  CD1  . PHE A 1 24 ? -12.725 -4.002  -3.198  1.00 0.00 ? 24  PHE A CD1  9  
ATOM   9635  C  CD2  . PHE A 1 24 ? -13.747 -5.387  -1.548  1.00 0.00 ? 24  PHE A CD2  9  
ATOM   9636  C  CE1  . PHE A 1 24 ? -13.849 -3.199  -3.225  1.00 0.00 ? 24  PHE A CE1  9  
ATOM   9637  C  CE2  . PHE A 1 24 ? -14.874 -4.588  -1.570  1.00 0.00 ? 24  PHE A CE2  9  
ATOM   9638  C  CZ   . PHE A 1 24 ? -14.926 -3.493  -2.411  1.00 0.00 ? 24  PHE A CZ   9  
ATOM   9639  H  H    . PHE A 1 24 ? -10.385 -4.818  -4.328  1.00 0.00 ? 24  PHE A H    9  
ATOM   9640  H  HA   . PHE A 1 24 ? -10.254 -4.357  -1.579  1.00 0.00 ? 24  PHE A HA   9  
ATOM   9641  H  HB2  . PHE A 1 24 ? -11.437 -6.574  -3.230  1.00 0.00 ? 24  PHE A HB2  9  
ATOM   9642  H  HB3  . PHE A 1 24 ? -11.507 -6.621  -1.471  1.00 0.00 ? 24  PHE A HB3  9  
ATOM   9643  H  HD1  . PHE A 1 24 ? -11.884 -3.772  -3.836  1.00 0.00 ? 24  PHE A HD1  9  
ATOM   9644  H  HD2  . PHE A 1 24 ? -13.707 -6.244  -0.890  1.00 0.00 ? 24  PHE A HD2  9  
ATOM   9645  H  HE1  . PHE A 1 24 ? -13.887 -2.344  -3.883  1.00 0.00 ? 24  PHE A HE1  9  
ATOM   9646  H  HE2  . PHE A 1 24 ? -15.714 -4.821  -0.933  1.00 0.00 ? 24  PHE A HE2  9  
ATOM   9647  H  HZ   . PHE A 1 24 ? -15.805 -2.867  -2.429  1.00 0.00 ? 24  PHE A HZ   9  
ATOM   9648  N  N    . ILE A 1 25 ? -8.515  -5.771  -0.545  1.00 0.00 ? 25  ILE A N    9  
ATOM   9649  C  CA   . ILE A 1 25 ? -7.444  -6.549  0.065   1.00 0.00 ? 25  ILE A CA   9  
ATOM   9650  C  C    . ILE A 1 25 ? -8.001  -7.739  0.839   1.00 0.00 ? 25  ILE A C    9  
ATOM   9651  O  O    . ILE A 1 25 ? -8.571  -7.579  1.917   1.00 0.00 ? 25  ILE A O    9  
ATOM   9652  C  CB   . ILE A 1 25 ? -6.593  -5.686  1.016   1.00 0.00 ? 25  ILE A CB   9  
ATOM   9653  C  CG1  . ILE A 1 25 ? -6.204  -4.371  0.336   1.00 0.00 ? 25  ILE A CG1  9  
ATOM   9654  C  CG2  . ILE A 1 25 ? -5.352  -6.449  1.456   1.00 0.00 ? 25  ILE A CG2  9  
ATOM   9655  C  CD1  . ILE A 1 25 ? -5.609  -3.354  1.284   1.00 0.00 ? 25  ILE A CD1  9  
ATOM   9656  H  H    . ILE A 1 25 ? -8.881  -5.000  -0.063  1.00 0.00 ? 25  ILE A H    9  
ATOM   9657  H  HA   . ILE A 1 25 ? -6.805  -6.914  -0.726  1.00 0.00 ? 25  ILE A HA   9  
ATOM   9658  H  HB   . ILE A 1 25 ? -7.183  -5.469  1.894   1.00 0.00 ? 25  ILE A HB   9  
ATOM   9659  H  HG12 . ILE A 1 25 ? -5.476  -4.573  -0.433  1.00 0.00 ? 25  ILE A HG12 9  
ATOM   9660  H  HG13 . ILE A 1 25 ? -7.084  -3.933  -0.113  1.00 0.00 ? 25  ILE A HG13 9  
ATOM   9661  H  HG21 . ILE A 1 25 ? -4.559  -6.287  0.741   1.00 0.00 ? 25  ILE A HG21 9  
ATOM   9662  H  HG22 . ILE A 1 25 ? -5.039  -6.096  2.427   1.00 0.00 ? 25  ILE A HG22 9  
ATOM   9663  H  HG23 . ILE A 1 25 ? -5.578  -7.503  1.511   1.00 0.00 ? 25  ILE A HG23 9  
ATOM   9664  H  HD11 . ILE A 1 25 ? -6.347  -2.599  1.512   1.00 0.00 ? 25  ILE A HD11 9  
ATOM   9665  H  HD12 . ILE A 1 25 ? -5.303  -3.846  2.195   1.00 0.00 ? 25  ILE A HD12 9  
ATOM   9666  H  HD13 . ILE A 1 25 ? -4.751  -2.889  0.821   1.00 0.00 ? 25  ILE A HD13 9  
ATOM   9667  N  N    . GLU A 1 26 ? -7.830  -8.933  0.280   1.00 0.00 ? 26  GLU A N    9  
ATOM   9668  C  CA   . GLU A 1 26 ? -8.315  -10.151 0.918   1.00 0.00 ? 26  GLU A CA   9  
ATOM   9669  C  C    . GLU A 1 26 ? -7.184  -10.870 1.648   1.00 0.00 ? 26  GLU A C    9  
ATOM   9670  O  O    . GLU A 1 26 ? -6.033  -10.843 1.213   1.00 0.00 ? 26  GLU A O    9  
ATOM   9671  C  CB   . GLU A 1 26 ? -8.940  -11.084 -0.121  1.00 0.00 ? 26  GLU A CB   9  
ATOM   9672  C  CG   . GLU A 1 26 ? -9.231  -12.478 0.409   1.00 0.00 ? 26  GLU A CG   9  
ATOM   9673  C  CD   . GLU A 1 26 ? -9.662  -13.439 -0.682  1.00 0.00 ? 26  GLU A CD   9  
ATOM   9674  O  OE1  . GLU A 1 26 ? -8.802  -13.836 -1.496  1.00 0.00 ? 26  GLU A OE1  9  
ATOM   9675  O  OE2  . GLU A 1 26 ? -10.859 -13.794 -0.722  1.00 0.00 ? 26  GLU A OE2  9  
ATOM   9676  H  H    . GLU A 1 26 ? -7.367  -8.996  -0.582  1.00 0.00 ? 26  GLU A H    9  
ATOM   9677  H  HA   . GLU A 1 26 ? -9.070  -9.871  1.637   1.00 0.00 ? 26  GLU A HA   9  
ATOM   9678  H  HB2  . GLU A 1 26 ? -9.867  -10.651 -0.465  1.00 0.00 ? 26  GLU A HB2  9  
ATOM   9679  H  HB3  . GLU A 1 26 ? -8.263  -11.175 -0.958  1.00 0.00 ? 26  GLU A HB3  9  
ATOM   9680  H  HG2  . GLU A 1 26 ? -8.338  -12.866 0.876   1.00 0.00 ? 26  GLU A HG2  9  
ATOM   9681  H  HG3  . GLU A 1 26 ? -10.020 -12.413 1.143   1.00 0.00 ? 26  GLU A HG3  9  
ATOM   9682  N  N    . GLY A 1 27 ? -7.521  -11.513 2.762   1.00 0.00 ? 27  GLY A N    9  
ATOM   9683  C  CA   . GLY A 1 27 ? -6.524  -12.229 3.536   1.00 0.00 ? 27  GLY A CA   9  
ATOM   9684  C  C    . GLY A 1 27 ? -5.914  -11.374 4.629   1.00 0.00 ? 27  GLY A C    9  
ATOM   9685  O  O    . GLY A 1 27 ? -6.155  -11.606 5.813   1.00 0.00 ? 27  GLY A O    9  
ATOM   9686  H  H    . GLY A 1 27 ? -8.454  -11.500 3.062   1.00 0.00 ? 27  GLY A H    9  
ATOM   9687  H  HA2  . GLY A 1 27 ? -6.987  -13.095 3.986   1.00 0.00 ? 27  GLY A HA2  9  
ATOM   9688  H  HA3  . GLY A 1 27 ? -5.738  -12.558 2.872   1.00 0.00 ? 27  GLY A HA3  9  
ATOM   9689  N  N    . GLU A 1 28 ? -5.120  -10.385 4.231   1.00 0.00 ? 28  GLU A N    9  
ATOM   9690  C  CA   . GLU A 1 28 ? -4.472  -9.495  5.187   1.00 0.00 ? 28  GLU A CA   9  
ATOM   9691  C  C    . GLU A 1 28 ? -4.307  -8.095  4.602   1.00 0.00 ? 28  GLU A C    9  
ATOM   9692  O  O    . GLU A 1 28 ? -4.206  -7.926  3.387   1.00 0.00 ? 28  GLU A O    9  
ATOM   9693  C  CB   . GLU A 1 28 ? -3.107  -10.054 5.594   1.00 0.00 ? 28  GLU A CB   9  
ATOM   9694  C  CG   . GLU A 1 28 ? -2.324  -9.135  6.517   1.00 0.00 ? 28  GLU A CG   9  
ATOM   9695  C  CD   . GLU A 1 28 ? -1.238  -9.865  7.283   1.00 0.00 ? 28  GLU A CD   9  
ATOM   9696  O  OE1  . GLU A 1 28 ? -1.553  -10.887 7.928   1.00 0.00 ? 28  GLU A OE1  9  
ATOM   9697  O  OE2  . GLU A 1 28 ? -0.074  -9.416  7.237   1.00 0.00 ? 28  GLU A OE2  9  
ATOM   9698  H  H    . GLU A 1 28 ? -4.967  -10.251 3.273   1.00 0.00 ? 28  GLU A H    9  
ATOM   9699  H  HA   . GLU A 1 28 ? -5.101  -9.433  6.063   1.00 0.00 ? 28  GLU A HA   9  
ATOM   9700  H  HB2  . GLU A 1 28 ? -3.254  -10.997 6.099   1.00 0.00 ? 28  GLU A HB2  9  
ATOM   9701  H  HB3  . GLU A 1 28 ? -2.520  -10.220 4.703   1.00 0.00 ? 28  GLU A HB3  9  
ATOM   9702  H  HG2  . GLU A 1 28 ? -1.865  -8.358  5.925   1.00 0.00 ? 28  GLU A HG2  9  
ATOM   9703  H  HG3  . GLU A 1 28 ? -3.007  -8.690  7.226   1.00 0.00 ? 28  GLU A HG3  9  
ATOM   9704  N  N    . VAL A 1 29 ? -4.280  -7.094  5.476   1.00 0.00 ? 29  VAL A N    9  
ATOM   9705  C  CA   . VAL A 1 29 ? -4.126  -5.709  5.047   1.00 0.00 ? 29  VAL A CA   9  
ATOM   9706  C  C    . VAL A 1 29 ? -3.096  -4.980  5.902   1.00 0.00 ? 29  VAL A C    9  
ATOM   9707  O  O    . VAL A 1 29 ? -2.941  -5.269  7.088   1.00 0.00 ? 29  VAL A O    9  
ATOM   9708  C  CB   . VAL A 1 29 ? -5.464  -4.948  5.116   1.00 0.00 ? 29  VAL A CB   9  
ATOM   9709  C  CG1  . VAL A 1 29 ? -6.223  -5.316  6.382   1.00 0.00 ? 29  VAL A CG1  9  
ATOM   9710  C  CG2  . VAL A 1 29 ? -5.227  -3.447  5.044   1.00 0.00 ? 29  VAL A CG2  9  
ATOM   9711  H  H    . VAL A 1 29 ? -4.365  -7.291  6.432   1.00 0.00 ? 29  VAL A H    9  
ATOM   9712  H  HA   . VAL A 1 29 ? -3.791  -5.712  4.020   1.00 0.00 ? 29  VAL A HA   9  
ATOM   9713  H  HB   . VAL A 1 29 ? -6.064  -5.238  4.266   1.00 0.00 ? 29  VAL A HB   9  
ATOM   9714  H  HG11 . VAL A 1 29 ? -5.824  -4.758  7.216   1.00 0.00 ? 29  VAL A HG11 9  
ATOM   9715  H  HG12 . VAL A 1 29 ? -7.270  -5.080  6.256   1.00 0.00 ? 29  VAL A HG12 9  
ATOM   9716  H  HG13 . VAL A 1 29 ? -6.113  -6.374  6.572   1.00 0.00 ? 29  VAL A HG13 9  
ATOM   9717  H  HG21 . VAL A 1 29 ? -4.737  -3.206  4.112   1.00 0.00 ? 29  VAL A HG21 9  
ATOM   9718  H  HG22 . VAL A 1 29 ? -6.175  -2.930  5.096   1.00 0.00 ? 29  VAL A HG22 9  
ATOM   9719  H  HG23 . VAL A 1 29 ? -4.604  -3.140  5.870   1.00 0.00 ? 29  VAL A HG23 9  
ATOM   9720  N  N    . VAL A 1 30 ? -2.392  -4.032  5.291   1.00 0.00 ? 30  VAL A N    9  
ATOM   9721  C  CA   . VAL A 1 30 ? -1.376  -3.260  5.996   1.00 0.00 ? 30  VAL A CA   9  
ATOM   9722  C  C    . VAL A 1 30 ? -1.846  -1.831  6.245   1.00 0.00 ? 30  VAL A C    9  
ATOM   9723  O  O    . VAL A 1 30 ? -1.779  -0.981  5.358   1.00 0.00 ? 30  VAL A O    9  
ATOM   9724  C  CB   . VAL A 1 30 ? -0.052  -3.222  5.208   1.00 0.00 ? 30  VAL A CB   9  
ATOM   9725  C  CG1  . VAL A 1 30 ? 0.984   -2.387  5.944   1.00 0.00 ? 30  VAL A CG1  9  
ATOM   9726  C  CG2  . VAL A 1 30 ? 0.463   -4.633  4.966   1.00 0.00 ? 30  VAL A CG2  9  
ATOM   9727  H  H    . VAL A 1 30 ? -2.560  -3.848  4.343   1.00 0.00 ? 30  VAL A H    9  
ATOM   9728  H  HA   . VAL A 1 30 ? -1.191  -3.739  6.946   1.00 0.00 ? 30  VAL A HA   9  
ATOM   9729  H  HB   . VAL A 1 30 ? -0.240  -2.761  4.250   1.00 0.00 ? 30  VAL A HB   9  
ATOM   9730  H  HG11 . VAL A 1 30 ? 0.678   -1.351  5.942   1.00 0.00 ? 30  VAL A HG11 9  
ATOM   9731  H  HG12 . VAL A 1 30 ? 1.070   -2.735  6.963   1.00 0.00 ? 30  VAL A HG12 9  
ATOM   9732  H  HG13 . VAL A 1 30 ? 1.939   -2.480  5.449   1.00 0.00 ? 30  VAL A HG13 9  
ATOM   9733  H  HG21 . VAL A 1 30 ? -0.065  -5.070  4.132   1.00 0.00 ? 30  VAL A HG21 9  
ATOM   9734  H  HG22 . VAL A 1 30 ? 1.520   -4.598  4.744   1.00 0.00 ? 30  VAL A HG22 9  
ATOM   9735  H  HG23 . VAL A 1 30 ? 0.301   -5.233  5.849   1.00 0.00 ? 30  VAL A HG23 9  
ATOM   9736  N  N    . SER A 1 31 ? -2.323  -1.575  7.459   1.00 0.00 ? 31  SER A N    9  
ATOM   9737  C  CA   . SER A 1 31 ? -2.808  -0.250  7.826   1.00 0.00 ? 31  SER A CA   9  
ATOM   9738  C  C    . SER A 1 31 ? -1.656  0.747   7.911   1.00 0.00 ? 31  SER A C    9  
ATOM   9739  O  O    . SER A 1 31 ? -0.847  0.699   8.837   1.00 0.00 ? 31  SER A O    9  
ATOM   9740  C  CB   . SER A 1 31 ? -3.548  -0.306  9.164   1.00 0.00 ? 31  SER A CB   9  
ATOM   9741  O  OG   . SER A 1 31 ? -2.717  -0.831  10.184  1.00 0.00 ? 31  SER A OG   9  
ATOM   9742  H  H    . SER A 1 31 ? -2.351  -2.295  8.124   1.00 0.00 ? 31  SER A H    9  
ATOM   9743  H  HA   . SER A 1 31 ? -3.494  0.076   7.058   1.00 0.00 ? 31  SER A HA   9  
ATOM   9744  H  HB2  . SER A 1 31 ? -3.857  0.689   9.444   1.00 0.00 ? 31  SER A HB2  9  
ATOM   9745  H  HB3  . SER A 1 31 ? -4.418  -0.939  9.064   1.00 0.00 ? 31  SER A HB3  9  
ATOM   9746  H  HG   . SER A 1 31 ? -3.261  -1.168  10.899  1.00 0.00 ? 31  SER A HG   9  
ATOM   9747  N  N    . ALA A 1 32 ? -1.588  1.648   6.937   1.00 0.00 ? 32  ALA A N    9  
ATOM   9748  C  CA   . ALA A 1 32 ? -0.538  2.657   6.901   1.00 0.00 ? 32  ALA A CA   9  
ATOM   9749  C  C    . ALA A 1 32 ? -1.097  4.044   7.201   1.00 0.00 ? 32  ALA A C    9  
ATOM   9750  O  O    . ALA A 1 32 ? -1.807  4.629   6.382   1.00 0.00 ? 32  ALA A O    9  
ATOM   9751  C  CB   . ALA A 1 32 ? 0.157   2.649   5.547   1.00 0.00 ? 32  ALA A CB   9  
ATOM   9752  H  H    . ALA A 1 32 ? -2.263  1.635   6.226   1.00 0.00 ? 32  ALA A H    9  
ATOM   9753  H  HA   . ALA A 1 32 ? 0.194   2.404   7.655   1.00 0.00 ? 32  ALA A HA   9  
ATOM   9754  H  HB1  . ALA A 1 32 ? -0.515  3.037   4.796   1.00 0.00 ? 32  ALA A HB1  9  
ATOM   9755  H  HB2  . ALA A 1 32 ? 1.042   3.266   5.593   1.00 0.00 ? 32  ALA A HB2  9  
ATOM   9756  H  HB3  . ALA A 1 32 ? 0.436   1.637   5.293   1.00 0.00 ? 32  ALA A HB3  9  
ATOM   9757  N  N    . LEU A 1 33 ? -0.775  4.564   8.380   1.00 0.00 ? 33  LEU A N    9  
ATOM   9758  C  CA   . LEU A 1 33 ? -1.246  5.883   8.790   1.00 0.00 ? 33  LEU A CA   9  
ATOM   9759  C  C    . LEU A 1 33 ? -2.770  5.946   8.772   1.00 0.00 ? 33  LEU A C    9  
ATOM   9760  O  O    . LEU A 1 33 ? -3.355  7.017   8.621   1.00 0.00 ? 33  LEU A O    9  
ATOM   9761  C  CB   . LEU A 1 33 ? -0.669  6.960   7.870   1.00 0.00 ? 33  LEU A CB   9  
ATOM   9762  C  CG   . LEU A 1 33 ? 0.821   7.259   8.039   1.00 0.00 ? 33  LEU A CG   9  
ATOM   9763  C  CD1  . LEU A 1 33 ? 1.367   7.966   6.808   1.00 0.00 ? 33  LEU A CD1  9  
ATOM   9764  C  CD2  . LEU A 1 33 ? 1.058   8.098   9.286   1.00 0.00 ? 33  LEU A CD2  9  
ATOM   9765  H  H    . LEU A 1 33 ? -0.206  4.050   8.991   1.00 0.00 ? 33  LEU A H    9  
ATOM   9766  H  HA   . LEU A 1 33 ? -0.902  6.059   9.798   1.00 0.00 ? 33  LEU A HA   9  
ATOM   9767  H  HB2  . LEU A 1 33 ? -0.829  6.645   6.850   1.00 0.00 ? 33  LEU A HB2  9  
ATOM   9768  H  HB3  . LEU A 1 33 ? -1.214  7.876   8.052   1.00 0.00 ? 33  LEU A HB3  9  
ATOM   9769  H  HG   . LEU A 1 33 ? 1.358   6.328   8.154   1.00 0.00 ? 33  LEU A HG   9  
ATOM   9770  H  HD11 . LEU A 1 33 ? 2.006   7.291   6.259   1.00 0.00 ? 33  LEU A HD11 9  
ATOM   9771  H  HD12 . LEU A 1 33 ? 1.934   8.832   7.112   1.00 0.00 ? 33  LEU A HD12 9  
ATOM   9772  H  HD13 . LEU A 1 33 ? 0.546   8.276   6.178   1.00 0.00 ? 33  LEU A HD13 9  
ATOM   9773  H  HD21 . LEU A 1 33 ? 1.865   7.668   9.861   1.00 0.00 ? 33  LEU A HD21 9  
ATOM   9774  H  HD22 . LEU A 1 33 ? 0.159   8.116   9.885   1.00 0.00 ? 33  LEU A HD22 9  
ATOM   9775  H  HD23 . LEU A 1 33 ? 1.319   9.106   8.998   1.00 0.00 ? 33  LEU A HD23 9  
ATOM   9776  N  N    . GLY A 1 34 ? -3.407  4.789   8.930   1.00 0.00 ? 34  GLY A N    9  
ATOM   9777  C  CA   . GLY A 1 34 ? -4.857  4.735   8.931   1.00 0.00 ? 34  GLY A CA   9  
ATOM   9778  C  C    . GLY A 1 34 ? -5.418  4.188   7.634   1.00 0.00 ? 34  GLY A C    9  
ATOM   9779  O  O    . GLY A 1 34 ? -6.499  3.599   7.616   1.00 0.00 ? 34  GLY A O    9  
ATOM   9780  H  H    . GLY A 1 34 ? -2.888  3.966   9.047   1.00 0.00 ? 34  GLY A H    9  
ATOM   9781  H  HA2  . GLY A 1 34 ? -5.183  4.106   9.746   1.00 0.00 ? 34  GLY A HA2  9  
ATOM   9782  H  HA3  . GLY A 1 34 ? -5.243  5.733   9.084   1.00 0.00 ? 34  GLY A HA3  9  
ATOM   9783  N  N    . LYS A 1 35 ? -4.684  4.383   6.545   1.00 0.00 ? 35  LYS A N    9  
ATOM   9784  C  CA   . LYS A 1 35 ? -5.113  3.905   5.236   1.00 0.00 ? 35  LYS A CA   9  
ATOM   9785  C  C    . LYS A 1 35 ? -4.803  2.420   5.070   1.00 0.00 ? 35  LYS A C    9  
ATOM   9786  O  O    . LYS A 1 35 ? -4.083  1.831   5.877   1.00 0.00 ? 35  LYS A O    9  
ATOM   9787  C  CB   . LYS A 1 35 ? -4.428  4.706   4.127   1.00 0.00 ? 35  LYS A CB   9  
ATOM   9788  C  CG   . LYS A 1 35 ? -5.218  5.924   3.679   1.00 0.00 ? 35  LYS A CG   9  
ATOM   9789  C  CD   . LYS A 1 35 ? -5.078  7.073   4.663   1.00 0.00 ? 35  LYS A CD   9  
ATOM   9790  C  CE   . LYS A 1 35 ? -6.278  8.006   4.606   1.00 0.00 ? 35  LYS A CE   9  
ATOM   9791  N  NZ   . LYS A 1 35 ? -6.270  8.844   3.375   1.00 0.00 ? 35  LYS A NZ   9  
ATOM   9792  H  H    . LYS A 1 35 ? -3.830  4.859   6.623   1.00 0.00 ? 35  LYS A H    9  
ATOM   9793  H  HA   . LYS A 1 35 ? -6.181  4.047   5.164   1.00 0.00 ? 35  LYS A HA   9  
ATOM   9794  H  HB2  . LYS A 1 35 ? -3.464  5.040   4.483   1.00 0.00 ? 35  LYS A HB2  9  
ATOM   9795  H  HB3  . LYS A 1 35 ? -4.283  4.063   3.271   1.00 0.00 ? 35  LYS A HB3  9  
ATOM   9796  H  HG2  . LYS A 1 35 ? -4.854  6.244   2.715   1.00 0.00 ? 35  LYS A HG2  9  
ATOM   9797  H  HG3  . LYS A 1 35 ? -6.262  5.655   3.601   1.00 0.00 ? 35  LYS A HG3  9  
ATOM   9798  H  HD2  . LYS A 1 35 ? -4.996  6.672   5.663   1.00 0.00 ? 35  LYS A HD2  9  
ATOM   9799  H  HD3  . LYS A 1 35 ? -4.185  7.633   4.424   1.00 0.00 ? 35  LYS A HD3  9  
ATOM   9800  H  HE2  . LYS A 1 35 ? -7.179  7.413   4.622   1.00 0.00 ? 35  LYS A HE2  9  
ATOM   9801  H  HE3  . LYS A 1 35 ? -6.256  8.652   5.471   1.00 0.00 ? 35  LYS A HE3  9  
ATOM   9802  H  HZ1  . LYS A 1 35 ? -5.412  8.654   2.819   1.00 0.00 ? 35  LYS A HZ1  9  
ATOM   9803  H  HZ2  . LYS A 1 35 ? -6.289  9.852   3.629   1.00 0.00 ? 35  LYS A HZ2  9  
ATOM   9804  H  HZ3  . LYS A 1 35 ? -7.104  8.629   2.791   1.00 0.00 ? 35  LYS A HZ3  9  
ATOM   9805  N  N    . THR A 1 36 ? -5.350  1.820   4.018   1.00 0.00 ? 36  THR A N    9  
ATOM   9806  C  CA   . THR A 1 36 ? -5.132  0.405   3.746   1.00 0.00 ? 36  THR A CA   9  
ATOM   9807  C  C    . THR A 1 36 ? -4.409  0.205   2.419   1.00 0.00 ? 36  THR A C    9  
ATOM   9808  O  O    . THR A 1 36 ? -4.756  0.823   1.412   1.00 0.00 ? 36  THR A O    9  
ATOM   9809  C  CB   . THR A 1 36 ? -6.461  -0.373  3.715   1.00 0.00 ? 36  THR A CB   9  
ATOM   9810  O  OG1  . THR A 1 36 ? -7.315  0.156   2.694   1.00 0.00 ? 36  THR A OG1  9  
ATOM   9811  C  CG2  . THR A 1 36 ? -7.165  -0.296  5.062   1.00 0.00 ? 36  THR A CG2  9  
ATOM   9812  H  H    . THR A 1 36 ? -5.915  2.342   3.411   1.00 0.00 ? 36  THR A H    9  
ATOM   9813  H  HA   . THR A 1 36 ? -4.522  0.003   4.542   1.00 0.00 ? 36  THR A HA   9  
ATOM   9814  H  HB   . THR A 1 36 ? -6.249  -1.410  3.495   1.00 0.00 ? 36  THR A HB   9  
ATOM   9815  H  HG1  . THR A 1 36 ? -7.187  -0.339  1.882   1.00 0.00 ? 36  THR A HG1  9  
ATOM   9816  H  HG21 . THR A 1 36 ? -7.045  0.695   5.474   1.00 0.00 ? 36  THR A HG21 9  
ATOM   9817  H  HG22 . THR A 1 36 ? -6.733  -1.021  5.735   1.00 0.00 ? 36  THR A HG22 9  
ATOM   9818  H  HG23 . THR A 1 36 ? -8.215  -0.507  4.931   1.00 0.00 ? 36  THR A HG23 9  
ATOM   9819  N  N    . TYR A 1 37 ? -3.402  -0.662  2.424   1.00 0.00 ? 37  TYR A N    9  
ATOM   9820  C  CA   . TYR A 1 37 ? -2.628  -0.942  1.221   1.00 0.00 ? 37  TYR A CA   9  
ATOM   9821  C  C    . TYR A 1 37 ? -2.247  -2.418  1.149   1.00 0.00 ? 37  TYR A C    9  
ATOM   9822  O  O    . TYR A 1 37 ? -2.411  -3.161  2.117   1.00 0.00 ? 37  TYR A O    9  
ATOM   9823  C  CB   . TYR A 1 37 ? -1.369  -0.076  1.186   1.00 0.00 ? 37  TYR A CB   9  
ATOM   9824  C  CG   . TYR A 1 37 ? -1.655  1.409   1.153   1.00 0.00 ? 37  TYR A CG   9  
ATOM   9825  C  CD1  . TYR A 1 37 ? -1.839  2.074   -0.053  1.00 0.00 ? 37  TYR A CD1  9  
ATOM   9826  C  CD2  . TYR A 1 37 ? -1.741  2.146   2.328   1.00 0.00 ? 37  TYR A CD2  9  
ATOM   9827  C  CE1  . TYR A 1 37 ? -2.101  3.430   -0.088  1.00 0.00 ? 37  TYR A CE1  9  
ATOM   9828  C  CE2  . TYR A 1 37 ? -2.003  3.502   2.302   1.00 0.00 ? 37  TYR A CE2  9  
ATOM   9829  C  CZ   . TYR A 1 37 ? -2.182  4.139   1.092   1.00 0.00 ? 37  TYR A CZ   9  
ATOM   9830  O  OH   . TYR A 1 37 ? -2.443  5.490   1.062   1.00 0.00 ? 37  TYR A OH   9  
ATOM   9831  H  H    . TYR A 1 37 ? -3.173  -1.124  3.258   1.00 0.00 ? 37  TYR A H    9  
ATOM   9832  H  HA   . TYR A 1 37 ? -3.244  -0.700  0.367   1.00 0.00 ? 37  TYR A HA   9  
ATOM   9833  H  HB2  . TYR A 1 37 ? -0.776  -0.279  2.064   1.00 0.00 ? 37  TYR A HB2  9  
ATOM   9834  H  HB3  . TYR A 1 37 ? -0.794  -0.322  0.305   1.00 0.00 ? 37  TYR A HB3  9  
ATOM   9835  H  HD1  . TYR A 1 37 ? -1.775  1.515   -0.976  1.00 0.00 ? 37  TYR A HD1  9  
ATOM   9836  H  HD2  . TYR A 1 37 ? -1.600  1.644   3.274   1.00 0.00 ? 37  TYR A HD2  9  
ATOM   9837  H  HE1  . TYR A 1 37 ? -2.241  3.930   -1.035  1.00 0.00 ? 37  TYR A HE1  9  
ATOM   9838  H  HE2  . TYR A 1 37 ? -2.067  4.058   3.226   1.00 0.00 ? 37  TYR A HE2  9  
ATOM   9839  H  HH   . TYR A 1 37 ? -3.322  5.639   0.706   1.00 0.00 ? 37  TYR A HH   9  
ATOM   9840  N  N    . HIS A 1 38 ? -1.735  -2.835  -0.004  1.00 0.00 ? 38  HIS A N    9  
ATOM   9841  C  CA   . HIS A 1 38 ? -1.327  -4.221  -0.203  1.00 0.00 ? 38  HIS A CA   9  
ATOM   9842  C  C    . HIS A 1 38 ? 0.105   -4.440  0.275   1.00 0.00 ? 38  HIS A C    9  
ATOM   9843  O  O    . HIS A 1 38 ? 0.896   -3.504  0.394   1.00 0.00 ? 38  HIS A O    9  
ATOM   9844  C  CB   . HIS A 1 38 ? -1.449  -4.603  -1.679  1.00 0.00 ? 38  HIS A CB   9  
ATOM   9845  C  CG   . HIS A 1 38 ? -2.792  -5.155  -2.045  1.00 0.00 ? 38  HIS A CG   9  
ATOM   9846  N  ND1  . HIS A 1 38 ? -3.572  -4.630  -3.055  1.00 0.00 ? 38  HIS A ND1  9  
ATOM   9847  C  CD2  . HIS A 1 38 ? -3.493  -6.194  -1.533  1.00 0.00 ? 38  HIS A CD2  9  
ATOM   9848  C  CE1  . HIS A 1 38 ? -4.694  -5.320  -3.145  1.00 0.00 ? 38  HIS A CE1  9  
ATOM   9849  N  NE2  . HIS A 1 38 ? -4.671  -6.275  -2.233  1.00 0.00 ? 38  HIS A NE2  9  
ATOM   9850  H  H    . HIS A 1 38 ? -1.628  -2.195  -0.739  1.00 0.00 ? 38  HIS A H    9  
ATOM   9851  H  HA   . HIS A 1 38 ? -1.987  -4.847  0.378   1.00 0.00 ? 38  HIS A HA   9  
ATOM   9852  H  HB2  . HIS A 1 38 ? -1.273  -3.728  -2.286  1.00 0.00 ? 38  HIS A HB2  9  
ATOM   9853  H  HB3  . HIS A 1 38 ? -0.706  -5.353  -1.912  1.00 0.00 ? 38  HIS A HB3  9  
ATOM   9854  H  HD2  . HIS A 1 38 ? -3.184  -6.839  -0.722  1.00 0.00 ? 38  HIS A HD2  9  
ATOM   9855  H  HE1  . HIS A 1 38 ? -5.495  -5.137  -3.846  1.00 0.00 ? 38  HIS A HE1  9  
ATOM   9856  H  HE2  . HIS A 1 38 ? -5.416  -6.877  -2.027  1.00 0.00 ? 38  HIS A HE2  9  
ATOM   9857  N  N    . PRO A 1 39 ? 0.448   -5.706  0.557   1.00 0.00 ? 39  PRO A N    9  
ATOM   9858  C  CA   . PRO A 1 39 ? 1.786   -6.078  1.027   1.00 0.00 ? 39  PRO A CA   9  
ATOM   9859  C  C    . PRO A 1 39 ? 2.844   -5.930  -0.061  1.00 0.00 ? 39  PRO A C    9  
ATOM   9860  O  O    . PRO A 1 39 ? 4.033   -6.134  0.185   1.00 0.00 ? 39  PRO A O    9  
ATOM   9861  C  CB   . PRO A 1 39 ? 1.627   -7.548  1.422   1.00 0.00 ? 39  PRO A CB   9  
ATOM   9862  C  CG   . PRO A 1 39 ? 0.488   -8.041  0.598   1.00 0.00 ? 39  PRO A CG   9  
ATOM   9863  C  CD   . PRO A 1 39 ? -0.444  -6.872  0.438   1.00 0.00 ? 39  PRO A CD   9  
ATOM   9864  H  HA   . PRO A 1 39 ? 2.077   -5.500  1.892   1.00 0.00 ? 39  PRO A HA   9  
ATOM   9865  H  HB2  . PRO A 1 39 ? 2.539   -8.084  1.199   1.00 0.00 ? 39  PRO A HB2  9  
ATOM   9866  H  HB3  . PRO A 1 39 ? 1.411   -7.619  2.478   1.00 0.00 ? 39  PRO A HB3  9  
ATOM   9867  H  HG2  . PRO A 1 39 ? 0.847   -8.369  -0.365  1.00 0.00 ? 39  PRO A HG2  9  
ATOM   9868  H  HG3  . PRO A 1 39 ? -0.011  -8.850  1.110   1.00 0.00 ? 39  PRO A HG3  9  
ATOM   9869  H  HD2  . PRO A 1 39 ? -0.918  -6.897  -0.532  1.00 0.00 ? 39  PRO A HD2  9  
ATOM   9870  H  HD3  . PRO A 1 39 ? -1.186  -6.870  1.223   1.00 0.00 ? 39  PRO A HD3  9  
ATOM   9871  N  N    . ASP A 1 40 ? 2.405   -5.573  -1.263  1.00 0.00 ? 40  ASP A N    9  
ATOM   9872  C  CA   . ASP A 1 40 ? 3.315   -5.397  -2.388  1.00 0.00 ? 40  ASP A CA   9  
ATOM   9873  C  C    . ASP A 1 40 ? 3.151   -4.012  -3.008  1.00 0.00 ? 40  ASP A C    9  
ATOM   9874  O  O    . ASP A 1 40 ? 3.979   -3.576  -3.807  1.00 0.00 ? 40  ASP A O    9  
ATOM   9875  C  CB   . ASP A 1 40 ? 3.068   -6.474  -3.445  1.00 0.00 ? 40  ASP A CB   9  
ATOM   9876  C  CG   . ASP A 1 40 ? 3.866   -7.736  -3.183  1.00 0.00 ? 40  ASP A CG   9  
ATOM   9877  O  OD1  . ASP A 1 40 ? 4.949   -7.636  -2.570  1.00 0.00 ? 40  ASP A OD1  9  
ATOM   9878  O  OD2  . ASP A 1 40 ? 3.408   -8.824  -3.592  1.00 0.00 ? 40  ASP A OD2  9  
ATOM   9879  H  H    . ASP A 1 40 ? 1.445   -5.425  -1.396  1.00 0.00 ? 40  ASP A H    9  
ATOM   9880  H  HA   . ASP A 1 40 ? 4.324   -5.494  -2.017  1.00 0.00 ? 40  ASP A HA   9  
ATOM   9881  H  HB2  . ASP A 1 40 ? 2.018   -6.729  -3.452  1.00 0.00 ? 40  ASP A HB2  9  
ATOM   9882  H  HB3  . ASP A 1 40 ? 3.346   -6.088  -4.415  1.00 0.00 ? 40  ASP A HB3  9  
ATOM   9883  N  N    . CYS A 1 41 ? 2.076   -3.326  -2.633  1.00 0.00 ? 41  CYS A N    9  
ATOM   9884  C  CA   . CYS A 1 41 ? 1.802   -1.991  -3.152  1.00 0.00 ? 41  CYS A CA   9  
ATOM   9885  C  C    . CYS A 1 41 ? 2.447   -0.923  -2.274  1.00 0.00 ? 41  CYS A C    9  
ATOM   9886  O  O    . CYS A 1 41 ? 2.773   0.168   -2.743  1.00 0.00 ? 41  CYS A O    9  
ATOM   9887  C  CB   . CYS A 1 41 ? 0.293   -1.754  -3.237  1.00 0.00 ? 41  CYS A CB   9  
ATOM   9888  S  SG   . CYS A 1 41 ? -0.533  -2.688  -4.565  1.00 0.00 ? 41  CYS A SG   9  
ATOM   9889  H  H    . CYS A 1 41 ? 1.452   -3.727  -1.992  1.00 0.00 ? 41  CYS A H    9  
ATOM   9890  H  HA   . CYS A 1 41 ? 2.223   -1.927  -4.144  1.00 0.00 ? 41  CYS A HA   9  
ATOM   9891  H  HB2  . CYS A 1 41 ? -0.162  -2.044  -2.300  1.00 0.00 ? 41  CYS A HB2  9  
ATOM   9892  H  HB3  . CYS A 1 41 ? 0.110   -0.704  -3.409  1.00 0.00 ? 41  CYS A HB3  9  
ATOM   9893  N  N    . PHE A 1 42 ? 2.630   -1.245  -0.998  1.00 0.00 ? 42  PHE A N    9  
ATOM   9894  C  CA   . PHE A 1 42 ? 3.235   -0.313  -0.054  1.00 0.00 ? 42  PHE A CA   9  
ATOM   9895  C  C    . PHE A 1 42 ? 4.756   -0.321  -0.181  1.00 0.00 ? 42  PHE A C    9  
ATOM   9896  O  O    . PHE A 1 42 ? 5.474   -0.318  0.818   1.00 0.00 ? 42  PHE A O    9  
ATOM   9897  C  CB   . PHE A 1 42 ? 2.831   -0.670  1.378   1.00 0.00 ? 42  PHE A CB   9  
ATOM   9898  C  CG   . PHE A 1 42 ? 3.248   0.356   2.392   1.00 0.00 ? 42  PHE A CG   9  
ATOM   9899  C  CD1  . PHE A 1 42 ? 2.930   1.693   2.217   1.00 0.00 ? 42  PHE A CD1  9  
ATOM   9900  C  CD2  . PHE A 1 42 ? 3.959   -0.016  3.522   1.00 0.00 ? 42  PHE A CD2  9  
ATOM   9901  C  CE1  . PHE A 1 42 ? 3.314   2.639   3.148   1.00 0.00 ? 42  PHE A CE1  9  
ATOM   9902  C  CE2  . PHE A 1 42 ? 4.345   0.925   4.457   1.00 0.00 ? 42  PHE A CE2  9  
ATOM   9903  C  CZ   . PHE A 1 42 ? 4.021   2.255   4.270   1.00 0.00 ? 42  PHE A CZ   9  
ATOM   9904  H  H    . PHE A 1 42 ? 2.349   -2.130  -0.684  1.00 0.00 ? 42  PHE A H    9  
ATOM   9905  H  HA   . PHE A 1 42 ? 2.872   0.676   -0.286  1.00 0.00 ? 42  PHE A HA   9  
ATOM   9906  H  HB2  . PHE A 1 42 ? 1.756   -0.766  1.428   1.00 0.00 ? 42  PHE A HB2  9  
ATOM   9907  H  HB3  . PHE A 1 42 ? 3.285   -1.611  1.649   1.00 0.00 ? 42  PHE A HB3  9  
ATOM   9908  H  HD1  . PHE A 1 42 ? 2.375   1.995   1.340   1.00 0.00 ? 42  PHE A HD1  9  
ATOM   9909  H  HD2  . PHE A 1 42 ? 4.213   -1.057  3.669   1.00 0.00 ? 42  PHE A HD2  9  
ATOM   9910  H  HE1  . PHE A 1 42 ? 3.059   3.678   3.000   1.00 0.00 ? 42  PHE A HE1  9  
ATOM   9911  H  HE2  . PHE A 1 42 ? 4.898   0.621   5.333   1.00 0.00 ? 42  PHE A HE2  9  
ATOM   9912  H  HZ   . PHE A 1 42 ? 4.322   2.992   4.999   1.00 0.00 ? 42  PHE A HZ   9  
ATOM   9913  N  N    . VAL A 1 43 ? 5.240   -0.331  -1.419  1.00 0.00 ? 43  VAL A N    9  
ATOM   9914  C  CA   . VAL A 1 43 ? 6.674   -0.339  -1.679  1.00 0.00 ? 43  VAL A CA   9  
ATOM   9915  C  C    . VAL A 1 43 ? 7.112   0.940   -2.384  1.00 0.00 ? 43  VAL A C    9  
ATOM   9916  O  O    . VAL A 1 43 ? 6.281   1.742   -2.812  1.00 0.00 ? 43  VAL A O    9  
ATOM   9917  C  CB   . VAL A 1 43 ? 7.082   -1.551  -2.538  1.00 0.00 ? 43  VAL A CB   9  
ATOM   9918  C  CG1  . VAL A 1 43 ? 6.519   -2.836  -1.950  1.00 0.00 ? 43  VAL A CG1  9  
ATOM   9919  C  CG2  . VAL A 1 43 ? 6.620   -1.365  -3.975  1.00 0.00 ? 43  VAL A CG2  9  
ATOM   9920  H  H    . VAL A 1 43 ? 4.617   -0.333  -2.176  1.00 0.00 ? 43  VAL A H    9  
ATOM   9921  H  HA   . VAL A 1 43 ? 7.185   -0.409  -0.730  1.00 0.00 ? 43  VAL A HA   9  
ATOM   9922  H  HB   . VAL A 1 43 ? 8.160   -1.622  -2.535  1.00 0.00 ? 43  VAL A HB   9  
ATOM   9923  H  HG11 . VAL A 1 43 ? 5.605   -2.618  -1.417  1.00 0.00 ? 43  VAL A HG11 9  
ATOM   9924  H  HG12 . VAL A 1 43 ? 6.315   -3.537  -2.746  1.00 0.00 ? 43  VAL A HG12 9  
ATOM   9925  H  HG13 . VAL A 1 43 ? 7.239   -3.265  -1.268  1.00 0.00 ? 43  VAL A HG13 9  
ATOM   9926  H  HG21 . VAL A 1 43 ? 6.204   -2.292  -4.341  1.00 0.00 ? 43  VAL A HG21 9  
ATOM   9927  H  HG22 . VAL A 1 43 ? 5.866   -0.592  -4.014  1.00 0.00 ? 43  VAL A HG22 9  
ATOM   9928  H  HG23 . VAL A 1 43 ? 7.460   -1.079  -4.590  1.00 0.00 ? 43  VAL A HG23 9  
ATOM   9929  N  N    . CYS A 1 44 ? 8.422   1.124   -2.504  1.00 0.00 ? 44  CYS A N    9  
ATOM   9930  C  CA   . CYS A 1 44 ? 8.973   2.306   -3.157  1.00 0.00 ? 44  CYS A CA   9  
ATOM   9931  C  C    . CYS A 1 44 ? 8.197   2.634   -4.430  1.00 0.00 ? 44  CYS A C    9  
ATOM   9932  O  O    . CYS A 1 44 ? 7.453   1.802   -4.948  1.00 0.00 ? 44  CYS A O    9  
ATOM   9933  C  CB   . CYS A 1 44 ? 10.450  2.089   -3.489  1.00 0.00 ? 44  CYS A CB   9  
ATOM   9934  S  SG   . CYS A 1 44 ? 11.330  3.604   -3.990  1.00 0.00 ? 44  CYS A SG   9  
ATOM   9935  H  H    . CYS A 1 44 ? 9.036   0.449   -2.143  1.00 0.00 ? 44  CYS A H    9  
ATOM   9936  H  HA   . CYS A 1 44 ? 8.884   3.135   -2.472  1.00 0.00 ? 44  CYS A HA   9  
ATOM   9937  H  HB2  . CYS A 1 44 ? 10.952  1.692   -2.619  1.00 0.00 ? 44  CYS A HB2  9  
ATOM   9938  H  HB3  . CYS A 1 44 ? 10.529  1.379   -4.299  1.00 0.00 ? 44  CYS A HB3  9  
ATOM   9939  N  N    . ALA A 1 45 ? 8.377   3.853   -4.928  1.00 0.00 ? 45  ALA A N    9  
ATOM   9940  C  CA   . ALA A 1 45 ? 7.697   4.291   -6.140  1.00 0.00 ? 45  ALA A CA   9  
ATOM   9941  C  C    . ALA A 1 45 ? 8.641   4.269   -7.338  1.00 0.00 ? 45  ALA A C    9  
ATOM   9942  O  O    . ALA A 1 45 ? 8.201   4.227   -8.487  1.00 0.00 ? 45  ALA A O    9  
ATOM   9943  C  CB   . ALA A 1 45 ? 7.119   5.685   -5.947  1.00 0.00 ? 45  ALA A CB   9  
ATOM   9944  H  H    . ALA A 1 45 ? 8.983   4.472   -4.470  1.00 0.00 ? 45  ALA A H    9  
ATOM   9945  H  HA   . ALA A 1 45 ? 6.878   3.611   -6.328  1.00 0.00 ? 45  ALA A HA   9  
ATOM   9946  H  HB1  . ALA A 1 45 ? 7.066   6.187   -6.902  1.00 0.00 ? 45  ALA A HB1  9  
ATOM   9947  H  HB2  . ALA A 1 45 ? 6.129   5.609   -5.524  1.00 0.00 ? 45  ALA A HB2  9  
ATOM   9948  H  HB3  . ALA A 1 45 ? 7.754   6.248   -5.279  1.00 0.00 ? 45  ALA A HB3  9  
ATOM   9949  N  N    . VAL A 1 46 ? 9.941   4.299   -7.061  1.00 0.00 ? 46  VAL A N    9  
ATOM   9950  C  CA   . VAL A 1 46 ? 10.947  4.282   -8.116  1.00 0.00 ? 46  VAL A CA   9  
ATOM   9951  C  C    . VAL A 1 46 ? 11.400  2.859   -8.421  1.00 0.00 ? 46  VAL A C    9  
ATOM   9952  O  O    . VAL A 1 46 ? 11.076  2.304   -9.472  1.00 0.00 ? 46  VAL A O    9  
ATOM   9953  C  CB   . VAL A 1 46 ? 12.176  5.129   -7.734  1.00 0.00 ? 46  VAL A CB   9  
ATOM   9954  C  CG1  . VAL A 1 46 ? 13.141  5.229   -8.905  1.00 0.00 ? 46  VAL A CG1  9  
ATOM   9955  C  CG2  . VAL A 1 46 ? 11.745  6.512   -7.268  1.00 0.00 ? 46  VAL A CG2  9  
ATOM   9956  H  H    . VAL A 1 46 ? 10.230  4.333   -6.126  1.00 0.00 ? 46  VAL A H    9  
ATOM   9957  H  HA   . VAL A 1 46 ? 10.506  4.708   -9.006  1.00 0.00 ? 46  VAL A HA   9  
ATOM   9958  H  HB   . VAL A 1 46 ? 12.685  4.640   -6.917  1.00 0.00 ? 46  VAL A HB   9  
ATOM   9959  H  HG11 . VAL A 1 46 ? 12.738  4.690   -9.750  1.00 0.00 ? 46  VAL A HG11 9  
ATOM   9960  H  HG12 . VAL A 1 46 ? 13.281  6.266   -9.170  1.00 0.00 ? 46  VAL A HG12 9  
ATOM   9961  H  HG13 . VAL A 1 46 ? 14.092  4.798   -8.625  1.00 0.00 ? 46  VAL A HG13 9  
ATOM   9962  H  HG21 . VAL A 1 46 ? 11.367  7.073   -8.110  1.00 0.00 ? 46  VAL A HG21 9  
ATOM   9963  H  HG22 . VAL A 1 46 ? 10.969  6.416   -6.522  1.00 0.00 ? 46  VAL A HG22 9  
ATOM   9964  H  HG23 . VAL A 1 46 ? 12.592  7.029   -6.842  1.00 0.00 ? 46  VAL A HG23 9  
ATOM   9965  N  N    . CYS A 1 47 ? 12.150  2.271   -7.496  1.00 0.00 ? 47  CYS A N    9  
ATOM   9966  C  CA   . CYS A 1 47 ? 12.649  0.912   -7.664  1.00 0.00 ? 47  CYS A CA   9  
ATOM   9967  C  C    . CYS A 1 47 ? 11.559  -0.109  -7.350  1.00 0.00 ? 47  CYS A C    9  
ATOM   9968  O  O    . CYS A 1 47 ? 11.639  -1.265  -7.766  1.00 0.00 ? 47  CYS A O    9  
ATOM   9969  C  CB   . CYS A 1 47 ? 13.861  0.675   -6.761  1.00 0.00 ? 47  CYS A CB   9  
ATOM   9970  S  SG   . CYS A 1 47 ? 13.470  0.653   -4.982  1.00 0.00 ? 47  CYS A SG   9  
ATOM   9971  H  H    . CYS A 1 47 ? 12.376  2.765   -6.678  1.00 0.00 ? 47  CYS A H    9  
ATOM   9972  H  HA   . CYS A 1 47 ? 12.949  0.794   -8.694  1.00 0.00 ? 47  CYS A HA   9  
ATOM   9973  H  HB2  . CYS A 1 47 ? 14.305  -0.278  -7.010  1.00 0.00 ? 47  CYS A HB2  9  
ATOM   9974  H  HB3  . CYS A 1 47 ? 14.584  1.459   -6.930  1.00 0.00 ? 47  CYS A HB3  9  
ATOM   9975  N  N    . ARG A 1 48 ? 10.543  0.326   -6.613  1.00 0.00 ? 48  ARG A N    9  
ATOM   9976  C  CA   . ARG A 1 48 ? 9.438   -0.550  -6.242  1.00 0.00 ? 48  ARG A CA   9  
ATOM   9977  C  C    . ARG A 1 48 ? 9.932   -1.720  -5.396  1.00 0.00 ? 48  ARG A C    9  
ATOM   9978  O  O    . ARG A 1 48 ? 9.549   -2.869  -5.623  1.00 0.00 ? 48  ARG A O    9  
ATOM   9979  C  CB   . ARG A 1 48 ? 8.732   -1.074  -7.494  1.00 0.00 ? 48  ARG A CB   9  
ATOM   9980  C  CG   . ARG A 1 48 ? 8.205   0.026   -8.401  1.00 0.00 ? 48  ARG A CG   9  
ATOM   9981  C  CD   . ARG A 1 48 ? 6.801   0.453   -8.001  1.00 0.00 ? 48  ARG A CD   9  
ATOM   9982  N  NE   . ARG A 1 48 ? 6.381   1.669   -8.694  1.00 0.00 ? 48  ARG A NE   9  
ATOM   9983  C  CZ   . ARG A 1 48 ? 5.960   1.689   -9.954  1.00 0.00 ? 48  ARG A CZ   9  
ATOM   9984  N  NH1  . ARG A 1 48 ? 5.904   0.565   -10.655 1.00 0.00 ? 48  ARG A NH1  9  
ATOM   9985  N  NH2  . ARG A 1 48 ? 5.595   2.835   -10.514 1.00 0.00 ? 48  ARG A NH2  9  
ATOM   9986  H  H    . ARG A 1 48 ? 10.535  1.258   -6.311  1.00 0.00 ? 48  ARG A H    9  
ATOM   9987  H  HA   . ARG A 1 48 ? 8.736   0.029   -5.660  1.00 0.00 ? 48  ARG A HA   9  
ATOM   9988  H  HB2  . ARG A 1 48 ? 9.428   -1.675  -8.061  1.00 0.00 ? 48  ARG A HB2  9  
ATOM   9989  H  HB3  . ARG A 1 48 ? 7.899   -1.691  -7.191  1.00 0.00 ? 48  ARG A HB3  9  
ATOM   9990  H  HG2  . ARG A 1 48 ? 8.862   0.881   -8.335  1.00 0.00 ? 48  ARG A HG2  9  
ATOM   9991  H  HG3  . ARG A 1 48 ? 8.185   -0.338  -9.418  1.00 0.00 ? 48  ARG A HG3  9  
ATOM   9992  H  HD2  . ARG A 1 48 ? 6.114   -0.343  -8.244  1.00 0.00 ? 48  ARG A HD2  9  
ATOM   9993  H  HD3  . ARG A 1 48 ? 6.783   0.632   -6.937  1.00 0.00 ? 48  ARG A HD3  9  
ATOM   9994  H  HE   . ARG A 1 48 ? 6.415   2.510   -8.194  1.00 0.00 ? 48  ARG A HE   9  
ATOM   9995  H  HH11 . ARG A 1 48 ? 6.178   -0.300  -10.235 1.00 0.00 ? 48  ARG A HH11 9  
ATOM   9996  H  HH12 . ARG A 1 48 ? 5.586   0.583   -11.603 1.00 0.00 ? 48  ARG A HH12 9  
ATOM   9997  H  HH21 . ARG A 1 48 ? 5.636   3.684   -9.988  1.00 0.00 ? 48  ARG A HH21 9  
ATOM   9998  H  HH22 . ARG A 1 48 ? 5.279   2.849   -11.462 1.00 0.00 ? 48  ARG A HH22 9  
ATOM   9999  N  N    . LEU A 1 49 ? 10.783  -1.421  -4.422  1.00 0.00 ? 49  LEU A N    9  
ATOM   10000 C  CA   . LEU A 1 49 ? 11.330  -2.447  -3.542  1.00 0.00 ? 49  LEU A CA   9  
ATOM   10001 C  C    . LEU A 1 49 ? 10.719  -2.352  -2.148  1.00 0.00 ? 49  LEU A C    9  
ATOM   10002 O  O    . LEU A 1 49 ? 10.544  -1.267  -1.592  1.00 0.00 ? 49  LEU A O    9  
ATOM   10003 C  CB   . LEU A 1 49 ? 12.852  -2.314  -3.454  1.00 0.00 ? 49  LEU A CB   9  
ATOM   10004 C  CG   . LEU A 1 49 ? 13.636  -2.745  -4.693  1.00 0.00 ? 49  LEU A CG   9  
ATOM   10005 C  CD1  . LEU A 1 49 ? 15.071  -2.247  -4.617  1.00 0.00 ? 49  LEU A CD1  9  
ATOM   10006 C  CD2  . LEU A 1 49 ? 13.602  -4.258  -4.846  1.00 0.00 ? 49  LEU A CD2  9  
ATOM   10007 H  H    . LEU A 1 49 ? 11.051  -0.487  -4.290  1.00 0.00 ? 49  LEU A H    9  
ATOM   10008 H  HA   . LEU A 1 49 ? 11.085  -3.410  -3.964  1.00 0.00 ? 49  LEU A HA   9  
ATOM   10009 H  HB2  . LEU A 1 49 ? 13.082  -1.277  -3.261  1.00 0.00 ? 49  LEU A HB2  9  
ATOM   10010 H  HB3  . LEU A 1 49 ? 13.188  -2.916  -2.622  1.00 0.00 ? 49  LEU A HB3  9  
ATOM   10011 H  HG   . LEU A 1 49 ? 13.178  -2.309  -5.571  1.00 0.00 ? 49  LEU A HG   9  
ATOM   10012 H  HD11 . LEU A 1 49 ? 15.747  -3.086  -4.682  1.00 0.00 ? 49  LEU A HD11 9  
ATOM   10013 H  HD12 . LEU A 1 49 ? 15.224  -1.732  -3.680  1.00 0.00 ? 49  LEU A HD12 9  
ATOM   10014 H  HD13 . LEU A 1 49 ? 15.260  -1.567  -5.435  1.00 0.00 ? 49  LEU A HD13 9  
ATOM   10015 H  HD21 . LEU A 1 49 ? 12.808  -4.663  -4.237  1.00 0.00 ? 49  LEU A HD21 9  
ATOM   10016 H  HD22 . LEU A 1 49 ? 14.547  -4.673  -4.527  1.00 0.00 ? 49  LEU A HD22 9  
ATOM   10017 H  HD23 . LEU A 1 49 ? 13.428  -4.512  -5.882  1.00 0.00 ? 49  LEU A HD23 9  
ATOM   10018 N  N    . PRO A 1 50 ? 10.387  -3.515  -1.566  1.00 0.00 ? 50  PRO A N    9  
ATOM   10019 C  CA   . PRO A 1 50 ? 9.792   -3.589  -0.228  1.00 0.00 ? 50  PRO A CA   9  
ATOM   10020 C  C    . PRO A 1 50 ? 10.782  -3.211  0.868   1.00 0.00 ? 50  PRO A C    9  
ATOM   10021 O  O    . PRO A 1 50 ? 11.891  -3.743  0.928   1.00 0.00 ? 50  PRO A O    9  
ATOM   10022 C  CB   . PRO A 1 50 ? 9.390   -5.060  -0.101  1.00 0.00 ? 50  PRO A CB   9  
ATOM   10023 C  CG   . PRO A 1 50 ? 10.305  -5.785  -1.026  1.00 0.00 ? 50  PRO A CG   9  
ATOM   10024 C  CD   . PRO A 1 50 ? 10.567  -4.846  -2.170  1.00 0.00 ? 50  PRO A CD   9  
ATOM   10025 H  HA   . PRO A 1 50 ? 8.914   -2.965  -0.149  1.00 0.00 ? 50  PRO A HA   9  
ATOM   10026 H  HB2  . PRO A 1 50 ? 9.522   -5.385  0.922   1.00 0.00 ? 50  PRO A HB2  9  
ATOM   10027 H  HB3  . PRO A 1 50 ? 8.357   -5.181  -0.392  1.00 0.00 ? 50  PRO A HB3  9  
ATOM   10028 H  HG2  . PRO A 1 50 ? 11.227  -6.024  -0.518  1.00 0.00 ? 50  PRO A HG2  9  
ATOM   10029 H  HG3  . PRO A 1 50 ? 9.828   -6.686  -1.383  1.00 0.00 ? 50  PRO A HG3  9  
ATOM   10030 H  HD2  . PRO A 1 50 ? 11.575  -4.969  -2.537  1.00 0.00 ? 50  PRO A HD2  9  
ATOM   10031 H  HD3  . PRO A 1 50 ? 9.852   -5.008  -2.963  1.00 0.00 ? 50  PRO A HD3  9  
ATOM   10032 N  N    . PHE A 1 51 ? 10.375  -2.289  1.734   1.00 0.00 ? 51  PHE A N    9  
ATOM   10033 C  CA   . PHE A 1 51 ? 11.227  -1.839  2.828   1.00 0.00 ? 51  PHE A CA   9  
ATOM   10034 C  C    . PHE A 1 51 ? 11.336  -2.910  3.909   1.00 0.00 ? 51  PHE A C    9  
ATOM   10035 O  O    . PHE A 1 51 ? 10.363  -3.583  4.252   1.00 0.00 ? 51  PHE A O    9  
ATOM   10036 C  CB   . PHE A 1 51 ? 10.678  -0.544  3.431   1.00 0.00 ? 51  PHE A CB   9  
ATOM   10037 C  CG   . PHE A 1 51 ? 10.066  0.378   2.416   1.00 0.00 ? 51  PHE A CG   9  
ATOM   10038 C  CD1  . PHE A 1 51 ? 10.833  0.909   1.391   1.00 0.00 ? 51  PHE A CD1  9  
ATOM   10039 C  CD2  . PHE A 1 51 ? 8.723   0.713   2.485   1.00 0.00 ? 51  PHE A CD2  9  
ATOM   10040 C  CE1  . PHE A 1 51 ? 10.272  1.757   0.456   1.00 0.00 ? 51  PHE A CE1  9  
ATOM   10041 C  CE2  . PHE A 1 51 ? 8.157   1.561   1.553   1.00 0.00 ? 51  PHE A CE2  9  
ATOM   10042 C  CZ   . PHE A 1 51 ? 8.932   2.083   0.536   1.00 0.00 ? 51  PHE A CZ   9  
ATOM   10043 H  H    . PHE A 1 51 ? 9.480   -1.901  1.634   1.00 0.00 ? 51  PHE A H    9  
ATOM   10044 H  HA   . PHE A 1 51 ? 12.211  -1.650  2.426   1.00 0.00 ? 51  PHE A HA   9  
ATOM   10045 H  HB2  . PHE A 1 51 ? 9.918   -0.788  4.158   1.00 0.00 ? 51  PHE A HB2  9  
ATOM   10046 H  HB3  . PHE A 1 51 ? 11.482  -0.014  3.920   1.00 0.00 ? 51  PHE A HB3  9  
ATOM   10047 H  HD1  . PHE A 1 51 ? 11.881  0.654   1.327   1.00 0.00 ? 51  PHE A HD1  9  
ATOM   10048 H  HD2  . PHE A 1 51 ? 8.116   0.304   3.281   1.00 0.00 ? 51  PHE A HD2  9  
ATOM   10049 H  HE1  . PHE A 1 51 ? 10.880  2.164   -0.338  1.00 0.00 ? 51  PHE A HE1  9  
ATOM   10050 H  HE2  . PHE A 1 51 ? 7.109   1.813   1.618   1.00 0.00 ? 51  PHE A HE2  9  
ATOM   10051 H  HZ   . PHE A 1 51 ? 8.491   2.746   -0.193  1.00 0.00 ? 51  PHE A HZ   9  
ATOM   10052 N  N    . PRO A 1 52 ? 12.548  -3.074  4.460   1.00 0.00 ? 52  PRO A N    9  
ATOM   10053 C  CA   . PRO A 1 52 ? 12.814  -4.063  5.509   1.00 0.00 ? 52  PRO A CA   9  
ATOM   10054 C  C    . PRO A 1 52 ? 12.154  -3.693  6.834   1.00 0.00 ? 52  PRO A C    9  
ATOM   10055 O  O    . PRO A 1 52 ? 11.786  -2.542  7.071   1.00 0.00 ? 52  PRO A O    9  
ATOM   10056 C  CB   . PRO A 1 52 ? 14.338  -4.035  5.645   1.00 0.00 ? 52  PRO A CB   9  
ATOM   10057 C  CG   . PRO A 1 52 ? 14.736  -2.678  5.175   1.00 0.00 ? 52  PRO A CG   9  
ATOM   10058 C  CD   . PRO A 1 52 ? 13.753  -2.308  4.100   1.00 0.00 ? 52  PRO A CD   9  
ATOM   10059 H  HA   . PRO A 1 52 ? 12.495  -5.051  5.213   1.00 0.00 ? 52  PRO A HA   9  
ATOM   10060 H  HB2  . PRO A 1 52 ? 14.613  -4.193  6.678   1.00 0.00 ? 52  PRO A HB2  9  
ATOM   10061 H  HB3  . PRO A 1 52 ? 14.772  -4.809  5.029   1.00 0.00 ? 52  PRO A HB3  9  
ATOM   10062 H  HG2  . PRO A 1 52 ? 14.680  -1.976  5.993   1.00 0.00 ? 52  PRO A HG2  9  
ATOM   10063 H  HG3  . PRO A 1 52 ? 15.737  -2.709  4.773   1.00 0.00 ? 52  PRO A HG3  9  
ATOM   10064 H  HD2  . PRO A 1 52 ? 13.554  -1.246  4.119   1.00 0.00 ? 52  PRO A HD2  9  
ATOM   10065 H  HD3  . PRO A 1 52 ? 14.123  -2.606  3.130   1.00 0.00 ? 52  PRO A HD3  9  
ATOM   10066 N  N    . PRO A 1 53 ? 12.002  -4.689  7.718   1.00 0.00 ? 53  PRO A N    9  
ATOM   10067 C  CA   . PRO A 1 53 ? 11.387  -4.492  9.034   1.00 0.00 ? 53  PRO A CA   9  
ATOM   10068 C  C    . PRO A 1 53 ? 12.267  -3.668  9.968   1.00 0.00 ? 53  PRO A C    9  
ATOM   10069 O  O    . PRO A 1 53 ? 13.233  -4.176  10.536  1.00 0.00 ? 53  PRO A O    9  
ATOM   10070 C  CB   . PRO A 1 53 ? 11.230  -5.918  9.569   1.00 0.00 ? 53  PRO A CB   9  
ATOM   10071 C  CG   . PRO A 1 53 ? 12.280  -6.705  8.865   1.00 0.00 ? 53  PRO A CG   9  
ATOM   10072 C  CD   . PRO A 1 53 ? 12.418  -6.085  7.502   1.00 0.00 ? 53  PRO A CD   9  
ATOM   10073 H  HA   . PRO A 1 53 ? 10.416  -4.027  8.953   1.00 0.00 ? 53  PRO A HA   9  
ATOM   10074 H  HB2  . PRO A 1 53 ? 11.382  -5.923  10.639  1.00 0.00 ? 53  PRO A HB2  9  
ATOM   10075 H  HB3  . PRO A 1 53 ? 10.241  -6.285  9.339   1.00 0.00 ? 53  PRO A HB3  9  
ATOM   10076 H  HG2  . PRO A 1 53 ? 13.213  -6.638  9.404   1.00 0.00 ? 53  PRO A HG2  9  
ATOM   10077 H  HG3  . PRO A 1 53 ? 11.969  -7.736  8.778   1.00 0.00 ? 53  PRO A HG3  9  
ATOM   10078 H  HD2  . PRO A 1 53 ? 13.443  -6.135  7.167   1.00 0.00 ? 53  PRO A HD2  9  
ATOM   10079 H  HD3  . PRO A 1 53 ? 11.764  -6.577  6.796   1.00 0.00 ? 53  PRO A HD3  9  
ATOM   10080 N  N    . GLY A 1 54 ? 11.927  -2.392  10.121  1.00 0.00 ? 54  GLY A N    9  
ATOM   10081 C  CA   . GLY A 1 54 ? 12.696  -1.517  10.986  1.00 0.00 ? 54  GLY A CA   9  
ATOM   10082 C  C    . GLY A 1 54 ? 13.543  -0.530  10.208  1.00 0.00 ? 54  GLY A C    9  
ATOM   10083 O  O    . GLY A 1 54 ? 14.734  -0.373  10.480  1.00 0.00 ? 54  GLY A O    9  
ATOM   10084 H  H    . GLY A 1 54 ? 11.147  -2.041  9.642   1.00 0.00 ? 54  GLY A H    9  
ATOM   10085 H  HA2  . GLY A 1 54 ? 12.017  -0.970  11.623  1.00 0.00 ? 54  GLY A HA2  9  
ATOM   10086 H  HA3  . GLY A 1 54 ? 13.345  -2.121  11.604  1.00 0.00 ? 54  GLY A HA3  9  
ATOM   10087 N  N    . ASP A 1 55 ? 12.929  0.137   9.237   1.00 0.00 ? 55  ASP A N    9  
ATOM   10088 C  CA   . ASP A 1 55 ? 13.635  1.114   8.416   1.00 0.00 ? 55  ASP A CA   9  
ATOM   10089 C  C    . ASP A 1 55 ? 12.866  2.431   8.358   1.00 0.00 ? 55  ASP A C    9  
ATOM   10090 O  O    . ASP A 1 55 ? 11.641  2.452   8.477   1.00 0.00 ? 55  ASP A O    9  
ATOM   10091 C  CB   . ASP A 1 55 ? 13.844  0.569   7.003   1.00 0.00 ? 55  ASP A CB   9  
ATOM   10092 C  CG   . ASP A 1 55 ? 14.420  1.608   6.060   1.00 0.00 ? 55  ASP A CG   9  
ATOM   10093 O  OD1  . ASP A 1 55 ? 13.661  2.499   5.625   1.00 0.00 ? 55  ASP A OD1  9  
ATOM   10094 O  OD2  . ASP A 1 55 ? 15.629  1.529   5.758   1.00 0.00 ? 55  ASP A OD2  9  
ATOM   10095 H  H    . ASP A 1 55 ? 11.978  -0.032  9.069   1.00 0.00 ? 55  ASP A H    9  
ATOM   10096 H  HA   . ASP A 1 55 ? 14.598  1.294   8.869   1.00 0.00 ? 55  ASP A HA   9  
ATOM   10097 H  HB2  . ASP A 1 55 ? 14.525  -0.269  7.044   1.00 0.00 ? 55  ASP A HB2  9  
ATOM   10098 H  HB3  . ASP A 1 55 ? 12.895  0.237   6.608   1.00 0.00 ? 55  ASP A HB3  9  
ATOM   10099 N  N    . ARG A 1 56 ? 13.595  3.528   8.176   1.00 0.00 ? 56  ARG A N    9  
ATOM   10100 C  CA   . ARG A 1 56 ? 12.982  4.848   8.104   1.00 0.00 ? 56  ARG A CA   9  
ATOM   10101 C  C    . ARG A 1 56 ? 12.464  5.133   6.697   1.00 0.00 ? 56  ARG A C    9  
ATOM   10102 O  O    . ARG A 1 56 ? 13.244  5.369   5.774   1.00 0.00 ? 56  ARG A O    9  
ATOM   10103 C  CB   . ARG A 1 56 ? 13.989  5.924   8.516   1.00 0.00 ? 56  ARG A CB   9  
ATOM   10104 C  CG   . ARG A 1 56 ? 14.315  5.918   10.000  1.00 0.00 ? 56  ARG A CG   9  
ATOM   10105 C  CD   . ARG A 1 56 ? 15.073  7.170   10.410  1.00 0.00 ? 56  ARG A CD   9  
ATOM   10106 N  NE   . ARG A 1 56 ? 14.864  7.501   11.817  1.00 0.00 ? 56  ARG A NE   9  
ATOM   10107 C  CZ   . ARG A 1 56 ? 15.077  8.709   12.327  1.00 0.00 ? 56  ARG A CZ   9  
ATOM   10108 N  NH1  . ARG A 1 56 ? 15.503  9.695   11.549  1.00 0.00 ? 56  ARG A NH1  9  
ATOM   10109 N  NH2  . ARG A 1 56 ? 14.864  8.933   13.617  1.00 0.00 ? 56  ARG A NH2  9  
ATOM   10110 H  H    . ARG A 1 56 ? 14.567  3.447   8.088   1.00 0.00 ? 56  ARG A H    9  
ATOM   10111 H  HA   . ARG A 1 56 ? 12.149  4.866   8.791   1.00 0.00 ? 56  ARG A HA   9  
ATOM   10112 H  HB2  . ARG A 1 56 ? 14.907  5.770   7.968   1.00 0.00 ? 56  ARG A HB2  9  
ATOM   10113 H  HB3  . ARG A 1 56 ? 13.586  6.893   8.262   1.00 0.00 ? 56  ARG A HB3  9  
ATOM   10114 H  HG2  . ARG A 1 56 ? 13.393  5.869   10.562  1.00 0.00 ? 56  ARG A HG2  9  
ATOM   10115 H  HG3  . ARG A 1 56 ? 14.920  5.051   10.222  1.00 0.00 ? 56  ARG A HG3  9  
ATOM   10116 H  HD2  . ARG A 1 56 ? 16.127  7.008   10.241  1.00 0.00 ? 56  ARG A HD2  9  
ATOM   10117 H  HD3  . ARG A 1 56 ? 14.735  7.995   9.801   1.00 0.00 ? 56  ARG A HD3  9  
ATOM   10118 H  HE   . ARG A 1 56 ? 14.550  6.788   12.409  1.00 0.00 ? 56  ARG A HE   9  
ATOM   10119 H  HH11 . ARG A 1 56 ? 15.664  9.530   10.576  1.00 0.00 ? 56  ARG A HH11 9  
ATOM   10120 H  HH12 . ARG A 1 56 ? 15.662  10.604  11.936  1.00 0.00 ? 56  ARG A HH12 9  
ATOM   10121 H  HH21 . ARG A 1 56 ? 14.543  8.192   14.206  1.00 0.00 ? 56  ARG A HH21 9  
ATOM   10122 H  HH22 . ARG A 1 56 ? 15.025  9.842   14.000  1.00 0.00 ? 56  ARG A HH22 9  
ATOM   10123 N  N    . VAL A 1 57 ? 11.145  5.107   6.541   1.00 0.00 ? 57  VAL A N    9  
ATOM   10124 C  CA   . VAL A 1 57 ? 10.523  5.362   5.247   1.00 0.00 ? 57  VAL A CA   9  
ATOM   10125 C  C    . VAL A 1 57 ? 10.424  6.858   4.970   1.00 0.00 ? 57  VAL A C    9  
ATOM   10126 O  O    . VAL A 1 57 ? 10.148  7.651   5.871   1.00 0.00 ? 57  VAL A O    9  
ATOM   10127 C  CB   . VAL A 1 57 ? 9.114   4.743   5.170   1.00 0.00 ? 57  VAL A CB   9  
ATOM   10128 C  CG1  . VAL A 1 57 ? 8.439   5.116   3.859   1.00 0.00 ? 57  VAL A CG1  9  
ATOM   10129 C  CG2  . VAL A 1 57 ? 9.188   3.232   5.330   1.00 0.00 ? 57  VAL A CG2  9  
ATOM   10130 H  H    . VAL A 1 57 ? 10.576  4.913   7.315   1.00 0.00 ? 57  VAL A H    9  
ATOM   10131 H  HA   . VAL A 1 57 ? 11.137  4.904   4.485   1.00 0.00 ? 57  VAL A HA   9  
ATOM   10132 H  HB   . VAL A 1 57 ? 8.523   5.142   5.980   1.00 0.00 ? 57  VAL A HB   9  
ATOM   10133 H  HG11 . VAL A 1 57 ? 9.166   5.555   3.192   1.00 0.00 ? 57  VAL A HG11 9  
ATOM   10134 H  HG12 . VAL A 1 57 ? 8.020   4.229   3.405   1.00 0.00 ? 57  VAL A HG12 9  
ATOM   10135 H  HG13 . VAL A 1 57 ? 7.650   5.829   4.051   1.00 0.00 ? 57  VAL A HG13 9  
ATOM   10136 H  HG21 . VAL A 1 57 ? 9.322   2.774   4.362   1.00 0.00 ? 57  VAL A HG21 9  
ATOM   10137 H  HG22 . VAL A 1 57 ? 10.023  2.977   5.967   1.00 0.00 ? 57  VAL A HG22 9  
ATOM   10138 H  HG23 . VAL A 1 57 ? 8.273   2.872   5.776   1.00 0.00 ? 57  VAL A HG23 9  
ATOM   10139 N  N    . THR A 1 58 ? 10.651  7.239   3.717   1.00 0.00 ? 58  THR A N    9  
ATOM   10140 C  CA   . THR A 1 58 ? 10.588  8.640   3.320   1.00 0.00 ? 58  THR A CA   9  
ATOM   10141 C  C    . THR A 1 58 ? 9.253   8.965   2.661   1.00 0.00 ? 58  THR A C    9  
ATOM   10142 O  O    . THR A 1 58 ? 8.846   8.309   1.702   1.00 0.00 ? 58  THR A O    9  
ATOM   10143 C  CB   . THR A 1 58 ? 11.729  9.000   2.349   1.00 0.00 ? 58  THR A CB   9  
ATOM   10144 O  OG1  . THR A 1 58 ? 12.972  8.488   2.842   1.00 0.00 ? 58  THR A OG1  9  
ATOM   10145 C  CG2  . THR A 1 58 ? 11.830  10.507  2.170   1.00 0.00 ? 58  THR A CG2  9  
ATOM   10146 H  H    . THR A 1 58 ? 10.866  6.559   3.044   1.00 0.00 ? 58  THR A H    9  
ATOM   10147 H  HA   . THR A 1 58 ? 10.697  9.243   4.210   1.00 0.00 ? 58  THR A HA   9  
ATOM   10148 H  HB   . THR A 1 58 ? 11.519  8.551   1.389   1.00 0.00 ? 58  THR A HB   9  
ATOM   10149 H  HG1  . THR A 1 58 ? 13.693  9.037   2.523   1.00 0.00 ? 58  THR A HG1  9  
ATOM   10150 H  HG21 . THR A 1 58 ? 12.725  10.868  2.655   1.00 0.00 ? 58  THR A HG21 9  
ATOM   10151 H  HG22 . THR A 1 58 ? 10.965  10.981  2.609   1.00 0.00 ? 58  THR A HG22 9  
ATOM   10152 H  HG23 . THR A 1 58 ? 11.873  10.741  1.117   1.00 0.00 ? 58  THR A HG23 9  
ATOM   10153 N  N    . PHE A 1 59 ? 8.575   9.983   3.181   1.00 0.00 ? 59  PHE A N    9  
ATOM   10154 C  CA   . PHE A 1 59 ? 7.284   10.396  2.643   1.00 0.00 ? 59  PHE A CA   9  
ATOM   10155 C  C    . PHE A 1 59 ? 7.430   11.643  1.775   1.00 0.00 ? 59  PHE A C    9  
ATOM   10156 O  O    . PHE A 1 59 ? 7.615   12.748  2.283   1.00 0.00 ? 59  PHE A O    9  
ATOM   10157 C  CB   . PHE A 1 59 ? 6.296   10.666  3.779   1.00 0.00 ? 59  PHE A CB   9  
ATOM   10158 C  CG   . PHE A 1 59 ? 4.858   10.543  3.365   1.00 0.00 ? 59  PHE A CG   9  
ATOM   10159 C  CD1  . PHE A 1 59 ? 4.205   9.323   3.433   1.00 0.00 ? 59  PHE A CD1  9  
ATOM   10160 C  CD2  . PHE A 1 59 ? 4.158   11.648  2.907   1.00 0.00 ? 59  PHE A CD2  9  
ATOM   10161 C  CE1  . PHE A 1 59 ? 2.881   9.206   3.053   1.00 0.00 ? 59  PHE A CE1  9  
ATOM   10162 C  CE2  . PHE A 1 59 ? 2.834   11.538  2.526   1.00 0.00 ? 59  PHE A CE2  9  
ATOM   10163 C  CZ   . PHE A 1 59 ? 2.195   10.315  2.598   1.00 0.00 ? 59  PHE A CZ   9  
ATOM   10164 H  H    . PHE A 1 59 ? 8.952   10.468  3.945   1.00 0.00 ? 59  PHE A H    9  
ATOM   10165 H  HA   . PHE A 1 59 ? 6.907   9.590   2.033   1.00 0.00 ? 59  PHE A HA   9  
ATOM   10166 H  HB2  . PHE A 1 59 ? 6.473   9.959   4.576   1.00 0.00 ? 59  PHE A HB2  9  
ATOM   10167 H  HB3  . PHE A 1 59 ? 6.451   11.667  4.152   1.00 0.00 ? 59  PHE A HB3  9  
ATOM   10168 H  HD1  . PHE A 1 59 ? 4.741   8.454   3.789   1.00 0.00 ? 59  PHE A HD1  9  
ATOM   10169 H  HD2  . PHE A 1 59 ? 4.657   12.605  2.850   1.00 0.00 ? 59  PHE A HD2  9  
ATOM   10170 H  HE1  . PHE A 1 59 ? 2.385   8.249   3.110   1.00 0.00 ? 59  PHE A HE1  9  
ATOM   10171 H  HE2  . PHE A 1 59 ? 2.300   12.406  2.171   1.00 0.00 ? 59  PHE A HE2  9  
ATOM   10172 H  HZ   . PHE A 1 59 ? 1.161   10.227  2.301   1.00 0.00 ? 59  PHE A HZ   9  
ATOM   10173 N  N    . ASN A 1 60 ? 7.347   11.455  0.461   1.00 0.00 ? 60  ASN A N    9  
ATOM   10174 C  CA   . ASN A 1 60 ? 7.471   12.563  -0.478  1.00 0.00 ? 60  ASN A CA   9  
ATOM   10175 C  C    . ASN A 1 60 ? 6.230   12.671  -1.359  1.00 0.00 ? 60  ASN A C    9  
ATOM   10176 O  O    . ASN A 1 60 ? 5.861   11.722  -2.049  1.00 0.00 ? 60  ASN A O    9  
ATOM   10177 C  CB   . ASN A 1 60 ? 8.715   12.383  -1.351  1.00 0.00 ? 60  ASN A CB   9  
ATOM   10178 C  CG   . ASN A 1 60 ? 8.623   13.151  -2.655  1.00 0.00 ? 60  ASN A CG   9  
ATOM   10179 O  OD1  . ASN A 1 60 ? 7.692   12.960  -3.437  1.00 0.00 ? 60  ASN A OD1  9  
ATOM   10180 N  ND2  . ASN A 1 60 ? 9.592   14.026  -2.895  1.00 0.00 ? 60  ASN A ND2  9  
ATOM   10181 H  H    . ASN A 1 60 ? 7.198   10.550  0.116   1.00 0.00 ? 60  ASN A H    9  
ATOM   10182 H  HA   . ASN A 1 60 ? 7.572   13.473  0.094   1.00 0.00 ? 60  ASN A HA   9  
ATOM   10183 H  HB2  . ASN A 1 60 ? 9.581   12.734  -0.809  1.00 0.00 ? 60  ASN A HB2  9  
ATOM   10184 H  HB3  . ASN A 1 60 ? 8.839   11.335  -1.579  1.00 0.00 ? 60  ASN A HB3  9  
ATOM   10185 H  HD21 . ASN A 1 60 ? 10.303  14.126  -2.227  1.00 0.00 ? 60  ASN A HD21 9  
ATOM   10186 H  HD22 . ASN A 1 60 ? 9.557   14.537  -3.731  1.00 0.00 ? 60  ASN A HD22 9  
ATOM   10187 N  N    . GLY A 1 61 ? 5.590   13.837  -1.331  1.00 0.00 ? 61  GLY A N    9  
ATOM   10188 C  CA   . GLY A 1 61 ? 4.398   14.048  -2.130  1.00 0.00 ? 61  GLY A CA   9  
ATOM   10189 C  C    . GLY A 1 61 ? 3.260   13.130  -1.729  1.00 0.00 ? 61  GLY A C    9  
ATOM   10190 O  O    . GLY A 1 61 ? 2.540   13.404  -0.769  1.00 0.00 ? 61  GLY A O    9  
ATOM   10191 H  H    . GLY A 1 61 ? 5.930   14.559  -0.761  1.00 0.00 ? 61  GLY A H    9  
ATOM   10192 H  HA2  . GLY A 1 61 ? 4.077   15.073  -2.016  1.00 0.00 ? 61  GLY A HA2  9  
ATOM   10193 H  HA3  . GLY A 1 61 ? 4.639   13.871  -3.169  1.00 0.00 ? 61  GLY A HA3  9  
ATOM   10194 N  N    . LYS A 1 62 ? 3.096   12.037  -2.467  1.00 0.00 ? 62  LYS A N    9  
ATOM   10195 C  CA   . LYS A 1 62 ? 2.038   11.075  -2.185  1.00 0.00 ? 62  LYS A CA   9  
ATOM   10196 C  C    . LYS A 1 62 ? 2.607   9.667   -2.042  1.00 0.00 ? 62  LYS A C    9  
ATOM   10197 O  O    . LYS A 1 62 ? 2.164   8.892   -1.194  1.00 0.00 ? 62  LYS A O    9  
ATOM   10198 C  CB   . LYS A 1 62 ? 0.986   11.101  -3.296  1.00 0.00 ? 62  LYS A CB   9  
ATOM   10199 C  CG   . LYS A 1 62 ? 1.574   10.990  -4.692  1.00 0.00 ? 62  LYS A CG   9  
ATOM   10200 C  CD   . LYS A 1 62 ? 0.495   10.745  -5.734  1.00 0.00 ? 62  LYS A CD   9  
ATOM   10201 C  CE   . LYS A 1 62 ? 1.073   10.721  -7.140  1.00 0.00 ? 62  LYS A CE   9  
ATOM   10202 N  NZ   . LYS A 1 62 ? 0.050   10.342  -8.154  1.00 0.00 ? 62  LYS A NZ   9  
ATOM   10203 H  H    . LYS A 1 62 ? 3.702   11.873  -3.220  1.00 0.00 ? 62  LYS A H    9  
ATOM   10204 H  HA   . LYS A 1 62 ? 1.572   11.358  -1.253  1.00 0.00 ? 62  LYS A HA   9  
ATOM   10205 H  HB2  . LYS A 1 62 ? 0.303   10.277  -3.149  1.00 0.00 ? 62  LYS A HB2  9  
ATOM   10206 H  HB3  . LYS A 1 62 ? 0.436   12.029  -3.232  1.00 0.00 ? 62  LYS A HB3  9  
ATOM   10207 H  HG2  . LYS A 1 62 ? 2.086   11.910  -4.931  1.00 0.00 ? 62  LYS A HG2  9  
ATOM   10208 H  HG3  . LYS A 1 62 ? 2.275   10.169  -4.713  1.00 0.00 ? 62  LYS A HG3  9  
ATOM   10209 H  HD2  . LYS A 1 62 ? 0.023   9.794   -5.534  1.00 0.00 ? 62  LYS A HD2  9  
ATOM   10210 H  HD3  . LYS A 1 62 ? -0.241  11.534  -5.669  1.00 0.00 ? 62  LYS A HD3  9  
ATOM   10211 H  HE2  . LYS A 1 62 ? 1.454   11.703  -7.376  1.00 0.00 ? 62  LYS A HE2  9  
ATOM   10212 H  HE3  . LYS A 1 62 ? 1.880   10.005  -7.171  1.00 0.00 ? 62  LYS A HE3  9  
ATOM   10213 H  HZ1  . LYS A 1 62 ? 0.181   9.351   -8.441  1.00 0.00 ? 62  LYS A HZ1  9  
ATOM   10214 H  HZ2  . LYS A 1 62 ? 0.137   10.949  -8.994  1.00 0.00 ? 62  LYS A HZ2  9  
ATOM   10215 H  HZ3  . LYS A 1 62 ? -0.905  10.454  -7.757  1.00 0.00 ? 62  LYS A HZ3  9  
ATOM   10216 N  N    . GLU A 1 63 ? 3.590   9.343   -2.876  1.00 0.00 ? 63  GLU A N    9  
ATOM   10217 C  CA   . GLU A 1 63 ? 4.219   8.028   -2.841  1.00 0.00 ? 63  GLU A CA   9  
ATOM   10218 C  C    . GLU A 1 63 ? 5.423   8.026   -1.904  1.00 0.00 ? 63  GLU A C    9  
ATOM   10219 O  O    . GLU A 1 63 ? 5.900   9.082   -1.485  1.00 0.00 ? 63  GLU A O    9  
ATOM   10220 C  CB   . GLU A 1 63 ? 4.653   7.608   -4.247  1.00 0.00 ? 63  GLU A CB   9  
ATOM   10221 C  CG   . GLU A 1 63 ? 3.557   6.918   -5.041  1.00 0.00 ? 63  GLU A CG   9  
ATOM   10222 C  CD   . GLU A 1 63 ? 3.325   5.488   -4.595  1.00 0.00 ? 63  GLU A CD   9  
ATOM   10223 O  OE1  . GLU A 1 63 ? 2.898   5.288   -3.439  1.00 0.00 ? 63  GLU A OE1  9  
ATOM   10224 O  OE2  . GLU A 1 63 ? 3.570   4.568   -5.404  1.00 0.00 ? 63  GLU A OE2  9  
ATOM   10225 H  H    . GLU A 1 63 ? 3.899   10.004  -3.530  1.00 0.00 ? 63  GLU A H    9  
ATOM   10226 H  HA   . GLU A 1 63 ? 3.491   7.322   -2.473  1.00 0.00 ? 63  GLU A HA   9  
ATOM   10227 H  HB2  . GLU A 1 63 ? 4.966   8.487   -4.792  1.00 0.00 ? 63  GLU A HB2  9  
ATOM   10228 H  HB3  . GLU A 1 63 ? 5.489   6.930   -4.165  1.00 0.00 ? 63  GLU A HB3  9  
ATOM   10229 H  HG2  . GLU A 1 63 ? 2.637   7.471   -4.917  1.00 0.00 ? 63  GLU A HG2  9  
ATOM   10230 H  HG3  . GLU A 1 63 ? 3.834   6.914   -6.085  1.00 0.00 ? 63  GLU A HG3  9  
ATOM   10231 N  N    . CYS A 1 64 ? 5.909   6.833   -1.578  1.00 0.00 ? 64  CYS A N    9  
ATOM   10232 C  CA   . CYS A 1 64 ? 7.057   6.692   -0.689  1.00 0.00 ? 64  CYS A CA   9  
ATOM   10233 C  C    . CYS A 1 64 ? 8.292   6.244   -1.462  1.00 0.00 ? 64  CYS A C    9  
ATOM   10234 O  O    . CYS A 1 64 ? 8.184   5.614   -2.513  1.00 0.00 ? 64  CYS A O    9  
ATOM   10235 C  CB   . CYS A 1 64 ? 6.746   5.690   0.424   1.00 0.00 ? 64  CYS A CB   9  
ATOM   10236 S  SG   . CYS A 1 64 ? 6.215   4.067   -0.171  1.00 0.00 ? 64  CYS A SG   9  
ATOM   10237 H  H    . CYS A 1 64 ? 5.486   6.028   -1.943  1.00 0.00 ? 64  CYS A H    9  
ATOM   10238 H  HA   . CYS A 1 64 ? 7.254   7.658   -0.247  1.00 0.00 ? 64  CYS A HA   9  
ATOM   10239 H  HB2  . CYS A 1 64 ? 7.631   5.545   1.026   1.00 0.00 ? 64  CYS A HB2  9  
ATOM   10240 H  HB3  . CYS A 1 64 ? 5.958   6.088   1.046   1.00 0.00 ? 64  CYS A HB3  9  
ATOM   10241 H  HG   . CYS A 1 64 ? 5.586   4.241   -1.323  1.00 0.00 ? 64  CYS A HG   9  
ATOM   10242 N  N    . MET A 1 65 ? 9.467   6.576   -0.936  1.00 0.00 ? 65  MET A N    9  
ATOM   10243 C  CA   . MET A 1 65 ? 10.723  6.208   -1.578  1.00 0.00 ? 65  MET A CA   9  
ATOM   10244 C  C    . MET A 1 65 ? 11.693  5.604   -0.567  1.00 0.00 ? 65  MET A C    9  
ATOM   10245 O  O    . MET A 1 65 ? 11.624  5.897   0.627   1.00 0.00 ? 65  MET A O    9  
ATOM   10246 C  CB   . MET A 1 65 ? 11.358  7.431   -2.243  1.00 0.00 ? 65  MET A CB   9  
ATOM   10247 C  CG   . MET A 1 65 ? 10.915  7.636   -3.683  1.00 0.00 ? 65  MET A CG   9  
ATOM   10248 S  SD   . MET A 1 65 ? 11.924  8.853   -4.552  1.00 0.00 ? 65  MET A SD   9  
ATOM   10249 C  CE   . MET A 1 65 ? 11.333  10.373  -3.812  1.00 0.00 ? 65  MET A CE   9  
ATOM   10250 H  H    . MET A 1 65 ? 9.489   7.079   -0.095  1.00 0.00 ? 65  MET A H    9  
ATOM   10251 H  HA   . MET A 1 65 ? 10.504  5.470   -2.335  1.00 0.00 ? 65  MET A HA   9  
ATOM   10252 H  HB2  . MET A 1 65 ? 11.092  8.312   -1.678  1.00 0.00 ? 65  MET A HB2  9  
ATOM   10253 H  HB3  . MET A 1 65 ? 12.431  7.315   -2.233  1.00 0.00 ? 65  MET A HB3  9  
ATOM   10254 H  HG2  . MET A 1 65 ? 10.984  6.694   -4.206  1.00 0.00 ? 65  MET A HG2  9  
ATOM   10255 H  HG3  . MET A 1 65 ? 9.889   7.972   -3.685  1.00 0.00 ? 65  MET A HG3  9  
ATOM   10256 H  HE1  . MET A 1 65 ? 10.296  10.521  -4.071  1.00 0.00 ? 65  MET A HE1  9  
ATOM   10257 H  HE2  . MET A 1 65 ? 11.431  10.312  -2.738  1.00 0.00 ? 65  MET A HE2  9  
ATOM   10258 H  HE3  . MET A 1 65 ? 11.919  11.203  -4.180  1.00 0.00 ? 65  MET A HE3  9  
ATOM   10259 N  N    . CYS A 1 66 ? 12.597  4.759   -1.054  1.00 0.00 ? 66  CYS A N    9  
ATOM   10260 C  CA   . CYS A 1 66 ? 13.581  4.113   -0.194  1.00 0.00 ? 66  CYS A CA   9  
ATOM   10261 C  C    . CYS A 1 66 ? 14.834  4.972   -0.060  1.00 0.00 ? 66  CYS A C    9  
ATOM   10262 O  O    . CYS A 1 66 ? 15.270  5.605   -1.021  1.00 0.00 ? 66  CYS A O    9  
ATOM   10263 C  CB   . CYS A 1 66 ? 13.950  2.736   -0.750  1.00 0.00 ? 66  CYS A CB   9  
ATOM   10264 S  SG   . CYS A 1 66 ? 14.865  2.792   -2.324  1.00 0.00 ? 66  CYS A SG   9  
ATOM   10265 H  H    . CYS A 1 66 ? 12.602  4.565   -2.015  1.00 0.00 ? 66  CYS A H    9  
ATOM   10266 H  HA   . CYS A 1 66 ? 13.138  3.990   0.783   1.00 0.00 ? 66  CYS A HA   9  
ATOM   10267 H  HB2  . CYS A 1 66 ? 14.567  2.219   -0.030  1.00 0.00 ? 66  CYS A HB2  9  
ATOM   10268 H  HB3  . CYS A 1 66 ? 13.046  2.169   -0.915  1.00 0.00 ? 66  CYS A HB3  9  
ATOM   10269 N  N    . GLN A 1 67 ? 15.409  4.988   1.138   1.00 0.00 ? 67  GLN A N    9  
ATOM   10270 C  CA   . GLN A 1 67 ? 16.612  5.770   1.397   1.00 0.00 ? 67  GLN A CA   9  
ATOM   10271 C  C    . GLN A 1 67 ? 17.523  5.790   0.174   1.00 0.00 ? 67  GLN A C    9  
ATOM   10272 O  O    . GLN A 1 67 ? 18.070  6.832   -0.189  1.00 0.00 ? 67  GLN A O    9  
ATOM   10273 C  CB   . GLN A 1 67 ? 17.367  5.201   2.600   1.00 0.00 ? 67  GLN A CB   9  
ATOM   10274 C  CG   . GLN A 1 67 ? 16.799  5.642   3.939   1.00 0.00 ? 67  GLN A CG   9  
ATOM   10275 C  CD   . GLN A 1 67 ? 17.253  7.033   4.336   1.00 0.00 ? 67  GLN A CD   9  
ATOM   10276 O  OE1  . GLN A 1 67 ? 18.331  7.208   4.904   1.00 0.00 ? 67  GLN A OE1  9  
ATOM   10277 N  NE2  . GLN A 1 67 ? 16.430  8.031   4.038   1.00 0.00 ? 67  GLN A NE2  9  
ATOM   10278 H  H    . GLN A 1 67 ? 15.015  4.463   1.865   1.00 0.00 ? 67  GLN A H    9  
ATOM   10279 H  HA   . GLN A 1 67 ? 16.309  6.782   1.621   1.00 0.00 ? 67  GLN A HA   9  
ATOM   10280 H  HB2  . GLN A 1 67 ? 17.331  4.123   2.555   1.00 0.00 ? 67  GLN A HB2  9  
ATOM   10281 H  HB3  . GLN A 1 67 ? 18.397  5.521   2.548   1.00 0.00 ? 67  GLN A HB3  9  
ATOM   10282 H  HG2  . GLN A 1 67 ? 15.721  5.635   3.878   1.00 0.00 ? 67  GLN A HG2  9  
ATOM   10283 H  HG3  . GLN A 1 67 ? 17.120  4.944   4.699   1.00 0.00 ? 67  GLN A HG3  9  
ATOM   10284 H  HE21 . GLN A 1 67 ? 15.586  7.816   3.586   1.00 0.00 ? 67  GLN A HE21 9  
ATOM   10285 H  HE22 . GLN A 1 67 ? 16.697  8.941   4.284   1.00 0.00 ? 67  GLN A HE22 9  
ATOM   10286 N  N    . LYS A 1 68 ? 17.681  4.633   -0.459  1.00 0.00 ? 68  LYS A N    9  
ATOM   10287 C  CA   . LYS A 1 68 ? 18.524  4.516   -1.643  1.00 0.00 ? 68  LYS A CA   9  
ATOM   10288 C  C    . LYS A 1 68 ? 18.125  5.543   -2.698  1.00 0.00 ? 68  LYS A C    9  
ATOM   10289 O  O    . LYS A 1 68 ? 18.943  6.356   -3.129  1.00 0.00 ? 68  LYS A O    9  
ATOM   10290 C  CB   . LYS A 1 68 ? 18.427  3.105   -2.226  1.00 0.00 ? 68  LYS A CB   9  
ATOM   10291 C  CG   . LYS A 1 68 ? 19.661  2.682   -3.004  1.00 0.00 ? 68  LYS A CG   9  
ATOM   10292 C  CD   . LYS A 1 68 ? 19.636  1.197   -3.325  1.00 0.00 ? 68  LYS A CD   9  
ATOM   10293 C  CE   . LYS A 1 68 ? 21.006  0.698   -3.758  1.00 0.00 ? 68  LYS A CE   9  
ATOM   10294 N  NZ   . LYS A 1 68 ? 21.011  -0.772  -3.996  1.00 0.00 ? 68  LYS A NZ   9  
ATOM   10295 H  H    . LYS A 1 68 ? 17.218  3.837   -0.121  1.00 0.00 ? 68  LYS A H    9  
ATOM   10296 H  HA   . LYS A 1 68 ? 19.544  4.703   -1.343  1.00 0.00 ? 68  LYS A HA   9  
ATOM   10297 H  HB2  . LYS A 1 68 ? 18.278  2.403   -1.418  1.00 0.00 ? 68  LYS A HB2  9  
ATOM   10298 H  HB3  . LYS A 1 68 ? 17.575  3.061   -2.890  1.00 0.00 ? 68  LYS A HB3  9  
ATOM   10299 H  HG2  . LYS A 1 68 ? 19.700  3.238   -3.929  1.00 0.00 ? 68  LYS A HG2  9  
ATOM   10300 H  HG3  . LYS A 1 68 ? 20.539  2.899   -2.414  1.00 0.00 ? 68  LYS A HG3  9  
ATOM   10301 H  HD2  . LYS A 1 68 ? 19.329  0.652   -2.445  1.00 0.00 ? 68  LYS A HD2  9  
ATOM   10302 H  HD3  . LYS A 1 68 ? 18.930  1.022   -4.124  1.00 0.00 ? 68  LYS A HD3  9  
ATOM   10303 H  HE2  . LYS A 1 68 ? 21.287  1.202   -4.669  1.00 0.00 ? 68  LYS A HE2  9  
ATOM   10304 H  HE3  . LYS A 1 68 ? 21.721  0.930   -2.982  1.00 0.00 ? 68  LYS A HE3  9  
ATOM   10305 H  HZ1  . LYS A 1 68 ? 20.568  -0.987  -4.913  1.00 0.00 ? 68  LYS A HZ1  9  
ATOM   10306 H  HZ2  . LYS A 1 68 ? 20.479  -1.258  -3.246  1.00 0.00 ? 68  LYS A HZ2  9  
ATOM   10307 H  HZ3  . LYS A 1 68 ? 21.987  -1.131  -4.002  1.00 0.00 ? 68  LYS A HZ3  9  
ATOM   10308 N  N    . CYS A 1 69 ? 16.862  5.500   -3.110  1.00 0.00 ? 69  CYS A N    9  
ATOM   10309 C  CA   . CYS A 1 69 ? 16.353  6.427   -4.115  1.00 0.00 ? 69  CYS A CA   9  
ATOM   10310 C  C    . CYS A 1 69 ? 16.313  7.851   -3.569  1.00 0.00 ? 69  CYS A C    9  
ATOM   10311 O  O    . CYS A 1 69 ? 16.882  8.769   -4.160  1.00 0.00 ? 69  CYS A O    9  
ATOM   10312 C  CB   . CYS A 1 69 ? 14.955  6.003   -4.568  1.00 0.00 ? 69  CYS A CB   9  
ATOM   10313 S  SG   . CYS A 1 69 ? 14.897  4.369   -5.372  1.00 0.00 ? 69  CYS A SG   9  
ATOM   10314 H  H    . CYS A 1 69 ? 16.257  4.828   -2.730  1.00 0.00 ? 69  CYS A H    9  
ATOM   10315 H  HA   . CYS A 1 69 ? 17.021  6.397   -4.962  1.00 0.00 ? 69  CYS A HA   9  
ATOM   10316 H  HB2  . CYS A 1 69 ? 14.301  5.968   -3.708  1.00 0.00 ? 69  CYS A HB2  9  
ATOM   10317 H  HB3  . CYS A 1 69 ? 14.577  6.730   -5.272  1.00 0.00 ? 69  CYS A HB3  9  
ATOM   10318 N  N    . SER A 1 70 ? 15.638  8.027   -2.438  1.00 0.00 ? 70  SER A N    9  
ATOM   10319 C  CA   . SER A 1 70 ? 15.520  9.340   -1.815  1.00 0.00 ? 70  SER A CA   9  
ATOM   10320 C  C    . SER A 1 70 ? 16.858  10.073  -1.835  1.00 0.00 ? 70  SER A C    9  
ATOM   10321 O  O    . SER A 1 70 ? 16.951  11.207  -2.309  1.00 0.00 ? 70  SER A O    9  
ATOM   10322 C  CB   . SER A 1 70 ? 15.024  9.202   -0.374  1.00 0.00 ? 70  SER A CB   9  
ATOM   10323 O  OG   . SER A 1 70 ? 13.832  8.437   -0.317  1.00 0.00 ? 70  SER A OG   9  
ATOM   10324 H  H    . SER A 1 70 ? 15.206  7.256   -2.015  1.00 0.00 ? 70  SER A H    9  
ATOM   10325 H  HA   . SER A 1 70 ? 14.801  9.913   -2.381  1.00 0.00 ? 70  SER A HA   9  
ATOM   10326 H  HB2  . SER A 1 70 ? 15.781  8.712   0.219   1.00 0.00 ? 70  SER A HB2  9  
ATOM   10327 H  HB3  . SER A 1 70 ? 14.828  10.183  0.032   1.00 0.00 ? 70  SER A HB3  9  
ATOM   10328 H  HG   . SER A 1 70 ? 13.184  8.807   -0.920  1.00 0.00 ? 70  SER A HG   9  
ATOM   10329 N  N    . LEU A 1 71 ? 17.892  9.418   -1.319  1.00 0.00 ? 71  LEU A N    9  
ATOM   10330 C  CA   . LEU A 1 71 ? 19.227  10.006  -1.277  1.00 0.00 ? 71  LEU A CA   9  
ATOM   10331 C  C    . LEU A 1 71 ? 19.842  10.060  -2.672  1.00 0.00 ? 71  LEU A C    9  
ATOM   10332 O  O    . LEU A 1 71 ? 19.434  9.342   -3.585  1.00 0.00 ? 71  LEU A O    9  
ATOM   10333 C  CB   . LEU A 1 71 ? 20.130  9.203   -0.339  1.00 0.00 ? 71  LEU A CB   9  
ATOM   10334 C  CG   . LEU A 1 71 ? 20.151  9.654   1.122   1.00 0.00 ? 71  LEU A CG   9  
ATOM   10335 C  CD1  . LEU A 1 71 ? 19.082  8.925   1.921   1.00 0.00 ? 71  LEU A CD1  9  
ATOM   10336 C  CD2  . LEU A 1 71 ? 21.526  9.423   1.731   1.00 0.00 ? 71  LEU A CD2  9  
ATOM   10337 H  H    . LEU A 1 71 ? 17.756  8.518   -0.957  1.00 0.00 ? 71  LEU A H    9  
ATOM   10338 H  HA   . LEU A 1 71 ? 19.133  11.013  -0.898  1.00 0.00 ? 71  LEU A HA   9  
ATOM   10339 H  HB2  . LEU A 1 71 ? 19.801  8.176   -0.363  1.00 0.00 ? 71  LEU A HB2  9  
ATOM   10340 H  HB3  . LEU A 1 71 ? 21.139  9.266   -0.720  1.00 0.00 ? 71  LEU A HB3  9  
ATOM   10341 H  HG   . LEU A 1 71 ? 19.937  10.713  1.168   1.00 0.00 ? 71  LEU A HG   9  
ATOM   10342 H  HD11 . LEU A 1 71 ? 18.109  9.304   1.650   1.00 0.00 ? 71  LEU A HD11 9  
ATOM   10343 H  HD12 . LEU A 1 71 ? 19.250  9.084   2.976   1.00 0.00 ? 71  LEU A HD12 9  
ATOM   10344 H  HD13 . LEU A 1 71 ? 19.131  7.867   1.705   1.00 0.00 ? 71  LEU A HD13 9  
ATOM   10345 H  HD21 . LEU A 1 71 ? 21.583  8.417   2.119   1.00 0.00 ? 71  LEU A HD21 9  
ATOM   10346 H  HD22 . LEU A 1 71 ? 21.687  10.128  2.534   1.00 0.00 ? 71  LEU A HD22 9  
ATOM   10347 H  HD23 . LEU A 1 71 ? 22.283  9.561   0.974   1.00 0.00 ? 71  LEU A HD23 9  
ATOM   10348 N  N    . PRO A 1 72 ? 20.849  10.930  -2.841  1.00 0.00 ? 72  PRO A N    9  
ATOM   10349 C  CA   . PRO A 1 72 ? 21.544  11.097  -4.121  1.00 0.00 ? 72  PRO A CA   9  
ATOM   10350 C  C    . PRO A 1 72 ? 22.400  9.886   -4.478  1.00 0.00 ? 72  PRO A C    9  
ATOM   10351 O  O    . PRO A 1 72 ? 22.933  9.210   -3.598  1.00 0.00 ? 72  PRO A O    9  
ATOM   10352 C  CB   . PRO A 1 72 ? 22.426  12.326  -3.888  1.00 0.00 ? 72  PRO A CB   9  
ATOM   10353 C  CG   . PRO A 1 72 ? 22.644  12.362  -2.415  1.00 0.00 ? 72  PRO A CG   9  
ATOM   10354 C  CD   . PRO A 1 72 ? 21.386  11.818  -1.796  1.00 0.00 ? 72  PRO A CD   9  
ATOM   10355 H  HA   . PRO A 1 72 ? 20.851  11.296  -4.926  1.00 0.00 ? 72  PRO A HA   9  
ATOM   10356 H  HB2  . PRO A 1 72 ? 23.358  12.210  -4.424  1.00 0.00 ? 72  PRO A HB2  9  
ATOM   10357 H  HB3  . PRO A 1 72 ? 21.914  13.212  -4.233  1.00 0.00 ? 72  PRO A HB3  9  
ATOM   10358 H  HG2  . PRO A 1 72 ? 23.489  11.742  -2.154  1.00 0.00 ? 72  PRO A HG2  9  
ATOM   10359 H  HG3  . PRO A 1 72 ? 22.810  13.379  -2.094  1.00 0.00 ? 72  PRO A HG3  9  
ATOM   10360 H  HD2  . PRO A 1 72 ? 21.616  11.263  -0.899  1.00 0.00 ? 72  PRO A HD2  9  
ATOM   10361 H  HD3  . PRO A 1 72 ? 20.696  12.620  -1.580  1.00 0.00 ? 72  PRO A HD3  9  
ATOM   10362 N  N    . VAL A 1 73 ? 22.527  9.618   -5.774  1.00 0.00 ? 73  VAL A N    9  
ATOM   10363 C  CA   . VAL A 1 73 ? 23.320  8.490   -6.247  1.00 0.00 ? 73  VAL A CA   9  
ATOM   10364 C  C    . VAL A 1 73 ? 24.092  8.852   -7.510  1.00 0.00 ? 73  VAL A C    9  
ATOM   10365 O  O    . VAL A 1 73 ? 23.670  9.713   -8.283  1.00 0.00 ? 73  VAL A O    9  
ATOM   10366 C  CB   . VAL A 1 73 ? 22.434  7.263   -6.533  1.00 0.00 ? 73  VAL A CB   9  
ATOM   10367 C  CG1  . VAL A 1 73 ? 21.476  7.551   -7.679  1.00 0.00 ? 73  VAL A CG1  9  
ATOM   10368 C  CG2  . VAL A 1 73 ? 23.294  6.046   -6.839  1.00 0.00 ? 73  VAL A CG2  9  
ATOM   10369 H  H    . VAL A 1 73 ? 22.078  10.194  -6.427  1.00 0.00 ? 73  VAL A H    9  
ATOM   10370 H  HA   . VAL A 1 73 ? 24.023  8.226   -5.469  1.00 0.00 ? 73  VAL A HA   9  
ATOM   10371 H  HB   . VAL A 1 73 ? 21.850  7.051   -5.650  1.00 0.00 ? 73  VAL A HB   9  
ATOM   10372 H  HG11 . VAL A 1 73 ? 20.541  7.040   -7.504  1.00 0.00 ? 73  VAL A HG11 9  
ATOM   10373 H  HG12 . VAL A 1 73 ? 21.301  8.615   -7.743  1.00 0.00 ? 73  VAL A HG12 9  
ATOM   10374 H  HG13 . VAL A 1 73 ? 21.908  7.201   -8.606  1.00 0.00 ? 73  VAL A HG13 9  
ATOM   10375 H  HG21 . VAL A 1 73 ? 23.411  5.948   -7.908  1.00 0.00 ? 73  VAL A HG21 9  
ATOM   10376 H  HG22 . VAL A 1 73 ? 24.265  6.165   -6.380  1.00 0.00 ? 73  VAL A HG22 9  
ATOM   10377 H  HG23 . VAL A 1 73 ? 22.817  5.160   -6.447  1.00 0.00 ? 73  VAL A HG23 9  
ATOM   10378 N  N    . SER A 1 74 ? 25.226  8.189   -7.715  1.00 0.00 ? 74  SER A N    9  
ATOM   10379 C  CA   . SER A 1 74 ? 26.060  8.443   -8.884  1.00 0.00 ? 74  SER A CA   9  
ATOM   10380 C  C    . SER A 1 74 ? 25.690  7.504   -10.029 1.00 0.00 ? 74  SER A C    9  
ATOM   10381 O  O    . SER A 1 74 ? 26.562  6.980   -10.722 1.00 0.00 ? 74  SER A O    9  
ATOM   10382 C  CB   . SER A 1 74 ? 27.538  8.275   -8.528  1.00 0.00 ? 74  SER A CB   9  
ATOM   10383 O  OG   . SER A 1 74 ? 27.924  9.183   -7.511  1.00 0.00 ? 74  SER A OG   9  
ATOM   10384 H  H    . SER A 1 74 ? 25.509  7.514   -7.062  1.00 0.00 ? 74  SER A H    9  
ATOM   10385 H  HA   . SER A 1 74 ? 25.887  9.461   -9.199  1.00 0.00 ? 74  SER A HA   9  
ATOM   10386 H  HB2  . SER A 1 74 ? 27.709  7.268   -8.178  1.00 0.00 ? 74  SER A HB2  9  
ATOM   10387 H  HB3  . SER A 1 74 ? 28.140  8.458   -9.406  1.00 0.00 ? 74  SER A HB3  9  
ATOM   10388 H  HG   . SER A 1 74 ? 27.441  8.987   -6.705  1.00 0.00 ? 74  SER A HG   9  
ATOM   10389 N  N    . VAL A 1 75 ? 24.391  7.298   -10.221 1.00 0.00 ? 75  VAL A N    9  
ATOM   10390 C  CA   . VAL A 1 75 ? 23.905  6.424   -11.282 1.00 0.00 ? 75  VAL A CA   9  
ATOM   10391 C  C    . VAL A 1 75 ? 22.604  6.952   -11.875 1.00 0.00 ? 75  VAL A C    9  
ATOM   10392 O  O    . VAL A 1 75 ? 21.736  7.446   -11.155 1.00 0.00 ? 75  VAL A O    9  
ATOM   10393 C  CB   . VAL A 1 75 ? 23.677  4.990   -10.768 1.00 0.00 ? 75  VAL A CB   9  
ATOM   10394 C  CG1  . VAL A 1 75 ? 23.129  4.106   -11.877 1.00 0.00 ? 75  VAL A CG1  9  
ATOM   10395 C  CG2  . VAL A 1 75 ? 24.968  4.415   -10.206 1.00 0.00 ? 75  VAL A CG2  9  
ATOM   10396 H  H    . VAL A 1 75 ? 23.745  7.744   -9.635  1.00 0.00 ? 75  VAL A H    9  
ATOM   10397 H  HA   . VAL A 1 75 ? 24.656  6.391   -12.058 1.00 0.00 ? 75  VAL A HA   9  
ATOM   10398 H  HB   . VAL A 1 75 ? 22.947  5.026   -9.972  1.00 0.00 ? 75  VAL A HB   9  
ATOM   10399 H  HG11 . VAL A 1 75 ? 23.948  3.702   -12.453 1.00 0.00 ? 75  VAL A HG11 9  
ATOM   10400 H  HG12 . VAL A 1 75 ? 22.558  3.297   -11.444 1.00 0.00 ? 75  VAL A HG12 9  
ATOM   10401 H  HG13 . VAL A 1 75 ? 22.491  4.692   -12.522 1.00 0.00 ? 75  VAL A HG13 9  
ATOM   10402 H  HG21 . VAL A 1 75 ? 24.851  3.353   -10.051 1.00 0.00 ? 75  VAL A HG21 9  
ATOM   10403 H  HG22 . VAL A 1 75 ? 25.775  4.590   -10.903 1.00 0.00 ? 75  VAL A HG22 9  
ATOM   10404 H  HG23 . VAL A 1 75 ? 25.197  4.893   -9.265  1.00 0.00 ? 75  VAL A HG23 9  
ATOM   10405 N  N    . SER A 1 76 ? 22.474  6.844   -13.194 1.00 0.00 ? 76  SER A N    9  
ATOM   10406 C  CA   . SER A 1 76 ? 21.280  7.314   -13.886 1.00 0.00 ? 76  SER A CA   9  
ATOM   10407 C  C    . SER A 1 76 ? 20.265  6.186   -14.044 1.00 0.00 ? 76  SER A C    9  
ATOM   10408 O  O    . SER A 1 76 ? 20.235  5.502   -15.066 1.00 0.00 ? 76  SER A O    9  
ATOM   10409 C  CB   . SER A 1 76 ? 21.649  7.880   -15.258 1.00 0.00 ? 76  SER A CB   9  
ATOM   10410 O  OG   . SER A 1 76 ? 22.487  9.016   -15.133 1.00 0.00 ? 76  SER A OG   9  
ATOM   10411 H  H    . SER A 1 76 ? 23.201  6.442   -13.714 1.00 0.00 ? 76  SER A H    9  
ATOM   10412 H  HA   . SER A 1 76 ? 20.838  8.099   -13.289 1.00 0.00 ? 76  SER A HA   9  
ATOM   10413 H  HB2  . SER A 1 76 ? 22.169  7.125   -15.828 1.00 0.00 ? 76  SER A HB2  9  
ATOM   10414 H  HB3  . SER A 1 76 ? 20.748  8.168   -15.780 1.00 0.00 ? 76  SER A HB3  9  
ATOM   10415 H  HG   . SER A 1 76 ? 22.023  9.793   -15.453 1.00 0.00 ? 76  SER A HG   9  
ATOM   10416 N  N    . GLY A 1 77 ? 19.434  5.998   -13.023 1.00 0.00 ? 77  GLY A N    9  
ATOM   10417 C  CA   . GLY A 1 77 ? 18.429  4.952   -13.068 1.00 0.00 ? 77  GLY A CA   9  
ATOM   10418 C  C    . GLY A 1 77 ? 17.355  5.224   -14.103 1.00 0.00 ? 77  GLY A C    9  
ATOM   10419 O  O    . GLY A 1 77 ? 16.737  6.288   -14.123 1.00 0.00 ? 77  GLY A O    9  
ATOM   10420 H  H    . GLY A 1 77 ? 19.504  6.574   -12.233 1.00 0.00 ? 77  GLY A H    9  
ATOM   10421 H  HA2  . GLY A 1 77 ? 18.911  4.015   -13.301 1.00 0.00 ? 77  GLY A HA2  9  
ATOM   10422 H  HA3  . GLY A 1 77 ? 17.964  4.874   -12.096 1.00 0.00 ? 77  GLY A HA3  9  
ATOM   10423 N  N    . PRO A 1 78 ? 17.121  4.244   -14.989 1.00 0.00 ? 78  PRO A N    9  
ATOM   10424 C  CA   . PRO A 1 78 ? 16.115  4.360   -16.049 1.00 0.00 ? 78  PRO A CA   9  
ATOM   10425 C  C    . PRO A 1 78 ? 14.692  4.339   -15.503 1.00 0.00 ? 78  PRO A C    9  
ATOM   10426 O  O    . PRO A 1 78 ? 14.272  3.368   -14.874 1.00 0.00 ? 78  PRO A O    9  
ATOM   10427 C  CB   . PRO A 1 78 ? 16.372  3.126   -16.918 1.00 0.00 ? 78  PRO A CB   9  
ATOM   10428 C  CG   . PRO A 1 78 ? 17.008  2.141   -15.999 1.00 0.00 ? 78  PRO A CG   9  
ATOM   10429 C  CD   . PRO A 1 78 ? 17.820  2.949   -15.024 1.00 0.00 ? 78  PRO A CD   9  
ATOM   10430 H  HA   . PRO A 1 78 ? 16.260  5.254   -16.638 1.00 0.00 ? 78  PRO A HA   9  
ATOM   10431 H  HB2  . PRO A 1 78 ? 15.435  2.756   -17.308 1.00 0.00 ? 78  PRO A HB2  9  
ATOM   10432 H  HB3  . PRO A 1 78 ? 17.030  3.387   -17.734 1.00 0.00 ? 78  PRO A HB3  9  
ATOM   10433 H  HG2  . PRO A 1 78 ? 16.247  1.580   -15.479 1.00 0.00 ? 78  PRO A HG2  9  
ATOM   10434 H  HG3  . PRO A 1 78 ? 17.649  1.477   -16.560 1.00 0.00 ? 78  PRO A HG3  9  
ATOM   10435 H  HD2  . PRO A 1 78 ? 17.815  2.481   -14.051 1.00 0.00 ? 78  PRO A HD2  9  
ATOM   10436 H  HD3  . PRO A 1 78 ? 18.832  3.067   -15.383 1.00 0.00 ? 78  PRO A HD3  9  
ATOM   10437 N  N    . SER A 1 79 ? 13.953  5.417   -15.747 1.00 0.00 ? 79  SER A N    9  
ATOM   10438 C  CA   . SER A 1 79 ? 12.577  5.524   -15.276 1.00 0.00 ? 79  SER A CA   9  
ATOM   10439 C  C    . SER A 1 79 ? 11.596  5.420   -16.439 1.00 0.00 ? 79  SER A C    9  
ATOM   10440 O  O    . SER A 1 79 ? 11.924  5.761   -17.575 1.00 0.00 ? 79  SER A O    9  
ATOM   10441 C  CB   . SER A 1 79 ? 12.371  6.847   -14.535 1.00 0.00 ? 79  SER A CB   9  
ATOM   10442 O  OG   . SER A 1 79 ? 11.183  6.818   -13.763 1.00 0.00 ? 79  SER A OG   9  
ATOM   10443 H  H    . SER A 1 79 ? 14.345  6.160   -16.254 1.00 0.00 ? 79  SER A H    9  
ATOM   10444 H  HA   . SER A 1 79 ? 12.397  4.707   -14.593 1.00 0.00 ? 79  SER A HA   9  
ATOM   10445 H  HB2  . SER A 1 79 ? 13.209  7.024   -13.879 1.00 0.00 ? 79  SER A HB2  9  
ATOM   10446 H  HB3  . SER A 1 79 ? 12.300  7.651   -15.254 1.00 0.00 ? 79  SER A HB3  9  
ATOM   10447 H  HG   . SER A 1 79 ? 11.242  6.116   -13.110 1.00 0.00 ? 79  SER A HG   9  
ATOM   10448 N  N    . SER A 1 80 ? 10.389  4.946   -16.146 1.00 0.00 ? 80  SER A N    9  
ATOM   10449 C  CA   . SER A 1 80 ? 9.359   4.792   -17.167 1.00 0.00 ? 80  SER A CA   9  
ATOM   10450 C  C    . SER A 1 80 ? 8.295   5.877   -17.032 1.00 0.00 ? 80  SER A C    9  
ATOM   10451 O  O    . SER A 1 80 ? 7.648   6.003   -15.992 1.00 0.00 ? 80  SER A O    9  
ATOM   10452 C  CB   . SER A 1 80 ? 8.711   3.411   -17.064 1.00 0.00 ? 80  SER A CB   9  
ATOM   10453 O  OG   . SER A 1 80 ? 9.596   2.398   -17.509 1.00 0.00 ? 80  SER A OG   9  
ATOM   10454 H  H    . SER A 1 80 ? 10.188  4.691   -15.221 1.00 0.00 ? 80  SER A H    9  
ATOM   10455 H  HA   . SER A 1 80 ? 9.833   4.888   -18.132 1.00 0.00 ? 80  SER A HA   9  
ATOM   10456 H  HB2  . SER A 1 80 ? 8.448   3.215   -16.035 1.00 0.00 ? 80  SER A HB2  9  
ATOM   10457 H  HB3  . SER A 1 80 ? 7.820   3.388   -17.674 1.00 0.00 ? 80  SER A HB3  9  
ATOM   10458 H  HG   . SER A 1 80 ? 9.446   2.228   -18.442 1.00 0.00 ? 80  SER A HG   9  
ATOM   10459 N  N    . GLY A 1 81 ? 8.118   6.660   -18.092 1.00 0.00 ? 81  GLY A N    9  
ATOM   10460 C  CA   . GLY A 1 81 ? 7.132   7.724   -18.073 1.00 0.00 ? 81  GLY A CA   9  
ATOM   10461 C  C    . GLY A 1 81 ? 7.761   9.099   -18.180 1.00 0.00 ? 81  GLY A C    9  
ATOM   10462 O  O    . GLY A 1 81 ? 7.345   9.883   -19.032 1.00 0.00 ? 81  GLY A O    9  
ATOM   10463 H  H    . GLY A 1 81 ? 8.663   6.513   -18.894 1.00 0.00 ? 81  GLY A H    9  
ATOM   10464 H  HA2  . GLY A 1 81 ? 6.452   7.585   -18.900 1.00 0.00 ? 81  GLY A HA2  9  
ATOM   10465 H  HA3  . GLY A 1 81 ? 6.576   7.667   -17.149 1.00 0.00 ? 81  GLY A HA3  9  
HETATM 10466 ZN ZN   . ZN  B 2 .  ? -2.820  -2.699  -4.121  1.00 0.00 ? 201 ZN  A ZN   9  
HETATM 10467 ZN ZN   . ZN  C 2 .  ? 13.528  2.862   -4.233  1.00 0.00 ? 401 ZN  A ZN   9  
ATOM   10468 N  N    . GLY A 1 1  ? -33.751 -10.154 5.701   1.00 0.00 ? 1   GLY A N    10 
ATOM   10469 C  CA   . GLY A 1 1  ? -35.193 -10.061 5.839   1.00 0.00 ? 1   GLY A CA   10 
ATOM   10470 C  C    . GLY A 1 1  ? -35.868 -9.596  4.564   1.00 0.00 ? 1   GLY A C    10 
ATOM   10471 O  O    . GLY A 1 1  ? -35.348 -9.802  3.468   1.00 0.00 ? 1   GLY A O    10 
ATOM   10472 H  H1   . GLY A 1 1  ? -33.218 -10.565 6.414   1.00 0.00 ? 1   GLY A H1   10 
ATOM   10473 H  HA2  . GLY A 1 1  ? -35.581 -11.032 6.107   1.00 0.00 ? 1   GLY A HA2  10 
ATOM   10474 H  HA3  . GLY A 1 1  ? -35.423 -9.362  6.630   1.00 0.00 ? 1   GLY A HA3  10 
ATOM   10475 N  N    . SER A 1 2  ? -37.031 -8.969  4.708   1.00 0.00 ? 2   SER A N    10 
ATOM   10476 C  CA   . SER A 1 2  ? -37.782 -8.478  3.558   1.00 0.00 ? 2   SER A CA   10 
ATOM   10477 C  C    . SER A 1 2  ? -37.928 -6.960  3.612   1.00 0.00 ? 2   SER A C    10 
ATOM   10478 O  O    . SER A 1 2  ? -37.833 -6.354  4.679   1.00 0.00 ? 2   SER A O    10 
ATOM   10479 C  CB   . SER A 1 2  ? -39.163 -9.134  3.507   1.00 0.00 ? 2   SER A CB   10 
ATOM   10480 O  OG   . SER A 1 2  ? -39.941 -8.772  4.634   1.00 0.00 ? 2   SER A OG   10 
ATOM   10481 H  H    . SER A 1 2  ? -37.394 -8.835  5.609   1.00 0.00 ? 2   SER A H    10 
ATOM   10482 H  HA   . SER A 1 2  ? -37.233 -8.743  2.666   1.00 0.00 ? 2   SER A HA   10 
ATOM   10483 H  HB2  . SER A 1 2  ? -39.677 -8.815  2.613   1.00 0.00 ? 2   SER A HB2  10 
ATOM   10484 H  HB3  . SER A 1 2  ? -39.048 -10.208 3.492   1.00 0.00 ? 2   SER A HB3  10 
ATOM   10485 H  HG   . SER A 1 2  ? -39.546 -9.141  5.428   1.00 0.00 ? 2   SER A HG   10 
ATOM   10486 N  N    . SER A 1 3  ? -38.160 -6.353  2.453   1.00 0.00 ? 3   SER A N    10 
ATOM   10487 C  CA   . SER A 1 3  ? -38.316 -4.906  2.366   1.00 0.00 ? 3   SER A CA   10 
ATOM   10488 C  C    . SER A 1 3  ? -37.130 -4.192  3.007   1.00 0.00 ? 3   SER A C    10 
ATOM   10489 O  O    . SER A 1 3  ? -37.294 -3.180  3.688   1.00 0.00 ? 3   SER A O    10 
ATOM   10490 C  CB   . SER A 1 3  ? -39.616 -4.470  3.045   1.00 0.00 ? 3   SER A CB   10 
ATOM   10491 O  OG   . SER A 1 3  ? -40.116 -3.275  2.470   1.00 0.00 ? 3   SER A OG   10 
ATOM   10492 H  H    . SER A 1 3  ? -38.226 -6.891  1.636   1.00 0.00 ? 3   SER A H    10 
ATOM   10493 H  HA   . SER A 1 3  ? -38.360 -4.639  1.321   1.00 0.00 ? 3   SER A HA   10 
ATOM   10494 H  HB2  . SER A 1 3  ? -40.356 -5.247  2.932   1.00 0.00 ? 3   SER A HB2  10 
ATOM   10495 H  HB3  . SER A 1 3  ? -39.430 -4.300  4.096   1.00 0.00 ? 3   SER A HB3  10 
ATOM   10496 H  HG   . SER A 1 3  ? -39.641 -3.087  1.658   1.00 0.00 ? 3   SER A HG   10 
ATOM   10497 N  N    . GLY A 1 4  ? -35.934 -4.728  2.784   1.00 0.00 ? 4   GLY A N    10 
ATOM   10498 C  CA   . GLY A 1 4  ? -34.737 -4.130  3.346   1.00 0.00 ? 4   GLY A CA   10 
ATOM   10499 C  C    . GLY A 1 4  ? -33.467 -4.754  2.801   1.00 0.00 ? 4   GLY A C    10 
ATOM   10500 O  O    . GLY A 1 4  ? -32.534 -4.047  2.420   1.00 0.00 ? 4   GLY A O    10 
ATOM   10501 H  H    . GLY A 1 4  ? -35.863 -5.535  2.232   1.00 0.00 ? 4   GLY A H    10 
ATOM   10502 H  HA2  . GLY A 1 4  ? -34.733 -3.075  3.118   1.00 0.00 ? 4   GLY A HA2  10 
ATOM   10503 H  HA3  . GLY A 1 4  ? -34.754 -4.257  4.418   1.00 0.00 ? 4   GLY A HA3  10 
ATOM   10504 N  N    . SER A 1 5  ? -33.430 -6.082  2.765   1.00 0.00 ? 5   SER A N    10 
ATOM   10505 C  CA   . SER A 1 5  ? -32.262 -6.801  2.269   1.00 0.00 ? 5   SER A CA   10 
ATOM   10506 C  C    . SER A 1 5  ? -32.282 -6.883  0.745   1.00 0.00 ? 5   SER A C    10 
ATOM   10507 O  O    . SER A 1 5  ? -33.347 -6.887  0.127   1.00 0.00 ? 5   SER A O    10 
ATOM   10508 C  CB   . SER A 1 5  ? -32.212 -8.208  2.866   1.00 0.00 ? 5   SER A CB   10 
ATOM   10509 O  OG   . SER A 1 5  ? -33.168 -9.056  2.254   1.00 0.00 ? 5   SER A OG   10 
ATOM   10510 H  H    . SER A 1 5  ? -34.205 -6.590  3.083   1.00 0.00 ? 5   SER A H    10 
ATOM   10511 H  HA   . SER A 1 5  ? -31.382 -6.257  2.577   1.00 0.00 ? 5   SER A HA   10 
ATOM   10512 H  HB2  . SER A 1 5  ? -31.229 -8.626  2.713   1.00 0.00 ? 5   SER A HB2  10 
ATOM   10513 H  HB3  . SER A 1 5  ? -32.420 -8.155  3.924   1.00 0.00 ? 5   SER A HB3  10 
ATOM   10514 H  HG   . SER A 1 5  ? -33.573 -9.616  2.921   1.00 0.00 ? 5   SER A HG   10 
ATOM   10515 N  N    . SER A 1 6  ? -31.097 -6.948  0.147   1.00 0.00 ? 6   SER A N    10 
ATOM   10516 C  CA   . SER A 1 6  ? -30.977 -7.026  -1.304  1.00 0.00 ? 6   SER A CA   10 
ATOM   10517 C  C    . SER A 1 6  ? -29.774 -7.874  -1.705  1.00 0.00 ? 6   SER A C    10 
ATOM   10518 O  O    . SER A 1 6  ? -29.082 -8.431  -0.854  1.00 0.00 ? 6   SER A O    10 
ATOM   10519 C  CB   . SER A 1 6  ? -30.848 -5.623  -1.902  1.00 0.00 ? 6   SER A CB   10 
ATOM   10520 O  OG   . SER A 1 6  ? -29.658 -4.990  -1.465  1.00 0.00 ? 6   SER A OG   10 
ATOM   10521 H  H    . SER A 1 6  ? -30.284 -6.941  0.695   1.00 0.00 ? 6   SER A H    10 
ATOM   10522 H  HA   . SER A 1 6  ? -31.874 -7.490  -1.687  1.00 0.00 ? 6   SER A HA   10 
ATOM   10523 H  HB2  . SER A 1 6  ? -30.829 -5.695  -2.979  1.00 0.00 ? 6   SER A HB2  10 
ATOM   10524 H  HB3  . SER A 1 6  ? -31.694 -5.025  -1.596  1.00 0.00 ? 6   SER A HB3  10 
ATOM   10525 H  HG   . SER A 1 6  ? -29.869 -4.345  -0.786  1.00 0.00 ? 6   SER A HG   10 
ATOM   10526 N  N    . GLY A 1 7  ? -29.533 -7.969  -3.009  1.00 0.00 ? 7   GLY A N    10 
ATOM   10527 C  CA   . GLY A 1 7  ? -28.414 -8.751  -3.501  1.00 0.00 ? 7   GLY A CA   10 
ATOM   10528 C  C    . GLY A 1 7  ? -27.081 -8.070  -3.264  1.00 0.00 ? 7   GLY A C    10 
ATOM   10529 O  O    . GLY A 1 7  ? -27.032 -6.891  -2.910  1.00 0.00 ? 7   GLY A O    10 
ATOM   10530 H  H    . GLY A 1 7  ? -30.119 -7.504  -3.642  1.00 0.00 ? 7   GLY A H    10 
ATOM   10531 H  HA2  . GLY A 1 7  ? -28.411 -9.709  -3.002  1.00 0.00 ? 7   GLY A HA2  10 
ATOM   10532 H  HA3  . GLY A 1 7  ? -28.540 -8.911  -4.562  1.00 0.00 ? 7   GLY A HA3  10 
ATOM   10533 N  N    . LEU A 1 8  ? -25.996 -8.812  -3.458  1.00 0.00 ? 8   LEU A N    10 
ATOM   10534 C  CA   . LEU A 1 8  ? -24.655 -8.272  -3.262  1.00 0.00 ? 8   LEU A CA   10 
ATOM   10535 C  C    . LEU A 1 8  ? -24.632 -7.279  -2.105  1.00 0.00 ? 8   LEU A C    10 
ATOM   10536 O  O    . LEU A 1 8  ? -24.154 -6.154  -2.249  1.00 0.00 ? 8   LEU A O    10 
ATOM   10537 C  CB   . LEU A 1 8  ? -24.165 -7.593  -4.542  1.00 0.00 ? 8   LEU A CB   10 
ATOM   10538 C  CG   . LEU A 1 8  ? -24.222 -8.439  -5.815  1.00 0.00 ? 8   LEU A CG   10 
ATOM   10539 C  CD1  . LEU A 1 8  ? -24.316 -7.548  -7.043  1.00 0.00 ? 8   LEU A CD1  10 
ATOM   10540 C  CD2  . LEU A 1 8  ? -23.006 -9.349  -5.906  1.00 0.00 ? 8   LEU A CD2  10 
ATOM   10541 H  H    . LEU A 1 8  ? -26.098 -9.744  -3.740  1.00 0.00 ? 8   LEU A H    10 
ATOM   10542 H  HA   . LEU A 1 8  ? -23.998 -9.096  -3.027  1.00 0.00 ? 8   LEU A HA   10 
ATOM   10543 H  HB2  . LEU A 1 8  ? -24.769 -6.714  -4.702  1.00 0.00 ? 8   LEU A HB2  10 
ATOM   10544 H  HB3  . LEU A 1 8  ? -23.137 -7.298  -4.386  1.00 0.00 ? 8   LEU A HB3  10 
ATOM   10545 H  HG   . LEU A 1 8  ? -25.105 -9.062  -5.786  1.00 0.00 ? 8   LEU A HG   10 
ATOM   10546 H  HD11 . LEU A 1 8  ? -25.261 -7.715  -7.538  1.00 0.00 ? 8   LEU A HD11 10 
ATOM   10547 H  HD12 . LEU A 1 8  ? -23.509 -7.782  -7.721  1.00 0.00 ? 8   LEU A HD12 10 
ATOM   10548 H  HD13 . LEU A 1 8  ? -24.245 -6.512  -6.744  1.00 0.00 ? 8   LEU A HD13 10 
ATOM   10549 H  HD21 . LEU A 1 8  ? -23.103 -10.151 -5.189  1.00 0.00 ? 8   LEU A HD21 10 
ATOM   10550 H  HD22 . LEU A 1 8  ? -22.113 -8.779  -5.690  1.00 0.00 ? 8   LEU A HD22 10 
ATOM   10551 H  HD23 . LEU A 1 8  ? -22.939 -9.761  -6.901  1.00 0.00 ? 8   LEU A HD23 10 
ATOM   10552 N  N    . ASP A 1 9  ? -25.149 -7.704  -0.957  1.00 0.00 ? 9   ASP A N    10 
ATOM   10553 C  CA   . ASP A 1 9  ? -25.184 -6.853  0.227   1.00 0.00 ? 9   ASP A CA   10 
ATOM   10554 C  C    . ASP A 1 9  ? -24.037 -7.190  1.173   1.00 0.00 ? 9   ASP A C    10 
ATOM   10555 O  O    . ASP A 1 9  ? -23.543 -6.327  1.899   1.00 0.00 ? 9   ASP A O    10 
ATOM   10556 C  CB   . ASP A 1 9  ? -26.522 -7.008  0.952   1.00 0.00 ? 9   ASP A CB   10 
ATOM   10557 C  CG   . ASP A 1 9  ? -26.765 -8.428  1.422   1.00 0.00 ? 9   ASP A CG   10 
ATOM   10558 O  OD1  . ASP A 1 9  ? -26.739 -9.346  0.575   1.00 0.00 ? 9   ASP A OD1  10 
ATOM   10559 O  OD2  . ASP A 1 9  ? -26.980 -8.623  2.637   1.00 0.00 ? 9   ASP A OD2  10 
ATOM   10560 H  H    . ASP A 1 9  ? -25.515 -8.612  -0.905  1.00 0.00 ? 9   ASP A H    10 
ATOM   10561 H  HA   . ASP A 1 9  ? -25.078 -5.829  -0.097  1.00 0.00 ? 9   ASP A HA   10 
ATOM   10562 H  HB2  . ASP A 1 9  ? -26.534 -6.356  1.814   1.00 0.00 ? 9   ASP A HB2  10 
ATOM   10563 H  HB3  . ASP A 1 9  ? -27.322 -6.727  0.283   1.00 0.00 ? 9   ASP A HB3  10 
ATOM   10564 N  N    . TYR A 1 10 ? -23.617 -8.450  1.160   1.00 0.00 ? 10  TYR A N    10 
ATOM   10565 C  CA   . TYR A 1 10 ? -22.530 -8.903  2.020   1.00 0.00 ? 10  TYR A CA   10 
ATOM   10566 C  C    . TYR A 1 10 ? -21.366 -7.917  1.991   1.00 0.00 ? 10  TYR A C    10 
ATOM   10567 O  O    . TYR A 1 10 ? -20.721 -7.671  3.010   1.00 0.00 ? 10  TYR A O    10 
ATOM   10568 C  CB   . TYR A 1 10 ? -22.050 -10.288 1.584   1.00 0.00 ? 10  TYR A CB   10 
ATOM   10569 C  CG   . TYR A 1 10 ? -21.280 -10.281 0.283   1.00 0.00 ? 10  TYR A CG   10 
ATOM   10570 C  CD1  . TYR A 1 10 ? -21.783 -9.638  -0.841  1.00 0.00 ? 10  TYR A CD1  10 
ATOM   10571 C  CD2  . TYR A 1 10 ? -20.048 -10.916 0.178   1.00 0.00 ? 10  TYR A CD2  10 
ATOM   10572 C  CE1  . TYR A 1 10 ? -21.083 -9.629  -2.032  1.00 0.00 ? 10  TYR A CE1  10 
ATOM   10573 C  CE2  . TYR A 1 10 ? -19.340 -10.911 -1.008  1.00 0.00 ? 10  TYR A CE2  10 
ATOM   10574 C  CZ   . TYR A 1 10 ? -19.862 -10.267 -2.111  1.00 0.00 ? 10  TYR A CZ   10 
ATOM   10575 O  OH   . TYR A 1 10 ? -19.161 -10.260 -3.295  1.00 0.00 ? 10  TYR A OH   10 
ATOM   10576 H  H    . TYR A 1 10 ? -24.050 -9.093  0.560   1.00 0.00 ? 10  TYR A H    10 
ATOM   10577 H  HA   . TYR A 1 10 ? -22.909 -8.965  3.030   1.00 0.00 ? 10  TYR A HA   10 
ATOM   10578 H  HB2  . TYR A 1 10 ? -21.405 -10.695 2.348   1.00 0.00 ? 10  TYR A HB2  10 
ATOM   10579 H  HB3  . TYR A 1 10 ? -22.906 -10.935 1.460   1.00 0.00 ? 10  TYR A HB3  10 
ATOM   10580 H  HD1  . TYR A 1 10 ? -22.739 -9.139  -0.776  1.00 0.00 ? 10  TYR A HD1  10 
ATOM   10581 H  HD2  . TYR A 1 10 ? -19.642 -11.420 1.044   1.00 0.00 ? 10  TYR A HD2  10 
ATOM   10582 H  HE1  . TYR A 1 10 ? -21.491 -9.125  -2.895  1.00 0.00 ? 10  TYR A HE1  10 
ATOM   10583 H  HE2  . TYR A 1 10 ? -18.385 -11.411 -1.070  1.00 0.00 ? 10  TYR A HE2  10 
ATOM   10584 H  HH   . TYR A 1 10 ? -18.288 -10.633 -3.152  1.00 0.00 ? 10  TYR A HH   10 
ATOM   10585 N  N    . GLN A 1 11 ? -21.104 -7.354  0.815   1.00 0.00 ? 11  GLN A N    10 
ATOM   10586 C  CA   . GLN A 1 11 ? -20.019 -6.395  0.652   1.00 0.00 ? 11  GLN A CA   10 
ATOM   10587 C  C    . GLN A 1 11 ? -20.202 -5.202  1.585   1.00 0.00 ? 11  GLN A C    10 
ATOM   10588 O  O    . GLN A 1 11 ? -19.229 -4.640  2.087   1.00 0.00 ? 11  GLN A O    10 
ATOM   10589 C  CB   . GLN A 1 11 ? -19.946 -5.916  -0.798  1.00 0.00 ? 11  GLN A CB   10 
ATOM   10590 C  CG   . GLN A 1 11 ? -21.027 -4.911  -1.162  1.00 0.00 ? 11  GLN A CG   10 
ATOM   10591 C  CD   . GLN A 1 11 ? -21.033 -4.569  -2.639  1.00 0.00 ? 11  GLN A CD   10 
ATOM   10592 O  OE1  . GLN A 1 11 ? -21.981 -4.887  -3.358  1.00 0.00 ? 11  GLN A OE1  10 
ATOM   10593 N  NE2  . GLN A 1 11 ? -19.972 -3.917  -3.100  1.00 0.00 ? 11  GLN A NE2  10 
ATOM   10594 H  H    . GLN A 1 11 ? -21.654 -7.591  0.040   1.00 0.00 ? 11  GLN A H    10 
ATOM   10595 H  HA   . GLN A 1 11 ? -19.095 -6.894  0.904   1.00 0.00 ? 11  GLN A HA   10 
ATOM   10596 H  HB2  . GLN A 1 11 ? -18.985 -5.455  -0.965  1.00 0.00 ? 11  GLN A HB2  10 
ATOM   10597 H  HB3  . GLN A 1 11 ? -20.045 -6.770  -1.452  1.00 0.00 ? 11  GLN A HB3  10 
ATOM   10598 H  HG2  . GLN A 1 11 ? -21.990 -5.326  -0.901  1.00 0.00 ? 11  GLN A HG2  10 
ATOM   10599 H  HG3  . GLN A 1 11 ? -20.863 -4.005  -0.598  1.00 0.00 ? 11  GLN A HG3  10 
ATOM   10600 H  HE21 . GLN A 1 11 ? -19.254 -3.698  -2.469  1.00 0.00 ? 11  GLN A HE21 10 
ATOM   10601 H  HE22 . GLN A 1 11 ? -19.949 -3.684  -4.051  1.00 0.00 ? 11  GLN A HE22 10 
ATOM   10602 N  N    . ARG A 1 12 ? -21.455 -4.822  1.813   1.00 0.00 ? 12  ARG A N    10 
ATOM   10603 C  CA   . ARG A 1 12 ? -21.765 -3.695  2.684   1.00 0.00 ? 12  ARG A CA   10 
ATOM   10604 C  C    . ARG A 1 12 ? -20.719 -3.556  3.787   1.00 0.00 ? 12  ARG A C    10 
ATOM   10605 O  O    . ARG A 1 12 ? -20.337 -2.446  4.158   1.00 0.00 ? 12  ARG A O    10 
ATOM   10606 C  CB   . ARG A 1 12 ? -23.153 -3.868  3.303   1.00 0.00 ? 12  ARG A CB   10 
ATOM   10607 C  CG   . ARG A 1 12 ? -24.288 -3.462  2.376   1.00 0.00 ? 12  ARG A CG   10 
ATOM   10608 C  CD   . ARG A 1 12 ? -25.514 -3.017  3.158   1.00 0.00 ? 12  ARG A CD   10 
ATOM   10609 N  NE   . ARG A 1 12 ? -26.381 -4.141  3.502   1.00 0.00 ? 12  ARG A NE   10 
ATOM   10610 C  CZ   . ARG A 1 12 ? -27.654 -4.005  3.855   1.00 0.00 ? 12  ARG A CZ   10 
ATOM   10611 N  NH1  . ARG A 1 12 ? -28.206 -2.800  3.910   1.00 0.00 ? 12  ARG A NH1  10 
ATOM   10612 N  NH2  . ARG A 1 12 ? -28.379 -5.075  4.154   1.00 0.00 ? 12  ARG A NH2  10 
ATOM   10613 H  H    . ARG A 1 12 ? -22.188 -5.311  1.384   1.00 0.00 ? 12  ARG A H    10 
ATOM   10614 H  HA   . ARG A 1 12 ? -21.758 -2.799  2.083   1.00 0.00 ? 12  ARG A HA   10 
ATOM   10615 H  HB2  . ARG A 1 12 ? -23.290 -4.906  3.568   1.00 0.00 ? 12  ARG A HB2  10 
ATOM   10616 H  HB3  . ARG A 1 12 ? -23.214 -3.265  4.196   1.00 0.00 ? 12  ARG A HB3  10 
ATOM   10617 H  HG2  . ARG A 1 12 ? -23.956 -2.645  1.753   1.00 0.00 ? 12  ARG A HG2  10 
ATOM   10618 H  HG3  . ARG A 1 12 ? -24.553 -4.306  1.756   1.00 0.00 ? 12  ARG A HG3  10 
ATOM   10619 H  HD2  . ARG A 1 12 ? -25.188 -2.534  4.067   1.00 0.00 ? 12  ARG A HD2  10 
ATOM   10620 H  HD3  . ARG A 1 12 ? -26.071 -2.314  2.557   1.00 0.00 ? 12  ARG A HD3  10 
ATOM   10621 H  HE   . ARG A 1 12 ? -25.994 -5.040  3.468   1.00 0.00 ? 12  ARG A HE   10 
ATOM   10622 H  HH11 . ARG A 1 12 ? -27.662 -1.992  3.684   1.00 0.00 ? 12  ARG A HH11 10 
ATOM   10623 H  HH12 . ARG A 1 12 ? -29.165 -2.701  4.175   1.00 0.00 ? 12  ARG A HH12 10 
ATOM   10624 H  HH21 . ARG A 1 12 ? -27.967 -5.985  4.113   1.00 0.00 ? 12  ARG A HH21 10 
ATOM   10625 H  HH22 . ARG A 1 12 ? -29.337 -4.972  4.419   1.00 0.00 ? 12  ARG A HH22 10 
ATOM   10626 N  N    . LEU A 1 13 ? -20.261 -4.690  4.306   1.00 0.00 ? 13  LEU A N    10 
ATOM   10627 C  CA   . LEU A 1 13 ? -19.260 -4.696  5.367   1.00 0.00 ? 13  LEU A CA   10 
ATOM   10628 C  C    . LEU A 1 13 ? -18.206 -3.620  5.126   1.00 0.00 ? 13  LEU A C    10 
ATOM   10629 O  O    . LEU A 1 13 ? -18.013 -3.166  3.998   1.00 0.00 ? 13  LEU A O    10 
ATOM   10630 C  CB   . LEU A 1 13 ? -18.591 -6.069  5.457   1.00 0.00 ? 13  LEU A CB   10 
ATOM   10631 C  CG   . LEU A 1 13 ? -18.172 -6.700  4.129   1.00 0.00 ? 13  LEU A CG   10 
ATOM   10632 C  CD1  . LEU A 1 13 ? -16.848 -6.120  3.657   1.00 0.00 ? 13  LEU A CD1  10 
ATOM   10633 C  CD2  . LEU A 1 13 ? -18.076 -8.213  4.264   1.00 0.00 ? 13  LEU A CD2  10 
ATOM   10634 H  H    . LEU A 1 13 ? -20.604 -5.544  3.969   1.00 0.00 ? 13  LEU A H    10 
ATOM   10635 H  HA   . LEU A 1 13 ? -19.763 -4.487  6.299   1.00 0.00 ? 13  LEU A HA   10 
ATOM   10636 H  HB2  . LEU A 1 13 ? -17.708 -5.967  6.068   1.00 0.00 ? 13  LEU A HB2  10 
ATOM   10637 H  HB3  . LEU A 1 13 ? -19.285 -6.742  5.940   1.00 0.00 ? 13  LEU A HB3  10 
ATOM   10638 H  HG   . LEU A 1 13 ? -18.920 -6.477  3.380   1.00 0.00 ? 13  LEU A HG   10 
ATOM   10639 H  HD11 . LEU A 1 13 ? -16.069 -6.858  3.775   1.00 0.00 ? 13  LEU A HD11 10 
ATOM   10640 H  HD12 . LEU A 1 13 ? -16.608 -5.246  4.244   1.00 0.00 ? 13  LEU A HD12 10 
ATOM   10641 H  HD13 . LEU A 1 13 ? -16.927 -5.843  2.616   1.00 0.00 ? 13  LEU A HD13 10 
ATOM   10642 H  HD21 . LEU A 1 13 ? -18.125 -8.484  5.309   1.00 0.00 ? 13  LEU A HD21 10 
ATOM   10643 H  HD22 . LEU A 1 13 ? -17.138 -8.552  3.848   1.00 0.00 ? 13  LEU A HD22 10 
ATOM   10644 H  HD23 . LEU A 1 13 ? -18.895 -8.674  3.733   1.00 0.00 ? 13  LEU A HD23 10 
ATOM   10645 N  N    . TYR A 1 14 ? -17.525 -3.217  6.194   1.00 0.00 ? 14  TYR A N    10 
ATOM   10646 C  CA   . TYR A 1 14 ? -16.490 -2.194  6.099   1.00 0.00 ? 14  TYR A CA   10 
ATOM   10647 C  C    . TYR A 1 14 ? -15.753 -2.286  4.766   1.00 0.00 ? 14  TYR A C    10 
ATOM   10648 O  O    . TYR A 1 14 ? -15.681 -1.315  4.014   1.00 0.00 ? 14  TYR A O    10 
ATOM   10649 C  CB   . TYR A 1 14 ? -15.497 -2.334  7.254   1.00 0.00 ? 14  TYR A CB   10 
ATOM   10650 C  CG   . TYR A 1 14 ? -14.799 -3.675  7.293   1.00 0.00 ? 14  TYR A CG   10 
ATOM   10651 C  CD1  . TYR A 1 14 ? -15.470 -4.817  7.715   1.00 0.00 ? 14  TYR A CD1  10 
ATOM   10652 C  CD2  . TYR A 1 14 ? -13.470 -3.800  6.910   1.00 0.00 ? 14  TYR A CD2  10 
ATOM   10653 C  CE1  . TYR A 1 14 ? -14.836 -6.044  7.753   1.00 0.00 ? 14  TYR A CE1  10 
ATOM   10654 C  CE2  . TYR A 1 14 ? -12.829 -5.023  6.944   1.00 0.00 ? 14  TYR A CE2  10 
ATOM   10655 C  CZ   . TYR A 1 14 ? -13.516 -6.142  7.366   1.00 0.00 ? 14  TYR A CZ   10 
ATOM   10656 O  OH   . TYR A 1 14 ? -12.880 -7.361  7.402   1.00 0.00 ? 14  TYR A OH   10 
ATOM   10657 H  H    . TYR A 1 14 ? -17.724 -3.615  7.066   1.00 0.00 ? 14  TYR A H    10 
ATOM   10658 H  HA   . TYR A 1 14 ? -16.971 -1.229  6.165   1.00 0.00 ? 14  TYR A HA   10 
ATOM   10659 H  HB2  . TYR A 1 14 ? -14.741 -1.570  7.165   1.00 0.00 ? 14  TYR A HB2  10 
ATOM   10660 H  HB3  . TYR A 1 14 ? -16.023 -2.206  8.189   1.00 0.00 ? 14  TYR A HB3  10 
ATOM   10661 H  HD1  . TYR A 1 14 ? -16.504 -4.737  8.017   1.00 0.00 ? 14  TYR A HD1  10 
ATOM   10662 H  HD2  . TYR A 1 14 ? -12.934 -2.921  6.580   1.00 0.00 ? 14  TYR A HD2  10 
ATOM   10663 H  HE1  . TYR A 1 14 ? -15.374 -6.920  8.083   1.00 0.00 ? 14  TYR A HE1  10 
ATOM   10664 H  HE2  . TYR A 1 14 ? -11.795 -5.099  6.642   1.00 0.00 ? 14  TYR A HE2  10 
ATOM   10665 H  HH   . TYR A 1 14 ? -12.158 -7.327  8.035   1.00 0.00 ? 14  TYR A HH   10 
ATOM   10666 N  N    . GLY A 1 15 ? -15.206 -3.464  4.480   1.00 0.00 ? 15  GLY A N    10 
ATOM   10667 C  CA   . GLY A 1 15 ? -14.482 -3.664  3.239   1.00 0.00 ? 15  GLY A CA   10 
ATOM   10668 C  C    . GLY A 1 15 ? -13.219 -2.829  3.163   1.00 0.00 ? 15  GLY A C    10 
ATOM   10669 O  O    . GLY A 1 15 ? -13.261 -1.610  3.332   1.00 0.00 ? 15  GLY A O    10 
ATOM   10670 H  H    . GLY A 1 15 ? -15.295 -4.204  5.118   1.00 0.00 ? 15  GLY A H    10 
ATOM   10671 H  HA2  . GLY A 1 15 ? -14.217 -4.707  3.153   1.00 0.00 ? 15  GLY A HA2  10 
ATOM   10672 H  HA3  . GLY A 1 15 ? -15.126 -3.398  2.413   1.00 0.00 ? 15  GLY A HA3  10 
ATOM   10673 N  N    . THR A 1 16 ? -12.091 -3.485  2.909   1.00 0.00 ? 16  THR A N    10 
ATOM   10674 C  CA   . THR A 1 16 ? -10.811 -2.796  2.814   1.00 0.00 ? 16  THR A CA   10 
ATOM   10675 C  C    . THR A 1 16 ? -10.325 -2.734  1.371   1.00 0.00 ? 16  THR A C    10 
ATOM   10676 O  O    . THR A 1 16 ? -9.941  -3.750  0.791   1.00 0.00 ? 16  THR A O    10 
ATOM   10677 C  CB   . THR A 1 16 ? -9.736  -3.486  3.676   1.00 0.00 ? 16  THR A CB   10 
ATOM   10678 O  OG1  . THR A 1 16 ? -10.099 -3.416  5.060   1.00 0.00 ? 16  THR A OG1  10 
ATOM   10679 C  CG2  . THR A 1 16 ? -8.377  -2.836  3.469   1.00 0.00 ? 16  THR A CG2  10 
ATOM   10680 H  H    . THR A 1 16 ? -12.123 -4.457  2.784   1.00 0.00 ? 16  THR A H    10 
ATOM   10681 H  HA   . THR A 1 16 ? -10.946 -1.789  3.183   1.00 0.00 ? 16  THR A HA   10 
ATOM   10682 H  HB   . THR A 1 16 ? -9.672  -4.524  3.381   1.00 0.00 ? 16  THR A HB   10 
ATOM   10683 H  HG1  . THR A 1 16 ? -9.719  -2.625  5.451   1.00 0.00 ? 16  THR A HG1  10 
ATOM   10684 H  HG21 . THR A 1 16 ? -7.789  -2.936  4.370   1.00 0.00 ? 16  THR A HG21 10 
ATOM   10685 H  HG22 . THR A 1 16 ? -8.510  -1.789  3.241   1.00 0.00 ? 16  THR A HG22 10 
ATOM   10686 H  HG23 . THR A 1 16 ? -7.867  -3.321  2.651   1.00 0.00 ? 16  THR A HG23 10 
ATOM   10687 N  N    . ARG A 1 17 ? -10.345 -1.536  0.796   1.00 0.00 ? 17  ARG A N    10 
ATOM   10688 C  CA   . ARG A 1 17 ? -9.907  -1.342  -0.581  1.00 0.00 ? 17  ARG A CA   10 
ATOM   10689 C  C    . ARG A 1 17 ? -8.543  -0.659  -0.627  1.00 0.00 ? 17  ARG A C    10 
ATOM   10690 O  O    . ARG A 1 17 ? -8.345  0.397   -0.026  1.00 0.00 ? 17  ARG A O    10 
ATOM   10691 C  CB   . ARG A 1 17 ? -10.932 -0.509  -1.353  1.00 0.00 ? 17  ARG A CB   10 
ATOM   10692 C  CG   . ARG A 1 17 ? -10.948 -0.794  -2.845  1.00 0.00 ? 17  ARG A CG   10 
ATOM   10693 C  CD   . ARG A 1 17 ? -11.701 0.284   -3.610  1.00 0.00 ? 17  ARG A CD   10 
ATOM   10694 N  NE   . ARG A 1 17 ? -11.125 1.609   -3.398  1.00 0.00 ? 17  ARG A NE   10 
ATOM   10695 C  CZ   . ARG A 1 17 ? -11.494 2.423   -2.416  1.00 0.00 ? 17  ARG A CZ   10 
ATOM   10696 N  NH1  . ARG A 1 17 ? -12.435 2.049   -1.559  1.00 0.00 ? 17  ARG A NH1  10 
ATOM   10697 N  NH2  . ARG A 1 17 ? -10.923 3.614   -2.289  1.00 0.00 ? 17  ARG A NH2  10 
ATOM   10698 H  H    . ARG A 1 17 ? -10.662 -0.764  1.309   1.00 0.00 ? 17  ARG A H    10 
ATOM   10699 H  HA   . ARG A 1 17 ? -9.825  -2.314  -1.043  1.00 0.00 ? 17  ARG A HA   10 
ATOM   10700 H  HB2  . ARG A 1 17 ? -11.916 -0.715  -0.958  1.00 0.00 ? 17  ARG A HB2  10 
ATOM   10701 H  HB3  . ARG A 1 17 ? -10.708 0.537   -1.210  1.00 0.00 ? 17  ARG A HB3  10 
ATOM   10702 H  HG2  . ARG A 1 17 ? -9.931  -0.831  -3.207  1.00 0.00 ? 17  ARG A HG2  10 
ATOM   10703 H  HG3  . ARG A 1 17 ? -11.428 -1.746  -3.015  1.00 0.00 ? 17  ARG A HG3  10 
ATOM   10704 H  HD2  . ARG A 1 17 ? -11.666 0.051   -4.663  1.00 0.00 ? 17  ARG A HD2  10 
ATOM   10705 H  HD3  . ARG A 1 17 ? -12.728 0.291   -3.277  1.00 0.00 ? 17  ARG A HD3  10 
ATOM   10706 H  HE   . ARG A 1 17 ? -10.428 1.905   -4.020  1.00 0.00 ? 17  ARG A HE   10 
ATOM   10707 H  HH11 . ARG A 1 17 ? -12.866 1.152   -1.652  1.00 0.00 ? 17  ARG A HH11 10 
ATOM   10708 H  HH12 . ARG A 1 17 ? -12.710 2.664   -0.820  1.00 0.00 ? 17  ARG A HH12 10 
ATOM   10709 H  HH21 . ARG A 1 17 ? -10.213 3.899   -2.933  1.00 0.00 ? 17  ARG A HH21 10 
ATOM   10710 H  HH22 . ARG A 1 17 ? -11.202 4.226   -1.550  1.00 0.00 ? 17  ARG A HH22 10 
ATOM   10711 N  N    . CYS A 1 18 ? -7.605  -1.270  -1.343  1.00 0.00 ? 18  CYS A N    10 
ATOM   10712 C  CA   . CYS A 1 18 ? -6.259  -0.723  -1.467  1.00 0.00 ? 18  CYS A CA   10 
ATOM   10713 C  C    . CYS A 1 18 ? -6.301  0.715   -1.974  1.00 0.00 ? 18  CYS A C    10 
ATOM   10714 O  O    . CYS A 1 18 ? -6.944  1.011   -2.982  1.00 0.00 ? 18  CYS A O    10 
ATOM   10715 C  CB   . CYS A 1 18 ? -5.421  -1.585  -2.412  1.00 0.00 ? 18  CYS A CB   10 
ATOM   10716 S  SG   . CYS A 1 18 ? -3.630  -1.259  -2.325  1.00 0.00 ? 18  CYS A SG   10 
ATOM   10717 H  H    . CYS A 1 18 ? -7.823  -2.110  -1.799  1.00 0.00 ? 18  CYS A H    10 
ATOM   10718 H  HA   . CYS A 1 18 ? -5.805  -0.733  -0.487  1.00 0.00 ? 18  CYS A HA   10 
ATOM   10719 H  HB2  . CYS A 1 18 ? -5.576  -2.627  -2.171  1.00 0.00 ? 18  CYS A HB2  10 
ATOM   10720 H  HB3  . CYS A 1 18 ? -5.739  -1.405  -3.429  1.00 0.00 ? 18  CYS A HB3  10 
ATOM   10721 N  N    . PHE A 1 19 ? -5.612  1.606   -1.269  1.00 0.00 ? 19  PHE A N    10 
ATOM   10722 C  CA   . PHE A 1 19 ? -5.571  3.014   -1.648  1.00 0.00 ? 19  PHE A CA   10 
ATOM   10723 C  C    . PHE A 1 19 ? -4.468  3.270   -2.671  1.00 0.00 ? 19  PHE A C    10 
ATOM   10724 O  O    . PHE A 1 19 ? -4.100  4.416   -2.929  1.00 0.00 ? 19  PHE A O    10 
ATOM   10725 C  CB   . PHE A 1 19 ? -5.349  3.889   -0.412  1.00 0.00 ? 19  PHE A CB   10 
ATOM   10726 C  CG   . PHE A 1 19 ? -6.620  4.250   0.302   1.00 0.00 ? 19  PHE A CG   10 
ATOM   10727 C  CD1  . PHE A 1 19 ? -7.153  3.407   1.265   1.00 0.00 ? 19  PHE A CD1  10 
ATOM   10728 C  CD2  . PHE A 1 19 ? -7.282  5.432   0.012   1.00 0.00 ? 19  PHE A CD2  10 
ATOM   10729 C  CE1  . PHE A 1 19 ? -8.322  3.737   1.923   1.00 0.00 ? 19  PHE A CE1  10 
ATOM   10730 C  CE2  . PHE A 1 19 ? -8.452  5.767   0.667   1.00 0.00 ? 19  PHE A CE2  10 
ATOM   10731 C  CZ   . PHE A 1 19 ? -8.972  4.919   1.625   1.00 0.00 ? 19  PHE A CZ   10 
ATOM   10732 H  H    . PHE A 1 19 ? -5.119  1.310   -0.475  1.00 0.00 ? 19  PHE A H    10 
ATOM   10733 H  HA   . PHE A 1 19 ? -6.522  3.265   -2.091  1.00 0.00 ? 19  PHE A HA   10 
ATOM   10734 H  HB2  . PHE A 1 19 ? -4.716  3.362   0.285   1.00 0.00 ? 19  PHE A HB2  10 
ATOM   10735 H  HB3  . PHE A 1 19 ? -4.864  4.806   -0.712  1.00 0.00 ? 19  PHE A HB3  10 
ATOM   10736 H  HD1  . PHE A 1 19 ? -6.645  2.484   1.500   1.00 0.00 ? 19  PHE A HD1  10 
ATOM   10737 H  HD2  . PHE A 1 19 ? -6.876  6.097   -0.738  1.00 0.00 ? 19  PHE A HD2  10 
ATOM   10738 H  HE1  . PHE A 1 19 ? -8.727  3.072   2.671   1.00 0.00 ? 19  PHE A HE1  10 
ATOM   10739 H  HE2  . PHE A 1 19 ? -8.957  6.692   0.431   1.00 0.00 ? 19  PHE A HE2  10 
ATOM   10740 H  HZ   . PHE A 1 19 ? -9.886  5.178   2.137   1.00 0.00 ? 19  PHE A HZ   10 
ATOM   10741 N  N    . SER A 1 20 ? -3.944  2.194   -3.249  1.00 0.00 ? 20  SER A N    10 
ATOM   10742 C  CA   . SER A 1 20 ? -2.880  2.301   -4.241  1.00 0.00 ? 20  SER A CA   10 
ATOM   10743 C  C    . SER A 1 20 ? -3.390  1.919   -5.627  1.00 0.00 ? 20  SER A C    10 
ATOM   10744 O  O    . SER A 1 20 ? -3.444  2.753   -6.533  1.00 0.00 ? 20  SER A O    10 
ATOM   10745 C  CB   . SER A 1 20 ? -1.702  1.405   -3.854  1.00 0.00 ? 20  SER A CB   10 
ATOM   10746 O  OG   . SER A 1 20 ? -0.773  2.106   -3.044  1.00 0.00 ? 20  SER A OG   10 
ATOM   10747 H  H    . SER A 1 20 ? -4.279  1.307   -3.001  1.00 0.00 ? 20  SER A H    10 
ATOM   10748 H  HA   . SER A 1 20 ? -2.549  3.328   -4.262  1.00 0.00 ? 20  SER A HA   10 
ATOM   10749 H  HB2  . SER A 1 20 ? -2.067  0.551   -3.305  1.00 0.00 ? 20  SER A HB2  10 
ATOM   10750 H  HB3  . SER A 1 20 ? -1.199  1.070   -4.750  1.00 0.00 ? 20  SER A HB3  10 
ATOM   10751 H  HG   . SER A 1 20 ? -0.665  1.644   -2.209  1.00 0.00 ? 20  SER A HG   10 
ATOM   10752 N  N    . CYS A 1 21 ? -3.762  0.654   -5.786  1.00 0.00 ? 21  CYS A N    10 
ATOM   10753 C  CA   . CYS A 1 21 ? -4.267  0.159   -7.061  1.00 0.00 ? 21  CYS A CA   10 
ATOM   10754 C  C    . CYS A 1 21 ? -5.790  0.231   -7.108  1.00 0.00 ? 21  CYS A C    10 
ATOM   10755 O  O    . CYS A 1 21 ? -6.405  -0.062  -8.134  1.00 0.00 ? 21  CYS A O    10 
ATOM   10756 C  CB   . CYS A 1 21 ? -3.806  -1.281  -7.292  1.00 0.00 ? 21  CYS A CB   10 
ATOM   10757 S  SG   . CYS A 1 21 ? -4.353  -2.451  -6.007  1.00 0.00 ? 21  CYS A SG   10 
ATOM   10758 H  H    . CYS A 1 21 ? -3.695  0.036   -5.027  1.00 0.00 ? 21  CYS A H    10 
ATOM   10759 H  HA   . CYS A 1 21 ? -3.865  0.786   -7.843  1.00 0.00 ? 21  CYS A HA   10 
ATOM   10760 H  HB2  . CYS A 1 21 ? -4.195  -1.629  -8.238  1.00 0.00 ? 21  CYS A HB2  10 
ATOM   10761 H  HB3  . CYS A 1 21 ? -2.727  -1.306  -7.322  1.00 0.00 ? 21  CYS A HB3  10 
ATOM   10762 N  N    . ASP A 1 22 ? -6.393  0.623   -5.991  1.00 0.00 ? 22  ASP A N    10 
ATOM   10763 C  CA   . ASP A 1 22 ? -7.844  0.735   -5.904  1.00 0.00 ? 22  ASP A CA   10 
ATOM   10764 C  C    . ASP A 1 22 ? -8.506  -0.629  -6.069  1.00 0.00 ? 22  ASP A C    10 
ATOM   10765 O  O    . ASP A 1 22 ? -9.456  -0.779  -6.837  1.00 0.00 ? 22  ASP A O    10 
ATOM   10766 C  CB   . ASP A 1 22 ? -8.367  1.702   -6.967  1.00 0.00 ? 22  ASP A CB   10 
ATOM   10767 C  CG   . ASP A 1 22 ? -9.669  2.363   -6.559  1.00 0.00 ? 22  ASP A CG   10 
ATOM   10768 O  OD1  . ASP A 1 22 ? -9.619  3.353   -5.801  1.00 0.00 ? 22  ASP A OD1  10 
ATOM   10769 O  OD2  . ASP A 1 22 ? -10.738 1.888   -6.998  1.00 0.00 ? 22  ASP A OD2  10 
ATOM   10770 H  H    . ASP A 1 22 ? -5.848  0.843   -5.206  1.00 0.00 ? 22  ASP A H    10 
ATOM   10771 H  HA   . ASP A 1 22 ? -8.089  1.123   -4.926  1.00 0.00 ? 22  ASP A HA   10 
ATOM   10772 H  HB2  . ASP A 1 22 ? -7.631  2.475   -7.136  1.00 0.00 ? 22  ASP A HB2  10 
ATOM   10773 H  HB3  . ASP A 1 22 ? -8.531  1.161   -7.887  1.00 0.00 ? 22  ASP A HB3  10 
ATOM   10774 N  N    . GLN A 1 23 ? -7.996  -1.620  -5.345  1.00 0.00 ? 23  GLN A N    10 
ATOM   10775 C  CA   . GLN A 1 23 ? -8.536  -2.973  -5.415  1.00 0.00 ? 23  GLN A CA   10 
ATOM   10776 C  C    . GLN A 1 23 ? -8.743  -3.548  -4.017  1.00 0.00 ? 23  GLN A C    10 
ATOM   10777 O  O    . GLN A 1 23 ? -7.928  -3.334  -3.120  1.00 0.00 ? 23  GLN A O    10 
ATOM   10778 C  CB   . GLN A 1 23 ? -7.601  -3.878  -6.218  1.00 0.00 ? 23  GLN A CB   10 
ATOM   10779 C  CG   . GLN A 1 23 ? -7.273  -3.339  -7.601  1.00 0.00 ? 23  GLN A CG   10 
ATOM   10780 C  CD   . GLN A 1 23 ? -8.500  -3.204  -8.482  1.00 0.00 ? 23  GLN A CD   10 
ATOM   10781 O  OE1  . GLN A 1 23 ? -9.302  -4.131  -8.595  1.00 0.00 ? 23  GLN A OE1  10 
ATOM   10782 N  NE2  . GLN A 1 23 ? -8.652  -2.045  -9.111  1.00 0.00 ? 23  GLN A NE2  10 
ATOM   10783 H  H    . GLN A 1 23 ? -7.238  -1.438  -4.752  1.00 0.00 ? 23  GLN A H    10 
ATOM   10784 H  HA   . GLN A 1 23 ? -9.492  -2.922  -5.915  1.00 0.00 ? 23  GLN A HA   10 
ATOM   10785 H  HB2  . GLN A 1 23 ? -6.677  -3.997  -5.673  1.00 0.00 ? 23  GLN A HB2  10 
ATOM   10786 H  HB3  . GLN A 1 23 ? -8.068  -4.845  -6.335  1.00 0.00 ? 23  GLN A HB3  10 
ATOM   10787 H  HG2  . GLN A 1 23 ? -6.817  -2.366  -7.495  1.00 0.00 ? 23  GLN A HG2  10 
ATOM   10788 H  HG3  . GLN A 1 23 ? -6.576  -4.011  -8.079  1.00 0.00 ? 23  GLN A HG3  10 
ATOM   10789 H  HE21 . GLN A 1 23 ? -7.972  -1.351  -8.975  1.00 0.00 ? 23  GLN A HE21 10 
ATOM   10790 H  HE22 . GLN A 1 23 ? -9.435  -1.930  -9.688  1.00 0.00 ? 23  GLN A HE22 10 
ATOM   10791 N  N    . PHE A 1 24 ? -9.839  -4.279  -3.840  1.00 0.00 ? 24  PHE A N    10 
ATOM   10792 C  CA   . PHE A 1 24 ? -10.154 -4.884  -2.551  1.00 0.00 ? 24  PHE A CA   10 
ATOM   10793 C  C    . PHE A 1 24 ? -9.024  -5.800  -2.090  1.00 0.00 ? 24  PHE A C    10 
ATOM   10794 O  O    . PHE A 1 24 ? -8.612  -6.708  -2.813  1.00 0.00 ? 24  PHE A O    10 
ATOM   10795 C  CB   . PHE A 1 24 ? -11.461 -5.674  -2.641  1.00 0.00 ? 24  PHE A CB   10 
ATOM   10796 C  CG   . PHE A 1 24 ? -12.689 -4.811  -2.578  1.00 0.00 ? 24  PHE A CG   10 
ATOM   10797 C  CD1  . PHE A 1 24 ? -12.800 -3.683  -3.376  1.00 0.00 ? 24  PHE A CD1  10 
ATOM   10798 C  CD2  . PHE A 1 24 ? -13.732 -5.128  -1.723  1.00 0.00 ? 24  PHE A CD2  10 
ATOM   10799 C  CE1  . PHE A 1 24 ? -13.928 -2.887  -3.319  1.00 0.00 ? 24  PHE A CE1  10 
ATOM   10800 C  CE2  . PHE A 1 24 ? -14.863 -4.335  -1.663  1.00 0.00 ? 24  PHE A CE2  10 
ATOM   10801 C  CZ   . PHE A 1 24 ? -14.961 -3.214  -2.463  1.00 0.00 ? 24  PHE A CZ   10 
ATOM   10802 H  H    . PHE A 1 24 ? -10.451 -4.414  -4.594  1.00 0.00 ? 24  PHE A H    10 
ATOM   10803 H  HA   . PHE A 1 24 ? -10.273 -4.088  -1.833  1.00 0.00 ? 24  PHE A HA   10 
ATOM   10804 H  HB2  . PHE A 1 24 ? -11.484 -6.215  -3.576  1.00 0.00 ? 24  PHE A HB2  10 
ATOM   10805 H  HB3  . PHE A 1 24 ? -11.506 -6.377  -1.823  1.00 0.00 ? 24  PHE A HB3  10 
ATOM   10806 H  HD1  . PHE A 1 24 ? -11.994 -3.426  -4.047  1.00 0.00 ? 24  PHE A HD1  10 
ATOM   10807 H  HD2  . PHE A 1 24 ? -13.656 -6.006  -1.097  1.00 0.00 ? 24  PHE A HD2  10 
ATOM   10808 H  HE1  . PHE A 1 24 ? -14.003 -2.011  -3.946  1.00 0.00 ? 24  PHE A HE1  10 
ATOM   10809 H  HE2  . PHE A 1 24 ? -15.668 -4.594  -0.992  1.00 0.00 ? 24  PHE A HE2  10 
ATOM   10810 H  HZ   . PHE A 1 24 ? -15.844 -2.593  -2.417  1.00 0.00 ? 24  PHE A HZ   10 
ATOM   10811 N  N    . ILE A 1 25 ? -8.527  -5.554  -0.882  1.00 0.00 ? 25  ILE A N    10 
ATOM   10812 C  CA   . ILE A 1 25 ? -7.446  -6.356  -0.324  1.00 0.00 ? 25  ILE A CA   10 
ATOM   10813 C  C    . ILE A 1 25 ? -7.989  -7.576  0.411   1.00 0.00 ? 25  ILE A C    10 
ATOM   10814 O  O    . ILE A 1 25 ? -8.665  -7.448  1.432   1.00 0.00 ? 25  ILE A O    10 
ATOM   10815 C  CB   . ILE A 1 25 ? -6.576  -5.532  0.645   1.00 0.00 ? 25  ILE A CB   10 
ATOM   10816 C  CG1  . ILE A 1 25 ? -6.280  -4.153  0.051   1.00 0.00 ? 25  ILE A CG1  10 
ATOM   10817 C  CG2  . ILE A 1 25 ? -5.283  -6.271  0.954   1.00 0.00 ? 25  ILE A CG2  10 
ATOM   10818 C  CD1  . ILE A 1 25 ? -5.596  -3.213  1.019   1.00 0.00 ? 25  ILE A CD1  10 
ATOM   10819 H  H    . ILE A 1 25 ? -8.897  -4.816  -0.354  1.00 0.00 ? 25  ILE A H    10 
ATOM   10820 H  HA   . ILE A 1 25 ? -6.822  -6.689  -1.141  1.00 0.00 ? 25  ILE A HA   10 
ATOM   10821 H  HB   . ILE A 1 25 ? -7.122  -5.409  1.567   1.00 0.00 ? 25  ILE A HB   10 
ATOM   10822 H  HG12 . ILE A 1 25 ? -5.638  -4.268  -0.808  1.00 0.00 ? 25  ILE A HG12 10 
ATOM   10823 H  HG13 . ILE A 1 25 ? -7.208  -3.695  -0.257  1.00 0.00 ? 25  ILE A HG13 10 
ATOM   10824 H  HG21 . ILE A 1 25 ? -5.350  -7.284  0.585   1.00 0.00 ? 25  ILE A HG21 10 
ATOM   10825 H  HG22 . ILE A 1 25 ? -4.457  -5.767  0.474   1.00 0.00 ? 25  ILE A HG22 10 
ATOM   10826 H  HG23 . ILE A 1 25 ? -5.124  -6.287  2.022   1.00 0.00 ? 25  ILE A HG23 10 
ATOM   10827 H  HD11 . ILE A 1 25 ? -5.101  -3.786  1.789   1.00 0.00 ? 25  ILE A HD11 10 
ATOM   10828 H  HD12 . ILE A 1 25 ? -4.868  -2.617  0.489   1.00 0.00 ? 25  ILE A HD12 10 
ATOM   10829 H  HD13 . ILE A 1 25 ? -6.332  -2.564  1.471   1.00 0.00 ? 25  ILE A HD13 10 
ATOM   10830 N  N    . GLU A 1 26 ? -7.687  -8.759  -0.113  1.00 0.00 ? 26  GLU A N    10 
ATOM   10831 C  CA   . GLU A 1 26 ? -8.145  -10.003 0.494   1.00 0.00 ? 26  GLU A CA   10 
ATOM   10832 C  C    . GLU A 1 26 ? -7.014  -10.683 1.261   1.00 0.00 ? 26  GLU A C    10 
ATOM   10833 O  O    . GLU A 1 26 ? -5.838  -10.486 0.958   1.00 0.00 ? 26  GLU A O    10 
ATOM   10834 C  CB   . GLU A 1 26 ? -8.691  -10.950 -0.577  1.00 0.00 ? 26  GLU A CB   10 
ATOM   10835 C  CG   . GLU A 1 26 ? -8.907  -12.370 -0.081  1.00 0.00 ? 26  GLU A CG   10 
ATOM   10836 C  CD   . GLU A 1 26 ? -9.302  -13.322 -1.194  1.00 0.00 ? 26  GLU A CD   10 
ATOM   10837 O  OE1  . GLU A 1 26 ? -8.469  -13.560 -2.093  1.00 0.00 ? 26  GLU A OE1  10 
ATOM   10838 O  OE2  . GLU A 1 26 ? -10.443 -13.829 -1.165  1.00 0.00 ? 26  GLU A OE2  10 
ATOM   10839 H  H    . GLU A 1 26 ? -7.145  -8.797  -0.929  1.00 0.00 ? 26  GLU A H    10 
ATOM   10840 H  HA   . GLU A 1 26 ? -8.938  -9.762  1.186   1.00 0.00 ? 26  GLU A HA   10 
ATOM   10841 H  HB2  . GLU A 1 26 ? -9.636  -10.566 -0.931  1.00 0.00 ? 26  GLU A HB2  10 
ATOM   10842 H  HB3  . GLU A 1 26 ? -7.994  -10.981 -1.401  1.00 0.00 ? 26  GLU A HB3  10 
ATOM   10843 H  HG2  . GLU A 1 26 ? -7.991  -12.724 0.367   1.00 0.00 ? 26  GLU A HG2  10 
ATOM   10844 H  HG3  . GLU A 1 26 ? -9.691  -12.363 0.662   1.00 0.00 ? 26  GLU A HG3  10 
ATOM   10845 N  N    . GLY A 1 27 ? -7.380  -11.485 2.256   1.00 0.00 ? 27  GLY A N    10 
ATOM   10846 C  CA   . GLY A 1 27 ? -6.385  -12.182 3.051   1.00 0.00 ? 27  GLY A CA   10 
ATOM   10847 C  C    . GLY A 1 27 ? -5.788  -11.303 4.132   1.00 0.00 ? 27  GLY A C    10 
ATOM   10848 O  O    . GLY A 1 27 ? -6.246  -11.314 5.273   1.00 0.00 ? 27  GLY A O    10 
ATOM   10849 H  H    . GLY A 1 27 ? -8.333  -11.605 2.452   1.00 0.00 ? 27  GLY A H    10 
ATOM   10850 H  HA2  . GLY A 1 27 ? -6.848  -13.040 3.514   1.00 0.00 ? 27  GLY A HA2  10 
ATOM   10851 H  HA3  . GLY A 1 27 ? -5.593  -12.520 2.399   1.00 0.00 ? 27  GLY A HA3  10 
ATOM   10852 N  N    . GLU A 1 28 ? -4.760  -10.540 3.771   1.00 0.00 ? 28  GLU A N    10 
ATOM   10853 C  CA   . GLU A 1 28 ? -4.098  -9.654  4.721   1.00 0.00 ? 28  GLU A CA   10 
ATOM   10854 C  C    . GLU A 1 28 ? -3.989  -8.239  4.159   1.00 0.00 ? 28  GLU A C    10 
ATOM   10855 O  O    . GLU A 1 28 ? -3.718  -8.049  2.973   1.00 0.00 ? 28  GLU A O    10 
ATOM   10856 C  CB   . GLU A 1 28 ? -2.705  -10.187 5.064   1.00 0.00 ? 28  GLU A CB   10 
ATOM   10857 C  CG   . GLU A 1 28 ? -1.887  -9.240  5.926   1.00 0.00 ? 28  GLU A CG   10 
ATOM   10858 C  CD   . GLU A 1 28 ? -0.850  -9.963  6.764   1.00 0.00 ? 28  GLU A CD   10 
ATOM   10859 O  OE1  . GLU A 1 28 ? -0.331  -11.000 6.302   1.00 0.00 ? 28  GLU A OE1  10 
ATOM   10860 O  OE2  . GLU A 1 28 ? -0.558  -9.491  7.883   1.00 0.00 ? 28  GLU A OE2  10 
ATOM   10861 H  H    . GLU A 1 28 ? -4.440  -10.575 2.846   1.00 0.00 ? 28  GLU A H    10 
ATOM   10862 H  HA   . GLU A 1 28 ? -4.694  -9.626  5.620   1.00 0.00 ? 28  GLU A HA   10 
ATOM   10863 H  HB2  . GLU A 1 28 ? -2.811  -11.122 5.593   1.00 0.00 ? 28  GLU A HB2  10 
ATOM   10864 H  HB3  . GLU A 1 28 ? -2.164  -10.362 4.146   1.00 0.00 ? 28  GLU A HB3  10 
ATOM   10865 H  HG2  . GLU A 1 28 ? -1.380  -8.536  5.284   1.00 0.00 ? 28  GLU A HG2  10 
ATOM   10866 H  HG3  . GLU A 1 28 ? -2.554  -8.707  6.587   1.00 0.00 ? 28  GLU A HG3  10 
ATOM   10867 N  N    . VAL A 1 29 ? -4.202  -7.249  5.020   1.00 0.00 ? 29  VAL A N    10 
ATOM   10868 C  CA   . VAL A 1 29 ? -4.127  -5.851  4.611   1.00 0.00 ? 29  VAL A CA   10 
ATOM   10869 C  C    . VAL A 1 29 ? -3.187  -5.063  5.516   1.00 0.00 ? 29  VAL A C    10 
ATOM   10870 O  O    . VAL A 1 29 ? -3.196  -5.231  6.736   1.00 0.00 ? 29  VAL A O    10 
ATOM   10871 C  CB   . VAL A 1 29 ? -5.517  -5.186  4.629   1.00 0.00 ? 29  VAL A CB   10 
ATOM   10872 C  CG1  . VAL A 1 29 ? -6.231  -5.478  5.940   1.00 0.00 ? 29  VAL A CG1  10 
ATOM   10873 C  CG2  . VAL A 1 29 ? -5.392  -3.687  4.402   1.00 0.00 ? 29  VAL A CG2  10 
ATOM   10874 H  H    . VAL A 1 29 ? -4.414  -7.463  5.952   1.00 0.00 ? 29  VAL A H    10 
ATOM   10875 H  HA   . VAL A 1 29 ? -3.749  -5.819  3.600   1.00 0.00 ? 29  VAL A HA   10 
ATOM   10876 H  HB   . VAL A 1 29 ? -6.104  -5.604  3.824   1.00 0.00 ? 29  VAL A HB   10 
ATOM   10877 H  HG11 . VAL A 1 29 ? -6.117  -6.523  6.187   1.00 0.00 ? 29  VAL A HG11 10 
ATOM   10878 H  HG12 . VAL A 1 29 ? -5.804  -4.872  6.726   1.00 0.00 ? 29  VAL A HG12 10 
ATOM   10879 H  HG13 . VAL A 1 29 ? -7.281  -5.245  5.837   1.00 0.00 ? 29  VAL A HG13 10 
ATOM   10880 H  HG21 . VAL A 1 29 ? -5.999  -3.401  3.555   1.00 0.00 ? 29  VAL A HG21 10 
ATOM   10881 H  HG22 . VAL A 1 29 ? -5.731  -3.160  5.282   1.00 0.00 ? 29  VAL A HG22 10 
ATOM   10882 H  HG23 . VAL A 1 29 ? -4.360  -3.437  4.207   1.00 0.00 ? 29  VAL A HG23 10 
ATOM   10883 N  N    . VAL A 1 30 ? -2.376  -4.202  4.911   1.00 0.00 ? 30  VAL A N    10 
ATOM   10884 C  CA   . VAL A 1 30 ? -1.430  -3.386  5.662   1.00 0.00 ? 30  VAL A CA   10 
ATOM   10885 C  C    . VAL A 1 30 ? -1.992  -1.993  5.924   1.00 0.00 ? 30  VAL A C    10 
ATOM   10886 O  O    . VAL A 1 30 ? -2.120  -1.182  5.008   1.00 0.00 ? 30  VAL A O    10 
ATOM   10887 C  CB   . VAL A 1 30 ? -0.088  -3.254  4.918   1.00 0.00 ? 30  VAL A CB   10 
ATOM   10888 C  CG1  . VAL A 1 30 ? 0.910   -2.463  5.751   1.00 0.00 ? 30  VAL A CG1  10 
ATOM   10889 C  CG2  . VAL A 1 30 ? 0.466   -4.627  4.571   1.00 0.00 ? 30  VAL A CG2  10 
ATOM   10890 H  H    . VAL A 1 30 ? -2.415  -4.112  3.936   1.00 0.00 ? 30  VAL A H    10 
ATOM   10891 H  HA   . VAL A 1 30 ? -1.246  -3.873  6.609   1.00 0.00 ? 30  VAL A HA   10 
ATOM   10892 H  HB   . VAL A 1 30 ? -0.261  -2.715  3.998   1.00 0.00 ? 30  VAL A HB   10 
ATOM   10893 H  HG11 . VAL A 1 30 ? 1.516   -1.850  5.100   1.00 0.00 ? 30  VAL A HG11 10 
ATOM   10894 H  HG12 . VAL A 1 30 ? 0.377   -1.832  6.448   1.00 0.00 ? 30  VAL A HG12 10 
ATOM   10895 H  HG13 . VAL A 1 30 ? 1.545   -3.146  6.296   1.00 0.00 ? 30  VAL A HG13 10 
ATOM   10896 H  HG21 . VAL A 1 30 ? 1.535   -4.560  4.435   1.00 0.00 ? 30  VAL A HG21 10 
ATOM   10897 H  HG22 . VAL A 1 30 ? 0.248   -5.317  5.374   1.00 0.00 ? 30  VAL A HG22 10 
ATOM   10898 H  HG23 . VAL A 1 30 ? 0.008   -4.981  3.659   1.00 0.00 ? 30  VAL A HG23 10 
ATOM   10899 N  N    . SER A 1 31 ? -2.326  -1.722  7.182   1.00 0.00 ? 31  SER A N    10 
ATOM   10900 C  CA   . SER A 1 31 ? -2.878  -0.428  7.565   1.00 0.00 ? 31  SER A CA   10 
ATOM   10901 C  C    . SER A 1 31 ? -1.766  0.590   7.797   1.00 0.00 ? 31  SER A C    10 
ATOM   10902 O  O    . SER A 1 31 ? -0.931  0.422   8.685   1.00 0.00 ? 31  SER A O    10 
ATOM   10903 C  CB   . SER A 1 31 ? -3.729  -0.567  8.829   1.00 0.00 ? 31  SER A CB   10 
ATOM   10904 O  OG   . SER A 1 31 ? -4.582  0.553   8.995   1.00 0.00 ? 31  SER A OG   10 
ATOM   10905 H  H    . SER A 1 31 ? -2.200  -2.411  7.868   1.00 0.00 ? 31  SER A H    10 
ATOM   10906 H  HA   . SER A 1 31 ? -3.504  -0.083  6.756   1.00 0.00 ? 31  SER A HA   10 
ATOM   10907 H  HB2  . SER A 1 31 ? -4.334  -1.458  8.756   1.00 0.00 ? 31  SER A HB2  10 
ATOM   10908 H  HB3  . SER A 1 31 ? -3.081  -0.641  9.690   1.00 0.00 ? 31  SER A HB3  10 
ATOM   10909 H  HG   . SER A 1 31 ? -5.415  0.267   9.377   1.00 0.00 ? 31  SER A HG   10 
ATOM   10910 N  N    . ALA A 1 32 ? -1.762  1.646   6.990   1.00 0.00 ? 32  ALA A N    10 
ATOM   10911 C  CA   . ALA A 1 32 ? -0.755  2.693   7.107   1.00 0.00 ? 32  ALA A CA   10 
ATOM   10912 C  C    . ALA A 1 32 ? -1.402  4.055   7.337   1.00 0.00 ? 32  ALA A C    10 
ATOM   10913 O  O    . ALA A 1 32 ? -2.151  4.548   6.494   1.00 0.00 ? 32  ALA A O    10 
ATOM   10914 C  CB   . ALA A 1 32 ? 0.120   2.726   5.862   1.00 0.00 ? 32  ALA A CB   10 
ATOM   10915 H  H    . ALA A 1 32 ? -2.454  1.724   6.301   1.00 0.00 ? 32  ALA A H    10 
ATOM   10916 H  HA   . ALA A 1 32 ? -0.125  2.457   7.953   1.00 0.00 ? 32  ALA A HA   10 
ATOM   10917 H  HB1  . ALA A 1 32 ? 0.999   3.323   6.057   1.00 0.00 ? 32  ALA A HB1  10 
ATOM   10918 H  HB2  . ALA A 1 32 ? 0.417   1.721   5.604   1.00 0.00 ? 32  ALA A HB2  10 
ATOM   10919 H  HB3  . ALA A 1 32 ? -0.436  3.159   5.044   1.00 0.00 ? 32  ALA A HB3  10 
ATOM   10920 N  N    . LEU A 1 33 ? -1.109  4.657   8.485   1.00 0.00 ? 33  LEU A N    10 
ATOM   10921 C  CA   . LEU A 1 33 ? -1.663  5.963   8.827   1.00 0.00 ? 33  LEU A CA   10 
ATOM   10922 C  C    . LEU A 1 33 ? -3.184  5.958   8.703   1.00 0.00 ? 33  LEU A C    10 
ATOM   10923 O  O    . LEU A 1 33 ? -3.791  6.968   8.353   1.00 0.00 ? 33  LEU A O    10 
ATOM   10924 C  CB   . LEU A 1 33 ? -1.070  7.043   7.921   1.00 0.00 ? 33  LEU A CB   10 
ATOM   10925 C  CG   . LEU A 1 33 ? 0.366   7.466   8.233   1.00 0.00 ? 33  LEU A CG   10 
ATOM   10926 C  CD1  . LEU A 1 33 ? 1.043   8.016   6.987   1.00 0.00 ? 33  LEU A CD1  10 
ATOM   10927 C  CD2  . LEU A 1 33 ? 0.388   8.496   9.353   1.00 0.00 ? 33  LEU A CD2  10 
ATOM   10928 H  H    . LEU A 1 33 ? -0.506  4.215   9.117   1.00 0.00 ? 33  LEU A H    10 
ATOM   10929 H  HA   . LEU A 1 33 ? -1.398  6.177   9.851   1.00 0.00 ? 33  LEU A HA   10 
ATOM   10930 H  HB2  . LEU A 1 33 ? -1.093  6.675   6.907   1.00 0.00 ? 33  LEU A HB2  10 
ATOM   10931 H  HB3  . LEU A 1 33 ? -1.698  7.920   7.999   1.00 0.00 ? 33  LEU A HB3  10 
ATOM   10932 H  HG   . LEU A 1 33 ? 0.926   6.601   8.562   1.00 0.00 ? 33  LEU A HG   10 
ATOM   10933 H  HD11 . LEU A 1 33 ? 1.183   7.219   6.272   1.00 0.00 ? 33  LEU A HD11 10 
ATOM   10934 H  HD12 . LEU A 1 33 ? 2.003   8.433   7.253   1.00 0.00 ? 33  LEU A HD12 10 
ATOM   10935 H  HD13 . LEU A 1 33 ? 0.424   8.787   6.552   1.00 0.00 ? 33  LEU A HD13 10 
ATOM   10936 H  HD21 . LEU A 1 33 ? 1.112   9.263   9.121   1.00 0.00 ? 33  LEU A HD21 10 
ATOM   10937 H  HD22 . LEU A 1 33 ? 0.660   8.014   10.280  1.00 0.00 ? 33  LEU A HD22 10 
ATOM   10938 H  HD23 . LEU A 1 33 ? -0.591  8.942   9.451   1.00 0.00 ? 33  LEU A HD23 10 
ATOM   10939 N  N    . GLY A 1 34 ? -3.793  4.813   8.996   1.00 0.00 ? 34  GLY A N    10 
ATOM   10940 C  CA   . GLY A 1 34 ? -5.237  4.698   8.913   1.00 0.00 ? 34  GLY A CA   10 
ATOM   10941 C  C    . GLY A 1 34 ? -5.703  4.197   7.561   1.00 0.00 ? 34  GLY A C    10 
ATOM   10942 O  O    . GLY A 1 34 ? -6.822  3.702   7.425   1.00 0.00 ? 34  GLY A O    10 
ATOM   10943 H  H    . GLY A 1 34 ? -3.257  4.039   9.270   1.00 0.00 ? 34  GLY A H    10 
ATOM   10944 H  HA2  . GLY A 1 34 ? -5.577  4.014   9.676   1.00 0.00 ? 34  GLY A HA2  10 
ATOM   10945 H  HA3  . GLY A 1 34 ? -5.674  5.670   9.094   1.00 0.00 ? 34  GLY A HA3  10 
ATOM   10946 N  N    . LYS A 1 35 ? -4.843  4.325   6.556   1.00 0.00 ? 35  LYS A N    10 
ATOM   10947 C  CA   . LYS A 1 35 ? -5.172  3.881   5.206   1.00 0.00 ? 35  LYS A CA   10 
ATOM   10948 C  C    . LYS A 1 35 ? -4.861  2.398   5.030   1.00 0.00 ? 35  LYS A C    10 
ATOM   10949 O  O    . LYS A 1 35 ? -4.204  1.786   5.873   1.00 0.00 ? 35  LYS A O    10 
ATOM   10950 C  CB   . LYS A 1 35 ? -4.394  4.702   4.174   1.00 0.00 ? 35  LYS A CB   10 
ATOM   10951 C  CG   . LYS A 1 35 ? -5.123  5.955   3.721   1.00 0.00 ? 35  LYS A CG   10 
ATOM   10952 C  CD   . LYS A 1 35 ? -5.120  7.024   4.801   1.00 0.00 ? 35  LYS A CD   10 
ATOM   10953 C  CE   . LYS A 1 35 ? -6.359  7.903   4.718   1.00 0.00 ? 35  LYS A CE   10 
ATOM   10954 N  NZ   . LYS A 1 35 ? -6.174  9.034   3.768   1.00 0.00 ? 35  LYS A NZ   10 
ATOM   10955 H  H    . LYS A 1 35 ? -3.965  4.727   6.726   1.00 0.00 ? 35  LYS A H    10 
ATOM   10956 H  HA   . LYS A 1 35 ? -6.229  4.036   5.054   1.00 0.00 ? 35  LYS A HA   10 
ATOM   10957 H  HB2  . LYS A 1 35 ? -3.448  4.996   4.605   1.00 0.00 ? 35  LYS A HB2  10 
ATOM   10958 H  HB3  . LYS A 1 35 ? -4.209  4.085   3.307   1.00 0.00 ? 35  LYS A HB3  10 
ATOM   10959 H  HG2  . LYS A 1 35 ? -4.633  6.347   2.841   1.00 0.00 ? 35  LYS A HG2  10 
ATOM   10960 H  HG3  . LYS A 1 35 ? -6.145  5.700   3.482   1.00 0.00 ? 35  LYS A HG3  10 
ATOM   10961 H  HD2  . LYS A 1 35 ? -5.096  6.545   5.769   1.00 0.00 ? 35  LYS A HD2  10 
ATOM   10962 H  HD3  . LYS A 1 35 ? -4.242  7.642   4.681   1.00 0.00 ? 35  LYS A HD3  10 
ATOM   10963 H  HE2  . LYS A 1 35 ? -7.191  7.300   4.388   1.00 0.00 ? 35  LYS A HE2  10 
ATOM   10964 H  HE3  . LYS A 1 35 ? -6.569  8.299   5.701   1.00 0.00 ? 35  LYS A HE3  10 
ATOM   10965 H  HZ1  . LYS A 1 35 ? -5.164  9.153   3.547   1.00 0.00 ? 35  LYS A HZ1  10 
ATOM   10966 H  HZ2  . LYS A 1 35 ? -6.530  9.916   4.189   1.00 0.00 ? 35  LYS A HZ2  10 
ATOM   10967 H  HZ3  . LYS A 1 35 ? -6.692  8.849   2.886   1.00 0.00 ? 35  LYS A HZ3  10 
ATOM   10968 N  N    . THR A 1 36 ? -5.337  1.825   3.929   1.00 0.00 ? 36  THR A N    10 
ATOM   10969 C  CA   . THR A 1 36 ? -5.110  0.414   3.643   1.00 0.00 ? 36  THR A CA   10 
ATOM   10970 C  C    . THR A 1 36 ? -4.432  0.231   2.290   1.00 0.00 ? 36  THR A C    10 
ATOM   10971 O  O    . THR A 1 36 ? -4.837  0.831   1.294   1.00 0.00 ? 36  THR A O    10 
ATOM   10972 C  CB   . THR A 1 36 ? -6.429  -0.381  3.655   1.00 0.00 ? 36  THR A CB   10 
ATOM   10973 O  OG1  . THR A 1 36 ? -7.367  0.212   2.751   1.00 0.00 ? 36  THR A OG1  10 
ATOM   10974 C  CG2  . THR A 1 36 ? -7.023  -0.422  5.055   1.00 0.00 ? 36  THR A CG2  10 
ATOM   10975 H  H    . THR A 1 36 ? -5.854  2.365   3.296   1.00 0.00 ? 36  THR A H    10 
ATOM   10976 H  HA   . THR A 1 36 ? -4.466  0.017   4.414   1.00 0.00 ? 36  THR A HA   10 
ATOM   10977 H  HB   . THR A 1 36 ? -6.224  -1.393  3.337   1.00 0.00 ? 36  THR A HB   10 
ATOM   10978 H  HG1  . THR A 1 36 ? -7.499  1.134   2.985   1.00 0.00 ? 36  THR A HG1  10 
ATOM   10979 H  HG21 . THR A 1 36 ? -7.917  -1.027  5.049   1.00 0.00 ? 36  THR A HG21 10 
ATOM   10980 H  HG22 . THR A 1 36 ? -7.268  0.581   5.371   1.00 0.00 ? 36  THR A HG22 10 
ATOM   10981 H  HG23 . THR A 1 36 ? -6.304  -0.849  5.738   1.00 0.00 ? 36  THR A HG23 10 
ATOM   10982 N  N    . TYR A 1 37 ? -3.398  -0.603  2.260   1.00 0.00 ? 37  TYR A N    10 
ATOM   10983 C  CA   . TYR A 1 37 ? -2.662  -0.865  1.029   1.00 0.00 ? 37  TYR A CA   10 
ATOM   10984 C  C    . TYR A 1 37 ? -2.287  -2.340  0.921   1.00 0.00 ? 37  TYR A C    10 
ATOM   10985 O  O    . TYR A 1 37 ? -2.439  -3.103  1.876   1.00 0.00 ? 37  TYR A O    10 
ATOM   10986 C  CB   . TYR A 1 37 ? -1.401  -0.001  0.970   1.00 0.00 ? 37  TYR A CB   10 
ATOM   10987 C  CG   . TYR A 1 37 ? -1.685  1.484   0.963   1.00 0.00 ? 37  TYR A CG   10 
ATOM   10988 C  CD1  . TYR A 1 37 ? -2.158  2.116   -0.181  1.00 0.00 ? 37  TYR A CD1  10 
ATOM   10989 C  CD2  . TYR A 1 37 ? -1.479  2.256   2.100   1.00 0.00 ? 37  TYR A CD2  10 
ATOM   10990 C  CE1  . TYR A 1 37 ? -2.418  3.472   -0.192  1.00 0.00 ? 37  TYR A CE1  10 
ATOM   10991 C  CE2  . TYR A 1 37 ? -1.737  3.613   2.098   1.00 0.00 ? 37  TYR A CE2  10 
ATOM   10992 C  CZ   . TYR A 1 37 ? -2.207  4.217   0.950   1.00 0.00 ? 37  TYR A CZ   10 
ATOM   10993 O  OH   . TYR A 1 37 ? -2.464  5.568   0.944   1.00 0.00 ? 37  TYR A OH   10 
ATOM   10994 H  H    . TYR A 1 37 ? -3.122  -1.053  3.086   1.00 0.00 ? 37  TYR A H    10 
ATOM   10995 H  HA   . TYR A 1 37 ? -3.303  -0.607  0.198   1.00 0.00 ? 37  TYR A HA   10 
ATOM   10996 H  HB2  . TYR A 1 37 ? -0.785  -0.216  1.829   1.00 0.00 ? 37  TYR A HB2  10 
ATOM   10997 H  HB3  . TYR A 1 37 ? -0.852  -0.238  0.070   1.00 0.00 ? 37  TYR A HB3  10 
ATOM   10998 H  HD1  . TYR A 1 37 ? -2.323  1.530   -1.073  1.00 0.00 ? 37  TYR A HD1  10 
ATOM   10999 H  HD2  . TYR A 1 37 ? -1.110  1.780   2.997   1.00 0.00 ? 37  TYR A HD2  10 
ATOM   11000 H  HE1  . TYR A 1 37 ? -2.786  3.946   -1.090  1.00 0.00 ? 37  TYR A HE1  10 
ATOM   11001 H  HE2  . TYR A 1 37 ? -1.571  4.196   2.992   1.00 0.00 ? 37  TYR A HE2  10 
ATOM   11002 H  HH   . TYR A 1 37 ? -3.408  5.715   1.037   1.00 0.00 ? 37  TYR A HH   10 
ATOM   11003 N  N    . HIS A 1 38 ? -1.795  -2.735  -0.249  1.00 0.00 ? 38  HIS A N    10 
ATOM   11004 C  CA   . HIS A 1 38 ? -1.396  -4.118  -0.482  1.00 0.00 ? 38  HIS A CA   10 
ATOM   11005 C  C    . HIS A 1 38 ? 0.018   -4.370  0.032   1.00 0.00 ? 38  HIS A C    10 
ATOM   11006 O  O    . HIS A 1 38 ? 0.798   -3.444  0.252   1.00 0.00 ? 38  HIS A O    10 
ATOM   11007 C  CB   . HIS A 1 38 ? -1.476  -4.449  -1.973  1.00 0.00 ? 38  HIS A CB   10 
ATOM   11008 C  CG   . HIS A 1 38 ? -2.809  -4.985  -2.397  1.00 0.00 ? 38  HIS A CG   10 
ATOM   11009 N  ND1  . HIS A 1 38 ? -3.518  -4.479  -3.466  1.00 0.00 ? 38  HIS A ND1  10 
ATOM   11010 C  CD2  . HIS A 1 38 ? -3.562  -5.989  -1.890  1.00 0.00 ? 38  HIS A CD2  10 
ATOM   11011 C  CE1  . HIS A 1 38 ? -4.650  -5.148  -3.598  1.00 0.00 ? 38  HIS A CE1  10 
ATOM   11012 N  NE2  . HIS A 1 38 ? -4.700  -6.070  -2.653  1.00 0.00 ? 38  HIS A NE2  10 
ATOM   11013 H  H    . HIS A 1 38 ? -1.698  -2.081  -0.972  1.00 0.00 ? 38  HIS A H    10 
ATOM   11014 H  HA   . HIS A 1 38 ? -2.081  -4.756  0.056   1.00 0.00 ? 38  HIS A HA   10 
ATOM   11015 H  HB2  . HIS A 1 38 ? -1.282  -3.554  -2.545  1.00 0.00 ? 38  HIS A HB2  10 
ATOM   11016 H  HB3  . HIS A 1 38 ? -0.728  -5.192  -2.211  1.00 0.00 ? 38  HIS A HB3  10 
ATOM   11017 H  HD2  . HIS A 1 38 ? -3.314  -6.612  -1.042  1.00 0.00 ? 38  HIS A HD2  10 
ATOM   11018 H  HE1  . HIS A 1 38 ? -5.405  -4.972  -4.349  1.00 0.00 ? 38  HIS A HE1  10 
ATOM   11019 H  HE2  . HIS A 1 38 ? -5.470  -6.648  -2.470  1.00 0.00 ? 38  HIS A HE2  10 
ATOM   11020 N  N    . PRO A 1 39 ? 0.357   -5.653  0.228   1.00 0.00 ? 39  PRO A N    10 
ATOM   11021 C  CA   . PRO A 1 39 ? 1.678   -6.056  0.719   1.00 0.00 ? 39  PRO A CA   10 
ATOM   11022 C  C    . PRO A 1 39 ? 2.776   -5.822  -0.313  1.00 0.00 ? 39  PRO A C    10 
ATOM   11023 O  O    . PRO A 1 39 ? 3.956   -6.037  -0.037  1.00 0.00 ? 39  PRO A O    10 
ATOM   11024 C  CB   . PRO A 1 39 ? 1.513   -7.553  0.994   1.00 0.00 ? 39  PRO A CB   10 
ATOM   11025 C  CG   . PRO A 1 39 ? 0.408   -7.984  0.092   1.00 0.00 ? 39  PRO A CG   10 
ATOM   11026 C  CD   . PRO A 1 39 ? -0.523  -6.808  -0.014  1.00 0.00 ? 39  PRO A CD   10 
ATOM   11027 H  HA   . PRO A 1 39 ? 1.933   -5.546  1.636   1.00 0.00 ? 39  PRO A HA   10 
ATOM   11028 H  HB2  . PRO A 1 39 ? 2.435   -8.068  0.765   1.00 0.00 ? 39  PRO A HB2  10 
ATOM   11029 H  HB3  . PRO A 1 39 ? 1.257   -7.706  2.032   1.00 0.00 ? 39  PRO A HB3  10 
ATOM   11030 H  HG2  . PRO A 1 39 ? 0.805   -8.236  -0.880  1.00 0.00 ? 39  PRO A HG2  10 
ATOM   11031 H  HG3  . PRO A 1 39 ? -0.105  -8.832  0.520   1.00 0.00 ? 39  PRO A HG3  10 
ATOM   11032 H  HD2  . PRO A 1 39 ? -0.960  -6.761  -1.000  1.00 0.00 ? 39  PRO A HD2  10 
ATOM   11033 H  HD3  . PRO A 1 39 ? -1.294  -6.869  0.740   1.00 0.00 ? 39  PRO A HD3  10 
ATOM   11034 N  N    . ASP A 1 40 ? 2.380   -5.381  -1.502  1.00 0.00 ? 40  ASP A N    10 
ATOM   11035 C  CA   . ASP A 1 40 ? 3.331   -5.116  -2.575  1.00 0.00 ? 40  ASP A CA   10 
ATOM   11036 C  C    . ASP A 1 40 ? 3.182   -3.689  -3.093  1.00 0.00 ? 40  ASP A C    10 
ATOM   11037 O  O    . ASP A 1 40 ? 4.083   -3.155  -3.742  1.00 0.00 ? 40  ASP A O    10 
ATOM   11038 C  CB   . ASP A 1 40 ? 3.131   -6.111  -3.720  1.00 0.00 ? 40  ASP A CB   10 
ATOM   11039 C  CG   . ASP A 1 40 ? 1.679   -6.220  -4.144  1.00 0.00 ? 40  ASP A CG   10 
ATOM   11040 O  OD1  . ASP A 1 40 ? 1.224   -5.363  -4.930  1.00 0.00 ? 40  ASP A OD1  10 
ATOM   11041 O  OD2  . ASP A 1 40 ? 0.999   -7.164  -3.691  1.00 0.00 ? 40  ASP A OD2  10 
ATOM   11042 H  H    . ASP A 1 40 ? 1.424   -5.228  -1.661  1.00 0.00 ? 40  ASP A H    10 
ATOM   11043 H  HA   . ASP A 1 40 ? 4.326   -5.238  -2.174  1.00 0.00 ? 40  ASP A HA   10 
ATOM   11044 H  HB2  . ASP A 1 40 ? 3.712   -5.791  -4.572  1.00 0.00 ? 40  ASP A HB2  10 
ATOM   11045 H  HB3  . ASP A 1 40 ? 3.469   -7.086  -3.403  1.00 0.00 ? 40  ASP A HB3  10 
ATOM   11046 N  N    . CYS A 1 41 ? 2.039   -3.076  -2.804  1.00 0.00 ? 41  CYS A N    10 
ATOM   11047 C  CA   . CYS A 1 41 ? 1.770   -1.711  -3.241  1.00 0.00 ? 41  CYS A CA   10 
ATOM   11048 C  C    . CYS A 1 41 ? 2.428   -0.701  -2.305  1.00 0.00 ? 41  CYS A C    10 
ATOM   11049 O  O    . CYS A 1 41 ? 2.766   0.411   -2.713  1.00 0.00 ? 41  CYS A O    10 
ATOM   11050 C  CB   . CYS A 1 41 ? 0.262   -1.460  -3.302  1.00 0.00 ? 41  CYS A CB   10 
ATOM   11051 S  SG   . CYS A 1 41 ? -0.572  -2.280  -4.698  1.00 0.00 ? 41  CYS A SG   10 
ATOM   11052 H  H    . CYS A 1 41 ? 1.359   -3.553  -2.283  1.00 0.00 ? 41  CYS A H    10 
ATOM   11053 H  HA   . CYS A 1 41 ? 2.187   -1.591  -4.229  1.00 0.00 ? 41  CYS A HA   10 
ATOM   11054 H  HB2  . CYS A 1 41 ? -0.192  -1.822  -2.391  1.00 0.00 ? 41  CYS A HB2  10 
ATOM   11055 H  HB3  . CYS A 1 41 ? 0.085   -0.399  -3.389  1.00 0.00 ? 41  CYS A HB3  10 
ATOM   11056 N  N    . PHE A 1 42 ? 2.606   -1.095  -1.049  1.00 0.00 ? 42  PHE A N    10 
ATOM   11057 C  CA   . PHE A 1 42 ? 3.222   -0.224  -0.054  1.00 0.00 ? 42  PHE A CA   10 
ATOM   11058 C  C    . PHE A 1 42 ? 4.744   -0.272  -0.158  1.00 0.00 ? 42  PHE A C    10 
ATOM   11059 O  O    . PHE A 1 42 ? 5.447   -0.273  0.853   1.00 0.00 ? 42  PHE A O    10 
ATOM   11060 C  CB   . PHE A 1 42 ? 2.782   -0.631  1.353   1.00 0.00 ? 42  PHE A CB   10 
ATOM   11061 C  CG   . PHE A 1 42 ? 3.201   0.343   2.417   1.00 0.00 ? 42  PHE A CG   10 
ATOM   11062 C  CD1  . PHE A 1 42 ? 2.733   1.647   2.404   1.00 0.00 ? 42  PHE A CD1  10 
ATOM   11063 C  CD2  . PHE A 1 42 ? 4.063   -0.046  3.431   1.00 0.00 ? 42  PHE A CD2  10 
ATOM   11064 C  CE1  . PHE A 1 42 ? 3.118   2.545   3.382   1.00 0.00 ? 42  PHE A CE1  10 
ATOM   11065 C  CE2  . PHE A 1 42 ? 4.451   0.848   4.411   1.00 0.00 ? 42  PHE A CE2  10 
ATOM   11066 C  CZ   . PHE A 1 42 ? 3.976   2.145   4.387   1.00 0.00 ? 42  PHE A CZ   10 
ATOM   11067 H  H    . PHE A 1 42 ? 2.316   -1.993  -0.784  1.00 0.00 ? 42  PHE A H    10 
ATOM   11068 H  HA   . PHE A 1 42 ? 2.892   0.784   -0.248  1.00 0.00 ? 42  PHE A HA   10 
ATOM   11069 H  HB2  . PHE A 1 42 ? 1.706   -0.707  1.379   1.00 0.00 ? 42  PHE A HB2  10 
ATOM   11070 H  HB3  . PHE A 1 42 ? 3.212   -1.592  1.593   1.00 0.00 ? 42  PHE A HB3  10 
ATOM   11071 H  HD1  . PHE A 1 42 ? 2.061   1.961   1.620   1.00 0.00 ? 42  PHE A HD1  10 
ATOM   11072 H  HD2  . PHE A 1 42 ? 4.434   -1.061  3.450   1.00 0.00 ? 42  PHE A HD2  10 
ATOM   11073 H  HE1  . PHE A 1 42 ? 2.746   3.558   3.361   1.00 0.00 ? 42  PHE A HE1  10 
ATOM   11074 H  HE2  . PHE A 1 42 ? 5.122   0.531   5.195   1.00 0.00 ? 42  PHE A HE2  10 
ATOM   11075 H  HZ   . PHE A 1 42 ? 4.279   2.845   5.152   1.00 0.00 ? 42  PHE A HZ   10 
ATOM   11076 N  N    . VAL A 1 43 ? 5.247   -0.313  -1.388  1.00 0.00 ? 43  VAL A N    10 
ATOM   11077 C  CA   . VAL A 1 43 ? 6.685   -0.361  -1.625  1.00 0.00 ? 43  VAL A CA   10 
ATOM   11078 C  C    . VAL A 1 43 ? 7.169   0.905   -2.322  1.00 0.00 ? 43  VAL A C    10 
ATOM   11079 O  O    . VAL A 1 43 ? 6.368   1.725   -2.771  1.00 0.00 ? 43  VAL A O    10 
ATOM   11080 C  CB   . VAL A 1 43 ? 7.073   -1.584  -2.477  1.00 0.00 ? 43  VAL A CB   10 
ATOM   11081 C  CG1  . VAL A 1 43 ? 6.635   -2.871  -1.795  1.00 0.00 ? 43  VAL A CG1  10 
ATOM   11082 C  CG2  . VAL A 1 43 ? 6.468   -1.476  -3.869  1.00 0.00 ? 43  VAL A CG2  10 
ATOM   11083 H  H    . VAL A 1 43 ? 4.636   -0.310  -2.154  1.00 0.00 ? 43  VAL A H    10 
ATOM   11084 H  HA   . VAL A 1 43 ? 7.178   -0.445  -0.667  1.00 0.00 ? 43  VAL A HA   10 
ATOM   11085 H  HB   . VAL A 1 43 ? 8.148   -1.602  -2.575  1.00 0.00 ? 43  VAL A HB   10 
ATOM   11086 H  HG11 . VAL A 1 43 ? 7.500   -3.487  -1.600  1.00 0.00 ? 43  VAL A HG11 10 
ATOM   11087 H  HG12 . VAL A 1 43 ? 6.142   -2.636  -0.863  1.00 0.00 ? 43  VAL A HG12 10 
ATOM   11088 H  HG13 . VAL A 1 43 ? 5.952   -3.405  -2.439  1.00 0.00 ? 43  VAL A HG13 10 
ATOM   11089 H  HG21 . VAL A 1 43 ? 5.487   -1.029  -3.801  1.00 0.00 ? 43  VAL A HG21 10 
ATOM   11090 H  HG22 . VAL A 1 43 ? 7.102   -0.860  -4.490  1.00 0.00 ? 43  VAL A HG22 10 
ATOM   11091 H  HG23 . VAL A 1 43 ? 6.386   -2.461  -4.304  1.00 0.00 ? 43  VAL A HG23 10 
ATOM   11092 N  N    . CYS A 1 44 ? 8.486   1.059   -2.409  1.00 0.00 ? 44  CYS A N    10 
ATOM   11093 C  CA   . CYS A 1 44 ? 9.079   2.225   -3.052  1.00 0.00 ? 44  CYS A CA   10 
ATOM   11094 C  C    . CYS A 1 44 ? 8.335   2.576   -4.337  1.00 0.00 ? 44  CYS A C    10 
ATOM   11095 O  O    . CYS A 1 44 ? 7.552   1.777   -4.851  1.00 0.00 ? 44  CYS A O    10 
ATOM   11096 C  CB   . CYS A 1 44 ? 10.556  1.969   -3.359  1.00 0.00 ? 44  CYS A CB   10 
ATOM   11097 S  SG   . CYS A 1 44 ? 11.463  3.441   -3.931  1.00 0.00 ? 44  CYS A SG   10 
ATOM   11098 H  H    . CYS A 1 44 ? 9.074   0.370   -2.032  1.00 0.00 ? 44  CYS A H    10 
ATOM   11099 H  HA   . CYS A 1 44 ? 9.002   3.056   -2.368  1.00 0.00 ? 44  CYS A HA   10 
ATOM   11100 H  HB2  . CYS A 1 44 ? 11.045  1.610   -2.464  1.00 0.00 ? 44  CYS A HB2  10 
ATOM   11101 H  HB3  . CYS A 1 44 ? 10.630  1.216   -4.129  1.00 0.00 ? 44  CYS A HB3  10 
ATOM   11102 N  N    . ALA A 1 45 ? 8.585   3.775   -4.851  1.00 0.00 ? 45  ALA A N    10 
ATOM   11103 C  CA   . ALA A 1 45 ? 7.941   4.231   -6.077  1.00 0.00 ? 45  ALA A CA   10 
ATOM   11104 C  C    . ALA A 1 45 ? 8.878   4.095   -7.272  1.00 0.00 ? 45  ALA A C    10 
ATOM   11105 O  O    . ALA A 1 45 ? 8.432   3.994   -8.415  1.00 0.00 ? 45  ALA A O    10 
ATOM   11106 C  CB   . ALA A 1 45 ? 7.480   5.673   -5.926  1.00 0.00 ? 45  ALA A CB   10 
ATOM   11107 H  H    . ALA A 1 45 ? 9.219   4.368   -4.395  1.00 0.00 ? 45  ALA A H    10 
ATOM   11108 H  HA   . ALA A 1 45 ? 7.069   3.616   -6.244  1.00 0.00 ? 45  ALA A HA   10 
ATOM   11109 H  HB1  . ALA A 1 45 ? 6.751   5.899   -6.691  1.00 0.00 ? 45  ALA A HB1  10 
ATOM   11110 H  HB2  . ALA A 1 45 ? 7.034   5.808   -4.952  1.00 0.00 ? 45  ALA A HB2  10 
ATOM   11111 H  HB3  . ALA A 1 45 ? 8.328   6.334   -6.030  1.00 0.00 ? 45  ALA A HB3  10 
ATOM   11112 N  N    . VAL A 1 46 ? 10.180  4.094   -7.001  1.00 0.00 ? 46  VAL A N    10 
ATOM   11113 C  CA   . VAL A 1 46 ? 11.180  3.970   -8.055  1.00 0.00 ? 46  VAL A CA   10 
ATOM   11114 C  C    . VAL A 1 46 ? 11.547  2.510   -8.295  1.00 0.00 ? 46  VAL A C    10 
ATOM   11115 O  O    . VAL A 1 46 ? 11.295  1.964   -9.370  1.00 0.00 ? 46  VAL A O    10 
ATOM   11116 C  CB   . VAL A 1 46 ? 12.457  4.760   -7.711  1.00 0.00 ? 46  VAL A CB   10 
ATOM   11117 C  CG1  . VAL A 1 46 ? 13.391  4.814   -8.911  1.00 0.00 ? 46  VAL A CG1  10 
ATOM   11118 C  CG2  . VAL A 1 46 ? 12.105  6.161   -7.236  1.00 0.00 ? 46  VAL A CG2  10 
ATOM   11119 H  H    . VAL A 1 46 ? 10.474  4.178   -6.070  1.00 0.00 ? 46  VAL A H    10 
ATOM   11120 H  HA   . VAL A 1 46 ? 10.762  4.381   -8.962  1.00 0.00 ? 46  VAL A HA   10 
ATOM   11121 H  HB   . VAL A 1 46 ? 12.968  4.248   -6.909  1.00 0.00 ? 46  VAL A HB   10 
ATOM   11122 H  HG11 . VAL A 1 46 ? 13.223  5.731   -9.456  1.00 0.00 ? 46  VAL A HG11 10 
ATOM   11123 H  HG12 . VAL A 1 46 ? 14.416  4.777   -8.572  1.00 0.00 ? 46  VAL A HG12 10 
ATOM   11124 H  HG13 . VAL A 1 46 ? 13.194  3.971   -9.558  1.00 0.00 ? 46  VAL A HG13 10 
ATOM   11125 H  HG21 . VAL A 1 46 ? 11.387  6.098   -6.432  1.00 0.00 ? 46  VAL A HG21 10 
ATOM   11126 H  HG22 . VAL A 1 46 ? 12.998  6.657   -6.883  1.00 0.00 ? 46  VAL A HG22 10 
ATOM   11127 H  HG23 . VAL A 1 46 ? 11.682  6.724   -8.055  1.00 0.00 ? 46  VAL A HG23 10 
ATOM   11128 N  N    . CYS A 1 47 ? 12.145  1.883   -7.288  1.00 0.00 ? 47  CYS A N    10 
ATOM   11129 C  CA   . CYS A 1 47 ? 12.547  0.485   -7.388  1.00 0.00 ? 47  CYS A CA   10 
ATOM   11130 C  C    . CYS A 1 47 ? 11.451  -0.436  -6.860  1.00 0.00 ? 47  CYS A C    10 
ATOM   11131 O  O    . CYS A 1 47 ? 11.470  -1.643  -7.104  1.00 0.00 ? 47  CYS A O    10 
ATOM   11132 C  CB   . CYS A 1 47 ? 13.845  0.249   -6.612  1.00 0.00 ? 47  CYS A CB   10 
ATOM   11133 S  SG   . CYS A 1 47 ? 13.690  0.494   -4.814  1.00 0.00 ? 47  CYS A SG   10 
ATOM   11134 H  H    . CYS A 1 47 ? 12.319  2.372   -6.456  1.00 0.00 ? 47  CYS A H    10 
ATOM   11135 H  HA   . CYS A 1 47 ? 12.716  0.262   -8.431  1.00 0.00 ? 47  CYS A HA   10 
ATOM   11136 H  HB2  . CYS A 1 47 ? 14.174  -0.766  -6.778  1.00 0.00 ? 47  CYS A HB2  10 
ATOM   11137 H  HB3  . CYS A 1 47 ? 14.600  0.931   -6.974  1.00 0.00 ? 47  CYS A HB3  10 
ATOM   11138 N  N    . ARG A 1 48 ? 10.498  0.142   -6.136  1.00 0.00 ? 48  ARG A N    10 
ATOM   11139 C  CA   . ARG A 1 48 ? 9.395   -0.627  -5.573  1.00 0.00 ? 48  ARG A CA   10 
ATOM   11140 C  C    . ARG A 1 48 ? 9.915   -1.803  -4.751  1.00 0.00 ? 48  ARG A C    10 
ATOM   11141 O  O    . ARG A 1 48 ? 9.430   -2.928  -4.882  1.00 0.00 ? 48  ARG A O    10 
ATOM   11142 C  CB   . ARG A 1 48 ? 8.478   -1.135  -6.687  1.00 0.00 ? 48  ARG A CB   10 
ATOM   11143 C  CG   . ARG A 1 48 ? 7.918   -0.029  -7.567  1.00 0.00 ? 48  ARG A CG   10 
ATOM   11144 C  CD   . ARG A 1 48 ? 8.852   0.290   -8.724  1.00 0.00 ? 48  ARG A CD   10 
ATOM   11145 N  NE   . ARG A 1 48 ? 8.172   1.017   -9.792  1.00 0.00 ? 48  ARG A NE   10 
ATOM   11146 C  CZ   . ARG A 1 48 ? 8.615   1.070   -11.043 1.00 0.00 ? 48  ARG A CZ   10 
ATOM   11147 N  NH1  . ARG A 1 48 ? 9.732   0.440   -11.381 1.00 0.00 ? 48  ARG A NH1  10 
ATOM   11148 N  NH2  . ARG A 1 48 ? 7.940   1.752   -11.959 1.00 0.00 ? 48  ARG A NH2  10 
ATOM   11149 H  H    . ARG A 1 48 ? 10.538  1.108   -5.977  1.00 0.00 ? 48  ARG A H    10 
ATOM   11150 H  HA   . ARG A 1 48 ? 8.831   0.028   -4.926  1.00 0.00 ? 48  ARG A HA   10 
ATOM   11151 H  HB2  . ARG A 1 48 ? 9.035   -1.816  -7.314  1.00 0.00 ? 48  ARG A HB2  10 
ATOM   11152 H  HB3  . ARG A 1 48 ? 7.650   -1.665  -6.241  1.00 0.00 ? 48  ARG A HB3  10 
ATOM   11153 H  HG2  . ARG A 1 48 ? 6.965   -0.346  -7.965  1.00 0.00 ? 48  ARG A HG2  10 
ATOM   11154 H  HG3  . ARG A 1 48 ? 7.782   0.860   -6.969  1.00 0.00 ? 48  ARG A HG3  10 
ATOM   11155 H  HD2  . ARG A 1 48 ? 9.668   0.892   -8.354  1.00 0.00 ? 48  ARG A HD2  10 
ATOM   11156 H  HD3  . ARG A 1 48 ? 9.239   -0.636  -9.121  1.00 0.00 ? 48  ARG A HD3  10 
ATOM   11157 H  HE   . ARG A 1 48 ? 7.344   1.489   -9.564  1.00 0.00 ? 48  ARG A HE   10 
ATOM   11158 H  HH11 . ARG A 1 48 ? 10.242  -0.076  -10.693 1.00 0.00 ? 48  ARG A HH11 10 
ATOM   11159 H  HH12 . ARG A 1 48 ? 10.063  0.480   -12.324 1.00 0.00 ? 48  ARG A HH12 10 
ATOM   11160 H  HH21 . ARG A 1 48 ? 7.098   2.228   -11.708 1.00 0.00 ? 48  ARG A HH21 10 
ATOM   11161 H  HH22 . ARG A 1 48 ? 8.274   1.792   -12.900 1.00 0.00 ? 48  ARG A HH22 10 
ATOM   11162 N  N    . LEU A 1 49 ? 10.904  -1.535  -3.906  1.00 0.00 ? 49  LEU A N    10 
ATOM   11163 C  CA   . LEU A 1 49 ? 11.491  -2.571  -3.063  1.00 0.00 ? 49  LEU A CA   10 
ATOM   11164 C  C    . LEU A 1 49 ? 10.829  -2.595  -1.689  1.00 0.00 ? 49  LEU A C    10 
ATOM   11165 O  O    . LEU A 1 49 ? 10.621  -1.560  -1.055  1.00 0.00 ? 49  LEU A O    10 
ATOM   11166 C  CB   . LEU A 1 49 ? 12.996  -2.342  -2.913  1.00 0.00 ? 49  LEU A CB   10 
ATOM   11167 C  CG   . LEU A 1 49 ? 13.886  -3.029  -3.949  1.00 0.00 ? 49  LEU A CG   10 
ATOM   11168 C  CD1  . LEU A 1 49 ? 14.429  -4.340  -3.402  1.00 0.00 ? 49  LEU A CD1  10 
ATOM   11169 C  CD2  . LEU A 1 49 ? 13.116  -3.266  -5.240  1.00 0.00 ? 49  LEU A CD2  10 
ATOM   11170 H  H    . LEU A 1 49 ? 11.248  -0.620  -3.846  1.00 0.00 ? 49  LEU A H    10 
ATOM   11171 H  HA   . LEU A 1 49 ? 11.326  -3.523  -3.545  1.00 0.00 ? 49  LEU A HA   10 
ATOM   11172 H  HB2  . LEU A 1 49 ? 13.176  -1.280  -2.974  1.00 0.00 ? 49  LEU A HB2  10 
ATOM   11173 H  HB3  . LEU A 1 49 ? 13.288  -2.699  -1.935  1.00 0.00 ? 49  LEU A HB3  10 
ATOM   11174 H  HG   . LEU A 1 49 ? 14.727  -2.388  -4.173  1.00 0.00 ? 49  LEU A HG   10 
ATOM   11175 H  HD11 . LEU A 1 49 ? 15.013  -4.145  -2.516  1.00 0.00 ? 49  LEU A HD11 10 
ATOM   11176 H  HD12 . LEU A 1 49 ? 15.051  -4.811  -4.148  1.00 0.00 ? 49  LEU A HD12 10 
ATOM   11177 H  HD13 . LEU A 1 49 ? 13.606  -4.995  -3.155  1.00 0.00 ? 49  LEU A HD13 10 
ATOM   11178 H  HD21 . LEU A 1 49 ? 12.301  -2.560  -5.307  1.00 0.00 ? 49  LEU A HD21 10 
ATOM   11179 H  HD22 . LEU A 1 49 ? 12.722  -4.272  -5.245  1.00 0.00 ? 49  LEU A HD22 10 
ATOM   11180 H  HD23 . LEU A 1 49 ? 13.778  -3.134  -6.083  1.00 0.00 ? 49  LEU A HD23 10 
ATOM   11181 N  N    . PRO A 1 50 ? 10.492  -3.803  -1.215  1.00 0.00 ? 50  PRO A N    10 
ATOM   11182 C  CA   . PRO A 1 50 ? 9.851   -3.991  0.090   1.00 0.00 ? 50  PRO A CA   10 
ATOM   11183 C  C    . PRO A 1 50 ? 10.797  -3.693  1.249   1.00 0.00 ? 50  PRO A C    10 
ATOM   11184 O  O    . PRO A 1 50 ? 11.804  -4.377  1.433   1.00 0.00 ? 50  PRO A O    10 
ATOM   11185 C  CB   . PRO A 1 50 ? 9.463   -5.472  0.085   1.00 0.00 ? 50  PRO A CB   10 
ATOM   11186 C  CG   . PRO A 1 50 ? 10.420  -6.111  -0.861  1.00 0.00 ? 50  PRO A CG   10 
ATOM   11187 C  CD   . PRO A 1 50 ? 10.710  -5.079  -1.916  1.00 0.00 ? 50  PRO A CD   10 
ATOM   11188 H  HA   . PRO A 1 50 ? 8.963   -3.385  0.187   1.00 0.00 ? 50  PRO A HA   10 
ATOM   11189 H  HB2  . PRO A 1 50 ? 9.563   -5.876  1.082   1.00 0.00 ? 50  PRO A HB2  10 
ATOM   11190 H  HB3  . PRO A 1 50 ? 8.443   -5.579  -0.253  1.00 0.00 ? 50  PRO A HB3  10 
ATOM   11191 H  HG2  . PRO A 1 50 ? 11.326  -6.381  -0.341  1.00 0.00 ? 50  PRO A HG2  10 
ATOM   11192 H  HG3  . PRO A 1 50 ? 9.967   -6.984  -1.307  1.00 0.00 ? 50  PRO A HG3  10 
ATOM   11193 H  HD2  . PRO A 1 50 ? 11.732  -5.163  -2.255  1.00 0.00 ? 50  PRO A HD2  10 
ATOM   11194 H  HD3  . PRO A 1 50 ? 10.026  -5.185  -2.746  1.00 0.00 ? 50  PRO A HD3  10 
ATOM   11195 N  N    . PHE A 1 51 ? 10.467  -2.667  2.027   1.00 0.00 ? 51  PHE A N    10 
ATOM   11196 C  CA   . PHE A 1 51 ? 11.288  -2.278  3.167   1.00 0.00 ? 51  PHE A CA   10 
ATOM   11197 C  C    . PHE A 1 51 ? 11.002  -3.170  4.372   1.00 0.00 ? 51  PHE A C    10 
ATOM   11198 O  O    . PHE A 1 51 ? 9.881   -3.633  4.582   1.00 0.00 ? 51  PHE A O    10 
ATOM   11199 C  CB   . PHE A 1 51 ? 11.032  -0.814  3.531   1.00 0.00 ? 51  PHE A CB   10 
ATOM   11200 C  CG   . PHE A 1 51 ? 10.595  0.026   2.364   1.00 0.00 ? 51  PHE A CG   10 
ATOM   11201 C  CD1  . PHE A 1 51 ? 11.440  0.229   1.285   1.00 0.00 ? 51  PHE A CD1  10 
ATOM   11202 C  CD2  . PHE A 1 51 ? 9.339   0.611   2.347   1.00 0.00 ? 51  PHE A CD2  10 
ATOM   11203 C  CE1  . PHE A 1 51 ? 11.040  1.001   0.211   1.00 0.00 ? 51  PHE A CE1  10 
ATOM   11204 C  CE2  . PHE A 1 51 ? 8.934   1.384   1.275   1.00 0.00 ? 51  PHE A CE2  10 
ATOM   11205 C  CZ   . PHE A 1 51 ? 9.786   1.579   0.205   1.00 0.00 ? 51  PHE A CZ   10 
ATOM   11206 H  H    . PHE A 1 51 ? 9.652   -2.160  1.829   1.00 0.00 ? 51  PHE A H    10 
ATOM   11207 H  HA   . PHE A 1 51 ? 12.322  -2.395  2.885   1.00 0.00 ? 51  PHE A HA   10 
ATOM   11208 H  HB2  . PHE A 1 51 ? 10.258  -0.766  4.281   1.00 0.00 ? 51  PHE A HB2  10 
ATOM   11209 H  HB3  . PHE A 1 51 ? 11.940  -0.385  3.928   1.00 0.00 ? 51  PHE A HB3  10 
ATOM   11210 H  HD1  . PHE A 1 51 ? 12.421  -0.223  1.287   1.00 0.00 ? 51  PHE A HD1  10 
ATOM   11211 H  HD2  . PHE A 1 51 ? 8.672   0.459   3.184   1.00 0.00 ? 51  PHE A HD2  10 
ATOM   11212 H  HE1  . PHE A 1 51 ? 11.708  1.152   -0.625  1.00 0.00 ? 51  PHE A HE1  10 
ATOM   11213 H  HE2  . PHE A 1 51 ? 7.953   1.834   1.274   1.00 0.00 ? 51  PHE A HE2  10 
ATOM   11214 H  HZ   . PHE A 1 51 ? 9.472   2.183   -0.633  1.00 0.00 ? 51  PHE A HZ   10 
ATOM   11215 N  N    . PRO A 1 52 ? 12.041  -3.417  5.184   1.00 0.00 ? 52  PRO A N    10 
ATOM   11216 C  CA   . PRO A 1 52 ? 11.928  -4.255  6.381   1.00 0.00 ? 52  PRO A CA   10 
ATOM   11217 C  C    . PRO A 1 52 ? 11.104  -3.590  7.478   1.00 0.00 ? 52  PRO A C    10 
ATOM   11218 O  O    . PRO A 1 52 ? 10.752  -2.413  7.397   1.00 0.00 ? 52  PRO A O    10 
ATOM   11219 C  CB   . PRO A 1 52 ? 13.381  -4.426  6.833   1.00 0.00 ? 52  PRO A CB   10 
ATOM   11220 C  CG   . PRO A 1 52 ? 14.089  -3.232  6.292   1.00 0.00 ? 52  PRO A CG   10 
ATOM   11221 C  CD   . PRO A 1 52 ? 13.406  -2.899  4.995   1.00 0.00 ? 52  PRO A CD   10 
ATOM   11222 H  HA   . PRO A 1 52 ? 11.505  -5.222  6.151   1.00 0.00 ? 52  PRO A HA   10 
ATOM   11223 H  HB2  . PRO A 1 52 ? 13.423  -4.457  7.913   1.00 0.00 ? 52  PRO A HB2  10 
ATOM   11224 H  HB3  . PRO A 1 52 ? 13.783  -5.342  6.425   1.00 0.00 ? 52  PRO A HB3  10 
ATOM   11225 H  HG2  . PRO A 1 52 ? 14.001  -2.409  6.984   1.00 0.00 ? 52  PRO A HG2  10 
ATOM   11226 H  HG3  . PRO A 1 52 ? 15.128  -3.470  6.118   1.00 0.00 ? 52  PRO A HG3  10 
ATOM   11227 H  HD2  . PRO A 1 52 ? 13.394  -1.830  4.838   1.00 0.00 ? 52  PRO A HD2  10 
ATOM   11228 H  HD3  . PRO A 1 52 ? 13.897  -3.397  4.171   1.00 0.00 ? 52  PRO A HD3  10 
ATOM   11229 N  N    . PRO A 1 53 ? 10.788  -4.359  8.531   1.00 0.00 ? 53  PRO A N    10 
ATOM   11230 C  CA   . PRO A 1 53 ? 10.002  -3.864  9.665   1.00 0.00 ? 53  PRO A CA   10 
ATOM   11231 C  C    . PRO A 1 53 ? 10.775  -2.855  10.509  1.00 0.00 ? 53  PRO A C    10 
ATOM   11232 O  O    . PRO A 1 53 ? 10.296  -2.407  11.551  1.00 0.00 ? 53  PRO A O    10 
ATOM   11233 C  CB   . PRO A 1 53 ? 9.713   -5.129  10.476  1.00 0.00 ? 53  PRO A CB   10 
ATOM   11234 C  CG   . PRO A 1 53 ? 10.820  -6.064  10.127  1.00 0.00 ? 53  PRO A CG   10 
ATOM   11235 C  CD   . PRO A 1 53 ? 11.174  -5.770  8.695   1.00 0.00 ? 53  PRO A CD   10 
ATOM   11236 H  HA   . PRO A 1 53 ? 9.072   -3.422  9.341   1.00 0.00 ? 53  PRO A HA   10 
ATOM   11237 H  HB2  . PRO A 1 53 ? 9.713   -4.892  11.531  1.00 0.00 ? 53  PRO A HB2  10 
ATOM   11238 H  HB3  . PRO A 1 53 ? 8.753   -5.532  10.192  1.00 0.00 ? 53  PRO A HB3  10 
ATOM   11239 H  HG2  . PRO A 1 53 ? 11.670  -5.883  10.768  1.00 0.00 ? 53  PRO A HG2  10 
ATOM   11240 H  HG3  . PRO A 1 53 ? 10.483  -7.085  10.228  1.00 0.00 ? 53  PRO A HG3  10 
ATOM   11241 H  HD2  . PRO A 1 53 ? 12.233  -5.902  8.534   1.00 0.00 ? 53  PRO A HD2  10 
ATOM   11242 H  HD3  . PRO A 1 53 ? 10.607  -6.404  8.029   1.00 0.00 ? 53  PRO A HD3  10 
ATOM   11243 N  N    . GLY A 1 54 ? 11.972  -2.502  10.053  1.00 0.00 ? 54  GLY A N    10 
ATOM   11244 C  CA   . GLY A 1 54 ? 12.791  -1.548  10.778  1.00 0.00 ? 54  GLY A CA   10 
ATOM   11245 C  C    . GLY A 1 54 ? 13.696  -0.747  9.864   1.00 0.00 ? 54  GLY A C    10 
ATOM   11246 O  O    . GLY A 1 54 ? 14.859  -1.100  9.666   1.00 0.00 ? 54  GLY A O    10 
ATOM   11247 H  H    . GLY A 1 54 ? 12.303  -2.892  9.216   1.00 0.00 ? 54  GLY A H    10 
ATOM   11248 H  HA2  . GLY A 1 54 ? 12.145  -0.869  11.313  1.00 0.00 ? 54  GLY A HA2  10 
ATOM   11249 H  HA3  . GLY A 1 54 ? 13.402  -2.084  11.490  1.00 0.00 ? 54  GLY A HA3  10 
ATOM   11250 N  N    . ASP A 1 55 ? 13.162  0.332   9.303   1.00 0.00 ? 55  ASP A N    10 
ATOM   11251 C  CA   . ASP A 1 55 ? 13.930  1.186   8.4