data_1VDG
# 
_entry.id   1VDG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VDG         
RCSB  RCSB006491   
WWPDB D_1000006491 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1G0X 'Crystal structure of LIR1.03 (space group P41212)' unspecified 
PDB 1UFU 'Crystal structure of LIR1.03 (space group P21212)' unspecified 
PDB 1UGN 'Crystal structure of LIR1.02'                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VDG 
_pdbx_database_status.recvd_initial_deposition_date   2004-03-22 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shiroishi, M.' 1 
'Rasubala, L.'  2 
'Kuroki, K.'    3 
'Amano, K.'     4 
'Tsuchiya, N.'  5 
'Tokunaga, K.'  6 
'Kohda, D.'     7 
'Maenaka, K.'   8 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of LIR1.03, one of the alleles of LIR1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shiroishi, M.' 1 
primary 'Rasubala, L.'  2 
primary 'Kuroki, K.'    3 
primary 'Amano, K.'     4 
primary 'Tsuchiya, N.'  5 
primary 'Tokunaga, K.'  6 
primary 'Kohda, D.'     7 
primary 'Maenaka, K.'   8 
# 
_cell.entry_id           1VDG 
_cell.length_a           40.969 
_cell.length_b           93.220 
_cell.length_c           57.773 
_cell.angle_alpha        90.00 
_cell.angle_beta         107.82 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1VDG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Leukocyte immunoglobulin-like receptor subfamily B member 1' 22000.662 2  ? A70T 
'Ligand binding domain (domain 1 and 2)' ? 
2 water   nat water                                                         18.015    61 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Leukocyte immunoglobulin-like receptor 1, LIR-1, Immunoglobulin- like transcript 2, ILT-2, Monocyte/macrophage immunoglobulin-like receptor 7, MIR-7, CD85j antigen
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSD
TAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFS
VGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSD
TAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFS
VGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   LEU n 
1 4   PRO n 
1 5   LYS n 
1 6   PRO n 
1 7   THR n 
1 8   LEU n 
1 9   TRP n 
1 10  ALA n 
1 11  GLU n 
1 12  PRO n 
1 13  GLY n 
1 14  SER n 
1 15  VAL n 
1 16  ILE n 
1 17  THR n 
1 18  GLN n 
1 19  GLY n 
1 20  SER n 
1 21  PRO n 
1 22  VAL n 
1 23  THR n 
1 24  LEU n 
1 25  ARG n 
1 26  CYS n 
1 27  GLN n 
1 28  GLY n 
1 29  GLY n 
1 30  GLN n 
1 31  GLU n 
1 32  THR n 
1 33  GLN n 
1 34  GLU n 
1 35  TYR n 
1 36  ARG n 
1 37  LEU n 
1 38  TYR n 
1 39  ARG n 
1 40  GLU n 
1 41  LYS n 
1 42  LYS n 
1 43  THR n 
1 44  ALA n 
1 45  LEU n 
1 46  TRP n 
1 47  ILE n 
1 48  THR n 
1 49  ARG n 
1 50  ILE n 
1 51  PRO n 
1 52  GLN n 
1 53  GLU n 
1 54  LEU n 
1 55  VAL n 
1 56  LYS n 
1 57  LYS n 
1 58  GLY n 
1 59  GLN n 
1 60  PHE n 
1 61  PRO n 
1 62  ILE n 
1 63  PRO n 
1 64  SER n 
1 65  ILE n 
1 66  THR n 
1 67  TRP n 
1 68  GLU n 
1 69  HIS n 
1 70  ALA n 
1 71  GLY n 
1 72  ARG n 
1 73  TYR n 
1 74  ARG n 
1 75  CYS n 
1 76  TYR n 
1 77  TYR n 
1 78  GLY n 
1 79  SER n 
1 80  ASP n 
1 81  THR n 
1 82  ALA n 
1 83  GLY n 
1 84  ARG n 
1 85  SER n 
1 86  GLU n 
1 87  SER n 
1 88  SER n 
1 89  ASP n 
1 90  PRO n 
1 91  LEU n 
1 92  GLU n 
1 93  LEU n 
1 94  VAL n 
1 95  VAL n 
1 96  THR n 
1 97  GLY n 
1 98  ALA n 
1 99  TYR n 
1 100 ILE n 
1 101 LYS n 
1 102 PRO n 
1 103 THR n 
1 104 LEU n 
1 105 SER n 
1 106 ALA n 
1 107 GLN n 
1 108 PRO n 
1 109 SER n 
1 110 PRO n 
1 111 VAL n 
1 112 VAL n 
1 113 ASN n 
1 114 SER n 
1 115 GLY n 
1 116 GLY n 
1 117 ASN n 
1 118 VAL n 
1 119 ILE n 
1 120 LEU n 
1 121 GLN n 
1 122 CYS n 
1 123 ASP n 
1 124 SER n 
1 125 GLN n 
1 126 VAL n 
1 127 ALA n 
1 128 PHE n 
1 129 ASP n 
1 130 GLY n 
1 131 PHE n 
1 132 SER n 
1 133 LEU n 
1 134 CYS n 
1 135 LYS n 
1 136 GLU n 
1 137 GLY n 
1 138 GLU n 
1 139 ASP n 
1 140 GLU n 
1 141 HIS n 
1 142 PRO n 
1 143 GLN n 
1 144 CYS n 
1 145 LEU n 
1 146 ASN n 
1 147 SER n 
1 148 GLN n 
1 149 PRO n 
1 150 HIS n 
1 151 ALA n 
1 152 ARG n 
1 153 GLY n 
1 154 SER n 
1 155 SER n 
1 156 ARG n 
1 157 ALA n 
1 158 ILE n 
1 159 PHE n 
1 160 SER n 
1 161 VAL n 
1 162 GLY n 
1 163 PRO n 
1 164 VAL n 
1 165 SER n 
1 166 PRO n 
1 167 SER n 
1 168 ARG n 
1 169 ARG n 
1 170 TRP n 
1 171 TRP n 
1 172 TYR n 
1 173 ARG n 
1 174 CYS n 
1 175 TYR n 
1 176 ALA n 
1 177 TYR n 
1 178 ASP n 
1 179 SER n 
1 180 ASN n 
1 181 SER n 
1 182 PRO n 
1 183 TYR n 
1 184 GLU n 
1 185 TRP n 
1 186 SER n 
1 187 LEU n 
1 188 PRO n 
1 189 SER n 
1 190 ASP n 
1 191 LEU n 
1 192 LEU n 
1 193 GLU n 
1 194 LEU n 
1 195 LEU n 
1 196 VAL n 
1 197 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGMT7 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LIRB1_HUMAN 
_struct_ref.pdbx_db_accession          Q8NHL6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSD
TAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFS
VGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVL
;
_struct_ref.pdbx_align_begin           24 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1VDG A 1 ? 197 ? Q8NHL6 24 ? 220 ? 1 197 
2 1 1VDG B 1 ? 197 ? Q8NHL6 24 ? 220 ? 1 197 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1VDG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris chloride, 0.7M potassium sodium tartrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
# 
_reflns.entry_id                     1VDG 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.75 
_reflns.number_obs                   10575 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.127 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.0 
_reflns.B_iso_Wilson_estimate        38.8 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           0.545 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1007 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1VDG 
_refine.ls_number_reflns_obs                     10088 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               867342.39 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.98 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          0.25 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.241 
_refine.ls_R_factor_R_free                       0.301 
_refine.ls_R_factor_R_free_error                 0.013 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  519 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.1 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.358498 
_refine.solvent_model_param_bsol                 27.3155 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1UGN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1VDG 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.48 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.53 
_refine_analyze.Luzzati_sigma_a_free            0.64 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2949 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             61 
_refine_hist.number_atoms_total               3010 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        19.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.05  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.27  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.21  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.79  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.78  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.97 
_refine_ls_shell.number_reflns_R_work             1573 
_refine_ls_shell.R_factor_R_work                  0.328 
_refine_ls_shell.percent_reflns_obs               97.2 
_refine_ls_shell.R_factor_R_free                  0.385 
_refine_ls_shell.R_factor_R_free_error            0.042 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             83 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1VDG 
_struct.title                     'Crystal structure of LIR1.01, one of the alleles of LIR1' 
_struct.pdbx_descriptor           'Leukocyte immunoglobulin-like receptor subfamily B member 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1VDG 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'immunoglobulin-like, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TRP A 46 ? ILE A 50 ? TRP A 46 ILE A 50 5 ? 5 
HELX_P HELX_P2 2 PRO A 51 ? LYS A 57 ? PRO A 51 LYS A 57 1 ? 7 
HELX_P HELX_P3 3 THR A 66 ? ALA A 70 ? THR A 66 ALA A 70 5 ? 5 
HELX_P HELX_P4 4 ALA B 44 ? ILE B 50 ? ALA B 44 ILE B 50 5 ? 7 
HELX_P HELX_P5 5 PRO B 51 ? LYS B 56 ? PRO B 51 LYS B 56 1 ? 6 
HELX_P HELX_P6 6 THR B 66 ? ALA B 70 ? THR B 66 ALA B 70 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 26  SG ? ? ? 1_555 A CYS 75  SG ? ? A CYS 26  A CYS 75  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2 disulf ? ? A CYS 122 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 122 A CYS 174 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3 disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 144 SG ? ? A CYS 134 A CYS 144 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf4 disulf ? ? B CYS 26  SG ? ? ? 1_555 B CYS 75  SG ? ? B CYS 26  B CYS 75  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf5 disulf ? ? B CYS 122 SG ? ? ? 1_555 B CYS 174 SG ? ? B CYS 122 B CYS 174 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6 disulf ? ? B CYS 134 SG ? ? ? 1_555 B CYS 144 SG ? ? B CYS 134 B CYS 144 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 11  A . ? GLU 11  A PRO 12  A ? PRO 12  A 1 0.11  
2 GLN 107 A . ? GLN 107 A PRO 108 A ? PRO 108 A 1 -0.41 
3 GLY 162 A . ? GLY 162 A PRO 163 A ? PRO 163 A 1 -0.30 
4 GLU 11  B . ? GLU 11  B PRO 12  B ? PRO 12  B 1 -0.94 
5 GLN 107 B . ? GLN 107 B PRO 108 B ? PRO 108 B 1 3.91  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 4 ? 
G ? 3 ? 
H ? 4 ? 
I ? 3 ? 
J ? 2 ? 
K ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 7   ? GLU A 11  ? THR A 7   GLU A 11  
A 2 VAL A 22  ? GLN A 27  ? VAL A 22  GLN A 27  
A 3 GLN A 59  ? ILE A 62  ? GLN A 59  ILE A 62  
B 1 VAL A 15  ? THR A 17  ? VAL A 15  THR A 17  
B 2 LEU A 91  ? THR A 96  ? LEU A 91  THR A 96  
B 3 GLY A 71  ? TYR A 77  ? GLY A 71  TYR A 77  
B 4 TYR A 35  ? ARG A 39  ? TYR A 35  ARG A 39  
C 1 VAL A 15  ? THR A 17  ? VAL A 15  THR A 17  
C 2 LEU A 91  ? THR A 96  ? LEU A 91  THR A 96  
C 3 GLU A 184 ? TRP A 185 ? GLU A 184 TRP A 185 
D 1 THR A 103 ? GLN A 107 ? THR A 103 GLN A 107 
D 2 VAL A 118 ? ASP A 123 ? VAL A 118 ASP A 123 
D 3 ARG A 156 ? VAL A 161 ? ARG A 156 VAL A 161 
E 1 VAL A 111 ? ASN A 113 ? VAL A 111 ASN A 113 
E 2 LEU A 195 ? LEU A 197 ? LEU A 195 LEU A 197 
F 1 CYS A 144 ? SER A 147 ? CYS A 144 SER A 147 
F 2 GLY A 130 ? LYS A 135 ? GLY A 130 LYS A 135 
F 3 TRP A 171 ? TYR A 177 ? TRP A 171 TYR A 177 
F 4 LEU A 192 ? GLU A 193 ? LEU A 192 GLU A 193 
G 1 THR B 7   ? GLU B 11  ? THR B 7   GLU B 11  
G 2 VAL B 22  ? GLN B 27  ? VAL B 22  GLN B 27  
G 3 GLN B 59  ? ILE B 62  ? GLN B 59  ILE B 62  
H 1 VAL B 15  ? THR B 17  ? VAL B 15  THR B 17  
H 2 LEU B 91  ? THR B 96  ? LEU B 91  THR B 96  
H 3 GLY B 71  ? TYR B 77  ? GLY B 71  TYR B 77  
H 4 TYR B 35  ? ARG B 39  ? TYR B 35  ARG B 39  
I 1 THR B 103 ? GLN B 107 ? THR B 103 GLN B 107 
I 2 VAL B 118 ? ASP B 123 ? VAL B 118 ASP B 123 
I 3 ARG B 156 ? VAL B 161 ? ARG B 156 VAL B 161 
J 1 VAL B 111 ? ASN B 113 ? VAL B 111 ASN B 113 
J 2 LEU B 195 ? LEU B 197 ? LEU B 195 LEU B 197 
K 1 CYS B 144 ? SER B 147 ? CYS B 144 SER B 147 
K 2 GLY B 130 ? LYS B 135 ? GLY B 130 LYS B 135 
K 3 TRP B 171 ? TYR B 177 ? TRP B 171 TYR B 177 
K 4 LEU B 192 ? GLU B 193 ? LEU B 192 GLU B 193 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP A 9   ? N TRP A 9   O ARG A 25  ? O ARG A 25  
A 2 3 N VAL A 22  ? N VAL A 22  O ILE A 62  ? O ILE A 62  
B 1 2 N ILE A 16  ? N ILE A 16  O VAL A 94  ? O VAL A 94  
B 2 3 O LEU A 93  ? O LEU A 93  N GLY A 71  ? N GLY A 71  
B 3 4 O TYR A 76  ? O TYR A 76  N ARG A 36  ? N ARG A 36  
C 1 2 N ILE A 16  ? N ILE A 16  O VAL A 94  ? O VAL A 94  
C 2 3 N VAL A 95  ? N VAL A 95  O TRP A 185 ? O TRP A 185 
D 1 2 N SER A 105 ? N SER A 105 O GLN A 121 ? O GLN A 121 
D 2 3 N LEU A 120 ? N LEU A 120 O PHE A 159 ? O PHE A 159 
E 1 2 N VAL A 112 ? N VAL A 112 O LEU A 195 ? O LEU A 195 
F 1 2 O LEU A 145 ? O LEU A 145 N LEU A 133 ? N LEU A 133 
F 2 3 N SER A 132 ? N SER A 132 O TYR A 175 ? O TYR A 175 
F 3 4 N TYR A 172 ? N TYR A 172 O LEU A 192 ? O LEU A 192 
G 1 2 N GLU B 11  ? N GLU B 11  O THR B 23  ? O THR B 23  
G 2 3 N VAL B 22  ? N VAL B 22  O ILE B 62  ? O ILE B 62  
H 1 2 N ILE B 16  ? N ILE B 16  O VAL B 94  ? O VAL B 94  
H 2 3 O LEU B 93  ? O LEU B 93  N GLY B 71  ? N GLY B 71  
H 3 4 O ARG B 74  ? O ARG B 74  N TYR B 38  ? N TYR B 38  
I 1 2 N THR B 103 ? N THR B 103 O ASP B 123 ? O ASP B 123 
I 2 3 N LEU B 120 ? N LEU B 120 O PHE B 159 ? O PHE B 159 
J 1 2 N VAL B 112 ? N VAL B 112 O LEU B 197 ? O LEU B 197 
K 1 2 O SER B 147 ? O SER B 147 N PHE B 131 ? N PHE B 131 
K 2 3 N CYS B 134 ? N CYS B 134 O ARG B 173 ? O ARG B 173 
K 3 4 N TYR B 172 ? N TYR B 172 O LEU B 192 ? O LEU B 192 
# 
_database_PDB_matrix.entry_id          1VDG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VDG 
_atom_sites.fract_transf_matrix[1][1]   0.024409 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007844 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010727 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018181 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 41.916 21.625 28.845 1.00 44.90 ? 1   GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 40.732 21.925 27.966 1.00 44.68 ? 1   GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 39.862 23.059 28.477 1.00 43.77 ? 1   GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 40.367 24.083 28.938 1.00 44.44 ? 1   GLY A O   1 
ATOM   5    N N   . HIS A 1 2   ? 38.550 22.893 28.376 1.00 42.80 ? 2   HIS A N   1 
ATOM   6    C CA  . HIS A 1 2   ? 37.638 23.916 28.862 1.00 42.27 ? 2   HIS A CA  1 
ATOM   7    C C   . HIS A 1 2   ? 36.512 23.287 29.669 1.00 41.83 ? 2   HIS A C   1 
ATOM   8    O O   . HIS A 1 2   ? 35.510 22.832 29.117 1.00 42.10 ? 2   HIS A O   1 
ATOM   9    C CB  . HIS A 1 2   ? 37.049 24.736 27.704 1.00 43.11 ? 2   HIS A CB  1 
ATOM   10   C CG  . HIS A 1 2   ? 35.956 25.679 28.124 1.00 44.12 ? 2   HIS A CG  1 
ATOM   11   N ND1 . HIS A 1 2   ? 35.015 26.169 27.243 1.00 44.59 ? 2   HIS A ND1 1 
ATOM   12   C CD2 . HIS A 1 2   ? 35.634 26.196 29.337 1.00 43.43 ? 2   HIS A CD2 1 
ATOM   13   C CE1 . HIS A 1 2   ? 34.160 26.940 27.893 1.00 43.08 ? 2   HIS A CE1 1 
ATOM   14   N NE2 . HIS A 1 2   ? 34.513 26.973 29.165 1.00 41.63 ? 2   HIS A NE2 1 
ATOM   15   N N   . LEU A 1 3   ? 36.691 23.259 30.984 1.00 41.26 ? 3   LEU A N   1 
ATOM   16   C CA  . LEU A 1 3   ? 35.684 22.714 31.875 1.00 40.37 ? 3   LEU A CA  1 
ATOM   17   C C   . LEU A 1 3   ? 34.867 23.886 32.425 1.00 40.02 ? 3   LEU A C   1 
ATOM   18   O O   . LEU A 1 3   ? 35.283 24.554 33.375 1.00 39.54 ? 3   LEU A O   1 
ATOM   19   C CB  . LEU A 1 3   ? 36.360 21.950 33.008 1.00 40.08 ? 3   LEU A CB  1 
ATOM   20   C CG  . LEU A 1 3   ? 37.235 20.824 32.467 1.00 39.84 ? 3   LEU A CG  1 
ATOM   21   C CD1 . LEU A 1 3   ? 38.111 20.263 33.578 1.00 40.03 ? 3   LEU A CD1 1 
ATOM   22   C CD2 . LEU A 1 3   ? 36.343 19.754 31.843 1.00 39.38 ? 3   LEU A CD2 1 
ATOM   23   N N   . PRO A 1 4   ? 33.693 24.159 31.817 1.00 39.33 ? 4   PRO A N   1 
ATOM   24   C CA  . PRO A 1 4   ? 32.806 25.248 32.232 1.00 38.66 ? 4   PRO A CA  1 
ATOM   25   C C   . PRO A 1 4   ? 32.315 25.075 33.653 1.00 38.69 ? 4   PRO A C   1 
ATOM   26   O O   . PRO A 1 4   ? 31.899 23.978 34.058 1.00 39.96 ? 4   PRO A O   1 
ATOM   27   C CB  . PRO A 1 4   ? 31.642 25.160 31.246 1.00 37.97 ? 4   PRO A CB  1 
ATOM   28   C CG  . PRO A 1 4   ? 32.225 24.502 30.062 1.00 38.95 ? 4   PRO A CG  1 
ATOM   29   C CD  . PRO A 1 4   ? 33.115 23.448 30.666 1.00 38.76 ? 4   PRO A CD  1 
ATOM   30   N N   . LYS A 1 5   ? 32.364 26.169 34.399 1.00 38.02 ? 5   LYS A N   1 
ATOM   31   C CA  . LYS A 1 5   ? 31.894 26.189 35.769 1.00 36.95 ? 5   LYS A CA  1 
ATOM   32   C C   . LYS A 1 5   ? 30.432 25.716 35.674 1.00 35.47 ? 5   LYS A C   1 
ATOM   33   O O   . LYS A 1 5   ? 29.657 26.244 34.872 1.00 35.09 ? 5   LYS A O   1 
ATOM   34   C CB  . LYS A 1 5   ? 32.013 27.630 36.286 1.00 38.80 ? 5   LYS A CB  1 
ATOM   35   C CG  . LYS A 1 5   ? 31.351 27.965 37.606 1.00 40.55 ? 5   LYS A CG  1 
ATOM   36   C CD  . LYS A 1 5   ? 31.337 29.497 37.804 1.00 42.76 ? 5   LYS A CD  1 
ATOM   37   C CE  . LYS A 1 5   ? 30.696 30.218 36.602 1.00 43.32 ? 5   LYS A CE  1 
ATOM   38   N NZ  . LYS A 1 5   ? 30.568 31.695 36.767 1.00 44.30 ? 5   LYS A NZ  1 
ATOM   39   N N   . PRO A 1 6   ? 30.053 24.690 36.467 1.00 34.00 ? 6   PRO A N   1 
ATOM   40   C CA  . PRO A 1 6   ? 28.692 24.138 36.473 1.00 31.54 ? 6   PRO A CA  1 
ATOM   41   C C   . PRO A 1 6   ? 27.635 25.054 37.067 1.00 29.91 ? 6   PRO A C   1 
ATOM   42   O O   . PRO A 1 6   ? 27.936 26.052 37.721 1.00 29.15 ? 6   PRO A O   1 
ATOM   43   C CB  . PRO A 1 6   ? 28.844 22.851 37.275 1.00 31.43 ? 6   PRO A CB  1 
ATOM   44   C CG  . PRO A 1 6   ? 29.863 23.226 38.284 1.00 33.09 ? 6   PRO A CG  1 
ATOM   45   C CD  . PRO A 1 6   ? 30.897 23.979 37.446 1.00 33.91 ? 6   PRO A CD  1 
ATOM   46   N N   . THR A 1 7   ? 26.383 24.696 36.839 1.00 28.85 ? 7   THR A N   1 
ATOM   47   C CA  . THR A 1 7   ? 25.279 25.489 37.334 1.00 27.43 ? 7   THR A CA  1 
ATOM   48   C C   . THR A 1 7   ? 24.694 24.825 38.561 1.00 27.54 ? 7   THR A C   1 
ATOM   49   O O   . THR A 1 7   ? 24.448 23.619 38.566 1.00 28.01 ? 7   THR A O   1 
ATOM   50   C CB  . THR A 1 7   ? 24.206 25.639 36.245 1.00 27.41 ? 7   THR A CB  1 
ATOM   51   O OG1 . THR A 1 7   ? 24.784 26.324 35.124 1.00 27.95 ? 7   THR A OG1 1 
ATOM   52   C CG2 . THR A 1 7   ? 22.996 26.415 36.771 1.00 25.34 ? 7   THR A CG2 1 
ATOM   53   N N   . LEU A 1 8   ? 24.481 25.615 39.607 1.00 26.12 ? 8   LEU A N   1 
ATOM   54   C CA  . LEU A 1 8   ? 23.936 25.098 40.855 1.00 25.09 ? 8   LEU A CA  1 
ATOM   55   C C   . LEU A 1 8   ? 22.619 25.788 41.157 1.00 23.59 ? 8   LEU A C   1 
ATOM   56   O O   . LEU A 1 8   ? 22.525 27.002 41.046 1.00 22.01 ? 8   LEU A O   1 
ATOM   57   C CB  . LEU A 1 8   ? 24.928 25.351 41.996 1.00 25.92 ? 8   LEU A CB  1 
ATOM   58   C CG  . LEU A 1 8   ? 24.547 24.933 43.417 1.00 24.94 ? 8   LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 8   ? 24.452 23.421 43.495 1.00 25.24 ? 8   LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 8   ? 25.591 25.456 44.392 1.00 22.44 ? 8   LEU A CD2 1 
ATOM   61   N N   . TRP A 1 9   ? 21.608 25.007 41.531 1.00 23.41 ? 9   TRP A N   1 
ATOM   62   C CA  . TRP A 1 9   ? 20.289 25.544 41.853 1.00 24.13 ? 9   TRP A CA  1 
ATOM   63   C C   . TRP A 1 9   ? 19.527 24.607 42.775 1.00 24.45 ? 9   TRP A C   1 
ATOM   64   O O   . TRP A 1 9   ? 19.863 23.432 42.888 1.00 25.20 ? 9   TRP A O   1 
ATOM   65   C CB  . TRP A 1 9   ? 19.477 25.813 40.572 1.00 23.07 ? 9   TRP A CB  1 
ATOM   66   C CG  . TRP A 1 9   ? 18.901 24.612 39.861 1.00 23.45 ? 9   TRP A CG  1 
ATOM   67   C CD1 . TRP A 1 9   ? 17.587 24.215 39.846 1.00 23.62 ? 9   TRP A CD1 1 
ATOM   68   C CD2 . TRP A 1 9   ? 19.596 23.718 38.983 1.00 22.67 ? 9   TRP A CD2 1 
ATOM   69   N NE1 . TRP A 1 9   ? 17.423 23.141 39.005 1.00 21.91 ? 9   TRP A NE1 1 
ATOM   70   C CE2 . TRP A 1 9   ? 18.639 22.812 38.461 1.00 23.15 ? 9   TRP A CE2 1 
ATOM   71   C CE3 . TRP A 1 9   ? 20.934 23.594 38.582 1.00 22.67 ? 9   TRP A CE3 1 
ATOM   72   C CZ2 . TRP A 1 9   ? 18.981 21.792 37.554 1.00 22.70 ? 9   TRP A CZ2 1 
ATOM   73   C CZ3 . TRP A 1 9   ? 21.275 22.581 37.681 1.00 22.06 ? 9   TRP A CZ3 1 
ATOM   74   C CH2 . TRP A 1 9   ? 20.299 21.695 37.178 1.00 22.34 ? 9   TRP A CH2 1 
ATOM   75   N N   . ALA A 1 10  ? 18.510 25.134 43.448 1.00 25.52 ? 10  ALA A N   1 
ATOM   76   C CA  . ALA A 1 10  ? 17.706 24.330 44.365 1.00 26.07 ? 10  ALA A CA  1 
ATOM   77   C C   . ALA A 1 10  ? 16.278 24.208 43.870 1.00 26.31 ? 10  ALA A C   1 
ATOM   78   O O   . ALA A 1 10  ? 15.730 25.156 43.302 1.00 27.86 ? 10  ALA A O   1 
ATOM   79   C CB  . ALA A 1 10  ? 17.699 24.960 45.748 1.00 23.85 ? 10  ALA A CB  1 
ATOM   80   N N   . GLU A 1 11  ? 15.675 23.044 44.093 1.00 26.22 ? 11  GLU A N   1 
ATOM   81   C CA  . GLU A 1 11  ? 14.288 22.820 43.697 1.00 25.59 ? 11  GLU A CA  1 
ATOM   82   C C   . GLU A 1 11  ? 13.519 22.413 44.945 1.00 24.56 ? 11  GLU A C   1 
ATOM   83   O O   . GLU A 1 11  ? 13.952 21.537 45.689 1.00 25.04 ? 11  GLU A O   1 
ATOM   84   C CB  . GLU A 1 11  ? 14.208 21.721 42.645 1.00 23.21 ? 11  GLU A CB  1 
ATOM   85   C CG  . GLU A 1 11  ? 15.146 21.969 41.495 1.00 25.89 ? 11  GLU A CG  1 
ATOM   86   C CD  . GLU A 1 11  ? 14.951 21.001 40.354 1.00 25.90 ? 11  GLU A CD  1 
ATOM   87   O OE1 . GLU A 1 11  ? 14.348 19.932 40.571 1.00 25.25 ? 11  GLU A OE1 1 
ATOM   88   O OE2 . GLU A 1 11  ? 15.418 21.310 39.237 1.00 27.18 ? 11  GLU A OE2 1 
ATOM   89   N N   . PRO A 1 12  ? 12.367 23.040 45.194 1.00 24.21 ? 12  PRO A N   1 
ATOM   90   C CA  . PRO A 1 12  ? 11.733 24.094 44.398 1.00 24.79 ? 12  PRO A CA  1 
ATOM   91   C C   . PRO A 1 12  ? 12.463 25.430 44.440 1.00 26.21 ? 12  PRO A C   1 
ATOM   92   O O   . PRO A 1 12  ? 12.314 26.251 43.536 1.00 27.94 ? 12  PRO A O   1 
ATOM   93   C CB  . PRO A 1 12  ? 10.348 24.193 45.013 1.00 24.52 ? 12  PRO A CB  1 
ATOM   94   C CG  . PRO A 1 12  ? 10.612 23.854 46.465 1.00 24.32 ? 12  PRO A CG  1 
ATOM   95   C CD  . PRO A 1 12  ? 11.529 22.678 46.351 1.00 23.96 ? 12  PRO A CD  1 
ATOM   96   N N   . GLY A 1 13  ? 13.244 25.655 45.493 1.00 26.16 ? 13  GLY A N   1 
ATOM   97   C CA  . GLY A 1 13  ? 13.964 26.912 45.618 1.00 25.28 ? 13  GLY A CA  1 
ATOM   98   C C   . GLY A 1 13  ? 14.970 26.923 46.746 1.00 23.60 ? 13  GLY A C   1 
ATOM   99   O O   . GLY A 1 13  ? 15.114 25.934 47.460 1.00 23.16 ? 13  GLY A O   1 
ATOM   100  N N   . SER A 1 14  ? 15.654 28.049 46.922 1.00 22.34 ? 14  SER A N   1 
ATOM   101  C CA  . SER A 1 14  ? 16.666 28.141 47.963 1.00 21.62 ? 14  SER A CA  1 
ATOM   102  C C   . SER A 1 14  ? 16.166 28.584 49.339 1.00 20.88 ? 14  SER A C   1 
ATOM   103  O O   . SER A 1 14  ? 16.857 28.371 50.326 1.00 22.46 ? 14  SER A O   1 
ATOM   104  C CB  . SER A 1 14  ? 17.809 29.049 47.505 1.00 20.99 ? 14  SER A CB  1 
ATOM   105  O OG  . SER A 1 14  ? 17.416 30.405 47.505 1.00 24.81 ? 14  SER A OG  1 
ATOM   106  N N   . VAL A 1 15  ? 14.983 29.193 49.408 1.00 20.24 ? 15  VAL A N   1 
ATOM   107  C CA  . VAL A 1 15  ? 14.394 29.640 50.686 1.00 19.35 ? 15  VAL A CA  1 
ATOM   108  C C   . VAL A 1 15  ? 13.317 28.621 51.073 1.00 20.48 ? 15  VAL A C   1 
ATOM   109  O O   . VAL A 1 15  ? 12.159 28.748 50.656 1.00 20.20 ? 15  VAL A O   1 
ATOM   110  C CB  . VAL A 1 15  ? 13.727 31.049 50.562 1.00 16.72 ? 15  VAL A CB  1 
ATOM   111  C CG1 . VAL A 1 15  ? 12.942 31.367 51.800 1.00 13.48 ? 15  VAL A CG1 1 
ATOM   112  C CG2 . VAL A 1 15  ? 14.776 32.117 50.364 1.00 15.42 ? 15  VAL A CG2 1 
ATOM   113  N N   . ILE A 1 16  ? 13.677 27.618 51.868 1.00 20.80 ? 16  ILE A N   1 
ATOM   114  C CA  . ILE A 1 16  ? 12.688 26.606 52.213 1.00 23.26 ? 16  ILE A CA  1 
ATOM   115  C C   . ILE A 1 16  ? 12.364 26.492 53.695 1.00 23.41 ? 16  ILE A C   1 
ATOM   116  O O   . ILE A 1 16  ? 13.246 26.475 54.549 1.00 23.92 ? 16  ILE A O   1 
ATOM   117  C CB  . ILE A 1 16  ? 13.097 25.204 51.652 1.00 24.30 ? 16  ILE A CB  1 
ATOM   118  C CG1 . ILE A 1 16  ? 13.789 24.374 52.732 1.00 25.65 ? 16  ILE A CG1 1 
ATOM   119  C CG2 . ILE A 1 16  ? 13.986 25.375 50.409 1.00 23.84 ? 16  ILE A CG2 1 
ATOM   120  C CD1 . ILE A 1 16  ? 14.261 23.032 52.240 1.00 27.67 ? 16  ILE A CD1 1 
ATOM   121  N N   . THR A 1 17  ? 11.070 26.405 53.968 1.00 24.61 ? 17  THR A N   1 
ATOM   122  C CA  . THR A 1 17  ? 10.539 26.307 55.312 1.00 26.44 ? 17  THR A CA  1 
ATOM   123  C C   . THR A 1 17  ? 11.055 25.050 55.998 1.00 26.76 ? 17  THR A C   1 
ATOM   124  O O   . THR A 1 17  ? 11.126 23.979 55.398 1.00 25.97 ? 17  THR A O   1 
ATOM   125  C CB  . THR A 1 17  ? 8.985  26.334 55.272 1.00 26.81 ? 17  THR A CB  1 
ATOM   126  O OG1 . THR A 1 17  ? 8.457  25.422 56.239 1.00 26.67 ? 17  THR A OG1 1 
ATOM   127  C CG2 . THR A 1 17  ? 8.481  25.943 53.880 1.00 28.42 ? 17  THR A CG2 1 
ATOM   128  N N   . GLN A 1 18  ? 11.431 25.198 57.260 1.00 27.52 ? 18  GLN A N   1 
ATOM   129  C CA  . GLN A 1 18  ? 11.963 24.093 58.030 1.00 29.00 ? 18  GLN A CA  1 
ATOM   130  C C   . GLN A 1 18  ? 11.087 22.857 57.996 1.00 28.87 ? 18  GLN A C   1 
ATOM   131  O O   . GLN A 1 18  ? 9.860  22.947 57.986 1.00 28.95 ? 18  GLN A O   1 
ATOM   132  C CB  . GLN A 1 18  ? 12.177 24.526 59.473 1.00 31.07 ? 18  GLN A CB  1 
ATOM   133  C CG  . GLN A 1 18  ? 12.634 23.387 60.362 1.00 34.25 ? 18  GLN A CG  1 
ATOM   134  C CD  . GLN A 1 18  ? 11.757 23.228 61.587 1.00 37.15 ? 18  GLN A CD  1 
ATOM   135  O OE1 . GLN A 1 18  ? 11.847 24.028 62.512 1.00 41.35 ? 18  GLN A OE1 1 
ATOM   136  N NE2 . GLN A 1 18  ? 10.898 22.207 61.598 1.00 37.18 ? 18  GLN A NE2 1 
ATOM   137  N N   . GLY A 1 19  ? 11.739 21.700 57.995 1.00 28.31 ? 19  GLY A N   1 
ATOM   138  C CA  . GLY A 1 19  ? 11.024 20.445 57.959 1.00 27.58 ? 19  GLY A CA  1 
ATOM   139  C C   . GLY A 1 19  ? 10.739 19.993 56.540 1.00 26.92 ? 19  GLY A C   1 
ATOM   140  O O   . GLY A 1 19  ? 10.643 18.793 56.290 1.00 27.53 ? 19  GLY A O   1 
ATOM   141  N N   . SER A 1 20  ? 10.623 20.945 55.614 1.00 25.51 ? 20  SER A N   1 
ATOM   142  C CA  . SER A 1 20  ? 10.324 20.647 54.211 1.00 24.85 ? 20  SER A CA  1 
ATOM   143  C C   . SER A 1 20  ? 11.506 20.159 53.356 1.00 24.42 ? 20  SER A C   1 
ATOM   144  O O   . SER A 1 20  ? 12.669 20.335 53.722 1.00 26.50 ? 20  SER A O   1 
ATOM   145  C CB  . SER A 1 20  ? 9.667  21.866 53.562 1.00 25.12 ? 20  SER A CB  1 
ATOM   146  O OG  . SER A 1 20  ? 8.377  22.094 54.120 1.00 22.73 ? 20  SER A OG  1 
ATOM   147  N N   . PRO A 1 21  ? 11.203 19.536 52.197 1.00 23.27 ? 21  PRO A N   1 
ATOM   148  C CA  . PRO A 1 21  ? 12.120 18.963 51.198 1.00 22.18 ? 21  PRO A CA  1 
ATOM   149  C C   . PRO A 1 21  ? 12.690 19.966 50.213 1.00 22.17 ? 21  PRO A C   1 
ATOM   150  O O   . PRO A 1 21  ? 12.091 21.002 49.961 1.00 21.89 ? 21  PRO A O   1 
ATOM   151  C CB  . PRO A 1 21  ? 11.243 17.949 50.456 1.00 21.91 ? 21  PRO A CB  1 
ATOM   152  C CG  . PRO A 1 21  ? 9.986  17.843 51.285 1.00 21.75 ? 21  PRO A CG  1 
ATOM   153  C CD  . PRO A 1 21  ? 9.818  19.210 51.825 1.00 22.44 ? 21  PRO A CD  1 
ATOM   154  N N   . VAL A 1 22  ? 13.838 19.630 49.638 1.00 22.34 ? 22  VAL A N   1 
ATOM   155  C CA  . VAL A 1 22  ? 14.509 20.471 48.650 1.00 22.93 ? 22  VAL A CA  1 
ATOM   156  C C   . VAL A 1 22  ? 15.631 19.607 48.090 1.00 23.65 ? 22  VAL A C   1 
ATOM   157  O O   . VAL A 1 22  ? 16.098 18.696 48.768 1.00 25.72 ? 22  VAL A O   1 
ATOM   158  C CB  . VAL A 1 22  ? 15.120 21.741 49.296 1.00 22.99 ? 22  VAL A CB  1 
ATOM   159  C CG1 . VAL A 1 22  ? 16.144 21.341 50.362 1.00 22.41 ? 22  VAL A CG1 1 
ATOM   160  C CG2 . VAL A 1 22  ? 15.782 22.610 48.233 1.00 21.53 ? 22  VAL A CG2 1 
ATOM   161  N N   . THR A 1 23  ? 16.058 19.870 46.860 1.00 23.93 ? 23  THR A N   1 
ATOM   162  C CA  . THR A 1 23  ? 17.133 19.087 46.270 1.00 25.08 ? 23  THR A CA  1 
ATOM   163  C C   . THR A 1 23  ? 18.092 19.990 45.527 1.00 26.63 ? 23  THR A C   1 
ATOM   164  O O   . THR A 1 23  ? 17.704 20.709 44.605 1.00 27.85 ? 23  THR A O   1 
ATOM   165  C CB  . THR A 1 23  ? 16.592 18.004 45.294 1.00 25.12 ? 23  THR A CB  1 
ATOM   166  O OG1 . THR A 1 23  ? 15.800 17.047 46.022 1.00 21.62 ? 23  THR A OG1 1 
ATOM   167  C CG2 . THR A 1 23  ? 17.764 17.297 44.565 1.00 22.81 ? 23  THR A CG2 1 
ATOM   168  N N   . LEU A 1 24  ? 19.352 19.953 45.943 1.00 27.70 ? 24  LEU A N   1 
ATOM   169  C CA  . LEU A 1 24  ? 20.381 20.777 45.329 1.00 27.91 ? 24  LEU A CA  1 
ATOM   170  C C   . LEU A 1 24  ? 20.840 20.133 44.033 1.00 29.19 ? 24  LEU A C   1 
ATOM   171  O O   . LEU A 1 24  ? 21.250 18.974 44.010 1.00 30.16 ? 24  LEU A O   1 
ATOM   172  C CB  . LEU A 1 24  ? 21.563 20.960 46.297 1.00 26.05 ? 24  LEU A CB  1 
ATOM   173  C CG  . LEU A 1 24  ? 21.252 21.578 47.667 1.00 24.06 ? 24  LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 24  ? 22.468 22.341 48.179 1.00 21.90 ? 24  LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 24  ? 20.089 22.540 47.554 1.00 23.86 ? 24  LEU A CD2 1 
ATOM   176  N N   . ARG A 1 25  ? 20.771 20.898 42.952 1.00 30.67 ? 25  ARG A N   1 
ATOM   177  C CA  . ARG A 1 25  ? 21.145 20.404 41.641 1.00 30.92 ? 25  ARG A CA  1 
ATOM   178  C C   . ARG A 1 25  ? 22.393 21.057 41.079 1.00 32.63 ? 25  ARG A C   1 
ATOM   179  O O   . ARG A 1 25  ? 22.470 22.279 40.962 1.00 32.24 ? 25  ARG A O   1 
ATOM   180  C CB  . ARG A 1 25  ? 19.992 20.629 40.672 1.00 29.91 ? 25  ARG A CB  1 
ATOM   181  C CG  . ARG A 1 25  ? 18.705 19.927 41.050 1.00 28.86 ? 25  ARG A CG  1 
ATOM   182  C CD  . ARG A 1 25  ? 18.775 18.451 40.736 1.00 29.19 ? 25  ARG A CD  1 
ATOM   183  N NE  . ARG A 1 25  ? 18.924 18.177 39.303 1.00 31.13 ? 25  ARG A NE  1 
ATOM   184  C CZ  . ARG A 1 25  ? 17.921 18.132 38.425 1.00 29.70 ? 25  ARG A CZ  1 
ATOM   185  N NH1 . ARG A 1 25  ? 16.675 18.349 38.821 1.00 28.55 ? 25  ARG A NH1 1 
ATOM   186  N NH2 . ARG A 1 25  ? 18.160 17.846 37.148 1.00 29.15 ? 25  ARG A NH2 1 
ATOM   187  N N   . CYS A 1 26  ? 23.360 20.220 40.718 1.00 35.19 ? 26  CYS A N   1 
ATOM   188  C CA  . CYS A 1 26  ? 24.615 20.658 40.125 1.00 37.46 ? 26  CYS A CA  1 
ATOM   189  C C   . CYS A 1 26  ? 24.642 19.937 38.793 1.00 39.63 ? 26  CYS A C   1 
ATOM   190  O O   . CYS A 1 26  ? 24.559 18.717 38.767 1.00 40.75 ? 26  CYS A O   1 
ATOM   191  C CB  . CYS A 1 26  ? 25.794 20.190 40.979 1.00 38.31 ? 26  CYS A CB  1 
ATOM   192  S SG  . CYS A 1 26  ? 27.445 20.791 40.481 1.00 38.79 ? 26  CYS A SG  1 
ATOM   193  N N   . GLN A 1 27  ? 24.726 20.675 37.692 1.00 41.77 ? 27  GLN A N   1 
ATOM   194  C CA  . GLN A 1 27  ? 24.757 20.045 36.381 1.00 44.14 ? 27  GLN A CA  1 
ATOM   195  C C   . GLN A 1 27  ? 25.597 20.816 35.379 1.00 46.35 ? 27  GLN A C   1 
ATOM   196  O O   . GLN A 1 27  ? 25.242 21.928 34.977 1.00 46.13 ? 27  GLN A O   1 
ATOM   197  C CB  . GLN A 1 27  ? 23.343 19.879 35.820 1.00 43.72 ? 27  GLN A CB  1 
ATOM   198  C CG  . GLN A 1 27  ? 23.298 19.009 34.577 1.00 44.01 ? 27  GLN A CG  1 
ATOM   199  C CD  . GLN A 1 27  ? 22.023 18.197 34.476 1.00 44.37 ? 27  GLN A CD  1 
ATOM   200  O OE1 . GLN A 1 27  ? 22.032 17.091 33.934 1.00 46.35 ? 27  GLN A OE1 1 
ATOM   201  N NE2 . GLN A 1 27  ? 20.918 18.740 34.983 1.00 44.39 ? 27  GLN A NE2 1 
ATOM   202  N N   . GLY A 1 28  ? 26.711 20.209 34.977 1.00 47.95 ? 28  GLY A N   1 
ATOM   203  C CA  . GLY A 1 28  ? 27.592 20.836 34.011 1.00 49.24 ? 28  GLY A CA  1 
ATOM   204  C C   . GLY A 1 28  ? 27.102 20.597 32.597 1.00 50.06 ? 28  GLY A C   1 
ATOM   205  O O   . GLY A 1 28  ? 27.385 21.378 31.687 1.00 51.01 ? 28  GLY A O   1 
ATOM   206  N N   . GLY A 1 29  ? 26.380 19.499 32.402 1.00 50.26 ? 29  GLY A N   1 
ATOM   207  C CA  . GLY A 1 29  ? 25.849 19.206 31.084 1.00 50.93 ? 29  GLY A CA  1 
ATOM   208  C C   . GLY A 1 29  ? 25.370 17.783 30.898 1.00 51.32 ? 29  GLY A C   1 
ATOM   209  O O   . GLY A 1 29  ? 24.271 17.400 31.302 1.00 49.53 ? 29  GLY A O   1 
ATOM   210  N N   . GLN A 1 30  ? 26.249 17.005 30.276 1.00 52.02 ? 30  GLN A N   1 
ATOM   211  C CA  . GLN A 1 30  ? 25.984 15.616 29.969 1.00 53.22 ? 30  GLN A CA  1 
ATOM   212  C C   . GLN A 1 30  ? 25.544 14.701 31.108 1.00 53.50 ? 30  GLN A C   1 
ATOM   213  O O   . GLN A 1 30  ? 25.698 15.038 32.308 1.00 54.96 ? 30  GLN A O   1 
ATOM   214  C CB  . GLN A 1 30  ? 27.165 15.028 29.245 1.00 53.32 ? 30  GLN A CB  1 
ATOM   215  C CG  . GLN A 1 30  ? 28.494 15.165 29.908 1.00 52.67 ? 30  GLN A CG  1 
ATOM   216  C CD  . GLN A 1 30  ? 29.532 15.272 28.836 1.00 53.20 ? 30  GLN A CD  1 
ATOM   217  O OE1 . GLN A 1 30  ? 29.547 16.257 28.062 1.00 53.92 ? 30  GLN A OE1 1 
ATOM   218  N NE2 . GLN A 1 30  ? 30.370 14.274 28.735 1.00 51.65 ? 30  GLN A NE2 1 
ATOM   219  N N   . GLU A 1 31  ? 25.075 13.510 30.721 1.00 53.23 ? 31  GLU A N   1 
ATOM   220  C CA  . GLU A 1 31  ? 24.548 12.572 31.688 1.00 52.31 ? 31  GLU A CA  1 
ATOM   221  C C   . GLU A 1 31  ? 25.326 12.608 32.954 1.00 51.90 ? 31  GLU A C   1 
ATOM   222  O O   . GLU A 1 31  ? 24.726 12.506 34.021 1.00 50.84 ? 31  GLU A O   1 
ATOM   223  C CB  . GLU A 1 31  ? 24.545 11.092 31.222 1.00 51.99 ? 31  GLU A CB  1 
ATOM   224  C CG  . GLU A 1 31  ? 24.099 10.710 29.835 1.00 53.40 ? 31  GLU A CG  1 
ATOM   225  C CD  . GLU A 1 31  ? 23.798 9.229  29.806 1.00 54.51 ? 31  GLU A CD  1 
ATOM   226  O OE1 . GLU A 1 31  ? 24.451 8.514  30.589 1.00 55.74 ? 31  GLU A OE1 1 
ATOM   227  O OE2 . GLU A 1 31  ? 22.917 8.788  29.022 1.00 53.76 ? 31  GLU A OE2 1 
ATOM   228  N N   . THR A 1 32  ? 26.650 12.774 32.895 1.00 52.25 ? 32  THR A N   1 
ATOM   229  C CA  . THR A 1 32  ? 27.304 12.684 34.195 1.00 52.32 ? 32  THR A CA  1 
ATOM   230  C C   . THR A 1 32  ? 28.564 13.225 34.888 1.00 52.16 ? 32  THR A C   1 
ATOM   231  O O   . THR A 1 32  ? 29.434 13.924 34.381 1.00 51.02 ? 32  THR A O   1 
ATOM   232  C CB  . THR A 1 32  ? 27.430 11.253 34.550 1.00 52.86 ? 32  THR A CB  1 
ATOM   233  O OG1 . THR A 1 32  ? 28.761 10.803 34.265 1.00 53.68 ? 32  THR A OG1 1 
ATOM   234  C CG2 . THR A 1 32  ? 26.469 10.424 33.727 1.00 53.29 ? 32  THR A CG2 1 
ATOM   235  N N   . GLN A 1 33  ? 28.546 12.599 36.077 1.00 52.34 ? 33  GLN A N   1 
ATOM   236  C CA  . GLN A 1 33  ? 29.339 12.424 37.301 1.00 52.16 ? 33  GLN A CA  1 
ATOM   237  C C   . GLN A 1 33  ? 30.165 13.373 38.189 1.00 50.67 ? 33  GLN A C   1 
ATOM   238  O O   . GLN A 1 33  ? 29.605 14.162 38.959 1.00 51.41 ? 33  GLN A O   1 
ATOM   239  C CB  . GLN A 1 33  ? 30.135 11.119 37.065 1.00 55.27 ? 33  GLN A CB  1 
ATOM   240  C CG  . GLN A 1 33  ? 31.071 11.007 35.800 1.00 57.68 ? 33  GLN A CG  1 
ATOM   241  C CD  . GLN A 1 33  ? 31.641 9.648  35.710 1.00 58.29 ? 33  GLN A CD  1 
ATOM   242  O OE1 . GLN A 1 33  ? 30.963 8.691  36.048 1.00 58.32 ? 33  GLN A OE1 1 
ATOM   243  N NE2 . GLN A 1 33  ? 32.898 9.538  35.275 1.00 58.94 ? 33  GLN A NE2 1 
ATOM   244  N N   . GLU A 1 34  ? 31.488 13.187 38.140 1.00 49.12 ? 34  GLU A N   1 
ATOM   245  C CA  . GLU A 1 34  ? 32.412 13.919 39.015 1.00 47.59 ? 34  GLU A CA  1 
ATOM   246  C C   . GLU A 1 34  ? 32.009 15.236 39.736 1.00 45.14 ? 34  GLU A C   1 
ATOM   247  O O   . GLU A 1 34  ? 32.874 16.027 40.100 1.00 43.91 ? 34  GLU A O   1 
ATOM   248  C CB  . GLU A 1 34  ? 33.780 14.054 38.303 1.00 49.43 ? 34  GLU A CB  1 
ATOM   249  C CG  . GLU A 1 34  ? 34.523 12.660 38.213 1.00 51.61 ? 34  GLU A CG  1 
ATOM   250  C CD  . GLU A 1 34  ? 35.457 12.290 39.408 1.00 52.86 ? 34  GLU A CD  1 
ATOM   251  O OE1 . GLU A 1 34  ? 34.989 12.165 40.563 1.00 53.51 ? 34  GLU A OE1 1 
ATOM   252  O OE2 . GLU A 1 34  ? 36.681 12.097 39.184 1.00 54.18 ? 34  GLU A OE2 1 
ATOM   253  N N   . TYR A 1 35  ? 30.710 15.378 40.015 1.00 42.81 ? 35  TYR A N   1 
ATOM   254  C CA  . TYR A 1 35  ? 30.069 16.485 40.720 1.00 39.98 ? 35  TYR A CA  1 
ATOM   255  C C   . TYR A 1 35  ? 30.480 16.412 42.166 1.00 38.10 ? 35  TYR A C   1 
ATOM   256  O O   . TYR A 1 35  ? 30.465 15.341 42.783 1.00 37.46 ? 35  TYR A O   1 
ATOM   257  C CB  . TYR A 1 35  ? 28.536 16.361 40.600 1.00 41.08 ? 35  TYR A CB  1 
ATOM   258  C CG  . TYR A 1 35  ? 28.039 16.613 39.186 1.00 42.13 ? 35  TYR A CG  1 
ATOM   259  C CD1 . TYR A 1 35  ? 27.239 15.681 38.515 1.00 42.42 ? 35  TYR A CD1 1 
ATOM   260  C CD2 . TYR A 1 35  ? 28.412 17.775 38.499 1.00 42.91 ? 35  TYR A CD2 1 
ATOM   261  C CE1 . TYR A 1 35  ? 26.826 15.893 37.189 1.00 42.70 ? 35  TYR A CE1 1 
ATOM   262  C CE2 . TYR A 1 35  ? 28.003 17.998 37.166 1.00 43.99 ? 35  TYR A CE2 1 
ATOM   263  C CZ  . TYR A 1 35  ? 27.212 17.046 36.520 1.00 43.71 ? 35  TYR A CZ  1 
ATOM   264  O OH  . TYR A 1 35  ? 26.838 17.222 35.204 1.00 42.86 ? 35  TYR A OH  1 
ATOM   265  N N   . ARG A 1 36  ? 30.865 17.571 42.682 1.00 36.38 ? 36  ARG A N   1 
ATOM   266  C CA  . ARG A 1 36  ? 31.329 17.712 44.048 1.00 35.71 ? 36  ARG A CA  1 
ATOM   267  C C   . ARG A 1 36  ? 30.793 18.981 44.709 1.00 33.07 ? 36  ARG A C   1 
ATOM   268  O O   . ARG A 1 36  ? 31.241 20.097 44.434 1.00 31.98 ? 36  ARG A O   1 
ATOM   269  C CB  . ARG A 1 36  ? 32.862 17.680 44.062 1.00 37.35 ? 36  ARG A CB  1 
ATOM   270  C CG  . ARG A 1 36  ? 33.434 16.288 43.747 1.00 40.76 ? 36  ARG A CG  1 
ATOM   271  C CD  . ARG A 1 36  ? 34.960 16.312 43.705 1.00 45.01 ? 36  ARG A CD  1 
ATOM   272  N NE  . ARG A 1 36  ? 35.554 15.031 43.308 1.00 46.72 ? 36  ARG A NE  1 
ATOM   273  C CZ  . ARG A 1 36  ? 35.802 14.021 44.139 1.00 47.45 ? 36  ARG A CZ  1 
ATOM   274  N NH1 . ARG A 1 36  ? 35.515 14.128 45.433 1.00 48.82 ? 36  ARG A NH1 1 
ATOM   275  N NH2 . ARG A 1 36  ? 36.340 12.904 43.676 1.00 46.76 ? 36  ARG A NH2 1 
ATOM   276  N N   . LEU A 1 37  ? 29.812 18.774 45.583 1.00 31.19 ? 37  LEU A N   1 
ATOM   277  C CA  . LEU A 1 37  ? 29.148 19.834 46.339 1.00 28.75 ? 37  LEU A CA  1 
ATOM   278  C C   . LEU A 1 37  ? 29.775 19.965 47.733 1.00 26.88 ? 37  LEU A C   1 
ATOM   279  O O   . LEU A 1 37  ? 30.109 18.969 48.371 1.00 24.18 ? 37  LEU A O   1 
ATOM   280  C CB  . LEU A 1 37  ? 27.657 19.507 46.490 1.00 28.23 ? 37  LEU A CB  1 
ATOM   281  C CG  . LEU A 1 37  ? 26.786 20.492 47.274 1.00 30.04 ? 37  LEU A CG  1 
ATOM   282  C CD1 . LEU A 1 37  ? 26.598 21.769 46.454 1.00 29.03 ? 37  LEU A CD1 1 
ATOM   283  C CD2 . LEU A 1 37  ? 25.435 19.855 47.593 1.00 29.25 ? 37  LEU A CD2 1 
ATOM   284  N N   . TYR A 1 38  ? 29.924 21.198 48.202 1.00 24.98 ? 38  TYR A N   1 
ATOM   285  C CA  . TYR A 1 38  ? 30.492 21.444 49.519 1.00 24.10 ? 38  TYR A CA  1 
ATOM   286  C C   . TYR A 1 38  ? 29.951 22.756 50.037 1.00 24.64 ? 38  TYR A C   1 
ATOM   287  O O   . TYR A 1 38  ? 29.659 23.672 49.265 1.00 24.17 ? 38  TYR A O   1 
ATOM   288  C CB  . TYR A 1 38  ? 32.016 21.511 49.445 1.00 21.97 ? 38  TYR A CB  1 
ATOM   289  C CG  . TYR A 1 38  ? 32.563 22.651 48.612 1.00 19.71 ? 38  TYR A CG  1 
ATOM   290  C CD1 . TYR A 1 38  ? 32.657 23.942 49.128 1.00 17.96 ? 38  TYR A CD1 1 
ATOM   291  C CD2 . TYR A 1 38  ? 33.015 22.434 47.311 1.00 19.92 ? 38  TYR A CD2 1 
ATOM   292  C CE1 . TYR A 1 38  ? 33.198 24.993 48.365 1.00 17.86 ? 38  TYR A CE1 1 
ATOM   293  C CE2 . TYR A 1 38  ? 33.553 23.476 46.542 1.00 18.73 ? 38  TYR A CE2 1 
ATOM   294  C CZ  . TYR A 1 38  ? 33.644 24.749 47.075 1.00 17.57 ? 38  TYR A CZ  1 
ATOM   295  O OH  . TYR A 1 38  ? 34.198 25.763 46.321 1.00 17.21 ? 38  TYR A OH  1 
ATOM   296  N N   . ARG A 1 39  ? 29.800 22.852 51.348 1.00 26.09 ? 39  ARG A N   1 
ATOM   297  C CA  . ARG A 1 39  ? 29.297 24.083 51.929 1.00 26.36 ? 39  ARG A CA  1 
ATOM   298  C C   . ARG A 1 39  ? 30.478 24.938 52.338 1.00 26.47 ? 39  ARG A C   1 
ATOM   299  O O   . ARG A 1 39  ? 31.444 24.443 52.916 1.00 25.80 ? 39  ARG A O   1 
ATOM   300  C CB  . ARG A 1 39  ? 28.417 23.789 53.138 1.00 25.72 ? 39  ARG A CB  1 
ATOM   301  C CG  . ARG A 1 39  ? 27.815 25.023 53.770 1.00 27.08 ? 39  ARG A CG  1 
ATOM   302  C CD  . ARG A 1 39  ? 26.832 24.641 54.854 1.00 28.49 ? 39  ARG A CD  1 
ATOM   303  N NE  . ARG A 1 39  ? 27.460 23.872 55.916 1.00 28.21 ? 39  ARG A NE  1 
ATOM   304  C CZ  . ARG A 1 39  ? 26.822 23.427 56.991 1.00 29.60 ? 39  ARG A CZ  1 
ATOM   305  N NH1 . ARG A 1 39  ? 25.525 23.667 57.155 1.00 30.25 ? 39  ARG A NH1 1 
ATOM   306  N NH2 . ARG A 1 39  ? 27.491 22.753 57.916 1.00 31.80 ? 39  ARG A NH2 1 
ATOM   307  N N   . GLU A 1 40  ? 30.404 26.223 52.020 1.00 27.28 ? 40  GLU A N   1 
ATOM   308  C CA  . GLU A 1 40  ? 31.476 27.152 52.360 1.00 28.31 ? 40  GLU A CA  1 
ATOM   309  C C   . GLU A 1 40  ? 31.531 27.416 53.855 1.00 28.56 ? 40  GLU A C   1 
ATOM   310  O O   . GLU A 1 40  ? 30.497 27.584 54.502 1.00 28.18 ? 40  GLU A O   1 
ATOM   311  C CB  . GLU A 1 40  ? 31.292 28.480 51.610 1.00 28.06 ? 40  GLU A CB  1 
ATOM   312  C CG  . GLU A 1 40  ? 32.003 28.541 50.246 1.00 29.14 ? 40  GLU A CG  1 
ATOM   313  C CD  . GLU A 1 40  ? 31.697 29.810 49.452 1.00 28.32 ? 40  GLU A CD  1 
ATOM   314  O OE1 . GLU A 1 40  ? 31.206 30.792 50.051 1.00 26.51 ? 40  GLU A OE1 1 
ATOM   315  O OE2 . GLU A 1 40  ? 31.962 29.829 48.230 1.00 29.08 ? 40  GLU A OE2 1 
ATOM   316  N N   . LYS A 1 41  ? 32.751 27.432 54.388 1.00 30.14 ? 41  LYS A N   1 
ATOM   317  C CA  . LYS A 1 41  ? 33.007 27.724 55.805 1.00 32.39 ? 41  LYS A CA  1 
ATOM   318  C C   . LYS A 1 41  ? 32.889 26.600 56.827 1.00 32.21 ? 41  LYS A C   1 
ATOM   319  O O   . LYS A 1 41  ? 33.581 26.618 57.835 1.00 33.09 ? 41  LYS A O   1 
ATOM   320  C CB  . LYS A 1 41  ? 32.132 28.900 56.268 1.00 33.07 ? 41  LYS A CB  1 
ATOM   321  C CG  . LYS A 1 41  ? 32.413 30.238 55.564 1.00 35.40 ? 41  LYS A CG  1 
ATOM   322  C CD  . LYS A 1 41  ? 33.593 31.002 56.171 1.00 36.52 ? 41  LYS A CD  1 
ATOM   323  C CE  . LYS A 1 41  ? 33.834 32.347 55.451 1.00 38.35 ? 41  LYS A CE  1 
ATOM   324  N NZ  . LYS A 1 41  ? 32.671 33.301 55.572 1.00 38.92 ? 41  LYS A NZ  1 
ATOM   325  N N   . LYS A 1 42  ? 32.007 25.639 56.599 1.00 33.02 ? 42  LYS A N   1 
ATOM   326  C CA  . LYS A 1 42  ? 31.861 24.535 57.537 1.00 32.64 ? 42  LYS A CA  1 
ATOM   327  C C   . LYS A 1 42  ? 31.358 23.319 56.791 1.00 33.78 ? 42  LYS A C   1 
ATOM   328  O O   . LYS A 1 42  ? 30.264 23.332 56.227 1.00 34.49 ? 42  LYS A O   1 
ATOM   329  C CB  . LYS A 1 42  ? 30.890 24.902 58.656 1.00 31.92 ? 42  LYS A CB  1 
ATOM   330  C CG  . LYS A 1 42  ? 30.594 23.765 59.601 1.00 32.36 ? 42  LYS A CG  1 
ATOM   331  C CD  . LYS A 1 42  ? 29.506 24.096 60.624 1.00 32.35 ? 42  LYS A CD  1 
ATOM   332  C CE  . LYS A 1 42  ? 29.223 22.867 61.508 1.00 32.06 ? 42  LYS A CE  1 
ATOM   333  N NZ  . LYS A 1 42  ? 28.093 23.036 62.469 1.00 31.60 ? 42  LYS A NZ  1 
ATOM   334  N N   . THR A 1 43  ? 32.168 22.268 56.774 1.00 35.38 ? 43  THR A N   1 
ATOM   335  C CA  . THR A 1 43  ? 31.794 21.053 56.064 1.00 36.25 ? 43  THR A CA  1 
ATOM   336  C C   . THR A 1 43  ? 30.356 20.648 56.363 1.00 36.34 ? 43  THR A C   1 
ATOM   337  O O   . THR A 1 43  ? 29.951 20.593 57.530 1.00 36.10 ? 43  THR A O   1 
ATOM   338  C CB  . THR A 1 43  ? 32.743 19.859 56.415 1.00 36.30 ? 43  THR A CB  1 
ATOM   339  O OG1 . THR A 1 43  ? 32.863 19.726 57.837 1.00 35.46 ? 43  THR A OG1 1 
ATOM   340  C CG2 . THR A 1 43  ? 34.124 20.075 55.819 1.00 35.87 ? 43  THR A CG2 1 
ATOM   341  N N   . ALA A 1 44  ? 29.589 20.391 55.302 1.00 36.44 ? 44  ALA A N   1 
ATOM   342  C CA  . ALA A 1 44  ? 28.199 19.955 55.439 1.00 37.51 ? 44  ALA A CA  1 
ATOM   343  C C   . ALA A 1 44  ? 28.233 18.432 55.435 1.00 37.78 ? 44  ALA A C   1 
ATOM   344  O O   . ALA A 1 44  ? 28.687 17.808 54.471 1.00 37.25 ? 44  ALA A O   1 
ATOM   345  C CB  . ALA A 1 44  ? 27.357 20.469 54.280 1.00 38.37 ? 44  ALA A CB  1 
ATOM   346  N N   . LEU A 1 45  ? 27.743 17.837 56.515 1.00 38.05 ? 45  LEU A N   1 
ATOM   347  C CA  . LEU A 1 45  ? 27.778 16.388 56.661 1.00 38.47 ? 45  LEU A CA  1 
ATOM   348  C C   . LEU A 1 45  ? 26.774 15.546 55.875 1.00 37.10 ? 45  LEU A C   1 
ATOM   349  O O   . LEU A 1 45  ? 27.042 14.381 55.603 1.00 36.95 ? 45  LEU A O   1 
ATOM   350  C CB  . LEU A 1 45  ? 27.724 16.047 58.155 1.00 40.44 ? 45  LEU A CB  1 
ATOM   351  C CG  . LEU A 1 45  ? 29.006 16.581 58.818 1.00 42.96 ? 45  LEU A CG  1 
ATOM   352  C CD1 . LEU A 1 45  ? 28.764 16.979 60.278 1.00 44.04 ? 45  LEU A CD1 1 
ATOM   353  C CD2 . LEU A 1 45  ? 30.116 15.537 58.660 1.00 42.49 ? 45  LEU A CD2 1 
ATOM   354  N N   . TRP A 1 46  ? 25.637 16.116 55.495 1.00 35.56 ? 46  TRP A N   1 
ATOM   355  C CA  . TRP A 1 46  ? 24.640 15.351 54.751 1.00 35.07 ? 46  TRP A CA  1 
ATOM   356  C C   . TRP A 1 46  ? 25.096 14.989 53.337 1.00 34.94 ? 46  TRP A C   1 
ATOM   357  O O   . TRP A 1 46  ? 24.685 13.966 52.784 1.00 34.60 ? 46  TRP A O   1 
ATOM   358  C CB  . TRP A 1 46  ? 23.331 16.136 54.647 1.00 35.38 ? 46  TRP A CB  1 
ATOM   359  C CG  . TRP A 1 46  ? 23.491 17.442 53.901 1.00 35.24 ? 46  TRP A CG  1 
ATOM   360  C CD1 . TRP A 1 46  ? 24.093 18.579 54.363 1.00 36.01 ? 46  TRP A CD1 1 
ATOM   361  C CD2 . TRP A 1 46  ? 23.086 17.723 52.558 1.00 33.68 ? 46  TRP A CD2 1 
ATOM   362  N NE1 . TRP A 1 46  ? 24.089 19.553 53.388 1.00 34.73 ? 46  TRP A NE1 1 
ATOM   363  C CE2 . TRP A 1 46  ? 23.476 19.053 52.268 1.00 33.70 ? 46  TRP A CE2 1 
ATOM   364  C CE3 . TRP A 1 46  ? 22.433 16.981 51.565 1.00 33.55 ? 46  TRP A CE3 1 
ATOM   365  C CZ2 . TRP A 1 46  ? 23.236 19.655 51.031 1.00 33.21 ? 46  TRP A CZ2 1 
ATOM   366  C CZ3 . TRP A 1 46  ? 22.193 17.578 50.332 1.00 34.27 ? 46  TRP A CZ3 1 
ATOM   367  C CH2 . TRP A 1 46  ? 22.594 18.903 50.077 1.00 34.08 ? 46  TRP A CH2 1 
ATOM   368  N N   . ILE A 1 47  ? 25.933 15.834 52.746 1.00 34.44 ? 47  ILE A N   1 
ATOM   369  C CA  . ILE A 1 47  ? 26.400 15.590 51.389 1.00 34.84 ? 47  ILE A CA  1 
ATOM   370  C C   . ILE A 1 47  ? 27.050 14.218 51.258 1.00 36.93 ? 47  ILE A C   1 
ATOM   371  O O   . ILE A 1 47  ? 26.779 13.469 50.310 1.00 37.22 ? 47  ILE A O   1 
ATOM   372  C CB  . ILE A 1 47  ? 27.404 16.671 50.948 1.00 32.62 ? 47  ILE A CB  1 
ATOM   373  C CG1 . ILE A 1 47  ? 26.774 18.052 51.119 1.00 30.46 ? 47  ILE A CG1 1 
ATOM   374  C CG2 . ILE A 1 47  ? 27.807 16.463 49.489 1.00 31.50 ? 47  ILE A CG2 1 
ATOM   375  C CD1 . ILE A 1 47  ? 27.654 19.188 50.650 1.00 28.80 ? 47  ILE A CD1 1 
ATOM   376  N N   . THR A 1 48  ? 27.911 13.898 52.219 1.00 38.58 ? 48  THR A N   1 
ATOM   377  C CA  . THR A 1 48  ? 28.625 12.623 52.239 1.00 39.83 ? 48  THR A CA  1 
ATOM   378  C C   . THR A 1 48  ? 27.634 11.457 52.309 1.00 40.26 ? 48  THR A C   1 
ATOM   379  O O   . THR A 1 48  ? 27.978 10.308 52.047 1.00 40.55 ? 48  THR A O   1 
ATOM   380  C CB  . THR A 1 48  ? 29.549 12.555 53.468 1.00 39.21 ? 48  THR A CB  1 
ATOM   381  O OG1 . THR A 1 48  ? 28.748 12.517 54.653 1.00 39.34 ? 48  THR A OG1 1 
ATOM   382  C CG2 . THR A 1 48  ? 30.432 13.790 53.543 1.00 38.78 ? 48  THR A CG2 1 
ATOM   383  N N   . ARG A 1 49  ? 26.394 11.779 52.648 1.00 40.84 ? 49  ARG A N   1 
ATOM   384  C CA  . ARG A 1 49  ? 25.336 10.792 52.805 1.00 41.95 ? 49  ARG A CA  1 
ATOM   385  C C   . ARG A 1 49  ? 24.466 10.634 51.541 1.00 40.38 ? 49  ARG A C   1 
ATOM   386  O O   . ARG A 1 49  ? 23.405 10.014 51.571 1.00 38.73 ? 49  ARG A O   1 
ATOM   387  C CB  . ARG A 1 49  ? 24.498 11.220 54.018 1.00 45.84 ? 49  ARG A CB  1 
ATOM   388  C CG  . ARG A 1 49  ? 23.555 10.185 54.593 1.00 50.40 ? 49  ARG A CG  1 
ATOM   389  C CD  . ARG A 1 49  ? 22.709 10.818 55.689 1.00 54.66 ? 49  ARG A CD  1 
ATOM   390  N NE  . ARG A 1 49  ? 23.411 10.928 56.969 1.00 59.28 ? 49  ARG A NE  1 
ATOM   391  C CZ  . ARG A 1 49  ? 23.030 11.729 57.965 1.00 60.69 ? 49  ARG A CZ  1 
ATOM   392  N NH1 . ARG A 1 49  ? 21.959 12.508 57.823 1.00 61.51 ? 49  ARG A NH1 1 
ATOM   393  N NH2 . ARG A 1 49  ? 23.691 11.717 59.121 1.00 61.03 ? 49  ARG A NH2 1 
ATOM   394  N N   . ILE A 1 50  ? 24.923 11.193 50.426 1.00 39.89 ? 50  ILE A N   1 
ATOM   395  C CA  . ILE A 1 50  ? 24.175 11.093 49.177 1.00 39.71 ? 50  ILE A CA  1 
ATOM   396  C C   . ILE A 1 50  ? 24.722 9.956  48.302 1.00 40.38 ? 50  ILE A C   1 
ATOM   397  O O   . ILE A 1 50  ? 25.915 9.918  48.000 1.00 40.09 ? 50  ILE A O   1 
ATOM   398  C CB  . ILE A 1 50  ? 24.233 12.423 48.388 1.00 39.83 ? 50  ILE A CB  1 
ATOM   399  C CG1 . ILE A 1 50  ? 23.697 13.570 49.257 1.00 39.28 ? 50  ILE A CG1 1 
ATOM   400  C CG2 . ILE A 1 50  ? 23.438 12.303 47.086 1.00 39.28 ? 50  ILE A CG2 1 
ATOM   401  C CD1 . ILE A 1 50  ? 22.226 13.500 49.551 1.00 39.07 ? 50  ILE A CD1 1 
ATOM   402  N N   . PRO A 1 51  ? 23.847 9.013  47.895 1.00 41.12 ? 51  PRO A N   1 
ATOM   403  C CA  . PRO A 1 51  ? 24.125 7.835  47.058 1.00 41.83 ? 51  PRO A CA  1 
ATOM   404  C C   . PRO A 1 51  ? 24.799 8.168  45.728 1.00 43.00 ? 51  PRO A C   1 
ATOM   405  O O   . PRO A 1 51  ? 24.209 8.831  44.873 1.00 43.07 ? 51  PRO A O   1 
ATOM   406  C CB  . PRO A 1 51  ? 22.738 7.223  46.851 1.00 41.95 ? 51  PRO A CB  1 
ATOM   407  C CG  . PRO A 1 51  ? 22.026 7.583  48.121 1.00 41.82 ? 51  PRO A CG  1 
ATOM   408  C CD  . PRO A 1 51  ? 22.433 9.026  48.310 1.00 41.38 ? 51  PRO A CD  1 
ATOM   409  N N   . GLN A 1 52  ? 26.032 7.702  45.559 1.00 44.15 ? 52  GLN A N   1 
ATOM   410  C CA  . GLN A 1 52  ? 26.791 7.945  44.334 1.00 44.71 ? 52  GLN A CA  1 
ATOM   411  C C   . GLN A 1 52  ? 25.937 8.042  43.081 1.00 43.99 ? 52  GLN A C   1 
ATOM   412  O O   . GLN A 1 52  ? 26.235 8.811  42.169 1.00 42.20 ? 52  GLN A O   1 
ATOM   413  C CB  . GLN A 1 52  ? 27.817 6.842  44.129 1.00 46.76 ? 52  GLN A CB  1 
ATOM   414  C CG  . GLN A 1 52  ? 29.089 7.076  44.870 1.00 48.98 ? 52  GLN A CG  1 
ATOM   415  C CD  . GLN A 1 52  ? 30.288 6.897  43.983 1.00 51.11 ? 52  GLN A CD  1 
ATOM   416  O OE1 . GLN A 1 52  ? 30.349 7.455  42.887 1.00 51.82 ? 52  GLN A OE1 1 
ATOM   417  N NE2 . GLN A 1 52  ? 31.255 6.121  44.447 1.00 52.18 ? 52  GLN A NE2 1 
ATOM   418  N N   . GLU A 1 53  ? 24.890 7.231  43.039 1.00 44.15 ? 53  GLU A N   1 
ATOM   419  C CA  . GLU A 1 53  ? 23.975 7.205  41.912 1.00 45.03 ? 53  GLU A CA  1 
ATOM   420  C C   . GLU A 1 53  ? 23.457 8.619  41.619 1.00 43.80 ? 53  GLU A C   1 
ATOM   421  O O   . GLU A 1 53  ? 23.520 9.099  40.480 1.00 43.27 ? 53  GLU A O   1 
ATOM   422  C CB  . GLU A 1 53  ? 22.799 6.276  42.233 1.00 47.72 ? 53  GLU A CB  1 
ATOM   423  C CG  . GLU A 1 53  ? 23.157 4.807  42.449 1.00 52.58 ? 53  GLU A CG  1 
ATOM   424  C CD  . GLU A 1 53  ? 24.156 4.577  43.578 1.00 55.00 ? 53  GLU A CD  1 
ATOM   425  O OE1 . GLU A 1 53  ? 23.912 5.048  44.710 1.00 54.84 ? 53  GLU A OE1 1 
ATOM   426  O OE2 . GLU A 1 53  ? 25.188 3.911  43.334 1.00 56.88 ? 53  GLU A OE2 1 
ATOM   427  N N   . LEU A 1 54  ? 22.947 9.279  42.656 1.00 41.91 ? 54  LEU A N   1 
ATOM   428  C CA  . LEU A 1 54  ? 22.399 10.625 42.528 1.00 40.10 ? 54  LEU A CA  1 
ATOM   429  C C   . LEU A 1 54  ? 23.483 11.662 42.261 1.00 38.51 ? 54  LEU A C   1 
ATOM   430  O O   . LEU A 1 54  ? 23.266 12.620 41.525 1.00 37.09 ? 54  LEU A O   1 
ATOM   431  C CB  . LEU A 1 54  ? 21.624 10.998 43.800 1.00 40.18 ? 54  LEU A CB  1 
ATOM   432  C CG  . LEU A 1 54  ? 20.441 10.094 44.181 1.00 40.66 ? 54  LEU A CG  1 
ATOM   433  C CD1 . LEU A 1 54  ? 19.768 10.627 45.446 1.00 40.41 ? 54  LEU A CD1 1 
ATOM   434  C CD2 . LEU A 1 54  ? 19.448 10.029 43.038 1.00 39.33 ? 54  LEU A CD2 1 
ATOM   435  N N   . VAL A 1 55  ? 24.653 11.451 42.852 1.00 37.56 ? 55  VAL A N   1 
ATOM   436  C CA  . VAL A 1 55  ? 25.771 12.372 42.704 1.00 36.82 ? 55  VAL A CA  1 
ATOM   437  C C   . VAL A 1 55  ? 26.316 12.474 41.270 1.00 37.34 ? 55  VAL A C   1 
ATOM   438  O O   . VAL A 1 55  ? 26.709 13.559 40.828 1.00 35.76 ? 55  VAL A O   1 
ATOM   439  C CB  . VAL A 1 55  ? 26.900 11.997 43.702 1.00 36.30 ? 55  VAL A CB  1 
ATOM   440  C CG1 . VAL A 1 55  ? 28.047 12.980 43.598 1.00 34.92 ? 55  VAL A CG1 1 
ATOM   441  C CG2 . VAL A 1 55  ? 26.344 12.000 45.123 1.00 34.49 ? 55  VAL A CG2 1 
ATOM   442  N N   . LYS A 1 56  ? 26.340 11.360 40.542 1.00 38.29 ? 56  LYS A N   1 
ATOM   443  C CA  . LYS A 1 56  ? 26.815 11.384 39.159 1.00 38.63 ? 56  LYS A CA  1 
ATOM   444  C C   . LYS A 1 56  ? 25.838 12.189 38.312 1.00 37.39 ? 56  LYS A C   1 
ATOM   445  O O   . LYS A 1 56  ? 26.210 12.727 37.274 1.00 36.28 ? 56  LYS A O   1 
ATOM   446  C CB  . LYS A 1 56  ? 26.894 9.975  38.582 1.00 40.93 ? 56  LYS A CB  1 
ATOM   447  C CG  . LYS A 1 56  ? 27.907 9.070  39.242 1.00 44.33 ? 56  LYS A CG  1 
ATOM   448  C CD  . LYS A 1 56  ? 27.703 7.629  38.780 1.00 44.99 ? 56  LYS A CD  1 
ATOM   449  C CE  . LYS A 1 56  ? 28.670 6.677  39.461 1.00 46.37 ? 56  LYS A CE  1 
ATOM   450  N NZ  . LYS A 1 56  ? 28.318 5.251  39.168 1.00 49.34 ? 56  LYS A NZ  1 
ATOM   451  N N   . LYS A 1 57  ? 24.588 12.251 38.767 1.00 36.63 ? 57  LYS A N   1 
ATOM   452  C CA  . LYS A 1 57  ? 23.520 12.969 38.073 1.00 36.17 ? 57  LYS A CA  1 
ATOM   453  C C   . LYS A 1 57  ? 23.403 14.416 38.575 1.00 35.61 ? 57  LYS A C   1 
ATOM   454  O O   . LYS A 1 57  ? 22.645 15.234 38.029 1.00 36.09 ? 57  LYS A O   1 
ATOM   455  C CB  . LYS A 1 57  ? 22.192 12.224 38.278 1.00 36.47 ? 57  LYS A CB  1 
ATOM   456  C CG  . LYS A 1 57  ? 22.295 10.726 38.008 1.00 35.12 ? 57  LYS A CG  1 
ATOM   457  C CD  . LYS A 1 57  ? 20.940 10.058 37.885 1.00 36.83 ? 57  LYS A CD  1 
ATOM   458  C CE  . LYS A 1 57  ? 20.169 10.115 39.189 1.00 38.71 ? 57  LYS A CE  1 
ATOM   459  N NZ  . LYS A 1 57  ? 18.874 9.387  39.098 1.00 41.30 ? 57  LYS A NZ  1 
ATOM   460  N N   . GLY A 1 58  ? 24.167 14.729 39.617 1.00 33.10 ? 58  GLY A N   1 
ATOM   461  C CA  . GLY A 1 58  ? 24.139 16.067 40.173 1.00 30.53 ? 58  GLY A CA  1 
ATOM   462  C C   . GLY A 1 58  ? 22.902 16.369 40.998 1.00 29.41 ? 58  GLY A C   1 
ATOM   463  O O   . GLY A 1 58  ? 22.425 17.497 41.000 1.00 29.84 ? 58  GLY A O   1 
ATOM   464  N N   . GLN A 1 59  ? 22.381 15.368 41.699 1.00 28.08 ? 59  GLN A N   1 
ATOM   465  C CA  . GLN A 1 59  ? 21.202 15.550 42.543 1.00 27.09 ? 59  GLN A CA  1 
ATOM   466  C C   . GLN A 1 59  ? 21.524 15.309 44.003 1.00 27.09 ? 59  GLN A C   1 
ATOM   467  O O   . GLN A 1 59  ? 21.827 14.180 44.390 1.00 27.16 ? 59  GLN A O   1 
ATOM   468  C CB  . GLN A 1 59  ? 20.106 14.573 42.169 1.00 27.82 ? 59  GLN A CB  1 
ATOM   469  C CG  . GLN A 1 59  ? 19.331 14.915 40.956 1.00 27.90 ? 59  GLN A CG  1 
ATOM   470  C CD  . GLN A 1 59  ? 18.562 13.726 40.485 1.00 28.49 ? 59  GLN A CD  1 
ATOM   471  O OE1 . GLN A 1 59  ? 17.771 13.154 41.227 1.00 29.04 ? 59  GLN A OE1 1 
ATOM   472  N NE2 . GLN A 1 59  ? 18.796 13.329 39.244 1.00 30.36 ? 59  GLN A NE2 1 
ATOM   473  N N   . PHE A 1 60  ? 21.428 16.359 44.813 1.00 26.17 ? 60  PHE A N   1 
ATOM   474  C CA  . PHE A 1 60  ? 21.700 16.261 46.243 1.00 23.51 ? 60  PHE A CA  1 
ATOM   475  C C   . PHE A 1 60  ? 20.419 16.629 46.984 1.00 23.07 ? 60  PHE A C   1 
ATOM   476  O O   . PHE A 1 60  ? 20.200 17.783 47.363 1.00 22.72 ? 60  PHE A O   1 
ATOM   477  C CB  . PHE A 1 60  ? 22.859 17.187 46.605 1.00 21.69 ? 60  PHE A CB  1 
ATOM   478  C CG  . PHE A 1 60  ? 24.068 16.993 45.727 1.00 20.59 ? 60  PHE A CG  1 
ATOM   479  C CD1 . PHE A 1 60  ? 24.098 17.520 44.440 1.00 19.46 ? 60  PHE A CD1 1 
ATOM   480  C CD2 . PHE A 1 60  ? 25.150 16.224 46.163 1.00 19.13 ? 60  PHE A CD2 1 
ATOM   481  C CE1 . PHE A 1 60  ? 25.189 17.279 43.595 1.00 20.40 ? 60  PHE A CE1 1 
ATOM   482  C CE2 . PHE A 1 60  ? 26.243 15.977 45.327 1.00 17.47 ? 60  PHE A CE2 1 
ATOM   483  C CZ  . PHE A 1 60  ? 26.263 16.504 44.042 1.00 18.09 ? 60  PHE A CZ  1 
ATOM   484  N N   . PRO A 1 61  ? 19.533 15.635 47.168 1.00 22.86 ? 61  PRO A N   1 
ATOM   485  C CA  . PRO A 1 61  ? 18.242 15.784 47.849 1.00 22.56 ? 61  PRO A CA  1 
ATOM   486  C C   . PRO A 1 61  ? 18.284 15.876 49.371 1.00 22.87 ? 61  PRO A C   1 
ATOM   487  O O   . PRO A 1 61  ? 19.098 15.223 50.035 1.00 23.34 ? 61  PRO A O   1 
ATOM   488  C CB  . PRO A 1 61  ? 17.470 14.558 47.379 1.00 22.41 ? 61  PRO A CB  1 
ATOM   489  C CG  . PRO A 1 61  ? 18.556 13.520 47.270 1.00 22.06 ? 61  PRO A CG  1 
ATOM   490  C CD  . PRO A 1 61  ? 19.674 14.282 46.596 1.00 21.77 ? 61  PRO A CD  1 
ATOM   491  N N   . ILE A 1 62  ? 17.391 16.696 49.912 1.00 22.33 ? 62  ILE A N   1 
ATOM   492  C CA  . ILE A 1 62  ? 17.271 16.880 51.349 1.00 23.20 ? 62  ILE A CA  1 
ATOM   493  C C   . ILE A 1 62  ? 15.797 16.664 51.660 1.00 25.23 ? 62  ILE A C   1 
ATOM   494  O O   . ILE A 1 62  ? 14.985 17.580 51.547 1.00 25.34 ? 62  ILE A O   1 
ATOM   495  C CB  . ILE A 1 62  ? 17.666 18.303 51.806 1.00 19.98 ? 62  ILE A CB  1 
ATOM   496  C CG1 . ILE A 1 62  ? 19.125 18.591 51.473 1.00 19.31 ? 62  ILE A CG1 1 
ATOM   497  C CG2 . ILE A 1 62  ? 17.489 18.430 53.296 1.00 19.65 ? 62  ILE A CG2 1 
ATOM   498  C CD1 . ILE A 1 62  ? 19.575 19.980 51.873 1.00 14.87 ? 62  ILE A CD1 1 
ATOM   499  N N   . PRO A 1 63  ? 15.432 15.437 52.051 1.00 26.70 ? 63  PRO A N   1 
ATOM   500  C CA  . PRO A 1 63  ? 14.056 15.053 52.386 1.00 26.20 ? 63  PRO A CA  1 
ATOM   501  C C   . PRO A 1 63  ? 13.384 15.958 53.412 1.00 25.65 ? 63  PRO A C   1 
ATOM   502  O O   . PRO A 1 63  ? 12.221 16.326 53.266 1.00 25.87 ? 63  PRO A O   1 
ATOM   503  C CB  . PRO A 1 63  ? 14.215 13.634 52.922 1.00 26.95 ? 63  PRO A CB  1 
ATOM   504  C CG  . PRO A 1 63  ? 15.418 13.123 52.190 1.00 27.60 ? 63  PRO A CG  1 
ATOM   505  C CD  . PRO A 1 63  ? 16.356 14.303 52.236 1.00 26.41 ? 63  PRO A CD  1 
ATOM   506  N N   . SER A 1 64  ? 14.118 16.307 54.459 1.00 25.99 ? 64  SER A N   1 
ATOM   507  C CA  . SER A 1 64  ? 13.573 17.140 55.522 1.00 25.37 ? 64  SER A CA  1 
ATOM   508  C C   . SER A 1 64  ? 14.650 18.080 56.033 1.00 25.86 ? 64  SER A C   1 
ATOM   509  O O   . SER A 1 64  ? 15.443 17.707 56.891 1.00 27.59 ? 64  SER A O   1 
ATOM   510  C CB  . SER A 1 64  ? 13.093 16.253 56.656 1.00 22.08 ? 64  SER A CB  1 
ATOM   511  O OG  . SER A 1 64  ? 12.648 17.044 57.728 1.00 21.69 ? 64  SER A OG  1 
ATOM   512  N N   . ILE A 1 65  ? 14.671 19.300 55.514 1.00 25.63 ? 65  ILE A N   1 
ATOM   513  C CA  . ILE A 1 65  ? 15.691 20.270 55.897 1.00 25.20 ? 65  ILE A CA  1 
ATOM   514  C C   . ILE A 1 65  ? 15.640 20.711 57.357 1.00 24.90 ? 65  ILE A C   1 
ATOM   515  O O   . ILE A 1 65  ? 14.572 20.816 57.949 1.00 24.42 ? 65  ILE A O   1 
ATOM   516  C CB  . ILE A 1 65  ? 15.634 21.524 54.980 1.00 23.42 ? 65  ILE A CB  1 
ATOM   517  C CG1 . ILE A 1 65  ? 16.948 22.289 55.067 1.00 23.58 ? 65  ILE A CG1 1 
ATOM   518  C CG2 . ILE A 1 65  ? 14.518 22.448 55.416 1.00 22.06 ? 65  ILE A CG2 1 
ATOM   519  C CD1 . ILE A 1 65  ? 17.165 23.257 53.927 1.00 25.16 ? 65  ILE A CD1 1 
ATOM   520  N N   . THR A 1 66  ? 16.820 20.981 57.908 1.00 26.21 ? 66  THR A N   1 
ATOM   521  C CA  . THR A 1 66  ? 17.002 21.419 59.294 1.00 27.12 ? 66  THR A CA  1 
ATOM   522  C C   . THR A 1 66  ? 17.957 22.602 59.333 1.00 26.46 ? 66  THR A C   1 
ATOM   523  O O   . THR A 1 66  ? 18.740 22.812 58.406 1.00 25.90 ? 66  THR A O   1 
ATOM   524  C CB  . THR A 1 66  ? 17.646 20.319 60.145 1.00 28.48 ? 66  THR A CB  1 
ATOM   525  O OG1 . THR A 1 66  ? 18.995 20.100 59.700 1.00 26.95 ? 66  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 66  ? 16.855 19.021 60.024 1.00 30.43 ? 66  THR A CG2 1 
ATOM   527  N N   . TRP A 1 67  ? 17.914 23.352 60.424 1.00 26.31 ? 67  TRP A N   1 
ATOM   528  C CA  . TRP A 1 67  ? 18.779 24.513 60.569 1.00 26.01 ? 67  TRP A CA  1 
ATOM   529  C C   . TRP A 1 67  ? 20.227 24.143 60.237 1.00 27.05 ? 67  TRP A C   1 
ATOM   530  O O   . TRP A 1 67  ? 20.987 24.973 59.732 1.00 28.11 ? 67  TRP A O   1 
ATOM   531  C CB  . TRP A 1 67  ? 18.713 25.050 62.003 1.00 26.13 ? 67  TRP A CB  1 
ATOM   532  C CG  . TRP A 1 67  ? 17.320 25.110 62.602 1.00 24.83 ? 67  TRP A CG  1 
ATOM   533  C CD1 . TRP A 1 67  ? 16.876 24.455 63.720 1.00 24.21 ? 67  TRP A CD1 1 
ATOM   534  C CD2 . TRP A 1 67  ? 16.215 25.886 62.130 1.00 23.31 ? 67  TRP A CD2 1 
ATOM   535  N NE1 . TRP A 1 67  ? 15.568 24.782 63.974 1.00 23.83 ? 67  TRP A NE1 1 
ATOM   536  C CE2 . TRP A 1 67  ? 15.134 25.657 63.012 1.00 23.05 ? 67  TRP A CE2 1 
ATOM   537  C CE3 . TRP A 1 67  ? 16.032 26.753 61.044 1.00 23.39 ? 67  TRP A CE3 1 
ATOM   538  C CZ2 . TRP A 1 67  ? 13.886 26.265 62.842 1.00 22.47 ? 67  TRP A CZ2 1 
ATOM   539  C CZ3 . TRP A 1 67  ? 14.793 27.356 60.874 1.00 22.72 ? 67  TRP A CZ3 1 
ATOM   540  C CH2 . TRP A 1 67  ? 13.736 27.109 61.769 1.00 23.44 ? 67  TRP A CH2 1 
ATOM   541  N N   . GLU A 1 68  ? 20.602 22.892 60.509 1.00 26.63 ? 68  GLU A N   1 
ATOM   542  C CA  . GLU A 1 68  ? 21.971 22.441 60.258 1.00 25.98 ? 68  GLU A CA  1 
ATOM   543  C C   . GLU A 1 68  ? 22.329 22.385 58.763 1.00 24.57 ? 68  GLU A C   1 
ATOM   544  O O   . GLU A 1 68  ? 23.506 22.440 58.391 1.00 23.21 ? 68  GLU A O   1 
ATOM   545  C CB  . GLU A 1 68  ? 22.203 21.080 60.923 1.00 28.77 ? 68  GLU A CB  1 
ATOM   546  C CG  . GLU A 1 68  ? 23.543 20.954 61.679 1.00 32.31 ? 68  GLU A CG  1 
ATOM   547  C CD  . GLU A 1 68  ? 24.799 20.987 60.786 1.00 34.99 ? 68  GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 68  ? 25.636 21.910 60.974 1.00 35.95 ? 68  GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 68  ? 24.958 20.087 59.919 1.00 34.39 ? 68  GLU A OE2 1 
ATOM   550  N N   . HIS A 1 69  ? 21.306 22.291 57.914 1.00 23.92 ? 69  HIS A N   1 
ATOM   551  C CA  . HIS A 1 69  ? 21.494 22.257 56.466 1.00 23.46 ? 69  HIS A CA  1 
ATOM   552  C C   . HIS A 1 69  ? 21.836 23.646 55.879 1.00 23.74 ? 69  HIS A C   1 
ATOM   553  O O   . HIS A 1 69  ? 22.543 23.723 54.875 1.00 24.13 ? 69  HIS A O   1 
ATOM   554  C CB  . HIS A 1 69  ? 20.242 21.745 55.741 1.00 23.56 ? 69  HIS A CB  1 
ATOM   555  C CG  . HIS A 1 69  ? 19.972 20.277 55.910 1.00 24.49 ? 69  HIS A CG  1 
ATOM   556  N ND1 . HIS A 1 69  ? 20.616 19.305 55.169 1.00 22.81 ? 69  HIS A ND1 1 
ATOM   557  C CD2 . HIS A 1 69  ? 19.098 19.616 56.708 1.00 22.81 ? 69  HIS A CD2 1 
ATOM   558  C CE1 . HIS A 1 69  ? 20.151 18.115 55.503 1.00 21.50 ? 69  HIS A CE1 1 
ATOM   559  N NE2 . HIS A 1 69  ? 19.229 18.276 56.436 1.00 22.34 ? 69  HIS A NE2 1 
ATOM   560  N N   . ALA A 1 70  ? 21.379 24.745 56.482 1.00 22.86 ? 70  ALA A N   1 
ATOM   561  C CA  . ALA A 1 70  ? 21.606 26.085 55.947 1.00 24.05 ? 70  ALA A CA  1 
ATOM   562  C C   . ALA A 1 70  ? 23.076 26.373 55.620 1.00 23.80 ? 70  ALA A C   1 
ATOM   563  O O   . ALA A 1 70  ? 23.965 25.805 56.246 1.00 24.80 ? 70  ALA A O   1 
ATOM   564  C CB  . ALA A 1 70  ? 21.055 27.135 56.934 1.00 25.71 ? 70  ALA A CB  1 
ATOM   565  N N   . GLY A 1 71  ? 23.332 27.301 54.692 1.00 21.65 ? 71  GLY A N   1 
ATOM   566  C CA  . GLY A 1 71  ? 24.719 27.605 54.352 1.00 22.05 ? 71  GLY A CA  1 
ATOM   567  C C   . GLY A 1 71  ? 24.931 28.006 52.904 1.00 23.96 ? 71  GLY A C   1 
ATOM   568  O O   . GLY A 1 71  ? 24.037 27.921 52.054 1.00 25.61 ? 71  GLY A O   1 
ATOM   569  N N   . ARG A 1 72  ? 26.146 28.451 52.619 1.00 24.27 ? 72  ARG A N   1 
ATOM   570  C CA  . ARG A 1 72  ? 26.530 28.884 51.287 1.00 24.08 ? 72  ARG A CA  1 
ATOM   571  C C   . ARG A 1 72  ? 27.204 27.691 50.645 1.00 24.26 ? 72  ARG A C   1 
ATOM   572  O O   . ARG A 1 72  ? 28.185 27.175 51.167 1.00 23.78 ? 72  ARG A O   1 
ATOM   573  C CB  . ARG A 1 72  ? 27.511 30.048 51.406 1.00 25.38 ? 72  ARG A CB  1 
ATOM   574  C CG  . ARG A 1 72  ? 27.588 30.971 50.204 1.00 25.08 ? 72  ARG A CG  1 
ATOM   575  C CD  . ARG A 1 72  ? 28.196 32.315 50.628 1.00 28.53 ? 72  ARG A CD  1 
ATOM   576  N NE  . ARG A 1 72  ? 28.056 33.355 49.611 1.00 30.14 ? 72  ARG A NE  1 
ATOM   577  C CZ  . ARG A 1 72  ? 28.908 33.545 48.611 1.00 29.95 ? 72  ARG A CZ  1 
ATOM   578  N NH1 . ARG A 1 72  ? 29.974 32.773 48.491 1.00 31.74 ? 72  ARG A NH1 1 
ATOM   579  N NH2 . ARG A 1 72  ? 28.686 34.498 47.719 1.00 33.73 ? 72  ARG A NH2 1 
ATOM   580  N N   . TYR A 1 73  ? 26.668 27.243 49.518 1.00 25.03 ? 73  TYR A N   1 
ATOM   581  C CA  . TYR A 1 73  ? 27.224 26.095 48.830 1.00 23.79 ? 73  TYR A CA  1 
ATOM   582  C C   . TYR A 1 73  ? 27.757 26.429 47.444 1.00 26.71 ? 73  TYR A C   1 
ATOM   583  O O   . TYR A 1 73  ? 27.396 27.437 46.819 1.00 25.91 ? 73  TYR A O   1 
ATOM   584  C CB  . TYR A 1 73  ? 26.175 24.988 48.669 1.00 21.21 ? 73  TYR A CB  1 
ATOM   585  C CG  . TYR A 1 73  ? 25.660 24.346 49.947 1.00 19.68 ? 73  TYR A CG  1 
ATOM   586  C CD1 . TYR A 1 73  ? 24.755 25.013 50.783 1.00 18.49 ? 73  TYR A CD1 1 
ATOM   587  C CD2 . TYR A 1 73  ? 26.071 23.057 50.312 1.00 17.95 ? 73  TYR A CD2 1 
ATOM   588  C CE1 . TYR A 1 73  ? 24.276 24.411 51.949 1.00 18.58 ? 73  TYR A CE1 1 
ATOM   589  C CE2 . TYR A 1 73  ? 25.606 22.448 51.471 1.00 16.06 ? 73  TYR A CE2 1 
ATOM   590  C CZ  . TYR A 1 73  ? 24.716 23.124 52.287 1.00 17.69 ? 73  TYR A CZ  1 
ATOM   591  O OH  . TYR A 1 73  ? 24.304 22.527 53.455 1.00 13.34 ? 73  TYR A OH  1 
ATOM   592  N N   . ARG A 1 74  ? 28.618 25.540 46.973 1.00 29.14 ? 74  ARG A N   1 
ATOM   593  C CA  . ARG A 1 74  ? 29.225 25.625 45.656 1.00 31.16 ? 74  ARG A CA  1 
ATOM   594  C C   . ARG A 1 74  ? 29.496 24.183 45.259 1.00 31.91 ? 74  ARG A C   1 
ATOM   595  O O   . ARG A 1 74  ? 29.670 23.315 46.123 1.00 31.47 ? 74  ARG A O   1 
ATOM   596  C CB  . ARG A 1 74  ? 30.549 26.405 45.686 1.00 31.53 ? 74  ARG A CB  1 
ATOM   597  C CG  . ARG A 1 74  ? 30.423 27.913 45.823 1.00 33.90 ? 74  ARG A CG  1 
ATOM   598  C CD  . ARG A 1 74  ? 31.749 28.581 45.462 1.00 37.51 ? 74  ARG A CD  1 
ATOM   599  N NE  . ARG A 1 74  ? 31.802 29.988 45.858 1.00 41.09 ? 74  ARG A NE  1 
ATOM   600  C CZ  . ARG A 1 74  ? 31.661 31.020 45.030 1.00 42.87 ? 74  ARG A CZ  1 
ATOM   601  N NH1 . ARG A 1 74  ? 31.459 30.826 43.730 1.00 44.29 ? 74  ARG A NH1 1 
ATOM   602  N NH2 . ARG A 1 74  ? 31.713 32.256 45.510 1.00 44.38 ? 74  ARG A NH2 1 
ATOM   603  N N   . CYS A 1 75  ? 29.504 23.915 43.960 1.00 32.83 ? 75  CYS A N   1 
ATOM   604  C CA  . CYS A 1 75  ? 29.775 22.569 43.485 1.00 33.24 ? 75  CYS A CA  1 
ATOM   605  C C   . CYS A 1 75  ? 30.666 22.666 42.277 1.00 32.92 ? 75  CYS A C   1 
ATOM   606  O O   . CYS A 1 75  ? 30.814 23.727 41.680 1.00 34.29 ? 75  CYS A O   1 
ATOM   607  C CB  . CYS A 1 75  ? 28.485 21.852 43.102 1.00 34.37 ? 75  CYS A CB  1 
ATOM   608  S SG  . CYS A 1 75  ? 27.703 22.473 41.587 1.00 38.54 ? 75  CYS A SG  1 
ATOM   609  N N   . TYR A 1 76  ? 31.269 21.550 41.920 1.00 33.05 ? 76  TYR A N   1 
ATOM   610  C CA  . TYR A 1 76  ? 32.141 21.507 40.765 1.00 33.07 ? 76  TYR A CA  1 
ATOM   611  C C   . TYR A 1 76  ? 32.194 20.050 40.344 1.00 32.31 ? 76  TYR A C   1 
ATOM   612  O O   . TYR A 1 76  ? 31.636 19.191 41.023 1.00 32.34 ? 76  TYR A O   1 
ATOM   613  C CB  . TYR A 1 76  ? 33.538 22.037 41.129 1.00 34.38 ? 76  TYR A CB  1 
ATOM   614  C CG  . TYR A 1 76  ? 34.299 21.206 42.154 1.00 35.54 ? 76  TYR A CG  1 
ATOM   615  C CD1 . TYR A 1 76  ? 35.032 20.084 41.766 1.00 36.24 ? 76  TYR A CD1 1 
ATOM   616  C CD2 . TYR A 1 76  ? 34.297 21.548 43.508 1.00 35.50 ? 76  TYR A CD2 1 
ATOM   617  C CE1 . TYR A 1 76  ? 35.749 19.323 42.691 1.00 34.75 ? 76  TYR A CE1 1 
ATOM   618  C CE2 . TYR A 1 76  ? 35.016 20.783 44.447 1.00 35.83 ? 76  TYR A CE2 1 
ATOM   619  C CZ  . TYR A 1 76  ? 35.742 19.671 44.027 1.00 34.99 ? 76  TYR A CZ  1 
ATOM   620  O OH  . TYR A 1 76  ? 36.468 18.915 44.927 1.00 32.69 ? 76  TYR A OH  1 
ATOM   621  N N   . TYR A 1 77  ? 32.848 19.768 39.228 1.00 32.03 ? 77  TYR A N   1 
ATOM   622  C CA  . TYR A 1 77  ? 32.935 18.405 38.757 1.00 31.41 ? 77  TYR A CA  1 
ATOM   623  C C   . TYR A 1 77  ? 34.347 18.060 38.330 1.00 31.96 ? 77  TYR A C   1 
ATOM   624  O O   . TYR A 1 77  ? 34.984 18.835 37.628 1.00 32.82 ? 77  TYR A O   1 
ATOM   625  C CB  . TYR A 1 77  ? 31.946 18.196 37.605 1.00 30.81 ? 77  TYR A CB  1 
ATOM   626  C CG  . TYR A 1 77  ? 32.165 19.068 36.379 1.00 32.16 ? 77  TYR A CG  1 
ATOM   627  C CD1 . TYR A 1 77  ? 33.077 18.696 35.386 1.00 32.26 ? 77  TYR A CD1 1 
ATOM   628  C CD2 . TYR A 1 77  ? 31.452 20.261 36.201 1.00 32.97 ? 77  TYR A CD2 1 
ATOM   629  C CE1 . TYR A 1 77  ? 33.278 19.488 34.243 1.00 32.50 ? 77  TYR A CE1 1 
ATOM   630  C CE2 . TYR A 1 77  ? 31.645 21.064 35.058 1.00 32.96 ? 77  TYR A CE2 1 
ATOM   631  C CZ  . TYR A 1 77  ? 32.564 20.666 34.087 1.00 32.70 ? 77  TYR A CZ  1 
ATOM   632  O OH  . TYR A 1 77  ? 32.787 21.437 32.972 1.00 31.51 ? 77  TYR A OH  1 
ATOM   633  N N   . GLY A 1 78  ? 34.840 16.907 38.778 1.00 33.51 ? 78  GLY A N   1 
ATOM   634  C CA  . GLY A 1 78  ? 36.181 16.458 38.413 1.00 34.47 ? 78  GLY A CA  1 
ATOM   635  C C   . GLY A 1 78  ? 37.210 16.342 39.537 1.00 34.79 ? 78  GLY A C   1 
ATOM   636  O O   . GLY A 1 78  ? 36.880 16.257 40.725 1.00 34.93 ? 78  GLY A O   1 
ATOM   637  N N   . GLY A 1 83  ? 41.666 16.577 36.443 1.00 46.61 ? 83  GLY A N   1 
ATOM   638  C CA  . GLY A 1 83  ? 41.209 17.912 36.094 1.00 46.75 ? 83  GLY A CA  1 
ATOM   639  C C   . GLY A 1 83  ? 39.805 18.182 36.592 1.00 46.95 ? 83  GLY A C   1 
ATOM   640  O O   . GLY A 1 83  ? 38.959 17.292 36.568 1.00 46.61 ? 83  GLY A O   1 
ATOM   641  N N   . ARG A 1 84  ? 39.551 19.407 37.040 1.00 47.24 ? 84  ARG A N   1 
ATOM   642  C CA  . ARG A 1 84  ? 38.234 19.775 37.551 1.00 47.66 ? 84  ARG A CA  1 
ATOM   643  C C   . ARG A 1 84  ? 37.785 21.124 37.012 1.00 48.80 ? 84  ARG A C   1 
ATOM   644  O O   . ARG A 1 84  ? 38.549 21.821 36.356 1.00 49.89 ? 84  ARG A O   1 
ATOM   645  C CB  . ARG A 1 84  ? 38.261 19.844 39.072 1.00 46.61 ? 84  ARG A CB  1 
ATOM   646  C CG  . ARG A 1 84  ? 39.295 20.805 39.605 1.00 45.31 ? 84  ARG A CG  1 
ATOM   647  C CD  . ARG A 1 84  ? 38.933 21.268 40.995 1.00 46.21 ? 84  ARG A CD  1 
ATOM   648  N NE  . ARG A 1 84  ? 37.882 22.276 40.975 1.00 46.69 ? 84  ARG A NE  1 
ATOM   649  C CZ  . ARG A 1 84  ? 37.436 22.898 42.060 1.00 48.46 ? 84  ARG A CZ  1 
ATOM   650  N NH1 . ARG A 1 84  ? 37.952 22.605 43.248 1.00 49.56 ? 84  ARG A NH1 1 
ATOM   651  N NH2 . ARG A 1 84  ? 36.487 23.822 41.963 1.00 48.82 ? 84  ARG A NH2 1 
ATOM   652  N N   . SER A 1 85  ? 36.543 21.500 37.291 1.00 49.38 ? 85  SER A N   1 
ATOM   653  C CA  . SER A 1 85  ? 36.047 22.786 36.825 1.00 50.38 ? 85  SER A CA  1 
ATOM   654  C C   . SER A 1 85  ? 36.069 23.767 37.990 1.00 52.05 ? 85  SER A C   1 
ATOM   655  O O   . SER A 1 85  ? 36.258 23.371 39.145 1.00 52.67 ? 85  SER A O   1 
ATOM   656  C CB  . SER A 1 85  ? 34.618 22.645 36.302 1.00 49.28 ? 85  SER A CB  1 
ATOM   657  O OG  . SER A 1 85  ? 33.731 22.324 37.357 1.00 47.38 ? 85  SER A OG  1 
ATOM   658  N N   . GLU A 1 86  ? 35.893 25.050 37.688 1.00 53.35 ? 86  GLU A N   1 
ATOM   659  C CA  . GLU A 1 86  ? 35.863 26.053 38.741 1.00 53.41 ? 86  GLU A CA  1 
ATOM   660  C C   . GLU A 1 86  ? 34.593 25.739 39.507 1.00 51.66 ? 86  GLU A C   1 
ATOM   661  O O   . GLU A 1 86  ? 33.707 25.037 39.009 1.00 51.26 ? 86  GLU A O   1 
ATOM   662  C CB  . GLU A 1 86  ? 35.719 27.463 38.175 1.00 55.92 ? 86  GLU A CB  1 
ATOM   663  C CG  . GLU A 1 86  ? 36.580 27.799 36.990 1.00 59.44 ? 86  GLU A CG  1 
ATOM   664  C CD  . GLU A 1 86  ? 36.039 29.013 36.264 1.00 61.82 ? 86  GLU A CD  1 
ATOM   665  O OE1 . GLU A 1 86  ? 35.904 30.081 36.904 1.00 62.35 ? 86  GLU A OE1 1 
ATOM   666  O OE2 . GLU A 1 86  ? 35.731 28.906 35.056 1.00 63.48 ? 86  GLU A OE2 1 
ATOM   667  N N   . SER A 1 87  ? 34.496 26.261 40.718 1.00 49.76 ? 87  SER A N   1 
ATOM   668  C CA  . SER A 1 87  ? 33.304 26.028 41.494 1.00 47.80 ? 87  SER A CA  1 
ATOM   669  C C   . SER A 1 87  ? 32.218 26.899 40.904 1.00 46.32 ? 87  SER A C   1 
ATOM   670  O O   . SER A 1 87  ? 32.482 27.989 40.395 1.00 46.24 ? 87  SER A O   1 
ATOM   671  C CB  . SER A 1 87  ? 33.529 26.382 42.968 1.00 48.08 ? 87  SER A CB  1 
ATOM   672  O OG  . SER A 1 87  ? 34.141 25.305 43.664 1.00 48.44 ? 87  SER A OG  1 
ATOM   673  N N   . SER A 1 88  ? 30.997 26.387 40.949 1.00 44.51 ? 88  SER A N   1 
ATOM   674  C CA  . SER A 1 88  ? 29.833 27.097 40.454 1.00 42.03 ? 88  SER A CA  1 
ATOM   675  C C   . SER A 1 88  ? 29.632 28.325 41.328 1.00 40.16 ? 88  SER A C   1 
ATOM   676  O O   . SER A 1 88  ? 30.218 28.428 42.408 1.00 38.64 ? 88  SER A O   1 
ATOM   677  C CB  . SER A 1 88  ? 28.612 26.203 40.593 1.00 42.42 ? 88  SER A CB  1 
ATOM   678  O OG  . SER A 1 88  ? 28.421 25.884 41.963 1.00 39.92 ? 88  SER A OG  1 
ATOM   679  N N   . ASP A 1 89  ? 28.801 29.253 40.868 1.00 38.39 ? 89  ASP A N   1 
ATOM   680  C CA  . ASP A 1 89  ? 28.519 30.436 41.663 1.00 37.98 ? 89  ASP A CA  1 
ATOM   681  C C   . ASP A 1 89  ? 27.878 29.938 42.961 1.00 35.92 ? 89  ASP A C   1 
ATOM   682  O O   . ASP A 1 89  ? 27.322 28.841 42.996 1.00 36.39 ? 89  ASP A O   1 
ATOM   683  C CB  . ASP A 1 89  ? 27.602 31.377 40.882 1.00 39.84 ? 89  ASP A CB  1 
ATOM   684  C CG  . ASP A 1 89  ? 28.217 31.801 39.552 1.00 41.83 ? 89  ASP A CG  1 
ATOM   685  O OD1 . ASP A 1 89  ? 29.437 32.080 39.539 1.00 41.86 ? 89  ASP A OD1 1 
ATOM   686  O OD2 . ASP A 1 89  ? 27.496 31.853 38.526 1.00 43.63 ? 89  ASP A OD2 1 
ATOM   687  N N   . PRO A 1 90  ? 27.949 30.728 44.045 1.00 34.72 ? 90  PRO A N   1 
ATOM   688  C CA  . PRO A 1 90  ? 27.354 30.257 45.302 1.00 32.36 ? 90  PRO A CA  1 
ATOM   689  C C   . PRO A 1 90  ? 25.838 30.197 45.358 1.00 31.19 ? 90  PRO A C   1 
ATOM   690  O O   . PRO A 1 90  ? 25.148 31.034 44.779 1.00 31.31 ? 90  PRO A O   1 
ATOM   691  C CB  . PRO A 1 90  ? 27.908 31.237 46.329 1.00 32.25 ? 90  PRO A CB  1 
ATOM   692  C CG  . PRO A 1 90  ? 27.921 32.534 45.553 1.00 33.80 ? 90  PRO A CG  1 
ATOM   693  C CD  . PRO A 1 90  ? 28.456 32.112 44.185 1.00 34.83 ? 90  PRO A CD  1 
ATOM   694  N N   . LEU A 1 91  ? 25.326 29.185 46.047 1.00 29.08 ? 91  LEU A N   1 
ATOM   695  C CA  . LEU A 1 91  ? 23.893 29.061 46.242 1.00 26.71 ? 91  LEU A CA  1 
ATOM   696  C C   . LEU A 1 91  ? 23.716 29.111 47.752 1.00 26.64 ? 91  LEU A C   1 
ATOM   697  O O   . LEU A 1 91  ? 24.275 28.281 48.485 1.00 25.83 ? 91  LEU A O   1 
ATOM   698  C CB  . LEU A 1 91  ? 23.341 27.740 45.703 1.00 25.76 ? 91  LEU A CB  1 
ATOM   699  C CG  . LEU A 1 91  ? 21.810 27.640 45.831 1.00 25.44 ? 91  LEU A CG  1 
ATOM   700  C CD1 . LEU A 1 91  ? 21.257 26.584 44.907 1.00 25.52 ? 91  LEU A CD1 1 
ATOM   701  C CD2 . LEU A 1 91  ? 21.426 27.318 47.253 1.00 25.50 ? 91  LEU A CD2 1 
ATOM   702  N N   . GLU A 1 92  ? 22.964 30.101 48.219 1.00 24.16 ? 92  GLU A N   1 
ATOM   703  C CA  . GLU A 1 92  ? 22.727 30.232 49.640 1.00 22.51 ? 92  GLU A CA  1 
ATOM   704  C C   . GLU A 1 92  ? 21.428 29.524 49.989 1.00 21.61 ? 92  GLU A C   1 
ATOM   705  O O   . GLU A 1 92  ? 20.351 29.873 49.508 1.00 21.52 ? 92  GLU A O   1 
ATOM   706  C CB  . GLU A 1 92  ? 22.708 31.711 50.030 1.00 21.49 ? 92  GLU A CB  1 
ATOM   707  C CG  . GLU A 1 92  ? 24.020 32.402 49.652 1.00 19.21 ? 92  GLU A CG  1 
ATOM   708  C CD  . GLU A 1 92  ? 24.146 33.816 50.184 1.00 20.47 ? 92  GLU A CD  1 
ATOM   709  O OE1 . GLU A 1 92  ? 23.094 34.483 50.376 1.00 20.60 ? 92  GLU A OE1 1 
ATOM   710  O OE2 . GLU A 1 92  ? 25.307 34.255 50.384 1.00 18.46 ? 92  GLU A OE2 1 
ATOM   711  N N   . LEU A 1 93  ? 21.557 28.496 50.814 1.00 20.63 ? 93  LEU A N   1 
ATOM   712  C CA  . LEU A 1 93  ? 20.420 27.699 51.232 1.00 20.80 ? 93  LEU A CA  1 
ATOM   713  C C   . LEU A 1 93  ? 19.877 28.261 52.529 1.00 20.25 ? 93  LEU A C   1 
ATOM   714  O O   . LEU A 1 93  ? 20.587 28.359 53.526 1.00 20.98 ? 93  LEU A O   1 
ATOM   715  C CB  . LEU A 1 93  ? 20.849 26.243 51.411 1.00 22.52 ? 93  LEU A CB  1 
ATOM   716  C CG  . LEU A 1 93  ? 19.727 25.233 51.640 1.00 23.05 ? 93  LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 93  ? 18.695 25.334 50.523 1.00 22.00 ? 93  LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 93  ? 20.332 23.834 51.713 1.00 24.80 ? 93  LEU A CD2 1 
ATOM   719  N N   . VAL A 1 94  ? 18.604 28.617 52.502 1.00 17.62 ? 94  VAL A N   1 
ATOM   720  C CA  . VAL A 1 94  ? 17.957 29.216 53.647 1.00 17.25 ? 94  VAL A CA  1 
ATOM   721  C C   . VAL A 1 94  ? 16.796 28.396 54.203 1.00 16.41 ? 94  VAL A C   1 
ATOM   722  O O   . VAL A 1 94  ? 16.006 27.798 53.462 1.00 15.05 ? 94  VAL A O   1 
ATOM   723  C CB  . VAL A 1 94  ? 17.470 30.638 53.258 1.00 19.47 ? 94  VAL A CB  1 
ATOM   724  C CG1 . VAL A 1 94  ? 16.713 31.292 54.398 1.00 21.72 ? 94  VAL A CG1 1 
ATOM   725  C CG2 . VAL A 1 94  ? 18.674 31.500 52.857 1.00 19.41 ? 94  VAL A CG2 1 
ATOM   726  N N   . VAL A 1 95  ? 16.707 28.368 55.526 1.00 15.96 ? 95  VAL A N   1 
ATOM   727  C CA  . VAL A 1 95  ? 15.636 27.656 56.204 1.00 17.13 ? 95  VAL A CA  1 
ATOM   728  C C   . VAL A 1 95  ? 14.862 28.706 56.980 1.00 17.11 ? 95  VAL A C   1 
ATOM   729  O O   . VAL A 1 95  ? 15.462 29.572 57.618 1.00 16.85 ? 95  VAL A O   1 
ATOM   730  C CB  . VAL A 1 95  ? 16.185 26.595 57.192 1.00 17.46 ? 95  VAL A CB  1 
ATOM   731  C CG1 . VAL A 1 95  ? 15.029 25.822 57.842 1.00 16.66 ? 95  VAL A CG1 1 
ATOM   732  C CG2 . VAL A 1 95  ? 17.125 25.649 56.465 1.00 17.42 ? 95  VAL A CG2 1 
ATOM   733  N N   . THR A 1 96  ? 13.538 28.638 56.938 1.00 17.58 ? 96  THR A N   1 
ATOM   734  C CA  . THR A 1 96  ? 12.742 29.626 57.650 1.00 19.68 ? 96  THR A CA  1 
ATOM   735  C C   . THR A 1 96  ? 11.939 29.004 58.780 1.00 21.88 ? 96  THR A C   1 
ATOM   736  O O   . THR A 1 96  ? 11.667 27.794 58.767 1.00 24.55 ? 96  THR A O   1 
ATOM   737  C CB  . THR A 1 96  ? 11.769 30.351 56.703 1.00 18.85 ? 96  THR A CB  1 
ATOM   738  O OG1 . THR A 1 96  ? 10.688 29.470 56.363 1.00 17.52 ? 96  THR A OG1 1 
ATOM   739  C CG2 . THR A 1 96  ? 12.502 30.808 55.437 1.00 16.83 ? 96  THR A CG2 1 
ATOM   740  N N   . GLY A 1 97  ? 11.594 29.839 59.765 1.00 20.96 ? 97  GLY A N   1 
ATOM   741  C CA  . GLY A 1 97  ? 10.804 29.395 60.901 1.00 19.43 ? 97  GLY A CA  1 
ATOM   742  C C   . GLY A 1 97  ? 11.481 29.387 62.261 1.00 19.06 ? 97  GLY A C   1 
ATOM   743  O O   . GLY A 1 97  ? 10.936 28.835 63.217 1.00 18.91 ? 97  GLY A O   1 
ATOM   744  N N   . ALA A 1 98  ? 12.639 30.033 62.362 1.00 18.31 ? 98  ALA A N   1 
ATOM   745  C CA  . ALA A 1 98  ? 13.407 30.060 63.597 1.00 17.83 ? 98  ALA A CA  1 
ATOM   746  C C   . ALA A 1 98  ? 12.988 31.092 64.639 1.00 18.91 ? 98  ALA A C   1 
ATOM   747  O O   . ALA A 1 98  ? 13.126 30.855 65.841 1.00 19.49 ? 98  ALA A O   1 
ATOM   748  C CB  . ALA A 1 98  ? 14.867 30.246 63.268 1.00 16.72 ? 98  ALA A CB  1 
ATOM   749  N N   . TYR A 1 99  ? 12.486 32.239 64.195 1.00 18.27 ? 99  TYR A N   1 
ATOM   750  C CA  . TYR A 1 99  ? 12.087 33.281 65.137 1.00 15.16 ? 99  TYR A CA  1 
ATOM   751  C C   . TYR A 1 99  ? 10.659 33.707 64.881 1.00 15.61 ? 99  TYR A C   1 
ATOM   752  O O   . TYR A 1 99  ? 10.098 33.371 63.845 1.00 17.29 ? 99  TYR A O   1 
ATOM   753  C CB  . TYR A 1 99  ? 12.985 34.497 64.977 1.00 12.52 ? 99  TYR A CB  1 
ATOM   754  C CG  . TYR A 1 99  ? 14.424 34.154 64.741 1.00 9.91  ? 99  TYR A CG  1 
ATOM   755  C CD1 . TYR A 1 99  ? 15.017 34.422 63.517 1.00 9.99  ? 99  TYR A CD1 1 
ATOM   756  C CD2 . TYR A 1 99  ? 15.200 33.581 65.746 1.00 8.30  ? 99  TYR A CD2 1 
ATOM   757  C CE1 . TYR A 1 99  ? 16.339 34.139 63.293 1.00 9.65  ? 99  TYR A CE1 1 
ATOM   758  C CE2 . TYR A 1 99  ? 16.520 33.297 65.544 1.00 6.85  ? 99  TYR A CE2 1 
ATOM   759  C CZ  . TYR A 1 99  ? 17.095 33.579 64.314 1.00 10.33 ? 99  TYR A CZ  1 
ATOM   760  O OH  . TYR A 1 99  ? 18.438 33.340 64.091 1.00 10.35 ? 99  TYR A OH  1 
ATOM   761  N N   . ILE A 1 100 ? 10.065 34.442 65.820 1.00 14.91 ? 100 ILE A N   1 
ATOM   762  C CA  . ILE A 1 100 ? 8.702  34.924 65.621 1.00 14.97 ? 100 ILE A CA  1 
ATOM   763  C C   . ILE A 1 100 ? 8.640  35.616 64.252 1.00 16.57 ? 100 ILE A C   1 
ATOM   764  O O   . ILE A 1 100 ? 9.683  35.970 63.680 1.00 15.09 ? 100 ILE A O   1 
ATOM   765  C CB  . ILE A 1 100 ? 8.295  35.904 66.729 1.00 11.37 ? 100 ILE A CB  1 
ATOM   766  C CG1 . ILE A 1 100 ? 9.312  37.047 66.817 1.00 9.12  ? 100 ILE A CG1 1 
ATOM   767  C CG2 . ILE A 1 100 ? 8.161  35.140 68.042 1.00 11.16 ? 100 ILE A CG2 1 
ATOM   768  C CD1 . ILE A 1 100 ? 8.948  38.137 67.805 1.00 5.13  ? 100 ILE A CD1 1 
ATOM   769  N N   . LYS A 1 101 ? 7.432  35.795 63.720 1.00 19.33 ? 101 LYS A N   1 
ATOM   770  C CA  . LYS A 1 101 ? 7.278  36.413 62.399 1.00 20.92 ? 101 LYS A CA  1 
ATOM   771  C C   . LYS A 1 101 ? 7.033  37.917 62.424 1.00 19.79 ? 101 LYS A C   1 
ATOM   772  O O   . LYS A 1 101 ? 6.284  38.426 63.264 1.00 21.17 ? 101 LYS A O   1 
ATOM   773  C CB  . LYS A 1 101 ? 6.159  35.714 61.614 1.00 24.17 ? 101 LYS A CB  1 
ATOM   774  C CG  . LYS A 1 101 ? 4.740  36.032 62.061 1.00 27.49 ? 101 LYS A CG  1 
ATOM   775  C CD  . LYS A 1 101 ? 3.735  35.370 61.110 1.00 32.18 ? 101 LYS A CD  1 
ATOM   776  C CE  . LYS A 1 101 ? 2.389  36.106 61.039 1.00 34.64 ? 101 LYS A CE  1 
ATOM   777  N NZ  . LYS A 1 101 ? 1.637  36.183 62.325 1.00 37.71 ? 101 LYS A NZ  1 
ATOM   778  N N   . PRO A 1 102 ? 7.690  38.654 61.508 1.00 18.95 ? 102 PRO A N   1 
ATOM   779  C CA  . PRO A 1 102 ? 7.518  40.115 61.445 1.00 17.24 ? 102 PRO A CA  1 
ATOM   780  C C   . PRO A 1 102 ? 6.231  40.457 60.710 1.00 16.05 ? 102 PRO A C   1 
ATOM   781  O O   . PRO A 1 102 ? 5.518  39.574 60.252 1.00 15.23 ? 102 PRO A O   1 
ATOM   782  C CB  . PRO A 1 102 ? 8.753  40.578 60.684 1.00 16.81 ? 102 PRO A CB  1 
ATOM   783  C CG  . PRO A 1 102 ? 8.989  39.420 59.721 1.00 17.86 ? 102 PRO A CG  1 
ATOM   784  C CD  . PRO A 1 102 ? 8.733  38.191 60.568 1.00 17.02 ? 102 PRO A CD  1 
ATOM   785  N N   . THR A 1 103 ? 5.926  41.738 60.598 1.00 18.09 ? 103 THR A N   1 
ATOM   786  C CA  . THR A 1 103 ? 4.717  42.130 59.898 1.00 20.21 ? 103 THR A CA  1 
ATOM   787  C C   . THR A 1 103 ? 5.115  42.886 58.648 1.00 21.50 ? 103 THR A C   1 
ATOM   788  O O   . THR A 1 103 ? 6.073  43.657 58.660 1.00 22.59 ? 103 THR A O   1 
ATOM   789  C CB  . THR A 1 103 ? 3.809  43.026 60.766 1.00 20.07 ? 103 THR A CB  1 
ATOM   790  O OG1 . THR A 1 103 ? 3.671  42.453 62.073 1.00 20.15 ? 103 THR A OG1 1 
ATOM   791  C CG2 . THR A 1 103 ? 2.429  43.132 60.138 1.00 22.69 ? 103 THR A CG2 1 
ATOM   792  N N   . LEU A 1 104 ? 4.388  42.659 57.560 1.00 22.96 ? 104 LEU A N   1 
ATOM   793  C CA  . LEU A 1 104 ? 4.697  43.338 56.310 1.00 23.34 ? 104 LEU A CA  1 
ATOM   794  C C   . LEU A 1 104 ? 3.576  44.292 55.915 1.00 24.63 ? 104 LEU A C   1 
ATOM   795  O O   . LEU A 1 104 ? 2.420  43.892 55.807 1.00 25.28 ? 104 LEU A O   1 
ATOM   796  C CB  . LEU A 1 104 ? 4.933  42.314 55.203 1.00 21.96 ? 104 LEU A CB  1 
ATOM   797  C CG  . LEU A 1 104 ? 5.389  42.894 53.866 1.00 22.12 ? 104 LEU A CG  1 
ATOM   798  C CD1 . LEU A 1 104 ? 6.618  43.769 54.036 1.00 22.10 ? 104 LEU A CD1 1 
ATOM   799  C CD2 . LEU A 1 104 ? 5.705  41.750 52.935 1.00 23.76 ? 104 LEU A CD2 1 
ATOM   800  N N   . SER A 1 105 ? 3.921  45.557 55.705 1.00 25.54 ? 105 SER A N   1 
ATOM   801  C CA  . SER A 1 105 ? 2.925  46.544 55.327 1.00 25.67 ? 105 SER A CA  1 
ATOM   802  C C   . SER A 1 105 ? 3.396  47.353 54.130 1.00 25.34 ? 105 SER A C   1 
ATOM   803  O O   . SER A 1 105 ? 4.593  47.434 53.854 1.00 24.79 ? 105 SER A O   1 
ATOM   804  C CB  . SER A 1 105 ? 2.623  47.481 56.514 1.00 25.70 ? 105 SER A CB  1 
ATOM   805  O OG  . SER A 1 105 ? 3.787  48.163 56.957 1.00 25.18 ? 105 SER A OG  1 
ATOM   806  N N   . ALA A 1 106 ? 2.437  47.933 53.416 1.00 26.12 ? 106 ALA A N   1 
ATOM   807  C CA  . ALA A 1 106 ? 2.723  48.769 52.262 1.00 26.15 ? 106 ALA A CA  1 
ATOM   808  C C   . ALA A 1 106 ? 2.350  50.194 52.654 1.00 26.09 ? 106 ALA A C   1 
ATOM   809  O O   . ALA A 1 106 ? 1.211  50.476 53.024 1.00 26.15 ? 106 ALA A O   1 
ATOM   810  C CB  . ALA A 1 106 ? 1.908  48.318 51.055 1.00 24.56 ? 106 ALA A CB  1 
ATOM   811  N N   . GLN A 1 107 ? 3.320  51.091 52.583 1.00 26.01 ? 107 GLN A N   1 
ATOM   812  C CA  . GLN A 1 107 ? 3.081  52.474 52.946 1.00 26.35 ? 107 GLN A CA  1 
ATOM   813  C C   . GLN A 1 107 ? 3.148  53.372 51.703 1.00 25.30 ? 107 GLN A C   1 
ATOM   814  O O   . GLN A 1 107 ? 4.157  53.377 50.991 1.00 25.32 ? 107 GLN A O   1 
ATOM   815  C CB  . GLN A 1 107 ? 4.111  52.879 54.001 1.00 29.34 ? 107 GLN A CB  1 
ATOM   816  C CG  . GLN A 1 107 ? 4.011  52.034 55.271 1.00 32.16 ? 107 GLN A CG  1 
ATOM   817  C CD  . GLN A 1 107 ? 2.631  52.116 55.888 1.00 37.36 ? 107 GLN A CD  1 
ATOM   818  O OE1 . GLN A 1 107 ? 2.309  53.081 56.587 1.00 39.46 ? 107 GLN A OE1 1 
ATOM   819  N NE2 . GLN A 1 107 ? 1.789  51.116 55.607 1.00 39.96 ? 107 GLN A NE2 1 
ATOM   820  N N   . PRO A 1 108 ? 2.079  54.162 51.438 1.00 23.28 ? 108 PRO A N   1 
ATOM   821  C CA  . PRO A 1 108 ? 0.847  54.236 52.229 1.00 20.83 ? 108 PRO A CA  1 
ATOM   822  C C   . PRO A 1 108 ? -0.086 53.052 52.076 1.00 20.51 ? 108 PRO A C   1 
ATOM   823  O O   . PRO A 1 108 ? -0.795 52.712 53.012 1.00 21.80 ? 108 PRO A O   1 
ATOM   824  C CB  . PRO A 1 108 ? 0.180  55.517 51.728 1.00 20.33 ? 108 PRO A CB  1 
ATOM   825  C CG  . PRO A 1 108 ? 1.259  56.254 50.992 1.00 20.41 ? 108 PRO A CG  1 
ATOM   826  C CD  . PRO A 1 108 ? 2.032  55.150 50.350 1.00 21.96 ? 108 PRO A CD  1 
ATOM   827  N N   . SER A 1 109 ? -0.102 52.426 50.901 1.00 20.49 ? 109 SER A N   1 
ATOM   828  C CA  . SER A 1 109 ? -1.017 51.297 50.685 1.00 20.33 ? 109 SER A CA  1 
ATOM   829  C C   . SER A 1 109 ? -0.603 50.253 49.644 1.00 18.47 ? 109 SER A C   1 
ATOM   830  O O   . SER A 1 109 ? 0.286  50.476 48.839 1.00 18.65 ? 109 SER A O   1 
ATOM   831  C CB  . SER A 1 109 ? -2.417 51.825 50.316 1.00 21.25 ? 109 SER A CB  1 
ATOM   832  O OG  . SER A 1 109 ? -2.524 52.126 48.928 1.00 18.33 ? 109 SER A OG  1 
ATOM   833  N N   . PRO A 1 110 ? -1.280 49.096 49.641 1.00 17.94 ? 110 PRO A N   1 
ATOM   834  C CA  . PRO A 1 110 ? -0.959 48.031 48.685 1.00 17.78 ? 110 PRO A CA  1 
ATOM   835  C C   . PRO A 1 110 ? -1.402 48.420 47.291 1.00 17.31 ? 110 PRO A C   1 
ATOM   836  O O   . PRO A 1 110 ? -0.898 47.904 46.305 1.00 18.03 ? 110 PRO A O   1 
ATOM   837  C CB  . PRO A 1 110 ? -1.756 46.829 49.202 1.00 17.01 ? 110 PRO A CB  1 
ATOM   838  C CG  . PRO A 1 110 ? -2.085 47.181 50.632 1.00 18.33 ? 110 PRO A CG  1 
ATOM   839  C CD  . PRO A 1 110 ? -2.335 48.662 50.570 1.00 17.26 ? 110 PRO A CD  1 
ATOM   840  N N   . VAL A 1 111 ? -2.363 49.327 47.217 1.00 18.06 ? 111 VAL A N   1 
ATOM   841  C CA  . VAL A 1 111 ? -2.878 49.762 45.930 1.00 21.26 ? 111 VAL A CA  1 
ATOM   842  C C   . VAL A 1 111 ? -2.012 50.865 45.359 1.00 23.87 ? 111 VAL A C   1 
ATOM   843  O O   . VAL A 1 111 ? -1.936 51.954 45.924 1.00 25.33 ? 111 VAL A O   1 
ATOM   844  C CB  . VAL A 1 111 ? -4.293 50.317 46.039 1.00 21.03 ? 111 VAL A CB  1 
ATOM   845  C CG1 . VAL A 1 111 ? -4.802 50.613 44.655 1.00 21.06 ? 111 VAL A CG1 1 
ATOM   846  C CG2 . VAL A 1 111 ? -5.202 49.339 46.760 1.00 19.79 ? 111 VAL A CG2 1 
ATOM   847  N N   . VAL A 1 112 ? -1.370 50.591 44.231 1.00 25.36 ? 112 VAL A N   1 
ATOM   848  C CA  . VAL A 1 112 ? -0.510 51.583 43.608 1.00 27.08 ? 112 VAL A CA  1 
ATOM   849  C C   . VAL A 1 112 ? -0.723 51.644 42.095 1.00 27.80 ? 112 VAL A C   1 
ATOM   850  O O   . VAL A 1 112 ? -1.140 50.668 41.469 1.00 26.19 ? 112 VAL A O   1 
ATOM   851  C CB  . VAL A 1 112 ? 0.972  51.277 43.902 1.00 27.69 ? 112 VAL A CB  1 
ATOM   852  C CG1 . VAL A 1 112 ? 1.154  51.012 45.397 1.00 28.14 ? 112 VAL A CG1 1 
ATOM   853  C CG2 . VAL A 1 112 ? 1.428  50.076 43.094 1.00 27.35 ? 112 VAL A CG2 1 
ATOM   854  N N   . ASN A 1 113 ? -0.420 52.799 41.513 1.00 29.38 ? 113 ASN A N   1 
ATOM   855  C CA  . ASN A 1 113 ? -0.587 52.997 40.078 1.00 31.48 ? 113 ASN A CA  1 
ATOM   856  C C   . ASN A 1 113 ? 0.501  52.358 39.231 1.00 31.86 ? 113 ASN A C   1 
ATOM   857  O O   . ASN A 1 113 ? 1.677  52.355 39.597 1.00 32.41 ? 113 ASN A O   1 
ATOM   858  C CB  . ASN A 1 113 ? -0.669 54.484 39.766 1.00 31.83 ? 113 ASN A CB  1 
ATOM   859  C CG  . ASN A 1 113 ? -1.806 55.144 40.483 1.00 34.12 ? 113 ASN A CG  1 
ATOM   860  O OD1 . ASN A 1 113 ? -2.964 54.759 40.309 1.00 36.61 ? 113 ASN A OD1 1 
ATOM   861  N ND2 . ASN A 1 113 ? -1.493 56.135 41.312 1.00 34.60 ? 113 ASN A ND2 1 
ATOM   862  N N   . SER A 1 114 ? 0.086  51.823 38.087 1.00 32.56 ? 114 SER A N   1 
ATOM   863  C CA  . SER A 1 114 ? 0.987  51.166 37.148 1.00 32.32 ? 114 SER A CA  1 
ATOM   864  C C   . SER A 1 114 ? 2.223  52.010 36.846 1.00 30.70 ? 114 SER A C   1 
ATOM   865  O O   . SER A 1 114 ? 2.122  53.183 36.483 1.00 29.53 ? 114 SER A O   1 
ATOM   866  C CB  . SER A 1 114 ? 0.241  50.853 35.841 1.00 32.93 ? 114 SER A CB  1 
ATOM   867  O OG  . SER A 1 114 ? 1.054  50.109 34.948 1.00 32.94 ? 114 SER A OG  1 
ATOM   868  N N   . GLY A 1 115 ? 3.392  51.394 37.002 1.00 30.04 ? 115 GLY A N   1 
ATOM   869  C CA  . GLY A 1 115 ? 4.644  52.078 36.740 1.00 28.23 ? 115 GLY A CA  1 
ATOM   870  C C   . GLY A 1 115 ? 5.150  52.834 37.950 1.00 27.10 ? 115 GLY A C   1 
ATOM   871  O O   . GLY A 1 115 ? 6.206  53.461 37.905 1.00 27.54 ? 115 GLY A O   1 
ATOM   872  N N   . GLY A 1 116 ? 4.393  52.773 39.037 1.00 25.32 ? 116 GLY A N   1 
ATOM   873  C CA  . GLY A 1 116 ? 4.790  53.468 40.238 1.00 23.87 ? 116 GLY A CA  1 
ATOM   874  C C   . GLY A 1 116 ? 5.631  52.616 41.158 1.00 23.51 ? 116 GLY A C   1 
ATOM   875  O O   . GLY A 1 116 ? 5.977  51.480 40.837 1.00 21.71 ? 116 GLY A O   1 
ATOM   876  N N   . ASN A 1 117 ? 5.975  53.182 42.307 1.00 24.98 ? 117 ASN A N   1 
ATOM   877  C CA  . ASN A 1 117 ? 6.764  52.474 43.303 1.00 26.06 ? 117 ASN A CA  1 
ATOM   878  C C   . ASN A 1 117 ? 6.088  52.508 44.669 1.00 25.46 ? 117 ASN A C   1 
ATOM   879  O O   . ASN A 1 117 ? 5.359  53.441 45.005 1.00 26.36 ? 117 ASN A O   1 
ATOM   880  C CB  . ASN A 1 117 ? 8.161  53.080 43.414 1.00 29.03 ? 117 ASN A CB  1 
ATOM   881  C CG  . ASN A 1 117 ? 9.113  52.567 42.347 1.00 33.40 ? 117 ASN A CG  1 
ATOM   882  O OD1 . ASN A 1 117 ? 8.857  52.715 41.148 1.00 35.71 ? 117 ASN A OD1 1 
ATOM   883  N ND2 . ASN A 1 117 ? 10.225 51.965 42.780 1.00 33.09 ? 117 ASN A ND2 1 
ATOM   884  N N   . VAL A 1 118 ? 6.326  51.480 45.464 1.00 23.86 ? 118 VAL A N   1 
ATOM   885  C CA  . VAL A 1 118 ? 5.730  51.433 46.780 1.00 22.17 ? 118 VAL A CA  1 
ATOM   886  C C   . VAL A 1 118 ? 6.803  51.033 47.824 1.00 22.30 ? 118 VAL A C   1 
ATOM   887  O O   . VAL A 1 118 ? 7.725  50.254 47.539 1.00 21.06 ? 118 VAL A O   1 
ATOM   888  C CB  . VAL A 1 118 ? 4.515  50.461 46.766 1.00 20.94 ? 118 VAL A CB  1 
ATOM   889  C CG1 . VAL A 1 118 ? 4.988  49.042 46.521 1.00 19.93 ? 118 VAL A CG1 1 
ATOM   890  C CG2 . VAL A 1 118 ? 3.726  50.562 48.060 1.00 19.90 ? 118 VAL A CG2 1 
ATOM   891  N N   . ILE A 1 119 ? 6.699  51.621 49.015 1.00 20.88 ? 119 ILE A N   1 
ATOM   892  C CA  . ILE A 1 119 ? 7.626  51.338 50.103 1.00 21.42 ? 119 ILE A CA  1 
ATOM   893  C C   . ILE A 1 119 ? 7.015  50.210 50.934 1.00 23.88 ? 119 ILE A C   1 
ATOM   894  O O   . ILE A 1 119 ? 5.890  50.335 51.434 1.00 24.32 ? 119 ILE A O   1 
ATOM   895  C CB  . ILE A 1 119 ? 7.838  52.567 51.046 1.00 21.07 ? 119 ILE A CB  1 
ATOM   896  C CG1 . ILE A 1 119 ? 8.512  53.732 50.307 1.00 17.73 ? 119 ILE A CG1 1 
ATOM   897  C CG2 . ILE A 1 119 ? 8.626  52.137 52.287 1.00 20.29 ? 119 ILE A CG2 1 
ATOM   898  C CD1 . ILE A 1 119 ? 9.853  53.392 49.682 1.00 17.40 ? 119 ILE A CD1 1 
ATOM   899  N N   . LEU A 1 120 ? 7.761  49.115 51.086 1.00 24.99 ? 120 LEU A N   1 
ATOM   900  C CA  . LEU A 1 120 ? 7.291  47.987 51.875 1.00 24.89 ? 120 LEU A CA  1 
ATOM   901  C C   . LEU A 1 120 ? 7.998  48.001 53.224 1.00 25.02 ? 120 LEU A C   1 
ATOM   902  O O   . LEU A 1 120 ? 9.222  48.112 53.302 1.00 24.79 ? 120 LEU A O   1 
ATOM   903  C CB  . LEU A 1 120 ? 7.539  46.674 51.131 1.00 24.55 ? 120 LEU A CB  1 
ATOM   904  C CG  . LEU A 1 120 ? 6.624  46.561 49.906 1.00 22.86 ? 120 LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 120 ? 6.912  45.299 49.129 1.00 22.25 ? 120 LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 120 ? 5.185  46.578 50.377 1.00 22.69 ? 120 LEU A CD2 1 
ATOM   907  N N   . GLN A 1 121 ? 7.217  47.895 54.288 1.00 24.87 ? 121 GLN A N   1 
ATOM   908  C CA  . GLN A 1 121 ? 7.780  47.941 55.617 1.00 26.21 ? 121 GLN A CA  1 
ATOM   909  C C   . GLN A 1 121 ? 7.702  46.644 56.407 1.00 26.85 ? 121 GLN A C   1 
ATOM   910  O O   . GLN A 1 121 ? 6.617  46.105 56.640 1.00 25.52 ? 121 GLN A O   1 
ATOM   911  C CB  . GLN A 1 121 ? 7.103  49.050 56.402 1.00 27.23 ? 121 GLN A CB  1 
ATOM   912  C CG  . GLN A 1 121 ? 7.744  49.293 57.738 1.00 30.22 ? 121 GLN A CG  1 
ATOM   913  C CD  . GLN A 1 121 ? 7.165  50.501 58.405 1.00 31.45 ? 121 GLN A CD  1 
ATOM   914  O OE1 . GLN A 1 121 ? 6.047  50.446 58.910 1.00 32.69 ? 121 GLN A OE1 1 
ATOM   915  N NE2 . GLN A 1 121 ? 7.904  51.613 58.395 1.00 34.35 ? 121 GLN A NE2 1 
ATOM   916  N N   . CYS A 1 122 ? 8.870  46.161 56.828 1.00 27.29 ? 122 CYS A N   1 
ATOM   917  C CA  . CYS A 1 122 ? 8.978  44.935 57.612 1.00 27.62 ? 122 CYS A CA  1 
ATOM   918  C C   . CYS A 1 122 ? 9.305  45.263 59.083 1.00 27.30 ? 122 CYS A C   1 
ATOM   919  O O   . CYS A 1 122 ? 10.428 45.645 59.410 1.00 27.62 ? 122 CYS A O   1 
ATOM   920  C CB  . CYS A 1 122 ? 10.068 44.043 57.010 1.00 26.50 ? 122 CYS A CB  1 
ATOM   921  S SG  . CYS A 1 122 ? 10.003 42.313 57.577 1.00 28.92 ? 122 CYS A SG  1 
ATOM   922  N N   . ASP A 1 123 ? 8.318  45.126 59.965 1.00 27.88 ? 123 ASP A N   1 
ATOM   923  C CA  . ASP A 1 123 ? 8.525  45.412 61.387 1.00 29.02 ? 123 ASP A CA  1 
ATOM   924  C C   . ASP A 1 123 ? 8.553  44.167 62.251 1.00 29.45 ? 123 ASP A C   1 
ATOM   925  O O   . ASP A 1 123 ? 7.667  43.307 62.152 1.00 26.99 ? 123 ASP A O   1 
ATOM   926  C CB  . ASP A 1 123 ? 7.434  46.329 61.939 1.00 29.84 ? 123 ASP A CB  1 
ATOM   927  C CG  . ASP A 1 123 ? 7.398  47.669 61.255 1.00 32.51 ? 123 ASP A CG  1 
ATOM   928  O OD1 . ASP A 1 123 ? 6.852  47.762 60.133 1.00 35.84 ? 123 ASP A OD1 1 
ATOM   929  O OD2 . ASP A 1 123 ? 7.923  48.631 61.842 1.00 32.15 ? 123 ASP A OD2 1 
ATOM   930  N N   . SER A 1 124 ? 9.566  44.090 63.114 1.00 31.12 ? 124 SER A N   1 
ATOM   931  C CA  . SER A 1 124 ? 9.715  42.961 64.029 1.00 34.04 ? 124 SER A CA  1 
ATOM   932  C C   . SER A 1 124 ? 9.469  43.369 65.487 1.00 35.55 ? 124 SER A C   1 
ATOM   933  O O   . SER A 1 124 ? 9.959  44.394 65.964 1.00 36.56 ? 124 SER A O   1 
ATOM   934  C CB  . SER A 1 124 ? 11.103 42.330 63.895 1.00 34.05 ? 124 SER A CB  1 
ATOM   935  O OG  . SER A 1 124 ? 11.182 41.144 64.663 1.00 36.70 ? 124 SER A OG  1 
ATOM   936  N N   . GLN A 1 125 ? 8.706  42.539 66.182 1.00 37.70 ? 125 GLN A N   1 
ATOM   937  C CA  . GLN A 1 125 ? 8.331  42.755 67.569 1.00 39.31 ? 125 GLN A CA  1 
ATOM   938  C C   . GLN A 1 125 ? 9.525  42.545 68.512 1.00 37.65 ? 125 GLN A C   1 
ATOM   939  O O   . GLN A 1 125 ? 9.456  42.865 69.701 1.00 38.33 ? 125 GLN A O   1 
ATOM   940  C CB  . GLN A 1 125 ? 7.200  41.782 67.868 1.00 43.40 ? 125 GLN A CB  1 
ATOM   941  C CG  . GLN A 1 125 ? 6.723  41.712 69.289 1.00 51.42 ? 125 GLN A CG  1 
ATOM   942  C CD  . GLN A 1 125 ? 5.505  40.814 69.397 1.00 56.94 ? 125 GLN A CD  1 
ATOM   943  O OE1 . GLN A 1 125 ? 5.194  40.076 68.455 1.00 59.54 ? 125 GLN A OE1 1 
ATOM   944  N NE2 . GLN A 1 125 ? 4.812  40.861 70.536 1.00 58.88 ? 125 GLN A NE2 1 
ATOM   945  N N   . VAL A 1 126 ? 10.607 42.005 67.955 1.00 34.64 ? 126 VAL A N   1 
ATOM   946  C CA  . VAL A 1 126 ? 11.848 41.710 68.677 1.00 32.22 ? 126 VAL A CA  1 
ATOM   947  C C   . VAL A 1 126 ? 12.980 42.171 67.768 1.00 30.92 ? 126 VAL A C   1 
ATOM   948  O O   . VAL A 1 126 ? 12.939 41.947 66.564 1.00 30.29 ? 126 VAL A O   1 
ATOM   949  C CB  . VAL A 1 126 ? 11.977 40.182 68.956 1.00 32.67 ? 126 VAL A CB  1 
ATOM   950  C CG1 . VAL A 1 126 ? 13.437 39.783 69.083 1.00 31.33 ? 126 VAL A CG1 1 
ATOM   951  C CG2 . VAL A 1 126 ? 11.219 39.817 70.233 1.00 34.16 ? 126 VAL A CG2 1 
ATOM   952  N N   . ALA A 1 127 ? 13.996 42.804 68.336 1.00 29.99 ? 127 ALA A N   1 
ATOM   953  C CA  . ALA A 1 127 ? 15.101 43.330 67.538 1.00 28.85 ? 127 ALA A CA  1 
ATOM   954  C C   . ALA A 1 127 ? 15.905 42.319 66.714 1.00 27.96 ? 127 ALA A C   1 
ATOM   955  O O   . ALA A 1 127 ? 16.123 41.178 67.137 1.00 30.49 ? 127 ALA A O   1 
ATOM   956  C CB  . ALA A 1 127 ? 16.038 44.134 68.442 1.00 27.27 ? 127 ALA A CB  1 
ATOM   957  N N   . PHE A 1 128 ? 16.339 42.776 65.536 1.00 25.95 ? 128 PHE A N   1 
ATOM   958  C CA  . PHE A 1 128 ? 17.141 42.010 64.580 1.00 23.30 ? 128 PHE A CA  1 
ATOM   959  C C   . PHE A 1 128 ? 18.027 42.907 63.735 1.00 23.60 ? 128 PHE A C   1 
ATOM   960  O O   . PHE A 1 128 ? 17.664 44.044 63.431 1.00 23.24 ? 128 PHE A O   1 
ATOM   961  C CB  . PHE A 1 128 ? 16.267 41.225 63.620 1.00 22.96 ? 128 PHE A CB  1 
ATOM   962  C CG  . PHE A 1 128 ? 15.850 39.921 64.153 1.00 22.14 ? 128 PHE A CG  1 
ATOM   963  C CD1 . PHE A 1 128 ? 14.617 39.774 64.773 1.00 20.62 ? 128 PHE A CD1 1 
ATOM   964  C CD2 . PHE A 1 128 ? 16.725 38.844 64.103 1.00 21.98 ? 128 PHE A CD2 1 
ATOM   965  C CE1 . PHE A 1 128 ? 14.264 38.580 65.340 1.00 21.99 ? 128 PHE A CE1 1 
ATOM   966  C CE2 . PHE A 1 128 ? 16.392 37.634 64.666 1.00 22.10 ? 128 PHE A CE2 1 
ATOM   967  C CZ  . PHE A 1 128 ? 15.158 37.496 65.289 1.00 24.03 ? 128 PHE A CZ  1 
ATOM   968  N N   . ASP A 1 129 ? 19.177 42.380 63.320 1.00 23.45 ? 129 ASP A N   1 
ATOM   969  C CA  . ASP A 1 129 ? 20.096 43.150 62.497 1.00 23.04 ? 129 ASP A CA  1 
ATOM   970  C C   . ASP A 1 129 ? 19.950 42.850 61.017 1.00 21.57 ? 129 ASP A C   1 
ATOM   971  O O   . ASP A 1 129 ? 20.650 43.436 60.191 1.00 23.03 ? 129 ASP A O   1 
ATOM   972  C CB  . ASP A 1 129 ? 21.563 42.930 62.934 1.00 24.00 ? 129 ASP A CB  1 
ATOM   973  C CG  . ASP A 1 129 ? 21.986 41.462 62.933 1.00 25.12 ? 129 ASP A CG  1 
ATOM   974  O OD1 . ASP A 1 129 ? 21.945 40.816 61.867 1.00 27.89 ? 129 ASP A OD1 1 
ATOM   975  O OD2 . ASP A 1 129 ? 22.378 40.953 64.007 1.00 26.28 ? 129 ASP A OD2 1 
ATOM   976  N N   . GLY A 1 130 ? 19.043 41.944 60.672 1.00 20.72 ? 130 GLY A N   1 
ATOM   977  C CA  . GLY A 1 130 ? 18.866 41.605 59.271 1.00 20.48 ? 130 GLY A CA  1 
ATOM   978  C C   . GLY A 1 130 ? 17.441 41.307 58.843 1.00 19.39 ? 130 GLY A C   1 
ATOM   979  O O   . GLY A 1 130 ? 16.704 40.602 59.534 1.00 18.68 ? 130 GLY A O   1 
ATOM   980  N N   . PHE A 1 131 ? 17.039 41.851 57.701 1.00 19.74 ? 131 PHE A N   1 
ATOM   981  C CA  . PHE A 1 131 ? 15.694 41.602 57.198 1.00 20.76 ? 131 PHE A CA  1 
ATOM   982  C C   . PHE A 1 131 ? 15.722 41.120 55.757 1.00 21.65 ? 131 PHE A C   1 
ATOM   983  O O   . PHE A 1 131 ? 16.648 41.411 55.006 1.00 21.95 ? 131 PHE A O   1 
ATOM   984  C CB  . PHE A 1 131 ? 14.822 42.854 57.295 1.00 19.30 ? 131 PHE A CB  1 
ATOM   985  C CG  . PHE A 1 131 ? 14.442 43.220 58.700 1.00 19.00 ? 131 PHE A CG  1 
ATOM   986  C CD1 . PHE A 1 131 ? 15.350 43.860 59.538 1.00 20.11 ? 131 PHE A CD1 1 
ATOM   987  C CD2 . PHE A 1 131 ? 13.186 42.897 59.198 1.00 18.36 ? 131 PHE A CD2 1 
ATOM   988  C CE1 . PHE A 1 131 ? 15.003 44.171 60.870 1.00 21.92 ? 131 PHE A CE1 1 
ATOM   989  C CE2 . PHE A 1 131 ? 12.827 43.200 60.518 1.00 19.45 ? 131 PHE A CE2 1 
ATOM   990  C CZ  . PHE A 1 131 ? 13.735 43.837 61.357 1.00 20.69 ? 131 PHE A CZ  1 
ATOM   991  N N   . SER A 1 132 ? 14.699 40.373 55.368 1.00 23.30 ? 132 SER A N   1 
ATOM   992  C CA  . SER A 1 132 ? 14.635 39.863 54.013 1.00 25.25 ? 132 SER A CA  1 
ATOM   993  C C   . SER A 1 132 ? 13.244 40.044 53.395 1.00 25.03 ? 132 SER A C   1 
ATOM   994  O O   . SER A 1 132 ? 12.236 39.907 54.086 1.00 25.25 ? 132 SER A O   1 
ATOM   995  C CB  . SER A 1 132 ? 15.023 38.395 54.010 1.00 26.10 ? 132 SER A CB  1 
ATOM   996  O OG  . SER A 1 132 ? 15.442 38.023 52.714 1.00 33.90 ? 132 SER A OG  1 
ATOM   997  N N   . LEU A 1 133 ? 13.197 40.371 52.101 1.00 24.86 ? 133 LEU A N   1 
ATOM   998  C CA  . LEU A 1 133 ? 11.926 40.563 51.393 1.00 24.88 ? 133 LEU A CA  1 
ATOM   999  C C   . LEU A 1 133 ? 11.892 39.679 50.164 1.00 25.13 ? 133 LEU A C   1 
ATOM   1000 O O   . LEU A 1 133 ? 12.694 39.860 49.249 1.00 25.75 ? 133 LEU A O   1 
ATOM   1001 C CB  . LEU A 1 133 ? 11.743 42.023 50.958 1.00 23.05 ? 133 LEU A CB  1 
ATOM   1002 C CG  . LEU A 1 133 ? 10.473 42.351 50.160 1.00 22.07 ? 133 LEU A CG  1 
ATOM   1003 C CD1 . LEU A 1 133 ? 9.239  42.021 50.960 1.00 18.51 ? 133 LEU A CD1 1 
ATOM   1004 C CD2 . LEU A 1 133 ? 10.451 43.817 49.816 1.00 23.17 ? 133 LEU A CD2 1 
ATOM   1005 N N   . CYS A 1 134 ? 10.958 38.730 50.141 1.00 25.97 ? 134 CYS A N   1 
ATOM   1006 C CA  . CYS A 1 134 ? 10.845 37.799 49.016 1.00 27.22 ? 134 CYS A CA  1 
ATOM   1007 C C   . CYS A 1 134 ? 9.514  37.883 48.291 1.00 29.89 ? 134 CYS A C   1 
ATOM   1008 O O   . CYS A 1 134 ? 8.470  38.109 48.906 1.00 29.13 ? 134 CYS A O   1 
ATOM   1009 C CB  . CYS A 1 134 ? 11.041 36.371 49.489 1.00 26.12 ? 134 CYS A CB  1 
ATOM   1010 S SG  . CYS A 1 134 ? 12.441 36.112 50.614 1.00 21.81 ? 134 CYS A SG  1 
ATOM   1011 N N   . LYS A 1 135 ? 9.561  37.660 46.982 1.00 33.15 ? 135 LYS A N   1 
ATOM   1012 C CA  . LYS A 1 135 ? 8.384  37.745 46.126 1.00 35.98 ? 135 LYS A CA  1 
ATOM   1013 C C   . LYS A 1 135 ? 7.973  36.371 45.608 1.00 37.86 ? 135 LYS A C   1 
ATOM   1014 O O   . LYS A 1 135 ? 8.685  35.780 44.795 1.00 39.20 ? 135 LYS A O   1 
ATOM   1015 C CB  . LYS A 1 135 ? 8.716  38.696 44.968 1.00 37.30 ? 135 LYS A CB  1 
ATOM   1016 C CG  . LYS A 1 135 ? 7.687  38.825 43.858 1.00 40.69 ? 135 LYS A CG  1 
ATOM   1017 C CD  . LYS A 1 135 ? 8.302  39.631 42.713 1.00 43.57 ? 135 LYS A CD  1 
ATOM   1018 C CE  . LYS A 1 135 ? 7.351  39.735 41.531 1.00 46.58 ? 135 LYS A CE  1 
ATOM   1019 N NZ  . LYS A 1 135 ? 7.981  40.337 40.317 1.00 48.49 ? 135 LYS A NZ  1 
ATOM   1020 N N   . GLU A 1 136 ? 6.843  35.847 46.082 1.00 39.98 ? 136 GLU A N   1 
ATOM   1021 C CA  . GLU A 1 136 ? 6.381  34.537 45.615 1.00 42.97 ? 136 GLU A CA  1 
ATOM   1022 C C   . GLU A 1 136 ? 5.917  34.648 44.177 1.00 43.75 ? 136 GLU A C   1 
ATOM   1023 O O   . GLU A 1 136 ? 5.009  33.931 43.768 1.00 46.03 ? 136 GLU A O   1 
ATOM   1024 C CB  . GLU A 1 136 ? 5.209  33.993 46.446 1.00 44.36 ? 136 GLU A CB  1 
ATOM   1025 C CG  . GLU A 1 136 ? 4.867  34.749 47.716 1.00 49.01 ? 136 GLU A CG  1 
ATOM   1026 C CD  . GLU A 1 136 ? 6.016  34.787 48.705 1.00 51.43 ? 136 GLU A CD  1 
ATOM   1027 O OE1 . GLU A 1 136 ? 6.617  33.721 48.970 1.00 53.56 ? 136 GLU A OE1 1 
ATOM   1028 O OE2 . GLU A 1 136 ? 6.316  35.884 49.222 1.00 52.20 ? 136 GLU A OE2 1 
ATOM   1029 N N   . GLN A 1 143 ? 12.724 34.930 45.018 1.00 37.29 ? 143 GLN A N   1 
ATOM   1030 C CA  . GLN A 1 143 ? 13.711 35.974 44.784 1.00 37.57 ? 143 GLN A CA  1 
ATOM   1031 C C   . GLN A 1 143 ? 13.654 37.022 45.887 1.00 36.25 ? 143 GLN A C   1 
ATOM   1032 O O   . GLN A 1 143 ? 12.718 37.831 45.925 1.00 37.65 ? 143 GLN A O   1 
ATOM   1033 C CB  . GLN A 1 143 ? 13.466 36.628 43.423 1.00 39.62 ? 143 GLN A CB  1 
ATOM   1034 C CG  . GLN A 1 143 ? 14.514 36.253 42.378 1.00 43.48 ? 143 GLN A CG  1 
ATOM   1035 C CD  . GLN A 1 143 ? 15.855 36.953 42.609 1.00 46.37 ? 143 GLN A CD  1 
ATOM   1036 O OE1 . GLN A 1 143 ? 16.319 37.072 43.750 1.00 49.95 ? 143 GLN A OE1 1 
ATOM   1037 N NE2 . GLN A 1 143 ? 16.488 37.408 41.524 1.00 46.10 ? 143 GLN A NE2 1 
ATOM   1038 N N   . CYS A 1 144 ? 14.655 37.032 46.773 1.00 33.24 ? 144 CYS A N   1 
ATOM   1039 C CA  . CYS A 1 144 ? 14.648 37.982 47.892 1.00 29.47 ? 144 CYS A CA  1 
ATOM   1040 C C   . CYS A 1 144 ? 15.610 39.169 47.860 1.00 28.54 ? 144 CYS A C   1 
ATOM   1041 O O   . CYS A 1 144 ? 16.623 39.181 47.146 1.00 28.91 ? 144 CYS A O   1 
ATOM   1042 C CB  . CYS A 1 144 ? 14.884 37.241 49.205 1.00 27.15 ? 144 CYS A CB  1 
ATOM   1043 S SG  . CYS A 1 144 ? 14.004 35.665 49.414 1.00 23.97 ? 144 CYS A SG  1 
ATOM   1044 N N   . LEU A 1 145 ? 15.261 40.175 48.654 1.00 26.07 ? 145 LEU A N   1 
ATOM   1045 C CA  . LEU A 1 145 ? 16.081 41.364 48.812 1.00 23.33 ? 145 LEU A CA  1 
ATOM   1046 C C   . LEU A 1 145 ? 16.536 41.326 50.274 1.00 22.48 ? 145 LEU A C   1 
ATOM   1047 O O   . LEU A 1 145 ? 15.791 40.893 51.157 1.00 21.22 ? 145 LEU A O   1 
ATOM   1048 C CB  . LEU A 1 145 ? 15.261 42.636 48.526 1.00 21.40 ? 145 LEU A CB  1 
ATOM   1049 C CG  . LEU A 1 145 ? 15.493 43.439 47.223 1.00 19.89 ? 145 LEU A CG  1 
ATOM   1050 C CD1 . LEU A 1 145 ? 15.649 42.511 46.036 1.00 16.82 ? 145 LEU A CD1 1 
ATOM   1051 C CD2 . LEU A 1 145 ? 14.354 44.421 46.983 1.00 16.19 ? 145 LEU A CD2 1 
ATOM   1052 N N   . ASN A 1 146 ? 17.773 41.732 50.525 1.00 22.65 ? 146 ASN A N   1 
ATOM   1053 C CA  . ASN A 1 146 ? 18.294 41.752 51.884 1.00 22.30 ? 146 ASN A CA  1 
ATOM   1054 C C   . ASN A 1 146 ? 18.633 43.181 52.280 1.00 22.17 ? 146 ASN A C   1 
ATOM   1055 O O   . ASN A 1 146 ? 19.347 43.906 51.572 1.00 22.40 ? 146 ASN A O   1 
ATOM   1056 C CB  . ASN A 1 146 ? 19.534 40.856 52.014 1.00 22.64 ? 146 ASN A CB  1 
ATOM   1057 C CG  . ASN A 1 146 ? 19.189 39.369 52.064 1.00 22.76 ? 146 ASN A CG  1 
ATOM   1058 O OD1 . ASN A 1 146 ? 18.774 38.773 51.065 1.00 25.07 ? 146 ASN A OD1 1 
ATOM   1059 N ND2 . ASN A 1 146 ? 19.357 38.766 53.234 1.00 23.78 ? 146 ASN A ND2 1 
ATOM   1060 N N   . SER A 1 147 ? 18.096 43.584 53.418 1.00 23.56 ? 147 SER A N   1 
ATOM   1061 C CA  . SER A 1 147 ? 18.316 44.918 53.930 1.00 24.67 ? 147 SER A CA  1 
ATOM   1062 C C   . SER A 1 147 ? 18.727 44.880 55.391 1.00 25.40 ? 147 SER A C   1 
ATOM   1063 O O   . SER A 1 147 ? 18.495 43.901 56.117 1.00 24.40 ? 147 SER A O   1 
ATOM   1064 C CB  . SER A 1 147 ? 17.031 45.749 53.789 1.00 25.31 ? 147 SER A CB  1 
ATOM   1065 O OG  . SER A 1 147 ? 17.130 47.023 54.425 1.00 26.00 ? 147 SER A OG  1 
ATOM   1066 N N   . GLN A 1 148 ? 19.358 45.971 55.800 1.00 26.83 ? 148 GLN A N   1 
ATOM   1067 C CA  . GLN A 1 148 ? 19.776 46.164 57.178 1.00 27.82 ? 148 GLN A CA  1 
ATOM   1068 C C   . GLN A 1 148 ? 18.633 46.984 57.757 1.00 27.39 ? 148 GLN A C   1 
ATOM   1069 O O   . GLN A 1 148 ? 17.783 47.457 57.011 1.00 28.23 ? 148 GLN A O   1 
ATOM   1070 C CB  . GLN A 1 148 ? 21.090 46.935 57.217 1.00 27.90 ? 148 GLN A CB  1 
ATOM   1071 C CG  . GLN A 1 148 ? 21.577 47.301 55.833 1.00 28.38 ? 148 GLN A CG  1 
ATOM   1072 C CD  . GLN A 1 148 ? 21.143 48.686 55.486 1.00 29.72 ? 148 GLN A CD  1 
ATOM   1073 O OE1 . GLN A 1 148 ? 20.404 49.298 56.255 1.00 33.56 ? 148 GLN A OE1 1 
ATOM   1074 N NE2 . GLN A 1 148 ? 21.591 49.204 54.346 1.00 28.73 ? 148 GLN A NE2 1 
ATOM   1075 N N   . PRO A 1 149 ? 18.581 47.170 59.083 1.00 28.13 ? 149 PRO A N   1 
ATOM   1076 C CA  . PRO A 1 149 ? 17.453 47.961 59.597 1.00 28.90 ? 149 PRO A CA  1 
ATOM   1077 C C   . PRO A 1 149 ? 17.312 49.368 59.012 1.00 30.54 ? 149 PRO A C   1 
ATOM   1078 O O   . PRO A 1 149 ? 18.161 49.827 58.243 1.00 30.56 ? 149 PRO A O   1 
ATOM   1079 C CB  . PRO A 1 149 ? 17.692 47.951 61.102 1.00 27.43 ? 149 PRO A CB  1 
ATOM   1080 C CG  . PRO A 1 149 ? 18.333 46.595 61.314 1.00 25.05 ? 149 PRO A CG  1 
ATOM   1081 C CD  . PRO A 1 149 ? 19.333 46.542 60.182 1.00 25.29 ? 149 PRO A CD  1 
ATOM   1082 N N   . HIS A 1 150 ? 16.229 50.044 59.371 1.00 32.33 ? 150 HIS A N   1 
ATOM   1083 C CA  . HIS A 1 150 ? 15.969 51.385 58.863 1.00 35.26 ? 150 HIS A CA  1 
ATOM   1084 C C   . HIS A 1 150 ? 15.981 52.439 59.966 1.00 37.19 ? 150 HIS A C   1 
ATOM   1085 O O   . HIS A 1 150 ? 15.344 52.271 61.002 1.00 38.04 ? 150 HIS A O   1 
ATOM   1086 C CB  . HIS A 1 150 ? 14.621 51.391 58.124 1.00 36.33 ? 150 HIS A CB  1 
ATOM   1087 C CG  . HIS A 1 150 ? 13.921 52.717 58.131 1.00 38.24 ? 150 HIS A CG  1 
ATOM   1088 N ND1 . HIS A 1 150 ? 14.331 53.788 57.363 1.00 39.06 ? 150 HIS A ND1 1 
ATOM   1089 C CD2 . HIS A 1 150 ? 12.851 53.150 58.842 1.00 38.64 ? 150 HIS A CD2 1 
ATOM   1090 C CE1 . HIS A 1 150 ? 13.544 54.824 57.603 1.00 40.02 ? 150 HIS A CE1 1 
ATOM   1091 N NE2 . HIS A 1 150 ? 12.639 54.463 58.497 1.00 40.05 ? 150 HIS A NE2 1 
ATOM   1092 N N   . ALA A 1 151 ? 16.717 53.518 59.712 1.00 40.04 ? 151 ALA A N   1 
ATOM   1093 C CA  . ALA A 1 151 ? 16.882 54.668 60.610 1.00 43.14 ? 151 ALA A CA  1 
ATOM   1094 C C   . ALA A 1 151 ? 15.946 54.820 61.816 1.00 44.87 ? 151 ALA A C   1 
ATOM   1095 O O   . ALA A 1 151 ? 16.373 54.748 62.965 1.00 45.67 ? 151 ALA A O   1 
ATOM   1096 C CB  . ALA A 1 151 ? 16.835 55.959 59.778 1.00 43.61 ? 151 ALA A CB  1 
ATOM   1097 N N   . ARG A 1 152 ? 14.671 55.048 61.543 1.00 46.34 ? 152 ARG A N   1 
ATOM   1098 C CA  . ARG A 1 152 ? 13.682 55.258 62.583 1.00 47.86 ? 152 ARG A CA  1 
ATOM   1099 C C   . ARG A 1 152 ? 12.682 54.093 62.593 1.00 48.49 ? 152 ARG A C   1 
ATOM   1100 O O   . ARG A 1 152 ? 11.723 54.068 61.818 1.00 50.46 ? 152 ARG A O   1 
ATOM   1101 C CB  . ARG A 1 152 ? 13.014 56.617 62.309 1.00 48.10 ? 152 ARG A CB  1 
ATOM   1102 C CG  . ARG A 1 152 ? 11.753 56.974 63.078 1.00 50.68 ? 152 ARG A CG  1 
ATOM   1103 C CD  . ARG A 1 152 ? 11.234 58.353 62.597 1.00 54.15 ? 152 ARG A CD  1 
ATOM   1104 N NE  . ARG A 1 152 ? 9.824  58.612 62.911 1.00 56.56 ? 152 ARG A NE  1 
ATOM   1105 C CZ  . ARG A 1 152 ? 8.780  58.275 62.147 1.00 58.23 ? 152 ARG A CZ  1 
ATOM   1106 N NH1 . ARG A 1 152 ? 8.941  57.645 60.983 1.00 58.32 ? 152 ARG A NH1 1 
ATOM   1107 N NH2 . ARG A 1 152 ? 7.556  58.593 62.551 1.00 59.67 ? 152 ARG A NH2 1 
ATOM   1108 N N   . GLY A 1 153 ? 12.936 53.122 63.469 1.00 47.42 ? 153 GLY A N   1 
ATOM   1109 C CA  . GLY A 1 153 ? 12.081 51.955 63.602 1.00 45.48 ? 153 GLY A CA  1 
ATOM   1110 C C   . GLY A 1 153 ? 12.701 51.019 64.624 1.00 44.56 ? 153 GLY A C   1 
ATOM   1111 O O   . GLY A 1 153 ? 13.925 50.907 64.691 1.00 44.02 ? 153 GLY A O   1 
ATOM   1112 N N   . SER A 1 154 ? 11.881 50.360 65.436 1.00 44.52 ? 154 SER A N   1 
ATOM   1113 C CA  . SER A 1 154 ? 12.403 49.426 66.440 1.00 43.58 ? 154 SER A CA  1 
ATOM   1114 C C   . SER A 1 154 ? 12.474 48.019 65.853 1.00 42.98 ? 154 SER A C   1 
ATOM   1115 O O   . SER A 1 154 ? 11.644 47.159 66.167 1.00 43.57 ? 154 SER A O   1 
ATOM   1116 C CB  . SER A 1 154 ? 11.505 49.408 67.681 1.00 44.16 ? 154 SER A CB  1 
ATOM   1117 O OG  . SER A 1 154 ? 11.928 48.403 68.591 1.00 45.13 ? 154 SER A OG  1 
ATOM   1118 N N   . SER A 1 155 ? 13.472 47.785 65.009 1.00 40.97 ? 155 SER A N   1 
ATOM   1119 C CA  . SER A 1 155 ? 13.628 46.497 64.349 1.00 39.39 ? 155 SER A CA  1 
ATOM   1120 C C   . SER A 1 155 ? 12.614 46.525 63.217 1.00 37.17 ? 155 SER A C   1 
ATOM   1121 O O   . SER A 1 155 ? 11.555 45.904 63.286 1.00 37.55 ? 155 SER A O   1 
ATOM   1122 C CB  . SER A 1 155 ? 13.317 45.337 65.296 1.00 39.82 ? 155 SER A CB  1 
ATOM   1123 O OG  . SER A 1 155 ? 13.894 44.135 64.813 1.00 43.54 ? 155 SER A OG  1 
ATOM   1124 N N   . ARG A 1 156 ? 12.947 47.282 62.185 1.00 33.88 ? 156 ARG A N   1 
ATOM   1125 C CA  . ARG A 1 156 ? 12.095 47.427 61.029 1.00 30.81 ? 156 ARG A CA  1 
ATOM   1126 C C   . ARG A 1 156 ? 13.007 47.694 59.849 1.00 28.53 ? 156 ARG A C   1 
ATOM   1127 O O   . ARG A 1 156 ? 13.980 48.432 59.958 1.00 27.89 ? 156 ARG A O   1 
ATOM   1128 C CB  . ARG A 1 156 ? 11.146 48.614 61.222 1.00 31.01 ? 156 ARG A CB  1 
ATOM   1129 C CG  . ARG A 1 156 ? 11.020 49.517 59.990 1.00 31.61 ? 156 ARG A CG  1 
ATOM   1130 C CD  . ARG A 1 156 ? 10.479 50.885 60.355 1.00 30.88 ? 156 ARG A CD  1 
ATOM   1131 N NE  . ARG A 1 156 ? 9.106  50.809 60.829 1.00 32.26 ? 156 ARG A NE  1 
ATOM   1132 C CZ  . ARG A 1 156 ? 8.489  51.771 61.510 1.00 32.27 ? 156 ARG A CZ  1 
ATOM   1133 N NH1 . ARG A 1 156 ? 9.128  52.895 61.806 1.00 32.12 ? 156 ARG A NH1 1 
ATOM   1134 N NH2 . ARG A 1 156 ? 7.226  51.610 61.890 1.00 31.50 ? 156 ARG A NH2 1 
ATOM   1135 N N   . ALA A 1 157 ? 12.701 47.071 58.725 1.00 26.71 ? 157 ALA A N   1 
ATOM   1136 C CA  . ALA A 1 157 ? 13.470 47.284 57.518 1.00 25.91 ? 157 ALA A CA  1 
ATOM   1137 C C   . ALA A 1 157 ? 12.446 47.795 56.520 1.00 25.50 ? 157 ALA A C   1 
ATOM   1138 O O   . ALA A 1 157 ? 11.296 47.343 56.521 1.00 24.54 ? 157 ALA A O   1 
ATOM   1139 C CB  . ALA A 1 157 ? 14.065 45.977 57.030 1.00 24.46 ? 157 ALA A CB  1 
ATOM   1140 N N   . ILE A 1 158 ? 12.821 48.762 55.695 1.00 25.20 ? 158 ILE A N   1 
ATOM   1141 C CA  . ILE A 1 158 ? 11.859 49.209 54.701 1.00 26.58 ? 158 ILE A CA  1 
ATOM   1142 C C   . ILE A 1 158 ? 12.452 48.969 53.322 1.00 26.64 ? 158 ILE A C   1 
ATOM   1143 O O   . ILE A 1 158 ? 13.641 49.195 53.100 1.00 25.95 ? 158 ILE A O   1 
ATOM   1144 C CB  . ILE A 1 158 ? 11.439 50.710 54.868 1.00 26.31 ? 158 ILE A CB  1 
ATOM   1145 C CG1 . ILE A 1 158 ? 12.324 51.631 54.018 1.00 25.26 ? 158 ILE A CG1 1 
ATOM   1146 C CG2 . ILE A 1 158 ? 11.478 51.098 56.345 1.00 27.69 ? 158 ILE A CG2 1 
ATOM   1147 C CD1 . ILE A 1 158 ? 13.703 51.876 54.582 1.00 23.80 ? 158 ILE A CD1 1 
ATOM   1148 N N   . PHE A 1 159 ? 11.625 48.466 52.410 1.00 27.66 ? 159 PHE A N   1 
ATOM   1149 C CA  . PHE A 1 159 ? 12.068 48.195 51.041 1.00 27.97 ? 159 PHE A CA  1 
ATOM   1150 C C   . PHE A 1 159 ? 11.269 48.976 50.004 1.00 28.43 ? 159 PHE A C   1 
ATOM   1151 O O   . PHE A 1 159 ? 10.093 49.282 50.201 1.00 26.60 ? 159 PHE A O   1 
ATOM   1152 C CB  . PHE A 1 159 ? 11.967 46.703 50.710 1.00 26.87 ? 159 PHE A CB  1 
ATOM   1153 C CG  . PHE A 1 159 ? 12.769 45.815 51.615 1.00 24.94 ? 159 PHE A CG  1 
ATOM   1154 C CD1 . PHE A 1 159 ? 12.348 45.559 52.917 1.00 24.85 ? 159 PHE A CD1 1 
ATOM   1155 C CD2 . PHE A 1 159 ? 13.923 45.198 51.149 1.00 24.04 ? 159 PHE A CD2 1 
ATOM   1156 C CE1 . PHE A 1 159 ? 13.066 44.691 53.737 1.00 25.38 ? 159 PHE A CE1 1 
ATOM   1157 C CE2 . PHE A 1 159 ? 14.648 44.330 51.957 1.00 23.46 ? 159 PHE A CE2 1 
ATOM   1158 C CZ  . PHE A 1 159 ? 14.223 44.072 53.247 1.00 24.73 ? 159 PHE A CZ  1 
ATOM   1159 N N   . SER A 1 160 ? 11.931 49.281 48.893 1.00 30.52 ? 160 SER A N   1 
ATOM   1160 C CA  . SER A 1 160 ? 11.333 50.028 47.788 1.00 32.19 ? 160 SER A CA  1 
ATOM   1161 C C   . SER A 1 160 ? 11.152 49.163 46.550 1.00 32.23 ? 160 SER A C   1 
ATOM   1162 O O   . SER A 1 160 ? 12.133 48.787 45.910 1.00 33.02 ? 160 SER A O   1 
ATOM   1163 C CB  . SER A 1 160 ? 12.220 51.212 47.403 1.00 34.00 ? 160 SER A CB  1 
ATOM   1164 O OG  . SER A 1 160 ? 12.198 51.415 45.991 1.00 37.09 ? 160 SER A OG  1 
ATOM   1165 N N   . VAL A 1 161 ? 9.911  48.856 46.194 1.00 31.54 ? 161 VAL A N   1 
ATOM   1166 C CA  . VAL A 1 161 ? 9.695  48.039 45.012 1.00 30.56 ? 161 VAL A CA  1 
ATOM   1167 C C   . VAL A 1 161 ? 8.984  48.813 43.918 1.00 31.29 ? 161 VAL A C   1 
ATOM   1168 O O   . VAL A 1 161 ? 8.058  49.590 44.173 1.00 31.06 ? 161 VAL A O   1 
ATOM   1169 C CB  . VAL A 1 161 ? 8.888  46.760 45.331 1.00 29.75 ? 161 VAL A CB  1 
ATOM   1170 C CG1 . VAL A 1 161 ? 9.637  45.922 46.350 1.00 29.39 ? 161 VAL A CG1 1 
ATOM   1171 C CG2 . VAL A 1 161 ? 7.493  47.120 45.823 1.00 29.66 ? 161 VAL A CG2 1 
ATOM   1172 N N   . GLY A 1 162 ? 9.430  48.588 42.689 1.00 31.57 ? 162 GLY A N   1 
ATOM   1173 C CA  . GLY A 1 162 ? 8.836  49.263 41.558 1.00 31.08 ? 162 GLY A CA  1 
ATOM   1174 C C   . GLY A 1 162 ? 9.854  49.375 40.450 1.00 31.34 ? 162 GLY A C   1 
ATOM   1175 O O   . GLY A 1 162 ? 11.038 49.147 40.680 1.00 32.66 ? 162 GLY A O   1 
ATOM   1176 N N   . PRO A 1 163 ? 9.430  49.737 39.232 1.00 31.13 ? 163 PRO A N   1 
ATOM   1177 C CA  . PRO A 1 163 ? 8.043  50.036 38.859 1.00 29.80 ? 163 PRO A CA  1 
ATOM   1178 C C   . PRO A 1 163 ? 7.158  48.803 38.796 1.00 29.45 ? 163 PRO A C   1 
ATOM   1179 O O   . PRO A 1 163 ? 7.558  47.767 38.262 1.00 27.89 ? 163 PRO A O   1 
ATOM   1180 C CB  . PRO A 1 163 ? 8.193  50.686 37.493 1.00 29.53 ? 163 PRO A CB  1 
ATOM   1181 C CG  . PRO A 1 163 ? 9.559  51.302 37.566 1.00 30.16 ? 163 PRO A CG  1 
ATOM   1182 C CD  . PRO A 1 163 ? 10.355 50.207 38.191 1.00 29.87 ? 163 PRO A CD  1 
ATOM   1183 N N   . VAL A 1 164 ? 5.953  48.917 39.341 1.00 29.58 ? 164 VAL A N   1 
ATOM   1184 C CA  . VAL A 1 164 ? 5.019  47.802 39.311 1.00 30.98 ? 164 VAL A CA  1 
ATOM   1185 C C   . VAL A 1 164 ? 4.218  47.886 38.020 1.00 31.41 ? 164 VAL A C   1 
ATOM   1186 O O   . VAL A 1 164 ? 4.121  48.964 37.423 1.00 32.46 ? 164 VAL A O   1 
ATOM   1187 C CB  . VAL A 1 164 ? 4.038  47.855 40.498 1.00 30.70 ? 164 VAL A CB  1 
ATOM   1188 C CG1 . VAL A 1 164 ? 4.809  47.946 41.793 1.00 30.08 ? 164 VAL A CG1 1 
ATOM   1189 C CG2 . VAL A 1 164 ? 3.090  49.036 40.347 1.00 30.98 ? 164 VAL A CG2 1 
ATOM   1190 N N   . SER A 1 165 ? 3.664  46.752 37.591 1.00 31.49 ? 165 SER A N   1 
ATOM   1191 C CA  . SER A 1 165 ? 2.837  46.677 36.383 1.00 31.65 ? 165 SER A CA  1 
ATOM   1192 C C   . SER A 1 165 ? 1.790  45.588 36.570 1.00 31.28 ? 165 SER A C   1 
ATOM   1193 O O   . SER A 1 165 ? 2.064  44.553 37.182 1.00 31.54 ? 165 SER A O   1 
ATOM   1194 C CB  . SER A 1 165 ? 3.679  46.353 35.147 1.00 32.46 ? 165 SER A CB  1 
ATOM   1195 O OG  . SER A 1 165 ? 4.295  45.083 35.271 1.00 35.90 ? 165 SER A OG  1 
ATOM   1196 N N   . PRO A 1 166 ? 0.579  45.802 36.028 1.00 31.14 ? 166 PRO A N   1 
ATOM   1197 C CA  . PRO A 1 166 ? -0.550 44.869 36.110 1.00 30.25 ? 166 PRO A CA  1 
ATOM   1198 C C   . PRO A 1 166 ? -0.196 43.504 35.549 1.00 29.72 ? 166 PRO A C   1 
ATOM   1199 O O   . PRO A 1 166 ? -0.635 42.470 36.064 1.00 28.18 ? 166 PRO A O   1 
ATOM   1200 C CB  . PRO A 1 166 ? -1.621 45.538 35.252 1.00 31.18 ? 166 PRO A CB  1 
ATOM   1201 C CG  . PRO A 1 166 ? -1.234 46.976 35.255 1.00 31.09 ? 166 PRO A CG  1 
ATOM   1202 C CD  . PRO A 1 166 ? 0.248  46.923 35.134 1.00 30.51 ? 166 PRO A CD  1 
ATOM   1203 N N   . SER A 1 167 ? 0.593  43.525 34.476 1.00 30.37 ? 167 SER A N   1 
ATOM   1204 C CA  . SER A 1 167 ? 1.009  42.310 33.785 1.00 31.95 ? 167 SER A CA  1 
ATOM   1205 C C   . SER A 1 167 ? 1.721  41.357 34.721 1.00 33.14 ? 167 SER A C   1 
ATOM   1206 O O   . SER A 1 167 ? 1.978  40.201 34.378 1.00 31.62 ? 167 SER A O   1 
ATOM   1207 C CB  . SER A 1 167 ? 1.934  42.638 32.609 1.00 30.35 ? 167 SER A CB  1 
ATOM   1208 O OG  . SER A 1 167 ? 3.212  43.026 33.070 1.00 31.62 ? 167 SER A OG  1 
ATOM   1209 N N   . ARG A 1 168 ? 2.044  41.837 35.910 1.00 34.67 ? 168 ARG A N   1 
ATOM   1210 C CA  . ARG A 1 168 ? 2.732  40.977 36.837 1.00 36.82 ? 168 ARG A CA  1 
ATOM   1211 C C   . ARG A 1 168 ? 2.114  40.837 38.208 1.00 37.84 ? 168 ARG A C   1 
ATOM   1212 O O   . ARG A 1 168 ? 1.339  41.674 38.676 1.00 38.27 ? 168 ARG A O   1 
ATOM   1213 C CB  . ARG A 1 168 ? 4.203  41.395 36.959 1.00 37.90 ? 168 ARG A CB  1 
ATOM   1214 C CG  . ARG A 1 168 ? 5.078  40.872 35.817 1.00 39.22 ? 168 ARG A CG  1 
ATOM   1215 C CD  . ARG A 1 168 ? 6.444  41.550 35.780 1.00 41.96 ? 168 ARG A CD  1 
ATOM   1216 N NE  . ARG A 1 168 ? 7.391  40.993 36.745 1.00 46.77 ? 168 ARG A NE  1 
ATOM   1217 C CZ  . ARG A 1 168 ? 8.555  41.557 37.077 1.00 47.68 ? 168 ARG A CZ  1 
ATOM   1218 N NH1 . ARG A 1 168 ? 8.928  42.706 36.531 1.00 48.42 ? 168 ARG A NH1 1 
ATOM   1219 N NH2 . ARG A 1 168 ? 9.358  40.963 37.951 1.00 49.01 ? 168 ARG A NH2 1 
ATOM   1220 N N   . ARG A 1 169 ? 2.496  39.721 38.814 1.00 38.77 ? 169 ARG A N   1 
ATOM   1221 C CA  . ARG A 1 169 ? 2.110  39.260 40.142 1.00 39.74 ? 169 ARG A CA  1 
ATOM   1222 C C   . ARG A 1 169 ? 3.024  39.924 41.192 1.00 38.02 ? 169 ARG A C   1 
ATOM   1223 O O   . ARG A 1 169 ? 4.249  39.843 41.087 1.00 37.97 ? 169 ARG A O   1 
ATOM   1224 C CB  . ARG A 1 169 ? 2.308  37.746 40.137 1.00 43.75 ? 169 ARG A CB  1 
ATOM   1225 C CG  . ARG A 1 169 ? 3.500  37.367 39.215 1.00 48.99 ? 169 ARG A CG  1 
ATOM   1226 C CD  . ARG A 1 169 ? 3.202  36.233 38.216 1.00 53.45 ? 169 ARG A CD  1 
ATOM   1227 N NE  . ARG A 1 169 ? 4.005  36.352 36.992 1.00 59.54 ? 169 ARG A NE  1 
ATOM   1228 C CZ  . ARG A 1 169 ? 4.206  35.371 36.106 1.00 63.11 ? 169 ARG A CZ  1 
ATOM   1229 N NH1 . ARG A 1 169 ? 3.669  34.170 36.297 1.00 64.60 ? 169 ARG A NH1 1 
ATOM   1230 N NH2 . ARG A 1 169 ? 4.931  35.592 35.007 1.00 64.67 ? 169 ARG A NH2 1 
ATOM   1231 N N   . TRP A 1 170 ? 2.444  40.589 42.188 1.00 35.90 ? 170 TRP A N   1 
ATOM   1232 C CA  . TRP A 1 170 ? 3.255  41.237 43.221 1.00 33.16 ? 170 TRP A CA  1 
ATOM   1233 C C   . TRP A 1 170 ? 2.861  40.787 44.624 1.00 32.27 ? 170 TRP A C   1 
ATOM   1234 O O   . TRP A 1 170 ? 2.160  41.502 45.354 1.00 31.09 ? 170 TRP A O   1 
ATOM   1235 C CB  . TRP A 1 170 ? 3.158  42.762 43.102 1.00 31.91 ? 170 TRP A CB  1 
ATOM   1236 C CG  . TRP A 1 170 ? 3.553  43.240 41.752 1.00 32.85 ? 170 TRP A CG  1 
ATOM   1237 C CD1 . TRP A 1 170 ? 2.738  43.392 40.671 1.00 34.11 ? 170 TRP A CD1 1 
ATOM   1238 C CD2 . TRP A 1 170 ? 4.878  43.514 41.293 1.00 33.45 ? 170 TRP A CD2 1 
ATOM   1239 N NE1 . TRP A 1 170 ? 3.469  43.735 39.562 1.00 33.33 ? 170 TRP A NE1 1 
ATOM   1240 C CE2 . TRP A 1 170 ? 4.787  43.818 39.915 1.00 33.96 ? 170 TRP A CE2 1 
ATOM   1241 C CE3 . TRP A 1 170 ? 6.136  43.527 41.909 1.00 33.04 ? 170 TRP A CE3 1 
ATOM   1242 C CZ2 . TRP A 1 170 ? 5.907  44.133 39.141 1.00 35.21 ? 170 TRP A CZ2 1 
ATOM   1243 C CZ3 . TRP A 1 170 ? 7.252  43.839 41.138 1.00 34.01 ? 170 TRP A CZ3 1 
ATOM   1244 C CH2 . TRP A 1 170 ? 7.129  44.138 39.767 1.00 35.48 ? 170 TRP A CH2 1 
ATOM   1245 N N   . TRP A 1 171 ? 3.308  39.580 44.971 1.00 31.22 ? 171 TRP A N   1 
ATOM   1246 C CA  . TRP A 1 171 ? 3.053  38.966 46.275 1.00 30.31 ? 171 TRP A CA  1 
ATOM   1247 C C   . TRP A 1 171 ? 4.347  38.934 47.086 1.00 28.12 ? 171 TRP A C   1 
ATOM   1248 O O   . TRP A 1 171 ? 5.373  38.426 46.621 1.00 26.82 ? 171 TRP A O   1 
ATOM   1249 C CB  . TRP A 1 171 ? 2.535  37.531 46.112 1.00 32.06 ? 171 TRP A CB  1 
ATOM   1250 C CG  . TRP A 1 171 ? 1.185  37.433 45.478 1.00 36.58 ? 171 TRP A CG  1 
ATOM   1251 C CD1 . TRP A 1 171 ? 0.349  38.467 45.162 1.00 38.25 ? 171 TRP A CD1 1 
ATOM   1252 C CD2 . TRP A 1 171 ? 0.489  36.230 45.113 1.00 38.31 ? 171 TRP A CD2 1 
ATOM   1253 N NE1 . TRP A 1 171 ? -0.825 37.986 44.624 1.00 38.33 ? 171 TRP A NE1 1 
ATOM   1254 C CE2 . TRP A 1 171 ? -0.766 36.617 44.582 1.00 38.43 ? 171 TRP A CE2 1 
ATOM   1255 C CE3 . TRP A 1 171 ? 0.804  34.865 45.182 1.00 39.37 ? 171 TRP A CE3 1 
ATOM   1256 C CZ2 . TRP A 1 171 ? -1.708 35.684 44.124 1.00 38.35 ? 171 TRP A CZ2 1 
ATOM   1257 C CZ3 . TRP A 1 171 ? -0.136 33.935 44.725 1.00 39.24 ? 171 TRP A CZ3 1 
ATOM   1258 C CH2 . TRP A 1 171 ? -1.376 34.353 44.203 1.00 39.10 ? 171 TRP A CH2 1 
ATOM   1259 N N   . TYR A 1 172 ? 4.295  39.463 48.304 1.00 26.44 ? 172 TYR A N   1 
ATOM   1260 C CA  . TYR A 1 172 ? 5.478  39.494 49.152 1.00 24.74 ? 172 TYR A CA  1 
ATOM   1261 C C   . TYR A 1 172 ? 5.291  38.926 50.543 1.00 24.10 ? 172 TYR A C   1 
ATOM   1262 O O   . TYR A 1 172 ? 4.170  38.737 51.015 1.00 24.03 ? 172 TYR A O   1 
ATOM   1263 C CB  . TYR A 1 172 ? 6.003  40.923 49.302 1.00 22.65 ? 172 TYR A CB  1 
ATOM   1264 C CG  . TYR A 1 172 ? 6.511  41.554 48.033 1.00 21.62 ? 172 TYR A CG  1 
ATOM   1265 C CD1 . TYR A 1 172 ? 5.653  42.269 47.198 1.00 22.33 ? 172 TYR A CD1 1 
ATOM   1266 C CD2 . TYR A 1 172 ? 7.857  41.470 47.683 1.00 21.33 ? 172 TYR A CD2 1 
ATOM   1267 C CE1 . TYR A 1 172 ? 6.123  42.895 46.052 1.00 21.94 ? 172 TYR A CE1 1 
ATOM   1268 C CE2 . TYR A 1 172 ? 8.337  42.087 46.534 1.00 23.76 ? 172 TYR A CE2 1 
ATOM   1269 C CZ  . TYR A 1 172 ? 7.462  42.802 45.727 1.00 23.70 ? 172 TYR A CZ  1 
ATOM   1270 O OH  . TYR A 1 172 ? 7.939  43.438 44.606 1.00 26.59 ? 172 TYR A OH  1 
ATOM   1271 N N   . ARG A 1 173 ? 6.433  38.664 51.177 1.00 24.15 ? 173 ARG A N   1 
ATOM   1272 C CA  . ARG A 1 173 ? 6.545  38.163 52.541 1.00 23.43 ? 173 ARG A CA  1 
ATOM   1273 C C   . ARG A 1 173 ? 7.919  38.650 52.969 1.00 24.05 ? 173 ARG A C   1 
ATOM   1274 O O   . ARG A 1 173 ? 8.837  38.727 52.138 1.00 23.37 ? 173 ARG A O   1 
ATOM   1275 C CB  . ARG A 1 173 ? 6.553  36.645 52.581 1.00 22.24 ? 173 ARG A CB  1 
ATOM   1276 C CG  . ARG A 1 173 ? 5.379  36.012 51.940 1.00 25.42 ? 173 ARG A CG  1 
ATOM   1277 C CD  . ARG A 1 173 ? 5.368  34.548 52.249 1.00 27.84 ? 173 ARG A CD  1 
ATOM   1278 N NE  . ARG A 1 173 ? 4.714  34.289 53.523 1.00 31.59 ? 173 ARG A NE  1 
ATOM   1279 C CZ  . ARG A 1 173 ? 3.425  33.981 53.646 1.00 33.56 ? 173 ARG A CZ  1 
ATOM   1280 N NH1 . ARG A 1 173 ? 2.654  33.890 52.567 1.00 34.61 ? 173 ARG A NH1 1 
ATOM   1281 N NH2 . ARG A 1 173 ? 2.902  33.764 54.846 1.00 34.71 ? 173 ARG A NH2 1 
ATOM   1282 N N   . CYS A 1 174 ? 8.082  38.986 54.244 1.00 23.09 ? 174 CYS A N   1 
ATOM   1283 C CA  . CYS A 1 174 ? 9.392  39.424 54.701 1.00 23.50 ? 174 CYS A CA  1 
ATOM   1284 C C   . CYS A 1 174 ? 9.846  38.640 55.929 1.00 23.86 ? 174 CYS A C   1 
ATOM   1285 O O   . CYS A 1 174 ? 9.016  38.147 56.707 1.00 23.02 ? 174 CYS A O   1 
ATOM   1286 C CB  . CYS A 1 174 ? 9.386  40.930 54.977 1.00 23.13 ? 174 CYS A CB  1 
ATOM   1287 S SG  . CYS A 1 174 ? 8.506  41.487 56.466 1.00 25.67 ? 174 CYS A SG  1 
ATOM   1288 N N   . TYR A 1 175 ? 11.168 38.519 56.080 1.00 23.64 ? 175 TYR A N   1 
ATOM   1289 C CA  . TYR A 1 175 ? 11.781 37.788 57.195 1.00 23.82 ? 175 TYR A CA  1 
ATOM   1290 C C   . TYR A 1 175 ? 12.790 38.613 57.992 1.00 22.16 ? 175 TYR A C   1 
ATOM   1291 O O   . TYR A 1 175 ? 13.420 39.525 57.462 1.00 21.56 ? 175 TYR A O   1 
ATOM   1292 C CB  . TYR A 1 175 ? 12.521 36.537 56.693 1.00 24.61 ? 175 TYR A CB  1 
ATOM   1293 C CG  . TYR A 1 175 ? 11.723 35.605 55.824 1.00 25.65 ? 175 TYR A CG  1 
ATOM   1294 C CD1 . TYR A 1 175 ? 11.465 35.921 54.494 1.00 26.35 ? 175 TYR A CD1 1 
ATOM   1295 C CD2 . TYR A 1 175 ? 11.239 34.391 56.323 1.00 26.56 ? 175 TYR A CD2 1 
ATOM   1296 C CE1 . TYR A 1 175 ? 10.747 35.050 53.670 1.00 26.98 ? 175 TYR A CE1 1 
ATOM   1297 C CE2 . TYR A 1 175 ? 10.518 33.515 55.510 1.00 26.63 ? 175 TYR A CE2 1 
ATOM   1298 C CZ  . TYR A 1 175 ? 10.280 33.853 54.186 1.00 26.61 ? 175 TYR A CZ  1 
ATOM   1299 O OH  . TYR A 1 175 ? 9.597  32.995 53.362 1.00 27.77 ? 175 TYR A OH  1 
ATOM   1300 N N   . ALA A 1 176 ? 12.934 38.283 59.272 1.00 21.75 ? 176 ALA A N   1 
ATOM   1301 C CA  . ALA A 1 176 ? 13.924 38.942 60.121 1.00 20.42 ? 176 ALA A CA  1 
ATOM   1302 C C   . ALA A 1 176 ? 14.937 37.846 60.458 1.00 19.82 ? 176 ALA A C   1 
ATOM   1303 O O   . ALA A 1 176 ? 14.570 36.667 60.570 1.00 19.69 ? 176 ALA A O   1 
ATOM   1304 C CB  . ALA A 1 176 ? 13.291 39.471 61.383 1.00 19.14 ? 176 ALA A CB  1 
ATOM   1305 N N   . TYR A 1 177 ? 16.207 38.228 60.578 1.00 18.76 ? 177 TYR A N   1 
ATOM   1306 C CA  . TYR A 1 177 ? 17.270 37.282 60.902 1.00 17.62 ? 177 TYR A CA  1 
ATOM   1307 C C   . TYR A 1 177 ? 18.467 37.972 61.544 1.00 17.00 ? 177 TYR A C   1 
ATOM   1308 O O   . TYR A 1 177 ? 18.654 39.183 61.395 1.00 15.79 ? 177 TYR A O   1 
ATOM   1309 C CB  . TYR A 1 177 ? 17.729 36.521 59.647 1.00 17.29 ? 177 TYR A CB  1 
ATOM   1310 C CG  . TYR A 1 177 ? 18.533 37.341 58.638 1.00 18.49 ? 177 TYR A CG  1 
ATOM   1311 C CD1 . TYR A 1 177 ? 19.842 37.766 58.920 1.00 16.31 ? 177 TYR A CD1 1 
ATOM   1312 C CD2 . TYR A 1 177 ? 17.973 37.704 57.401 1.00 17.20 ? 177 TYR A CD2 1 
ATOM   1313 C CE1 . TYR A 1 177 ? 20.562 38.527 58.013 1.00 14.79 ? 177 TYR A CE1 1 
ATOM   1314 C CE2 . TYR A 1 177 ? 18.686 38.464 56.482 1.00 16.01 ? 177 TYR A CE2 1 
ATOM   1315 C CZ  . TYR A 1 177 ? 19.980 38.877 56.796 1.00 17.01 ? 177 TYR A CZ  1 
ATOM   1316 O OH  . TYR A 1 177 ? 20.666 39.667 55.900 1.00 16.07 ? 177 TYR A OH  1 
ATOM   1317 N N   . ASP A 1 178 ? 19.267 37.182 62.258 1.00 17.18 ? 178 ASP A N   1 
ATOM   1318 C CA  . ASP A 1 178 ? 20.469 37.663 62.924 1.00 17.67 ? 178 ASP A CA  1 
ATOM   1319 C C   . ASP A 1 178 ? 21.602 37.376 61.959 1.00 17.64 ? 178 ASP A C   1 
ATOM   1320 O O   . ASP A 1 178 ? 21.704 36.270 61.424 1.00 16.60 ? 178 ASP A O   1 
ATOM   1321 C CB  . ASP A 1 178 ? 20.677 36.900 64.241 1.00 20.08 ? 178 ASP A CB  1 
ATOM   1322 C CG  . ASP A 1 178 ? 21.929 37.348 65.005 1.00 20.99 ? 178 ASP A CG  1 
ATOM   1323 O OD1 . ASP A 1 178 ? 23.054 37.101 64.522 1.00 18.00 ? 178 ASP A OD1 1 
ATOM   1324 O OD2 . ASP A 1 178 ? 21.783 37.949 66.095 1.00 23.71 ? 178 ASP A OD2 1 
ATOM   1325 N N   . SER A 1 179 ? 22.444 38.369 61.715 1.00 18.36 ? 179 SER A N   1 
ATOM   1326 C CA  . SER A 1 179 ? 23.550 38.169 60.788 1.00 20.43 ? 179 SER A CA  1 
ATOM   1327 C C   . SER A 1 179 ? 24.541 37.111 61.279 1.00 21.45 ? 179 SER A C   1 
ATOM   1328 O O   . SER A 1 179 ? 25.311 36.577 60.491 1.00 22.34 ? 179 SER A O   1 
ATOM   1329 C CB  . SER A 1 179 ? 24.279 39.485 60.531 1.00 20.16 ? 179 SER A CB  1 
ATOM   1330 O OG  . SER A 1 179 ? 24.766 40.032 61.746 1.00 21.22 ? 179 SER A OG  1 
ATOM   1331 N N   . ASN A 1 180 ? 24.527 36.805 62.573 1.00 23.60 ? 180 ASN A N   1 
ATOM   1332 C CA  . ASN A 1 180 ? 25.431 35.786 63.107 1.00 26.56 ? 180 ASN A CA  1 
ATOM   1333 C C   . ASN A 1 180 ? 25.154 34.461 62.414 1.00 26.32 ? 180 ASN A C   1 
ATOM   1334 O O   . ASN A 1 180 ? 26.027 33.606 62.316 1.00 26.61 ? 180 ASN A O   1 
ATOM   1335 C CB  . ASN A 1 180 ? 25.282 35.653 64.626 1.00 29.96 ? 180 ASN A CB  1 
ATOM   1336 C CG  . ASN A 1 180 ? 26.325 36.468 65.387 1.00 33.40 ? 180 ASN A CG  1 
ATOM   1337 O OD1 . ASN A 1 180 ? 27.354 35.931 65.805 1.00 37.27 ? 180 ASN A OD1 1 
ATOM   1338 N ND2 . ASN A 1 180 ? 26.071 37.767 65.556 1.00 34.79 ? 180 ASN A ND2 1 
ATOM   1339 N N   . SER A 1 181 ? 23.929 34.293 61.939 1.00 26.39 ? 181 SER A N   1 
ATOM   1340 C CA  . SER A 1 181 ? 23.580 33.101 61.187 1.00 26.75 ? 181 SER A CA  1 
ATOM   1341 C C   . SER A 1 181 ? 22.609 33.538 60.083 1.00 25.47 ? 181 SER A C   1 
ATOM   1342 O O   . SER A 1 181 ? 21.412 33.250 60.111 1.00 26.56 ? 181 SER A O   1 
ATOM   1343 C CB  . SER A 1 181 ? 22.960 32.050 62.093 1.00 28.33 ? 181 SER A CB  1 
ATOM   1344 O OG  . SER A 1 181 ? 22.945 30.792 61.429 1.00 31.96 ? 181 SER A OG  1 
ATOM   1345 N N   . PRO A 1 182 ? 23.142 34.234 59.078 1.00 23.66 ? 182 PRO A N   1 
ATOM   1346 C CA  . PRO A 1 182 ? 22.424 34.770 57.925 1.00 23.80 ? 182 PRO A CA  1 
ATOM   1347 C C   . PRO A 1 182 ? 21.554 33.838 57.095 1.00 23.70 ? 182 PRO A C   1 
ATOM   1348 O O   . PRO A 1 182 ? 20.822 34.318 56.235 1.00 23.36 ? 182 PRO A O   1 
ATOM   1349 C CB  . PRO A 1 182 ? 23.542 35.402 57.102 1.00 22.40 ? 182 PRO A CB  1 
ATOM   1350 C CG  . PRO A 1 182 ? 24.668 34.486 57.355 1.00 22.89 ? 182 PRO A CG  1 
ATOM   1351 C CD  . PRO A 1 182 ? 24.593 34.330 58.852 1.00 22.72 ? 182 PRO A CD  1 
ATOM   1352 N N   . TYR A 1 183 ? 21.610 32.526 57.346 1.00 23.91 ? 183 TYR A N   1 
ATOM   1353 C CA  . TYR A 1 183 ? 20.805 31.575 56.566 1.00 22.29 ? 183 TYR A CA  1 
ATOM   1354 C C   . TYR A 1 183 ? 19.692 30.862 57.318 1.00 21.64 ? 183 TYR A C   1 
ATOM   1355 O O   . TYR A 1 183 ? 19.162 29.857 56.846 1.00 20.99 ? 183 TYR A O   1 
ATOM   1356 C CB  . TYR A 1 183 ? 21.687 30.535 55.914 1.00 21.88 ? 183 TYR A CB  1 
ATOM   1357 C CG  . TYR A 1 183 ? 22.869 31.129 55.228 1.00 23.61 ? 183 TYR A CG  1 
ATOM   1358 C CD1 . TYR A 1 183 ? 24.100 31.192 55.875 1.00 24.11 ? 183 TYR A CD1 1 
ATOM   1359 C CD2 . TYR A 1 183 ? 22.762 31.659 53.948 1.00 24.90 ? 183 TYR A CD2 1 
ATOM   1360 C CE1 . TYR A 1 183 ? 25.201 31.761 55.272 1.00 23.32 ? 183 TYR A CE1 1 
ATOM   1361 C CE2 . TYR A 1 183 ? 23.868 32.245 53.324 1.00 25.79 ? 183 TYR A CE2 1 
ATOM   1362 C CZ  . TYR A 1 183 ? 25.092 32.284 53.996 1.00 24.51 ? 183 TYR A CZ  1 
ATOM   1363 O OH  . TYR A 1 183 ? 26.226 32.772 53.377 1.00 25.83 ? 183 TYR A OH  1 
ATOM   1364 N N   . GLU A 1 184 ? 19.342 31.390 58.486 1.00 21.28 ? 184 GLU A N   1 
ATOM   1365 C CA  . GLU A 1 184 ? 18.255 30.859 59.303 1.00 20.82 ? 184 GLU A CA  1 
ATOM   1366 C C   . GLU A 1 184 ? 17.345 32.057 59.552 1.00 20.19 ? 184 GLU A C   1 
ATOM   1367 O O   . GLU A 1 184 ? 17.667 32.934 60.360 1.00 23.15 ? 184 GLU A O   1 
ATOM   1368 C CB  . GLU A 1 184 ? 18.798 30.302 60.616 1.00 19.93 ? 184 GLU A CB  1 
ATOM   1369 C CG  . GLU A 1 184 ? 19.663 29.073 60.414 1.00 19.65 ? 184 GLU A CG  1 
ATOM   1370 C CD  . GLU A 1 184 ? 20.384 28.630 61.674 1.00 20.38 ? 184 GLU A CD  1 
ATOM   1371 O OE1 . GLU A 1 184 ? 19.730 28.507 62.736 1.00 20.69 ? 184 GLU A OE1 1 
ATOM   1372 O OE2 . GLU A 1 184 ? 21.607 28.397 61.589 1.00 20.02 ? 184 GLU A OE2 1 
ATOM   1373 N N   . TRP A 1 185 ? 16.226 32.102 58.839 1.00 18.58 ? 185 TRP A N   1 
ATOM   1374 C CA  . TRP A 1 185 ? 15.296 33.214 58.959 1.00 18.08 ? 185 TRP A CA  1 
ATOM   1375 C C   . TRP A 1 185 ? 14.089 32.911 59.799 1.00 17.55 ? 185 TRP A C   1 
ATOM   1376 O O   . TRP A 1 185 ? 13.727 31.756 60.028 1.00 18.06 ? 185 TRP A O   1 
ATOM   1377 C CB  . TRP A 1 185 ? 14.798 33.665 57.591 1.00 19.31 ? 185 TRP A CB  1 
ATOM   1378 C CG  . TRP A 1 185 ? 15.852 34.125 56.655 1.00 20.14 ? 185 TRP A CG  1 
ATOM   1379 C CD1 . TRP A 1 185 ? 17.151 34.406 56.952 1.00 20.64 ? 185 TRP A CD1 1 
ATOM   1380 C CD2 . TRP A 1 185 ? 15.688 34.396 55.258 1.00 21.35 ? 185 TRP A CD2 1 
ATOM   1381 N NE1 . TRP A 1 185 ? 17.811 34.840 55.827 1.00 21.28 ? 185 TRP A NE1 1 
ATOM   1382 C CE2 . TRP A 1 185 ? 16.937 34.845 54.772 1.00 21.36 ? 185 TRP A CE2 1 
ATOM   1383 C CE3 . TRP A 1 185 ? 14.603 34.304 54.367 1.00 19.58 ? 185 TRP A CE3 1 
ATOM   1384 C CZ2 . TRP A 1 185 ? 17.134 35.204 53.433 1.00 20.44 ? 185 TRP A CZ2 1 
ATOM   1385 C CZ3 . TRP A 1 185 ? 14.796 34.656 53.042 1.00 17.45 ? 185 TRP A CZ3 1 
ATOM   1386 C CH2 . TRP A 1 185 ? 16.054 35.102 52.585 1.00 19.60 ? 185 TRP A CH2 1 
ATOM   1387 N N   . SER A 1 186 ? 13.447 33.980 60.233 1.00 15.55 ? 186 SER A N   1 
ATOM   1388 C CA  . SER A 1 186 ? 12.260 33.863 61.045 1.00 14.17 ? 186 SER A CA  1 
ATOM   1389 C C   . SER A 1 186 ? 11.167 33.203 60.211 1.00 12.99 ? 186 SER A C   1 
ATOM   1390 O O   . SER A 1 186 ? 11.376 32.834 59.064 1.00 10.03 ? 186 SER A O   1 
ATOM   1391 C CB  . SER A 1 186 ? 11.791 35.255 61.415 1.00 14.92 ? 186 SER A CB  1 
ATOM   1392 O OG  . SER A 1 186 ? 11.320 35.896 60.231 1.00 15.46 ? 186 SER A OG  1 
ATOM   1393 N N   . LEU A 1 187 ? 10.000 33.057 60.819 1.00 14.95 ? 187 LEU A N   1 
ATOM   1394 C CA  . LEU A 1 187 ? 8.829  32.526 60.154 1.00 16.02 ? 187 LEU A CA  1 
ATOM   1395 C C   . LEU A 1 187 ? 8.469  33.639 59.158 1.00 18.36 ? 187 LEU A C   1 
ATOM   1396 O O   . LEU A 1 187 ? 8.763  34.823 59.407 1.00 18.21 ? 187 LEU A O   1 
ATOM   1397 C CB  . LEU A 1 187 ? 7.674  32.386 61.146 1.00 13.18 ? 187 LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 187 ? 7.596  31.250 62.152 1.00 13.59 ? 187 LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 187 ? 6.578  31.613 63.223 1.00 11.07 ? 187 LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 187 ? 7.193  29.963 61.446 1.00 9.83  ? 187 LEU A CD2 1 
ATOM   1401 N N   . PRO A 1 188 ? 7.835  33.283 58.022 1.00 18.15 ? 188 PRO A N   1 
ATOM   1402 C CA  . PRO A 1 188 ? 7.477  34.326 57.061 1.00 19.44 ? 188 PRO A CA  1 
ATOM   1403 C C   . PRO A 1 188 ? 6.347  35.213 57.591 1.00 20.63 ? 188 PRO A C   1 
ATOM   1404 O O   . PRO A 1 188 ? 5.579  34.813 58.472 1.00 20.83 ? 188 PRO A O   1 
ATOM   1405 C CB  . PRO A 1 188 ? 7.050  33.524 55.835 1.00 18.55 ? 188 PRO A CB  1 
ATOM   1406 C CG  . PRO A 1 188 ? 6.371  32.355 56.452 1.00 18.55 ? 188 PRO A CG  1 
ATOM   1407 C CD  . PRO A 1 188 ? 7.331  31.970 57.577 1.00 17.93 ? 188 PRO A CD  1 
ATOM   1408 N N   . SER A 1 189 ? 6.264  36.426 57.061 1.00 21.88 ? 189 SER A N   1 
ATOM   1409 C CA  . SER A 1 189 ? 5.212  37.364 57.438 1.00 22.79 ? 189 SER A CA  1 
ATOM   1410 C C   . SER A 1 189 ? 4.008  36.906 56.640 1.00 23.03 ? 189 SER A C   1 
ATOM   1411 O O   . SER A 1 189 ? 4.134  36.066 55.746 1.00 22.18 ? 189 SER A O   1 
ATOM   1412 C CB  . SER A 1 189 ? 5.550  38.782 56.973 1.00 23.60 ? 189 SER A CB  1 
ATOM   1413 O OG  . SER A 1 189 ? 5.459  38.868 55.553 1.00 22.42 ? 189 SER A OG  1 
ATOM   1414 N N   . ASP A 1 190 ? 2.840  37.447 56.957 1.00 23.10 ? 190 ASP A N   1 
ATOM   1415 C CA  . ASP A 1 190 ? 1.666  37.093 56.190 1.00 23.69 ? 190 ASP A CA  1 
ATOM   1416 C C   . ASP A 1 190 ? 1.911  37.562 54.762 1.00 22.52 ? 190 ASP A C   1 
ATOM   1417 O O   . ASP A 1 190 ? 2.730  38.448 54.522 1.00 20.03 ? 190 ASP A O   1 
ATOM   1418 C CB  . ASP A 1 190 ? 0.421  37.752 56.783 1.00 24.71 ? 190 ASP A CB  1 
ATOM   1419 C CG  . ASP A 1 190 ? 0.028  37.125 58.103 1.00 26.80 ? 190 ASP A CG  1 
ATOM   1420 O OD1 . ASP A 1 190 ? 0.227  35.893 58.238 1.00 26.09 ? 190 ASP A OD1 1 
ATOM   1421 O OD2 . ASP A 1 190 ? -0.475 37.846 58.993 1.00 28.20 ? 190 ASP A OD2 1 
ATOM   1422 N N   . LEU A 1 191 ? 1.230  36.947 53.806 1.00 23.35 ? 191 LEU A N   1 
ATOM   1423 C CA  . LEU A 1 191 ? 1.416  37.340 52.419 1.00 24.86 ? 191 LEU A CA  1 
ATOM   1424 C C   . LEU A 1 191 ? 0.795  38.700 52.152 1.00 24.43 ? 191 LEU A C   1 
ATOM   1425 O O   . LEU A 1 191 ? -0.345 38.960 52.536 1.00 23.25 ? 191 LEU A O   1 
ATOM   1426 C CB  . LEU A 1 191 ? 0.791  36.317 51.480 1.00 27.90 ? 191 LEU A CB  1 
ATOM   1427 C CG  . LEU A 1 191 ? 1.033  36.655 50.013 1.00 29.24 ? 191 LEU A CG  1 
ATOM   1428 C CD1 . LEU A 1 191 ? 2.481  36.382 49.695 1.00 29.65 ? 191 LEU A CD1 1 
ATOM   1429 C CD2 . LEU A 1 191 ? 0.134  35.828 49.124 1.00 30.71 ? 191 LEU A CD2 1 
ATOM   1430 N N   . LEU A 1 192 ? 1.561  39.563 51.495 1.00 25.41 ? 192 LEU A N   1 
ATOM   1431 C CA  . LEU A 1 192 ? 1.113  40.906 51.146 1.00 25.05 ? 192 LEU A CA  1 
ATOM   1432 C C   . LEU A 1 192 ? 0.954  41.002 49.629 1.00 25.60 ? 192 LEU A C   1 
ATOM   1433 O O   . LEU A 1 192 ? 1.924  40.870 48.867 1.00 23.89 ? 192 LEU A O   1 
ATOM   1434 C CB  . LEU A 1 192 ? 2.124  41.934 51.625 1.00 24.89 ? 192 LEU A CB  1 
ATOM   1435 C CG  . LEU A 1 192 ? 1.785  43.380 51.270 1.00 26.09 ? 192 LEU A CG  1 
ATOM   1436 C CD1 . LEU A 1 192 ? 0.393  43.744 51.766 1.00 24.86 ? 192 LEU A CD1 1 
ATOM   1437 C CD2 . LEU A 1 192 ? 2.846  44.276 51.883 1.00 25.03 ? 192 LEU A CD2 1 
ATOM   1438 N N   . GLU A 1 193 ? -0.277 41.231 49.193 1.00 26.16 ? 193 GLU A N   1 
ATOM   1439 C CA  . GLU A 1 193 ? -0.563 41.310 47.770 1.00 27.82 ? 193 GLU A CA  1 
ATOM   1440 C C   . GLU A 1 193 ? -0.738 42.748 47.289 1.00 26.13 ? 193 GLU A C   1 
ATOM   1441 O O   . GLU A 1 193 ? -1.583 43.490 47.798 1.00 23.27 ? 193 GLU A O   1 
ATOM   1442 C CB  . GLU A 1 193 ? -1.826 40.495 47.464 1.00 30.78 ? 193 GLU A CB  1 
ATOM   1443 C CG  . GLU A 1 193 ? -2.143 40.313 45.984 1.00 36.37 ? 193 GLU A CG  1 
ATOM   1444 C CD  . GLU A 1 193 ? -3.540 39.760 45.770 1.00 39.66 ? 193 GLU A CD  1 
ATOM   1445 O OE1 . GLU A 1 193 ? -3.851 38.685 46.336 1.00 39.83 ? 193 GLU A OE1 1 
ATOM   1446 O OE2 . GLU A 1 193 ? -4.331 40.407 45.042 1.00 42.48 ? 193 GLU A OE2 1 
ATOM   1447 N N   . LEU A 1 194 ? 0.068  43.139 46.308 1.00 25.76 ? 194 LEU A N   1 
ATOM   1448 C CA  . LEU A 1 194 ? -0.027 44.481 45.757 1.00 26.71 ? 194 LEU A CA  1 
ATOM   1449 C C   . LEU A 1 194 ? -1.086 44.538 44.677 1.00 27.35 ? 194 LEU A C   1 
ATOM   1450 O O   . LEU A 1 194 ? -1.147 43.670 43.804 1.00 26.49 ? 194 LEU A O   1 
ATOM   1451 C CB  . LEU A 1 194 ? 1.303  44.929 45.158 1.00 26.38 ? 194 LEU A CB  1 
ATOM   1452 C CG  . LEU A 1 194 ? 2.404  45.316 46.140 1.00 28.18 ? 194 LEU A CG  1 
ATOM   1453 C CD1 . LEU A 1 194 ? 3.584  45.899 45.357 1.00 27.66 ? 194 LEU A CD1 1 
ATOM   1454 C CD2 . LEU A 1 194 ? 1.857  46.331 47.162 1.00 27.53 ? 194 LEU A CD2 1 
ATOM   1455 N N   . LEU A 1 195 ? -1.927 45.562 44.749 1.00 28.64 ? 195 LEU A N   1 
ATOM   1456 C CA  . LEU A 1 195 ? -2.973 45.760 43.758 1.00 30.66 ? 195 LEU A CA  1 
ATOM   1457 C C   . LEU A 1 195 ? -2.487 46.836 42.781 1.00 32.15 ? 195 LEU A C   1 
ATOM   1458 O O   . LEU A 1 195 ? -2.666 48.030 43.039 1.00 32.24 ? 195 LEU A O   1 
ATOM   1459 C CB  . LEU A 1 195 ? -4.259 46.235 44.439 1.00 31.88 ? 195 LEU A CB  1 
ATOM   1460 C CG  . LEU A 1 195 ? -5.623 45.658 44.042 1.00 32.83 ? 195 LEU A CG  1 
ATOM   1461 C CD1 . LEU A 1 195 ? -5.691 44.201 44.457 1.00 33.52 ? 195 LEU A CD1 1 
ATOM   1462 C CD2 . LEU A 1 195 ? -6.741 46.430 44.745 1.00 31.57 ? 195 LEU A CD2 1 
ATOM   1463 N N   . VAL A 1 196 ? -1.848 46.431 41.681 1.00 32.46 ? 196 VAL A N   1 
ATOM   1464 C CA  . VAL A 1 196 ? -1.374 47.401 40.695 1.00 32.58 ? 196 VAL A CA  1 
ATOM   1465 C C   . VAL A 1 196 ? -2.632 47.946 40.041 1.00 34.21 ? 196 VAL A C   1 
ATOM   1466 O O   . VAL A 1 196 ? -3.644 47.264 40.011 1.00 36.93 ? 196 VAL A O   1 
ATOM   1467 C CB  . VAL A 1 196 ? -0.480 46.728 39.660 1.00 31.24 ? 196 VAL A CB  1 
ATOM   1468 C CG1 . VAL A 1 196 ? 0.083  47.746 38.697 1.00 29.83 ? 196 VAL A CG1 1 
ATOM   1469 C CG2 . VAL A 1 196 ? 0.646  46.027 40.374 1.00 31.61 ? 196 VAL A CG2 1 
ATOM   1470 N N   . LEU A 1 197 ? -2.604 49.170 39.535 1.00 36.65 ? 197 LEU A N   1 
ATOM   1471 C CA  . LEU A 1 197 ? -3.813 49.726 38.934 1.00 37.34 ? 197 LEU A CA  1 
ATOM   1472 C C   . LEU A 1 197 ? -3.826 49.755 37.416 1.00 40.16 ? 197 LEU A C   1 
ATOM   1473 O O   . LEU A 1 197 ? -2.832 50.285 36.841 1.00 40.61 ? 197 LEU A O   1 
ATOM   1474 C CB  . LEU A 1 197 ? -4.045 51.126 39.470 1.00 35.61 ? 197 LEU A CB  1 
ATOM   1475 C CG  . LEU A 1 197 ? -5.450 51.364 39.993 1.00 34.44 ? 197 LEU A CG  1 
ATOM   1476 C CD1 . LEU A 1 197 ? -5.810 50.313 41.014 1.00 34.15 ? 197 LEU A CD1 1 
ATOM   1477 C CD2 . LEU A 1 197 ? -5.522 52.742 40.603 1.00 37.10 ? 197 LEU A CD2 1 
ATOM   1478 O OXT . LEU A 1 197 ? -4.852 49.241 36.856 1.00 43.56 ? 197 LEU A OXT 1 
ATOM   1479 N N   . GLY B 1 1   ? 28.185 48.250 61.842 1.00 44.63 ? 1   GLY B N   1 
ATOM   1480 C CA  . GLY B 1 1   ? 26.822 47.645 61.632 1.00 43.75 ? 1   GLY B CA  1 
ATOM   1481 C C   . GLY B 1 1   ? 26.847 46.366 60.809 1.00 43.42 ? 1   GLY B C   1 
ATOM   1482 O O   . GLY B 1 1   ? 27.793 45.580 60.886 1.00 45.18 ? 1   GLY B O   1 
ATOM   1483 N N   . HIS B 1 2   ? 25.794 46.147 60.029 1.00 42.30 ? 2   HIS B N   1 
ATOM   1484 C CA  . HIS B 1 2   ? 25.698 44.963 59.168 1.00 39.80 ? 2   HIS B CA  1 
ATOM   1485 C C   . HIS B 1 2   ? 25.239 45.378 57.770 1.00 38.54 ? 2   HIS B C   1 
ATOM   1486 O O   . HIS B 1 2   ? 24.116 45.869 57.616 1.00 39.11 ? 2   HIS B O   1 
ATOM   1487 C CB  . HIS B 1 2   ? 24.689 43.968 59.723 1.00 38.17 ? 2   HIS B CB  1 
ATOM   1488 C CG  . HIS B 1 2   ? 24.372 42.861 58.771 1.00 37.60 ? 2   HIS B CG  1 
ATOM   1489 N ND1 . HIS B 1 2   ? 23.097 42.357 58.607 1.00 36.26 ? 2   HIS B ND1 1 
ATOM   1490 C CD2 . HIS B 1 2   ? 25.163 42.161 57.924 1.00 36.77 ? 2   HIS B CD2 1 
ATOM   1491 C CE1 . HIS B 1 2   ? 23.120 41.398 57.701 1.00 33.98 ? 2   HIS B CE1 1 
ATOM   1492 N NE2 . HIS B 1 2   ? 24.361 41.258 57.270 1.00 34.29 ? 2   HIS B NE2 1 
ATOM   1493 N N   . LEU B 1 3   ? 26.081 45.175 56.756 1.00 36.09 ? 3   LEU B N   1 
ATOM   1494 C CA  . LEU B 1 3   ? 25.717 45.570 55.395 1.00 32.65 ? 3   LEU B CA  1 
ATOM   1495 C C   . LEU B 1 3   ? 25.469 44.413 54.457 1.00 30.76 ? 3   LEU B C   1 
ATOM   1496 O O   . LEU B 1 3   ? 26.381 43.930 53.776 1.00 30.87 ? 3   LEU B O   1 
ATOM   1497 C CB  . LEU B 1 3   ? 26.776 46.494 54.795 1.00 31.58 ? 3   LEU B CB  1 
ATOM   1498 C CG  . LEU B 1 3   ? 26.827 47.872 55.458 1.00 30.65 ? 3   LEU B CG  1 
ATOM   1499 C CD1 . LEU B 1 3   ? 27.896 48.712 54.795 1.00 31.42 ? 3   LEU B CD1 1 
ATOM   1500 C CD2 . LEU B 1 3   ? 25.475 48.559 55.344 1.00 29.93 ? 3   LEU B CD2 1 
ATOM   1501 N N   . PRO B 1 4   ? 24.207 43.973 54.389 1.00 28.67 ? 4   PRO B N   1 
ATOM   1502 C CA  . PRO B 1 4   ? 23.764 42.868 53.545 1.00 26.99 ? 4   PRO B CA  1 
ATOM   1503 C C   . PRO B 1 4   ? 24.130 43.060 52.079 1.00 26.31 ? 4   PRO B C   1 
ATOM   1504 O O   . PRO B 1 4   ? 23.804 44.068 51.469 1.00 24.39 ? 4   PRO B O   1 
ATOM   1505 C CB  . PRO B 1 4   ? 22.248 42.861 53.745 1.00 26.49 ? 4   PRO B CB  1 
ATOM   1506 C CG  . PRO B 1 4   ? 22.065 43.457 55.094 1.00 27.09 ? 4   PRO B CG  1 
ATOM   1507 C CD  . PRO B 1 4   ? 23.065 44.578 55.092 1.00 27.95 ? 4   PRO B CD  1 
ATOM   1508 N N   . LYS B 1 5   ? 24.822 42.076 51.534 1.00 26.91 ? 5   LYS B N   1 
ATOM   1509 C CA  . LYS B 1 5   ? 25.213 42.047 50.132 1.00 27.75 ? 5   LYS B CA  1 
ATOM   1510 C C   . LYS B 1 5   ? 23.926 42.219 49.283 1.00 28.11 ? 5   LYS B C   1 
ATOM   1511 O O   . LYS B 1 5   ? 22.946 41.488 49.479 1.00 28.72 ? 5   LYS B O   1 
ATOM   1512 C CB  . LYS B 1 5   ? 25.866 40.687 49.889 1.00 29.56 ? 5   LYS B CB  1 
ATOM   1513 C CG  . LYS B 1 5   ? 26.270 40.335 48.490 1.00 30.59 ? 5   LYS B CG  1 
ATOM   1514 C CD  . LYS B 1 5   ? 26.764 38.881 48.469 1.00 33.39 ? 5   LYS B CD  1 
ATOM   1515 C CE  . LYS B 1 5   ? 25.688 37.916 48.983 1.00 32.98 ? 5   LYS B CE  1 
ATOM   1516 N NZ  . LYS B 1 5   ? 26.128 36.502 48.922 1.00 33.67 ? 5   LYS B NZ  1 
ATOM   1517 N N   . PRO B 1 6   ? 23.914 43.185 48.332 1.00 26.95 ? 6   PRO B N   1 
ATOM   1518 C CA  . PRO B 1 6   ? 22.765 43.474 47.452 1.00 26.06 ? 6   PRO B CA  1 
ATOM   1519 C C   . PRO B 1 6   ? 22.423 42.348 46.486 1.00 25.65 ? 6   PRO B C   1 
ATOM   1520 O O   . PRO B 1 6   ? 23.261 41.481 46.216 1.00 24.55 ? 6   PRO B O   1 
ATOM   1521 C CB  . PRO B 1 6   ? 23.204 44.714 46.667 1.00 25.67 ? 6   PRO B CB  1 
ATOM   1522 C CG  . PRO B 1 6   ? 24.323 45.266 47.449 1.00 26.14 ? 6   PRO B CG  1 
ATOM   1523 C CD  . PRO B 1 6   ? 25.044 44.055 47.979 1.00 26.28 ? 6   PRO B CD  1 
ATOM   1524 N N   . THR B 1 7   ? 21.196 42.379 45.961 1.00 25.08 ? 7   THR B N   1 
ATOM   1525 C CA  . THR B 1 7   ? 20.732 41.376 44.989 1.00 25.55 ? 7   THR B CA  1 
ATOM   1526 C C   . THR B 1 7   ? 20.861 42.001 43.594 1.00 23.53 ? 7   THR B C   1 
ATOM   1527 O O   . THR B 1 7   ? 20.324 43.074 43.331 1.00 22.14 ? 7   THR B O   1 
ATOM   1528 C CB  . THR B 1 7   ? 19.243 40.973 45.211 1.00 25.79 ? 7   THR B CB  1 
ATOM   1529 O OG1 . THR B 1 7   ? 18.954 40.920 46.610 1.00 29.99 ? 7   THR B OG1 1 
ATOM   1530 C CG2 . THR B 1 7   ? 18.971 39.597 44.644 1.00 27.08 ? 7   THR B CG2 1 
ATOM   1531 N N   . LEU B 1 8   ? 21.570 41.322 42.702 1.00 22.20 ? 8   LEU B N   1 
ATOM   1532 C CA  . LEU B 1 8   ? 21.785 41.821 41.354 1.00 22.29 ? 8   LEU B CA  1 
ATOM   1533 C C   . LEU B 1 8   ? 21.180 40.893 40.298 1.00 23.77 ? 8   LEU B C   1 
ATOM   1534 O O   . LEU B 1 8   ? 21.605 39.743 40.156 1.00 23.50 ? 8   LEU B O   1 
ATOM   1535 C CB  . LEU B 1 8   ? 23.278 41.950 41.111 1.00 19.28 ? 8   LEU B CB  1 
ATOM   1536 C CG  . LEU B 1 8   ? 23.657 42.341 39.695 1.00 17.06 ? 8   LEU B CG  1 
ATOM   1537 C CD1 . LEU B 1 8   ? 23.277 43.795 39.460 1.00 17.22 ? 8   LEU B CD1 1 
ATOM   1538 C CD2 . LEU B 1 8   ? 25.134 42.126 39.496 1.00 13.14 ? 8   LEU B CD2 1 
ATOM   1539 N N   . TRP B 1 9   ? 20.190 41.398 39.562 1.00 25.38 ? 9   TRP B N   1 
ATOM   1540 C CA  . TRP B 1 9   ? 19.530 40.625 38.505 1.00 25.33 ? 9   TRP B CA  1 
ATOM   1541 C C   . TRP B 1 9   ? 19.394 41.470 37.238 1.00 25.51 ? 9   TRP B C   1 
ATOM   1542 O O   . TRP B 1 9   ? 19.855 42.611 37.180 1.00 25.70 ? 9   TRP B O   1 
ATOM   1543 C CB  . TRP B 1 9   ? 18.147 40.150 38.978 1.00 24.46 ? 9   TRP B CB  1 
ATOM   1544 C CG  . TRP B 1 9   ? 17.092 41.231 39.091 1.00 25.82 ? 9   TRP B CG  1 
ATOM   1545 C CD1 . TRP B 1 9   ? 16.045 41.448 38.236 1.00 26.13 ? 9   TRP B CD1 1 
ATOM   1546 C CD2 . TRP B 1 9   ? 16.954 42.199 40.140 1.00 25.50 ? 9   TRP B CD2 1 
ATOM   1547 N NE1 . TRP B 1 9   ? 15.263 42.482 38.694 1.00 27.06 ? 9   TRP B NE1 1 
ATOM   1548 C CE2 . TRP B 1 9   ? 15.796 42.961 39.860 1.00 26.64 ? 9   TRP B CE2 1 
ATOM   1549 C CE3 . TRP B 1 9   ? 17.694 42.496 41.289 1.00 25.52 ? 9   TRP B CE3 1 
ATOM   1550 C CZ2 . TRP B 1 9   ? 15.360 44.003 40.693 1.00 27.07 ? 9   TRP B CZ2 1 
ATOM   1551 C CZ3 . TRP B 1 9   ? 17.261 43.534 42.118 1.00 26.13 ? 9   TRP B CZ3 1 
ATOM   1552 C CH2 . TRP B 1 9   ? 16.105 44.273 41.815 1.00 26.71 ? 9   TRP B CH2 1 
ATOM   1553 N N   . ALA B 1 10  ? 18.771 40.910 36.213 1.00 26.78 ? 10  ALA B N   1 
ATOM   1554 C CA  . ALA B 1 10  ? 18.580 41.647 34.967 1.00 26.40 ? 10  ALA B CA  1 
ATOM   1555 C C   . ALA B 1 10  ? 17.157 41.465 34.440 1.00 26.07 ? 10  ALA B C   1 
ATOM   1556 O O   . ALA B 1 10  ? 16.527 40.425 34.645 1.00 25.03 ? 10  ALA B O   1 
ATOM   1557 C CB  . ALA B 1 10  ? 19.587 41.189 33.920 1.00 24.17 ? 10  ALA B CB  1 
ATOM   1558 N N   . GLU B 1 11  ? 16.658 42.504 33.780 1.00 27.11 ? 11  GLU B N   1 
ATOM   1559 C CA  . GLU B 1 11  ? 15.326 42.493 33.190 1.00 27.71 ? 11  GLU B CA  1 
ATOM   1560 C C   . GLU B 1 11  ? 15.518 42.791 31.703 1.00 26.59 ? 11  GLU B C   1 
ATOM   1561 O O   . GLU B 1 11  ? 16.214 43.734 31.325 1.00 26.11 ? 11  GLU B O   1 
ATOM   1562 C CB  . GLU B 1 11  ? 14.427 43.553 33.846 1.00 29.00 ? 11  GLU B CB  1 
ATOM   1563 C CG  . GLU B 1 11  ? 14.366 43.483 35.378 1.00 32.71 ? 11  GLU B CG  1 
ATOM   1564 C CD  . GLU B 1 11  ? 13.303 44.395 36.010 1.00 35.34 ? 11  GLU B CD  1 
ATOM   1565 O OE1 . GLU B 1 11  ? 13.290 45.621 35.746 1.00 36.53 ? 11  GLU B OE1 1 
ATOM   1566 O OE2 . GLU B 1 11  ? 12.476 43.876 36.794 1.00 36.62 ? 11  GLU B OE2 1 
ATOM   1567 N N   . PRO B 1 12  ? 14.886 41.997 30.837 1.00 26.36 ? 12  PRO B N   1 
ATOM   1568 C CA  . PRO B 1 12  ? 14.039 40.852 31.186 1.00 25.35 ? 12  PRO B CA  1 
ATOM   1569 C C   . PRO B 1 12  ? 14.792 39.571 31.555 1.00 24.52 ? 12  PRO B C   1 
ATOM   1570 O O   . PRO B 1 12  ? 14.176 38.594 31.979 1.00 23.85 ? 12  PRO B O   1 
ATOM   1571 C CB  . PRO B 1 12  ? 13.184 40.685 29.936 1.00 25.06 ? 12  PRO B CB  1 
ATOM   1572 C CG  . PRO B 1 12  ? 14.152 41.040 28.840 1.00 23.93 ? 12  PRO B CG  1 
ATOM   1573 C CD  . PRO B 1 12  ? 14.862 42.259 29.387 1.00 24.99 ? 12  PRO B CD  1 
ATOM   1574 N N   . GLY B 1 13  ? 16.117 39.579 31.391 1.00 24.37 ? 13  GLY B N   1 
ATOM   1575 C CA  . GLY B 1 13  ? 16.923 38.405 31.710 1.00 23.36 ? 13  GLY B CA  1 
ATOM   1576 C C   . GLY B 1 13  ? 18.397 38.599 31.391 1.00 22.17 ? 13  GLY B C   1 
ATOM   1577 O O   . GLY B 1 13  ? 18.764 39.627 30.835 1.00 22.19 ? 13  GLY B O   1 
ATOM   1578 N N   . SER B 1 14  ? 19.237 37.616 31.717 1.00 21.76 ? 14  SER B N   1 
ATOM   1579 C CA  . SER B 1 14  ? 20.682 37.722 31.476 1.00 20.26 ? 14  SER B CA  1 
ATOM   1580 C C   . SER B 1 14  ? 21.187 37.197 30.130 1.00 19.57 ? 14  SER B C   1 
ATOM   1581 O O   . SER B 1 14  ? 22.390 37.247 29.843 1.00 19.50 ? 14  SER B O   1 
ATOM   1582 C CB  . SER B 1 14  ? 21.458 37.049 32.616 1.00 19.71 ? 14  SER B CB  1 
ATOM   1583 O OG  . SER B 1 14  ? 21.005 35.728 32.823 1.00 21.43 ? 14  SER B OG  1 
ATOM   1584 N N   . VAL B 1 15  ? 20.271 36.687 29.314 1.00 18.34 ? 15  VAL B N   1 
ATOM   1585 C CA  . VAL B 1 15  ? 20.608 36.192 27.978 1.00 16.66 ? 15  VAL B CA  1 
ATOM   1586 C C   . VAL B 1 15  ? 19.786 37.084 27.047 1.00 15.96 ? 15  VAL B C   1 
ATOM   1587 O O   . VAL B 1 15  ? 18.572 36.924 26.938 1.00 15.76 ? 15  VAL B O   1 
ATOM   1588 C CB  . VAL B 1 15  ? 20.189 34.719 27.784 1.00 16.57 ? 15  VAL B CB  1 
ATOM   1589 C CG1 . VAL B 1 15  ? 20.658 34.224 26.422 1.00 15.98 ? 15  VAL B CG1 1 
ATOM   1590 C CG2 . VAL B 1 15  ? 20.774 33.861 28.873 1.00 14.89 ? 15  VAL B CG2 1 
ATOM   1591 N N   . ILE B 1 16  ? 20.448 38.034 26.394 1.00 14.60 ? 16  ILE B N   1 
ATOM   1592 C CA  . ILE B 1 16  ? 19.762 38.999 25.531 1.00 13.55 ? 16  ILE B CA  1 
ATOM   1593 C C   . ILE B 1 16  ? 20.309 39.017 24.109 1.00 13.55 ? 16  ILE B C   1 
ATOM   1594 O O   . ILE B 1 16  ? 21.509 39.153 23.896 1.00 12.01 ? 16  ILE B O   1 
ATOM   1595 C CB  . ILE B 1 16  ? 19.878 40.445 26.127 1.00 13.14 ? 16  ILE B CB  1 
ATOM   1596 C CG1 . ILE B 1 16  ? 19.472 40.442 27.616 1.00 11.96 ? 16  ILE B CG1 1 
ATOM   1597 C CG2 . ILE B 1 16  ? 19.044 41.434 25.301 1.00 11.48 ? 16  ILE B CG2 1 
ATOM   1598 C CD1 . ILE B 1 16  ? 18.030 40.040 27.912 1.00 7.60  ? 16  ILE B CD1 1 
ATOM   1599 N N   . THR B 1 17  ? 19.413 38.887 23.138 1.00 15.14 ? 17  THR B N   1 
ATOM   1600 C CA  . THR B 1 17  ? 19.811 38.886 21.737 1.00 15.70 ? 17  THR B CA  1 
ATOM   1601 C C   . THR B 1 17  ? 20.427 40.248 21.427 1.00 15.83 ? 17  THR B C   1 
ATOM   1602 O O   . THR B 1 17  ? 19.985 41.280 21.941 1.00 16.18 ? 17  THR B O   1 
ATOM   1603 C CB  . THR B 1 17  ? 18.598 38.663 20.798 1.00 15.42 ? 17  THR B CB  1 
ATOM   1604 O OG1 . THR B 1 17  ? 17.872 39.890 20.668 1.00 18.39 ? 17  THR B OG1 1 
ATOM   1605 C CG2 . THR B 1 17  ? 17.657 37.603 21.361 1.00 14.30 ? 17  THR B CG2 1 
ATOM   1606 N N   . GLN B 1 18  ? 21.449 40.255 20.589 1.00 16.53 ? 18  GLN B N   1 
ATOM   1607 C CA  . GLN B 1 18  ? 22.098 41.502 20.242 1.00 19.15 ? 18  GLN B CA  1 
ATOM   1608 C C   . GLN B 1 18  ? 21.084 42.504 19.682 1.00 20.21 ? 18  GLN B C   1 
ATOM   1609 O O   . GLN B 1 18  ? 20.204 42.142 18.893 1.00 21.16 ? 18  GLN B O   1 
ATOM   1610 C CB  . GLN B 1 18  ? 23.209 41.237 19.237 1.00 20.72 ? 18  GLN B CB  1 
ATOM   1611 C CG  . GLN B 1 18  ? 24.106 42.427 19.032 1.00 27.38 ? 18  GLN B CG  1 
ATOM   1612 C CD  . GLN B 1 18  ? 24.045 42.908 17.610 1.00 30.01 ? 18  GLN B CD  1 
ATOM   1613 O OE1 . GLN B 1 18  ? 23.026 42.720 16.950 1.00 31.19 ? 18  GLN B OE1 1 
ATOM   1614 N NE2 . GLN B 1 18  ? 25.122 43.542 17.124 1.00 31.17 ? 18  GLN B NE2 1 
ATOM   1615 N N   . GLY B 1 19  ? 21.204 43.760 20.107 1.00 20.65 ? 19  GLY B N   1 
ATOM   1616 C CA  . GLY B 1 19  ? 20.292 44.797 19.656 1.00 18.30 ? 19  GLY B CA  1 
ATOM   1617 C C   . GLY B 1 19  ? 19.174 45.134 20.637 1.00 18.89 ? 19  GLY B C   1 
ATOM   1618 O O   . GLY B 1 19  ? 18.646 46.247 20.600 1.00 18.96 ? 19  GLY B O   1 
ATOM   1619 N N   . SER B 1 20  ? 18.816 44.192 21.516 1.00 18.04 ? 20  SER B N   1 
ATOM   1620 C CA  . SER B 1 20  ? 17.740 44.396 22.495 1.00 17.68 ? 20  SER B CA  1 
ATOM   1621 C C   . SER B 1 20  ? 18.117 45.186 23.747 1.00 18.72 ? 20  SER B C   1 
ATOM   1622 O O   . SER B 1 20  ? 19.285 45.282 24.128 1.00 18.17 ? 20  SER B O   1 
ATOM   1623 C CB  . SER B 1 20  ? 17.167 43.051 22.957 1.00 17.57 ? 20  SER B CB  1 
ATOM   1624 O OG  . SER B 1 20  ? 16.781 42.238 21.867 1.00 17.64 ? 20  SER B OG  1 
ATOM   1625 N N   . PRO B 1 21  ? 17.109 45.764 24.411 1.00 19.94 ? 21  PRO B N   1 
ATOM   1626 C CA  . PRO B 1 21  ? 17.354 46.534 25.625 1.00 20.70 ? 21  PRO B CA  1 
ATOM   1627 C C   . PRO B 1 21  ? 17.438 45.540 26.765 1.00 21.63 ? 21  PRO B C   1 
ATOM   1628 O O   . PRO B 1 21  ? 16.965 44.407 26.650 1.00 23.61 ? 21  PRO B O   1 
ATOM   1629 C CB  . PRO B 1 21  ? 16.099 47.374 25.746 1.00 19.94 ? 21  PRO B CB  1 
ATOM   1630 C CG  . PRO B 1 21  ? 15.066 46.384 25.348 1.00 18.63 ? 21  PRO B CG  1 
ATOM   1631 C CD  . PRO B 1 21  ? 15.672 45.772 24.091 1.00 19.09 ? 21  PRO B CD  1 
ATOM   1632 N N   . VAL B 1 22  ? 18.030 45.970 27.868 1.00 21.30 ? 22  VAL B N   1 
ATOM   1633 C CA  . VAL B 1 22  ? 18.152 45.127 29.049 1.00 18.91 ? 22  VAL B CA  1 
ATOM   1634 C C   . VAL B 1 22  ? 18.467 46.063 30.212 1.00 17.96 ? 22  VAL B C   1 
ATOM   1635 O O   . VAL B 1 22  ? 19.208 47.031 30.045 1.00 17.85 ? 22  VAL B O   1 
ATOM   1636 C CB  . VAL B 1 22  ? 19.269 44.042 28.876 1.00 16.12 ? 22  VAL B CB  1 
ATOM   1637 C CG1 . VAL B 1 22  ? 20.625 44.704 28.649 1.00 15.00 ? 22  VAL B CG1 1 
ATOM   1638 C CG2 . VAL B 1 22  ? 19.303 43.134 30.099 1.00 14.51 ? 22  VAL B CG2 1 
ATOM   1639 N N   . THR B 1 23  ? 17.897 45.789 31.378 1.00 17.66 ? 23  THR B N   1 
ATOM   1640 C CA  . THR B 1 23  ? 18.127 46.634 32.534 1.00 19.89 ? 23  THR B CA  1 
ATOM   1641 C C   . THR B 1 23  ? 18.637 45.800 33.680 1.00 20.50 ? 23  THR B C   1 
ATOM   1642 O O   . THR B 1 23  ? 17.965 44.871 34.139 1.00 21.00 ? 23  THR B O   1 
ATOM   1643 C CB  . THR B 1 23  ? 16.839 47.345 32.942 1.00 18.88 ? 23  THR B CB  1 
ATOM   1644 O OG1 . THR B 1 23  ? 16.553 48.366 31.978 1.00 21.89 ? 23  THR B OG1 1 
ATOM   1645 C CG2 . THR B 1 23  ? 16.966 47.946 34.330 1.00 18.97 ? 23  THR B CG2 1 
ATOM   1646 N N   . LEU B 1 24  ? 19.845 46.120 34.123 1.00 20.79 ? 24  LEU B N   1 
ATOM   1647 C CA  . LEU B 1 24  ? 20.440 45.399 35.229 1.00 22.17 ? 24  LEU B CA  1 
ATOM   1648 C C   . LEU B 1 24  ? 20.014 46.070 36.512 1.00 20.98 ? 24  LEU B C   1 
ATOM   1649 O O   . LEU B 1 24  ? 20.137 47.279 36.651 1.00 21.22 ? 24  LEU B O   1 
ATOM   1650 C CB  . LEU B 1 24  ? 21.964 45.411 35.130 1.00 22.55 ? 24  LEU B CB  1 
ATOM   1651 C CG  . LEU B 1 24  ? 22.427 45.038 33.730 1.00 26.88 ? 24  LEU B CG  1 
ATOM   1652 C CD1 . LEU B 1 24  ? 23.914 44.713 33.690 1.00 28.77 ? 24  LEU B CD1 1 
ATOM   1653 C CD2 . LEU B 1 24  ? 21.626 43.838 33.295 1.00 30.38 ? 24  LEU B CD2 1 
ATOM   1654 N N   . ARG B 1 25  ? 19.514 45.279 37.450 1.00 21.26 ? 25  ARG B N   1 
ATOM   1655 C CA  . ARG B 1 25  ? 19.087 45.814 38.730 1.00 22.17 ? 25  ARG B CA  1 
ATOM   1656 C C   . ARG B 1 25  ? 20.012 45.339 39.853 1.00 23.47 ? 25  ARG B C   1 
ATOM   1657 O O   . ARG B 1 25  ? 20.449 44.179 39.900 1.00 22.42 ? 25  ARG B O   1 
ATOM   1658 C CB  . ARG B 1 25  ? 17.640 45.403 39.034 1.00 20.85 ? 25  ARG B CB  1 
ATOM   1659 C CG  . ARG B 1 25  ? 16.625 45.806 37.963 1.00 19.78 ? 25  ARG B CG  1 
ATOM   1660 C CD  . ARG B 1 25  ? 16.355 47.292 38.020 1.00 18.74 ? 25  ARG B CD  1 
ATOM   1661 N NE  . ARG B 1 25  ? 15.684 47.615 39.271 1.00 19.31 ? 25  ARG B NE  1 
ATOM   1662 C CZ  . ARG B 1 25  ? 14.378 47.468 39.479 1.00 20.03 ? 25  ARG B CZ  1 
ATOM   1663 N NH1 . ARG B 1 25  ? 13.590 47.012 38.509 1.00 21.71 ? 25  ARG B NH1 1 
ATOM   1664 N NH2 . ARG B 1 25  ? 13.859 47.757 40.663 1.00 19.68 ? 25  ARG B NH2 1 
ATOM   1665 N N   . CYS B 1 26  ? 20.314 46.278 40.739 1.00 25.03 ? 26  CYS B N   1 
ATOM   1666 C CA  . CYS B 1 26  ? 21.149 46.061 41.908 1.00 26.49 ? 26  CYS B CA  1 
ATOM   1667 C C   . CYS B 1 26  ? 20.309 46.713 42.991 1.00 27.59 ? 26  CYS B C   1 
ATOM   1668 O O   . CYS B 1 26  ? 20.168 47.937 43.007 1.00 27.30 ? 26  CYS B O   1 
ATOM   1669 C CB  . CYS B 1 26  ? 22.494 46.803 41.757 1.00 27.58 ? 26  CYS B CB  1 
ATOM   1670 S SG  . CYS B 1 26  ? 23.622 46.819 43.206 1.00 27.23 ? 26  CYS B SG  1 
ATOM   1671 N N   . GLN B 1 27  ? 19.709 45.911 43.866 1.00 29.02 ? 27  GLN B N   1 
ATOM   1672 C CA  . GLN B 1 27  ? 18.899 46.479 44.928 1.00 30.32 ? 27  GLN B CA  1 
ATOM   1673 C C   . GLN B 1 27  ? 19.253 45.978 46.310 1.00 31.78 ? 27  GLN B C   1 
ATOM   1674 O O   . GLN B 1 27  ? 19.815 44.898 46.473 1.00 32.04 ? 27  GLN B O   1 
ATOM   1675 C CB  . GLN B 1 27  ? 17.410 46.248 44.679 1.00 30.88 ? 27  GLN B CB  1 
ATOM   1676 C CG  . GLN B 1 27  ? 16.609 47.528 44.976 1.00 33.40 ? 27  GLN B CG  1 
ATOM   1677 C CD  . GLN B 1 27  ? 15.097 47.339 44.975 1.00 33.98 ? 27  GLN B CD  1 
ATOM   1678 O OE1 . GLN B 1 27  ? 14.509 47.022 43.942 1.00 35.89 ? 27  GLN B OE1 1 
ATOM   1679 N NE2 . GLN B 1 27  ? 14.463 47.540 46.131 1.00 34.46 ? 27  GLN B NE2 1 
ATOM   1680 N N   . GLY B 1 28  ? 18.914 46.799 47.299 1.00 33.52 ? 28  GLY B N   1 
ATOM   1681 C CA  . GLY B 1 28  ? 19.174 46.483 48.684 1.00 34.43 ? 28  GLY B CA  1 
ATOM   1682 C C   . GLY B 1 28  ? 18.039 46.902 49.601 1.00 35.67 ? 28  GLY B C   1 
ATOM   1683 O O   . GLY B 1 28  ? 16.868 46.669 49.321 1.00 35.28 ? 28  GLY B O   1 
ATOM   1684 N N   . GLY B 1 29  ? 18.383 47.567 50.691 1.00 37.60 ? 29  GLY B N   1 
ATOM   1685 C CA  . GLY B 1 29  ? 17.367 47.952 51.647 1.00 39.66 ? 29  GLY B CA  1 
ATOM   1686 C C   . GLY B 1 29  ? 16.468 49.159 51.494 1.00 40.76 ? 29  GLY B C   1 
ATOM   1687 O O   . GLY B 1 29  ? 15.255 49.004 51.395 1.00 42.69 ? 29  GLY B O   1 
ATOM   1688 N N   . GLN B 1 30  ? 17.034 50.356 51.484 1.00 40.78 ? 30  GLN B N   1 
ATOM   1689 C CA  . GLN B 1 30  ? 16.211 51.546 51.416 1.00 41.57 ? 30  GLN B CA  1 
ATOM   1690 C C   . GLN B 1 30  ? 15.692 51.943 50.042 1.00 40.89 ? 30  GLN B C   1 
ATOM   1691 O O   . GLN B 1 30  ? 15.697 51.147 49.104 1.00 42.03 ? 30  GLN B O   1 
ATOM   1692 C CB  . GLN B 1 30  ? 16.980 52.690 52.065 1.00 43.78 ? 30  GLN B CB  1 
ATOM   1693 C CG  . GLN B 1 30  ? 17.390 52.363 53.501 1.00 46.18 ? 30  GLN B CG  1 
ATOM   1694 C CD  . GLN B 1 30  ? 16.886 53.397 54.485 1.00 49.74 ? 30  GLN B CD  1 
ATOM   1695 O OE1 . GLN B 1 30  ? 15.934 54.128 54.194 1.00 50.56 ? 30  GLN B OE1 1 
ATOM   1696 N NE2 . GLN B 1 30  ? 17.510 53.462 55.658 1.00 51.10 ? 30  GLN B NE2 1 
ATOM   1697 N N   . GLU B 1 31  ? 15.236 53.184 49.941 1.00 39.89 ? 31  GLU B N   1 
ATOM   1698 C CA  . GLU B 1 31  ? 14.692 53.726 48.704 1.00 39.80 ? 31  GLU B CA  1 
ATOM   1699 C C   . GLU B 1 31  ? 15.787 54.157 47.757 1.00 38.49 ? 31  GLU B C   1 
ATOM   1700 O O   . GLU B 1 31  ? 15.571 54.258 46.553 1.00 37.62 ? 31  GLU B O   1 
ATOM   1701 C CB  . GLU B 1 31  ? 13.834 54.948 49.009 1.00 41.41 ? 31  GLU B CB  1 
ATOM   1702 C CG  . GLU B 1 31  ? 12.919 54.763 50.198 1.00 43.20 ? 31  GLU B CG  1 
ATOM   1703 C CD  . GLU B 1 31  ? 12.205 56.046 50.576 1.00 45.26 ? 31  GLU B CD  1 
ATOM   1704 O OE1 . GLU B 1 31  ? 11.829 56.813 49.661 1.00 44.20 ? 31  GLU B OE1 1 
ATOM   1705 O OE2 . GLU B 1 31  ? 12.003 56.285 51.788 1.00 45.77 ? 31  GLU B OE2 1 
ATOM   1706 N N   . THR B 1 32  ? 16.955 54.444 48.321 1.00 38.69 ? 32  THR B N   1 
ATOM   1707 C CA  . THR B 1 32  ? 18.093 54.913 47.544 1.00 38.15 ? 32  THR B CA  1 
ATOM   1708 C C   . THR B 1 32  ? 19.377 54.666 48.311 1.00 37.34 ? 32  THR B C   1 
ATOM   1709 O O   . THR B 1 32  ? 19.533 55.121 49.446 1.00 39.89 ? 32  THR B O   1 
ATOM   1710 C CB  . THR B 1 32  ? 17.997 56.447 47.253 1.00 37.95 ? 32  THR B CB  1 
ATOM   1711 O OG1 . THR B 1 32  ? 19.050 57.137 47.942 1.00 40.28 ? 32  THR B OG1 1 
ATOM   1712 C CG2 . THR B 1 32  ? 16.672 57.010 47.736 1.00 37.19 ? 32  THR B CG2 1 
ATOM   1713 N N   . GLN B 1 33  ? 20.289 53.929 47.701 1.00 35.35 ? 33  GLN B N   1 
ATOM   1714 C CA  . GLN B 1 33  ? 21.562 53.668 48.331 1.00 33.45 ? 33  GLN B CA  1 
ATOM   1715 C C   . GLN B 1 33  ? 22.622 53.993 47.314 1.00 32.48 ? 33  GLN B C   1 
ATOM   1716 O O   . GLN B 1 33  ? 22.334 54.089 46.123 1.00 30.05 ? 33  GLN B O   1 
ATOM   1717 C CB  . GLN B 1 33  ? 21.653 52.218 48.789 1.00 33.36 ? 33  GLN B CB  1 
ATOM   1718 C CG  . GLN B 1 33  ? 20.701 51.926 49.946 1.00 33.05 ? 33  GLN B CG  1 
ATOM   1719 C CD  . GLN B 1 33  ? 21.007 50.628 50.652 1.00 31.46 ? 33  GLN B CD  1 
ATOM   1720 O OE1 . GLN B 1 33  ? 21.076 49.566 50.032 1.00 31.91 ? 33  GLN B OE1 1 
ATOM   1721 N NE2 . GLN B 1 33  ? 21.185 50.705 51.962 1.00 31.69 ? 33  GLN B NE2 1 
ATOM   1722 N N   . GLU B 1 34  ? 23.845 54.201 47.784 1.00 33.38 ? 34  GLU B N   1 
ATOM   1723 C CA  . GLU B 1 34  ? 24.929 54.528 46.878 1.00 33.00 ? 34  GLU B CA  1 
ATOM   1724 C C   . GLU B 1 34  ? 25.392 53.262 46.181 1.00 31.04 ? 34  GLU B C   1 
ATOM   1725 O O   . GLU B 1 34  ? 26.472 52.746 46.448 1.00 30.80 ? 34  GLU B O   1 
ATOM   1726 C CB  . GLU B 1 34  ? 26.080 55.173 47.641 1.00 36.18 ? 34  GLU B CB  1 
ATOM   1727 C CG  . GLU B 1 34  ? 25.745 56.522 48.296 1.00 42.64 ? 34  GLU B CG  1 
ATOM   1728 C CD  . GLU B 1 34  ? 24.524 57.240 47.677 1.00 45.22 ? 34  GLU B CD  1 
ATOM   1729 O OE1 . GLU B 1 34  ? 23.376 56.965 48.098 1.00 46.73 ? 34  GLU B OE1 1 
ATOM   1730 O OE2 . GLU B 1 34  ? 24.703 58.084 46.769 1.00 46.60 ? 34  GLU B OE2 1 
ATOM   1731 N N   . TYR B 1 35  ? 24.550 52.755 45.291 1.00 29.25 ? 35  TYR B N   1 
ATOM   1732 C CA  . TYR B 1 35  ? 24.876 51.547 44.555 1.00 27.21 ? 35  TYR B CA  1 
ATOM   1733 C C   . TYR B 1 35  ? 26.001 51.806 43.571 1.00 26.88 ? 35  TYR B C   1 
ATOM   1734 O O   . TYR B 1 35  ? 26.162 52.918 43.059 1.00 26.53 ? 35  TYR B O   1 
ATOM   1735 C CB  . TYR B 1 35  ? 23.662 51.015 43.788 1.00 25.76 ? 35  TYR B CB  1 
ATOM   1736 C CG  . TYR B 1 35  ? 22.532 50.547 44.663 1.00 22.87 ? 35  TYR B CG  1 
ATOM   1737 C CD1 . TYR B 1 35  ? 21.365 51.301 44.787 1.00 21.03 ? 35  TYR B CD1 1 
ATOM   1738 C CD2 . TYR B 1 35  ? 22.630 49.353 45.371 1.00 21.02 ? 35  TYR B CD2 1 
ATOM   1739 C CE1 . TYR B 1 35  ? 20.326 50.878 45.589 1.00 20.03 ? 35  TYR B CE1 1 
ATOM   1740 C CE2 . TYR B 1 35  ? 21.595 48.917 46.178 1.00 20.96 ? 35  TYR B CE2 1 
ATOM   1741 C CZ  . TYR B 1 35  ? 20.443 49.679 46.283 1.00 21.05 ? 35  TYR B CZ  1 
ATOM   1742 O OH  . TYR B 1 35  ? 19.404 49.214 47.055 1.00 19.57 ? 35  TYR B OH  1 
ATOM   1743 N N   . ARG B 1 36  ? 26.772 50.758 43.312 1.00 26.44 ? 36  ARG B N   1 
ATOM   1744 C CA  . ARG B 1 36  ? 27.891 50.834 42.397 1.00 26.14 ? 36  ARG B CA  1 
ATOM   1745 C C   . ARG B 1 36  ? 28.022 49.564 41.587 1.00 23.17 ? 36  ARG B C   1 
ATOM   1746 O O   . ARG B 1 36  ? 28.343 48.508 42.130 1.00 22.94 ? 36  ARG B O   1 
ATOM   1747 C CB  . ARG B 1 36  ? 29.181 51.093 43.165 1.00 28.59 ? 36  ARG B CB  1 
ATOM   1748 C CG  . ARG B 1 36  ? 29.718 52.469 42.883 1.00 34.62 ? 36  ARG B CG  1 
ATOM   1749 C CD  . ARG B 1 36  ? 31.093 52.654 43.453 1.00 39.32 ? 36  ARG B CD  1 
ATOM   1750 N NE  . ARG B 1 36  ? 31.724 53.861 42.925 1.00 42.24 ? 36  ARG B NE  1 
ATOM   1751 C CZ  . ARG B 1 36  ? 31.936 54.091 41.631 1.00 43.74 ? 36  ARG B CZ  1 
ATOM   1752 N NH1 . ARG B 1 36  ? 31.568 53.196 40.714 1.00 43.77 ? 36  ARG B NH1 1 
ATOM   1753 N NH2 . ARG B 1 36  ? 32.523 55.220 41.252 1.00 44.40 ? 36  ARG B NH2 1 
ATOM   1754 N N   . LEU B 1 37  ? 27.780 49.680 40.285 1.00 20.65 ? 37  LEU B N   1 
ATOM   1755 C CA  . LEU B 1 37  ? 27.856 48.539 39.387 1.00 19.15 ? 37  LEU B CA  1 
ATOM   1756 C C   . LEU B 1 37  ? 29.195 48.475 38.678 1.00 17.06 ? 37  LEU B C   1 
ATOM   1757 O O   . LEU B 1 37  ? 29.720 49.494 38.234 1.00 16.95 ? 37  LEU B O   1 
ATOM   1758 C CB  . LEU B 1 37  ? 26.738 48.597 38.338 1.00 19.21 ? 37  LEU B CB  1 
ATOM   1759 C CG  . LEU B 1 37  ? 26.739 47.353 37.440 1.00 20.51 ? 37  LEU B CG  1 
ATOM   1760 C CD1 . LEU B 1 37  ? 26.434 46.131 38.310 1.00 19.97 ? 37  LEU B CD1 1 
ATOM   1761 C CD2 . LEU B 1 37  ? 25.727 47.479 36.318 1.00 17.44 ? 37  LEU B CD2 1 
ATOM   1762 N N   . TYR B 1 38  ? 29.739 47.272 38.553 1.00 15.16 ? 38  TYR B N   1 
ATOM   1763 C CA  . TYR B 1 38  ? 31.022 47.108 37.879 1.00 14.22 ? 38  TYR B CA  1 
ATOM   1764 C C   . TYR B 1 38  ? 31.168 45.727 37.260 1.00 13.33 ? 38  TYR B C   1 
ATOM   1765 O O   . TYR B 1 38  ? 30.568 44.747 37.719 1.00 13.67 ? 38  TYR B O   1 
ATOM   1766 C CB  . TYR B 1 38  ? 32.181 47.366 38.856 1.00 11.29 ? 38  TYR B CB  1 
ATOM   1767 C CG  . TYR B 1 38  ? 32.352 46.303 39.925 1.00 8.42  ? 38  TYR B CG  1 
ATOM   1768 C CD1 . TYR B 1 38  ? 33.286 45.276 39.767 1.00 6.19  ? 38  TYR B CD1 1 
ATOM   1769 C CD2 . TYR B 1 38  ? 31.590 46.336 41.095 1.00 6.10  ? 38  TYR B CD2 1 
ATOM   1770 C CE1 . TYR B 1 38  ? 33.462 44.311 40.744 1.00 5.76  ? 38  TYR B CE1 1 
ATOM   1771 C CE2 . TYR B 1 38  ? 31.753 45.377 42.085 1.00 6.59  ? 38  TYR B CE2 1 
ATOM   1772 C CZ  . TYR B 1 38  ? 32.696 44.362 41.904 1.00 8.32  ? 38  TYR B CZ  1 
ATOM   1773 O OH  . TYR B 1 38  ? 32.884 43.405 42.883 1.00 7.96  ? 38  TYR B OH  1 
ATOM   1774 N N   . ARG B 1 39  ? 31.986 45.668 36.223 1.00 13.69 ? 39  ARG B N   1 
ATOM   1775 C CA  . ARG B 1 39  ? 32.239 44.436 35.494 1.00 15.41 ? 39  ARG B CA  1 
ATOM   1776 C C   . ARG B 1 39  ? 33.609 43.845 35.852 1.00 16.00 ? 39  ARG B C   1 
ATOM   1777 O O   . ARG B 1 39  ? 34.540 44.564 36.212 1.00 14.96 ? 39  ARG B O   1 
ATOM   1778 C CB  . ARG B 1 39  ? 32.167 44.735 33.994 1.00 14.65 ? 39  ARG B CB  1 
ATOM   1779 C CG  . ARG B 1 39  ? 32.265 43.530 33.091 1.00 14.86 ? 39  ARG B CG  1 
ATOM   1780 C CD  . ARG B 1 39  ? 31.982 43.884 31.624 1.00 14.60 ? 39  ARG B CD  1 
ATOM   1781 N NE  . ARG B 1 39  ? 32.965 44.802 31.058 1.00 12.64 ? 39  ARG B NE  1 
ATOM   1782 C CZ  . ARG B 1 39  ? 33.019 45.129 29.771 1.00 13.04 ? 39  ARG B CZ  1 
ATOM   1783 N NH1 . ARG B 1 39  ? 32.140 44.608 28.918 1.00 15.55 ? 39  ARG B NH1 1 
ATOM   1784 N NH2 . ARG B 1 39  ? 33.947 45.974 29.335 1.00 9.84  ? 39  ARG B NH2 1 
ATOM   1785 N N   . GLU B 1 40  ? 33.730 42.529 35.770 1.00 17.46 ? 40  GLU B N   1 
ATOM   1786 C CA  . GLU B 1 40  ? 35.002 41.891 36.060 1.00 18.39 ? 40  GLU B CA  1 
ATOM   1787 C C   . GLU B 1 40  ? 35.857 41.814 34.797 1.00 18.72 ? 40  GLU B C   1 
ATOM   1788 O O   . GLU B 1 40  ? 35.339 41.820 33.678 1.00 18.66 ? 40  GLU B O   1 
ATOM   1789 C CB  . GLU B 1 40  ? 34.784 40.479 36.588 1.00 18.10 ? 40  GLU B CB  1 
ATOM   1790 C CG  . GLU B 1 40  ? 34.108 40.393 37.933 1.00 20.34 ? 40  GLU B CG  1 
ATOM   1791 C CD  . GLU B 1 40  ? 34.069 38.966 38.450 1.00 22.61 ? 40  GLU B CD  1 
ATOM   1792 O OE1 . GLU B 1 40  ? 34.305 38.024 37.648 1.00 20.85 ? 40  GLU B OE1 1 
ATOM   1793 O OE2 . GLU B 1 40  ? 33.793 38.796 39.659 1.00 23.53 ? 40  GLU B OE2 1 
ATOM   1794 N N   . LYS B 1 41  ? 37.168 41.734 35.005 1.00 19.11 ? 41  LYS B N   1 
ATOM   1795 C CA  . LYS B 1 41  ? 38.182 41.619 33.952 1.00 18.22 ? 41  LYS B CA  1 
ATOM   1796 C C   . LYS B 1 41  ? 38.311 42.763 32.962 1.00 15.80 ? 41  LYS B C   1 
ATOM   1797 O O   . LYS B 1 41  ? 39.363 42.949 32.355 1.00 13.92 ? 41  LYS B O   1 
ATOM   1798 C CB  . LYS B 1 41  ? 38.016 40.280 33.235 1.00 21.05 ? 41  LYS B CB  1 
ATOM   1799 C CG  . LYS B 1 41  ? 38.258 39.078 34.193 1.00 28.24 ? 41  LYS B CG  1 
ATOM   1800 C CD  . LYS B 1 41  ? 39.542 39.308 35.086 1.00 32.56 ? 41  LYS B CD  1 
ATOM   1801 C CE  . LYS B 1 41  ? 39.925 38.135 36.011 1.00 31.95 ? 41  LYS B CE  1 
ATOM   1802 N NZ  . LYS B 1 41  ? 38.840 37.848 36.984 1.00 35.09 ? 41  LYS B NZ  1 
ATOM   1803 N N   . LYS B 1 42  ? 37.248 43.532 32.796 1.00 14.79 ? 42  LYS B N   1 
ATOM   1804 C CA  . LYS B 1 42  ? 37.292 44.676 31.913 1.00 14.68 ? 42  LYS B CA  1 
ATOM   1805 C C   . LYS B 1 42  ? 36.248 45.679 32.357 1.00 15.32 ? 42  LYS B C   1 
ATOM   1806 O O   . LYS B 1 42  ? 35.078 45.325 32.585 1.00 15.08 ? 42  LYS B O   1 
ATOM   1807 C CB  . LYS B 1 42  ? 37.070 44.276 30.457 1.00 13.55 ? 42  LYS B CB  1 
ATOM   1808 C CG  . LYS B 1 42  ? 37.072 45.475 29.521 1.00 15.18 ? 42  LYS B CG  1 
ATOM   1809 C CD  . LYS B 1 42  ? 37.109 45.099 28.055 1.00 15.34 ? 42  LYS B CD  1 
ATOM   1810 C CE  . LYS B 1 42  ? 37.117 46.361 27.203 1.00 15.71 ? 42  LYS B CE  1 
ATOM   1811 N NZ  . LYS B 1 42  ? 37.530 46.072 25.801 1.00 16.78 ? 42  LYS B NZ  1 
ATOM   1812 N N   . THR B 1 43  ? 36.701 46.922 32.509 1.00 16.52 ? 43  THR B N   1 
ATOM   1813 C CA  . THR B 1 43  ? 35.842 48.010 32.940 1.00 18.98 ? 43  THR B CA  1 
ATOM   1814 C C   . THR B 1 43  ? 34.758 48.282 31.886 1.00 19.01 ? 43  THR B C   1 
ATOM   1815 O O   . THR B 1 43  ? 35.004 48.231 30.666 1.00 20.24 ? 43  THR B O   1 
ATOM   1816 C CB  . THR B 1 43  ? 36.688 49.325 33.324 1.00 19.11 ? 43  THR B CB  1 
ATOM   1817 O OG1 . THR B 1 43  ? 36.140 50.488 32.688 1.00 20.25 ? 43  THR B OG1 1 
ATOM   1818 C CG2 . THR B 1 43  ? 38.163 49.179 32.943 1.00 20.22 ? 43  THR B CG2 1 
ATOM   1819 N N   . ALA B 1 44  ? 33.552 48.530 32.396 1.00 18.72 ? 44  ALA B N   1 
ATOM   1820 C CA  . ALA B 1 44  ? 32.375 48.812 31.585 1.00 20.10 ? 44  ALA B CA  1 
ATOM   1821 C C   . ALA B 1 44  ? 32.066 50.316 31.528 1.00 20.20 ? 44  ALA B C   1 
ATOM   1822 O O   . ALA B 1 44  ? 31.457 50.875 32.452 1.00 19.14 ? 44  ALA B O   1 
ATOM   1823 C CB  . ALA B 1 44  ? 31.164 48.046 32.138 1.00 19.53 ? 44  ALA B CB  1 
ATOM   1824 N N   . LEU B 1 45  ? 32.476 50.957 30.432 1.00 21.33 ? 45  LEU B N   1 
ATOM   1825 C CA  . LEU B 1 45  ? 32.254 52.387 30.239 1.00 24.11 ? 45  LEU B CA  1 
ATOM   1826 C C   . LEU B 1 45  ? 30.787 52.762 30.313 1.00 23.78 ? 45  LEU B C   1 
ATOM   1827 O O   . LEU B 1 45  ? 30.416 53.755 30.946 1.00 24.31 ? 45  LEU B O   1 
ATOM   1828 C CB  . LEU B 1 45  ? 32.809 52.849 28.893 1.00 27.32 ? 45  LEU B CB  1 
ATOM   1829 C CG  . LEU B 1 45  ? 34.327 52.760 28.741 1.00 31.69 ? 45  LEU B CG  1 
ATOM   1830 C CD1 . LEU B 1 45  ? 34.748 53.226 27.333 1.00 33.69 ? 45  LEU B CD1 1 
ATOM   1831 C CD2 . LEU B 1 45  ? 34.996 53.608 29.819 1.00 32.72 ? 45  LEU B CD2 1 
ATOM   1832 N N   . TRP B 1 46  ? 29.939 51.973 29.666 1.00 22.04 ? 46  TRP B N   1 
ATOM   1833 C CA  . TRP B 1 46  ? 28.519 52.291 29.683 1.00 20.57 ? 46  TRP B CA  1 
ATOM   1834 C C   . TRP B 1 46  ? 27.944 52.530 31.083 1.00 19.50 ? 46  TRP B C   1 
ATOM   1835 O O   . TRP B 1 46  ? 26.962 53.250 31.221 1.00 20.19 ? 46  TRP B O   1 
ATOM   1836 C CB  . TRP B 1 46  ? 27.711 51.196 29.005 1.00 18.37 ? 46  TRP B CB  1 
ATOM   1837 C CG  . TRP B 1 46  ? 27.601 49.934 29.810 1.00 17.07 ? 46  TRP B CG  1 
ATOM   1838 C CD1 . TRP B 1 46  ? 28.447 48.856 29.775 1.00 15.89 ? 46  TRP B CD1 1 
ATOM   1839 C CD2 . TRP B 1 46  ? 26.562 49.601 30.735 1.00 15.32 ? 46  TRP B CD2 1 
ATOM   1840 N NE1 . TRP B 1 46  ? 27.989 47.874 30.614 1.00 13.20 ? 46  TRP B NE1 1 
ATOM   1841 C CE2 . TRP B 1 46  ? 26.837 48.304 31.219 1.00 14.89 ? 46  TRP B CE2 1 
ATOM   1842 C CE3 . TRP B 1 46  ? 25.422 50.275 31.203 1.00 15.21 ? 46  TRP B CE3 1 
ATOM   1843 C CZ2 . TRP B 1 46  ? 26.013 47.660 32.151 1.00 16.51 ? 46  TRP B CZ2 1 
ATOM   1844 C CZ3 . TRP B 1 46  ? 24.597 49.632 32.135 1.00 15.75 ? 46  TRP B CZ3 1 
ATOM   1845 C CH2 . TRP B 1 46  ? 24.900 48.339 32.597 1.00 16.13 ? 46  TRP B CH2 1 
ATOM   1846 N N   . ILE B 1 47  ? 28.536 51.935 32.117 1.00 18.26 ? 47  ILE B N   1 
ATOM   1847 C CA  . ILE B 1 47  ? 28.016 52.117 33.478 1.00 19.78 ? 47  ILE B CA  1 
ATOM   1848 C C   . ILE B 1 47  ? 28.187 53.540 34.000 1.00 20.23 ? 47  ILE B C   1 
ATOM   1849 O O   . ILE B 1 47  ? 27.424 54.002 34.847 1.00 18.39 ? 47  ILE B O   1 
ATOM   1850 C CB  . ILE B 1 47  ? 28.679 51.152 34.497 1.00 20.00 ? 47  ILE B CB  1 
ATOM   1851 C CG1 . ILE B 1 47  ? 28.547 49.712 34.001 1.00 20.46 ? 47  ILE B CG1 1 
ATOM   1852 C CG2 . ILE B 1 47  ? 27.983 51.272 35.861 1.00 19.55 ? 47  ILE B CG2 1 
ATOM   1853 C CD1 . ILE B 1 47  ? 28.928 48.663 35.019 1.00 21.22 ? 47  ILE B CD1 1 
ATOM   1854 N N   . THR B 1 48  ? 29.189 54.225 33.469 1.00 22.45 ? 48  THR B N   1 
ATOM   1855 C CA  . THR B 1 48  ? 29.505 55.584 33.857 1.00 23.75 ? 48  THR B CA  1 
ATOM   1856 C C   . THR B 1 48  ? 28.566 56.596 33.188 1.00 26.86 ? 48  THR B C   1 
ATOM   1857 O O   . THR B 1 48  ? 28.475 57.747 33.613 1.00 28.06 ? 48  THR B O   1 
ATOM   1858 C CB  . THR B 1 48  ? 30.948 55.899 33.484 1.00 22.92 ? 48  THR B CB  1 
ATOM   1859 O OG1 . THR B 1 48  ? 31.026 56.154 32.077 1.00 24.05 ? 48  THR B OG1 1 
ATOM   1860 C CG2 . THR B 1 48  ? 31.853 54.709 33.825 1.00 22.41 ? 48  THR B CG2 1 
ATOM   1861 N N   . ARG B 1 49  ? 27.863 56.176 32.147 1.00 28.39 ? 49  ARG B N   1 
ATOM   1862 C CA  . ARG B 1 49  ? 26.937 57.074 31.478 1.00 30.63 ? 49  ARG B CA  1 
ATOM   1863 C C   . ARG B 1 49  ? 25.576 57.033 32.159 1.00 31.43 ? 49  ARG B C   1 
ATOM   1864 O O   . ARG B 1 49  ? 24.639 57.711 31.734 1.00 32.31 ? 49  ARG B O   1 
ATOM   1865 C CB  . ARG B 1 49  ? 26.746 56.674 30.023 1.00 33.18 ? 49  ARG B CB  1 
ATOM   1866 C CG  . ARG B 1 49  ? 27.976 56.780 29.158 1.00 37.66 ? 49  ARG B CG  1 
ATOM   1867 C CD  . ARG B 1 49  ? 27.703 56.060 27.838 1.00 40.46 ? 49  ARG B CD  1 
ATOM   1868 N NE  . ARG B 1 49  ? 28.922 55.527 27.223 1.00 44.30 ? 49  ARG B NE  1 
ATOM   1869 C CZ  . ARG B 1 49  ? 28.967 54.460 26.422 1.00 45.42 ? 49  ARG B CZ  1 
ATOM   1870 N NH1 . ARG B 1 49  ? 27.858 53.786 26.123 1.00 46.57 ? 49  ARG B NH1 1 
ATOM   1871 N NH2 . ARG B 1 49  ? 30.127 54.060 25.914 1.00 46.66 ? 49  ARG B NH2 1 
ATOM   1872 N N   . ILE B 1 50  ? 25.447 56.237 33.212 1.00 31.21 ? 50  ILE B N   1 
ATOM   1873 C CA  . ILE B 1 50  ? 24.161 56.151 33.892 1.00 31.34 ? 50  ILE B CA  1 
ATOM   1874 C C   . ILE B 1 50  ? 23.931 57.334 34.830 1.00 33.32 ? 50  ILE B C   1 
ATOM   1875 O O   . ILE B 1 50  ? 24.721 57.599 35.744 1.00 34.31 ? 50  ILE B O   1 
ATOM   1876 C CB  . ILE B 1 50  ? 24.017 54.820 34.682 1.00 29.57 ? 50  ILE B CB  1 
ATOM   1877 C CG1 . ILE B 1 50  ? 24.218 53.632 33.733 1.00 28.84 ? 50  ILE B CG1 1 
ATOM   1878 C CG2 . ILE B 1 50  ? 22.650 54.744 35.351 1.00 26.74 ? 50  ILE B CG2 1 
ATOM   1879 C CD1 . ILE B 1 50  ? 23.326 53.645 32.506 1.00 26.01 ? 50  ILE B CD1 1 
ATOM   1880 N N   . PRO B 1 51  ? 22.843 58.078 34.599 1.00 34.51 ? 51  PRO B N   1 
ATOM   1881 C CA  . PRO B 1 51  ? 22.498 59.242 35.423 1.00 34.27 ? 51  PRO B CA  1 
ATOM   1882 C C   . PRO B 1 51  ? 22.426 58.862 36.893 1.00 34.70 ? 51  PRO B C   1 
ATOM   1883 O O   . PRO B 1 51  ? 22.087 57.727 37.227 1.00 34.85 ? 51  PRO B O   1 
ATOM   1884 C CB  . PRO B 1 51  ? 21.138 59.658 34.873 1.00 33.45 ? 51  PRO B CB  1 
ATOM   1885 C CG  . PRO B 1 51  ? 21.221 59.243 33.425 1.00 33.79 ? 51  PRO B CG  1 
ATOM   1886 C CD  . PRO B 1 51  ? 21.876 57.893 33.501 1.00 33.88 ? 51  PRO B CD  1 
ATOM   1887 N N   . GLN B 1 52  ? 22.745 59.804 37.775 1.00 36.23 ? 52  GLN B N   1 
ATOM   1888 C CA  . GLN B 1 52  ? 22.691 59.517 39.203 1.00 36.70 ? 52  GLN B CA  1 
ATOM   1889 C C   . GLN B 1 52  ? 21.289 59.236 39.679 1.00 36.55 ? 52  GLN B C   1 
ATOM   1890 O O   . GLN B 1 52  ? 21.104 58.591 40.703 1.00 35.41 ? 52  GLN B O   1 
ATOM   1891 C CB  . GLN B 1 52  ? 23.259 60.667 40.018 1.00 38.80 ? 52  GLN B CB  1 
ATOM   1892 C CG  . GLN B 1 52  ? 24.765 60.700 40.025 1.00 43.23 ? 52  GLN B CG  1 
ATOM   1893 C CD  . GLN B 1 52  ? 25.377 59.303 40.060 1.00 45.62 ? 52  GLN B CD  1 
ATOM   1894 O OE1 . GLN B 1 52  ? 25.611 58.688 39.012 1.00 45.14 ? 52  GLN B OE1 1 
ATOM   1895 N NE2 . GLN B 1 52  ? 25.628 58.790 41.272 1.00 47.85 ? 52  GLN B NE2 1 
ATOM   1896 N N   . GLU B 1 53  ? 20.305 59.732 38.935 1.00 37.61 ? 53  GLU B N   1 
ATOM   1897 C CA  . GLU B 1 53  ? 18.896 59.537 39.277 1.00 38.45 ? 53  GLU B CA  1 
ATOM   1898 C C   . GLU B 1 53  ? 18.550 58.056 39.306 1.00 36.37 ? 53  GLU B C   1 
ATOM   1899 O O   . GLU B 1 53  ? 17.829 57.586 40.191 1.00 35.38 ? 53  GLU B O   1 
ATOM   1900 C CB  . GLU B 1 53  ? 17.977 60.234 38.255 1.00 41.72 ? 53  GLU B CB  1 
ATOM   1901 C CG  . GLU B 1 53  ? 17.711 61.716 38.485 1.00 46.21 ? 53  GLU B CG  1 
ATOM   1902 C CD  . GLU B 1 53  ? 18.914 62.587 38.218 1.00 49.38 ? 53  GLU B CD  1 
ATOM   1903 O OE1 . GLU B 1 53  ? 19.323 62.705 37.038 1.00 50.65 ? 53  GLU B OE1 1 
ATOM   1904 O OE2 . GLU B 1 53  ? 19.450 63.152 39.198 1.00 52.21 ? 53  GLU B OE2 1 
ATOM   1905 N N   . LEU B 1 54  ? 19.052 57.327 38.316 1.00 35.36 ? 54  LEU B N   1 
ATOM   1906 C CA  . LEU B 1 54  ? 18.793 55.899 38.230 1.00 34.34 ? 54  LEU B CA  1 
ATOM   1907 C C   . LEU B 1 54  ? 19.702 55.134 39.177 1.00 32.80 ? 54  LEU B C   1 
ATOM   1908 O O   . LEU B 1 54  ? 19.240 54.268 39.917 1.00 32.72 ? 54  LEU B O   1 
ATOM   1909 C CB  . LEU B 1 54  ? 19.012 55.400 36.803 1.00 34.34 ? 54  LEU B CB  1 
ATOM   1910 C CG  . LEU B 1 54  ? 18.112 55.985 35.716 1.00 33.95 ? 54  LEU B CG  1 
ATOM   1911 C CD1 . LEU B 1 54  ? 18.427 55.305 34.383 1.00 33.88 ? 54  LEU B CD1 1 
ATOM   1912 C CD2 . LEU B 1 54  ? 16.663 55.776 36.098 1.00 32.70 ? 54  LEU B CD2 1 
ATOM   1913 N N   . VAL B 1 55  ? 20.991 55.469 39.158 1.00 31.41 ? 55  VAL B N   1 
ATOM   1914 C CA  . VAL B 1 55  ? 21.966 54.802 40.009 1.00 31.38 ? 55  VAL B CA  1 
ATOM   1915 C C   . VAL B 1 55  ? 21.527 54.683 41.470 1.00 33.00 ? 55  VAL B C   1 
ATOM   1916 O O   . VAL B 1 55  ? 21.635 53.605 42.067 1.00 33.53 ? 55  VAL B O   1 
ATOM   1917 C CB  . VAL B 1 55  ? 23.327 55.505 39.958 1.00 30.20 ? 55  VAL B CB  1 
ATOM   1918 C CG1 . VAL B 1 55  ? 24.311 54.761 40.851 1.00 27.52 ? 55  VAL B CG1 1 
ATOM   1919 C CG2 . VAL B 1 55  ? 23.839 55.551 38.526 1.00 26.53 ? 55  VAL B CG2 1 
ATOM   1920 N N   . LYS B 1 56  ? 21.040 55.780 42.043 1.00 32.77 ? 56  LYS B N   1 
ATOM   1921 C CA  . LYS B 1 56  ? 20.579 55.767 43.425 1.00 34.29 ? 56  LYS B CA  1 
ATOM   1922 C C   . LYS B 1 56  ? 19.448 54.764 43.603 1.00 33.93 ? 56  LYS B C   1 
ATOM   1923 O O   . LYS B 1 56  ? 19.258 54.233 44.698 1.00 33.61 ? 56  LYS B O   1 
ATOM   1924 C CB  . LYS B 1 56  ? 20.084 57.146 43.827 1.00 36.66 ? 56  LYS B CB  1 
ATOM   1925 C CG  . LYS B 1 56  ? 21.103 58.225 43.599 1.00 40.34 ? 56  LYS B CG  1 
ATOM   1926 C CD  . LYS B 1 56  ? 20.523 59.577 43.967 1.00 44.31 ? 56  LYS B CD  1 
ATOM   1927 C CE  . LYS B 1 56  ? 21.537 60.700 43.764 1.00 46.08 ? 56  LYS B CE  1 
ATOM   1928 N NZ  . LYS B 1 56  ? 21.014 62.027 44.207 1.00 47.74 ? 56  LYS B NZ  1 
ATOM   1929 N N   . LYS B 1 57  ? 18.685 54.529 42.532 1.00 34.07 ? 57  LYS B N   1 
ATOM   1930 C CA  . LYS B 1 57  ? 17.573 53.567 42.565 1.00 34.29 ? 57  LYS B CA  1 
ATOM   1931 C C   . LYS B 1 57  ? 18.077 52.161 42.190 1.00 32.90 ? 57  LYS B C   1 
ATOM   1932 O O   . LYS B 1 57  ? 17.316 51.189 42.172 1.00 32.75 ? 57  LYS B O   1 
ATOM   1933 C CB  . LYS B 1 57  ? 16.444 54.003 41.613 1.00 35.65 ? 57  LYS B CB  1 
ATOM   1934 C CG  . LYS B 1 57  ? 15.779 55.355 41.960 1.00 38.66 ? 57  LYS B CG  1 
ATOM   1935 C CD  . LYS B 1 57  ? 14.336 55.238 42.528 1.00 41.39 ? 57  LYS B CD  1 
ATOM   1936 C CE  . LYS B 1 57  ? 14.296 54.590 43.929 1.00 42.35 ? 57  LYS B CE  1 
ATOM   1937 N NZ  . LYS B 1 57  ? 12.957 54.609 44.613 1.00 43.10 ? 57  LYS B NZ  1 
ATOM   1938 N N   . GLY B 1 58  ? 19.372 52.072 41.895 1.00 31.03 ? 58  GLY B N   1 
ATOM   1939 C CA  . GLY B 1 58  ? 19.983 50.801 41.554 1.00 30.68 ? 58  GLY B CA  1 
ATOM   1940 C C   . GLY B 1 58  ? 19.635 50.276 40.179 1.00 30.96 ? 58  GLY B C   1 
ATOM   1941 O O   . GLY B 1 58  ? 19.693 49.073 39.918 1.00 30.84 ? 58  GLY B O   1 
ATOM   1942 N N   . GLN B 1 59  ? 19.285 51.181 39.281 1.00 31.02 ? 59  GLN B N   1 
ATOM   1943 C CA  . GLN B 1 59  ? 18.915 50.780 37.935 1.00 29.67 ? 59  GLN B CA  1 
ATOM   1944 C C   . GLN B 1 59  ? 20.025 51.124 36.962 1.00 29.06 ? 59  GLN B C   1 
ATOM   1945 O O   . GLN B 1 59  ? 20.593 52.215 37.028 1.00 29.62 ? 59  GLN B O   1 
ATOM   1946 C CB  . GLN B 1 59  ? 17.623 51.483 37.537 1.00 30.00 ? 59  GLN B CB  1 
ATOM   1947 C CG  . GLN B 1 59  ? 16.495 51.273 38.534 1.00 29.49 ? 59  GLN B CG  1 
ATOM   1948 C CD  . GLN B 1 59  ? 15.200 51.860 38.040 1.00 30.86 ? 59  GLN B CD  1 
ATOM   1949 O OE1 . GLN B 1 59  ? 15.148 52.395 36.935 1.00 32.37 ? 59  GLN B OE1 1 
ATOM   1950 N NE2 . GLN B 1 59  ? 14.144 51.761 38.844 1.00 30.47 ? 59  GLN B NE2 1 
ATOM   1951 N N   . PHE B 1 60  ? 20.361 50.193 36.075 1.00 27.22 ? 60  PHE B N   1 
ATOM   1952 C CA  . PHE B 1 60  ? 21.421 50.454 35.106 1.00 26.17 ? 60  PHE B CA  1 
ATOM   1953 C C   . PHE B 1 60  ? 21.002 49.908 33.754 1.00 27.46 ? 60  PHE B C   1 
ATOM   1954 O O   . PHE B 1 60  ? 21.421 48.833 33.340 1.00 27.99 ? 60  PHE B O   1 
ATOM   1955 C CB  . PHE B 1 60  ? 22.744 49.816 35.553 1.00 23.38 ? 60  PHE B CB  1 
ATOM   1956 C CG  . PHE B 1 60  ? 23.208 50.252 36.927 1.00 20.26 ? 60  PHE B CG  1 
ATOM   1957 C CD1 . PHE B 1 60  ? 22.534 49.838 38.068 1.00 18.25 ? 60  PHE B CD1 1 
ATOM   1958 C CD2 . PHE B 1 60  ? 24.320 51.075 37.073 1.00 18.37 ? 60  PHE B CD2 1 
ATOM   1959 C CE1 . PHE B 1 60  ? 22.957 50.234 39.319 1.00 19.15 ? 60  PHE B CE1 1 
ATOM   1960 C CE2 . PHE B 1 60  ? 24.748 51.476 38.333 1.00 17.92 ? 60  PHE B CE2 1 
ATOM   1961 C CZ  . PHE B 1 60  ? 24.069 51.056 39.452 1.00 18.74 ? 60  PHE B CZ  1 
ATOM   1962 N N   . PRO B 1 61  ? 20.159 50.663 33.043 1.00 28.73 ? 61  PRO B N   1 
ATOM   1963 C CA  . PRO B 1 61  ? 19.637 50.298 31.722 1.00 28.39 ? 61  PRO B CA  1 
ATOM   1964 C C   . PRO B 1 61  ? 20.609 50.364 30.545 1.00 27.80 ? 61  PRO B C   1 
ATOM   1965 O O   . PRO B 1 61  ? 21.508 51.206 30.518 1.00 27.80 ? 61  PRO B O   1 
ATOM   1966 C CB  . PRO B 1 61  ? 18.478 51.266 31.544 1.00 28.88 ? 61  PRO B CB  1 
ATOM   1967 C CG  . PRO B 1 61  ? 18.988 52.508 32.248 1.00 29.20 ? 61  PRO B CG  1 
ATOM   1968 C CD  . PRO B 1 61  ? 19.565 51.930 33.514 1.00 28.74 ? 61  PRO B CD  1 
ATOM   1969 N N   . ILE B 1 62  ? 20.404 49.459 29.586 1.00 27.13 ? 62  ILE B N   1 
ATOM   1970 C CA  . ILE B 1 62  ? 21.181 49.371 28.346 1.00 26.59 ? 62  ILE B CA  1 
ATOM   1971 C C   . ILE B 1 62  ? 20.115 49.279 27.248 1.00 26.69 ? 62  ILE B C   1 
ATOM   1972 O O   . ILE B 1 62  ? 19.540 48.211 27.011 1.00 25.40 ? 62  ILE B O   1 
ATOM   1973 C CB  . ILE B 1 62  ? 22.049 48.102 28.283 1.00 26.36 ? 62  ILE B CB  1 
ATOM   1974 C CG1 . ILE B 1 62  ? 23.056 48.094 29.432 1.00 27.39 ? 62  ILE B CG1 1 
ATOM   1975 C CG2 . ILE B 1 62  ? 22.770 48.042 26.937 1.00 26.26 ? 62  ILE B CG2 1 
ATOM   1976 C CD1 . ILE B 1 62  ? 23.976 46.876 29.463 1.00 26.95 ? 62  ILE B CD1 1 
ATOM   1977 N N   . PRO B 1 63  ? 19.828 50.411 26.580 1.00 26.65 ? 63  PRO B N   1 
ATOM   1978 C CA  . PRO B 1 63  ? 18.839 50.560 25.500 1.00 25.38 ? 63  PRO B CA  1 
ATOM   1979 C C   . PRO B 1 63  ? 18.946 49.525 24.380 1.00 25.47 ? 63  PRO B C   1 
ATOM   1980 O O   . PRO B 1 63  ? 17.971 48.858 24.025 1.00 23.89 ? 63  PRO B O   1 
ATOM   1981 C CB  . PRO B 1 63  ? 19.112 51.968 24.981 1.00 25.12 ? 63  PRO B CB  1 
ATOM   1982 C CG  . PRO B 1 63  ? 19.636 52.686 26.190 1.00 26.01 ? 63  PRO B CG  1 
ATOM   1983 C CD  . PRO B 1 63  ? 20.570 51.671 26.784 1.00 26.04 ? 63  PRO B CD  1 
ATOM   1984 N N   . SER B 1 64  ? 20.143 49.423 23.815 1.00 25.63 ? 64  SER B N   1 
ATOM   1985 C CA  . SER B 1 64  ? 20.425 48.494 22.725 1.00 24.85 ? 64  SER B CA  1 
ATOM   1986 C C   . SER B 1 64  ? 21.760 47.827 23.070 1.00 24.40 ? 64  SER B C   1 
ATOM   1987 O O   . SER B 1 64  ? 22.819 48.451 22.948 1.00 22.50 ? 64  SER B O   1 
ATOM   1988 C CB  . SER B 1 64  ? 20.528 49.278 21.404 1.00 24.30 ? 64  SER B CB  1 
ATOM   1989 O OG  . SER B 1 64  ? 20.658 48.427 20.276 1.00 26.16 ? 64  SER B OG  1 
ATOM   1990 N N   . ILE B 1 65  ? 21.707 46.567 23.496 1.00 24.21 ? 65  ILE B N   1 
ATOM   1991 C CA  . ILE B 1 65  ? 22.916 45.851 23.892 1.00 25.71 ? 65  ILE B CA  1 
ATOM   1992 C C   . ILE B 1 65  ? 23.840 45.431 22.739 1.00 25.30 ? 65  ILE B C   1 
ATOM   1993 O O   . ILE B 1 65  ? 23.390 45.088 21.653 1.00 26.09 ? 65  ILE B O   1 
ATOM   1994 C CB  . ILE B 1 65  ? 22.558 44.607 24.733 1.00 25.94 ? 65  ILE B CB  1 
ATOM   1995 C CG1 . ILE B 1 65  ? 23.772 44.187 25.570 1.00 25.96 ? 65  ILE B CG1 1 
ATOM   1996 C CG2 . ILE B 1 65  ? 22.114 43.473 23.814 1.00 26.26 ? 65  ILE B CG2 1 
ATOM   1997 C CD1 . ILE B 1 65  ? 23.459 43.252 26.731 1.00 26.61 ? 65  ILE B CD1 1 
ATOM   1998 N N   . THR B 1 66  ? 25.141 45.469 22.989 1.00 25.10 ? 66  THR B N   1 
ATOM   1999 C CA  . THR B 1 66  ? 26.125 45.099 21.981 1.00 25.90 ? 66  THR B CA  1 
ATOM   2000 C C   . THR B 1 66  ? 27.132 44.106 22.557 1.00 24.12 ? 66  THR B C   1 
ATOM   2001 O O   . THR B 1 66  ? 27.077 43.767 23.740 1.00 24.37 ? 66  THR B O   1 
ATOM   2002 C CB  . THR B 1 66  ? 26.891 46.332 21.471 1.00 27.61 ? 66  THR B CB  1 
ATOM   2003 O OG1 . THR B 1 66  ? 27.859 46.735 22.445 1.00 29.05 ? 66  THR B OG1 1 
ATOM   2004 C CG2 . THR B 1 66  ? 25.936 47.475 21.224 1.00 27.27 ? 66  THR B CG2 1 
ATOM   2005 N N   . TRP B 1 67  ? 28.056 43.652 21.722 1.00 21.96 ? 67  TRP B N   1 
ATOM   2006 C CA  . TRP B 1 67  ? 29.053 42.686 22.153 1.00 20.74 ? 67  TRP B CA  1 
ATOM   2007 C C   . TRP B 1 67  ? 29.845 43.219 23.347 1.00 20.46 ? 67  TRP B C   1 
ATOM   2008 O O   . TRP B 1 67  ? 30.059 42.510 24.332 1.00 19.67 ? 67  TRP B O   1 
ATOM   2009 C CB  . TRP B 1 67  ? 29.984 42.353 20.986 1.00 19.83 ? 67  TRP B CB  1 
ATOM   2010 C CG  . TRP B 1 67  ? 29.230 42.026 19.725 1.00 20.82 ? 67  TRP B CG  1 
ATOM   2011 C CD1 . TRP B 1 67  ? 29.270 42.717 18.545 1.00 19.98 ? 67  TRP B CD1 1 
ATOM   2012 C CD2 . TRP B 1 67  ? 28.239 40.995 19.550 1.00 22.11 ? 67  TRP B CD2 1 
ATOM   2013 N NE1 . TRP B 1 67  ? 28.362 42.192 17.652 1.00 22.25 ? 67  TRP B NE1 1 
ATOM   2014 C CE2 . TRP B 1 67  ? 27.716 41.136 18.240 1.00 22.67 ? 67  TRP B CE2 1 
ATOM   2015 C CE3 . TRP B 1 67  ? 27.739 39.970 20.375 1.00 20.97 ? 67  TRP B CE3 1 
ATOM   2016 C CZ2 . TRP B 1 67  ? 26.718 40.294 17.735 1.00 22.71 ? 67  TRP B CZ2 1 
ATOM   2017 C CZ3 . TRP B 1 67  ? 26.745 39.132 19.871 1.00 21.79 ? 67  TRP B CZ3 1 
ATOM   2018 C CH2 . TRP B 1 67  ? 26.246 39.303 18.563 1.00 22.92 ? 67  TRP B CH2 1 
ATOM   2019 N N   . GLU B 1 68  ? 30.250 44.482 23.264 1.00 20.25 ? 68  GLU B N   1 
ATOM   2020 C CA  . GLU B 1 68  ? 31.017 45.136 24.323 1.00 20.51 ? 68  GLU B CA  1 
ATOM   2021 C C   . GLU B 1 68  ? 30.304 45.182 25.687 1.00 19.98 ? 68  GLU B C   1 
ATOM   2022 O O   . GLU B 1 68  ? 30.936 45.466 26.708 1.00 17.98 ? 68  GLU B O   1 
ATOM   2023 C CB  . GLU B 1 68  ? 31.407 46.547 23.864 1.00 22.14 ? 68  GLU B CB  1 
ATOM   2024 C CG  . GLU B 1 68  ? 31.968 47.490 24.938 1.00 26.23 ? 68  GLU B CG  1 
ATOM   2025 C CD  . GLU B 1 68  ? 33.279 47.005 25.574 1.00 29.32 ? 68  GLU B CD  1 
ATOM   2026 O OE1 . GLU B 1 68  ? 34.085 46.326 24.889 1.00 26.97 ? 68  GLU B OE1 1 
ATOM   2027 O OE2 . GLU B 1 68  ? 33.499 47.331 26.767 1.00 29.86 ? 68  GLU B OE2 1 
ATOM   2028 N N   . HIS B 1 69  ? 29.004 44.887 25.702 1.00 19.84 ? 69  HIS B N   1 
ATOM   2029 C CA  . HIS B 1 69  ? 28.221 44.890 26.935 1.00 21.06 ? 69  HIS B CA  1 
ATOM   2030 C C   . HIS B 1 69  ? 28.281 43.577 27.709 1.00 21.65 ? 69  HIS B C   1 
ATOM   2031 O O   . HIS B 1 69  ? 28.008 43.551 28.915 1.00 21.95 ? 69  HIS B O   1 
ATOM   2032 C CB  . HIS B 1 69  ? 26.759 45.158 26.644 1.00 23.25 ? 69  HIS B CB  1 
ATOM   2033 C CG  . HIS B 1 69  ? 26.476 46.543 26.177 1.00 26.18 ? 69  HIS B CG  1 
ATOM   2034 N ND1 . HIS B 1 69  ? 26.406 47.618 27.038 1.00 26.91 ? 69  HIS B ND1 1 
ATOM   2035 C CD2 . HIS B 1 69  ? 26.206 47.028 24.943 1.00 25.92 ? 69  HIS B CD2 1 
ATOM   2036 C CE1 . HIS B 1 69  ? 26.098 48.703 26.352 1.00 27.00 ? 69  HIS B CE1 1 
ATOM   2037 N NE2 . HIS B 1 69  ? 25.971 48.372 25.078 1.00 25.74 ? 69  HIS B NE2 1 
ATOM   2038 N N   . ALA B 1 70  ? 28.602 42.483 27.018 1.00 20.51 ? 70  ALA B N   1 
ATOM   2039 C CA  . ALA B 1 70  ? 28.674 41.162 27.646 1.00 20.76 ? 70  ALA B CA  1 
ATOM   2040 C C   . ALA B 1 70  ? 29.710 41.174 28.775 1.00 18.68 ? 70  ALA B C   1 
ATOM   2041 O O   . ALA B 1 70  ? 30.713 41.885 28.678 1.00 16.84 ? 70  ALA B O   1 
ATOM   2042 C CB  . ALA B 1 70  ? 29.037 40.099 26.599 1.00 22.04 ? 70  ALA B CB  1 
ATOM   2043 N N   . GLY B 1 71  ? 29.479 40.390 29.829 1.00 16.78 ? 71  GLY B N   1 
ATOM   2044 C CA  . GLY B 1 71  ? 30.456 40.341 30.901 1.00 18.59 ? 71  GLY B CA  1 
ATOM   2045 C C   . GLY B 1 71  ? 29.949 39.911 32.267 1.00 19.60 ? 71  GLY B C   1 
ATOM   2046 O O   . GLY B 1 71  ? 28.746 39.735 32.465 1.00 18.59 ? 71  GLY B O   1 
ATOM   2047 N N   . ARG B 1 72  ? 30.875 39.748 33.212 1.00 19.72 ? 72  ARG B N   1 
ATOM   2048 C CA  . ARG B 1 72  ? 30.535 39.341 34.564 1.00 20.35 ? 72  ARG B CA  1 
ATOM   2049 C C   . ARG B 1 72  ? 30.405 40.587 35.423 1.00 20.78 ? 72  ARG B C   1 
ATOM   2050 O O   . ARG B 1 72  ? 31.378 41.315 35.635 1.00 21.67 ? 72  ARG B O   1 
ATOM   2051 C CB  . ARG B 1 72  ? 31.625 38.425 35.128 1.00 20.46 ? 72  ARG B CB  1 
ATOM   2052 C CG  . ARG B 1 72  ? 31.180 37.490 36.253 1.00 21.42 ? 72  ARG B CG  1 
ATOM   2053 C CD  . ARG B 1 72  ? 32.130 36.296 36.323 1.00 24.18 ? 72  ARG B CD  1 
ATOM   2054 N NE  . ARG B 1 72  ? 31.563 35.133 37.003 1.00 27.52 ? 72  ARG B NE  1 
ATOM   2055 C CZ  . ARG B 1 72  ? 31.582 34.941 38.319 1.00 28.60 ? 72  ARG B CZ  1 
ATOM   2056 N NH1 . ARG B 1 72  ? 32.141 35.835 39.119 1.00 30.96 ? 72  ARG B NH1 1 
ATOM   2057 N NH2 . ARG B 1 72  ? 31.058 33.839 38.836 1.00 30.40 ? 72  ARG B NH2 1 
ATOM   2058 N N   . TYR B 1 73  ? 29.201 40.848 35.914 1.00 20.67 ? 73  TYR B N   1 
ATOM   2059 C CA  . TYR B 1 73  ? 29.001 42.019 36.746 1.00 20.33 ? 73  TYR B CA  1 
ATOM   2060 C C   . TYR B 1 73  ? 28.707 41.651 38.199 1.00 21.16 ? 73  TYR B C   1 
ATOM   2061 O O   . TYR B 1 73  ? 28.324 40.527 38.523 1.00 20.32 ? 73  TYR B O   1 
ATOM   2062 C CB  . TYR B 1 73  ? 27.863 42.906 36.191 1.00 18.83 ? 73  TYR B CB  1 
ATOM   2063 C CG  . TYR B 1 73  ? 28.104 43.503 34.799 1.00 17.68 ? 73  TYR B CG  1 
ATOM   2064 C CD1 . TYR B 1 73  ? 28.047 42.708 33.653 1.00 17.40 ? 73  TYR B CD1 1 
ATOM   2065 C CD2 . TYR B 1 73  ? 28.409 44.862 34.634 1.00 17.69 ? 73  TYR B CD2 1 
ATOM   2066 C CE1 . TYR B 1 73  ? 28.287 43.241 32.385 1.00 16.56 ? 73  TYR B CE1 1 
ATOM   2067 C CE2 . TYR B 1 73  ? 28.657 45.411 33.363 1.00 15.63 ? 73  TYR B CE2 1 
ATOM   2068 C CZ  . TYR B 1 73  ? 28.593 44.589 32.240 1.00 17.19 ? 73  TYR B CZ  1 
ATOM   2069 O OH  . TYR B 1 73  ? 28.832 45.082 30.966 1.00 15.20 ? 73  TYR B OH  1 
ATOM   2070 N N   . ARG B 1 74  ? 28.926 42.630 39.065 1.00 23.43 ? 74  ARG B N   1 
ATOM   2071 C CA  . ARG B 1 74  ? 28.683 42.538 40.499 1.00 25.81 ? 74  ARG B CA  1 
ATOM   2072 C C   . ARG B 1 74  ? 28.454 43.989 40.894 1.00 27.03 ? 74  ARG B C   1 
ATOM   2073 O O   . ARG B 1 74  ? 28.721 44.906 40.100 1.00 28.14 ? 74  ARG B O   1 
ATOM   2074 C CB  . ARG B 1 74  ? 29.911 42.033 41.252 1.00 26.38 ? 74  ARG B CB  1 
ATOM   2075 C CG  . ARG B 1 74  ? 30.185 40.562 41.205 1.00 27.81 ? 74  ARG B CG  1 
ATOM   2076 C CD  . ARG B 1 74  ? 31.543 40.364 41.818 1.00 30.02 ? 74  ARG B CD  1 
ATOM   2077 N NE  . ARG B 1 74  ? 31.985 38.983 41.763 1.00 31.61 ? 74  ARG B NE  1 
ATOM   2078 C CZ  . ARG B 1 74  ? 31.457 38.009 42.492 1.00 33.66 ? 74  ARG B CZ  1 
ATOM   2079 N NH1 . ARG B 1 74  ? 30.460 38.274 43.339 1.00 32.22 ? 74  ARG B NH1 1 
ATOM   2080 N NH2 . ARG B 1 74  ? 31.929 36.769 42.371 1.00 33.82 ? 74  ARG B NH2 1 
ATOM   2081 N N   . CYS B 1 75  ? 27.973 44.204 42.112 1.00 26.50 ? 75  CYS B N   1 
ATOM   2082 C CA  . CYS B 1 75  ? 27.735 45.556 42.587 1.00 26.91 ? 75  CYS B CA  1 
ATOM   2083 C C   . CYS B 1 75  ? 27.699 45.535 44.100 1.00 26.91 ? 75  CYS B C   1 
ATOM   2084 O O   . CYS B 1 75  ? 27.648 44.477 44.723 1.00 25.24 ? 75  CYS B O   1 
ATOM   2085 C CB  . CYS B 1 75  ? 26.399 46.094 42.051 1.00 26.75 ? 75  CYS B CB  1 
ATOM   2086 S SG  . CYS B 1 75  ? 24.960 45.329 42.867 1.00 31.08 ? 75  CYS B SG  1 
ATOM   2087 N N   . TYR B 1 76  ? 27.721 46.725 44.677 1.00 27.88 ? 76  TYR B N   1 
ATOM   2088 C CA  . TYR B 1 76  ? 27.683 46.894 46.119 1.00 27.50 ? 76  TYR B CA  1 
ATOM   2089 C C   . TYR B 1 76  ? 27.203 48.318 46.373 1.00 26.76 ? 76  TYR B C   1 
ATOM   2090 O O   . TYR B 1 76  ? 27.058 49.097 45.428 1.00 25.56 ? 76  TYR B O   1 
ATOM   2091 C CB  . TYR B 1 76  ? 29.085 46.699 46.691 1.00 27.30 ? 76  TYR B CB  1 
ATOM   2092 C CG  . TYR B 1 76  ? 30.065 47.713 46.167 1.00 28.20 ? 76  TYR B CG  1 
ATOM   2093 C CD1 . TYR B 1 76  ? 30.205 48.960 46.779 1.00 27.90 ? 76  TYR B CD1 1 
ATOM   2094 C CD2 . TYR B 1 76  ? 30.825 47.446 45.034 1.00 28.75 ? 76  TYR B CD2 1 
ATOM   2095 C CE1 . TYR B 1 76  ? 31.078 49.917 46.269 1.00 27.45 ? 76  TYR B CE1 1 
ATOM   2096 C CE2 . TYR B 1 76  ? 31.701 48.391 44.517 1.00 27.78 ? 76  TYR B CE2 1 
ATOM   2097 C CZ  . TYR B 1 76  ? 31.824 49.626 45.136 1.00 28.12 ? 76  TYR B CZ  1 
ATOM   2098 O OH  . TYR B 1 76  ? 32.693 50.566 44.620 1.00 26.44 ? 76  TYR B OH  1 
ATOM   2099 N N   . TYR B 1 77  ? 26.959 48.658 47.636 1.00 27.09 ? 77  TYR B N   1 
ATOM   2100 C CA  . TYR B 1 77  ? 26.501 50.000 47.968 1.00 28.98 ? 77  TYR B CA  1 
ATOM   2101 C C   . TYR B 1 77  ? 27.225 50.596 49.168 1.00 31.45 ? 77  TYR B C   1 
ATOM   2102 O O   . TYR B 1 77  ? 27.787 49.868 49.981 1.00 31.47 ? 77  TYR B O   1 
ATOM   2103 C CB  . TYR B 1 77  ? 24.997 49.987 48.224 1.00 25.97 ? 77  TYR B CB  1 
ATOM   2104 C CG  . TYR B 1 77  ? 24.594 49.143 49.396 1.00 23.83 ? 77  TYR B CG  1 
ATOM   2105 C CD1 . TYR B 1 77  ? 24.644 49.651 50.699 1.00 23.87 ? 77  TYR B CD1 1 
ATOM   2106 C CD2 . TYR B 1 77  ? 24.186 47.823 49.216 1.00 22.05 ? 77  TYR B CD2 1 
ATOM   2107 C CE1 . TYR B 1 77  ? 24.298 48.857 51.800 1.00 22.04 ? 77  TYR B CE1 1 
ATOM   2108 C CE2 . TYR B 1 77  ? 23.839 47.014 50.305 1.00 21.93 ? 77  TYR B CE2 1 
ATOM   2109 C CZ  . TYR B 1 77  ? 23.899 47.536 51.593 1.00 22.42 ? 77  TYR B CZ  1 
ATOM   2110 O OH  . TYR B 1 77  ? 23.576 46.742 52.672 1.00 22.84 ? 77  TYR B OH  1 
ATOM   2111 N N   . GLY B 1 78  ? 27.204 51.923 49.264 1.00 34.40 ? 78  GLY B N   1 
ATOM   2112 C CA  . GLY B 1 78  ? 27.847 52.615 50.367 1.00 38.86 ? 78  GLY B CA  1 
ATOM   2113 C C   . GLY B 1 78  ? 29.076 53.415 49.960 1.00 42.53 ? 78  GLY B C   1 
ATOM   2114 O O   . GLY B 1 78  ? 29.263 53.743 48.781 1.00 43.36 ? 78  GLY B O   1 
ATOM   2115 N N   . SER B 1 79  ? 29.920 53.720 50.945 1.00 44.66 ? 79  SER B N   1 
ATOM   2116 C CA  . SER B 1 79  ? 31.144 54.484 50.732 1.00 47.20 ? 79  SER B CA  1 
ATOM   2117 C C   . SER B 1 79  ? 32.309 54.020 51.619 1.00 48.35 ? 79  SER B C   1 
ATOM   2118 O O   . SER B 1 79  ? 32.116 53.599 52.768 1.00 47.91 ? 79  SER B O   1 
ATOM   2119 C CB  . SER B 1 79  ? 30.873 55.968 50.979 1.00 48.21 ? 79  SER B CB  1 
ATOM   2120 O OG  . SER B 1 79  ? 31.998 56.584 51.582 1.00 50.35 ? 79  SER B OG  1 
ATOM   2121 N N   . ASP B 1 80  ? 33.517 54.113 51.069 1.00 49.67 ? 80  ASP B N   1 
ATOM   2122 C CA  . ASP B 1 80  ? 34.737 53.717 51.770 1.00 51.06 ? 80  ASP B CA  1 
ATOM   2123 C C   . ASP B 1 80  ? 34.939 54.575 53.022 1.00 51.51 ? 80  ASP B C   1 
ATOM   2124 O O   . ASP B 1 80  ? 34.442 54.244 54.104 1.00 50.77 ? 80  ASP B O   1 
ATOM   2125 C CB  . ASP B 1 80  ? 35.940 53.866 50.828 1.00 51.72 ? 80  ASP B CB  1 
ATOM   2126 C CG  . ASP B 1 80  ? 35.641 53.362 49.418 1.00 52.19 ? 80  ASP B CG  1 
ATOM   2127 O OD1 . ASP B 1 80  ? 35.380 52.154 49.258 1.00 52.68 ? 80  ASP B OD1 1 
ATOM   2128 O OD2 . ASP B 1 80  ? 35.658 54.178 48.470 1.00 53.68 ? 80  ASP B OD2 1 
ATOM   2129 N N   . ALA B 1 82  ? 30.716 55.581 54.972 1.00 51.89 ? 82  ALA B N   1 
ATOM   2130 C CA  . ALA B 1 82  ? 30.156 55.104 56.233 1.00 51.92 ? 82  ALA B CA  1 
ATOM   2131 C C   . ALA B 1 82  ? 29.971 53.579 56.211 1.00 52.26 ? 82  ALA B C   1 
ATOM   2132 O O   . ALA B 1 82  ? 29.407 52.993 57.144 1.00 51.84 ? 82  ALA B O   1 
ATOM   2133 C CB  . ALA B 1 82  ? 28.816 55.804 56.509 1.00 52.21 ? 82  ALA B CB  1 
ATOM   2134 N N   . GLY B 1 83  ? 30.458 52.944 55.148 1.00 51.45 ? 83  GLY B N   1 
ATOM   2135 C CA  . GLY B 1 83  ? 30.336 51.503 55.034 1.00 50.06 ? 83  GLY B CA  1 
ATOM   2136 C C   . GLY B 1 83  ? 29.821 50.997 53.697 1.00 49.44 ? 83  GLY B C   1 
ATOM   2137 O O   . GLY B 1 83  ? 28.726 51.353 53.251 1.00 49.62 ? 83  GLY B O   1 
ATOM   2138 N N   . ARG B 1 84  ? 30.623 50.170 53.038 1.00 48.44 ? 84  ARG B N   1 
ATOM   2139 C CA  . ARG B 1 84  ? 30.206 49.590 51.775 1.00 47.86 ? 84  ARG B CA  1 
ATOM   2140 C C   . ARG B 1 84  ? 29.950 48.115 52.042 1.00 45.36 ? 84  ARG B C   1 
ATOM   2141 O O   . ARG B 1 84  ? 30.586 47.524 52.912 1.00 44.11 ? 84  ARG B O   1 
ATOM   2142 C CB  . ARG B 1 84  ? 31.280 49.782 50.695 1.00 51.08 ? 84  ARG B CB  1 
ATOM   2143 C CG  . ARG B 1 84  ? 32.695 49.406 51.096 1.00 55.23 ? 84  ARG B CG  1 
ATOM   2144 C CD  . ARG B 1 84  ? 33.680 50.263 50.308 1.00 57.58 ? 84  ARG B CD  1 
ATOM   2145 N NE  . ARG B 1 84  ? 35.051 50.239 50.833 1.00 60.83 ? 84  ARG B NE  1 
ATOM   2146 C CZ  . ARG B 1 84  ? 35.378 50.310 52.124 1.00 62.36 ? 84  ARG B CZ  1 
ATOM   2147 N NH1 . ARG B 1 84  ? 34.435 50.398 53.067 1.00 64.06 ? 84  ARG B NH1 1 
ATOM   2148 N NH2 . ARG B 1 84  ? 36.661 50.321 52.470 1.00 62.24 ? 84  ARG B NH2 1 
ATOM   2149 N N   . SER B 1 85  ? 28.999 47.538 51.314 1.00 42.91 ? 85  SER B N   1 
ATOM   2150 C CA  . SER B 1 85  ? 28.637 46.133 51.469 1.00 38.91 ? 85  SER B CA  1 
ATOM   2151 C C   . SER B 1 85  ? 29.567 45.232 50.652 1.00 37.13 ? 85  SER B C   1 
ATOM   2152 O O   . SER B 1 85  ? 30.404 45.717 49.887 1.00 36.59 ? 85  SER B O   1 
ATOM   2153 C CB  . SER B 1 85  ? 27.204 45.935 50.987 1.00 38.06 ? 85  SER B CB  1 
ATOM   2154 O OG  . SER B 1 85  ? 27.115 46.177 49.589 1.00 33.71 ? 85  SER B OG  1 
ATOM   2155 N N   . GLU B 1 86  ? 29.425 43.922 50.822 1.00 35.15 ? 86  GLU B N   1 
ATOM   2156 C CA  . GLU B 1 86  ? 30.221 42.984 50.043 1.00 34.66 ? 86  GLU B CA  1 
ATOM   2157 C C   . GLU B 1 86  ? 29.654 43.164 48.647 1.00 32.23 ? 86  GLU B C   1 
ATOM   2158 O O   . GLU B 1 86  ? 28.616 43.808 48.494 1.00 33.42 ? 86  GLU B O   1 
ATOM   2159 C CB  . GLU B 1 86  ? 29.936 41.553 50.459 1.00 37.00 ? 86  GLU B CB  1 
ATOM   2160 C CG  . GLU B 1 86  ? 30.742 40.981 51.583 1.00 41.42 ? 86  GLU B CG  1 
ATOM   2161 C CD  . GLU B 1 86  ? 30.217 39.599 51.953 1.00 46.28 ? 86  GLU B CD  1 
ATOM   2162 O OE1 . GLU B 1 86  ? 29.792 38.853 51.036 1.00 48.35 ? 86  GLU B OE1 1 
ATOM   2163 O OE2 . GLU B 1 86  ? 30.218 39.249 53.156 1.00 48.13 ? 86  GLU B OE2 1 
ATOM   2164 N N   . SER B 1 87  ? 30.318 42.610 47.636 1.00 28.54 ? 87  SER B N   1 
ATOM   2165 C CA  . SER B 1 87  ? 29.802 42.699 46.281 1.00 24.80 ? 87  SER B CA  1 
ATOM   2166 C C   . SER B 1 87  ? 28.711 41.639 46.177 1.00 24.16 ? 87  SER B C   1 
ATOM   2167 O O   . SER B 1 87  ? 28.789 40.587 46.816 1.00 23.15 ? 87  SER B O   1 
ATOM   2168 C CB  . SER B 1 87  ? 30.896 42.412 45.257 1.00 24.32 ? 87  SER B CB  1 
ATOM   2169 O OG  . SER B 1 87  ? 31.880 43.423 45.288 1.00 24.86 ? 87  SER B OG  1 
ATOM   2170 N N   . SER B 1 88  ? 27.684 41.927 45.386 1.00 23.09 ? 88  SER B N   1 
ATOM   2171 C CA  . SER B 1 88  ? 26.572 40.999 45.182 1.00 21.54 ? 88  SER B CA  1 
ATOM   2172 C C   . SER B 1 88  ? 27.095 39.747 44.495 1.00 20.20 ? 88  SER B C   1 
ATOM   2173 O O   . SER B 1 88  ? 28.259 39.698 44.078 1.00 18.26 ? 88  SER B O   1 
ATOM   2174 C CB  . SER B 1 88  ? 25.529 41.641 44.266 1.00 19.39 ? 88  SER B CB  1 
ATOM   2175 O OG  . SER B 1 88  ? 26.088 41.825 42.972 1.00 14.05 ? 88  SER B OG  1 
ATOM   2176 N N   . ASP B 1 89  ? 26.242 38.734 44.375 1.00 20.58 ? 89  ASP B N   1 
ATOM   2177 C CA  . ASP B 1 89  ? 26.662 37.527 43.672 1.00 22.65 ? 89  ASP B CA  1 
ATOM   2178 C C   . ASP B 1 89  ? 26.811 37.999 42.239 1.00 21.20 ? 89  ASP B C   1 
ATOM   2179 O O   . ASP B 1 89  ? 26.115 38.926 41.809 1.00 22.29 ? 89  ASP B O   1 
ATOM   2180 C CB  . ASP B 1 89  ? 25.619 36.418 43.783 1.00 23.73 ? 89  ASP B CB  1 
ATOM   2181 C CG  . ASP B 1 89  ? 25.427 35.958 45.213 1.00 25.81 ? 89  ASP B CG  1 
ATOM   2182 O OD1 . ASP B 1 89  ? 26.446 35.632 45.877 1.00 26.45 ? 89  ASP B OD1 1 
ATOM   2183 O OD2 . ASP B 1 89  ? 24.263 35.930 45.674 1.00 26.09 ? 89  ASP B OD2 1 
ATOM   2184 N N   . PRO B 1 90  ? 27.723 37.386 41.481 1.00 19.04 ? 90  PRO B N   1 
ATOM   2185 C CA  . PRO B 1 90  ? 27.899 37.831 40.103 1.00 17.91 ? 90  PRO B CA  1 
ATOM   2186 C C   . PRO B 1 90  ? 26.716 37.556 39.174 1.00 17.68 ? 90  PRO B C   1 
ATOM   2187 O O   . PRO B 1 90  ? 25.914 36.647 39.404 1.00 17.39 ? 90  PRO B O   1 
ATOM   2188 C CB  . PRO B 1 90  ? 29.167 37.104 39.680 1.00 17.61 ? 90  PRO B CB  1 
ATOM   2189 C CG  . PRO B 1 90  ? 29.017 35.790 40.356 1.00 18.24 ? 90  PRO B CG  1 
ATOM   2190 C CD  . PRO B 1 90  ? 28.433 36.120 41.726 1.00 17.64 ? 90  PRO B CD  1 
ATOM   2191 N N   . LEU B 1 91  ? 26.613 38.378 38.135 1.00 17.62 ? 91  LEU B N   1 
ATOM   2192 C CA  . LEU B 1 91  ? 25.569 38.263 37.120 1.00 16.61 ? 91  LEU B CA  1 
ATOM   2193 C C   . LEU B 1 91  ? 26.279 38.234 35.790 1.00 16.12 ? 91  LEU B C   1 
ATOM   2194 O O   . LEU B 1 91  ? 26.926 39.203 35.402 1.00 16.79 ? 91  LEU B O   1 
ATOM   2195 C CB  . LEU B 1 91  ? 24.641 39.463 37.132 1.00 16.61 ? 91  LEU B CB  1 
ATOM   2196 C CG  . LEU B 1 91  ? 23.754 39.573 35.882 1.00 17.65 ? 91  LEU B CG  1 
ATOM   2197 C CD1 . LEU B 1 91  ? 22.302 39.184 36.179 1.00 16.51 ? 91  LEU B CD1 1 
ATOM   2198 C CD2 . LEU B 1 91  ? 23.823 41.013 35.388 1.00 17.49 ? 91  LEU B CD2 1 
ATOM   2199 N N   . GLU B 1 92  ? 26.167 37.119 35.094 1.00 15.48 ? 92  GLU B N   1 
ATOM   2200 C CA  . GLU B 1 92  ? 26.818 36.990 33.816 1.00 17.27 ? 92  GLU B CA  1 
ATOM   2201 C C   . GLU B 1 92  ? 25.862 37.455 32.727 1.00 16.59 ? 92  GLU B C   1 
ATOM   2202 O O   . GLU B 1 92  ? 24.820 36.861 32.496 1.00 15.62 ? 92  GLU B O   1 
ATOM   2203 C CB  . GLU B 1 92  ? 27.270 35.539 33.637 1.00 19.41 ? 92  GLU B CB  1 
ATOM   2204 C CG  . GLU B 1 92  ? 28.228 35.123 34.765 1.00 23.09 ? 92  GLU B CG  1 
ATOM   2205 C CD  . GLU B 1 92  ? 28.847 33.745 34.600 1.00 25.31 ? 92  GLU B CD  1 
ATOM   2206 O OE1 . GLU B 1 92  ? 28.120 32.731 34.676 1.00 27.06 ? 92  GLU B OE1 1 
ATOM   2207 O OE2 . GLU B 1 92  ? 30.075 33.681 34.399 1.00 28.34 ? 92  GLU B OE2 1 
ATOM   2208 N N   . LEU B 1 93  ? 26.216 38.561 32.091 1.00 17.36 ? 93  LEU B N   1 
ATOM   2209 C CA  . LEU B 1 93  ? 25.401 39.136 31.031 1.00 18.11 ? 93  LEU B CA  1 
ATOM   2210 C C   . LEU B 1 93  ? 25.864 38.603 29.673 1.00 20.13 ? 93  LEU B C   1 
ATOM   2211 O O   . LEU B 1 93  ? 26.974 38.907 29.202 1.00 21.20 ? 93  LEU B O   1 
ATOM   2212 C CB  . LEU B 1 93  ? 25.501 40.664 31.081 1.00 17.04 ? 93  LEU B CB  1 
ATOM   2213 C CG  . LEU B 1 93  ? 24.682 41.571 30.160 1.00 15.73 ? 93  LEU B CG  1 
ATOM   2214 C CD1 . LEU B 1 93  ? 23.209 41.214 30.223 1.00 15.51 ? 93  LEU B CD1 1 
ATOM   2215 C CD2 . LEU B 1 93  ? 24.917 43.019 30.590 1.00 15.07 ? 93  LEU B CD2 1 
ATOM   2216 N N   . VAL B 1 94  ? 25.000 37.797 29.059 1.00 18.97 ? 94  VAL B N   1 
ATOM   2217 C CA  . VAL B 1 94  ? 25.284 37.189 27.770 1.00 16.27 ? 94  VAL B CA  1 
ATOM   2218 C C   . VAL B 1 94  ? 24.584 37.903 26.607 1.00 16.19 ? 94  VAL B C   1 
ATOM   2219 O O   . VAL B 1 94  ? 23.481 38.427 26.753 1.00 14.43 ? 94  VAL B O   1 
ATOM   2220 C CB  . VAL B 1 94  ? 24.872 35.701 27.796 1.00 16.75 ? 94  VAL B CB  1 
ATOM   2221 C CG1 . VAL B 1 94  ? 25.096 35.058 26.446 1.00 16.05 ? 94  VAL B CG1 1 
ATOM   2222 C CG2 . VAL B 1 94  ? 25.675 34.974 28.837 1.00 12.39 ? 94  VAL B CG2 1 
ATOM   2223 N N   . VAL B 1 95  ? 25.248 37.931 25.456 1.00 16.06 ? 95  VAL B N   1 
ATOM   2224 C CA  . VAL B 1 95  ? 24.696 38.556 24.264 1.00 17.24 ? 95  VAL B CA  1 
ATOM   2225 C C   . VAL B 1 95  ? 24.724 37.492 23.183 1.00 16.35 ? 95  VAL B C   1 
ATOM   2226 O O   . VAL B 1 95  ? 25.778 36.933 22.899 1.00 17.08 ? 95  VAL B O   1 
ATOM   2227 C CB  . VAL B 1 95  ? 25.533 39.783 23.839 1.00 18.40 ? 95  VAL B CB  1 
ATOM   2228 C CG1 . VAL B 1 95  ? 25.036 40.339 22.493 1.00 19.01 ? 95  VAL B CG1 1 
ATOM   2229 C CG2 . VAL B 1 95  ? 25.433 40.862 24.919 1.00 19.03 ? 95  VAL B CG2 1 
ATOM   2230 N N   . THR B 1 96  ? 23.572 37.207 22.583 1.00 15.04 ? 96  THR B N   1 
ATOM   2231 C CA  . THR B 1 96  ? 23.493 36.160 21.570 1.00 15.16 ? 96  THR B CA  1 
ATOM   2232 C C   . THR B 1 96  ? 23.420 36.657 20.128 1.00 14.78 ? 96  THR B C   1 
ATOM   2233 O O   . THR B 1 96  ? 23.114 37.824 19.878 1.00 14.65 ? 96  THR B O   1 
ATOM   2234 C CB  . THR B 1 96  ? 22.289 35.252 21.856 1.00 15.05 ? 96  THR B CB  1 
ATOM   2235 O OG1 . THR B 1 96  ? 21.069 35.950 21.560 1.00 14.64 ? 96  THR B OG1 1 
ATOM   2236 C CG2 . THR B 1 96  ? 22.286 34.860 23.322 1.00 10.97 ? 96  THR B CG2 1 
ATOM   2237 N N   . GLY B 1 97  ? 23.721 35.761 19.189 1.00 13.46 ? 97  GLY B N   1 
ATOM   2238 C CA  . GLY B 1 97  ? 23.671 36.108 17.782 1.00 11.21 ? 97  GLY B CA  1 
ATOM   2239 C C   . GLY B 1 97  ? 24.998 36.427 17.121 1.00 10.74 ? 97  GLY B C   1 
ATOM   2240 O O   . GLY B 1 97  ? 25.040 37.010 16.040 1.00 10.43 ? 97  GLY B O   1 
ATOM   2241 N N   . ALA B 1 98  ? 26.096 36.042 17.749 1.00 12.74 ? 98  ALA B N   1 
ATOM   2242 C CA  . ALA B 1 98  ? 27.418 36.320 17.186 1.00 13.94 ? 98  ALA B CA  1 
ATOM   2243 C C   . ALA B 1 98  ? 27.895 35.250 16.194 1.00 15.09 ? 98  ALA B C   1 
ATOM   2244 O O   . ALA B 1 98  ? 28.706 35.513 15.299 1.00 14.91 ? 98  ALA B O   1 
ATOM   2245 C CB  . ALA B 1 98  ? 28.439 36.461 18.319 1.00 12.32 ? 98  ALA B CB  1 
ATOM   2246 N N   . TYR B 1 99  ? 27.398 34.035 16.353 1.00 16.98 ? 99  TYR B N   1 
ATOM   2247 C CA  . TYR B 1 99  ? 27.833 32.967 15.480 1.00 19.19 ? 99  TYR B CA  1 
ATOM   2248 C C   . TYR B 1 99  ? 26.668 32.277 14.813 1.00 20.20 ? 99  TYR B C   1 
ATOM   2249 O O   . TYR B 1 99  ? 25.504 32.603 15.080 1.00 18.41 ? 99  TYR B O   1 
ATOM   2250 C CB  . TYR B 1 99  ? 28.634 31.953 16.281 1.00 19.37 ? 99  TYR B CB  1 
ATOM   2251 C CG  . TYR B 1 99  ? 29.690 32.574 17.169 1.00 21.95 ? 99  TYR B CG  1 
ATOM   2252 C CD1 . TYR B 1 99  ? 29.462 32.780 18.528 1.00 23.20 ? 99  TYR B CD1 1 
ATOM   2253 C CD2 . TYR B 1 99  ? 30.935 32.923 16.654 1.00 23.41 ? 99  TYR B CD2 1 
ATOM   2254 C CE1 . TYR B 1 99  ? 30.452 33.313 19.350 1.00 24.49 ? 99  TYR B CE1 1 
ATOM   2255 C CE2 . TYR B 1 99  ? 31.929 33.450 17.460 1.00 24.85 ? 99  TYR B CE2 1 
ATOM   2256 C CZ  . TYR B 1 99  ? 31.689 33.643 18.807 1.00 25.37 ? 99  TYR B CZ  1 
ATOM   2257 O OH  . TYR B 1 99  ? 32.699 34.143 19.607 1.00 26.07 ? 99  TYR B OH  1 
ATOM   2258 N N   . ILE B 1 100 ? 26.996 31.328 13.937 1.00 21.33 ? 100 ILE B N   1 
ATOM   2259 C CA  . ILE B 1 100 ? 25.984 30.554 13.222 1.00 22.17 ? 100 ILE B CA  1 
ATOM   2260 C C   . ILE B 1 100 ? 25.327 29.662 14.259 1.00 21.57 ? 100 ILE B C   1 
ATOM   2261 O O   . ILE B 1 100 ? 25.988 29.137 15.157 1.00 21.14 ? 100 ILE B O   1 
ATOM   2262 C CB  . ILE B 1 100 ? 26.595 29.674 12.085 1.00 21.32 ? 100 ILE B CB  1 
ATOM   2263 C CG1 . ILE B 1 100 ? 27.554 28.637 12.672 1.00 21.47 ? 100 ILE B CG1 1 
ATOM   2264 C CG2 . ILE B 1 100 ? 27.324 30.559 11.064 1.00 19.55 ? 100 ILE B CG2 1 
ATOM   2265 C CD1 . ILE B 1 100 ? 28.000 27.582 11.672 1.00 22.92 ? 100 ILE B CD1 1 
ATOM   2266 N N   . LYS B 1 101 ? 24.021 29.492 14.144 1.00 22.88 ? 101 LYS B N   1 
ATOM   2267 C CA  . LYS B 1 101 ? 23.322 28.688 15.121 1.00 23.50 ? 101 LYS B CA  1 
ATOM   2268 C C   . LYS B 1 101 ? 23.621 27.207 15.002 1.00 24.30 ? 101 LYS B C   1 
ATOM   2269 O O   . LYS B 1 101 ? 23.823 26.693 13.903 1.00 23.59 ? 101 LYS B O   1 
ATOM   2270 C CB  . LYS B 1 101 ? 21.818 28.922 15.024 1.00 23.84 ? 101 LYS B CB  1 
ATOM   2271 C CG  . LYS B 1 101 ? 21.139 28.311 13.826 1.00 24.87 ? 101 LYS B CG  1 
ATOM   2272 C CD  . LYS B 1 101 ? 19.666 28.719 13.860 1.00 30.22 ? 101 LYS B CD  1 
ATOM   2273 C CE  . LYS B 1 101 ? 18.797 28.037 12.804 1.00 33.04 ? 101 LYS B CE  1 
ATOM   2274 N NZ  . LYS B 1 101 ? 19.139 28.419 11.399 1.00 36.94 ? 101 LYS B NZ  1 
ATOM   2275 N N   . PRO B 1 102 ? 23.677 26.506 16.154 1.00 25.73 ? 102 PRO B N   1 
ATOM   2276 C CA  . PRO B 1 102 ? 23.943 25.068 16.265 1.00 26.29 ? 102 PRO B CA  1 
ATOM   2277 C C   . PRO B 1 102 ? 22.615 24.347 16.134 1.00 27.32 ? 102 PRO B C   1 
ATOM   2278 O O   . PRO B 1 102 ? 21.562 24.973 16.234 1.00 27.15 ? 102 PRO B O   1 
ATOM   2279 C CB  . PRO B 1 102 ? 24.507 24.940 17.667 1.00 26.91 ? 102 PRO B CB  1 
ATOM   2280 C CG  . PRO B 1 102 ? 23.642 25.911 18.427 1.00 26.53 ? 102 PRO B CG  1 
ATOM   2281 C CD  . PRO B 1 102 ? 23.627 27.124 17.496 1.00 25.87 ? 102 PRO B CD  1 
ATOM   2282 N N   . THR B 1 103 ? 22.658 23.042 15.910 1.00 28.81 ? 103 THR B N   1 
ATOM   2283 C CA  . THR B 1 103 ? 21.431 22.278 15.784 1.00 30.43 ? 103 THR B CA  1 
ATOM   2284 C C   . THR B 1 103 ? 21.241 21.529 17.092 1.00 30.61 ? 103 THR B C   1 
ATOM   2285 O O   . THR B 1 103 ? 22.203 21.039 17.682 1.00 30.31 ? 103 THR B O   1 
ATOM   2286 C CB  . THR B 1 103 ? 21.504 21.302 14.582 1.00 30.79 ? 103 THR B CB  1 
ATOM   2287 O OG1 . THR B 1 103 ? 20.220 20.700 14.371 1.00 31.68 ? 103 THR B OG1 1 
ATOM   2288 C CG2 . THR B 1 103 ? 22.529 20.216 14.828 1.00 32.03 ? 103 THR B CG2 1 
ATOM   2289 N N   . LEU B 1 104 ? 20.000 21.474 17.560 1.00 31.74 ? 104 LEU B N   1 
ATOM   2290 C CA  . LEU B 1 104 ? 19.678 20.800 18.819 1.00 33.40 ? 104 LEU B CA  1 
ATOM   2291 C C   . LEU B 1 104 ? 18.753 19.619 18.534 1.00 34.62 ? 104 LEU B C   1 
ATOM   2292 O O   . LEU B 1 104 ? 17.707 19.784 17.916 1.00 33.73 ? 104 LEU B O   1 
ATOM   2293 C CB  . LEU B 1 104 ? 19.012 21.796 19.768 1.00 32.36 ? 104 LEU B CB  1 
ATOM   2294 C CG  . LEU B 1 104 ? 18.533 21.259 21.101 1.00 32.66 ? 104 LEU B CG  1 
ATOM   2295 C CD1 . LEU B 1 104 ? 19.698 20.648 21.852 1.00 31.72 ? 104 LEU B CD1 1 
ATOM   2296 C CD2 . LEU B 1 104 ? 17.904 22.385 21.893 1.00 32.52 ? 104 LEU B CD2 1 
ATOM   2297 N N   . SER B 1 105 ? 19.123 18.427 18.988 1.00 37.04 ? 105 SER B N   1 
ATOM   2298 C CA  . SER B 1 105 ? 18.300 17.241 18.728 1.00 39.09 ? 105 SER B CA  1 
ATOM   2299 C C   . SER B 1 105 ? 18.068 16.415 20.014 1.00 41.70 ? 105 SER B C   1 
ATOM   2300 O O   . SER B 1 105 ? 18.899 16.518 20.920 1.00 41.96 ? 105 SER B O   1 
ATOM   2301 C CB  . SER B 1 105 ? 19.034 16.363 17.712 1.00 37.63 ? 105 SER B CB  1 
ATOM   2302 O OG  . SER B 1 105 ? 20.355 16.062 18.152 1.00 36.35 ? 105 SER B OG  1 
ATOM   2303 N N   . ALA B 1 106 ? 16.939 15.664 20.080 1.00 44.36 ? 106 ALA B N   1 
ATOM   2304 C CA  . ALA B 1 106 ? 16.576 14.700 21.149 1.00 46.69 ? 106 ALA B CA  1 
ATOM   2305 C C   . ALA B 1 106 ? 17.472 13.441 20.817 1.00 47.90 ? 106 ALA B C   1 
ATOM   2306 O O   . ALA B 1 106 ? 17.812 13.172 19.632 1.00 47.88 ? 106 ALA B O   1 
ATOM   2307 C CB  . ALA B 1 106 ? 14.916 14.356 21.137 1.00 46.70 ? 106 ALA B CB  1 
ATOM   2308 N N   . GLN B 1 107 ? 17.980 12.762 21.855 1.00 49.92 ? 107 GLN B N   1 
ATOM   2309 C CA  . GLN B 1 107 ? 18.825 11.530 21.772 1.00 51.06 ? 107 GLN B CA  1 
ATOM   2310 C C   . GLN B 1 107 ? 18.238 10.391 22.729 1.00 52.42 ? 107 GLN B C   1 
ATOM   2311 O O   . GLN B 1 107 ? 18.593 10.283 23.902 1.00 52.82 ? 107 GLN B O   1 
ATOM   2312 C CB  . GLN B 1 107 ? 20.305 11.976 22.111 1.00 50.52 ? 107 GLN B CB  1 
ATOM   2313 C CG  . GLN B 1 107 ? 20.955 12.847 21.017 1.00 51.39 ? 107 GLN B CG  1 
ATOM   2314 C CD  . GLN B 1 107 ? 21.634 11.988 19.989 1.00 52.27 ? 107 GLN B CD  1 
ATOM   2315 O OE1 . GLN B 1 107 ? 21.022 11.056 19.443 1.00 52.19 ? 107 GLN B OE1 1 
ATOM   2316 N NE2 . GLN B 1 107 ? 22.896 12.275 19.720 1.00 52.98 ? 107 GLN B NE2 1 
ATOM   2317 N N   . PRO B 1 108 ? 17.369 9.488  22.238 1.00 52.84 ? 108 PRO B N   1 
ATOM   2318 C CA  . PRO B 1 108 ? 16.757 9.126  20.959 1.00 51.88 ? 108 PRO B CA  1 
ATOM   2319 C C   . PRO B 1 108 ? 15.507 9.912  20.458 1.00 50.52 ? 108 PRO B C   1 
ATOM   2320 O O   . PRO B 1 108 ? 15.145 9.806  19.281 1.00 52.55 ? 108 PRO B O   1 
ATOM   2321 C CB  . PRO B 1 108 ? 16.358 7.692  21.171 1.00 52.91 ? 108 PRO B CB  1 
ATOM   2322 C CG  . PRO B 1 108 ? 17.639 7.284  21.958 1.00 53.57 ? 108 PRO B CG  1 
ATOM   2323 C CD  . PRO B 1 108 ? 17.519 8.270  23.011 1.00 53.94 ? 108 PRO B CD  1 
ATOM   2324 N N   . SER B 1 109 ? 14.772 10.666 21.274 1.00 48.27 ? 109 SER B N   1 
ATOM   2325 C CA  . SER B 1 109 ? 13.580 11.409 20.775 1.00 47.02 ? 109 SER B CA  1 
ATOM   2326 C C   . SER B 1 109 ? 12.839 12.389 21.747 1.00 45.36 ? 109 SER B C   1 
ATOM   2327 O O   . SER B 1 109 ? 12.768 12.201 22.933 1.00 43.25 ? 109 SER B O   1 
ATOM   2328 C CB  . SER B 1 109 ? 12.550 10.383 20.211 1.00 47.58 ? 109 SER B CB  1 
ATOM   2329 O OG  . SER B 1 109 ? 11.784 9.896  21.282 1.00 48.76 ? 109 SER B OG  1 
ATOM   2330 N N   . PRO B 1 110 ? 12.304 13.491 21.191 1.00 44.50 ? 110 PRO B N   1 
ATOM   2331 C CA  . PRO B 1 110 ? 11.560 14.550 21.936 1.00 43.85 ? 110 PRO B CA  1 
ATOM   2332 C C   . PRO B 1 110 ? 10.318 14.109 22.703 1.00 43.58 ? 110 PRO B C   1 
ATOM   2333 O O   . PRO B 1 110 ? 9.719  14.877 23.450 1.00 42.56 ? 110 PRO B O   1 
ATOM   2334 C CB  . PRO B 1 110 ? 11.179 15.564 20.852 1.00 43.83 ? 110 PRO B CB  1 
ATOM   2335 C CG  . PRO B 1 110 ? 12.184 15.190 19.687 1.00 44.75 ? 110 PRO B CG  1 
ATOM   2336 C CD  . PRO B 1 110 ? 12.243 13.709 19.724 1.00 44.58 ? 110 PRO B CD  1 
ATOM   2337 N N   . VAL B 1 111 ? 9.912  12.874 22.462 1.00 43.70 ? 111 VAL B N   1 
ATOM   2338 C CA  . VAL B 1 111 ? 8.744  12.344 23.154 1.00 44.03 ? 111 VAL B CA  1 
ATOM   2339 C C   . VAL B 1 111 ? 9.192  11.315 24.175 1.00 43.47 ? 111 VAL B C   1 
ATOM   2340 O O   . VAL B 1 111 ? 9.667  10.220 23.821 1.00 42.98 ? 111 VAL B O   1 
ATOM   2341 C CB  . VAL B 1 111 ? 7.762  11.693 22.208 1.00 44.50 ? 111 VAL B CB  1 
ATOM   2342 C CG1 . VAL B 1 111 ? 6.572  11.241 22.995 1.00 45.12 ? 111 VAL B CG1 1 
ATOM   2343 C CG2 . VAL B 1 111 ? 7.373  12.687 21.086 1.00 45.42 ? 111 VAL B CG2 1 
ATOM   2344 N N   . VAL B 1 112 ? 9.095  11.712 25.446 1.00 41.85 ? 112 VAL B N   1 
ATOM   2345 C CA  . VAL B 1 112 ? 9.496  10.852 26.558 1.00 41.04 ? 112 VAL B CA  1 
ATOM   2346 C C   . VAL B 1 112 ? 8.462  10.638 27.660 1.00 39.91 ? 112 VAL B C   1 
ATOM   2347 O O   . VAL B 1 112 ? 7.595  11.471 27.918 1.00 38.80 ? 112 VAL B O   1 
ATOM   2348 C CB  . VAL B 1 112 ? 10.781 11.342 27.236 1.00 39.99 ? 112 VAL B CB  1 
ATOM   2349 C CG1 . VAL B 1 112 ? 11.869 11.493 26.213 1.00 40.95 ? 112 VAL B CG1 1 
ATOM   2350 C CG2 . VAL B 1 112 ? 10.530 12.621 27.990 1.00 38.85 ? 112 VAL B CG2 1 
ATOM   2351 N N   . ASN B 1 113 ? 8.602  9.483  28.304 1.00 39.71 ? 113 ASN B N   1 
ATOM   2352 C CA  . ASN B 1 113 ? 7.748  9.042  29.407 1.00 39.04 ? 113 ASN B CA  1 
ATOM   2353 C C   . ASN B 1 113 ? 7.977  9.898  30.645 1.00 39.25 ? 113 ASN B C   1 
ATOM   2354 O O   . ASN B 1 113 ? 9.125  10.151 31.024 1.00 38.96 ? 113 ASN B O   1 
ATOM   2355 C CB  . ASN B 1 113 ? 8.057  7.598  29.773 1.00 36.70 ? 113 ASN B CB  1 
ATOM   2356 C CG  . ASN B 1 113 ? 7.783  6.658  28.651 1.00 35.99 ? 113 ASN B CG  1 
ATOM   2357 O OD1 . ASN B 1 113 ? 6.637  6.433  28.274 1.00 37.98 ? 113 ASN B OD1 1 
ATOM   2358 N ND2 . ASN B 1 113 ? 8.831  6.088  28.108 1.00 35.20 ? 113 ASN B ND2 1 
ATOM   2359 N N   . SER B 1 114 ? 6.893  10.318 31.294 1.00 39.16 ? 114 SER B N   1 
ATOM   2360 C CA  . SER B 1 114 ? 7.017  11.141 32.482 1.00 38.62 ? 114 SER B CA  1 
ATOM   2361 C C   . SER B 1 114 ? 8.000  10.508 33.459 1.00 38.83 ? 114 SER B C   1 
ATOM   2362 O O   . SER B 1 114 ? 8.092  9.289  33.570 1.00 38.02 ? 114 SER B O   1 
ATOM   2363 C CB  . SER B 1 114 ? 5.665  11.337 33.148 1.00 37.54 ? 114 SER B CB  1 
ATOM   2364 O OG  . SER B 1 114 ? 5.811  12.207 34.248 1.00 37.52 ? 114 SER B OG  1 
ATOM   2365 N N   . GLY B 1 115 ? 8.752  11.355 34.152 1.00 40.30 ? 115 GLY B N   1 
ATOM   2366 C CA  . GLY B 1 115 ? 9.732  10.867 35.099 1.00 40.64 ? 115 GLY B CA  1 
ATOM   2367 C C   . GLY B 1 115 ? 11.009 10.443 34.403 1.00 41.45 ? 115 GLY B C   1 
ATOM   2368 O O   . GLY B 1 115 ? 12.020 10.191 35.061 1.00 40.71 ? 115 GLY B O   1 
ATOM   2369 N N   . GLY B 1 116 ? 10.977 10.380 33.075 1.00 42.03 ? 116 GLY B N   1 
ATOM   2370 C CA  . GLY B 1 116 ? 12.152 9.970  32.332 1.00 42.55 ? 116 GLY B CA  1 
ATOM   2371 C C   . GLY B 1 116 ? 13.199 11.040 32.078 1.00 43.46 ? 116 GLY B C   1 
ATOM   2372 O O   . GLY B 1 116 ? 12.977 12.231 32.306 1.00 43.20 ? 116 GLY B O   1 
ATOM   2373 N N   . ASN B 1 117 ? 14.359 10.588 31.605 1.00 44.61 ? 117 ASN B N   1 
ATOM   2374 C CA  . ASN B 1 117 ? 15.495 11.451 31.270 1.00 44.57 ? 117 ASN B CA  1 
ATOM   2375 C C   . ASN B 1 117 ? 15.741 11.318 29.784 1.00 43.77 ? 117 ASN B C   1 
ATOM   2376 O O   . ASN B 1 117 ? 15.597 10.232 29.228 1.00 45.01 ? 117 ASN B O   1 
ATOM   2377 C CB  . ASN B 1 117 ? 16.766 10.986 31.979 1.00 46.58 ? 117 ASN B CB  1 
ATOM   2378 C CG  . ASN B 1 117 ? 16.781 11.339 33.444 1.00 48.79 ? 117 ASN B CG  1 
ATOM   2379 O OD1 . ASN B 1 117 ? 16.948 12.502 33.805 1.00 49.87 ? 117 ASN B OD1 1 
ATOM   2380 N ND2 . ASN B 1 117 ? 16.612 10.338 34.303 1.00 49.27 ? 117 ASN B ND2 1 
ATOM   2381 N N   . VAL B 1 118 ? 16.120 12.410 29.133 1.00 41.50 ? 118 VAL B N   1 
ATOM   2382 C CA  . VAL B 1 118 ? 16.429 12.360 27.703 1.00 40.00 ? 118 VAL B CA  1 
ATOM   2383 C C   . VAL B 1 118 ? 17.763 13.075 27.501 1.00 38.51 ? 118 VAL B C   1 
ATOM   2384 O O   . VAL B 1 118 ? 18.138 13.932 28.297 1.00 38.95 ? 118 VAL B O   1 
ATOM   2385 C CB  . VAL B 1 118 ? 15.316 13.036 26.833 1.00 40.12 ? 118 VAL B CB  1 
ATOM   2386 C CG1 . VAL B 1 118 ? 15.094 14.471 27.284 1.00 41.02 ? 118 VAL B CG1 1 
ATOM   2387 C CG2 . VAL B 1 118 ? 15.707 13.016 25.357 1.00 39.41 ? 118 VAL B CG2 1 
ATOM   2388 N N   . ILE B 1 119 ? 18.479 12.705 26.445 1.00 36.98 ? 119 ILE B N   1 
ATOM   2389 C CA  . ILE B 1 119 ? 19.756 13.329 26.131 1.00 36.18 ? 119 ILE B CA  1 
ATOM   2390 C C   . ILE B 1 119 ? 19.554 14.360 25.020 1.00 35.06 ? 119 ILE B C   1 
ATOM   2391 O O   . ILE B 1 119 ? 18.984 14.054 23.975 1.00 34.64 ? 119 ILE B O   1 
ATOM   2392 C CB  . ILE B 1 119 ? 20.789 12.310 25.629 1.00 36.47 ? 119 ILE B CB  1 
ATOM   2393 C CG1 . ILE B 1 119 ? 21.146 11.324 26.733 1.00 36.22 ? 119 ILE B CG1 1 
ATOM   2394 C CG2 . ILE B 1 119 ? 22.047 13.055 25.158 1.00 34.67 ? 119 ILE B CG2 1 
ATOM   2395 C CD1 . ILE B 1 119 ? 22.182 11.892 27.715 1.00 39.69 ? 119 ILE B CD1 1 
ATOM   2396 N N   . LEU B 1 120 ? 20.029 15.578 25.249 1.00 34.60 ? 120 LEU B N   1 
ATOM   2397 C CA  . LEU B 1 120 ? 19.912 16.619 24.248 1.00 34.11 ? 120 LEU B CA  1 
ATOM   2398 C C   . LEU B 1 120 ? 21.284 16.850 23.668 1.00 34.53 ? 120 LEU B C   1 
ATOM   2399 O O   . LEU B 1 120 ? 22.270 16.904 24.402 1.00 33.67 ? 120 LEU B O   1 
ATOM   2400 C CB  . LEU B 1 120 ? 19.396 17.913 24.859 1.00 32.50 ? 120 LEU B CB  1 
ATOM   2401 C CG  . LEU B 1 120 ? 17.936 17.888 25.286 1.00 31.15 ? 120 LEU B CG  1 
ATOM   2402 C CD1 . LEU B 1 120 ? 17.499 19.280 25.674 1.00 32.76 ? 120 LEU B CD1 1 
ATOM   2403 C CD2 . LEU B 1 120 ? 17.092 17.382 24.145 1.00 30.45 ? 120 LEU B CD2 1 
ATOM   2404 N N   . GLN B 1 121 ? 21.348 16.980 22.350 1.00 35.30 ? 121 GLN B N   1 
ATOM   2405 C CA  . GLN B 1 121 ? 22.622 17.198 21.702 1.00 36.22 ? 121 GLN B CA  1 
ATOM   2406 C C   . GLN B 1 121 ? 22.641 18.495 20.946 1.00 35.97 ? 121 GLN B C   1 
ATOM   2407 O O   . GLN B 1 121 ? 21.726 18.808 20.177 1.00 36.02 ? 121 GLN B O   1 
ATOM   2408 C CB  . GLN B 1 121 ? 22.943 16.057 20.750 1.00 38.21 ? 121 GLN B CB  1 
ATOM   2409 C CG  . GLN B 1 121 ? 24.344 16.121 20.209 1.00 39.68 ? 121 GLN B CG  1 
ATOM   2410 C CD  . GLN B 1 121 ? 24.618 15.007 19.236 1.00 41.31 ? 121 GLN B CD  1 
ATOM   2411 O OE1 . GLN B 1 121 ? 24.001 14.931 18.171 1.00 41.47 ? 121 GLN B OE1 1 
ATOM   2412 N NE2 . GLN B 1 121 ? 25.542 14.123 19.597 1.00 42.87 ? 121 GLN B NE2 1 
ATOM   2413 N N   . CYS B 1 122 ? 23.700 19.252 21.185 1.00 35.88 ? 122 CYS B N   1 
ATOM   2414 C CA  . CYS B 1 122 ? 23.905 20.538 20.538 1.00 36.10 ? 122 CYS B CA  1 
ATOM   2415 C C   . CYS B 1 122 ? 25.070 20.368 19.554 1.00 36.05 ? 122 CYS B C   1 
ATOM   2416 O O   . CYS B 1 122 ? 26.222 20.177 19.964 1.00 36.45 ? 122 CYS B O   1 
ATOM   2417 C CB  . CYS B 1 122 ? 24.234 21.588 21.605 1.00 34.82 ? 122 CYS B CB  1 
ATOM   2418 S SG  . CYS B 1 122 ? 24.224 23.323 21.055 1.00 34.94 ? 122 CYS B SG  1 
ATOM   2419 N N   . ASP B 1 123 ? 24.770 20.416 18.258 1.00 35.74 ? 123 ASP B N   1 
ATOM   2420 C CA  . ASP B 1 123 ? 25.806 20.248 17.241 1.00 35.39 ? 123 ASP B CA  1 
ATOM   2421 C C   . ASP B 1 123 ? 26.057 21.521 16.430 1.00 33.58 ? 123 ASP B C   1 
ATOM   2422 O O   . ASP B 1 123 ? 25.131 22.263 16.102 1.00 33.22 ? 123 ASP B O   1 
ATOM   2423 C CB  . ASP B 1 123 ? 25.447 19.093 16.303 1.00 36.84 ? 123 ASP B CB  1 
ATOM   2424 C CG  . ASP B 1 123 ? 26.557 18.793 15.311 1.00 40.53 ? 123 ASP B CG  1 
ATOM   2425 O OD1 . ASP B 1 123 ? 27.638 18.341 15.751 1.00 40.58 ? 123 ASP B OD1 1 
ATOM   2426 O OD2 . ASP B 1 123 ? 26.364 19.018 14.092 1.00 43.96 ? 123 ASP B OD2 1 
ATOM   2427 N N   . SER B 1 124 ? 27.322 21.760 16.106 1.00 32.71 ? 124 SER B N   1 
ATOM   2428 C CA  . SER B 1 124 ? 27.725 22.950 15.357 1.00 32.38 ? 124 SER B CA  1 
ATOM   2429 C C   . SER B 1 124 ? 28.547 22.659 14.083 1.00 32.69 ? 124 SER B C   1 
ATOM   2430 O O   . SER B 1 124 ? 29.491 21.857 14.103 1.00 32.37 ? 124 SER B O   1 
ATOM   2431 C CB  . SER B 1 124 ? 28.518 23.867 16.298 1.00 31.44 ? 124 SER B CB  1 
ATOM   2432 O OG  . SER B 1 124 ? 28.983 25.035 15.649 1.00 31.49 ? 124 SER B OG  1 
ATOM   2433 N N   . GLN B 1 125 ? 28.191 23.324 12.981 1.00 32.76 ? 125 GLN B N   1 
ATOM   2434 C CA  . GLN B 1 125 ? 28.897 23.136 11.711 1.00 33.02 ? 125 GLN B CA  1 
ATOM   2435 C C   . GLN B 1 125 ? 30.347 23.638 11.774 1.00 31.61 ? 125 GLN B C   1 
ATOM   2436 O O   . GLN B 1 125 ? 31.116 23.427 10.836 1.00 31.37 ? 125 GLN B O   1 
ATOM   2437 C CB  . GLN B 1 125 ? 28.175 23.866 10.574 1.00 35.16 ? 125 GLN B CB  1 
ATOM   2438 C CG  . GLN B 1 125 ? 26.665 23.660 10.513 1.00 39.40 ? 125 GLN B CG  1 
ATOM   2439 C CD  . GLN B 1 125 ? 25.953 24.697 9.632  1.00 41.63 ? 125 GLN B CD  1 
ATOM   2440 O OE1 . GLN B 1 125 ? 24.729 24.856 9.716  1.00 42.94 ? 125 GLN B OE1 1 
ATOM   2441 N NE2 . GLN B 1 125 ? 26.716 25.401 8.783  1.00 42.10 ? 125 GLN B NE2 1 
ATOM   2442 N N   . VAL B 1 126 ? 30.709 24.331 12.855 1.00 30.49 ? 126 VAL B N   1 
ATOM   2443 C CA  . VAL B 1 126 ? 32.079 24.837 13.031 1.00 30.35 ? 126 VAL B CA  1 
ATOM   2444 C C   . VAL B 1 126 ? 32.518 24.648 14.486 1.00 29.36 ? 126 VAL B C   1 
ATOM   2445 O O   . VAL B 1 126 ? 31.723 24.817 15.415 1.00 29.99 ? 126 VAL B O   1 
ATOM   2446 C CB  . VAL B 1 126 ? 32.203 26.330 12.629 1.00 30.47 ? 126 VAL B CB  1 
ATOM   2447 C CG1 . VAL B 1 126 ? 31.624 26.525 11.255 1.00 30.86 ? 126 VAL B CG1 1 
ATOM   2448 C CG2 . VAL B 1 126 ? 31.489 27.219 13.608 1.00 29.00 ? 126 VAL B CG2 1 
ATOM   2449 N N   . ALA B 1 127 ? 33.782 24.291 14.673 1.00 27.42 ? 127 ALA B N   1 
ATOM   2450 C CA  . ALA B 1 127 ? 34.322 24.026 16.001 1.00 26.69 ? 127 ALA B CA  1 
ATOM   2451 C C   . ALA B 1 127 ? 34.094 25.131 17.013 1.00 24.09 ? 127 ALA B C   1 
ATOM   2452 O O   . ALA B 1 127 ? 34.296 26.300 16.705 1.00 25.39 ? 127 ALA B O   1 
ATOM   2453 C CB  . ALA B 1 127 ? 35.824 23.726 15.897 1.00 27.23 ? 127 ALA B CB  1 
ATOM   2454 N N   . PHE B 1 128 ? 33.650 24.750 18.209 1.00 22.29 ? 128 PHE B N   1 
ATOM   2455 C CA  . PHE B 1 128 ? 33.446 25.682 19.332 1.00 21.92 ? 128 PHE B CA  1 
ATOM   2456 C C   . PHE B 1 128 ? 33.786 24.875 20.585 1.00 21.06 ? 128 PHE B C   1 
ATOM   2457 O O   . PHE B 1 128 ? 33.446 23.690 20.674 1.00 20.11 ? 128 PHE B O   1 
ATOM   2458 C CB  . PHE B 1 128 ? 31.997 26.198 19.421 1.00 21.46 ? 128 PHE B CB  1 
ATOM   2459 C CG  . PHE B 1 128 ? 31.668 27.310 18.445 1.00 21.25 ? 128 PHE B CG  1 
ATOM   2460 C CD1 . PHE B 1 128 ? 30.789 27.083 17.377 1.00 21.12 ? 128 PHE B CD1 1 
ATOM   2461 C CD2 . PHE B 1 128 ? 32.220 28.591 18.599 1.00 20.35 ? 128 PHE B CD2 1 
ATOM   2462 C CE1 . PHE B 1 128 ? 30.457 28.109 16.473 1.00 19.02 ? 128 PHE B CE1 1 
ATOM   2463 C CE2 . PHE B 1 128 ? 31.898 29.633 17.696 1.00 19.17 ? 128 PHE B CE2 1 
ATOM   2464 C CZ  . PHE B 1 128 ? 31.008 29.383 16.628 1.00 17.95 ? 128 PHE B CZ  1 
ATOM   2465 N N   . ASP B 1 129 ? 34.454 25.496 21.550 1.00 20.59 ? 129 ASP B N   1 
ATOM   2466 C CA  . ASP B 1 129 ? 34.845 24.763 22.753 1.00 20.78 ? 129 ASP B CA  1 
ATOM   2467 C C   . ASP B 1 129 ? 33.889 24.939 23.921 1.00 20.44 ? 129 ASP B C   1 
ATOM   2468 O O   . ASP B 1 129 ? 34.131 24.457 25.018 1.00 19.75 ? 129 ASP B O   1 
ATOM   2469 C CB  . ASP B 1 129 ? 36.252 25.172 23.171 1.00 20.93 ? 129 ASP B CB  1 
ATOM   2470 C CG  . ASP B 1 129 ? 36.396 26.650 23.287 1.00 20.63 ? 129 ASP B CG  1 
ATOM   2471 O OD1 . ASP B 1 129 ? 35.535 27.265 23.943 1.00 24.21 ? 129 ASP B OD1 1 
ATOM   2472 O OD2 . ASP B 1 129 ? 37.362 27.198 22.724 1.00 23.47 ? 129 ASP B OD2 1 
ATOM   2473 N N   . GLY B 1 130 ? 32.790 25.629 23.683 1.00 21.26 ? 130 GLY B N   1 
ATOM   2474 C CA  . GLY B 1 130 ? 31.845 25.818 24.754 1.00 21.23 ? 130 GLY B CA  1 
ATOM   2475 C C   . GLY B 1 130 ? 30.451 25.743 24.202 1.00 21.16 ? 130 GLY B C   1 
ATOM   2476 O O   . GLY B 1 130 ? 30.212 26.159 23.079 1.00 21.89 ? 130 GLY B O   1 
ATOM   2477 N N   . PHE B 1 131 ? 29.530 25.197 24.980 1.00 21.53 ? 131 PHE B N   1 
ATOM   2478 C CA  . PHE B 1 131 ? 28.156 25.105 24.537 1.00 21.88 ? 131 PHE B CA  1 
ATOM   2479 C C   . PHE B 1 131 ? 27.258 25.450 25.692 1.00 22.07 ? 131 PHE B C   1 
ATOM   2480 O O   . PHE B 1 131 ? 27.665 25.391 26.853 1.00 22.22 ? 131 PHE B O   1 
ATOM   2481 C CB  . PHE B 1 131 ? 27.838 23.701 24.030 1.00 21.85 ? 131 PHE B CB  1 
ATOM   2482 C CG  . PHE B 1 131 ? 28.482 23.380 22.713 1.00 22.67 ? 131 PHE B CG  1 
ATOM   2483 C CD1 . PHE B 1 131 ? 29.810 22.961 22.646 1.00 23.16 ? 131 PHE B CD1 1 
ATOM   2484 C CD2 . PHE B 1 131 ? 27.766 23.517 21.536 1.00 23.13 ? 131 PHE B CD2 1 
ATOM   2485 C CE1 . PHE B 1 131 ? 30.401 22.689 21.425 1.00 24.20 ? 131 PHE B CE1 1 
ATOM   2486 C CE2 . PHE B 1 131 ? 28.348 23.248 20.314 1.00 23.35 ? 131 PHE B CE2 1 
ATOM   2487 C CZ  . PHE B 1 131 ? 29.665 22.834 20.254 1.00 24.58 ? 131 PHE B CZ  1 
ATOM   2488 N N   . SER B 1 132 ? 26.028 25.819 25.376 1.00 21.86 ? 132 SER B N   1 
ATOM   2489 C CA  . SER B 1 132 ? 25.091 26.167 26.419 1.00 22.87 ? 132 SER B CA  1 
ATOM   2490 C C   . SER B 1 132 ? 23.681 25.698 26.069 1.00 23.94 ? 132 SER B C   1 
ATOM   2491 O O   . SER B 1 132 ? 23.243 25.818 24.930 1.00 23.66 ? 132 SER B O   1 
ATOM   2492 C CB  . SER B 1 132 ? 25.100 27.675 26.642 1.00 22.33 ? 132 SER B CB  1 
ATOM   2493 O OG  . SER B 1 132 ? 24.506 27.984 27.887 1.00 26.30 ? 132 SER B OG  1 
ATOM   2494 N N   . LEU B 1 133 ? 22.975 25.166 27.059 1.00 24.62 ? 133 LEU B N   1 
ATOM   2495 C CA  . LEU B 1 133 ? 21.618 24.678 26.868 1.00 24.12 ? 133 LEU B CA  1 
ATOM   2496 C C   . LEU B 1 133 ? 20.734 25.496 27.781 1.00 24.79 ? 133 LEU B C   1 
ATOM   2497 O O   . LEU B 1 133 ? 21.005 25.594 28.976 1.00 23.89 ? 133 LEU B O   1 
ATOM   2498 C CB  . LEU B 1 133 ? 21.531 23.205 27.249 1.00 24.68 ? 133 LEU B CB  1 
ATOM   2499 C CG  . LEU B 1 133 ? 20.131 22.601 27.285 1.00 26.10 ? 133 LEU B CG  1 
ATOM   2500 C CD1 . LEU B 1 133 ? 19.587 22.530 25.869 1.00 24.60 ? 133 LEU B CD1 1 
ATOM   2501 C CD2 . LEU B 1 133 ? 20.179 21.216 27.925 1.00 26.22 ? 133 LEU B CD2 1 
ATOM   2502 N N   . CYS B 1 134 ? 19.679 26.074 27.210 1.00 26.31 ? 134 CYS B N   1 
ATOM   2503 C CA  . CYS B 1 134 ? 18.753 26.927 27.947 1.00 27.89 ? 134 CYS B CA  1 
ATOM   2504 C C   . CYS B 1 134 ? 17.279 26.543 27.856 1.00 30.26 ? 134 CYS B C   1 
ATOM   2505 O O   . CYS B 1 134 ? 16.702 26.416 26.771 1.00 30.45 ? 134 CYS B O   1 
ATOM   2506 C CB  . CYS B 1 134 ? 18.891 28.368 27.481 1.00 27.04 ? 134 CYS B CB  1 
ATOM   2507 S SG  . CYS B 1 134 ? 20.549 29.113 27.574 1.00 29.57 ? 134 CYS B SG  1 
ATOM   2508 N N   . LYS B 1 135 ? 16.672 26.404 29.026 1.00 32.60 ? 135 LYS B N   1 
ATOM   2509 C CA  . LYS B 1 135 ? 15.276 26.041 29.139 1.00 34.59 ? 135 LYS B CA  1 
ATOM   2510 C C   . LYS B 1 135 ? 14.395 27.283 29.041 1.00 36.19 ? 135 LYS B C   1 
ATOM   2511 O O   . LYS B 1 135 ? 14.237 28.007 30.021 1.00 38.22 ? 135 LYS B O   1 
ATOM   2512 C CB  . LYS B 1 135 ? 15.037 25.333 30.483 1.00 36.21 ? 135 LYS B CB  1 
ATOM   2513 C CG  . LYS B 1 135 ? 13.601 24.860 30.716 1.00 38.99 ? 135 LYS B CG  1 
ATOM   2514 C CD  . LYS B 1 135 ? 13.468 24.132 32.047 1.00 41.39 ? 135 LYS B CD  1 
ATOM   2515 C CE  . LYS B 1 135 ? 12.067 23.561 32.238 1.00 42.33 ? 135 LYS B CE  1 
ATOM   2516 N NZ  . LYS B 1 135 ? 11.890 22.932 33.583 1.00 43.76 ? 135 LYS B NZ  1 
ATOM   2517 N N   . GLU B 1 136 ? 13.824 27.530 27.865 1.00 37.03 ? 136 GLU B N   1 
ATOM   2518 C CA  . GLU B 1 136 ? 12.947 28.682 27.661 1.00 38.28 ? 136 GLU B CA  1 
ATOM   2519 C C   . GLU B 1 136 ? 11.762 28.613 28.637 1.00 38.59 ? 136 GLU B C   1 
ATOM   2520 O O   . GLU B 1 136 ? 10.778 27.899 28.403 1.00 38.85 ? 136 GLU B O   1 
ATOM   2521 C CB  . GLU B 1 136 ? 12.427 28.712 26.210 1.00 39.61 ? 136 GLU B CB  1 
ATOM   2522 C CG  . GLU B 1 136 ? 13.511 28.622 25.118 1.00 42.58 ? 136 GLU B CG  1 
ATOM   2523 C CD  . GLU B 1 136 ? 14.609 29.690 25.237 1.00 44.03 ? 136 GLU B CD  1 
ATOM   2524 O OE1 . GLU B 1 136 ? 14.276 30.895 25.305 1.00 45.29 ? 136 GLU B OE1 1 
ATOM   2525 O OE2 . GLU B 1 136 ? 15.811 29.325 25.248 1.00 42.94 ? 136 GLU B OE2 1 
ATOM   2526 N N   . GLN B 1 143 ? 16.673 28.908 32.672 1.00 41.41 ? 143 GLN B N   1 
ATOM   2527 C CA  . GLN B 1 143 ? 18.101 29.080 32.931 1.00 40.43 ? 143 GLN B CA  1 
ATOM   2528 C C   . GLN B 1 143 ? 18.948 28.208 32.002 1.00 38.61 ? 143 GLN B C   1 
ATOM   2529 O O   . GLN B 1 143 ? 18.413 27.485 31.151 1.00 37.70 ? 143 GLN B O   1 
ATOM   2530 C CB  . GLN B 1 143 ? 18.426 28.719 34.380 1.00 42.64 ? 143 GLN B CB  1 
ATOM   2531 C CG  . GLN B 1 143 ? 18.602 27.223 34.629 1.00 45.94 ? 143 GLN B CG  1 
ATOM   2532 C CD  . GLN B 1 143 ? 17.994 26.791 35.941 1.00 49.13 ? 143 GLN B CD  1 
ATOM   2533 O OE1 . GLN B 1 143 ? 18.181 27.455 36.962 1.00 51.13 ? 143 GLN B OE1 1 
ATOM   2534 N NE2 . GLN B 1 143 ? 17.260 25.675 35.930 1.00 50.40 ? 143 GLN B NE2 1 
ATOM   2535 N N   . CYS B 1 144 ? 20.266 28.251 32.188 1.00 35.65 ? 144 CYS B N   1 
ATOM   2536 C CA  . CYS B 1 144 ? 21.152 27.483 31.328 1.00 32.58 ? 144 CYS B CA  1 
ATOM   2537 C C   . CYS B 1 144 ? 22.299 26.807 32.037 1.00 31.64 ? 144 CYS B C   1 
ATOM   2538 O O   . CYS B 1 144 ? 22.773 27.263 33.071 1.00 30.61 ? 144 CYS B O   1 
ATOM   2539 C CB  . CYS B 1 144 ? 21.793 28.379 30.264 1.00 29.83 ? 144 CYS B CB  1 
ATOM   2540 S SG  . CYS B 1 144 ? 20.790 29.696 29.505 1.00 26.95 ? 144 CYS B SG  1 
ATOM   2541 N N   . LEU B 1 145 ? 22.743 25.708 31.454 1.00 32.10 ? 145 LEU B N   1 
ATOM   2542 C CA  . LEU B 1 145 ? 23.909 25.031 31.958 1.00 32.55 ? 145 LEU B CA  1 
ATOM   2543 C C   . LEU B 1 145 ? 24.811 24.985 30.743 1.00 31.46 ? 145 LEU B C   1 
ATOM   2544 O O   . LEU B 1 145 ? 24.348 24.761 29.628 1.00 29.33 ? 145 LEU B O   1 
ATOM   2545 C CB  . LEU B 1 145 ? 23.603 23.626 32.480 1.00 34.68 ? 145 LEU B CB  1 
ATOM   2546 C CG  . LEU B 1 145 ? 22.733 22.621 31.745 1.00 35.63 ? 145 LEU B CG  1 
ATOM   2547 C CD1 . LEU B 1 145 ? 23.268 21.216 31.970 1.00 37.78 ? 145 LEU B CD1 1 
ATOM   2548 C CD2 . LEU B 1 145 ? 21.326 22.719 32.274 1.00 37.79 ? 145 LEU B CD2 1 
ATOM   2549 N N   . ASN B 1 146 ? 26.091 25.247 30.959 1.00 32.35 ? 146 ASN B N   1 
ATOM   2550 C CA  . ASN B 1 146 ? 27.063 25.260 29.881 1.00 33.91 ? 146 ASN B CA  1 
ATOM   2551 C C   . ASN B 1 146 ? 27.800 23.941 29.901 1.00 34.49 ? 146 ASN B C   1 
ATOM   2552 O O   . ASN B 1 146 ? 27.945 23.327 30.951 1.00 34.74 ? 146 ASN B O   1 
ATOM   2553 C CB  . ASN B 1 146 ? 28.069 26.401 30.088 1.00 34.38 ? 146 ASN B CB  1 
ATOM   2554 C CG  . ASN B 1 146 ? 27.401 27.729 30.410 1.00 33.84 ? 146 ASN B CG  1 
ATOM   2555 O OD1 . ASN B 1 146 ? 26.577 27.818 31.321 1.00 35.76 ? 146 ASN B OD1 1 
ATOM   2556 N ND2 . ASN B 1 146 ? 27.765 28.771 29.670 1.00 32.59 ? 146 ASN B ND2 1 
ATOM   2557 N N   . SER B 1 147 ? 28.263 23.503 28.739 1.00 35.71 ? 147 SER B N   1 
ATOM   2558 C CA  . SER B 1 147 ? 29.014 22.266 28.675 1.00 37.75 ? 147 SER B CA  1 
ATOM   2559 C C   . SER B 1 147 ? 30.272 22.451 27.830 1.00 39.37 ? 147 SER B C   1 
ATOM   2560 O O   . SER B 1 147 ? 30.689 23.572 27.492 1.00 39.98 ? 147 SER B O   1 
ATOM   2561 C CB  . SER B 1 147 ? 28.155 21.112 28.117 1.00 36.79 ? 147 SER B CB  1 
ATOM   2562 O OG  . SER B 1 147 ? 28.820 19.853 28.222 1.00 35.41 ? 147 SER B OG  1 
ATOM   2563 N N   . GLN B 1 148 ? 30.879 21.323 27.512 1.00 40.82 ? 148 GLN B N   1 
ATOM   2564 C CA  . GLN B 1 148 ? 32.104 21.288 26.737 1.00 41.88 ? 148 GLN B CA  1 
ATOM   2565 C C   . GLN B 1 148 ? 31.823 20.289 25.626 1.00 43.04 ? 148 GLN B C   1 
ATOM   2566 O O   . GLN B 1 148 ? 30.759 19.685 25.621 1.00 43.70 ? 148 GLN B O   1 
ATOM   2567 C CB  . GLN B 1 148 ? 33.208 20.790 27.643 1.00 41.67 ? 148 GLN B CB  1 
ATOM   2568 C CG  . GLN B 1 148 ? 32.726 20.731 29.089 1.00 42.87 ? 148 GLN B CG  1 
ATOM   2569 C CD  . GLN B 1 148 ? 32.818 19.343 29.685 1.00 42.53 ? 148 GLN B CD  1 
ATOM   2570 O OE1 . GLN B 1 148 ? 33.894 18.923 30.089 1.00 44.09 ? 148 GLN B OE1 1 
ATOM   2571 N NE2 . GLN B 1 148 ? 31.698 18.622 29.736 1.00 42.69 ? 148 GLN B NE2 1 
ATOM   2572 N N   . PRO B 1 149 ? 32.758 20.077 24.682 1.00 43.92 ? 149 PRO B N   1 
ATOM   2573 C CA  . PRO B 1 149 ? 32.428 19.103 23.626 1.00 44.51 ? 149 PRO B CA  1 
ATOM   2574 C C   . PRO B 1 149 ? 32.219 17.655 24.110 1.00 44.50 ? 149 PRO B C   1 
ATOM   2575 O O   . PRO B 1 149 ? 32.347 17.358 25.303 1.00 45.92 ? 149 PRO B O   1 
ATOM   2576 C CB  . PRO B 1 149 ? 33.594 19.279 22.648 1.00 44.17 ? 149 PRO B CB  1 
ATOM   2577 C CG  . PRO B 1 149 ? 33.868 20.728 22.807 1.00 43.56 ? 149 PRO B CG  1 
ATOM   2578 C CD  . PRO B 1 149 ? 33.970 20.817 24.310 1.00 42.81 ? 149 PRO B CD  1 
ATOM   2579 N N   . ARG B 1 152 ? 35.218 15.129 23.631 1.00 74.00 ? 152 ARG B N   1 
ATOM   2580 C CA  . ARG B 1 152 ? 35.163 16.579 23.528 1.00 74.60 ? 152 ARG B CA  1 
ATOM   2581 C C   . ARG B 1 152 ? 36.345 17.055 22.704 1.00 72.96 ? 152 ARG B C   1 
ATOM   2582 O O   . ARG B 1 152 ? 36.877 18.149 22.917 1.00 73.44 ? 152 ARG B O   1 
ATOM   2583 C CB  . ARG B 1 152 ? 35.195 17.217 24.925 1.00 77.10 ? 152 ARG B CB  1 
ATOM   2584 C CG  . ARG B 1 152 ? 36.590 17.359 25.540 1.00 80.58 ? 152 ARG B CG  1 
ATOM   2585 C CD  . ARG B 1 152 ? 36.560 17.561 27.067 1.00 83.14 ? 152 ARG B CD  1 
ATOM   2586 N NE  . ARG B 1 152 ? 36.174 18.907 27.501 1.00 86.27 ? 152 ARG B NE  1 
ATOM   2587 C CZ  . ARG B 1 152 ? 36.907 20.006 27.327 1.00 87.68 ? 152 ARG B CZ  1 
ATOM   2588 N NH1 . ARG B 1 152 ? 38.085 19.945 26.717 1.00 88.43 ? 152 ARG B NH1 1 
ATOM   2589 N NH2 . ARG B 1 152 ? 36.460 21.171 27.781 1.00 88.54 ? 152 ARG B NH2 1 
ATOM   2590 N N   . GLY B 1 153 ? 36.754 16.211 21.763 1.00 71.40 ? 153 GLY B N   1 
ATOM   2591 C CA  . GLY B 1 153 ? 37.859 16.557 20.892 1.00 68.74 ? 153 GLY B CA  1 
ATOM   2592 C C   . GLY B 1 153 ? 37.371 17.655 19.972 1.00 66.82 ? 153 GLY B C   1 
ATOM   2593 O O   . GLY B 1 153 ? 38.151 18.519 19.563 1.00 66.82 ? 153 GLY B O   1 
ATOM   2594 N N   . SER B 1 154 ? 36.070 17.624 19.656 1.00 64.63 ? 154 SER B N   1 
ATOM   2595 C CA  . SER B 1 154 ? 35.485 18.637 18.789 1.00 61.57 ? 154 SER B CA  1 
ATOM   2596 C C   . SER B 1 154 ? 33.978 18.619 18.454 1.00 60.45 ? 154 SER B C   1 
ATOM   2597 O O   . SER B 1 154 ? 33.303 17.587 18.511 1.00 60.48 ? 154 SER B O   1 
ATOM   2598 C CB  . SER B 1 154 ? 36.289 18.676 17.483 1.00 60.14 ? 154 SER B CB  1 
ATOM   2599 O OG  . SER B 1 154 ? 36.617 17.363 17.065 1.00 58.93 ? 154 SER B OG  1 
ATOM   2600 N N   . SER B 1 155 ? 33.510 19.831 18.145 1.00 58.68 ? 155 SER B N   1 
ATOM   2601 C CA  . SER B 1 155 ? 32.179 20.241 17.682 1.00 57.40 ? 155 SER B CA  1 
ATOM   2602 C C   . SER B 1 155 ? 30.790 19.903 18.235 1.00 56.35 ? 155 SER B C   1 
ATOM   2603 O O   . SER B 1 155 ? 29.811 20.326 17.627 1.00 55.99 ? 155 SER B O   1 
ATOM   2604 C CB  . SER B 1 155 ? 32.129 20.014 16.162 1.00 58.62 ? 155 SER B CB  1 
ATOM   2605 O OG  . SER B 1 155 ? 31.396 18.850 15.821 1.00 59.00 ? 155 SER B OG  1 
ATOM   2606 N N   . ARG B 1 156 ? 30.647 19.188 19.346 1.00 55.19 ? 156 ARG B N   1 
ATOM   2607 C CA  . ARG B 1 156 ? 29.287 18.899 19.825 1.00 52.81 ? 156 ARG B CA  1 
ATOM   2608 C C   . ARG B 1 156 ? 29.197 18.825 21.341 1.00 50.63 ? 156 ARG B C   1 
ATOM   2609 O O   . ARG B 1 156 ? 30.189 18.564 22.019 1.00 50.40 ? 156 ARG B O   1 
ATOM   2610 C CB  . ARG B 1 156 ? 28.775 17.586 19.225 1.00 53.90 ? 156 ARG B CB  1 
ATOM   2611 C CG  . ARG B 1 156 ? 29.220 16.342 19.971 1.00 56.74 ? 156 ARG B CG  1 
ATOM   2612 C CD  . ARG B 1 156 ? 29.002 15.100 19.134 1.00 59.27 ? 156 ARG B CD  1 
ATOM   2613 N NE  . ARG B 1 156 ? 27.777 15.170 18.337 1.00 61.76 ? 156 ARG B NE  1 
ATOM   2614 C CZ  . ARG B 1 156 ? 27.372 14.203 17.517 1.00 63.35 ? 156 ARG B CZ  1 
ATOM   2615 N NH1 . ARG B 1 156 ? 28.097 13.097 17.395 1.00 64.07 ? 156 ARG B NH1 1 
ATOM   2616 N NH2 . ARG B 1 156 ? 26.255 14.337 16.810 1.00 63.43 ? 156 ARG B NH2 1 
ATOM   2617 N N   . ALA B 1 157 ? 28.004 19.058 21.876 1.00 48.41 ? 157 ALA B N   1 
ATOM   2618 C CA  . ALA B 1 157 ? 27.823 19.004 23.318 1.00 46.53 ? 157 ALA B CA  1 
ATOM   2619 C C   . ALA B 1 157 ? 26.668 18.104 23.710 1.00 45.46 ? 157 ALA B C   1 
ATOM   2620 O O   . ALA B 1 157 ? 25.644 18.040 23.026 1.00 45.10 ? 157 ALA B O   1 
ATOM   2621 C CB  . ALA B 1 157 ? 27.609 20.392 23.872 1.00 47.01 ? 157 ALA B CB  1 
ATOM   2622 N N   . ILE B 1 158 ? 26.836 17.408 24.826 1.00 44.55 ? 158 ILE B N   1 
ATOM   2623 C CA  . ILE B 1 158 ? 25.804 16.496 25.304 1.00 44.39 ? 158 ILE B CA  1 
ATOM   2624 C C   . ILE B 1 158 ? 25.243 16.932 26.650 1.00 43.36 ? 158 ILE B C   1 
ATOM   2625 O O   . ILE B 1 158 ? 25.986 17.093 27.618 1.00 43.14 ? 158 ILE B O   1 
ATOM   2626 C CB  . ILE B 1 158 ? 26.363 15.054 25.448 1.00 45.20 ? 158 ILE B CB  1 
ATOM   2627 C CG1 . ILE B 1 158 ? 27.001 14.617 24.131 1.00 45.14 ? 158 ILE B CG1 1 
ATOM   2628 C CG2 . ILE B 1 158 ? 25.246 14.076 25.829 1.00 43.14 ? 158 ILE B CG2 1 
ATOM   2629 C CD1 . ILE B 1 158 ? 27.987 13.485 24.286 1.00 46.70 ? 158 ILE B CD1 1 
ATOM   2630 N N   . PHE B 1 159 ? 23.929 17.128 26.696 1.00 42.25 ? 159 PHE B N   1 
ATOM   2631 C CA  . PHE B 1 159 ? 23.240 17.504 27.924 1.00 41.88 ? 159 PHE B CA  1 
ATOM   2632 C C   . PHE B 1 159 ? 22.203 16.434 28.249 1.00 42.53 ? 159 PHE B C   1 
ATOM   2633 O O   . PHE B 1 159 ? 21.571 15.883 27.352 1.00 42.60 ? 159 PHE B O   1 
ATOM   2634 C CB  . PHE B 1 159 ? 22.538 18.855 27.772 1.00 39.63 ? 159 PHE B CB  1 
ATOM   2635 C CG  . PHE B 1 159 ? 23.469 19.992 27.485 1.00 37.92 ? 159 PHE B CG  1 
ATOM   2636 C CD1 . PHE B 1 159 ? 23.931 20.227 26.192 1.00 36.12 ? 159 PHE B CD1 1 
ATOM   2637 C CD2 . PHE B 1 159 ? 23.903 20.823 28.516 1.00 35.59 ? 159 PHE B CD2 1 
ATOM   2638 C CE1 . PHE B 1 159 ? 24.815 21.281 25.934 1.00 35.53 ? 159 PHE B CE1 1 
ATOM   2639 C CE2 . PHE B 1 159 ? 24.784 21.876 28.270 1.00 33.71 ? 159 PHE B CE2 1 
ATOM   2640 C CZ  . PHE B 1 159 ? 25.240 22.108 26.983 1.00 33.96 ? 159 PHE B CZ  1 
ATOM   2641 N N   . SER B 1 160 ? 22.043 16.148 29.534 1.00 43.69 ? 160 SER B N   1 
ATOM   2642 C CA  . SER B 1 160 ? 21.089 15.158 30.012 1.00 44.68 ? 160 SER B CA  1 
ATOM   2643 C C   . SER B 1 160 ? 20.108 15.885 30.909 1.00 45.41 ? 160 SER B C   1 
ATOM   2644 O O   . SER B 1 160 ? 20.508 16.392 31.955 1.00 46.19 ? 160 SER B O   1 
ATOM   2645 C CB  . SER B 1 160 ? 21.814 14.098 30.825 1.00 44.62 ? 160 SER B CB  1 
ATOM   2646 O OG  . SER B 1 160 ? 21.023 13.696 31.922 1.00 46.03 ? 160 SER B OG  1 
ATOM   2647 N N   . VAL B 1 161 ? 18.834 15.940 30.521 1.00 46.30 ? 161 VAL B N   1 
ATOM   2648 C CA  . VAL B 1 161 ? 17.834 16.650 31.322 1.00 48.10 ? 161 VAL B CA  1 
ATOM   2649 C C   . VAL B 1 161 ? 17.070 15.720 32.278 1.00 49.53 ? 161 VAL B C   1 
ATOM   2650 O O   . VAL B 1 161 ? 16.298 14.857 31.848 1.00 48.62 ? 161 VAL B O   1 
ATOM   2651 C CB  . VAL B 1 161 ? 16.840 17.457 30.400 1.00 47.70 ? 161 VAL B CB  1 
ATOM   2652 C CG1 . VAL B 1 161 ? 17.450 17.669 29.023 1.00 47.58 ? 161 VAL B CG1 1 
ATOM   2653 C CG2 . VAL B 1 161 ? 15.507 16.747 30.263 1.00 47.32 ? 161 VAL B CG2 1 
ATOM   2654 N N   . GLY B 1 162 ? 17.300 15.940 33.580 1.00 52.48 ? 162 GLY B N   1 
ATOM   2655 C CA  . GLY B 1 162 ? 16.704 15.162 34.663 1.00 54.61 ? 162 GLY B CA  1 
ATOM   2656 C C   . GLY B 1 162 ? 15.212 14.897 34.587 1.00 55.86 ? 162 GLY B C   1 
ATOM   2657 O O   . GLY B 1 162 ? 14.522 15.507 33.778 1.00 56.75 ? 162 GLY B O   1 
ATOM   2658 N N   . PRO B 1 163 ? 14.684 14.023 35.472 1.00 55.90 ? 163 PRO B N   1 
ATOM   2659 C CA  . PRO B 1 163 ? 13.262 13.656 35.507 1.00 55.74 ? 163 PRO B CA  1 
ATOM   2660 C C   . PRO B 1 163 ? 12.333 14.650 34.811 1.00 55.77 ? 163 PRO B C   1 
ATOM   2661 O O   . PRO B 1 163 ? 12.040 15.720 35.335 1.00 55.20 ? 163 PRO B O   1 
ATOM   2662 C CB  . PRO B 1 163 ? 12.981 13.507 36.996 1.00 55.87 ? 163 PRO B CB  1 
ATOM   2663 C CG  . PRO B 1 163 ? 14.280 12.897 37.512 1.00 56.67 ? 163 PRO B CG  1 
ATOM   2664 C CD  . PRO B 1 163 ? 15.384 13.577 36.696 1.00 56.55 ? 163 PRO B CD  1 
ATOM   2665 N N   . VAL B 1 164 ? 11.891 14.293 33.611 1.00 56.42 ? 164 VAL B N   1 
ATOM   2666 C CA  . VAL B 1 164 ? 10.991 15.129 32.828 1.00 57.87 ? 164 VAL B CA  1 
ATOM   2667 C C   . VAL B 1 164 ? 9.576  14.940 33.371 1.00 58.48 ? 164 VAL B C   1 
ATOM   2668 O O   . VAL B 1 164 ? 9.115  13.808 33.512 1.00 59.67 ? 164 VAL B O   1 
ATOM   2669 C CB  . VAL B 1 164 ? 11.009 14.683 31.348 1.00 58.59 ? 164 VAL B CB  1 
ATOM   2670 C CG1 . VAL B 1 164 ? 10.033 15.509 30.533 1.00 58.74 ? 164 VAL B CG1 1 
ATOM   2671 C CG2 . VAL B 1 164 ? 12.419 14.778 30.794 1.00 59.11 ? 164 VAL B CG2 1 
ATOM   2672 N N   . SER B 1 165 ? 8.879  16.030 33.670 1.00 58.69 ? 165 SER B N   1 
ATOM   2673 C CA  . SER B 1 165 ? 7.522  15.903 34.201 1.00 59.83 ? 165 SER B CA  1 
ATOM   2674 C C   . SER B 1 165 ? 6.511  16.841 33.566 1.00 60.58 ? 165 SER B C   1 
ATOM   2675 O O   . SER B 1 165 ? 6.834  17.979 33.220 1.00 61.41 ? 165 SER B O   1 
ATOM   2676 C CB  . SER B 1 165 ? 7.515  16.113 35.723 1.00 60.21 ? 165 SER B CB  1 
ATOM   2677 O OG  . SER B 1 165 ? 8.006  17.391 36.101 1.00 59.72 ? 165 SER B OG  1 
ATOM   2678 N N   . PRO B 1 166 ? 5.260  16.370 33.406 1.00 60.54 ? 166 PRO B N   1 
ATOM   2679 C CA  . PRO B 1 166 ? 4.217  17.213 32.802 1.00 61.12 ? 166 PRO B CA  1 
ATOM   2680 C C   . PRO B 1 166 ? 4.084  18.566 33.499 1.00 62.37 ? 166 PRO B C   1 
ATOM   2681 O O   . PRO B 1 166 ? 4.185  19.632 32.870 1.00 62.92 ? 166 PRO B O   1 
ATOM   2682 C CB  . PRO B 1 166 ? 2.964  16.355 32.949 1.00 60.52 ? 166 PRO B CB  1 
ATOM   2683 C CG  . PRO B 1 166 ? 3.509  14.984 32.734 1.00 60.27 ? 166 PRO B CG  1 
ATOM   2684 C CD  . PRO B 1 166 ? 4.733  15.019 33.672 1.00 60.75 ? 166 PRO B CD  1 
ATOM   2685 N N   . SER B 1 167 ? 3.861  18.502 34.807 1.00 63.46 ? 167 SER B N   1 
ATOM   2686 C CA  . SER B 1 167 ? 3.727  19.693 35.637 1.00 64.57 ? 167 SER B CA  1 
ATOM   2687 C C   . SER B 1 167 ? 4.735  20.758 35.208 1.00 64.94 ? 167 SER B C   1 
ATOM   2688 O O   . SER B 1 167 ? 4.731  21.876 35.723 1.00 65.49 ? 167 SER B O   1 
ATOM   2689 C CB  . SER B 1 167 ? 3.963  19.347 37.112 1.00 64.89 ? 167 SER B CB  1 
ATOM   2690 O OG  . SER B 1 167 ? 5.289  18.896 37.330 1.00 65.18 ? 167 SER B OG  1 
ATOM   2691 N N   . ARG B 1 169 ? 6.014  21.912 31.159 1.00 53.76 ? 169 ARG B N   1 
ATOM   2692 C CA  . ARG B 1 169 ? 6.399  22.371 29.819 1.00 54.87 ? 169 ARG B CA  1 
ATOM   2693 C C   . ARG B 1 169 ? 7.915  22.341 29.626 1.00 53.44 ? 169 ARG B C   1 
ATOM   2694 O O   . ARG B 1 169 ? 8.664  22.822 30.472 1.00 54.65 ? 169 ARG B O   1 
ATOM   2695 C CB  . ARG B 1 169 ? 5.882  23.796 29.564 1.00 56.89 ? 169 ARG B CB  1 
ATOM   2696 C CG  . ARG B 1 169 ? 6.243  24.328 28.172 1.00 60.53 ? 169 ARG B CG  1 
ATOM   2697 C CD  . ARG B 1 169 ? 5.803  25.772 27.934 1.00 63.92 ? 169 ARG B CD  1 
ATOM   2698 N NE  . ARG B 1 169 ? 4.350  25.914 27.854 1.00 67.57 ? 169 ARG B NE  1 
ATOM   2699 C CZ  . ARG B 1 169 ? 3.715  27.073 27.679 1.00 68.99 ? 169 ARG B CZ  1 
ATOM   2700 N NH1 . ARG B 1 169 ? 4.397  28.209 27.564 1.00 69.74 ? 169 ARG B NH1 1 
ATOM   2701 N NH2 . ARG B 1 169 ? 2.390  27.097 27.617 1.00 69.53 ? 169 ARG B NH2 1 
ATOM   2702 N N   . TRP B 1 170 ? 8.375  21.803 28.502 1.00 51.31 ? 170 TRP B N   1 
ATOM   2703 C CA  . TRP B 1 170 ? 9.808  21.708 28.289 1.00 48.54 ? 170 TRP B CA  1 
ATOM   2704 C C   . TRP B 1 170 ? 10.304 22.198 26.944 1.00 47.32 ? 170 TRP B C   1 
ATOM   2705 O O   . TRP B 1 170 ? 10.297 21.450 25.972 1.00 47.97 ? 170 TRP B O   1 
ATOM   2706 C CB  . TRP B 1 170 ? 10.251 20.257 28.475 1.00 49.48 ? 170 TRP B CB  1 
ATOM   2707 C CG  . TRP B 1 170 ? 9.840  19.665 29.779 1.00 49.03 ? 170 TRP B CG  1 
ATOM   2708 C CD1 . TRP B 1 170 ? 8.567  19.384 30.191 1.00 49.77 ? 170 TRP B CD1 1 
ATOM   2709 C CD2 . TRP B 1 170 ? 10.695 19.362 30.883 1.00 49.92 ? 170 TRP B CD2 1 
ATOM   2710 N NE1 . TRP B 1 170 ? 8.579  18.936 31.484 1.00 50.18 ? 170 TRP B NE1 1 
ATOM   2711 C CE2 . TRP B 1 170 ? 9.873  18.912 31.935 1.00 50.17 ? 170 TRP B CE2 1 
ATOM   2712 C CE3 . TRP B 1 170 ? 12.079 19.432 31.089 1.00 50.99 ? 170 TRP B CE3 1 
ATOM   2713 C CZ2 . TRP B 1 170 ? 10.386 18.534 33.179 1.00 50.76 ? 170 TRP B CZ2 1 
ATOM   2714 C CZ3 . TRP B 1 170 ? 12.590 19.055 32.335 1.00 51.34 ? 170 TRP B CZ3 1 
ATOM   2715 C CH2 . TRP B 1 170 ? 11.742 18.613 33.359 1.00 50.76 ? 170 TRP B CH2 1 
ATOM   2716 N N   . TRP B 1 171 ? 10.757 23.445 26.888 1.00 45.99 ? 171 TRP B N   1 
ATOM   2717 C CA  . TRP B 1 171 ? 11.281 24.008 25.646 1.00 44.10 ? 171 TRP B CA  1 
ATOM   2718 C C   . TRP B 1 171 ? 12.751 24.351 25.827 1.00 41.51 ? 171 TRP B C   1 
ATOM   2719 O O   . TRP B 1 171 ? 13.125 24.896 26.859 1.00 41.45 ? 171 TRP B O   1 
ATOM   2720 C CB  . TRP B 1 171 ? 10.511 25.273 25.261 1.00 46.36 ? 171 TRP B CB  1 
ATOM   2721 C CG  . TRP B 1 171 ? 9.078  25.023 24.896 1.00 49.83 ? 171 TRP B CG  1 
ATOM   2722 C CD1 . TRP B 1 171 ? 8.523  23.826 24.563 1.00 50.56 ? 171 TRP B CD1 1 
ATOM   2723 C CD2 . TRP B 1 171 ? 8.020  25.996 24.809 1.00 51.37 ? 171 TRP B CD2 1 
ATOM   2724 N NE1 . TRP B 1 171 ? 7.190  23.984 24.274 1.00 51.73 ? 171 TRP B NE1 1 
ATOM   2725 C CE2 . TRP B 1 171 ? 6.852  25.305 24.415 1.00 51.64 ? 171 TRP B CE2 1 
ATOM   2726 C CE3 . TRP B 1 171 ? 7.948  27.382 25.021 1.00 52.08 ? 171 TRP B CE3 1 
ATOM   2727 C CZ2 . TRP B 1 171 ? 5.621  25.950 24.231 1.00 51.42 ? 171 TRP B CZ2 1 
ATOM   2728 C CZ3 . TRP B 1 171 ? 6.725  28.026 24.837 1.00 51.82 ? 171 TRP B CZ3 1 
ATOM   2729 C CH2 . TRP B 1 171 ? 5.577  27.306 24.445 1.00 52.44 ? 171 TRP B CH2 1 
ATOM   2730 N N   . TYR B 1 172 ? 13.580 24.039 24.831 1.00 38.49 ? 172 TYR B N   1 
ATOM   2731 C CA  . TYR B 1 172 ? 15.016 24.322 24.913 1.00 36.27 ? 172 TYR B CA  1 
ATOM   2732 C C   . TYR B 1 172 ? 15.622 24.869 23.630 1.00 34.94 ? 172 TYR B C   1 
ATOM   2733 O O   . TYR B 1 172 ? 15.183 24.537 22.534 1.00 34.40 ? 172 TYR B O   1 
ATOM   2734 C CB  . TYR B 1 172 ? 15.810 23.056 25.251 1.00 36.39 ? 172 TYR B CB  1 
ATOM   2735 C CG  . TYR B 1 172 ? 15.432 22.351 26.534 1.00 37.59 ? 172 TYR B CG  1 
ATOM   2736 C CD1 . TYR B 1 172 ? 14.222 21.656 26.647 1.00 38.10 ? 172 TYR B CD1 1 
ATOM   2737 C CD2 . TYR B 1 172 ? 16.293 22.361 27.634 1.00 36.87 ? 172 TYR B CD2 1 
ATOM   2738 C CE1 . TYR B 1 172 ? 13.882 20.990 27.821 1.00 38.39 ? 172 TYR B CE1 1 
ATOM   2739 C CE2 . TYR B 1 172 ? 15.960 21.697 28.813 1.00 38.03 ? 172 TYR B CE2 1 
ATOM   2740 C CZ  . TYR B 1 172 ? 14.756 21.014 28.895 1.00 39.35 ? 172 TYR B CZ  1 
ATOM   2741 O OH  . TYR B 1 172 ? 14.428 20.331 30.039 1.00 39.83 ? 172 TYR B OH  1 
ATOM   2742 N N   . ARG B 1 173 ? 16.654 25.693 23.784 1.00 33.44 ? 173 ARG B N   1 
ATOM   2743 C CA  . ARG B 1 173 ? 17.406 26.243 22.650 1.00 31.49 ? 173 ARG B CA  1 
ATOM   2744 C C   . ARG B 1 173 ? 18.865 26.108 23.068 1.00 29.29 ? 173 ARG B C   1 
ATOM   2745 O O   . ARG B 1 173 ? 19.171 26.255 24.247 1.00 29.23 ? 173 ARG B O   1 
ATOM   2746 C CB  . ARG B 1 173 ? 17.116 27.723 22.430 1.00 32.33 ? 173 ARG B CB  1 
ATOM   2747 C CG  . ARG B 1 173 ? 15.707 28.058 22.090 1.00 35.47 ? 173 ARG B CG  1 
ATOM   2748 C CD  . ARG B 1 173 ? 15.588 29.553 21.973 1.00 38.16 ? 173 ARG B CD  1 
ATOM   2749 N NE  . ARG B 1 173 ? 15.072 29.922 20.666 1.00 41.49 ? 173 ARG B NE  1 
ATOM   2750 C CZ  . ARG B 1 173 ? 13.798 30.206 20.419 1.00 43.77 ? 173 ARG B CZ  1 
ATOM   2751 N NH1 . ARG B 1 173 ? 12.901 30.171 21.401 1.00 44.84 ? 173 ARG B NH1 1 
ATOM   2752 N NH2 . ARG B 1 173 ? 13.421 30.512 19.183 1.00 43.13 ? 173 ARG B NH2 1 
ATOM   2753 N N   . CYS B 1 174 ? 19.772 25.827 22.141 1.00 25.92 ? 174 CYS B N   1 
ATOM   2754 C CA  . CYS B 1 174 ? 21.156 25.714 22.552 1.00 24.02 ? 174 CYS B CA  1 
ATOM   2755 C C   . CYS B 1 174 ? 21.993 26.715 21.791 1.00 23.01 ? 174 CYS B C   1 
ATOM   2756 O O   . CYS B 1 174 ? 21.543 27.246 20.769 1.00 21.36 ? 174 CYS B O   1 
ATOM   2757 C CB  . CYS B 1 174 ? 21.674 24.275 22.373 1.00 26.39 ? 174 CYS B CB  1 
ATOM   2758 S SG  . CYS B 1 174 ? 22.259 23.731 20.732 1.00 29.33 ? 174 CYS B SG  1 
ATOM   2759 N N   . TYR B 1 175 ? 23.189 26.998 22.322 1.00 22.05 ? 175 TYR B N   1 
ATOM   2760 C CA  . TYR B 1 175 ? 24.124 27.956 21.724 1.00 19.16 ? 175 TYR B CA  1 
ATOM   2761 C C   . TYR B 1 175 ? 25.547 27.419 21.703 1.00 19.04 ? 175 TYR B C   1 
ATOM   2762 O O   . TYR B 1 175 ? 25.865 26.456 22.402 1.00 19.07 ? 175 TYR B O   1 
ATOM   2763 C CB  . TYR B 1 175 ? 24.149 29.269 22.511 1.00 16.22 ? 175 TYR B CB  1 
ATOM   2764 C CG  . TYR B 1 175 ? 22.827 29.966 22.690 1.00 12.94 ? 175 TYR B CG  1 
ATOM   2765 C CD1 . TYR B 1 175 ? 21.952 29.579 23.696 1.00 11.52 ? 175 TYR B CD1 1 
ATOM   2766 C CD2 . TYR B 1 175 ? 22.476 31.049 21.881 1.00 12.69 ? 175 TYR B CD2 1 
ATOM   2767 C CE1 . TYR B 1 175 ? 20.764 30.254 23.907 1.00 13.97 ? 175 TYR B CE1 1 
ATOM   2768 C CE2 . TYR B 1 175 ? 21.290 31.739 22.074 1.00 12.68 ? 175 TYR B CE2 1 
ATOM   2769 C CZ  . TYR B 1 175 ? 20.434 31.341 23.095 1.00 15.11 ? 175 TYR B CZ  1 
ATOM   2770 O OH  . TYR B 1 175 ? 19.269 32.041 23.332 1.00 15.30 ? 175 TYR B OH  1 
ATOM   2771 N N   . ALA B 1 176 ? 26.402 28.053 20.904 1.00 17.57 ? 176 ALA B N   1 
ATOM   2772 C CA  . ALA B 1 176 ? 27.804 27.665 20.825 1.00 17.70 ? 176 ALA B CA  1 
ATOM   2773 C C   . ALA B 1 176 ? 28.599 28.935 21.104 1.00 19.44 ? 176 ALA B C   1 
ATOM   2774 O O   . ALA B 1 176 ? 28.141 30.035 20.772 1.00 20.09 ? 176 ALA B O   1 
ATOM   2775 C CB  . ALA B 1 176 ? 28.131 27.136 19.448 1.00 15.78 ? 176 ALA B CB  1 
ATOM   2776 N N   . TYR B 1 177 ? 29.765 28.794 21.735 1.00 18.97 ? 177 TYR B N   1 
ATOM   2777 C CA  . TYR B 1 177 ? 30.595 29.950 22.045 1.00 19.00 ? 177 TYR B CA  1 
ATOM   2778 C C   . TYR B 1 177 ? 32.081 29.614 22.180 1.00 20.07 ? 177 TYR B C   1 
ATOM   2779 O O   . TYR B 1 177 ? 32.493 28.446 22.167 1.00 20.23 ? 177 TYR B O   1 
ATOM   2780 C CB  . TYR B 1 177 ? 30.090 30.651 23.326 1.00 18.58 ? 177 TYR B CB  1 
ATOM   2781 C CG  . TYR B 1 177 ? 30.312 29.897 24.626 1.00 19.28 ? 177 TYR B CG  1 
ATOM   2782 C CD1 . TYR B 1 177 ? 31.588 29.770 25.176 1.00 18.39 ? 177 TYR B CD1 1 
ATOM   2783 C CD2 . TYR B 1 177 ? 29.245 29.284 25.290 1.00 19.90 ? 177 TYR B CD2 1 
ATOM   2784 C CE1 . TYR B 1 177 ? 31.799 29.050 26.346 1.00 19.58 ? 177 TYR B CE1 1 
ATOM   2785 C CE2 . TYR B 1 177 ? 29.446 28.561 26.463 1.00 19.48 ? 177 TYR B CE2 1 
ATOM   2786 C CZ  . TYR B 1 177 ? 30.727 28.446 26.986 1.00 19.47 ? 177 TYR B CZ  1 
ATOM   2787 O OH  . TYR B 1 177 ? 30.927 27.713 28.143 1.00 20.01 ? 177 TYR B OH  1 
ATOM   2788 N N   . ASP B 1 178 ? 32.881 30.670 22.295 1.00 20.63 ? 178 ASP B N   1 
ATOM   2789 C CA  . ASP B 1 178 ? 34.319 30.554 22.454 1.00 19.51 ? 178 ASP B CA  1 
ATOM   2790 C C   . ASP B 1 178 ? 34.636 30.869 23.921 1.00 17.33 ? 178 ASP B C   1 
ATOM   2791 O O   . ASP B 1 178 ? 34.174 31.868 24.468 1.00 14.37 ? 178 ASP B O   1 
ATOM   2792 C CB  . ASP B 1 178 ? 35.012 31.552 21.538 1.00 22.82 ? 178 ASP B CB  1 
ATOM   2793 C CG  . ASP B 1 178 ? 36.509 31.376 21.514 1.00 25.57 ? 178 ASP B CG  1 
ATOM   2794 O OD1 . ASP B 1 178 ? 37.119 31.206 22.594 1.00 28.02 ? 178 ASP B OD1 1 
ATOM   2795 O OD2 . ASP B 1 178 ? 37.080 31.415 20.406 1.00 26.84 ? 178 ASP B OD2 1 
ATOM   2796 N N   . SER B 1 179 ? 35.423 30.002 24.551 1.00 17.36 ? 179 SER B N   1 
ATOM   2797 C CA  . SER B 1 179 ? 35.790 30.161 25.958 1.00 17.62 ? 179 SER B CA  1 
ATOM   2798 C C   . SER B 1 179 ? 36.599 31.427 26.187 1.00 18.43 ? 179 SER B C   1 
ATOM   2799 O O   . SER B 1 179 ? 36.698 31.914 27.305 1.00 17.19 ? 179 SER B O   1 
ATOM   2800 C CB  . SER B 1 179 ? 36.572 28.936 26.446 1.00 15.06 ? 179 SER B CB  1 
ATOM   2801 O OG  . SER B 1 179 ? 37.637 28.613 25.564 1.00 13.92 ? 179 SER B OG  1 
ATOM   2802 N N   . ASN B 1 180 ? 37.174 31.952 25.113 1.00 20.33 ? 180 ASN B N   1 
ATOM   2803 C CA  . ASN B 1 180 ? 37.954 33.178 25.170 1.00 22.30 ? 180 ASN B CA  1 
ATOM   2804 C C   . ASN B 1 180 ? 37.060 34.392 25.052 1.00 22.07 ? 180 ASN B C   1 
ATOM   2805 O O   . ASN B 1 180 ? 37.534 35.509 24.880 1.00 23.06 ? 180 ASN B O   1 
ATOM   2806 C CB  . ASN B 1 180 ? 38.957 33.203 24.033 1.00 25.39 ? 180 ASN B CB  1 
ATOM   2807 C CG  . ASN B 1 180 ? 40.282 32.655 24.443 1.00 27.98 ? 180 ASN B CG  1 
ATOM   2808 O OD1 . ASN B 1 180 ? 40.899 33.168 25.383 1.00 33.08 ? 180 ASN B OD1 1 
ATOM   2809 N ND2 . ASN B 1 180 ? 40.739 31.606 23.761 1.00 27.33 ? 180 ASN B ND2 1 
ATOM   2810 N N   . SER B 1 181 ? 35.759 34.164 25.143 1.00 22.31 ? 181 SER B N   1 
ATOM   2811 C CA  . SER B 1 181 ? 34.788 35.227 25.019 1.00 20.50 ? 181 SER B CA  1 
ATOM   2812 C C   . SER B 1 181 ? 33.492 34.545 25.428 1.00 20.61 ? 181 SER B C   1 
ATOM   2813 O O   . SER B 1 181 ? 32.493 34.572 24.699 1.00 21.57 ? 181 SER B O   1 
ATOM   2814 C CB  . SER B 1 181 ? 34.746 35.652 23.564 1.00 20.97 ? 181 SER B CB  1 
ATOM   2815 O OG  . SER B 1 181 ? 34.358 36.998 23.432 1.00 27.82 ? 181 SER B OG  1 
ATOM   2816 N N   . PRO B 1 182 ? 33.494 33.931 26.627 1.00 19.84 ? 182 PRO B N   1 
ATOM   2817 C CA  . PRO B 1 182 ? 32.380 33.194 27.228 1.00 19.30 ? 182 PRO B CA  1 
ATOM   2818 C C   . PRO B 1 182 ? 30.987 33.813 27.318 1.00 19.42 ? 182 PRO B C   1 
ATOM   2819 O O   . PRO B 1 182 ? 30.022 33.096 27.580 1.00 20.28 ? 182 PRO B O   1 
ATOM   2820 C CB  . PRO B 1 182 ? 32.936 32.817 28.602 1.00 17.39 ? 182 PRO B CB  1 
ATOM   2821 C CG  . PRO B 1 182 ? 33.807 33.974 28.925 1.00 15.97 ? 182 PRO B CG  1 
ATOM   2822 C CD  . PRO B 1 182 ? 34.545 34.164 27.638 1.00 17.46 ? 182 PRO B CD  1 
ATOM   2823 N N   . TYR B 1 183 ? 30.857 35.118 27.110 1.00 20.49 ? 183 TYR B N   1 
ATOM   2824 C CA  . TYR B 1 183 ? 29.536 35.732 27.221 1.00 20.95 ? 183 TYR B CA  1 
ATOM   2825 C C   . TYR B 1 183 ? 28.927 36.141 25.907 1.00 19.91 ? 183 TYR B C   1 
ATOM   2826 O O   . TYR B 1 183 ? 27.816 36.666 25.872 1.00 18.61 ? 183 TYR B O   1 
ATOM   2827 C CB  . TYR B 1 183 ? 29.573 36.933 28.156 1.00 22.38 ? 183 TYR B CB  1 
ATOM   2828 C CG  . TYR B 1 183 ? 30.189 36.587 29.476 1.00 24.75 ? 183 TYR B CG  1 
ATOM   2829 C CD1 . TYR B 1 183 ? 31.581 36.632 29.654 1.00 26.21 ? 183 TYR B CD1 1 
ATOM   2830 C CD2 . TYR B 1 183 ? 29.404 36.152 30.533 1.00 25.06 ? 183 TYR B CD2 1 
ATOM   2831 C CE1 . TYR B 1 183 ? 32.172 36.250 30.853 1.00 23.91 ? 183 TYR B CE1 1 
ATOM   2832 C CE2 . TYR B 1 183 ? 29.991 35.766 31.737 1.00 27.29 ? 183 TYR B CE2 1 
ATOM   2833 C CZ  . TYR B 1 183 ? 31.378 35.818 31.881 1.00 25.36 ? 183 TYR B CZ  1 
ATOM   2834 O OH  . TYR B 1 183 ? 31.967 35.418 33.048 1.00 24.98 ? 183 TYR B OH  1 
ATOM   2835 N N   . GLU B 1 184 ? 29.664 35.912 24.828 1.00 19.80 ? 184 GLU B N   1 
ATOM   2836 C CA  . GLU B 1 184 ? 29.170 36.219 23.500 1.00 19.67 ? 184 GLU B CA  1 
ATOM   2837 C C   . GLU B 1 184 ? 28.801 34.878 22.898 1.00 19.55 ? 184 GLU B C   1 
ATOM   2838 O O   . GLU B 1 184 ? 29.668 34.072 22.543 1.00 21.16 ? 184 GLU B O   1 
ATOM   2839 C CB  . GLU B 1 184 ? 30.244 36.917 22.675 1.00 19.17 ? 184 GLU B CB  1 
ATOM   2840 C CG  . GLU B 1 184 ? 30.582 38.297 23.185 1.00 18.46 ? 184 GLU B CG  1 
ATOM   2841 C CD  . GLU B 1 184 ? 31.680 38.930 22.375 1.00 21.60 ? 184 GLU B CD  1 
ATOM   2842 O OE1 . GLU B 1 184 ? 31.559 38.923 21.123 1.00 24.61 ? 184 GLU B OE1 1 
ATOM   2843 O OE2 . GLU B 1 184 ? 32.653 39.433 22.983 1.00 20.95 ? 184 GLU B OE2 1 
ATOM   2844 N N   . TRP B 1 185 ? 27.498 34.635 22.828 1.00 18.99 ? 185 TRP B N   1 
ATOM   2845 C CA  . TRP B 1 185 ? 26.971 33.396 22.295 1.00 17.29 ? 185 TRP B CA  1 
ATOM   2846 C C   . TRP B 1 185 ? 26.601 33.556 20.842 1.00 17.52 ? 185 TRP B C   1 
ATOM   2847 O O   . TRP B 1 185 ? 26.514 34.672 20.330 1.00 18.24 ? 185 TRP B O   1 
ATOM   2848 C CB  . TRP B 1 185 ? 25.758 32.971 23.112 1.00 15.52 ? 185 TRP B CB  1 
ATOM   2849 C CG  . TRP B 1 185 ? 26.128 32.528 24.528 1.00 16.09 ? 185 TRP B CG  1 
ATOM   2850 C CD1 . TRP B 1 185 ? 27.392 32.509 25.100 1.00 12.73 ? 185 TRP B CD1 1 
ATOM   2851 C CD2 . TRP B 1 185 ? 25.227 32.047 25.541 1.00 14.47 ? 185 TRP B CD2 1 
ATOM   2852 N NE1 . TRP B 1 185 ? 27.314 32.050 26.394 1.00 12.76 ? 185 TRP B NE1 1 
ATOM   2853 C CE2 . TRP B 1 185 ? 26.006 31.762 26.693 1.00 13.05 ? 185 TRP B CE2 1 
ATOM   2854 C CE3 . TRP B 1 185 ? 23.839 31.831 25.589 1.00 13.96 ? 185 TRP B CE3 1 
ATOM   2855 C CZ2 . TRP B 1 185 ? 25.438 31.274 27.876 1.00 10.33 ? 185 TRP B CZ2 1 
ATOM   2856 C CZ3 . TRP B 1 185 ? 23.277 31.343 26.769 1.00 13.37 ? 185 TRP B CZ3 1 
ATOM   2857 C CH2 . TRP B 1 185 ? 24.078 31.071 27.895 1.00 11.14 ? 185 TRP B CH2 1 
ATOM   2858 N N   . SER B 1 186 ? 26.390 32.426 20.182 1.00 17.75 ? 186 SER B N   1 
ATOM   2859 C CA  . SER B 1 186 ? 26.023 32.387 18.773 1.00 16.69 ? 186 SER B CA  1 
ATOM   2860 C C   . SER B 1 186 ? 24.536 32.692 18.651 1.00 17.50 ? 186 SER B C   1 
ATOM   2861 O O   . SER B 1 186 ? 23.891 33.138 19.611 1.00 16.07 ? 186 SER B O   1 
ATOM   2862 C CB  . SER B 1 186 ? 26.239 30.985 18.244 1.00 16.05 ? 186 SER B CB  1 
ATOM   2863 O OG  . SER B 1 186 ? 25.246 30.146 18.810 1.00 13.21 ? 186 SER B OG  1 
ATOM   2864 N N   . LEU B 1 187 ? 23.998 32.459 17.456 1.00 17.52 ? 187 LEU B N   1 
ATOM   2865 C CA  . LEU B 1 187 ? 22.573 32.629 17.238 1.00 17.63 ? 187 LEU B CA  1 
ATOM   2866 C C   . LEU B 1 187 ? 21.980 31.411 17.929 1.00 18.26 ? 187 LEU B C   1 
ATOM   2867 O O   . LEU B 1 187 ? 22.620 30.359 18.011 1.00 19.10 ? 187 LEU B O   1 
ATOM   2868 C CB  . LEU B 1 187 ? 22.227 32.574 15.751 1.00 17.00 ? 187 LEU B CB  1 
ATOM   2869 C CG  . LEU B 1 187 ? 22.457 33.806 14.885 1.00 13.55 ? 187 LEU B CG  1 
ATOM   2870 C CD1 . LEU B 1 187 ? 22.273 33.417 13.439 1.00 14.61 ? 187 LEU B CD1 1 
ATOM   2871 C CD2 . LEU B 1 187 ? 21.504 34.907 15.291 1.00 11.01 ? 187 LEU B CD2 1 
ATOM   2872 N N   . PRO B 1 188 ? 20.761 31.533 18.452 1.00 18.72 ? 188 PRO B N   1 
ATOM   2873 C CA  . PRO B 1 188 ? 20.185 30.359 19.117 1.00 20.83 ? 188 PRO B CA  1 
ATOM   2874 C C   . PRO B 1 188 ? 19.734 29.304 18.110 1.00 22.40 ? 188 PRO B C   1 
ATOM   2875 O O   . PRO B 1 188 ? 19.360 29.617 16.977 1.00 21.75 ? 188 PRO B O   1 
ATOM   2876 C CB  . PRO B 1 188 ? 19.009 30.940 19.898 1.00 19.32 ? 188 PRO B CB  1 
ATOM   2877 C CG  . PRO B 1 188 ? 18.550 32.070 19.012 1.00 18.64 ? 188 PRO B CG  1 
ATOM   2878 C CD  . PRO B 1 188 ? 19.853 32.692 18.501 1.00 18.37 ? 188 PRO B CD  1 
ATOM   2879 N N   . SER B 1 189 ? 19.780 28.048 18.519 1.00 25.05 ? 189 SER B N   1 
ATOM   2880 C CA  . SER B 1 189 ? 19.327 26.980 17.646 1.00 27.69 ? 189 SER B CA  1 
ATOM   2881 C C   . SER B 1 189 ? 17.802 27.085 17.689 1.00 29.00 ? 189 SER B C   1 
ATOM   2882 O O   . SER B 1 189 ? 17.257 27.816 18.523 1.00 29.16 ? 189 SER B O   1 
ATOM   2883 C CB  . SER B 1 189 ? 19.755 25.631 18.205 1.00 28.18 ? 189 SER B CB  1 
ATOM   2884 O OG  . SER B 1 189 ? 19.119 25.402 19.452 1.00 30.75 ? 189 SER B OG  1 
ATOM   2885 N N   . ASP B 1 190 ? 17.112 26.372 16.801 1.00 29.91 ? 190 ASP B N   1 
ATOM   2886 C CA  . ASP B 1 190 ? 15.649 26.416 16.813 1.00 30.39 ? 190 ASP B CA  1 
ATOM   2887 C C   . ASP B 1 190 ? 15.164 25.871 18.153 1.00 29.81 ? 190 ASP B C   1 
ATOM   2888 O O   . ASP B 1 190 ? 15.856 25.077 18.801 1.00 28.79 ? 190 ASP B O   1 
ATOM   2889 C CB  . ASP B 1 190 ? 15.040 25.561 15.692 1.00 31.12 ? 190 ASP B CB  1 
ATOM   2890 C CG  . ASP B 1 190 ? 15.409 26.053 14.298 1.00 32.56 ? 190 ASP B CG  1 
ATOM   2891 O OD1 . ASP B 1 190 ? 15.427 27.280 14.059 1.00 32.80 ? 190 ASP B OD1 1 
ATOM   2892 O OD2 . ASP B 1 190 ? 15.665 25.197 13.427 1.00 31.54 ? 190 ASP B OD2 1 
ATOM   2893 N N   . LEU B 1 191 ? 13.978 26.302 18.570 1.00 29.87 ? 191 LEU B N   1 
ATOM   2894 C CA  . LEU B 1 191 ? 13.401 25.838 19.825 1.00 30.47 ? 191 LEU B CA  1 
ATOM   2895 C C   . LEU B 1 191 ? 13.120 24.331 19.725 1.00 30.73 ? 191 LEU B C   1 
ATOM   2896 O O   . LEU B 1 191 ? 12.702 23.836 18.682 1.00 31.21 ? 191 LEU B O   1 
ATOM   2897 C CB  . LEU B 1 191 ? 12.112 26.612 20.110 1.00 30.85 ? 191 LEU B CB  1 
ATOM   2898 C CG  . LEU B 1 191 ? 11.325 26.320 21.388 1.00 32.65 ? 191 LEU B CG  1 
ATOM   2899 C CD1 . LEU B 1 191 ? 12.220 26.480 22.614 1.00 31.57 ? 191 LEU B CD1 1 
ATOM   2900 C CD2 . LEU B 1 191 ? 10.130 27.279 21.447 1.00 32.53 ? 191 LEU B CD2 1 
ATOM   2901 N N   . LEU B 1 192 ? 13.361 23.599 20.805 1.00 31.85 ? 192 LEU B N   1 
ATOM   2902 C CA  . LEU B 1 192 ? 13.131 22.154 20.808 1.00 33.40 ? 192 LEU B CA  1 
ATOM   2903 C C   . LEU B 1 192 ? 12.136 21.754 21.899 1.00 34.38 ? 192 LEU B C   1 
ATOM   2904 O O   . LEU B 1 192 ? 12.493 21.635 23.071 1.00 34.00 ? 192 LEU B O   1 
ATOM   2905 C CB  . LEU B 1 192 ? 14.455 21.409 21.023 1.00 33.26 ? 192 LEU B CB  1 
ATOM   2906 C CG  . LEU B 1 192 ? 14.410 19.875 21.103 1.00 33.65 ? 192 LEU B CG  1 
ATOM   2907 C CD1 . LEU B 1 192 ? 14.062 19.322 19.723 1.00 31.61 ? 192 LEU B CD1 1 
ATOM   2908 C CD2 . LEU B 1 192 ? 15.762 19.314 21.587 1.00 31.58 ? 192 LEU B CD2 1 
ATOM   2909 N N   . GLU B 1 193 ? 10.888 21.538 21.509 1.00 35.71 ? 193 GLU B N   1 
ATOM   2910 C CA  . GLU B 1 193 ? 9.863  21.165 22.466 1.00 37.39 ? 193 GLU B CA  1 
ATOM   2911 C C   . GLU B 1 193 ? 9.884  19.680 22.788 1.00 37.39 ? 193 GLU B C   1 
ATOM   2912 O O   . GLU B 1 193 ? 9.802  18.834 21.892 1.00 36.68 ? 193 GLU B O   1 
ATOM   2913 C CB  . GLU B 1 193 ? 8.496  21.550 21.918 1.00 39.36 ? 193 GLU B CB  1 
ATOM   2914 C CG  . GLU B 1 193 ? 7.346  21.262 22.844 1.00 41.74 ? 193 GLU B CG  1 
ATOM   2915 C CD  . GLU B 1 193 ? 6.048  21.721 22.247 1.00 43.75 ? 193 GLU B CD  1 
ATOM   2916 O OE1 . GLU B 1 193 ? 6.004  22.870 21.750 1.00 44.67 ? 193 GLU B OE1 1 
ATOM   2917 O OE2 . GLU B 1 193 ? 5.072  20.937 22.274 1.00 46.46 ? 193 GLU B OE2 1 
ATOM   2918 N N   . LEU B 1 194 ? 10.021 19.370 24.076 1.00 38.68 ? 194 LEU B N   1 
ATOM   2919 C CA  . LEU B 1 194 ? 10.000 17.980 24.525 1.00 39.96 ? 194 LEU B CA  1 
ATOM   2920 C C   . LEU B 1 194 ? 8.539  17.588 24.751 1.00 41.87 ? 194 LEU B C   1 
ATOM   2921 O O   . LEU B 1 194 ? 7.728  18.402 25.196 1.00 40.98 ? 194 LEU B O   1 
ATOM   2922 C CB  . LEU B 1 194 ? 10.778 17.786 25.824 1.00 37.75 ? 194 LEU B CB  1 
ATOM   2923 C CG  . LEU B 1 194 ? 12.303 17.773 25.769 1.00 36.68 ? 194 LEU B CG  1 
ATOM   2924 C CD1 . LEU B 1 194 ? 12.828 17.241 27.113 1.00 35.69 ? 194 LEU B CD1 1 
ATOM   2925 C CD2 . LEU B 1 194 ? 12.808 16.887 24.616 1.00 35.59 ? 194 LEU B CD2 1 
ATOM   2926 N N   . LEU B 1 195 ? 8.204  16.343 24.430 1.00 43.98 ? 195 LEU B N   1 
ATOM   2927 C CA  . LEU B 1 195 ? 6.842  15.868 24.608 1.00 46.67 ? 195 LEU B CA  1 
ATOM   2928 C C   . LEU B 1 195 ? 6.731  14.722 25.577 1.00 47.26 ? 195 LEU B C   1 
ATOM   2929 O O   . LEU B 1 195 ? 7.187  13.608 25.313 1.00 45.49 ? 195 LEU B O   1 
ATOM   2930 C CB  . LEU B 1 195 ? 6.224  15.446 23.299 1.00 49.08 ? 195 LEU B CB  1 
ATOM   2931 C CG  . LEU B 1 195 ? 5.914  16.612 22.387 1.00 51.15 ? 195 LEU B CG  1 
ATOM   2932 C CD1 . LEU B 1 195 ? 7.183  16.976 21.600 1.00 52.13 ? 195 LEU B CD1 1 
ATOM   2933 C CD2 . LEU B 1 195 ? 4.769  16.220 21.436 1.00 52.86 ? 195 LEU B CD2 1 
ATOM   2934 N N   . VAL B 1 196 ? 6.048  15.022 26.681 1.00 49.26 ? 196 VAL B N   1 
ATOM   2935 C CA  . VAL B 1 196 ? 5.801  14.083 27.783 1.00 51.80 ? 196 VAL B CA  1 
ATOM   2936 C C   . VAL B 1 196 ? 4.604  13.165 27.578 1.00 52.53 ? 196 VAL B C   1 
ATOM   2937 O O   . VAL B 1 196 ? 3.510  13.594 27.185 1.00 52.40 ? 196 VAL B O   1 
ATOM   2938 C CB  . VAL B 1 196 ? 5.586  14.846 29.128 1.00 52.94 ? 196 VAL B CB  1 
ATOM   2939 C CG1 . VAL B 1 196 ? 5.488  13.870 30.357 1.00 53.60 ? 196 VAL B CG1 1 
ATOM   2940 C CG2 . VAL B 1 196 ? 6.696  15.833 29.343 1.00 53.48 ? 196 VAL B CG2 1 
ATOM   2941 N N   . LEU B 1 197 ? 4.816  11.905 27.935 1.00 53.72 ? 197 LEU B N   1 
ATOM   2942 C CA  . LEU B 1 197 ? 3.779  10.910 27.819 1.00 55.37 ? 197 LEU B CA  1 
ATOM   2943 C C   . LEU B 1 197 ? 3.684  10.111 29.092 1.00 56.18 ? 197 LEU B C   1 
ATOM   2944 O O   . LEU B 1 197 ? 4.690  9.982  29.833 1.00 56.19 ? 197 LEU B O   1 
ATOM   2945 C CB  . LEU B 1 197 ? 4.061  9.970  26.657 1.00 56.40 ? 197 LEU B CB  1 
ATOM   2946 C CG  . LEU B 1 197 ? 3.486  10.262 25.275 1.00 57.76 ? 197 LEU B CG  1 
ATOM   2947 C CD1 . LEU B 1 197 ? 3.705  11.738 24.906 1.00 60.36 ? 197 LEU B CD1 1 
ATOM   2948 C CD2 . LEU B 1 197 ? 4.150  9.284  24.281 1.00 59.26 ? 197 LEU B CD2 1 
ATOM   2949 O OXT . LEU B 1 197 ? 2.545  9.628  29.273 1.00 58.01 ? 197 LEU B OXT 1 
HETATM 2950 O O   . HOH C 2 .   ? 23.357 30.742 59.130 1.00 2.37  ? 198 HOH A O   1 
HETATM 2951 O O   . HOH C 2 .   ? 18.155 32.600 48.944 1.00 13.71 ? 199 HOH A O   1 
HETATM 2952 O O   . HOH C 2 .   ? 25.057 18.040 57.455 1.00 11.92 ? 200 HOH A O   1 
HETATM 2953 O O   . HOH C 2 .   ? 16.050 50.034 55.615 1.00 15.08 ? 201 HOH A O   1 
HETATM 2954 O O   . HOH C 2 .   ? 9.634  32.767 50.259 1.00 9.54  ? 202 HOH A O   1 
HETATM 2955 O O   . HOH C 2 .   ? 9.132  48.382 64.316 1.00 6.10  ? 203 HOH A O   1 
HETATM 2956 O O   . HOH C 2 .   ? 14.878 30.771 45.664 1.00 23.16 ? 204 HOH A O   1 
HETATM 2957 O O   . HOH C 2 .   ? 11.923 28.494 47.728 1.00 6.83  ? 205 HOH A O   1 
HETATM 2958 O O   . HOH C 2 .   ? 21.686 38.258 49.813 1.00 20.07 ? 206 HOH A O   1 
HETATM 2959 O O   . HOH C 2 .   ? 15.698 50.094 62.775 1.00 20.64 ? 207 HOH A O   1 
HETATM 2960 O O   . HOH C 2 .   ? 11.011 42.865 44.713 1.00 13.54 ? 208 HOH A O   1 
HETATM 2961 O O   . HOH C 2 .   ? 25.806 35.893 53.145 1.00 22.09 ? 209 HOH A O   1 
HETATM 2962 O O   . HOH C 2 .   ? 18.853 27.591 65.103 1.00 37.92 ? 210 HOH A O   1 
HETATM 2963 O O   . HOH C 2 .   ? 2.418  39.179 59.283 1.00 26.04 ? 211 HOH A O   1 
HETATM 2964 O O   . HOH C 2 .   ? 1.053  53.043 47.997 1.00 28.27 ? 212 HOH A O   1 
HETATM 2965 O O   . HOH C 2 .   ? 11.825 45.412 69.721 1.00 33.08 ? 213 HOH A O   1 
HETATM 2966 O O   . HOH C 2 .   ? 0.626  55.008 42.987 1.00 17.02 ? 214 HOH A O   1 
HETATM 2967 O O   . HOH C 2 .   ? 32.003 33.787 43.184 1.00 40.49 ? 215 HOH A O   1 
HETATM 2968 O O   . HOH C 2 .   ? 21.028 35.298 52.777 1.00 14.97 ? 216 HOH A O   1 
HETATM 2969 O O   . HOH C 2 .   ? 14.509 26.702 41.084 1.00 35.48 ? 217 HOH A O   1 
HETATM 2970 O O   . HOH C 2 .   ? 33.922 22.080 59.311 1.00 12.89 ? 218 HOH A O   1 
HETATM 2971 O O   . HOH C 2 .   ? 13.320 50.601 42.420 1.00 24.58 ? 219 HOH A O   1 
HETATM 2972 O O   . HOH C 2 .   ? 4.994  34.592 65.074 1.00 17.56 ? 220 HOH A O   1 
HETATM 2973 O O   . HOH C 2 .   ? 30.649 20.566 52.679 1.00 16.62 ? 221 HOH A O   1 
HETATM 2974 O O   . HOH C 2 .   ? 40.344 27.236 28.452 1.00 34.29 ? 222 HOH A O   1 
HETATM 2975 O O   . HOH C 2 .   ? 35.807 27.343 52.745 1.00 7.20  ? 223 HOH A O   1 
HETATM 2976 O O   . HOH C 2 .   ? -0.608 34.824 54.965 1.00 43.09 ? 224 HOH A O   1 
HETATM 2977 O O   . HOH C 2 .   ? 3.779  33.093 59.047 1.00 38.50 ? 225 HOH A O   1 
HETATM 2978 O O   . HOH C 2 .   ? 24.052 15.135 34.991 1.00 32.88 ? 226 HOH A O   1 
HETATM 2979 O O   . HOH D 2 .   ? 8.048  3.100  26.456 1.00 7.09  ? 198 HOH B O   1 
HETATM 2980 O O   . HOH D 2 .   ? 31.576 39.825 17.883 1.00 14.64 ? 199 HOH B O   1 
HETATM 2981 O O   . HOH D 2 .   ? 17.534 31.667 25.711 1.00 23.69 ? 200 HOH B O   1 
HETATM 2982 O O   . HOH D 2 .   ? 29.560 31.745 13.306 1.00 20.52 ? 201 HOH B O   1 
HETATM 2983 O O   . HOH D 2 .   ? 32.480 42.894 26.669 1.00 10.27 ? 202 HOH B O   1 
HETATM 2984 O O   . HOH D 2 .   ? 30.382 49.971 27.460 1.00 15.53 ? 203 HOH B O   1 
HETATM 2985 O O   . HOH D 2 .   ? 32.898 45.971 48.609 1.00 14.48 ? 204 HOH B O   1 
HETATM 2986 O O   . HOH D 2 .   ? 27.449 45.118 18.984 1.00 23.14 ? 205 HOH B O   1 
HETATM 2987 O O   . HOH D 2 .   ? 29.529 37.989 47.340 1.00 26.22 ? 206 HOH B O   1 
HETATM 2988 O O   . HOH D 2 .   ? 14.853 43.016 25.293 1.00 31.07 ? 207 HOH B O   1 
HETATM 2989 O O   . HOH D 2 .   ? 39.812 46.753 31.592 1.00 20.82 ? 208 HOH B O   1 
HETATM 2990 O O   . HOH D 2 .   ? 18.970 34.710 22.655 1.00 21.37 ? 209 HOH B O   1 
HETATM 2991 O O   . HOH D 2 .   ? 29.024 31.326 29.127 1.00 3.86  ? 210 HOH B O   1 
HETATM 2992 O O   . HOH D 2 .   ? 34.415 33.455 36.015 1.00 10.14 ? 211 HOH B O   1 
HETATM 2993 O O   . HOH D 2 .   ? 13.969 38.960 35.670 1.00 29.37 ? 212 HOH B O   1 
HETATM 2994 O O   . HOH D 2 .   ? 17.847 51.428 47.518 1.00 15.68 ? 213 HOH B O   1 
HETATM 2995 O O   . HOH D 2 .   ? 31.202 30.929 32.835 1.00 36.07 ? 214 HOH B O   1 
HETATM 2996 O O   . HOH D 2 .   ? 28.185 28.897 33.730 1.00 18.51 ? 215 HOH B O   1 
HETATM 2997 O O   . HOH D 2 .   ? 20.136 55.637 52.170 1.00 4.16  ? 216 HOH B O   1 
HETATM 2998 O O   . HOH D 2 .   ? 17.586 35.417 29.683 1.00 21.25 ? 217 HOH B O   1 
HETATM 2999 O O   . HOH D 2 .   ? 30.011 45.906 20.431 1.00 18.09 ? 218 HOH B O   1 
HETATM 3000 O O   . HOH D 2 .   ? 17.214 43.118 18.729 1.00 42.75 ? 219 HOH B O   1 
HETATM 3001 O O   . HOH D 2 .   ? 23.259 52.131 28.582 1.00 41.54 ? 220 HOH B O   1 
HETATM 3002 O O   . HOH D 2 .   ? 32.069 51.003 37.587 1.00 20.15 ? 221 HOH B O   1 
HETATM 3003 O O   . HOH D 2 .   ? 17.821 37.631 35.763 1.00 3.29  ? 222 HOH B O   1 
HETATM 3004 O O   . HOH D 2 .   ? 19.653 14.868 35.458 1.00 19.21 ? 223 HOH B O   1 
HETATM 3005 O O   . HOH D 2 .   ? 34.263 36.306 40.529 1.00 25.63 ? 224 HOH B O   1 
HETATM 3006 O O   . HOH D 2 .   ? 20.342 9.923  16.137 1.00 34.05 ? 225 HOH B O   1 
HETATM 3007 O O   . HOH D 2 .   ? 23.003 39.030 43.184 1.00 13.14 ? 226 HOH B O   1 
HETATM 3008 O O   . HOH D 2 .   ? 10.562 45.395 38.599 1.00 25.64 ? 227 HOH B O   1 
HETATM 3009 O O   . HOH D 2 .   ? 27.014 40.069 53.080 1.00 27.53 ? 228 HOH B O   1 
HETATM 3010 O O   . HOH D 2 .   ? 13.369 7.639  30.048 1.00 26.56 ? 229 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   HIS 2   2   2   HIS HIS A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   TRP 9   9   9   TRP TRP A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  GLN 18  18  18  GLN GLN A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  TRP 46  46  46  TRP TRP A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  TRP 67  67  67  TRP TRP A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  CYS 75  75  75  CYS CYS A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  ?   ?   ?   A . n 
A 1 80  ASP 80  80  ?   ?   ?   A . n 
A 1 81  THR 81  81  ?   ?   ?   A . n 
A 1 82  ALA 82  82  ?   ?   ?   A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 CYS 122 122 122 CYS CYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 CYS 134 134 134 CYS CYS A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 GLY 137 137 ?   ?   ?   A . n 
A 1 138 GLU 138 138 ?   ?   ?   A . n 
A 1 139 ASP 139 139 ?   ?   ?   A . n 
A 1 140 GLU 140 140 ?   ?   ?   A . n 
A 1 141 HIS 141 141 ?   ?   ?   A . n 
A 1 142 PRO 142 142 ?   ?   ?   A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 CYS 144 144 144 CYS CYS A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 PHE 159 159 159 PHE PHE A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 TRP 170 170 170 TRP TRP A . n 
A 1 171 TRP 171 171 171 TRP TRP A . n 
A 1 172 TYR 172 172 172 TYR TYR A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 CYS 174 174 174 CYS CYS A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 TYR 177 177 177 TYR TYR A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 ASN 180 180 180 ASN ASN A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 TRP 185 185 185 TRP TRP A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
B 1 1   GLY 1   1   1   GLY GLY B . n 
B 1 2   HIS 2   2   2   HIS HIS B . n 
B 1 3   LEU 3   3   3   LEU LEU B . n 
B 1 4   PRO 4   4   4   PRO PRO B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   TRP 9   9   9   TRP TRP B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  SER 14  14  14  SER SER B . n 
B 1 15  VAL 15  15  15  VAL VAL B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  GLN 18  18  18  GLN GLN B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  THR 23  23  23  THR THR B . n 
B 1 24  LEU 24  24  24  LEU LEU B . n 
B 1 25  ARG 25  25  25  ARG ARG B . n 
B 1 26  CYS 26  26  26  CYS CYS B . n 
B 1 27  GLN 27  27  27  GLN GLN B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  GLY 29  29  29  GLY GLY B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  GLU 31  31  31  GLU GLU B . n 
B 1 32  THR 32  32  32  THR THR B . n 
B 1 33  GLN 33  33  33  GLN GLN B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  TYR 38  38  38  TYR TYR B . n 
B 1 39  ARG 39  39  39  ARG ARG B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  THR 43  43  43  THR THR B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  TRP 46  46  46  TRP TRP B . n 
B 1 47  ILE 47  47  47  ILE ILE B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  GLN 52  52  52  GLN GLN B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  LYS 57  57  57  LYS LYS B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  GLN 59  59  59  GLN GLN B . n 
B 1 60  PHE 60  60  60  PHE PHE B . n 
B 1 61  PRO 61  61  61  PRO PRO B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  TRP 67  67  67  TRP TRP B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  GLY 71  71  71  GLY GLY B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  TYR 73  73  73  TYR TYR B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  CYS 75  75  75  CYS CYS B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  ASP 80  80  80  ASP ASP B . n 
B 1 81  THR 81  81  ?   ?   ?   B . n 
B 1 82  ALA 82  82  82  ALA ALA B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  ARG 84  84  84  ARG ARG B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  SER 87  87  87  SER SER B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  ASP 89  89  89  ASP ASP B . n 
B 1 90  PRO 90  90  90  PRO PRO B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  TYR 99  99  99  TYR TYR B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 PRO 102 102 102 PRO PRO B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 ALA 106 106 106 ALA ALA B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 ASN 113 113 113 ASN ASN B . n 
B 1 114 SER 114 114 114 SER SER B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 LEU 120 120 120 LEU LEU B . n 
B 1 121 GLN 121 121 121 GLN GLN B . n 
B 1 122 CYS 122 122 122 CYS CYS B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 GLN 125 125 125 GLN GLN B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 PHE 128 128 128 PHE PHE B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 GLY 130 130 130 GLY GLY B . n 
B 1 131 PHE 131 131 131 PHE PHE B . n 
B 1 132 SER 132 132 132 SER SER B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 CYS 134 134 134 CYS CYS B . n 
B 1 135 LYS 135 135 135 LYS LYS B . n 
B 1 136 GLU 136 136 136 GLU GLU B . n 
B 1 137 GLY 137 137 ?   ?   ?   B . n 
B 1 138 GLU 138 138 ?   ?   ?   B . n 
B 1 139 ASP 139 139 ?   ?   ?   B . n 
B 1 140 GLU 140 140 ?   ?   ?   B . n 
B 1 141 HIS 141 141 ?   ?   ?   B . n 
B 1 142 PRO 142 142 ?   ?   ?   B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 CYS 144 144 144 CYS CYS B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 ASN 146 146 146 ASN ASN B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 GLN 148 148 148 GLN GLN B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 HIS 150 150 ?   ?   ?   B . n 
B 1 151 ALA 151 151 ?   ?   ?   B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 GLY 153 153 153 GLY GLY B . n 
B 1 154 SER 154 154 154 SER SER B . n 
B 1 155 SER 155 155 155 SER SER B . n 
B 1 156 ARG 156 156 156 ARG ARG B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 ILE 158 158 158 ILE ILE B . n 
B 1 159 PHE 159 159 159 PHE PHE B . n 
B 1 160 SER 160 160 160 SER SER B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 GLY 162 162 162 GLY GLY B . n 
B 1 163 PRO 163 163 163 PRO PRO B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 SER 165 165 165 SER SER B . n 
B 1 166 PRO 166 166 166 PRO PRO B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 ARG 168 168 ?   ?   ?   B . n 
B 1 169 ARG 169 169 169 ARG ARG B . n 
B 1 170 TRP 170 170 170 TRP TRP B . n 
B 1 171 TRP 171 171 171 TRP TRP B . n 
B 1 172 TYR 172 172 172 TYR TYR B . n 
B 1 173 ARG 173 173 173 ARG ARG B . n 
B 1 174 CYS 174 174 174 CYS CYS B . n 
B 1 175 TYR 175 175 175 TYR TYR B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 TYR 177 177 177 TYR TYR B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 ASN 180 180 180 ASN ASN B . n 
B 1 181 SER 181 181 181 SER SER B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 TYR 183 183 183 TYR TYR B . n 
B 1 184 GLU 184 184 184 GLU GLU B . n 
B 1 185 TRP 185 185 185 TRP TRP B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 SER 189 189 189 SER SER B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 LEU 191 191 191 LEU LEU B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 GLU 193 193 193 GLU GLU B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 VAL 196 196 196 VAL VAL B . n 
B 1 197 LEU 197 197 197 LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  198 2  HOH WAT A . 
C 2 HOH 2  199 3  HOH WAT A . 
C 2 HOH 3  200 7  HOH WAT A . 
C 2 HOH 4  201 10 HOH WAT A . 
C 2 HOH 5  202 11 HOH WAT A . 
C 2 HOH 6  203 12 HOH WAT A . 
C 2 HOH 7  204 14 HOH WAT A . 
C 2 HOH 8  205 15 HOH WAT A . 
C 2 HOH 9  206 16 HOH WAT A . 
C 2 HOH 10 207 17 HOH WAT A . 
C 2 HOH 11 208 18 HOH WAT A . 
C 2 HOH 12 209 20 HOH WAT A . 
C 2 HOH 13 210 28 HOH WAT A . 
C 2 HOH 14 211 29 HOH WAT A . 
C 2 HOH 15 212 35 HOH WAT A . 
C 2 HOH 16 213 36 HOH WAT A . 
C 2 HOH 17 214 37 HOH WAT A . 
C 2 HOH 18 215 40 HOH WAT A . 
C 2 HOH 19 216 41 HOH WAT A . 
C 2 HOH 20 217 42 HOH WAT A . 
C 2 HOH 21 218 43 HOH WAT A . 
C 2 HOH 22 219 49 HOH WAT A . 
C 2 HOH 23 220 53 HOH WAT A . 
C 2 HOH 24 221 55 HOH WAT A . 
C 2 HOH 25 222 57 HOH WAT A . 
C 2 HOH 26 223 58 HOH WAT A . 
C 2 HOH 27 224 61 HOH WAT A . 
C 2 HOH 28 225 64 HOH WAT A . 
C 2 HOH 29 226 65 HOH WAT A . 
D 2 HOH 1  198 1  HOH WAT B . 
D 2 HOH 2  199 4  HOH WAT B . 
D 2 HOH 3  200 5  HOH WAT B . 
D 2 HOH 4  201 6  HOH WAT B . 
D 2 HOH 5  202 8  HOH WAT B . 
D 2 HOH 6  203 9  HOH WAT B . 
D 2 HOH 7  204 13 HOH WAT B . 
D 2 HOH 8  205 19 HOH WAT B . 
D 2 HOH 9  206 21 HOH WAT B . 
D 2 HOH 10 207 22 HOH WAT B . 
D 2 HOH 11 208 23 HOH WAT B . 
D 2 HOH 12 209 24 HOH WAT B . 
D 2 HOH 13 210 25 HOH WAT B . 
D 2 HOH 14 211 27 HOH WAT B . 
D 2 HOH 15 212 30 HOH WAT B . 
D 2 HOH 16 213 31 HOH WAT B . 
D 2 HOH 17 214 32 HOH WAT B . 
D 2 HOH 18 215 33 HOH WAT B . 
D 2 HOH 19 216 34 HOH WAT B . 
D 2 HOH 20 217 38 HOH WAT B . 
D 2 HOH 21 218 39 HOH WAT B . 
D 2 HOH 22 219 45 HOH WAT B . 
D 2 HOH 23 220 46 HOH WAT B . 
D 2 HOH 24 221 47 HOH WAT B . 
D 2 HOH 25 222 50 HOH WAT B . 
D 2 HOH 26 223 52 HOH WAT B . 
D 2 HOH 27 224 54 HOH WAT B . 
D 2 HOH 28 225 56 HOH WAT B . 
D 2 HOH 29 226 59 HOH WAT B . 
D 2 HOH 30 227 60 HOH WAT B . 
D 2 HOH 31 228 62 HOH WAT B . 
D 2 HOH 32 229 63 HOH WAT B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-02 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A GLN 33 ? ? N A TYR 35  ? ? 1.95 
2 1 O A GLY 28 ? ? O B ASN 146 ? ? 2.16 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ALA 
_pdbx_validate_rmsd_bond.auth_seq_id_1             106 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ALA 
_pdbx_validate_rmsd_bond.auth_seq_id_2             106 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.695 
_pdbx_validate_rmsd_bond.bond_target_value         1.520 
_pdbx_validate_rmsd_bond.bond_deviation            0.175 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.021 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A SER 20  ? ? N  A PRO 21  ? ? CA A PRO 21  ? ? 128.48 119.30 9.18   1.50 Y 
2 1 N  A THR 32  ? ? CA A THR 32  ? ? C  A THR 32  ? ? 138.44 111.00 27.44  2.70 N 
3 1 CA A THR 32  ? ? C  A THR 32  ? ? N  A GLN 33  ? ? 102.95 117.20 -14.25 2.20 Y 
4 1 C  A THR 32  ? ? N  A GLN 33  ? ? CA A GLN 33  ? ? 141.77 121.70 20.07  2.50 Y 
5 1 N  A GLN 33  ? ? CA A GLN 33  ? ? C  A GLN 33  ? ? 134.16 111.00 23.16  2.70 N 
6 1 N  B SER 155 ? ? CA B SER 155 ? ? C  B SER 155 ? ? 130.27 111.00 19.27  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 31  ? ? -37.23  -37.48  
2  1 GLN A 33  ? ? 41.73   -110.26 
3  1 GLU A 34  ? ? -19.01  28.06   
4  1 LYS A 41  ? ? 83.86   -31.64  
5  1 GLN A 52  ? ? -31.93  -36.41  
6  1 PRO A 149 ? ? -56.76  173.83  
7  1 ALA A 151 ? ? -13.07  -66.14  
8  1 SER A 155 ? ? 78.64   74.69   
9  1 PRO A 182 ? ? -52.97  -8.42   
10 1 SER A 186 ? ? -64.71  -178.47 
11 1 LYS B 41  ? ? 62.68   -23.59  
12 1 SER B 109 ? ? -174.04 145.97  
13 1 PRO B 110 ? ? -58.73  -9.99   
14 1 SER B 155 ? ? 49.04   4.01    
15 1 PRO B 163 ? ? -19.76  103.13  
16 1 SER B 181 ? ? -170.52 54.35   
17 1 SER B 186 ? ? -79.22  -168.38 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 79  ? A SER 79  
2  1 Y 1 A ASP 80  ? A ASP 80  
3  1 Y 1 A THR 81  ? A THR 81  
4  1 Y 1 A ALA 82  ? A ALA 82  
5  1 Y 1 A GLY 137 ? A GLY 137 
6  1 Y 1 A GLU 138 ? A GLU 138 
7  1 Y 1 A ASP 139 ? A ASP 139 
8  1 Y 1 A GLU 140 ? A GLU 140 
9  1 Y 1 A HIS 141 ? A HIS 141 
10 1 Y 1 A PRO 142 ? A PRO 142 
11 1 Y 1 B THR 81  ? B THR 81  
12 1 Y 1 B GLY 137 ? B GLY 137 
13 1 Y 1 B GLU 138 ? B GLU 138 
14 1 Y 1 B ASP 139 ? B ASP 139 
15 1 Y 1 B GLU 140 ? B GLU 140 
16 1 Y 1 B HIS 141 ? B HIS 141 
17 1 Y 1 B PRO 142 ? B PRO 142 
18 1 Y 1 B HIS 150 ? B HIS 150 
19 1 Y 1 B ALA 151 ? B ALA 151 
20 1 Y 1 B ARG 168 ? B ARG 168 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#