data_1W8A
# 
_entry.id   1W8A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1W8A         
PDBE  EBI-21081    
WWPDB D_1290021081 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1OZN 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'NOGO RECEPTOR LIGAND BINDING DOMAIN' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1W8A 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Howitt, J.A.'   1 ? 
'Clout, N.J.'    2 ? 
'Hohenester, E.' 3 ? 
# 
_citation.id                        primary 
_citation.title                     
'Binding Site for Robo Receptors Revealed by Dissection of the Leucine-Rich Repeat Region of Slit.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            23 
_citation.page_first                4406 
_citation.page_last                 ? 
_citation.year                      2004 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15496984 
_citation.pdbx_database_id_DOI      10.1038/SJ.EMBOJ.7600446 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Howitt, J.A.'   1 
primary 'Clout, N.J.'    2 
primary 'Hohenester, E.' 3 
# 
_cell.entry_id           1W8A 
_cell.length_a           121.213 
_cell.length_b           31.852 
_cell.length_c           49.526 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.72 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1W8A 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SLIT PROTEIN' 21313.307 1 ? ? 'THIRD LRR DOMAIN, RESIDUES 542-733' ? 
2 water   nat water          18.015    5 ? ? ?                                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHI
QELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA
ARCGAPSKVRDVQIKDLPHSEFKCSSENSEGC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHI
QELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGA
ARCGAPSKVRDVQIKDLPHSEFKCSSENSEGC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   CYS n 
1 3   PRO n 
1 4   ALA n 
1 5   MET n 
1 6   CYS n 
1 7   HIS n 
1 8   CYS n 
1 9   GLU n 
1 10  GLY n 
1 11  THR n 
1 12  THR n 
1 13  VAL n 
1 14  ASP n 
1 15  CYS n 
1 16  THR n 
1 17  GLY n 
1 18  ARG n 
1 19  GLY n 
1 20  LEU n 
1 21  LYS n 
1 22  GLU n 
1 23  ILE n 
1 24  PRO n 
1 25  ARG n 
1 26  ASP n 
1 27  ILE n 
1 28  PRO n 
1 29  LEU n 
1 30  HIS n 
1 31  THR n 
1 32  THR n 
1 33  GLU n 
1 34  LEU n 
1 35  LEU n 
1 36  LEU n 
1 37  ASN n 
1 38  ASP n 
1 39  ASN n 
1 40  GLU n 
1 41  LEU n 
1 42  GLY n 
1 43  ARG n 
1 44  ILE n 
1 45  SER n 
1 46  SER n 
1 47  ASP n 
1 48  GLY n 
1 49  LEU n 
1 50  PHE n 
1 51  GLY n 
1 52  ARG n 
1 53  LEU n 
1 54  PRO n 
1 55  HIS n 
1 56  LEU n 
1 57  VAL n 
1 58  LYS n 
1 59  LEU n 
1 60  GLU n 
1 61  LEU n 
1 62  LYS n 
1 63  ARG n 
1 64  ASN n 
1 65  GLN n 
1 66  LEU n 
1 67  THR n 
1 68  GLY n 
1 69  ILE n 
1 70  GLU n 
1 71  PRO n 
1 72  ASN n 
1 73  ALA n 
1 74  PHE n 
1 75  GLU n 
1 76  GLY n 
1 77  ALA n 
1 78  SER n 
1 79  HIS n 
1 80  ILE n 
1 81  GLN n 
1 82  GLU n 
1 83  LEU n 
1 84  GLN n 
1 85  LEU n 
1 86  GLY n 
1 87  GLU n 
1 88  ASN n 
1 89  LYS n 
1 90  ILE n 
1 91  LYS n 
1 92  GLU n 
1 93  ILE n 
1 94  SER n 
1 95  ASN n 
1 96  LYS n 
1 97  MET n 
1 98  PHE n 
1 99  LEU n 
1 100 GLY n 
1 101 LEU n 
1 102 HIS n 
1 103 GLN n 
1 104 LEU n 
1 105 LYS n 
1 106 THR n 
1 107 LEU n 
1 108 ASN n 
1 109 LEU n 
1 110 TYR n 
1 111 ASP n 
1 112 ASN n 
1 113 GLN n 
1 114 ILE n 
1 115 SER n 
1 116 CYS n 
1 117 VAL n 
1 118 MET n 
1 119 PRO n 
1 120 GLY n 
1 121 SER n 
1 122 PHE n 
1 123 GLU n 
1 124 HIS n 
1 125 LEU n 
1 126 ASN n 
1 127 SER n 
1 128 LEU n 
1 129 THR n 
1 130 SER n 
1 131 LEU n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 SER n 
1 136 ASN n 
1 137 PRO n 
1 138 PHE n 
1 139 ASN n 
1 140 CYS n 
1 141 ASN n 
1 142 CYS n 
1 143 HIS n 
1 144 LEU n 
1 145 ALA n 
1 146 TRP n 
1 147 PHE n 
1 148 ALA n 
1 149 GLU n 
1 150 TRP n 
1 151 LEU n 
1 152 ARG n 
1 153 LYS n 
1 154 LYS n 
1 155 SER n 
1 156 LEU n 
1 157 ASN n 
1 158 GLY n 
1 159 GLY n 
1 160 ALA n 
1 161 ALA n 
1 162 ARG n 
1 163 CYS n 
1 164 GLY n 
1 165 ALA n 
1 166 PRO n 
1 167 SER n 
1 168 LYS n 
1 169 VAL n 
1 170 ARG n 
1 171 ASP n 
1 172 VAL n 
1 173 GLN n 
1 174 ILE n 
1 175 LYS n 
1 176 ASP n 
1 177 LEU n 
1 178 PRO n 
1 179 HIS n 
1 180 SER n 
1 181 GLU n 
1 182 PHE n 
1 183 LYS n 
1 184 CYS n 
1 185 SER n 
1 186 SER n 
1 187 GLU n 
1 188 ASN n 
1 189 SER n 
1 190 GLU n 
1 191 GLY n 
1 192 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Fruit fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            293-EBNA 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCEP-PU 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SLIT_DROME 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P24014 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1W8A 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 192 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24014 
_struct_ref_seq.db_align_beg                  542 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  733 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       542 
_struct_ref_seq.pdbx_auth_seq_align_end       733 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1W8A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.20 
_exptl_crystal.density_percent_sol   44.19 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1W8A 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   4705 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            0.07000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.000 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   96.3 
_reflns_shell.Rmerge_I_obs           0.19000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.000 
_reflns_shell.pdbx_redundancy        4.00 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1W8A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     4705 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          0.1994 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1994 
_refine.ls_R_factor_R_free                       0.2687 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.3 
_refine.ls_number_reflns_R_free                  493 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -8.417 
_refine.aniso_B[2][2]                            0.528 
_refine.aniso_B[3][3]                            7.889 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -1.610 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.294686 
_refine.solvent_model_param_bsol                 21.6057 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1OZN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1465 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             5 
_refine_hist.number_atoms_total               1470 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.817 1.000 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.441 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.239 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.480 3.000 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM ? 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   ? 
# 
_struct.entry_id                  1W8A 
_struct.title                     'Third LRR domain of Drosophila Slit' 
_struct.pdbx_descriptor           'SLIT PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1W8A 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'SIGNALING PROTEIN, SECRETED PROTEIN, AXON GUIDANCE, LEUCINE-RICH REPEAT GLYCOPROTEIN, EGF-LIKE DOMAIN, SIGNAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 49  ? LEU A 53  ? LEU A 590 LEU A 594 5 ? 5  
HELX_P HELX_P2 2 ASN A 141 ? HIS A 143 ? ASN A 682 HIS A 684 5 ? 3  
HELX_P HELX_P3 3 LEU A 144 ? SER A 155 ? LEU A 685 SER A 696 1 ? 12 
HELX_P HELX_P4 4 ASN A 157 ? ALA A 161 ? ASN A 698 ALA A 702 5 ? 5  
HELX_P HELX_P5 5 ILE A 174 ? LEU A 177 ? ILE A 715 LEU A 718 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 2   SG ? ? ? 1_555 A CYS 8   SG ? ? A CYS 543 A CYS 549 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 6   SG ? ? ? 1_555 A CYS 15  SG ? ? A CYS 547 A CYS 556 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf3 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 192 SG ? ? A CYS 657 A CYS 733 1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf4 disulf ? ? A CYS 140 SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 681 A CYS 704 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf5 disulf ? ? A CYS 142 SG ? ? ? 1_555 A CYS 184 SG ? ? A CYS 683 A CYS 725 1_555 ? ? ? ? ? ? ? 2.020 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AB 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 HIS A 7   ? GLU A 9   ? HIS A 548 GLU A 550 
AA 2 THR A 12  ? ASP A 14  ? THR A 553 ASP A 555 
AA 3 GLU A 33  ? LEU A 35  ? GLU A 574 LEU A 576 
AA 4 LYS A 58  ? GLU A 60  ? LYS A 599 GLU A 601 
AA 5 GLU A 82  ? GLN A 84  ? GLU A 623 GLN A 625 
AA 6 THR A 106 ? ASN A 108 ? THR A 647 ASN A 649 
AA 7 SER A 130 ? ASN A 132 ? SER A 671 ASN A 673 
AB 1 GLU A 92  ? ILE A 93  ? GLU A 633 ILE A 634 
AB 2 CYS A 116 ? VAL A 117 ? CYS A 657 VAL A 658 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 9   ? N GLU A 550 O THR A 12  ? O THR A 553 
AA 2 3 N VAL A 13  ? N VAL A 554 O GLU A 33  ? O GLU A 574 
AA 3 4 N LEU A 34  ? N LEU A 575 O LYS A 58  ? O LYS A 599 
AA 4 5 N LEU A 59  ? N LEU A 600 O GLU A 82  ? O GLU A 623 
AA 5 6 N LEU A 83  ? N LEU A 624 O THR A 106 ? O THR A 647 
AA 6 7 N LEU A 107 ? N LEU A 648 O SER A 130 ? O SER A 671 
AB 1 2 N ILE A 93  ? N ILE A 634 O CYS A 116 ? O CYS A 657 
# 
_database_PDB_matrix.entry_id          1W8A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1W8A 
_atom_sites.fract_transf_matrix[1][1]   0.008250 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001562 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.031395 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020550 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 6.305  6.593   6.984  1.00   48.94 ? 542  ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 7.394  7.540   7.369  1.00   48.93 ? 542  ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 8.805  7.051   7.007  1.00   48.57 ? 542  ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 9.111  5.855   7.053  1.00   48.62 ? 542  ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 7.311  7.861   8.866  1.00   49.31 ? 542  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 6.731  6.716   9.682  1.00   50.03 ? 542  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 7.348  5.625   9.724  1.00   48.85 ? 542  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 5.651  6.919   10.283 1.00   49.78 ? 542  ASP A OD2 1 
ATOM   9    N N   . CYS A 1 2   ? 9.656  8.006   6.648  1.00   47.43 ? 543  CYS A N   1 
ATOM   10   C CA  . CYS A 1 2   ? 11.029 7.740   6.235  1.00   46.10 ? 543  CYS A CA  1 
ATOM   11   C C   . CYS A 1 2   ? 11.735 9.088   6.327  1.00   45.71 ? 543  CYS A C   1 
ATOM   12   O O   . CYS A 1 2   ? 11.172 10.111  5.931  1.00   45.91 ? 543  CYS A O   1 
ATOM   13   C CB  . CYS A 1 2   ? 11.026 7.230   4.783  1.00   44.68 ? 543  CYS A CB  1 
ATOM   14   S SG  . CYS A 1 2   ? 12.631 6.888   3.978  1.00   39.23 ? 543  CYS A SG  1 
ATOM   15   N N   . PRO A 1 3   ? 12.964 9.117   6.869  1.00   44.85 ? 544  PRO A N   1 
ATOM   16   C CA  . PRO A 1 3   ? 13.669 10.396  6.970  1.00   43.97 ? 544  PRO A CA  1 
ATOM   17   C C   . PRO A 1 3   ? 13.485 11.224  5.702  1.00   43.68 ? 544  PRO A C   1 
ATOM   18   O O   . PRO A 1 3   ? 13.731 10.754  4.587  1.00   43.63 ? 544  PRO A O   1 
ATOM   19   C CB  . PRO A 1 3   ? 15.109 9.969   7.202  1.00   43.07 ? 544  PRO A CB  1 
ATOM   20   C CG  . PRO A 1 3   ? 14.936 8.758   8.059  1.00   43.86 ? 544  PRO A CG  1 
ATOM   21   C CD  . PRO A 1 3   ? 13.807 8.014   7.365  1.00   44.70 ? 544  PRO A CD  1 
ATOM   22   N N   . ALA A 1 4   ? 13.026 12.454  5.893  1.00   43.08 ? 545  ALA A N   1 
ATOM   23   C CA  . ALA A 1 4   ? 12.772 13.378  4.803  1.00   42.11 ? 545  ALA A CA  1 
ATOM   24   C C   . ALA A 1 4   ? 13.688 13.224  3.595  1.00   41.50 ? 545  ALA A C   1 
ATOM   25   O O   . ALA A 1 4   ? 13.213 12.934  2.498  1.00   41.58 ? 545  ALA A O   1 
ATOM   26   C CB  . ALA A 1 4   ? 12.836 14.805  5.323  1.00   42.73 ? 545  ALA A CB  1 
ATOM   27   N N   . MET A 1 5   ? 14.992 13.405  3.788  1.00   40.79 ? 546  MET A N   1 
ATOM   28   C CA  . MET A 1 5   ? 15.928 13.312  2.670  1.00   40.00 ? 546  MET A CA  1 
ATOM   29   C C   . MET A 1 5   ? 16.626 11.969  2.412  1.00   38.23 ? 546  MET A C   1 
ATOM   30   O O   . MET A 1 5   ? 17.799 11.947  2.044  1.00   37.94 ? 546  MET A O   1 
ATOM   31   C CB  . MET A 1 5   ? 16.988 14.418  2.782  1.00   42.90 ? 546  MET A CB  1 
ATOM   32   C CG  . MET A 1 5   ? 18.000 14.260  3.915  1.00   47.29 ? 546  MET A CG  1 
ATOM   33   S SD  . MET A 1 5   ? 17.409 14.756  5.548  1.00   53.27 ? 546  MET A SD  1 
ATOM   34   C CE  . MET A 1 5   ? 16.745 13.195  6.166  1.00   50.67 ? 546  MET A CE  1 
ATOM   35   N N   . CYS A 1 6   ? 15.910 10.858  2.582  1.00   36.71 ? 547  CYS A N   1 
ATOM   36   C CA  . CYS A 1 6   ? 16.481 9.530   2.332  1.00   35.01 ? 547  CYS A CA  1 
ATOM   37   C C   . CYS A 1 6   ? 15.509 8.687   1.524  1.00   35.14 ? 547  CYS A C   1 
ATOM   38   O O   . CYS A 1 6   ? 14.431 9.147   1.182  1.00   36.10 ? 547  CYS A O   1 
ATOM   39   C CB  . CYS A 1 6   ? 16.757 8.797   3.638  1.00   31.34 ? 547  CYS A CB  1 
ATOM   40   S SG  . CYS A 1 6   ? 17.809 9.658   4.837  1.00   26.80 ? 547  CYS A SG  1 
ATOM   41   N N   . HIS A 1 7   ? 15.891 7.449   1.223  1.00   35.43 ? 548  HIS A N   1 
ATOM   42   C CA  . HIS A 1 7   ? 15.021 6.544   0.478  1.00   35.53 ? 548  HIS A CA  1 
ATOM   43   C C   . HIS A 1 7   ? 14.794 5.267   1.270  1.00   35.33 ? 548  HIS A C   1 
ATOM   44   O O   . HIS A 1 7   ? 15.731 4.715   1.837  1.00   35.26 ? 548  HIS A O   1 
ATOM   45   C CB  . HIS A 1 7   ? 15.623 6.193   -0.871 1.00   37.55 ? 548  HIS A CB  1 
ATOM   46   C CG  . HIS A 1 7   ? 14.723 5.346   -1.709 1.00   40.96 ? 548  HIS A CG  1 
ATOM   47   N ND1 . HIS A 1 7   ? 13.414 5.694   -1.970 1.00   41.58 ? 548  HIS A ND1 1 
ATOM   48   C CD2 . HIS A 1 7   ? 14.926 4.156   -2.319 1.00   42.99 ? 548  HIS A CD2 1 
ATOM   49   C CE1 . HIS A 1 7   ? 12.849 4.753   -2.704 1.00   42.96 ? 548  HIS A CE1 1 
ATOM   50   N NE2 . HIS A 1 7   ? 13.744 3.808   -2.929 1.00   44.32 ? 548  HIS A NE2 1 
ATOM   51   N N   . CYS A 1 8   ? 13.559 4.775   1.280  1.00   35.70 ? 549  CYS A N   1 
ATOM   52   C CA  . CYS A 1 8   ? 13.232 3.585   2.064  1.00   35.99 ? 549  CYS A CA  1 
ATOM   53   C C   . CYS A 1 8   ? 12.753 2.304   1.388  1.00   36.59 ? 549  CYS A C   1 
ATOM   54   O O   . CYS A 1 8   ? 11.572 2.147   1.101  1.00   36.86 ? 549  CYS A O   1 
ATOM   55   C CB  . CYS A 1 8   ? 12.227 3.971   3.142  1.00   34.73 ? 549  CYS A CB  1 
ATOM   56   S SG  . CYS A 1 8   ? 12.982 4.949   4.470  1.00   34.13 ? 549  CYS A SG  1 
ATOM   57   N N   . GLU A 1 9   ? 13.678 1.377   1.166  1.00   37.14 ? 550  GLU A N   1 
ATOM   58   C CA  . GLU A 1 9   ? 13.349 0.089   0.570  1.00   37.59 ? 550  GLU A CA  1 
ATOM   59   C C   . GLU A 1 9   ? 13.072 -0.897  1.700  1.00   36.95 ? 550  GLU A C   1 
ATOM   60   O O   . GLU A 1 9   ? 13.987 -1.290  2.429  1.00   37.45 ? 550  GLU A O   1 
ATOM   61   C CB  . GLU A 1 9   ? 14.514 -0.424  -0.280 1.00   39.38 ? 550  GLU A CB  1 
ATOM   62   C CG  . GLU A 1 9   ? 14.568 0.178   -1.669 1.00   44.54 ? 550  GLU A CG  1 
ATOM   63   C CD  . GLU A 1 9   ? 13.406 -0.273  -2.539 1.00   48.08 ? 550  GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 9   ? 12.243 -0.121  -2.111 1.00   49.30 ? 550  GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 9   ? 13.654 -0.781  -3.653 1.00   50.47 ? 550  GLU A OE2 1 
ATOM   66   N N   . GLY A 1 10  ? 11.815 -1.299  1.847  1.00   35.36 ? 551  GLY A N   1 
ATOM   67   C CA  . GLY A 1 10  ? 11.482 -2.232  2.907  1.00   33.32 ? 551  GLY A CA  1 
ATOM   68   C C   . GLY A 1 10  ? 11.941 -1.687  4.248  1.00   31.85 ? 551  GLY A C   1 
ATOM   69   O O   . GLY A 1 10  ? 11.499 -0.615  4.674  1.00   31.69 ? 551  GLY A O   1 
ATOM   70   N N   . THR A 1 11  ? 12.829 -2.421  4.914  1.00   30.12 ? 552  THR A N   1 
ATOM   71   C CA  . THR A 1 11  ? 13.362 -2.002  6.211  1.00   27.06 ? 552  THR A CA  1 
ATOM   72   C C   . THR A 1 11  ? 14.755 -1.374  6.044  1.00   25.31 ? 552  THR A C   1 
ATOM   73   O O   . THR A 1 11  ? 15.456 -1.074  7.017  1.00   24.31 ? 552  THR A O   1 
ATOM   74   C CB  . THR A 1 11  ? 13.406 -3.195  7.194  1.00   26.16 ? 552  THR A CB  1 
ATOM   75   O OG1 . THR A 1 11  ? 13.913 -4.356  6.527  1.00   23.84 ? 552  THR A OG1 1 
ATOM   76   C CG2 . THR A 1 11  ? 12.014 -3.493  7.716  1.00   24.06 ? 552  THR A CG2 1 
ATOM   77   N N   . THR A 1 12  ? 15.132 -1.171  4.786  1.00   23.38 ? 553  THR A N   1 
ATOM   78   C CA  . THR A 1 12  ? 16.398 -0.557  4.445  1.00   21.13 ? 553  THR A CA  1 
ATOM   79   C C   . THR A 1 12  ? 16.210 0.933   4.262  1.00   21.13 ? 553  THR A C   1 
ATOM   80   O O   . THR A 1 12  ? 15.289 1.376   3.582  1.00   21.04 ? 553  THR A O   1 
ATOM   81   C CB  . THR A 1 12  ? 16.947 -1.102  3.146  1.00   18.90 ? 553  THR A CB  1 
ATOM   82   O OG1 . THR A 1 12  ? 17.484 -2.405  3.373  1.00   22.17 ? 553  THR A OG1 1 
ATOM   83   C CG2 . THR A 1 12  ? 18.027 -0.192  2.607  1.00   17.45 ? 553  THR A CG2 1 
ATOM   84   N N   . VAL A 1 13  ? 17.094 1.702   4.876  1.00   20.63 ? 554  VAL A N   1 
ATOM   85   C CA  . VAL A 1 13  ? 17.048 3.145   4.767  1.00   19.75 ? 554  VAL A CA  1 
ATOM   86   C C   . VAL A 1 13  ? 18.321 3.572   4.040  1.00   20.13 ? 554  VAL A C   1 
ATOM   87   O O   . VAL A 1 13  ? 19.438 3.248   4.452  1.00   21.42 ? 554  VAL A O   1 
ATOM   88   C CB  . VAL A 1 13  ? 16.973 3.794   6.158  1.00   18.06 ? 554  VAL A CB  1 
ATOM   89   C CG1 . VAL A 1 13  ? 16.877 5.309   6.037  1.00   19.10 ? 554  VAL A CG1 1 
ATOM   90   C CG2 . VAL A 1 13  ? 15.781 3.257   6.888  1.00   15.05 ? 554  VAL A CG2 1 
ATOM   91   N N   . ASP A 1 14  ? 18.150 4.288   2.940  1.00   19.42 ? 555  ASP A N   1 
ATOM   92   C CA  . ASP A 1 14  ? 19.286 4.729   2.158  1.00   17.66 ? 555  ASP A CA  1 
ATOM   93   C C   . ASP A 1 14  ? 19.408 6.245   2.178  1.00   16.63 ? 555  ASP A C   1 
ATOM   94   O O   . ASP A 1 14  ? 18.581 6.952   1.605  1.00   15.46 ? 555  ASP A O   1 
ATOM   95   C CB  . ASP A 1 14  ? 19.136 4.232   0.727  1.00   17.51 ? 555  ASP A CB  1 
ATOM   96   C CG  . ASP A 1 14  ? 20.370 4.459   -0.099 1.00   20.70 ? 555  ASP A CG  1 
ATOM   97   O OD1 . ASP A 1 14  ? 20.345 4.094   -1.294 1.00   21.78 ? 555  ASP A OD1 1 
ATOM   98   O OD2 . ASP A 1 14  ? 21.363 4.999   0.442  1.00   22.36 ? 555  ASP A OD2 1 
ATOM   99   N N   . CYS A 1 15  ? 20.439 6.737   2.857  1.00   15.65 ? 556  CYS A N   1 
ATOM   100  C CA  . CYS A 1 15  ? 20.678 8.165   2.943  1.00   15.51 ? 556  CYS A CA  1 
ATOM   101  C C   . CYS A 1 15  ? 22.045 8.463   2.341  1.00   14.52 ? 556  CYS A C   1 
ATOM   102  O O   . CYS A 1 15  ? 22.695 9.434   2.702  1.00   14.06 ? 556  CYS A O   1 
ATOM   103  C CB  . CYS A 1 15  ? 20.660 8.627   4.397  1.00   17.54 ? 556  CYS A CB  1 
ATOM   104  S SG  . CYS A 1 15  ? 19.178 8.270   5.402  1.00   19.78 ? 556  CYS A SG  1 
ATOM   105  N N   . THR A 1 16  ? 22.469 7.612   1.417  1.00   14.45 ? 557  THR A N   1 
ATOM   106  C CA  . THR A 1 16  ? 23.763 7.745   0.757  1.00   13.47 ? 557  THR A CA  1 
ATOM   107  C C   . THR A 1 16  ? 23.852 8.975   -0.127 1.00   13.15 ? 557  THR A C   1 
ATOM   108  O O   . THR A 1 16  ? 22.892 9.335   -0.798 1.00   13.48 ? 557  THR A O   1 
ATOM   109  C CB  . THR A 1 16  ? 24.052 6.519   -0.114 1.00   13.05 ? 557  THR A CB  1 
ATOM   110  O OG1 . THR A 1 16  ? 22.912 6.262   -0.938 1.00   13.37 ? 557  THR A OG1 1 
ATOM   111  C CG2 . THR A 1 16  ? 24.319 5.293   0.741  1.00   13.91 ? 557  THR A CG2 1 
ATOM   112  N N   . GLY A 1 17  ? 25.017 9.614   -0.114 1.00   13.52 ? 558  GLY A N   1 
ATOM   113  C CA  . GLY A 1 17  ? 25.252 10.791  -0.928 1.00   12.75 ? 558  GLY A CA  1 
ATOM   114  C C   . GLY A 1 17  ? 24.267 11.933  -0.779 1.00   13.58 ? 558  GLY A C   1 
ATOM   115  O O   . GLY A 1 17  ? 23.988 12.624  -1.759 1.00   13.45 ? 558  GLY A O   1 
ATOM   116  N N   . ARG A 1 18  ? 23.747 12.152  0.429  1.00   13.79 ? 559  ARG A N   1 
ATOM   117  C CA  . ARG A 1 18  ? 22.796 13.239  0.655  1.00   14.82 ? 559  ARG A CA  1 
ATOM   118  C C   . ARG A 1 18  ? 23.468 14.430  1.363  1.00   15.82 ? 559  ARG A C   1 
ATOM   119  O O   . ARG A 1 18  ? 22.798 15.361  1.824  1.00   15.48 ? 559  ARG A O   1 
ATOM   120  C CB  . ARG A 1 18  ? 21.605 12.740  1.477  1.00   14.81 ? 559  ARG A CB  1 
ATOM   121  C CG  . ARG A 1 18  ? 20.915 11.473  0.943  1.00   14.03 ? 559  ARG A CG  1 
ATOM   122  C CD  . ARG A 1 18  ? 20.217 11.732  -0.372 1.00   16.15 ? 559  ARG A CD  1 
ATOM   123  N NE  . ARG A 1 18  ? 19.045 10.881  -0.585 1.00   15.89 ? 559  ARG A NE  1 
ATOM   124  C CZ  . ARG A 1 18  ? 19.088 9.589   -0.896 1.00   17.82 ? 559  ARG A CZ  1 
ATOM   125  N NH1 . ARG A 1 18  ? 20.250 8.963   -1.035 1.00   18.69 ? 559  ARG A NH1 1 
ATOM   126  N NH2 . ARG A 1 18  ? 17.959 8.922   -1.086 1.00   17.64 ? 559  ARG A NH2 1 
ATOM   127  N N   . GLY A 1 19  ? 24.797 14.383  1.444  1.00   16.45 ? 560  GLY A N   1 
ATOM   128  C CA  . GLY A 1 19  ? 25.564 15.456  2.052  1.00   17.87 ? 560  GLY A CA  1 
ATOM   129  C C   . GLY A 1 19  ? 25.283 15.718  3.512  1.00   19.97 ? 560  GLY A C   1 
ATOM   130  O O   . GLY A 1 19  ? 25.474 16.841  3.992  1.00   21.09 ? 560  GLY A O   1 
ATOM   131  N N   . LEU A 1 20  ? 24.854 14.680  4.225  1.00   20.76 ? 561  LEU A N   1 
ATOM   132  C CA  . LEU A 1 20  ? 24.518 14.789  5.640  1.00   20.44 ? 561  LEU A CA  1 
ATOM   133  C C   . LEU A 1 20  ? 25.689 15.099  6.552  1.00   21.35 ? 561  LEU A C   1 
ATOM   134  O O   . LEU A 1 20  ? 26.787 14.564  6.384  1.00   20.44 ? 561  LEU A O   1 
ATOM   135  C CB  . LEU A 1 20  ? 23.836 13.505  6.104  1.00   20.31 ? 561  LEU A CB  1 
ATOM   136  C CG  . LEU A 1 20  ? 22.549 13.207  5.342  1.00   19.75 ? 561  LEU A CG  1 
ATOM   137  C CD1 . LEU A 1 20  ? 21.922 11.934  5.852  1.00   20.61 ? 561  LEU A CD1 1 
ATOM   138  C CD2 . LEU A 1 20  ? 21.600 14.379  5.514  1.00   21.67 ? 561  LEU A CD2 1 
ATOM   139  N N   . LYS A 1 21  ? 25.435 15.976  7.522  1.00   23.43 ? 562  LYS A N   1 
ATOM   140  C CA  . LYS A 1 21  ? 26.444 16.388  8.492  1.00   25.27 ? 562  LYS A CA  1 
ATOM   141  C C   . LYS A 1 21  ? 26.195 15.678  9.804  1.00   26.12 ? 562  LYS A C   1 
ATOM   142  O O   . LYS A 1 21  ? 27.097 15.551  10.627 1.00   27.99 ? 562  LYS A O   1 
ATOM   143  C CB  . LYS A 1 21  ? 26.406 17.905  8.716  1.00   26.66 ? 562  LYS A CB  1 
ATOM   144  C CG  . LYS A 1 21  ? 26.783 18.738  7.498  1.00   27.93 ? 562  LYS A CG  1 
ATOM   145  C CD  . LYS A 1 21  ? 28.173 18.387  6.993  1.00   32.93 ? 562  LYS A CD  1 
ATOM   146  C CE  . LYS A 1 21  ? 28.613 19.335  5.884  1.00   37.56 ? 562  LYS A CE  1 
ATOM   147  N NZ  . LYS A 1 21  ? 27.651 19.361  4.738  1.00   40.60 ? 562  LYS A NZ  1 
ATOM   148  N N   . GLU A 1 22  ? 24.962 15.232  10.008 1.00   25.58 ? 563  GLU A N   1 
ATOM   149  C CA  . GLU A 1 22  ? 24.614 14.498  11.212 1.00   25.02 ? 563  GLU A CA  1 
ATOM   150  C C   . GLU A 1 22  ? 23.495 13.553  10.843 1.00   24.21 ? 563  GLU A C   1 
ATOM   151  O O   . GLU A 1 22  ? 22.668 13.864  9.989  1.00   24.28 ? 563  GLU A O   1 
ATOM   152  C CB  . GLU A 1 22  ? 24.166 15.432  12.338 1.00   26.79 ? 563  GLU A CB  1 
ATOM   153  C CG  . GLU A 1 22  ? 22.881 16.207  12.070 1.00   30.98 ? 563  GLU A CG  1 
ATOM   154  C CD  . GLU A 1 22  ? 22.343 16.904  13.317 1.00   34.02 ? 563  GLU A CD  1 
ATOM   155  O OE1 . GLU A 1 22  ? 23.152 17.455  14.101 1.00   34.99 ? 563  GLU A OE1 1 
ATOM   156  O OE2 . GLU A 1 22  ? 21.108 16.910  13.509 1.00   36.36 ? 563  GLU A OE2 1 
ATOM   157  N N   . ILE A 1 23  ? 23.479 12.397  11.491 1.00   23.25 ? 564  ILE A N   1 
ATOM   158  C CA  . ILE A 1 23  ? 22.482 11.375  11.233 1.00   22.43 ? 564  ILE A CA  1 
ATOM   159  C C   . ILE A 1 23  ? 21.059 11.815  11.559 1.00   23.22 ? 564  ILE A C   1 
ATOM   160  O O   . ILE A 1 23  ? 20.787 12.299  12.651 1.00   23.58 ? 564  ILE A O   1 
ATOM   161  C CB  . ILE A 1 23  ? 22.837 10.087  12.016 1.00   20.50 ? 564  ILE A CB  1 
ATOM   162  C CG1 . ILE A 1 23  ? 24.222 9.605   11.574 1.00   19.06 ? 564  ILE A CG1 1 
ATOM   163  C CG2 . ILE A 1 23  ? 21.780 9.004   11.786 1.00   18.54 ? 564  ILE A CG2 1 
ATOM   164  C CD1 . ILE A 1 23  ? 24.636 8.278   12.155 1.00   20.37 ? 564  ILE A CD1 1 
ATOM   165  N N   . PRO A 1 24  ? 20.133 11.656  10.600 1.00   24.26 ? 565  PRO A N   1 
ATOM   166  C CA  . PRO A 1 24  ? 18.719 12.023  10.745 1.00   25.68 ? 565  PRO A CA  1 
ATOM   167  C C   . PRO A 1 24  ? 18.115 11.453  12.015 1.00   26.72 ? 565  PRO A C   1 
ATOM   168  O O   . PRO A 1 24  ? 18.123 10.249  12.221 1.00   27.18 ? 565  PRO A O   1 
ATOM   169  C CB  . PRO A 1 24  ? 18.082 11.429  9.496  1.00   25.09 ? 565  PRO A CB  1 
ATOM   170  C CG  . PRO A 1 24  ? 19.176 11.571  8.486  1.00   25.95 ? 565  PRO A CG  1 
ATOM   171  C CD  . PRO A 1 24  ? 20.394 11.117  9.254  1.00   24.39 ? 565  PRO A CD  1 
ATOM   172  N N   . ARG A 1 25  ? 17.574 12.321  12.858 1.00   28.70 ? 566  ARG A N   1 
ATOM   173  C CA  . ARG A 1 25  ? 16.991 11.885  14.120 1.00   31.15 ? 566  ARG A CA  1 
ATOM   174  C C   . ARG A 1 25  ? 15.758 10.989  14.043 1.00   31.70 ? 566  ARG A C   1 
ATOM   175  O O   . ARG A 1 25  ? 15.494 10.222  14.973 1.00   31.25 ? 566  ARG A O   1 
ATOM   176  C CB  . ARG A 1 25  ? 16.653 13.098  14.984 1.00   33.64 ? 566  ARG A CB  1 
ATOM   177  C CG  . ARG A 1 25  ? 17.781 13.546  15.885 1.00   39.42 ? 566  ARG A CG  1 
ATOM   178  C CD  . ARG A 1 25  ? 17.241 14.407  17.024 1.00   46.52 ? 566  ARG A CD  1 
ATOM   179  N NE  . ARG A 1 25  ? 16.210 13.713  17.800 1.00   50.40 ? 566  ARG A NE  1 
ATOM   180  C CZ  . ARG A 1 25  ? 15.530 14.261  18.806 1.00   53.35 ? 566  ARG A CZ  1 
ATOM   181  N NH1 . ARG A 1 25  ? 15.767 15.518  19.168 1.00   53.37 ? 566  ARG A NH1 1 
ATOM   182  N NH2 . ARG A 1 25  ? 14.608 13.554  19.451 1.00   54.68 ? 566  ARG A NH2 1 
ATOM   183  N N   . ASP A 1 26  ? 15.008 11.078  12.947 1.00   32.10 ? 567  ASP A N   1 
ATOM   184  C CA  . ASP A 1 26  ? 13.790 10.290  12.811 1.00   32.39 ? 567  ASP A CA  1 
ATOM   185  C C   . ASP A 1 26  ? 13.915 9.032   11.963 1.00   32.14 ? 567  ASP A C   1 
ATOM   186  O O   . ASP A 1 26  ? 13.276 8.899   10.919 1.00   32.95 ? 567  ASP A O   1 
ATOM   187  C CB  . ASP A 1 26  ? 12.668 11.171  12.260 1.00   34.39 ? 567  ASP A CB  1 
ATOM   188  C CG  . ASP A 1 26  ? 12.939 11.637  10.850 1.00   37.04 ? 567  ASP A CG  1 
ATOM   189  O OD1 . ASP A 1 26  ? 14.091 12.034  10.570 1.00   36.81 ? 567  ASP A OD1 1 
ATOM   190  O OD2 . ASP A 1 26  ? 11.995 11.610  10.028 1.00   40.81 ? 567  ASP A OD2 1 
ATOM   191  N N   . ILE A 1 27  ? 14.734 8.098   12.417 1.00   31.05 ? 568  ILE A N   1 
ATOM   192  C CA  . ILE A 1 27  ? 14.906 6.852   11.694 1.00   29.98 ? 568  ILE A CA  1 
ATOM   193  C C   . ILE A 1 27  ? 13.857 5.874   12.220 1.00   29.61 ? 568  ILE A C   1 
ATOM   194  O O   . ILE A 1 27  ? 13.746 5.659   13.430 1.00   30.24 ? 568  ILE A O   1 
ATOM   195  C CB  . ILE A 1 27  ? 16.329 6.319   11.909 1.00   29.24 ? 568  ILE A CB  1 
ATOM   196  C CG1 . ILE A 1 27  ? 17.318 7.332   11.330 1.00   29.60 ? 568  ILE A CG1 1 
ATOM   197  C CG2 . ILE A 1 27  ? 16.505 4.967   11.242 1.00   28.51 ? 568  ILE A CG2 1 
ATOM   198  C CD1 . ILE A 1 27  ? 18.737 7.126   11.759 1.00   30.54 ? 568  ILE A CD1 1 
ATOM   199  N N   . PRO A 1 28  ? 13.054 5.282   11.317 1.00   28.65 ? 569  PRO A N   1 
ATOM   200  C CA  . PRO A 1 28  ? 12.014 4.330   11.731 1.00   27.46 ? 569  PRO A CA  1 
ATOM   201  C C   . PRO A 1 28  ? 12.525 3.309   12.756 1.00   26.80 ? 569  PRO A C   1 
ATOM   202  O O   . PRO A 1 28  ? 13.693 2.918   12.733 1.00   26.01 ? 569  PRO A O   1 
ATOM   203  C CB  . PRO A 1 28  ? 11.597 3.678   10.413 1.00   26.32 ? 569  PRO A CB  1 
ATOM   204  C CG  . PRO A 1 28  ? 11.829 4.758   9.414  1.00   26.74 ? 569  PRO A CG  1 
ATOM   205  C CD  . PRO A 1 28  ? 13.153 5.343   9.847  1.00   27.57 ? 569  PRO A CD  1 
ATOM   206  N N   . LEU A 1 29  ? 11.636 2.880   13.644 1.00   26.64 ? 570  LEU A N   1 
ATOM   207  C CA  . LEU A 1 29  ? 11.976 1.926   14.693 1.00   26.95 ? 570  LEU A CA  1 
ATOM   208  C C   . LEU A 1 29  ? 12.314 0.529   14.155 1.00   27.20 ? 570  LEU A C   1 
ATOM   209  O O   . LEU A 1 29  ? 12.968 -0.267  14.833 1.00   26.75 ? 570  LEU A O   1 
ATOM   210  C CB  . LEU A 1 29  ? 10.809 1.827   15.682 1.00   27.18 ? 570  LEU A CB  1 
ATOM   211  C CG  . LEU A 1 29  ? 11.052 1.502   17.163 1.00   29.36 ? 570  LEU A CG  1 
ATOM   212  C CD1 . LEU A 1 29  ? 9.700  1.410   17.855 1.00   30.06 ? 570  LEU A CD1 1 
ATOM   213  C CD2 . LEU A 1 29  ? 11.818 0.192   17.342 1.00   30.36 ? 570  LEU A CD2 1 
ATOM   214  N N   . HIS A 1 30  ? 11.899 0.233   12.930 1.00   27.26 ? 571  HIS A N   1 
ATOM   215  C CA  . HIS A 1 30  ? 12.144 -1.096  12.387 1.00   27.19 ? 571  HIS A CA  1 
ATOM   216  C C   . HIS A 1 30  ? 13.204 -1.254  11.311 1.00   25.57 ? 571  HIS A C   1 
ATOM   217  O O   . HIS A 1 30  ? 13.252 -2.290  10.644 1.00   25.32 ? 571  HIS A O   1 
ATOM   218  C CB  . HIS A 1 30  ? 10.815 -1.685  11.903 1.00   31.48 ? 571  HIS A CB  1 
ATOM   219  C CG  . HIS A 1 30  ? 9.906  -2.089  13.023 1.00   37.99 ? 571  HIS A CG  1 
ATOM   220  N ND1 . HIS A 1 30  ? 9.508  -1.210  14.010 1.00   42.44 ? 571  HIS A ND1 1 
ATOM   221  C CD2 . HIS A 1 30  ? 9.374  -3.290  13.352 1.00   39.53 ? 571  HIS A CD2 1 
ATOM   222  C CE1 . HIS A 1 30  ? 8.775  -1.854  14.901 1.00   42.99 ? 571  HIS A CE1 1 
ATOM   223  N NE2 . HIS A 1 30  ? 8.679  -3.118  14.526 1.00   43.24 ? 571  HIS A NE2 1 
ATOM   224  N N   . THR A 1 31  ? 14.069 -0.254  11.156 1.00   23.99 ? 572  THR A N   1 
ATOM   225  C CA  . THR A 1 31  ? 15.117 -0.322  10.140 1.00   22.42 ? 572  THR A CA  1 
ATOM   226  C C   . THR A 1 31  ? 16.119 -1.432  10.447 1.00   20.94 ? 572  THR A C   1 
ATOM   227  O O   . THR A 1 31  ? 16.585 -1.588  11.575 1.00   19.70 ? 572  THR A O   1 
ATOM   228  C CB  . THR A 1 31  ? 15.884 1.009   10.005 1.00   23.48 ? 572  THR A CB  1 
ATOM   229  O OG1 . THR A 1 31  ? 16.705 1.203   11.161 1.00   26.74 ? 572  THR A OG1 1 
ATOM   230  C CG2 . THR A 1 31  ? 14.914 2.173   9.871  1.00   20.57 ? 572  THR A CG2 1 
ATOM   231  N N   . THR A 1 32  ? 16.445 -2.190  9.411  1.00   20.07 ? 573  THR A N   1 
ATOM   232  C CA  . THR A 1 32  ? 17.353 -3.317  9.503  1.00   18.93 ? 573  THR A CA  1 
ATOM   233  C C   . THR A 1 32  ? 18.728 -2.983  8.925  1.00   18.90 ? 573  THR A C   1 
ATOM   234  O O   . THR A 1 32  ? 19.760 -3.455  9.417  1.00   18.35 ? 573  THR A O   1 
ATOM   235  C CB  . THR A 1 32  ? 16.709 -4.526  8.789  1.00   16.76 ? 573  THR A CB  1 
ATOM   236  O OG1 . THR A 1 32  ? 16.388 -5.516  9.766  1.00   18.83 ? 573  THR A OG1 1 
ATOM   237  C CG2 . THR A 1 32  ? 17.613 -5.109  7.726  1.00   16.80 ? 573  THR A CG2 1 
ATOM   238  N N   . GLU A 1 33  ? 18.730 -2.172  7.872  1.00   18.79 ? 574  GLU A N   1 
ATOM   239  C CA  . GLU A 1 33  ? 19.963 -1.729  7.238  1.00   18.41 ? 574  GLU A CA  1 
ATOM   240  C C   . GLU A 1 33  ? 19.915 -0.217  7.232  1.00   16.65 ? 574  GLU A C   1 
ATOM   241  O O   . GLU A 1 33  ? 18.880 0.358   6.908  1.00   15.91 ? 574  GLU A O   1 
ATOM   242  C CB  . GLU A 1 33  ? 20.052 -2.181  5.783  1.00   21.95 ? 574  GLU A CB  1 
ATOM   243  C CG  . GLU A 1 33  ? 20.184 -3.660  5.525  1.00   29.19 ? 574  GLU A CG  1 
ATOM   244  C CD  . GLU A 1 33  ? 20.506 -3.933  4.053  1.00   35.32 ? 574  GLU A CD  1 
ATOM   245  O OE1 . GLU A 1 33  ? 21.570 -3.470  3.578  1.00   37.53 ? 574  GLU A OE1 1 
ATOM   246  O OE2 . GLU A 1 33  ? 19.699 -4.598  3.368  1.00   37.39 ? 574  GLU A OE2 1 
ATOM   247  N N   . LEU A 1 34  ? 21.019 0.427   7.589  1.00   15.46 ? 575  LEU A N   1 
ATOM   248  C CA  . LEU A 1 34  ? 21.074 1.889   7.569  1.00   14.61 ? 575  LEU A CA  1 
ATOM   249  C C   . LEU A 1 34  ? 22.283 2.291   6.741  1.00   14.23 ? 575  LEU A C   1 
ATOM   250  O O   . LEU A 1 34  ? 23.423 2.083   7.156  1.00   13.76 ? 575  LEU A O   1 
ATOM   251  C CB  . LEU A 1 34  ? 21.199 2.450   8.985  1.00   14.42 ? 575  LEU A CB  1 
ATOM   252  C CG  . LEU A 1 34  ? 21.322 3.973   9.128  1.00   13.90 ? 575  LEU A CG  1 
ATOM   253  C CD1 . LEU A 1 34  ? 20.256 4.682   8.287  1.00   10.99 ? 575  LEU A CD1 1 
ATOM   254  C CD2 . LEU A 1 34  ? 21.204 4.339   10.602 1.00   9.80  ? 575  LEU A CD2 1 
ATOM   255  N N   . LEU A 1 35  ? 22.034 2.856   5.563  1.00   13.91 ? 576  LEU A N   1 
ATOM   256  C CA  . LEU A 1 35  ? 23.118 3.255   4.673  1.00   13.12 ? 576  LEU A CA  1 
ATOM   257  C C   . LEU A 1 35  ? 23.372 4.751   4.656  1.00   13.25 ? 576  LEU A C   1 
ATOM   258  O O   . LEU A 1 35  ? 22.589 5.523   4.107  1.00   14.49 ? 576  LEU A O   1 
ATOM   259  C CB  . LEU A 1 35  ? 22.816 2.764   3.271  1.00   11.97 ? 576  LEU A CB  1 
ATOM   260  C CG  . LEU A 1 35  ? 22.424 1.288   3.272  1.00   11.85 ? 576  LEU A CG  1 
ATOM   261  C CD1 . LEU A 1 35  ? 22.096 0.847   1.861  1.00   11.98 ? 576  LEU A CD1 1 
ATOM   262  C CD2 . LEU A 1 35  ? 23.562 0.458   3.830  1.00   12.84 ? 576  LEU A CD2 1 
ATOM   263  N N   . LEU A 1 36  ? 24.476 5.155   5.267  1.00   12.59 ? 577  LEU A N   1 
ATOM   264  C CA  . LEU A 1 36  ? 24.837 6.561   5.326  1.00   12.05 ? 577  LEU A CA  1 
ATOM   265  C C   . LEU A 1 36  ? 26.165 6.785   4.617  1.00   11.91 ? 577  LEU A C   1 
ATOM   266  O O   . LEU A 1 36  ? 26.991 7.587   5.038  1.00   11.93 ? 577  LEU A O   1 
ATOM   267  C CB  . LEU A 1 36  ? 24.915 7.014   6.784  1.00   10.72 ? 577  LEU A CB  1 
ATOM   268  C CG  . LEU A 1 36  ? 23.570 6.926   7.511  1.00   10.59 ? 577  LEU A CG  1 
ATOM   269  C CD1 . LEU A 1 36  ? 23.813 6.723   8.997  1.00   9.12  ? 577  LEU A CD1 1 
ATOM   270  C CD2 . LEU A 1 36  ? 22.729 8.182   7.226  1.00   8.27  ? 577  LEU A CD2 1 
ATOM   271  N N   . ASN A 1 37  ? 26.354 6.068   3.519  1.00   11.79 ? 578  ASN A N   1 
ATOM   272  C CA  . ASN A 1 37  ? 27.567 6.188   2.740  1.00   11.49 ? 578  ASN A CA  1 
ATOM   273  C C   . ASN A 1 37  ? 27.640 7.526   2.036  1.00   11.48 ? 578  ASN A C   1 
ATOM   274  O O   . ASN A 1 37  ? 26.618 8.159   1.770  1.00   10.85 ? 578  ASN A O   1 
ATOM   275  C CB  . ASN A 1 37  ? 27.619 5.080   1.700  1.00   12.01 ? 578  ASN A CB  1 
ATOM   276  C CG  . ASN A 1 37  ? 27.615 3.714   2.316  1.00   11.68 ? 578  ASN A CG  1 
ATOM   277  O OD1 . ASN A 1 37  ? 27.242 2.734   1.676  1.00   13.99 ? 578  ASN A OD1 1 
ATOM   278  N ND2 . ASN A 1 37  ? 28.036 3.632   3.566  1.00   12.43 ? 578  ASN A ND2 1 
ATOM   279  N N   . ASP A 1 38  ? 28.867 7.949   1.747  1.00   11.92 ? 579  ASP A N   1 
ATOM   280  C CA  . ASP A 1 38  ? 29.127 9.191   1.022  1.00   12.63 ? 579  ASP A CA  1 
ATOM   281  C C   . ASP A 1 38  ? 28.427 10.420  1.574  1.00   13.79 ? 579  ASP A C   1 
ATOM   282  O O   . ASP A 1 38  ? 27.696 11.105  0.856  1.00   14.07 ? 579  ASP A O   1 
ATOM   283  C CB  . ASP A 1 38  ? 28.743 9.023   -0.449 1.00   10.55 ? 579  ASP A CB  1 
ATOM   284  C CG  . ASP A 1 38  ? 29.442 7.852   -1.098 1.00   11.39 ? 579  ASP A CG  1 
ATOM   285  O OD1 . ASP A 1 38  ? 30.652 7.957   -1.370 1.00   7.75  ? 579  ASP A OD1 1 
ATOM   286  O OD2 . ASP A 1 38  ? 28.781 6.815   -1.322 1.00   12.94 ? 579  ASP A OD2 1 
ATOM   287  N N   . ASN A 1 39  ? 28.641 10.693  2.851  1.00   13.74 ? 580  ASN A N   1 
ATOM   288  C CA  . ASN A 1 39  ? 28.056 11.865  3.457  1.00   14.04 ? 580  ASN A CA  1 
ATOM   289  C C   . ASN A 1 39  ? 29.199 12.652  4.043  1.00   15.24 ? 580  ASN A C   1 
ATOM   290  O O   . ASN A 1 39  ? 30.361 12.336  3.784  1.00   14.63 ? 580  ASN A O   1 
ATOM   291  C CB  . ASN A 1 39  ? 27.042 11.481  4.520  1.00   13.31 ? 580  ASN A CB  1 
ATOM   292  C CG  . ASN A 1 39  ? 25.716 11.074  3.918  1.00   15.74 ? 580  ASN A CG  1 
ATOM   293  O OD1 . ASN A 1 39  ? 25.064 11.866  3.225  1.00   13.59 ? 580  ASN A OD1 1 
ATOM   294  N ND2 . ASN A 1 39  ? 25.309 9.835   4.170  1.00   14.71 ? 580  ASN A ND2 1 
ATOM   295  N N   . GLU A 1 40  ? 28.884 13.674  4.828  1.00   16.02 ? 581  GLU A N   1 
ATOM   296  C CA  . GLU A 1 40  ? 29.928 14.507  5.399  1.00   17.16 ? 581  GLU A CA  1 
ATOM   297  C C   . GLU A 1 40  ? 29.912 14.503  6.923  1.00   17.27 ? 581  GLU A C   1 
ATOM   298  O O   . GLU A 1 40  ? 30.389 15.444  7.562  1.00   17.51 ? 581  GLU A O   1 
ATOM   299  C CB  . GLU A 1 40  ? 29.778 15.933  4.843  1.00   18.11 ? 581  GLU A CB  1 
ATOM   300  C CG  . GLU A 1 40  ? 30.019 16.015  3.336  1.00   18.50 ? 581  GLU A CG  1 
ATOM   301  C CD  . GLU A 1 40  ? 29.606 17.342  2.713  1.00   20.77 ? 581  GLU A CD  1 
ATOM   302  O OE1 . GLU A 1 40  ? 29.925 18.410  3.275  1.00   22.44 ? 581  GLU A OE1 1 
ATOM   303  O OE2 . GLU A 1 40  ? 28.969 17.319  1.642  1.00   19.40 ? 581  GLU A OE2 1 
ATOM   304  N N   . LEU A 1 41  ? 29.387 13.420  7.491  1.00   17.16 ? 582  LEU A N   1 
ATOM   305  C CA  . LEU A 1 41  ? 29.263 13.258  8.936  1.00   16.59 ? 582  LEU A CA  1 
ATOM   306  C C   . LEU A 1 41  ? 30.395 13.798  9.829  1.00   16.18 ? 582  LEU A C   1 
ATOM   307  O O   . LEU A 1 41  ? 30.142 14.625  10.707 1.00   16.85 ? 582  LEU A O   1 
ATOM   308  C CB  . LEU A 1 41  ? 28.991 11.788  9.259  1.00   16.02 ? 582  LEU A CB  1 
ATOM   309  C CG  . LEU A 1 41  ? 27.514 11.408  9.418  1.00   16.26 ? 582  LEU A CG  1 
ATOM   310  C CD1 . LEU A 1 41  ? 26.744 11.703  8.156  1.00   17.69 ? 582  LEU A CD1 1 
ATOM   311  C CD2 . LEU A 1 41  ? 27.412 9.933   9.757  1.00   17.37 ? 582  LEU A CD2 1 
ATOM   312  N N   . GLY A 1 42  ? 31.629 13.348  9.636  1.00   15.14 ? 583  GLY A N   1 
ATOM   313  C CA  . GLY A 1 42  ? 32.698 13.863  10.477 1.00   15.33 ? 583  GLY A CA  1 
ATOM   314  C C   . GLY A 1 42  ? 33.139 12.970  11.627 1.00   15.53 ? 583  GLY A C   1 
ATOM   315  O O   . GLY A 1 42  ? 34.337 12.756  11.833 1.00   15.67 ? 583  GLY A O   1 
ATOM   316  N N   . ARG A 1 43  ? 32.183 12.465  12.395 1.00   15.73 ? 584  ARG A N   1 
ATOM   317  C CA  . ARG A 1 43  ? 32.494 11.574  13.510 1.00   16.95 ? 584  ARG A CA  1 
ATOM   318  C C   . ARG A 1 43  ? 31.196 11.077  14.117 1.00   16.73 ? 584  ARG A C   1 
ATOM   319  O O   . ARG A 1 43  ? 30.176 11.754  14.040 1.00   17.66 ? 584  ARG A O   1 
ATOM   320  C CB  . ARG A 1 43  ? 33.341 12.289  14.569 1.00   19.17 ? 584  ARG A CB  1 
ATOM   321  C CG  . ARG A 1 43  ? 32.573 13.058  15.627 1.00   20.94 ? 584  ARG A CG  1 
ATOM   322  C CD  . ARG A 1 43  ? 33.529 13.897  16.466 1.00   25.23 ? 584  ARG A CD  1 
ATOM   323  N NE  . ARG A 1 43  ? 32.841 14.600  17.547 1.00   31.42 ? 584  ARG A NE  1 
ATOM   324  C CZ  . ARG A 1 43  ? 33.327 15.656  18.202 1.00   32.23 ? 584  ARG A CZ  1 
ATOM   325  N NH1 . ARG A 1 43  ? 34.522 16.164  17.898 1.00   29.93 ? 584  ARG A NH1 1 
ATOM   326  N NH2 . ARG A 1 43  ? 32.609 16.203  19.173 1.00   31.29 ? 584  ARG A NH2 1 
ATOM   327  N N   . ILE A 1 44  ? 31.222 9.884   14.697 1.00   16.46 ? 585  ILE A N   1 
ATOM   328  C CA  . ILE A 1 44  ? 30.016 9.327   15.297 1.00   16.59 ? 585  ILE A CA  1 
ATOM   329  C C   . ILE A 1 44  ? 29.770 9.941   16.661 1.00   15.44 ? 585  ILE A C   1 
ATOM   330  O O   . ILE A 1 44  ? 30.633 9.898   17.527 1.00   15.28 ? 585  ILE A O   1 
ATOM   331  C CB  . ILE A 1 44  ? 30.125 7.802   15.443 1.00   17.09 ? 585  ILE A CB  1 
ATOM   332  C CG1 . ILE A 1 44  ? 30.439 7.187   14.078 1.00   20.32 ? 585  ILE A CG1 1 
ATOM   333  C CG2 . ILE A 1 44  ? 28.821 7.235   15.980 1.00   15.76 ? 585  ILE A CG2 1 
ATOM   334  C CD1 . ILE A 1 44  ? 30.899 5.729   14.141 1.00   24.07 ? 585  ILE A CD1 1 
ATOM   335  N N   . SER A 1 45  ? 28.589 10.523  16.838 1.00   15.78 ? 586  SER A N   1 
ATOM   336  C CA  . SER A 1 45  ? 28.222 11.155  18.103 1.00   16.37 ? 586  SER A CA  1 
ATOM   337  C C   . SER A 1 45  ? 27.744 10.135  19.129 1.00   16.20 ? 586  SER A C   1 
ATOM   338  O O   . SER A 1 45  ? 27.340 9.027   18.786 1.00   16.48 ? 586  SER A O   1 
ATOM   339  C CB  . SER A 1 45  ? 27.116 12.182  17.881 1.00   16.27 ? 586  SER A CB  1 
ATOM   340  O OG  . SER A 1 45  ? 27.536 13.171  16.963 1.00   20.19 ? 586  SER A OG  1 
ATOM   341  N N   . SER A 1 46  ? 27.792 10.511  20.398 1.00   15.80 ? 587  SER A N   1 
ATOM   342  C CA  . SER A 1 46  ? 27.350 9.608   21.438 1.00   14.73 ? 587  SER A CA  1 
ATOM   343  C C   . SER A 1 46  ? 26.040 10.118  22.015 1.00   15.29 ? 587  SER A C   1 
ATOM   344  O O   . SER A 1 46  ? 26.016 10.732  23.078 1.00   16.86 ? 587  SER A O   1 
ATOM   345  C CB  . SER A 1 46  ? 28.408 9.508   22.527 1.00   12.13 ? 587  SER A CB  1 
ATOM   346  O OG  . SER A 1 46  ? 28.059 8.519   23.468 1.00   8.83  ? 587  SER A OG  1 
ATOM   347  N N   . ASP A 1 47  ? 24.954 9.882   21.287 1.00   14.80 ? 588  ASP A N   1 
ATOM   348  C CA  . ASP A 1 47  ? 23.624 10.294  21.717 1.00   14.83 ? 588  ASP A CA  1 
ATOM   349  C C   . ASP A 1 47  ? 22.813 9.035   21.931 1.00   14.73 ? 588  ASP A C   1 
ATOM   350  O O   . ASP A 1 47  ? 21.679 9.085   22.400 1.00   14.30 ? 588  ASP A O   1 
ATOM   351  C CB  . ASP A 1 47  ? 22.947 11.164  20.658 1.00   15.73 ? 588  ASP A CB  1 
ATOM   352  C CG  . ASP A 1 47  ? 22.827 10.472  19.313 1.00   17.81 ? 588  ASP A CG  1 
ATOM   353  O OD1 . ASP A 1 47  ? 23.137 9.262   19.196 1.00   22.14 ? 588  ASP A OD1 1 
ATOM   354  O OD2 . ASP A 1 47  ? 22.410 11.146  18.358 1.00   19.15 ? 588  ASP A OD2 1 
ATOM   355  N N   . GLY A 1 48  ? 23.407 7.910   21.548 1.00   14.51 ? 589  GLY A N   1 
ATOM   356  C CA  . GLY A 1 48  ? 22.769 6.622   21.732 1.00   15.28 ? 589  GLY A CA  1 
ATOM   357  C C   . GLY A 1 48  ? 21.653 6.224   20.795 1.00   15.26 ? 589  GLY A C   1 
ATOM   358  O O   . GLY A 1 48  ? 20.797 5.421   21.171 1.00   14.36 ? 589  GLY A O   1 
ATOM   359  N N   . LEU A 1 49  ? 21.654 6.769   19.582 1.00   15.67 ? 590  LEU A N   1 
ATOM   360  C CA  . LEU A 1 49  ? 20.627 6.426   18.603 1.00   16.06 ? 590  LEU A CA  1 
ATOM   361  C C   . LEU A 1 49  ? 20.714 4.946   18.249 1.00   16.55 ? 590  LEU A C   1 
ATOM   362  O O   . LEU A 1 49  ? 19.705 4.240   18.178 1.00   16.97 ? 590  LEU A O   1 
ATOM   363  C CB  . LEU A 1 49  ? 20.811 7.255   17.334 1.00   15.81 ? 590  LEU A CB  1 
ATOM   364  C CG  . LEU A 1 49  ? 20.086 6.808   16.061 1.00   13.00 ? 590  LEU A CG  1 
ATOM   365  C CD1 . LEU A 1 49  ? 18.581 6.772   16.285 1.00   12.08 ? 590  LEU A CD1 1 
ATOM   366  C CD2 . LEU A 1 49  ? 20.432 7.770   14.947 1.00   12.59 ? 590  LEU A CD2 1 
ATOM   367  N N   . PHE A 1 50  ? 21.933 4.477   18.039 1.00   16.30 ? 591  PHE A N   1 
ATOM   368  C CA  . PHE A 1 50  ? 22.143 3.094   17.676 1.00   17.47 ? 591  PHE A CA  1 
ATOM   369  C C   . PHE A 1 50  ? 21.576 2.116   18.687 1.00   18.90 ? 591  PHE A C   1 
ATOM   370  O O   . PHE A 1 50  ? 20.862 1.184   18.320 1.00   20.09 ? 591  PHE A O   1 
ATOM   371  C CB  . PHE A 1 50  ? 23.630 2.862   17.467 1.00   16.76 ? 591  PHE A CB  1 
ATOM   372  C CG  . PHE A 1 50  ? 24.208 3.711   16.379 1.00   15.19 ? 591  PHE A CG  1 
ATOM   373  C CD1 . PHE A 1 50  ? 25.306 4.526   16.620 1.00   16.94 ? 591  PHE A CD1 1 
ATOM   374  C CD2 . PHE A 1 50  ? 23.631 3.719   15.120 1.00   12.18 ? 591  PHE A CD2 1 
ATOM   375  C CE1 . PHE A 1 50  ? 25.820 5.340   15.621 1.00   18.05 ? 591  PHE A CE1 1 
ATOM   376  C CE2 . PHE A 1 50  ? 24.134 4.527   14.114 1.00   16.14 ? 591  PHE A CE2 1 
ATOM   377  C CZ  . PHE A 1 50  ? 25.231 5.341   14.360 1.00   16.74 ? 591  PHE A CZ  1 
ATOM   378  N N   . GLY A 1 51  ? 21.883 2.324   19.961 1.00   19.57 ? 592  GLY A N   1 
ATOM   379  C CA  . GLY A 1 51  ? 21.376 1.428   20.977 1.00   19.26 ? 592  GLY A CA  1 
ATOM   380  C C   . GLY A 1 51  ? 19.875 1.571   21.102 1.00   19.81 ? 592  GLY A C   1 
ATOM   381  O O   . GLY A 1 51  ? 19.253 0.969   21.982 1.00   21.15 ? 592  GLY A O   1 
ATOM   382  N N   . ARG A 1 52  ? 19.283 2.356   20.208 1.00   19.22 ? 593  ARG A N   1 
ATOM   383  C CA  . ARG A 1 52  ? 17.843 2.608   20.241 1.00   18.11 ? 593  ARG A CA  1 
ATOM   384  C C   . ARG A 1 52  ? 17.107 2.036   19.035 1.00   16.61 ? 593  ARG A C   1 
ATOM   385  O O   . ARG A 1 52  ? 15.890 2.127   18.944 1.00   16.22 ? 593  ARG A O   1 
ATOM   386  C CB  . ARG A 1 52  ? 17.603 4.109   20.324 1.00   18.20 ? 593  ARG A CB  1 
ATOM   387  C CG  . ARG A 1 52  ? 16.240 4.498   20.776 1.00   19.40 ? 593  ARG A CG  1 
ATOM   388  C CD  . ARG A 1 52  ? 16.147 6.012   20.777 1.00   23.87 ? 593  ARG A CD  1 
ATOM   389  N NE  . ARG A 1 52  ? 17.181 6.606   21.613 1.00   22.74 ? 593  ARG A NE  1 
ATOM   390  C CZ  . ARG A 1 52  ? 17.685 7.817   21.417 1.00   25.36 ? 593  ARG A CZ  1 
ATOM   391  N NH1 . ARG A 1 52  ? 17.245 8.561   20.407 1.00   26.84 ? 593  ARG A NH1 1 
ATOM   392  N NH2 . ARG A 1 52  ? 18.633 8.277   22.220 1.00   24.92 ? 593  ARG A NH2 1 
ATOM   393  N N   . LEU A 1 53  ? 17.857 1.478   18.095 1.00   15.67 ? 594  LEU A N   1 
ATOM   394  C CA  . LEU A 1 53  ? 17.272 0.863   16.911 1.00   14.66 ? 594  LEU A CA  1 
ATOM   395  C C   . LEU A 1 53  ? 17.554 -0.611  17.106 1.00   13.74 ? 594  LEU A C   1 
ATOM   396  O O   . LEU A 1 53  ? 18.574 -1.119  16.658 1.00   13.66 ? 594  LEU A O   1 
ATOM   397  C CB  . LEU A 1 53  ? 17.949 1.382   15.642 1.00   14.44 ? 594  LEU A CB  1 
ATOM   398  C CG  . LEU A 1 53  ? 17.737 2.873   15.362 1.00   13.60 ? 594  LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 53  ? 18.519 3.278   14.117 1.00   11.60 ? 594  LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 53  ? 16.252 3.160   15.191 1.00   10.42 ? 594  LEU A CD2 1 
ATOM   401  N N   . PRO A 1 54  ? 16.641 -1.312  17.794 1.00   13.56 ? 595  PRO A N   1 
ATOM   402  C CA  . PRO A 1 54  ? 16.694 -2.737  18.127 1.00   13.27 ? 595  PRO A CA  1 
ATOM   403  C C   . PRO A 1 54  ? 16.740 -3.744  16.975 1.00   14.37 ? 595  PRO A C   1 
ATOM   404  O O   . PRO A 1 54  ? 16.992 -4.926  17.199 1.00   14.56 ? 595  PRO A O   1 
ATOM   405  C CB  . PRO A 1 54  ? 15.466 -2.916  19.012 1.00   10.22 ? 595  PRO A CB  1 
ATOM   406  C CG  . PRO A 1 54  ? 14.495 -1.966  18.415 1.00   10.28 ? 595  PRO A CG  1 
ATOM   407  C CD  . PRO A 1 54  ? 15.338 -0.739  18.184 1.00   12.37 ? 595  PRO A CD  1 
ATOM   408  N N   . HIS A 1 55  ? 16.514 -3.294  15.746 1.00   14.77 ? 596  HIS A N   1 
ATOM   409  C CA  . HIS A 1 55  ? 16.540 -4.219  14.622 1.00   15.27 ? 596  HIS A CA  1 
ATOM   410  C C   . HIS A 1 55  ? 17.659 -3.949  13.623 1.00   15.18 ? 596  HIS A C   1 
ATOM   411  O O   . HIS A 1 55  ? 17.737 -4.612  12.581 1.00   15.60 ? 596  HIS A O   1 
ATOM   412  C CB  . HIS A 1 55  ? 15.201 -4.184  13.905 1.00   15.79 ? 596  HIS A CB  1 
ATOM   413  C CG  . HIS A 1 55  ? 14.045 -4.518  14.786 1.00   16.05 ? 596  HIS A CG  1 
ATOM   414  N ND1 . HIS A 1 55  ? 13.844 -5.779  15.298 1.00   17.99 ? 596  HIS A ND1 1 
ATOM   415  C CD2 . HIS A 1 55  ? 13.027 -3.756  15.247 1.00   19.15 ? 596  HIS A CD2 1 
ATOM   416  C CE1 . HIS A 1 55  ? 12.749 -5.782  16.035 1.00   18.51 ? 596  HIS A CE1 1 
ATOM   417  N NE2 . HIS A 1 55  ? 12.234 -4.566  16.021 1.00   19.39 ? 596  HIS A NE2 1 
ATOM   418  N N   . LEU A 1 56  ? 18.520 -2.987  13.945 1.00   14.11 ? 597  LEU A N   1 
ATOM   419  C CA  . LEU A 1 56  ? 19.632 -2.624  13.079 1.00   14.09 ? 597  LEU A CA  1 
ATOM   420  C C   . LEU A 1 56  ? 20.699 -3.703  13.143 1.00   14.24 ? 597  LEU A C   1 
ATOM   421  O O   . LEU A 1 56  ? 21.235 -3.981  14.211 1.00   14.42 ? 597  LEU A O   1 
ATOM   422  C CB  . LEU A 1 56  ? 20.225 -1.292  13.528 1.00   14.58 ? 597  LEU A CB  1 
ATOM   423  C CG  . LEU A 1 56  ? 21.176 -0.551  12.587 1.00   14.03 ? 597  LEU A CG  1 
ATOM   424  C CD1 . LEU A 1 56  ? 20.400 -0.002  11.397 1.00   14.93 ? 597  LEU A CD1 1 
ATOM   425  C CD2 . LEU A 1 56  ? 21.830 0.597   13.348 1.00   13.05 ? 597  LEU A CD2 1 
ATOM   426  N N   . VAL A 1 57  ? 21.010 -4.305  11.999 1.00   14.14 ? 598  VAL A N   1 
ATOM   427  C CA  . VAL A 1 57  ? 22.004 -5.361  11.946 1.00   13.38 ? 598  VAL A CA  1 
ATOM   428  C C   . VAL A 1 57  ? 23.203 -4.963  11.096 1.00   14.42 ? 598  VAL A C   1 
ATOM   429  O O   . VAL A 1 57  ? 24.319 -5.432  11.334 1.00   14.81 ? 598  VAL A O   1 
ATOM   430  C CB  . VAL A 1 57  ? 21.386 -6.669  11.400 1.00   12.73 ? 598  VAL A CB  1 
ATOM   431  C CG1 . VAL A 1 57  ? 20.104 -6.954  12.131 1.00   13.91 ? 598  VAL A CG1 1 
ATOM   432  C CG2 . VAL A 1 57  ? 21.115 -6.567  9.907  1.00   11.82 ? 598  VAL A CG2 1 
ATOM   433  N N   . LYS A 1 58  ? 22.977 -4.098  10.108 1.00   15.24 ? 599  LYS A N   1 
ATOM   434  C CA  . LYS A 1 58  ? 24.055 -3.633  9.230  1.00   16.59 ? 599  LYS A CA  1 
ATOM   435  C C   . LYS A 1 58  ? 24.070 -2.111  9.164  1.00   16.33 ? 599  LYS A C   1 
ATOM   436  O O   . LYS A 1 58  ? 23.040 -1.478  8.928  1.00   16.95 ? 599  LYS A O   1 
ATOM   437  C CB  . LYS A 1 58  ? 23.896 -4.187  7.809  1.00   19.52 ? 599  LYS A CB  1 
ATOM   438  C CG  . LYS A 1 58  ? 25.028 -3.753  6.868  1.00   24.52 ? 599  LYS A CG  1 
ATOM   439  C CD  . LYS A 1 58  ? 24.607 -3.697  5.394  1.00   27.34 ? 599  LYS A CD  1 
ATOM   440  C CE  . LYS A 1 58  ? 24.212 -5.063  4.857  1.00   31.61 ? 599  LYS A CE  1 
ATOM   441  N NZ  . LYS A 1 58  ? 23.839 -5.023  3.415  1.00   30.98 ? 599  LYS A NZ  1 
ATOM   442  N N   . LEU A 1 59  ? 25.243 -1.525  9.368  1.00   15.90 ? 600  LEU A N   1 
ATOM   443  C CA  . LEU A 1 59  ? 25.384 -0.074  9.337  1.00   15.46 ? 600  LEU A CA  1 
ATOM   444  C C   . LEU A 1 59  ? 26.543 0.317   8.438  1.00   15.35 ? 600  LEU A C   1 
ATOM   445  O O   . LEU A 1 59  ? 27.668 -0.140  8.632  1.00   15.78 ? 600  LEU A O   1 
ATOM   446  C CB  . LEU A 1 59  ? 25.620 0.452   10.749 1.00   15.05 ? 600  LEU A CB  1 
ATOM   447  C CG  . LEU A 1 59  ? 25.862 1.949   10.919 1.00   13.95 ? 600  LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 59  ? 24.689 2.759   10.378 1.00   12.04 ? 600  LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 59  ? 26.074 2.218   12.396 1.00   13.26 ? 600  LEU A CD2 1 
ATOM   450  N N   . GLU A 1 60  ? 26.273 1.162   7.451  1.00   14.59 ? 601  GLU A N   1 
ATOM   451  C CA  . GLU A 1 60  ? 27.319 1.578   6.527  1.00   13.99 ? 601  GLU A CA  1 
ATOM   452  C C   . GLU A 1 60  ? 27.623 3.067   6.584  1.00   12.99 ? 601  GLU A C   1 
ATOM   453  O O   . GLU A 1 60  ? 26.766 3.912   6.324  1.00   13.00 ? 601  GLU A O   1 
ATOM   454  C CB  . GLU A 1 60  ? 26.962 1.138   5.102  1.00   14.36 ? 601  GLU A CB  1 
ATOM   455  C CG  . GLU A 1 60  ? 27.071 -0.374  4.942  1.00   16.75 ? 601  GLU A CG  1 
ATOM   456  C CD  . GLU A 1 60  ? 26.889 -0.861  3.514  1.00   18.51 ? 601  GLU A CD  1 
ATOM   457  O OE1 . GLU A 1 60  ? 27.271 -0.128  2.572  1.00   17.55 ? 601  GLU A OE1 1 
ATOM   458  O OE2 . GLU A 1 60  ? 26.380 -1.994  3.339  1.00   19.29 ? 601  GLU A OE2 1 
ATOM   459  N N   . LEU A 1 61  ? 28.863 3.373   6.939  1.00   11.71 ? 602  LEU A N   1 
ATOM   460  C CA  . LEU A 1 61  ? 29.298 4.747   7.052  1.00   11.93 ? 602  LEU A CA  1 
ATOM   461  C C   . LEU A 1 61  ? 30.578 4.958   6.267  1.00   11.93 ? 602  LEU A C   1 
ATOM   462  O O   . LEU A 1 61  ? 31.488 5.639   6.740  1.00   12.46 ? 602  LEU A O   1 
ATOM   463  C CB  . LEU A 1 61  ? 29.534 5.099   8.525  1.00   11.99 ? 602  LEU A CB  1 
ATOM   464  C CG  . LEU A 1 61  ? 28.317 5.124   9.458  1.00   12.04 ? 602  LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 61  ? 28.760 4.885   10.898 1.00   10.74 ? 602  LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 61  ? 27.603 6.452   9.325  1.00   9.80  ? 602  LEU A CD2 1 
ATOM   467  N N   . LYS A 1 62  ? 30.656 4.385   5.073  1.00   11.70 ? 603  LYS A N   1 
ATOM   468  C CA  . LYS A 1 62  ? 31.861 4.527   4.257  1.00   13.08 ? 603  LYS A CA  1 
ATOM   469  C C   . LYS A 1 62  ? 31.993 5.906   3.645  1.00   14.51 ? 603  LYS A C   1 
ATOM   470  O O   . LYS A 1 62  ? 30.997 6.608   3.428  1.00   14.98 ? 603  LYS A O   1 
ATOM   471  C CB  . LYS A 1 62  ? 31.893 3.480   3.139  1.00   11.83 ? 603  LYS A CB  1 
ATOM   472  C CG  . LYS A 1 62  ? 31.992 2.072   3.648  1.00   11.74 ? 603  LYS A CG  1 
ATOM   473  C CD  . LYS A 1 62  ? 31.021 1.165   2.934  1.00   11.23 ? 603  LYS A CD  1 
ATOM   474  C CE  . LYS A 1 62  ? 31.441 0.932   1.517  1.00   13.00 ? 603  LYS A CE  1 
ATOM   475  N NZ  . LYS A 1 62  ? 30.625 -0.142  0.897  1.00   16.16 ? 603  LYS A NZ  1 
ATOM   476  N N   . ARG A 1 63  ? 33.241 6.276   3.364  1.00   15.28 ? 604  ARG A N   1 
ATOM   477  C CA  . ARG A 1 63  ? 33.576 7.559   2.764  1.00   14.92 ? 604  ARG A CA  1 
ATOM   478  C C   . ARG A 1 63  ? 32.785 8.686   3.420  1.00   14.74 ? 604  ARG A C   1 
ATOM   479  O O   . ARG A 1 63  ? 31.892 9.272   2.814  1.00   15.30 ? 604  ARG A O   1 
ATOM   480  C CB  . ARG A 1 63  ? 33.318 7.492   1.254  1.00   13.72 ? 604  ARG A CB  1 
ATOM   481  C CG  . ARG A 1 63  ? 34.139 6.395   0.546  1.00   15.94 ? 604  ARG A CG  1 
ATOM   482  C CD  . ARG A 1 63  ? 33.906 6.382   -0.969 1.00   15.61 ? 604  ARG A CD  1 
ATOM   483  N NE  . ARG A 1 63  ? 32.517 6.063   -1.275 1.00   18.26 ? 604  ARG A NE  1 
ATOM   484  C CZ  . ARG A 1 63  ? 32.044 4.831   -1.428 1.00   19.24 ? 604  ARG A CZ  1 
ATOM   485  N NH1 . ARG A 1 63  ? 32.852 3.785   -1.324 1.00   18.52 ? 604  ARG A NH1 1 
ATOM   486  N NH2 . ARG A 1 63  ? 30.750 4.648   -1.643 1.00   18.37 ? 604  ARG A NH2 1 
ATOM   487  N N   . ASN A 1 64  ? 33.133 8.985   4.667  1.00   15.10 ? 605  ASN A N   1 
ATOM   488  C CA  . ASN A 1 64  ? 32.456 10.026  5.438  1.00   15.77 ? 605  ASN A CA  1 
ATOM   489  C C   . ASN A 1 64  ? 33.412 11.002  6.108  1.00   16.93 ? 605  ASN A C   1 
ATOM   490  O O   . ASN A 1 64  ? 32.995 11.838  6.908  1.00   17.68 ? 605  ASN A O   1 
ATOM   491  C CB  . ASN A 1 64  ? 31.589 9.379   6.520  1.00   13.05 ? 605  ASN A CB  1 
ATOM   492  C CG  . ASN A 1 64  ? 30.131 9.352   6.155  1.00   10.35 ? 605  ASN A CG  1 
ATOM   493  O OD1 . ASN A 1 64  ? 29.453 10.375  6.225  1.00   12.30 ? 605  ASN A OD1 1 
ATOM   494  N ND2 . ASN A 1 64  ? 29.634 8.182   5.759  1.00   5.00  ? 605  ASN A ND2 1 
ATOM   495  N N   . GLN A 1 65  ? 34.693 10.900  5.799  1.00   18.84 ? 606  GLN A N   1 
ATOM   496  C CA  . GLN A 1 65  ? 35.675 11.784  6.424  1.00   21.23 ? 606  GLN A CA  1 
ATOM   497  C C   . GLN A 1 65  ? 35.653 11.660  7.948  1.00   21.15 ? 606  GLN A C   1 
ATOM   498  O O   . GLN A 1 65  ? 35.894 12.637  8.659  1.00   20.98 ? 606  GLN A O   1 
ATOM   499  C CB  . GLN A 1 65  ? 35.402 13.236  6.063  1.00   24.32 ? 606  GLN A CB  1 
ATOM   500  C CG  . GLN A 1 65  ? 35.051 13.467  4.613  1.00   29.38 ? 606  GLN A CG  1 
ATOM   501  C CD  . GLN A 1 65  ? 35.228 14.914  4.230  1.00   32.48 ? 606  GLN A CD  1 
ATOM   502  O OE1 . GLN A 1 65  ? 36.333 15.341  3.874  1.00   33.65 ? 606  GLN A OE1 1 
ATOM   503  N NE2 . GLN A 1 65  ? 34.148 15.691  4.324  1.00   32.41 ? 606  GLN A NE2 1 
ATOM   504  N N   . LEU A 1 66  ? 35.348 10.465  8.444  1.00   21.25 ? 607  LEU A N   1 
ATOM   505  C CA  . LEU A 1 66  ? 35.319 10.230  9.876  1.00   21.12 ? 607  LEU A CA  1 
ATOM   506  C C   . LEU A 1 66  ? 36.724 10.240  10.449 1.00   21.98 ? 607  LEU A C   1 
ATOM   507  O O   . LEU A 1 66  ? 37.617 9.548   9.953  1.00   20.92 ? 607  LEU A O   1 
ATOM   508  C CB  . LEU A 1 66  ? 34.694 8.879   10.199 1.00   18.51 ? 607  LEU A CB  1 
ATOM   509  C CG  . LEU A 1 66  ? 33.201 8.704   10.006 1.00   16.72 ? 607  LEU A CG  1 
ATOM   510  C CD1 . LEU A 1 66  ? 32.830 7.329   10.528 1.00   17.11 ? 607  LEU A CD1 1 
ATOM   511  C CD2 . LEU A 1 66  ? 32.437 9.785   10.738 1.00   12.58 ? 607  LEU A CD2 1 
ATOM   512  N N   . THR A 1 67  ? 36.905 11.031  11.501 1.00   23.28 ? 608  THR A N   1 
ATOM   513  C CA  . THR A 1 67  ? 38.184 11.125  12.185 1.00   24.04 ? 608  THR A CA  1 
ATOM   514  C C   . THR A 1 67  ? 37.956 10.820  13.659 1.00   24.56 ? 608  THR A C   1 
ATOM   515  O O   . THR A 1 67  ? 38.597 11.411  14.524 1.00   25.53 ? 608  THR A O   1 
ATOM   516  C CB  . THR A 1 67  ? 38.784 12.524  12.057 1.00   25.35 ? 608  THR A CB  1 
ATOM   517  O OG1 . THR A 1 67  ? 37.882 13.483  12.629 1.00   27.58 ? 608  THR A OG1 1 
ATOM   518  C CG2 . THR A 1 67  ? 39.034 12.860  10.583 1.00   25.81 ? 608  THR A CG2 1 
ATOM   519  N N   . GLY A 1 68  ? 37.027 9.905   13.939 1.00   24.61 ? 609  GLY A N   1 
ATOM   520  C CA  . GLY A 1 68  ? 36.746 9.538   15.312 1.00   23.79 ? 609  GLY A CA  1 
ATOM   521  C C   . GLY A 1 68  ? 35.310 9.160   15.620 1.00   23.71 ? 609  GLY A C   1 
ATOM   522  O O   . GLY A 1 68  ? 34.392 9.431   14.844 1.00   23.08 ? 609  GLY A O   1 
ATOM   523  N N   . ILE A 1 69  ? 35.133 8.530   16.782 1.00   24.01 ? 610  ILE A N   1 
ATOM   524  C CA  . ILE A 1 69  ? 33.833 8.078   17.277 1.00   23.70 ? 610  ILE A CA  1 
ATOM   525  C C   . ILE A 1 69  ? 33.739 8.418   18.765 1.00   24.05 ? 610  ILE A C   1 
ATOM   526  O O   . ILE A 1 69  ? 34.561 7.955   19.550 1.00   24.54 ? 610  ILE A O   1 
ATOM   527  C CB  . ILE A 1 69  ? 33.697 6.551   17.140 1.00   22.42 ? 610  ILE A CB  1 
ATOM   528  C CG1 . ILE A 1 69  ? 34.055 6.124   15.720 1.00   21.52 ? 610  ILE A CG1 1 
ATOM   529  C CG2 . ILE A 1 69  ? 32.286 6.120   17.479 1.00   21.43 ? 610  ILE A CG2 1 
ATOM   530  C CD1 . ILE A 1 69  ? 34.175 4.634   15.550 1.00   20.74 ? 610  ILE A CD1 1 
ATOM   531  N N   . GLU A 1 70  ? 32.755 9.219   19.161 1.00   24.55 ? 611  GLU A N   1 
ATOM   532  C CA  . GLU A 1 70  ? 32.613 9.571   20.578 1.00   25.85 ? 611  GLU A CA  1 
ATOM   533  C C   . GLU A 1 70  ? 32.466 8.322   21.453 1.00   25.38 ? 611  GLU A C   1 
ATOM   534  O O   . GLU A 1 70  ? 31.874 7.321   21.042 1.00   25.89 ? 611  GLU A O   1 
ATOM   535  C CB  . GLU A 1 70  ? 31.400 10.479  20.808 1.00   28.46 ? 611  GLU A CB  1 
ATOM   536  C CG  . GLU A 1 70  ? 31.511 11.882  20.237 1.00   32.73 ? 611  GLU A CG  1 
ATOM   537  C CD  . GLU A 1 70  ? 30.612 12.873  20.978 1.00   40.46 ? 611  GLU A CD  1 
ATOM   538  O OE1 . GLU A 1 70  ? 29.387 12.614  21.120 1.00   40.99 ? 611  GLU A OE1 1 
ATOM   539  O OE2 . GLU A 1 70  ? 31.137 13.919  21.425 1.00   43.90 ? 611  GLU A OE2 1 
ATOM   540  N N   . PRO A 1 71  ? 32.987 8.373   22.686 1.00   25.00 ? 612  PRO A N   1 
ATOM   541  C CA  . PRO A 1 71  ? 32.907 7.231   23.609 1.00   24.12 ? 612  PRO A CA  1 
ATOM   542  C C   . PRO A 1 71  ? 31.476 6.786   23.928 1.00   23.59 ? 612  PRO A C   1 
ATOM   543  O O   . PRO A 1 71  ? 30.569 7.613   24.028 1.00   24.40 ? 612  PRO A O   1 
ATOM   544  C CB  . PRO A 1 71  ? 33.629 7.747   24.857 1.00   22.86 ? 612  PRO A CB  1 
ATOM   545  C CG  . PRO A 1 71  ? 34.565 8.793   24.319 1.00   21.70 ? 612  PRO A CG  1 
ATOM   546  C CD  . PRO A 1 71  ? 33.693 9.504   23.316 1.00   24.04 ? 612  PRO A CD  1 
ATOM   547  N N   . ASN A 1 72  ? 31.283 5.481   24.094 1.00   22.72 ? 613  ASN A N   1 
ATOM   548  C CA  . ASN A 1 72  ? 29.973 4.926   24.433 1.00   21.72 ? 613  ASN A CA  1 
ATOM   549  C C   . ASN A 1 72  ? 28.889 5.192   23.400 1.00   21.48 ? 613  ASN A C   1 
ATOM   550  O O   . ASN A 1 72  ? 27.708 5.253   23.750 1.00   21.60 ? 613  ASN A O   1 
ATOM   551  C CB  . ASN A 1 72  ? 29.481 5.482   25.775 1.00   21.87 ? 613  ASN A CB  1 
ATOM   552  C CG  . ASN A 1 72  ? 30.514 5.368   26.884 1.00   22.04 ? 613  ASN A CG  1 
ATOM   553  O OD1 . ASN A 1 72  ? 31.091 4.298   27.118 1.00   20.71 ? 613  ASN A OD1 1 
ATOM   554  N ND2 . ASN A 1 72  ? 30.744 6.475   27.584 1.00   19.88 ? 613  ASN A ND2 1 
ATOM   555  N N   . ALA A 1 73  ? 29.271 5.348   22.136 1.00   21.00 ? 614  ALA A N   1 
ATOM   556  C CA  . ALA A 1 73  ? 28.291 5.615   21.084 1.00   20.00 ? 614  ALA A CA  1 
ATOM   557  C C   . ALA A 1 73  ? 27.555 4.359   20.622 1.00   19.32 ? 614  ALA A C   1 
ATOM   558  O O   . ALA A 1 73  ? 26.473 4.454   20.047 1.00   19.60 ? 614  ALA A O   1 
ATOM   559  C CB  . ALA A 1 73  ? 28.965 6.288   19.895 1.00   18.76 ? 614  ALA A CB  1 
ATOM   560  N N   . PHE A 1 74  ? 28.135 3.188   20.866 1.00   18.82 ? 615  PHE A N   1 
ATOM   561  C CA  . PHE A 1 74  ? 27.502 1.935   20.459 1.00   18.99 ? 615  PHE A CA  1 
ATOM   562  C C   . PHE A 1 74  ? 27.039 1.147   21.671 1.00   20.30 ? 615  PHE A C   1 
ATOM   563  O O   . PHE A 1 74  ? 26.909 -0.075  21.626 1.00   20.05 ? 615  PHE A O   1 
ATOM   564  C CB  . PHE A 1 74  ? 28.462 1.084   19.627 1.00   15.26 ? 615  PHE A CB  1 
ATOM   565  C CG  . PHE A 1 74  ? 28.776 1.670   18.288 1.00   11.87 ? 615  PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 74  ? 27.827 1.661   17.274 1.00   13.15 ? 615  PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 74  ? 30.010 2.257   18.046 1.00   10.87 ? 615  PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 74  ? 28.102 2.233   16.029 1.00   12.95 ? 615  PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 74  ? 30.298 2.833   16.812 1.00   11.53 ? 615  PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 74  ? 29.342 2.821   15.800 1.00   12.75 ? 615  PHE A CZ  1 
ATOM   571  N N   . GLU A 1 75  ? 26.791 1.864   22.759 1.00   21.58 ? 616  GLU A N   1 
ATOM   572  C CA  . GLU A 1 75  ? 26.330 1.246   23.986 1.00   22.47 ? 616  GLU A CA  1 
ATOM   573  C C   . GLU A 1 75  ? 24.868 0.872   23.806 1.00   22.68 ? 616  GLU A C   1 
ATOM   574  O O   . GLU A 1 75  ? 24.057 1.699   23.380 1.00   23.56 ? 616  GLU A O   1 
ATOM   575  C CB  . GLU A 1 75  ? 26.455 2.225   25.141 1.00   26.26 ? 616  GLU A CB  1 
ATOM   576  C CG  . GLU A 1 75  ? 26.189 1.605   26.491 1.00   33.65 ? 616  GLU A CG  1 
ATOM   577  C CD  . GLU A 1 75  ? 27.379 0.824   26.986 1.00   39.45 ? 616  GLU A CD  1 
ATOM   578  O OE1 . GLU A 1 75  ? 28.451 1.453   27.153 1.00   41.76 ? 616  GLU A OE1 1 
ATOM   579  O OE2 . GLU A 1 75  ? 27.245 -0.405  27.204 1.00   42.22 ? 616  GLU A OE2 1 
ATOM   580  N N   . GLY A 1 76  ? 24.534 -0.372  24.134 1.00   21.91 ? 617  GLY A N   1 
ATOM   581  C CA  . GLY A 1 76  ? 23.167 -0.832  24.002 1.00   20.60 ? 617  GLY A CA  1 
ATOM   582  C C   . GLY A 1 76  ? 22.852 -1.337  22.610 1.00   20.84 ? 617  GLY A C   1 
ATOM   583  O O   . GLY A 1 76  ? 21.726 -1.738  22.343 1.00   21.49 ? 617  GLY A O   1 
ATOM   584  N N   . ALA A 1 77  ? 23.838 -1.329  21.720 1.00   20.62 ? 618  ALA A N   1 
ATOM   585  C CA  . ALA A 1 77  ? 23.626 -1.791  20.354 1.00   20.56 ? 618  ALA A CA  1 
ATOM   586  C C   . ALA A 1 77  ? 24.170 -3.200  20.104 1.00   20.51 ? 618  ALA A C   1 
ATOM   587  O O   . ALA A 1 77  ? 24.973 -3.413  19.203 1.00   21.10 ? 618  ALA A O   1 
ATOM   588  C CB  . ALA A 1 77  ? 24.256 -0.804  19.377 1.00   20.09 ? 618  ALA A CB  1 
ATOM   589  N N   . SER A 1 78  ? 23.719 -4.165  20.895 1.00   20.68 ? 619  SER A N   1 
ATOM   590  C CA  . SER A 1 78  ? 24.176 -5.546  20.752 1.00   20.16 ? 619  SER A CA  1 
ATOM   591  C C   . SER A 1 78  ? 23.545 -6.206  19.533 1.00   20.06 ? 619  SER A C   1 
ATOM   592  O O   . SER A 1 78  ? 23.816 -7.369  19.228 1.00   20.23 ? 619  SER A O   1 
ATOM   593  C CB  . SER A 1 78  ? 23.837 -6.352  22.015 1.00   19.57 ? 619  SER A CB  1 
ATOM   594  O OG  . SER A 1 78  ? 22.442 -6.339  22.286 1.00   18.38 ? 619  SER A OG  1 
ATOM   595  N N   . HIS A 1 79  ? 22.701 -5.456  18.834 1.00   19.53 ? 620  HIS A N   1 
ATOM   596  C CA  . HIS A 1 79  ? 22.034 -5.981  17.653 1.00   18.21 ? 620  HIS A CA  1 
ATOM   597  C C   . HIS A 1 79  ? 22.915 -5.924  16.408 1.00   17.48 ? 620  HIS A C   1 
ATOM   598  O O   . HIS A 1 79  ? 22.928 -6.858  15.615 1.00   18.38 ? 620  HIS A O   1 
ATOM   599  C CB  . HIS A 1 79  ? 20.723 -5.225  17.409 1.00   17.03 ? 620  HIS A CB  1 
ATOM   600  C CG  . HIS A 1 79  ? 20.762 -3.787  17.834 1.00   18.97 ? 620  HIS A CG  1 
ATOM   601  N ND1 . HIS A 1 79  ? 20.159 -3.336  18.991 1.00   19.10 ? 620  HIS A ND1 1 
ATOM   602  C CD2 . HIS A 1 79  ? 21.311 -2.696  17.247 1.00   18.14 ? 620  HIS A CD2 1 
ATOM   603  C CE1 . HIS A 1 79  ? 20.331 -2.029  19.095 1.00   20.19 ? 620  HIS A CE1 1 
ATOM   604  N NE2 . HIS A 1 79  ? 21.027 -1.616  18.050 1.00   20.05 ? 620  HIS A NE2 1 
ATOM   605  N N   . ILE A 1 80  ? 23.662 -4.838  16.245 1.00   16.67 ? 621  ILE A N   1 
ATOM   606  C CA  . ILE A 1 80  ? 24.526 -4.664  15.079 1.00   15.85 ? 621  ILE A CA  1 
ATOM   607  C C   . ILE A 1 80  ? 25.475 -5.841  14.818 1.00   16.37 ? 621  ILE A C   1 
ATOM   608  O O   . ILE A 1 80  ? 26.096 -6.368  15.742 1.00   17.47 ? 621  ILE A O   1 
ATOM   609  C CB  . ILE A 1 80  ? 25.334 -3.366  15.211 1.00   13.56 ? 621  ILE A CB  1 
ATOM   610  C CG1 . ILE A 1 80  ? 24.367 -2.184  15.333 1.00   11.49 ? 621  ILE A CG1 1 
ATOM   611  C CG2 . ILE A 1 80  ? 26.252 -3.193  14.011 1.00   13.24 ? 621  ILE A CG2 1 
ATOM   612  C CD1 . ILE A 1 80  ? 25.045 -0.831  15.456 1.00   7.89  ? 621  ILE A CD1 1 
ATOM   613  N N   . GLN A 1 81  ? 25.588 -6.254  13.557 1.00   15.54 ? 622  GLN A N   1 
ATOM   614  C CA  . GLN A 1 81  ? 26.454 -7.378  13.221 1.00   15.89 ? 622  GLN A CA  1 
ATOM   615  C C   . GLN A 1 81  ? 27.453 -7.054  12.134 1.00   15.40 ? 622  GLN A C   1 
ATOM   616  O O   . GLN A 1 81  ? 28.433 -7.771  11.950 1.00   15.03 ? 622  GLN A O   1 
ATOM   617  C CB  . GLN A 1 81  ? 25.618 -8.574  12.793 1.00   16.75 ? 622  GLN A CB  1 
ATOM   618  C CG  . GLN A 1 81  ? 24.543 -8.919  13.796 1.00   21.40 ? 622  GLN A CG  1 
ATOM   619  C CD  . GLN A 1 81  ? 23.828 -10.203 13.462 1.00   24.69 ? 622  GLN A CD  1 
ATOM   620  O OE1 . GLN A 1 81  ? 24.389 -11.298 13.589 1.00   27.81 ? 622  GLN A OE1 1 
ATOM   621  N NE2 . GLN A 1 81  ? 22.580 -10.081 13.022 1.00   26.04 ? 622  GLN A NE2 1 
ATOM   622  N N   . GLU A 1 82  ? 27.203 -5.967  11.416 1.00   15.11 ? 623  GLU A N   1 
ATOM   623  C CA  . GLU A 1 82  ? 28.093 -5.555  10.349 1.00   14.84 ? 623  GLU A CA  1 
ATOM   624  C C   . GLU A 1 82  ? 28.312 -4.049  10.350 1.00   14.59 ? 623  GLU A C   1 
ATOM   625  O O   . GLU A 1 82  ? 27.358 -3.273  10.287 1.00   14.76 ? 623  GLU A O   1 
ATOM   626  C CB  . GLU A 1 82  ? 27.525 -5.988  9.009  1.00   16.43 ? 623  GLU A CB  1 
ATOM   627  C CG  . GLU A 1 82  ? 28.255 -5.386  7.846  1.00   22.43 ? 623  GLU A CG  1 
ATOM   628  C CD  . GLU A 1 82  ? 27.908 -6.063  6.558  1.00   24.92 ? 623  GLU A CD  1 
ATOM   629  O OE1 . GLU A 1 82  ? 28.296 -7.238  6.406  1.00   23.96 ? 623  GLU A OE1 1 
ATOM   630  O OE2 . GLU A 1 82  ? 27.244 -5.422  5.711  1.00   28.26 ? 623  GLU A OE2 1 
ATOM   631  N N   . LEU A 1 83  ? 29.573 -3.635  10.407 1.00   13.67 ? 624  LEU A N   1 
ATOM   632  C CA  . LEU A 1 83  ? 29.891 -2.217  10.426 1.00   12.69 ? 624  LEU A CA  1 
ATOM   633  C C   . LEU A 1 83  ? 30.924 -1.870  9.377  1.00   12.53 ? 624  LEU A C   1 
ATOM   634  O O   . LEU A 1 83  ? 32.077 -2.280  9.460  1.00   12.98 ? 624  LEU A O   1 
ATOM   635  C CB  . LEU A 1 83  ? 30.383 -1.812  11.809 1.00   11.06 ? 624  LEU A CB  1 
ATOM   636  C CG  . LEU A 1 83  ? 30.509 -0.325  12.115 1.00   10.14 ? 624  LEU A CG  1 
ATOM   637  C CD1 . LEU A 1 83  ? 29.258 0.439   11.717 1.00   9.24  ? 624  LEU A CD1 1 
ATOM   638  C CD2 . LEU A 1 83  ? 30.754 -0.186  13.599 1.00   11.14 ? 624  LEU A CD2 1 
ATOM   639  N N   . GLN A 1 84  ? 30.479 -1.110  8.382  1.00   12.35 ? 625  GLN A N   1 
ATOM   640  C CA  . GLN A 1 84  ? 31.306 -0.673  7.272  1.00   11.09 ? 625  GLN A CA  1 
ATOM   641  C C   . GLN A 1 84  ? 31.866 0.703   7.540  1.00   10.61 ? 625  GLN A C   1 
ATOM   642  O O   . GLN A 1 84  ? 31.155 1.700   7.421  1.00   10.60 ? 625  GLN A O   1 
ATOM   643  C CB  . GLN A 1 84  ? 30.475 -0.631  5.995  1.00   11.19 ? 625  GLN A CB  1 
ATOM   644  C CG  . GLN A 1 84  ? 30.142 -1.989  5.460  1.00   12.49 ? 625  GLN A CG  1 
ATOM   645  C CD  . GLN A 1 84  ? 31.383 -2.818  5.249  1.00   13.97 ? 625  GLN A CD  1 
ATOM   646  O OE1 . GLN A 1 84  ? 32.376 -2.338  4.691  1.00   15.92 ? 625  GLN A OE1 1 
ATOM   647  N NE2 . GLN A 1 84  ? 31.339 -4.070  5.684  1.00   14.50 ? 625  GLN A NE2 1 
ATOM   648  N N   . LEU A 1 85  ? 33.144 0.755   7.891  1.00   10.07 ? 626  LEU A N   1 
ATOM   649  C CA  . LEU A 1 85  ? 33.796 2.022   8.186  1.00   10.10 ? 626  LEU A CA  1 
ATOM   650  C C   . LEU A 1 85  ? 34.937 2.314   7.232  1.00   10.08 ? 626  LEU A C   1 
ATOM   651  O O   . LEU A 1 85  ? 35.783 3.149   7.526  1.00   9.94  ? 626  LEU A O   1 
ATOM   652  C CB  . LEU A 1 85  ? 34.322 2.003   9.622  1.00   9.79  ? 626  LEU A CB  1 
ATOM   653  C CG  . LEU A 1 85  ? 33.215 1.986   10.681 1.00   9.03  ? 626  LEU A CG  1 
ATOM   654  C CD1 . LEU A 1 85  ? 33.763 1.575   12.040 1.00   7.85  ? 626  LEU A CD1 1 
ATOM   655  C CD2 . LEU A 1 85  ? 32.573 3.361   10.724 1.00   6.95  ? 626  LEU A CD2 1 
ATOM   656  N N   . GLY A 1 86  ? 34.956 1.631   6.089  1.00   10.56 ? 627  GLY A N   1 
ATOM   657  C CA  . GLY A 1 86  ? 36.025 1.832   5.126  1.00   11.31 ? 627  GLY A CA  1 
ATOM   658  C C   . GLY A 1 86  ? 36.130 3.219   4.506  1.00   12.08 ? 627  GLY A C   1 
ATOM   659  O O   . GLY A 1 86  ? 35.128 3.918   4.345  1.00   11.77 ? 627  GLY A O   1 
ATOM   660  N N   . GLU A 1 87  ? 37.358 3.613   4.168  1.00   12.78 ? 628  GLU A N   1 
ATOM   661  C CA  . GLU A 1 87  ? 37.644 4.903   3.543  1.00   13.99 ? 628  GLU A CA  1 
ATOM   662  C C   . GLU A 1 87  ? 37.299 6.131   4.367  1.00   14.61 ? 628  GLU A C   1 
ATOM   663  O O   . GLU A 1 87  ? 36.609 7.033   3.887  1.00   14.97 ? 628  GLU A O   1 
ATOM   664  C CB  . GLU A 1 87  ? 36.935 5.006   2.193  1.00   14.00 ? 628  GLU A CB  1 
ATOM   665  C CG  . GLU A 1 87  ? 37.177 3.806   1.316  1.00   16.52 ? 628  GLU A CG  1 
ATOM   666  C CD  . GLU A 1 87  ? 36.579 3.962   -0.049 1.00   17.09 ? 628  GLU A CD  1 
ATOM   667  O OE1 . GLU A 1 87  ? 37.114 4.777   -0.828 1.00   17.84 ? 628  GLU A OE1 1 
ATOM   668  O OE2 . GLU A 1 87  ? 35.574 3.274   -0.334 1.00   17.96 ? 628  GLU A OE2 1 
ATOM   669  N N   . ASN A 1 88  ? 37.784 6.170   5.601  1.00   15.08 ? 629  ASN A N   1 
ATOM   670  C CA  . ASN A 1 88  ? 37.553 7.308   6.474  1.00   15.92 ? 629  ASN A CA  1 
ATOM   671  C C   . ASN A 1 88  ? 38.907 7.807   6.924  1.00   16.60 ? 629  ASN A C   1 
ATOM   672  O O   . ASN A 1 88  ? 39.923 7.367   6.397  1.00   16.80 ? 629  ASN A O   1 
ATOM   673  C CB  . ASN A 1 88  ? 36.699 6.900   7.670  1.00   16.68 ? 629  ASN A CB  1 
ATOM   674  C CG  . ASN A 1 88  ? 35.232 6.816   7.326  1.00   16.82 ? 629  ASN A CG  1 
ATOM   675  O OD1 . ASN A 1 88  ? 34.589 7.833   7.087  1.00   17.73 ? 629  ASN A OD1 1 
ATOM   676  N ND2 . ASN A 1 88  ? 34.696 5.601   7.282  1.00   16.75 ? 629  ASN A ND2 1 
ATOM   677  N N   . LYS A 1 89  ? 38.927 8.704   7.904  1.00   18.19 ? 630  LYS A N   1 
ATOM   678  C CA  . LYS A 1 89  ? 40.179 9.283   8.384  1.00   20.36 ? 630  LYS A CA  1 
ATOM   679  C C   . LYS A 1 89  ? 40.443 9.058   9.866  1.00   21.65 ? 630  LYS A C   1 
ATOM   680  O O   . LYS A 1 89  ? 40.755 9.997   10.594 1.00   22.13 ? 630  LYS A O   1 
ATOM   681  C CB  . LYS A 1 89  ? 40.187 10.786  8.104  1.00   21.65 ? 630  LYS A CB  1 
ATOM   682  C CG  . LYS A 1 89  ? 40.107 11.151  6.631  1.00   23.22 ? 630  LYS A CG  1 
ATOM   683  C CD  . LYS A 1 89  ? 39.858 12.645  6.449  1.00   25.94 ? 630  LYS A CD  1 
ATOM   684  C CE  . LYS A 1 89  ? 39.936 13.047  4.971  1.00   29.01 ? 630  LYS A CE  1 
ATOM   685  N NZ  . LYS A 1 89  ? 39.584 14.487  4.722  1.00   30.45 ? 630  LYS A NZ  1 
ATOM   686  N N   . ILE A 1 90  ? 40.329 7.813   10.311 1.00   22.88 ? 631  ILE A N   1 
ATOM   687  C CA  . ILE A 1 90  ? 40.553 7.474   11.713 1.00   23.38 ? 631  ILE A CA  1 
ATOM   688  C C   . ILE A 1 90  ? 42.027 7.133   11.889 1.00   24.54 ? 631  ILE A C   1 
ATOM   689  O O   . ILE A 1 90  ? 42.575 6.357   11.110 1.00   25.07 ? 631  ILE A O   1 
ATOM   690  C CB  . ILE A 1 90  ? 39.657 6.285   12.113 1.00   22.73 ? 631  ILE A CB  1 
ATOM   691  C CG1 . ILE A 1 90  ? 38.193 6.724   12.045 1.00   21.29 ? 631  ILE A CG1 1 
ATOM   692  C CG2 . ILE A 1 90  ? 40.030 5.775   13.489 1.00   22.60 ? 631  ILE A CG2 1 
ATOM   693  C CD1 . ILE A 1 90  ? 37.199 5.609   12.189 1.00   22.73 ? 631  ILE A CD1 1 
ATOM   694  N N   . LYS A 1 91  ? 42.665 7.720   12.902 1.00   25.44 ? 632  LYS A N   1 
ATOM   695  C CA  . LYS A 1 91  ? 44.094 7.503   13.139 1.00   26.33 ? 632  LYS A CA  1 
ATOM   696  C C   . LYS A 1 91  ? 44.426 6.673   14.369 1.00   25.85 ? 632  LYS A C   1 
ATOM   697  O O   . LYS A 1 91  ? 45.443 5.976   14.392 1.00   25.61 ? 632  LYS A O   1 
ATOM   698  C CB  . LYS A 1 91  ? 44.817 8.846   13.233 1.00   27.69 ? 632  LYS A CB  1 
ATOM   699  C CG  . LYS A 1 91  ? 44.733 9.684   11.970 1.00   32.61 ? 632  LYS A CG  1 
ATOM   700  C CD  . LYS A 1 91  ? 45.404 11.038  12.151 1.00   36.57 ? 632  LYS A CD  1 
ATOM   701  C CE  . LYS A 1 91  ? 44.689 11.869  13.213 1.00   41.19 ? 632  LYS A CE  1 
ATOM   702  N NZ  . LYS A 1 91  ? 45.289 13.234  13.400 1.00   44.26 ? 632  LYS A NZ  1 
ATOM   703  N N   . GLU A 1 92  ? 43.579 6.763   15.390 1.00   25.26 ? 633  GLU A N   1 
ATOM   704  C CA  . GLU A 1 92  ? 43.772 6.012   16.626 1.00   24.13 ? 633  GLU A CA  1 
ATOM   705  C C   . GLU A 1 92  ? 42.524 5.203   16.916 1.00   23.58 ? 633  GLU A C   1 
ATOM   706  O O   . GLU A 1 92  ? 41.438 5.517   16.431 1.00   23.39 ? 633  GLU A O   1 
ATOM   707  C CB  . GLU A 1 92  ? 43.998 6.952   17.815 1.00   24.04 ? 633  GLU A CB  1 
ATOM   708  C CG  . GLU A 1 92  ? 45.075 8.003   17.633 1.00   29.19 ? 633  GLU A CG  1 
ATOM   709  C CD  . GLU A 1 92  ? 45.233 8.898   18.862 1.00   32.50 ? 633  GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 92  ? 44.215 9.427   19.356 1.00   34.83 ? 633  GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 92  ? 46.372 9.083   19.336 1.00   33.86 ? 633  GLU A OE2 1 
ATOM   712  N N   . ILE A 1 93  ? 42.676 4.157   17.710 1.00   23.52 ? 634  ILE A N   1 
ATOM   713  C CA  . ILE A 1 93  ? 41.530 3.363   18.096 1.00   24.54 ? 634  ILE A CA  1 
ATOM   714  C C   . ILE A 1 93  ? 41.492 3.259   19.610 1.00   24.87 ? 634  ILE A C   1 
ATOM   715  O O   . ILE A 1 93  ? 42.333 2.614   20.219 1.00   24.60 ? 634  ILE A O   1 
ATOM   716  C CB  . ILE A 1 93  ? 41.563 1.967   17.450 1.00   25.22 ? 634  ILE A CB  1 
ATOM   717  C CG1 . ILE A 1 93  ? 41.255 2.110   15.955 1.00   27.26 ? 634  ILE A CG1 1 
ATOM   718  C CG2 . ILE A 1 93  ? 40.542 1.046   18.114 1.00   23.04 ? 634  ILE A CG2 1 
ATOM   719  C CD1 . ILE A 1 93  ? 41.196 0.807   15.197 1.00   28.70 ? 634  ILE A CD1 1 
ATOM   720  N N   . SER A 1 94  ? 40.513 3.929   20.209 1.00   26.03 ? 635  SER A N   1 
ATOM   721  C CA  . SER A 1 94  ? 40.333 3.935   21.659 1.00   26.90 ? 635  SER A CA  1 
ATOM   722  C C   . SER A 1 94  ? 39.769 2.593   22.107 1.00   27.13 ? 635  SER A C   1 
ATOM   723  O O   . SER A 1 94  ? 39.485 1.730   21.277 1.00   27.35 ? 635  SER A O   1 
ATOM   724  C CB  . SER A 1 94  ? 39.359 5.048   22.053 1.00   27.71 ? 635  SER A CB  1 
ATOM   725  O OG  . SER A 1 94  ? 39.621 6.234   21.314 1.00   28.05 ? 635  SER A OG  1 
ATOM   726  N N   . ASN A 1 95  ? 39.600 2.416   23.414 1.00   27.71 ? 636  ASN A N   1 
ATOM   727  C CA  . ASN A 1 95  ? 39.054 1.167   23.938 1.00   28.24 ? 636  ASN A CA  1 
ATOM   728  C C   . ASN A 1 95  ? 37.593 1.311   24.370 1.00   27.78 ? 636  ASN A C   1 
ATOM   729  O O   . ASN A 1 95  ? 36.940 0.323   24.700 1.00   28.00 ? 636  ASN A O   1 
ATOM   730  C CB  . ASN A 1 95  ? 39.911 0.639   25.099 1.00   29.21 ? 636  ASN A CB  1 
ATOM   731  C CG  . ASN A 1 95  ? 40.165 1.684   26.174 1.00   31.94 ? 636  ASN A CG  1 
ATOM   732  O OD1 . ASN A 1 95  ? 39.237 2.311   26.691 1.00   33.12 ? 636  ASN A OD1 1 
ATOM   733  N ND2 . ASN A 1 95  ? 41.432 1.867   26.522 1.00   32.20 ? 636  ASN A ND2 1 
ATOM   734  N N   . LYS A 1 96  ? 37.088 2.542   24.356 1.00   27.30 ? 637  LYS A N   1 
ATOM   735  C CA  . LYS A 1 96  ? 35.699 2.833   24.712 1.00   27.28 ? 637  LYS A CA  1 
ATOM   736  C C   . LYS A 1 96  ? 34.997 3.270   23.426 1.00   25.79 ? 637  LYS A C   1 
ATOM   737  O O   . LYS A 1 96  ? 34.034 4.036   23.442 1.00   25.31 ? 637  LYS A O   1 
ATOM   738  C CB  . LYS A 1 96  ? 35.645 3.976   25.730 1.00   31.49 ? 637  LYS A CB  1 
ATOM   739  C CG  . LYS A 1 96  ? 35.416 3.553   27.183 1.00   35.91 ? 637  LYS A CG  1 
ATOM   740  C CD  . LYS A 1 96  ? 36.552 2.696   27.724 1.00   39.25 ? 637  LYS A CD  1 
ATOM   741  C CE  . LYS A 1 96  ? 36.434 2.530   29.237 1.00   40.79 ? 637  LYS A CE  1 
ATOM   742  N NZ  . LYS A 1 96  ? 37.620 1.837   29.820 1.00   42.45 ? 637  LYS A NZ  1 
ATOM   743  N N   . MET A 1 97  ? 35.493 2.740   22.316 1.00   24.69 ? 638  MET A N   1 
ATOM   744  C CA  . MET A 1 97  ? 35.025 3.072   20.978 1.00   22.75 ? 638  MET A CA  1 
ATOM   745  C C   . MET A 1 97  ? 34.058 2.045   20.379 1.00   21.50 ? 638  MET A C   1 
ATOM   746  O O   . MET A 1 97  ? 33.087 2.404   19.710 1.00   20.90 ? 638  MET A O   1 
ATOM   747  C CB  . MET A 1 97  ? 36.268 3.223   20.106 1.00   23.46 ? 638  MET A CB  1 
ATOM   748  C CG  . MET A 1 97  ? 36.109 3.930   18.799 1.00   24.87 ? 638  MET A CG  1 
ATOM   749  S SD  . MET A 1 97  ? 37.769 4.246   18.151 1.00   26.62 ? 638  MET A SD  1 
ATOM   750  C CE  . MET A 1 97  ? 37.835 6.060   18.285 1.00   27.24 ? 638  MET A CE  1 
ATOM   751  N N   . PHE A 1 98  ? 34.324 0.765   20.620 1.00   19.91 ? 639  PHE A N   1 
ATOM   752  C CA  . PHE A 1 98  ? 33.470 -0.296  20.104 1.00   18.14 ? 639  PHE A CA  1 
ATOM   753  C C   . PHE A 1 98  ? 32.744 -0.997  21.247 1.00   17.70 ? 639  PHE A C   1 
ATOM   754  O O   . PHE A 1 98  ? 32.200 -2.086  21.085 1.00   17.80 ? 639  PHE A O   1 
ATOM   755  C CB  . PHE A 1 98  ? 34.311 -1.300  19.315 1.00   16.11 ? 639  PHE A CB  1 
ATOM   756  C CG  . PHE A 1 98  ? 35.013 -0.698  18.130 1.00   14.99 ? 639  PHE A CG  1 
ATOM   757  C CD1 . PHE A 1 98  ? 36.392 -0.835  17.973 1.00   13.85 ? 639  PHE A CD1 1 
ATOM   758  C CD2 . PHE A 1 98  ? 34.299 0.019   17.172 1.00   13.38 ? 639  PHE A CD2 1 
ATOM   759  C CE1 . PHE A 1 98  ? 37.047 -0.267  16.885 1.00   13.32 ? 639  PHE A CE1 1 
ATOM   760  C CE2 . PHE A 1 98  ? 34.945 0.595   16.075 1.00   12.87 ? 639  PHE A CE2 1 
ATOM   761  C CZ  . PHE A 1 98  ? 36.318 0.454   15.930 1.00   12.88 ? 639  PHE A CZ  1 
ATOM   762  N N   . LEU A 1 99  ? 32.722 -0.349  22.403 1.00   17.05 ? 640  LEU A N   1 
ATOM   763  C CA  . LEU A 1 99  ? 32.092 -0.902  23.588 1.00   16.90 ? 640  LEU A CA  1 
ATOM   764  C C   . LEU A 1 99  ? 30.592 -1.112  23.416 1.00   16.60 ? 640  LEU A C   1 
ATOM   765  O O   . LEU A 1 99  ? 29.838 -0.155  23.225 1.00   17.25 ? 640  LEU A O   1 
ATOM   766  C CB  . LEU A 1 99  ? 32.374 0.021   24.776 1.00   19.46 ? 640  LEU A CB  1 
ATOM   767  C CG  . LEU A 1 99  ? 31.917 -0.388  26.178 1.00   24.06 ? 640  LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 99  ? 32.676 0.438   27.200 1.00   24.33 ? 640  LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 99  ? 30.404 -0.207  26.330 1.00   23.08 ? 640  LEU A CD2 1 
ATOM   770  N N   . GLY A 1 100 ? 30.169 -2.372  23.490 1.00   15.53 ? 641  GLY A N   1 
ATOM   771  C CA  . GLY A 1 100 ? 28.764 -2.705  23.355 1.00   14.75 ? 641  GLY A CA  1 
ATOM   772  C C   . GLY A 1 100 ? 28.463 -3.640  22.197 1.00   14.92 ? 641  GLY A C   1 
ATOM   773  O O   . GLY A 1 100 ? 27.447 -4.324  22.182 1.00   15.60 ? 641  GLY A O   1 
ATOM   774  N N   . LEU A 1 101 ? 29.357 -3.694  21.227 1.00   14.86 ? 642  LEU A N   1 
ATOM   775  C CA  . LEU A 1 101 ? 29.146 -4.531  20.054 1.00   15.06 ? 642  LEU A CA  1 
ATOM   776  C C   . LEU A 1 101 ? 29.651 -5.964  20.189 1.00   15.16 ? 642  LEU A C   1 
ATOM   777  O O   . LEU A 1 101 ? 30.413 -6.424  19.341 1.00   15.91 ? 642  LEU A O   1 
ATOM   778  C CB  . LEU A 1 101 ? 29.815 -3.872  18.847 1.00   14.23 ? 642  LEU A CB  1 
ATOM   779  C CG  . LEU A 1 101 ? 29.466 -2.391  18.649 1.00   11.62 ? 642  LEU A CG  1 
ATOM   780  C CD1 . LEU A 1 101 ? 30.556 -1.700  17.818 1.00   8.36  ? 642  LEU A CD1 1 
ATOM   781  C CD2 . LEU A 1 101 ? 28.094 -2.283  17.997 1.00   5.82  ? 642  LEU A CD2 1 
ATOM   782  N N   . HIS A 1 102 ? 29.219 -6.680  21.224 1.00   14.83 ? 643  HIS A N   1 
ATOM   783  C CA  . HIS A 1 102 ? 29.676 -8.051  21.409 1.00   14.93 ? 643  HIS A CA  1 
ATOM   784  C C   . HIS A 1 102 ? 28.997 -9.083  20.486 1.00   15.83 ? 643  HIS A C   1 
ATOM   785  O O   . HIS A 1 102 ? 29.251 -10.296 20.595 1.00   15.98 ? 643  HIS A O   1 
ATOM   786  C CB  . HIS A 1 102 ? 29.531 -8.475  22.884 1.00   14.39 ? 643  HIS A CB  1 
ATOM   787  C CG  . HIS A 1 102 ? 28.116 -8.554  23.361 1.00   11.83 ? 643  HIS A CG  1 
ATOM   788  N ND1 . HIS A 1 102 ? 27.343 -7.437  23.593 1.00   14.09 ? 643  HIS A ND1 1 
ATOM   789  C CD2 . HIS A 1 102 ? 27.325 -9.619  23.626 1.00   13.11 ? 643  HIS A CD2 1 
ATOM   790  C CE1 . HIS A 1 102 ? 26.136 -7.810  23.979 1.00   13.41 ? 643  HIS A CE1 1 
ATOM   791  N NE2 . HIS A 1 102 ? 26.098 -9.130  24.007 1.00   12.95 ? 643  HIS A NE2 1 
ATOM   792  N N   . GLN A 1 103 ? 28.134 -8.614  19.584 1.00   15.34 ? 644  GLN A N   1 
ATOM   793  C CA  . GLN A 1 103 ? 27.467 -9.512  18.640 1.00   14.99 ? 644  GLN A CA  1 
ATOM   794  C C   . GLN A 1 103 ? 27.944 -9.226  17.230 1.00   14.68 ? 644  GLN A C   1 
ATOM   795  O O   . GLN A 1 103 ? 27.608 -9.941  16.292 1.00   15.43 ? 644  GLN A O   1 
ATOM   796  C CB  . GLN A 1 103 ? 25.950 -9.352  18.695 1.00   16.96 ? 644  GLN A CB  1 
ATOM   797  C CG  . GLN A 1 103 ? 25.318 -10.055 19.865 1.00   22.67 ? 644  GLN A CG  1 
ATOM   798  C CD  . GLN A 1 103 ? 25.784 -11.492 19.974 1.00   28.00 ? 644  GLN A CD  1 
ATOM   799  O OE1 . GLN A 1 103 ? 25.323 -12.364 19.237 1.00   32.23 ? 644  GLN A OE1 1 
ATOM   800  N NE2 . GLN A 1 103 ? 26.721 -11.743 20.887 1.00   29.86 ? 644  GLN A NE2 1 
ATOM   801  N N   . LEU A 1 104 ? 28.728 -8.165  17.086 1.00   13.58 ? 645  LEU A N   1 
ATOM   802  C CA  . LEU A 1 104 ? 29.265 -7.776  15.792 1.00   12.35 ? 645  LEU A CA  1 
ATOM   803  C C   . LEU A 1 104 ? 30.095 -8.922  15.219 1.00   11.45 ? 645  LEU A C   1 
ATOM   804  O O   . LEU A 1 104 ? 30.937 -9.476  15.912 1.00   11.96 ? 645  LEU A O   1 
ATOM   805  C CB  . LEU A 1 104 ? 30.153 -6.536  15.953 1.00   9.83  ? 645  LEU A CB  1 
ATOM   806  C CG  . LEU A 1 104 ? 30.581 -5.861  14.650 1.00   9.15  ? 645  LEU A CG  1 
ATOM   807  C CD1 . LEU A 1 104 ? 29.356 -5.342  13.924 1.00   7.54  ? 645  LEU A CD1 1 
ATOM   808  C CD2 . LEU A 1 104 ? 31.531 -4.724  14.941 1.00   9.15  ? 645  LEU A CD2 1 
ATOM   809  N N   . LYS A 1 105 ? 29.866 -9.284  13.962 1.00   10.46 ? 646  LYS A N   1 
ATOM   810  C CA  . LYS A 1 105 ? 30.642 -10.356 13.357 1.00   10.16 ? 646  LYS A CA  1 
ATOM   811  C C   . LYS A 1 105 ? 31.644 -9.776  12.376 1.00   10.51 ? 646  LYS A C   1 
ATOM   812  O O   . LYS A 1 105 ? 32.739 -10.313 12.203 1.00   10.61 ? 646  LYS A O   1 
ATOM   813  C CB  . LYS A 1 105 ? 29.740 -11.334 12.618 1.00   9.78  ? 646  LYS A CB  1 
ATOM   814  C CG  . LYS A 1 105 ? 28.524 -11.764 13.399 1.00   16.90 ? 646  LYS A CG  1 
ATOM   815  C CD  . LYS A 1 105 ? 27.882 -13.024 12.826 1.00   22.34 ? 646  LYS A CD  1 
ATOM   816  C CE  . LYS A 1 105 ? 28.773 -14.251 13.037 1.00   27.39 ? 646  LYS A CE  1 
ATOM   817  N NZ  . LYS A 1 105 ? 29.129 -14.451 14.482 1.00   28.93 ? 646  LYS A NZ  1 
ATOM   818  N N   . THR A 1 106 ? 31.276 -8.657  11.758 1.00   10.00 ? 647  THR A N   1 
ATOM   819  C CA  . THR A 1 106 ? 32.128 -8.025  10.758 1.00   9.65  ? 647  THR A CA  1 
ATOM   820  C C   . THR A 1 106 ? 32.475 -6.557  10.992 1.00   8.64  ? 647  THR A C   1 
ATOM   821  O O   . THR A 1 106 ? 31.615 -5.731  11.253 1.00   8.14  ? 647  THR A O   1 
ATOM   822  C CB  . THR A 1 106 ? 31.475 -8.127  9.363  1.00   10.73 ? 647  THR A CB  1 
ATOM   823  O OG1 . THR A 1 106 ? 31.180 -9.499  9.067  1.00   12.76 ? 647  THR A OG1 1 
ATOM   824  C CG2 . THR A 1 106 ? 32.408 -7.569  8.301  1.00   11.83 ? 647  THR A CG2 1 
ATOM   825  N N   . LEU A 1 107 ? 33.749 -6.233  10.872 1.00   8.17  ? 648  LEU A N   1 
ATOM   826  C CA  . LEU A 1 107 ? 34.173 -4.855  11.043 1.00   8.75  ? 648  LEU A CA  1 
ATOM   827  C C   . LEU A 1 107 ? 35.130 -4.457  9.934  1.00   8.93  ? 648  LEU A C   1 
ATOM   828  O O   . LEU A 1 107 ? 36.210 -5.028  9.794  1.00   9.00  ? 648  LEU A O   1 
ATOM   829  C CB  . LEU A 1 107 ? 34.855 -4.658  12.388 1.00   7.29  ? 648  LEU A CB  1 
ATOM   830  C CG  . LEU A 1 107 ? 35.229 -3.199  12.619 1.00   6.64  ? 648  LEU A CG  1 
ATOM   831  C CD1 . LEU A 1 107 ? 33.981 -2.325  12.545 1.00   5.00  ? 648  LEU A CD1 1 
ATOM   832  C CD2 . LEU A 1 107 ? 35.906 -3.070  13.974 1.00   7.31  ? 648  LEU A CD2 1 
ATOM   833  N N   . ASN A 1 108 ? 34.740 -3.482  9.132  1.00   8.74  ? 649  ASN A N   1 
ATOM   834  C CA  . ASN A 1 108 ? 35.620 -3.069  8.065  1.00   9.12  ? 649  ASN A CA  1 
ATOM   835  C C   . ASN A 1 108 ? 36.230 -1.703  8.322  1.00   9.24  ? 649  ASN A C   1 
ATOM   836  O O   . ASN A 1 108 ? 35.532 -0.698  8.349  1.00   9.60  ? 649  ASN A O   1 
ATOM   837  C CB  . ASN A 1 108 ? 34.883 -3.057  6.740  1.00   8.31  ? 649  ASN A CB  1 
ATOM   838  C CG  . ASN A 1 108 ? 35.828 -3.123  5.583  1.00   8.83  ? 649  ASN A CG  1 
ATOM   839  O OD1 . ASN A 1 108 ? 36.920 -2.547  5.629  1.00   11.54 ? 649  ASN A OD1 1 
ATOM   840  N ND2 . ASN A 1 108 ? 35.432 -3.824  4.539  1.00   5.00  ? 649  ASN A ND2 1 
ATOM   841  N N   . LEU A 1 109 ? 37.542 -1.680  8.517  1.00   10.01 ? 650  LEU A N   1 
ATOM   842  C CA  . LEU A 1 109 ? 38.256 -0.438  8.776  1.00   10.95 ? 650  LEU A CA  1 
ATOM   843  C C   . LEU A 1 109 ? 39.207 -0.179  7.630  1.00   11.74 ? 650  LEU A C   1 
ATOM   844  O O   . LEU A 1 109 ? 40.062 0.691   7.698  1.00   11.57 ? 650  LEU A O   1 
ATOM   845  C CB  . LEU A 1 109 ? 39.028 -0.530  10.100 1.00   11.39 ? 650  LEU A CB  1 
ATOM   846  C CG  . LEU A 1 109 ? 38.190 -0.333  11.376 1.00   11.58 ? 650  LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 109 ? 38.982 -0.750  12.607 1.00   11.19 ? 650  LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 109 ? 37.765 1.126   11.476 1.00   8.54  ? 650  LEU A CD2 1 
ATOM   849  N N   . TYR A 1 110 ? 39.046 -0.953  6.568  1.00   13.24 ? 651  TYR A N   1 
ATOM   850  C CA  . TYR A 1 110 ? 39.887 -0.810  5.399  1.00   14.80 ? 651  TYR A CA  1 
ATOM   851  C C   . TYR A 1 110 ? 40.137 0.656   5.035  1.00   16.53 ? 651  TYR A C   1 
ATOM   852  O O   . TYR A 1 110 ? 39.241 1.496   5.125  1.00   17.16 ? 651  TYR A O   1 
ATOM   853  C CB  . TYR A 1 110 ? 39.248 -1.527  4.209  1.00   14.16 ? 651  TYR A CB  1 
ATOM   854  C CG  . TYR A 1 110 ? 39.923 -1.214  2.897  1.00   15.71 ? 651  TYR A CG  1 
ATOM   855  C CD1 . TYR A 1 110 ? 41.185 -1.728  2.603  1.00   17.48 ? 651  TYR A CD1 1 
ATOM   856  C CD2 . TYR A 1 110 ? 39.330 -0.349  1.974  1.00   15.51 ? 651  TYR A CD2 1 
ATOM   857  C CE1 . TYR A 1 110 ? 41.852 -1.384  1.420  1.00   18.19 ? 651  TYR A CE1 1 
ATOM   858  C CE2 . TYR A 1 110 ? 39.983 0.001   0.794  1.00   18.00 ? 651  TYR A CE2 1 
ATOM   859  C CZ  . TYR A 1 110 ? 41.247 -0.520  0.523  1.00   18.91 ? 651  TYR A CZ  1 
ATOM   860  O OH  . TYR A 1 110 ? 41.907 -0.176  -0.636 1.00   20.27 ? 651  TYR A OH  1 
ATOM   861  N N   . ASP A 1 111 ? 41.369 0.933   4.615  1.00   17.51 ? 652  ASP A N   1 
ATOM   862  C CA  . ASP A 1 111 ? 41.831 2.254   4.195  1.00   18.53 ? 652  ASP A CA  1 
ATOM   863  C C   . ASP A 1 111 ? 41.455 3.458   5.040  1.00   18.53 ? 652  ASP A C   1 
ATOM   864  O O   . ASP A 1 111 ? 40.835 4.400   4.562  1.00   18.76 ? 652  ASP A O   1 
ATOM   865  C CB  . ASP A 1 111 ? 41.428 2.539   2.745  1.00   21.09 ? 652  ASP A CB  1 
ATOM   866  C CG  . ASP A 1 111 ? 42.131 3.772   2.180  1.00   24.35 ? 652  ASP A CG  1 
ATOM   867  O OD1 . ASP A 1 111 ? 43.382 3.752   2.084  1.00   25.24 ? 652  ASP A OD1 1 
ATOM   868  O OD2 . ASP A 1 111 ? 41.440 4.763   1.842  1.00   26.70 ? 652  ASP A OD2 1 
ATOM   869  N N   . ASN A 1 112 ? 41.829 3.416   6.306  1.00   18.65 ? 653  ASN A N   1 
ATOM   870  C CA  . ASN A 1 112 ? 41.604 4.529   7.198  1.00   18.94 ? 653  ASN A CA  1 
ATOM   871  C C   . ASN A 1 112 ? 43.044 4.983   7.449  1.00   20.60 ? 653  ASN A C   1 
ATOM   872  O O   . ASN A 1 112 ? 43.906 4.773   6.582  1.00   21.09 ? 653  ASN A O   1 
ATOM   873  C CB  . ASN A 1 112 ? 40.919 4.049   8.470  1.00   17.24 ? 653  ASN A CB  1 
ATOM   874  C CG  . ASN A 1 112 ? 39.433 4.382   8.490  1.00   15.52 ? 653  ASN A CG  1 
ATOM   875  O OD1 . ASN A 1 112 ? 39.046 5.514   8.769  1.00   15.08 ? 653  ASN A OD1 1 
ATOM   876  N ND2 . ASN A 1 112 ? 38.599 3.401   8.181  1.00   12.93 ? 653  ASN A ND2 1 
ATOM   877  N N   . GLN A 1 113 ? 43.331 5.586   8.599  1.00   21.10 ? 654  GLN A N   1 
ATOM   878  C CA  . GLN A 1 113 ? 44.703 6.026   8.867  1.00   22.13 ? 654  GLN A CA  1 
ATOM   879  C C   . GLN A 1 113 ? 45.206 5.540   10.208 1.00   21.07 ? 654  GLN A C   1 
ATOM   880  O O   . GLN A 1 113 ? 46.046 6.168   10.842 1.00   19.97 ? 654  GLN A O   1 
ATOM   881  C CB  . GLN A 1 113 ? 44.796 7.550   8.815  1.00   25.03 ? 654  GLN A CB  1 
ATOM   882  C CG  . GLN A 1 113 ? 44.464 8.133   7.464  1.00   29.89 ? 654  GLN A CG  1 
ATOM   883  C CD  . GLN A 1 113 ? 44.694 9.629   7.411  1.00   35.15 ? 654  GLN A CD  1 
ATOM   884  O OE1 . GLN A 1 113 ? 45.838 10.088  7.420  1.00   39.11 ? 654  GLN A OE1 1 
ATOM   885  N NE2 . GLN A 1 113 ? 43.605 10.403  7.365  1.00   33.72 ? 654  GLN A NE2 1 
ATOM   886  N N   . ILE A 1 114 ? 44.674 4.405   10.627 1.00   21.88 ? 655  ILE A N   1 
ATOM   887  C CA  . ILE A 1 114 ? 45.027 3.798   11.898 1.00   22.34 ? 655  ILE A CA  1 
ATOM   888  C C   . ILE A 1 114 ? 46.510 3.424   11.959 1.00   23.08 ? 655  ILE A C   1 
ATOM   889  O O   . ILE A 1 114 ? 47.027 2.710   11.088 1.00   23.08 ? 655  ILE A O   1 
ATOM   890  C CB  . ILE A 1 114 ? 44.160 2.557   12.130 1.00   20.03 ? 655  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 114 ? 42.681 2.960   12.081 1.00   17.10 ? 655  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 114 ? 44.520 1.916   13.455 1.00   21.78 ? 655  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 114 ? 41.734 1.795   11.964 1.00   16.03 ? 655  ILE A CD1 1 
ATOM   894  N N   . SER A 1 115 ? 47.190 3.917   12.991 1.00   23.06 ? 656  SER A N   1 
ATOM   895  C CA  . SER A 1 115 ? 48.611 3.644   13.158 1.00   23.20 ? 656  SER A CA  1 
ATOM   896  C C   . SER A 1 115 ? 48.916 3.014   14.509 1.00   23.61 ? 656  SER A C   1 
ATOM   897  O O   . SER A 1 115 ? 49.947 2.364   14.669 1.00   23.20 ? 656  SER A O   1 
ATOM   898  C CB  . SER A 1 115 ? 49.417 4.932   13.006 1.00   22.26 ? 656  SER A CB  1 
ATOM   899  O OG  . SER A 1 115 ? 49.130 5.832   14.060 1.00   22.33 ? 656  SER A OG  1 
ATOM   900  N N   . CYS A 1 116 ? 48.010 3.201   15.467 1.00   24.08 ? 657  CYS A N   1 
ATOM   901  C CA  . CYS A 1 116 ? 48.166 2.665   16.821 1.00   25.41 ? 657  CYS A CA  1 
ATOM   902  C C   . CYS A 1 116 ? 46.824 2.109   17.300 1.00   24.74 ? 657  CYS A C   1 
ATOM   903  O O   . CYS A 1 116 ? 45.767 2.562   16.857 1.00   24.68 ? 657  CYS A O   1 
ATOM   904  C CB  . CYS A 1 116 ? 48.550 3.775   17.785 1.00   28.93 ? 657  CYS A CB  1 
ATOM   905  S SG  . CYS A 1 116 ? 47.053 4.755   18.070 1.00   38.75 ? 657  CYS A SG  1 
ATOM   906  N N   . VAL A 1 117 ? 46.870 1.160   18.233 1.00   24.36 ? 658  VAL A N   1 
ATOM   907  C CA  . VAL A 1 117 ? 45.660 0.557   18.786 1.00   23.68 ? 658  VAL A CA  1 
ATOM   908  C C   . VAL A 1 117 ? 45.790 0.390   20.302 1.00   24.63 ? 658  VAL A C   1 
ATOM   909  O O   . VAL A 1 117 ? 46.609 -0.394  20.782 1.00   24.69 ? 658  VAL A O   1 
ATOM   910  C CB  . VAL A 1 117 ? 45.383 -0.835  18.166 1.00   21.75 ? 658  VAL A CB  1 
ATOM   911  C CG1 . VAL A 1 117 ? 44.085 -1.410  18.727 1.00   20.10 ? 658  VAL A CG1 1 
ATOM   912  C CG2 . VAL A 1 117 ? 45.312 -0.733  16.663 1.00   19.30 ? 658  VAL A CG2 1 
ATOM   913  N N   . MET A 1 118 ? 44.973 1.125   21.045 1.00   25.37 ? 659  MET A N   1 
ATOM   914  C CA  . MET A 1 118 ? 44.971 1.074   22.503 1.00   27.75 ? 659  MET A CA  1 
ATOM   915  C C   . MET A 1 118 ? 44.617 -0.329  23.011 1.00   28.30 ? 659  MET A C   1 
ATOM   916  O O   . MET A 1 118 ? 43.731 -0.985  22.474 1.00   28.32 ? 659  MET A O   1 
ATOM   917  C CB  . MET A 1 118 ? 43.955 2.081   23.035 1.00   30.99 ? 659  MET A CB  1 
ATOM   918  C CG  . MET A 1 118 ? 44.224 2.596   24.433 1.00   35.17 ? 659  MET A CG  1 
ATOM   919  S SD  . MET A 1 118 ? 42.956 3.795   24.906 1.00   40.76 ? 659  MET A SD  1 
ATOM   920  C CE  . MET A 1 118 ? 43.126 5.035   23.567 1.00   37.50 ? 659  MET A CE  1 
ATOM   921  N N   . PRO A 1 119 ? 45.314 -0.806  24.057 1.00   29.26 ? 660  PRO A N   1 
ATOM   922  C CA  . PRO A 1 119 ? 45.062 -2.136  24.627 1.00   29.30 ? 660  PRO A CA  1 
ATOM   923  C C   . PRO A 1 119 ? 43.627 -2.328  25.104 1.00   29.46 ? 660  PRO A C   1 
ATOM   924  O O   . PRO A 1 119 ? 43.050 -1.439  25.724 1.00   29.73 ? 660  PRO A O   1 
ATOM   925  C CB  . PRO A 1 119 ? 46.061 -2.211  25.775 1.00   28.65 ? 660  PRO A CB  1 
ATOM   926  C CG  . PRO A 1 119 ? 47.218 -1.413  25.246 1.00   29.28 ? 660  PRO A CG  1 
ATOM   927  C CD  . PRO A 1 119 ? 46.513 -0.200  24.668 1.00   29.50 ? 660  PRO A CD  1 
ATOM   928  N N   . GLY A 1 120 ? 43.056 -3.492  24.804 1.00   29.73 ? 661  GLY A N   1 
ATOM   929  C CA  . GLY A 1 120 ? 41.692 -3.779  25.216 1.00   29.77 ? 661  GLY A CA  1 
ATOM   930  C C   . GLY A 1 120 ? 40.615 -3.154  24.346 1.00   29.84 ? 661  GLY A C   1 
ATOM   931  O O   . GLY A 1 120 ? 39.439 -3.155  24.715 1.00   29.84 ? 661  GLY A O   1 
ATOM   932  N N   . SER A 1 121 ? 41.009 -2.641  23.183 1.00   29.27 ? 662  SER A N   1 
ATOM   933  C CA  . SER A 1 121 ? 40.079 -1.998  22.261 1.00   28.86 ? 662  SER A CA  1 
ATOM   934  C C   . SER A 1 121 ? 39.155 -2.957  21.503 1.00   28.96 ? 662  SER A C   1 
ATOM   935  O O   . SER A 1 121 ? 38.029 -2.596  21.153 1.00   28.13 ? 662  SER A O   1 
ATOM   936  C CB  . SER A 1 121 ? 40.854 -1.147  21.249 1.00   28.27 ? 662  SER A CB  1 
ATOM   937  O OG  . SER A 1 121 ? 41.347 0.039   21.846 1.00   28.10 ? 662  SER A OG  1 
ATOM   938  N N   . PHE A 1 122 ? 39.630 -4.171  21.247 1.00   28.62 ? 663  PHE A N   1 
ATOM   939  C CA  . PHE A 1 122 ? 38.842 -5.155  20.511 1.00   28.43 ? 663  PHE A CA  1 
ATOM   940  C C   . PHE A 1 122 ? 38.305 -6.311  21.368 1.00   29.15 ? 663  PHE A C   1 
ATOM   941  O O   . PHE A 1 122 ? 37.612 -7.197  20.859 1.00   27.56 ? 663  PHE A O   1 
ATOM   942  C CB  . PHE A 1 122 ? 39.679 -5.729  19.369 1.00   26.39 ? 663  PHE A CB  1 
ATOM   943  C CG  . PHE A 1 122 ? 39.988 -4.744  18.280 1.00   24.52 ? 663  PHE A CG  1 
ATOM   944  C CD1 . PHE A 1 122 ? 41.302 -4.449  17.944 1.00   24.03 ? 663  PHE A CD1 1 
ATOM   945  C CD2 . PHE A 1 122 ? 38.968 -4.154  17.548 1.00   24.11 ? 663  PHE A CD2 1 
ATOM   946  C CE1 . PHE A 1 122 ? 41.595 -3.585  16.890 1.00   21.65 ? 663  PHE A CE1 1 
ATOM   947  C CE2 . PHE A 1 122 ? 39.254 -3.288  16.490 1.00   22.71 ? 663  PHE A CE2 1 
ATOM   948  C CZ  . PHE A 1 122 ? 40.570 -3.007  16.164 1.00   21.56 ? 663  PHE A CZ  1 
ATOM   949  N N   . GLU A 1 123 ? 38.616 -6.298  22.663 1.00   30.72 ? 664  GLU A N   1 
ATOM   950  C CA  . GLU A 1 123 ? 38.174 -7.362  23.564 1.00   32.08 ? 664  GLU A CA  1 
ATOM   951  C C   . GLU A 1 123 ? 36.665 -7.376  23.765 1.00   31.54 ? 664  GLU A C   1 
ATOM   952  O O   . GLU A 1 123 ? 36.066 -8.428  23.970 1.00   31.91 ? 664  GLU A O   1 
ATOM   953  C CB  . GLU A 1 123 ? 38.858 -7.230  24.923 1.00   34.64 ? 664  GLU A CB  1 
ATOM   954  C CG  . GLU A 1 123 ? 38.578 -5.909  25.625 1.00   41.53 ? 664  GLU A CG  1 
ATOM   955  C CD  . GLU A 1 123 ? 38.500 -6.058  27.138 1.00   45.79 ? 664  GLU A CD  1 
ATOM   956  O OE1 . GLU A 1 123 ? 38.643 -5.036  27.849 1.00   47.70 ? 664  GLU A OE1 1 
ATOM   957  O OE2 . GLU A 1 123 ? 38.284 -7.198  27.612 1.00   47.07 ? 664  GLU A OE2 1 
ATOM   958  N N   . HIS A 1 124 ? 36.056 -6.203  23.702 1.00   31.35 ? 665  HIS A N   1 
ATOM   959  C CA  . HIS A 1 124 ? 34.619 -6.068  23.877 1.00   31.35 ? 665  HIS A CA  1 
ATOM   960  C C   . HIS A 1 124 ? 33.846 -6.732  22.731 1.00   29.89 ? 665  HIS A C   1 
ATOM   961  O O   . HIS A 1 124 ? 32.611 -6.747  22.741 1.00   30.08 ? 665  HIS A O   1 
ATOM   962  C CB  . HIS A 1 124 ? 34.259 -4.583  23.927 1.00   35.14 ? 665  HIS A CB  1 
ATOM   963  C CG  . HIS A 1 124 ? 33.397 -4.209  25.091 1.00   41.05 ? 665  HIS A CG  1 
ATOM   964  N ND1 . HIS A 1 124 ? 33.894 -4.056  26.367 1.00   43.94 ? 665  HIS A ND1 1 
ATOM   965  C CD2 . HIS A 1 124 ? 32.066 -3.965  25.173 1.00   44.08 ? 665  HIS A CD2 1 
ATOM   966  C CE1 . HIS A 1 124 ? 32.908 -3.732  27.186 1.00   45.14 ? 665  HIS A CE1 1 
ATOM   967  N NE2 . HIS A 1 124 ? 31.788 -3.670  26.487 1.00   45.28 ? 665  HIS A NE2 1 
ATOM   968  N N   . LEU A 1 125 ? 34.573 -7.272  21.752 1.00   27.25 ? 666  LEU A N   1 
ATOM   969  C CA  . LEU A 1 125 ? 33.964 -7.896  20.584 1.00   25.09 ? 666  LEU A CA  1 
ATOM   970  C C   . LEU A 1 125 ? 34.074 -9.412  20.551 1.00   24.48 ? 666  LEU A C   1 
ATOM   971  O O   . LEU A 1 125 ? 34.852 -9.977  19.781 1.00   23.80 ? 666  LEU A O   1 
ATOM   972  C CB  . LEU A 1 125 ? 34.584 -7.324  19.314 1.00   23.72 ? 666  LEU A CB  1 
ATOM   973  C CG  . LEU A 1 125 ? 34.636 -5.804  19.256 1.00   22.87 ? 666  LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 125 ? 35.227 -5.357  17.935 1.00   22.55 ? 666  LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 125 ? 33.237 -5.250  19.442 1.00   23.97 ? 666  LEU A CD2 1 
ATOM   976  N N   . ASN A 1 126 ? 33.256 -10.060 21.371 1.00   23.93 ? 667  ASN A N   1 
ATOM   977  C CA  . ASN A 1 126 ? 33.230 -11.513 21.485 1.00   22.71 ? 667  ASN A CA  1 
ATOM   978  C C   . ASN A 1 126 ? 33.044 -12.281 20.186 1.00   22.28 ? 667  ASN A C   1 
ATOM   979  O O   . ASN A 1 126 ? 33.739 -13.266 19.948 1.00   22.93 ? 667  ASN A O   1 
ATOM   980  C CB  . ASN A 1 126 ? 32.115 -11.927 22.441 1.00   22.70 ? 667  ASN A CB  1 
ATOM   981  C CG  . ASN A 1 126 ? 32.241 -11.278 23.802 1.00   22.82 ? 667  ASN A CG  1 
ATOM   982  O OD1 . ASN A 1 126 ? 31.378 -11.443 24.659 1.00   21.65 ? 667  ASN A OD1 1 
ATOM   983  N ND2 . ASN A 1 126 ? 33.322 -10.539 24.009 1.00   24.25 ? 667  ASN A ND2 1 
ATOM   984  N N   . SER A 1 127 ? 32.115 -11.819 19.349 1.00   21.82 ? 668  SER A N   1 
ATOM   985  C CA  . SER A 1 127 ? 31.752 -12.485 18.093 1.00   20.08 ? 668  SER A CA  1 
ATOM   986  C C   . SER A 1 127 ? 32.503 -12.177 16.788 1.00   19.96 ? 668  SER A C   1 
ATOM   987  O O   . SER A 1 127 ? 32.208 -12.784 15.757 1.00   20.55 ? 668  SER A O   1 
ATOM   988  C CB  . SER A 1 127 ? 30.255 -12.269 17.843 1.00   19.00 ? 668  SER A CB  1 
ATOM   989  O OG  . SER A 1 127 ? 29.468 -12.699 18.947 1.00   20.10 ? 668  SER A OG  1 
ATOM   990  N N   . LEU A 1 128 ? 33.460 -11.259 16.811 1.00   19.34 ? 669  LEU A N   1 
ATOM   991  C CA  . LEU A 1 128 ? 34.188 -10.908 15.595 1.00   18.99 ? 669  LEU A CA  1 
ATOM   992  C C   . LEU A 1 128 ? 34.752 -12.102 14.815 1.00   18.93 ? 669  LEU A C   1 
ATOM   993  O O   . LEU A 1 128 ? 35.465 -12.931 15.372 1.00   19.32 ? 669  LEU A O   1 
ATOM   994  C CB  . LEU A 1 128 ? 35.339 -9.955  15.924 1.00   18.42 ? 669  LEU A CB  1 
ATOM   995  C CG  . LEU A 1 128 ? 35.698 -9.065  14.733 1.00   19.52 ? 669  LEU A CG  1 
ATOM   996  C CD1 . LEU A 1 128 ? 34.704 -7.905  14.679 1.00   17.54 ? 669  LEU A CD1 1 
ATOM   997  C CD2 . LEU A 1 128 ? 37.118 -8.551  14.851 1.00   20.23 ? 669  LEU A CD2 1 
ATOM   998  N N   . THR A 1 129 ? 34.433 -12.186 13.524 1.00   18.76 ? 670  THR A N   1 
ATOM   999  C CA  . THR A 1 129 ? 34.948 -13.268 12.678 1.00   18.60 ? 670  THR A CA  1 
ATOM   1000 C C   . THR A 1 129 ? 35.618 -12.692 11.440 1.00   18.78 ? 670  THR A C   1 
ATOM   1001 O O   . THR A 1 129 ? 36.351 -13.379 10.729 1.00   19.36 ? 670  THR A O   1 
ATOM   1002 C CB  . THR A 1 129 ? 33.844 -14.243 12.201 1.00   17.79 ? 670  THR A CB  1 
ATOM   1003 O OG1 . THR A 1 129 ? 32.817 -13.522 11.501 1.00   17.26 ? 670  THR A OG1 1 
ATOM   1004 C CG2 . THR A 1 129 ? 33.267 -14.998 13.378 1.00   16.36 ? 670  THR A CG2 1 
ATOM   1005 N N   . SER A 1 130 ? 35.363 -11.417 11.193 1.00   18.58 ? 671  SER A N   1 
ATOM   1006 C CA  . SER A 1 130 ? 35.935 -10.737 10.049 1.00   18.17 ? 671  SER A CA  1 
ATOM   1007 C C   . SER A 1 130 ? 36.384 -9.328  10.450 1.00   17.45 ? 671  SER A C   1 
ATOM   1008 O O   . SER A 1 130 ? 35.588 -8.522  10.929 1.00   18.03 ? 671  SER A O   1 
ATOM   1009 C CB  . SER A 1 130 ? 34.900 -10.675 8.926  1.00   18.60 ? 671  SER A CB  1 
ATOM   1010 O OG  . SER A 1 130 ? 35.342 -9.842  7.872  1.00   23.63 ? 671  SER A OG  1 
ATOM   1011 N N   . LEU A 1 131 ? 37.668 -9.050  10.265 1.00   16.41 ? 672  LEU A N   1 
ATOM   1012 C CA  . LEU A 1 131 ? 38.230 -7.752  10.594 1.00   15.53 ? 672  LEU A CA  1 
ATOM   1013 C C   . LEU A 1 131 ? 39.060 -7.290  9.419  1.00   14.85 ? 672  LEU A C   1 
ATOM   1014 O O   . LEU A 1 131 ? 40.069 -7.903  9.097  1.00   15.21 ? 672  LEU A O   1 
ATOM   1015 C CB  . LEU A 1 131 ? 39.133 -7.846  11.831 1.00   16.19 ? 672  LEU A CB  1 
ATOM   1016 C CG  . LEU A 1 131 ? 39.683 -6.530  12.398 1.00   14.55 ? 672  LEU A CG  1 
ATOM   1017 C CD1 . LEU A 1 131 ? 38.518 -5.680  12.907 1.00   11.13 ? 672  LEU A CD1 1 
ATOM   1018 C CD2 . LEU A 1 131 ? 40.670 -6.812  13.527 1.00   13.18 ? 672  LEU A CD2 1 
ATOM   1019 N N   . ASN A 1 132 ? 38.635 -6.223  8.758  1.00   14.58 ? 673  ASN A N   1 
ATOM   1020 C CA  . ASN A 1 132 ? 39.406 -5.722  7.636  1.00   14.41 ? 673  ASN A CA  1 
ATOM   1021 C C   . ASN A 1 132 ? 40.240 -4.544  8.125  1.00   13.96 ? 673  ASN A C   1 
ATOM   1022 O O   . ASN A 1 132 ? 39.697 -3.521  8.557  1.00   13.38 ? 673  ASN A O   1 
ATOM   1023 C CB  . ASN A 1 132 ? 38.494 -5.272  6.501  1.00   15.12 ? 673  ASN A CB  1 
ATOM   1024 C CG  . ASN A 1 132 ? 39.220 -5.192  5.176  1.00   14.84 ? 673  ASN A CG  1 
ATOM   1025 O OD1 . ASN A 1 132 ? 40.329 -4.654  5.087  1.00   13.30 ? 673  ASN A OD1 1 
ATOM   1026 N ND2 . ASN A 1 132 ? 38.598 -5.725  4.133  1.00   16.91 ? 673  ASN A ND2 1 
ATOM   1027 N N   . LEU A 1 133 ? 41.558 -4.704  8.054  1.00   13.33 ? 674  LEU A N   1 
ATOM   1028 C CA  . LEU A 1 133 ? 42.490 -3.679  8.497  1.00   13.57 ? 674  LEU A CA  1 
ATOM   1029 C C   . LEU A 1 133 ? 43.521 -3.338  7.431  1.00   13.33 ? 674  LEU A C   1 
ATOM   1030 O O   . LEU A 1 133 ? 44.578 -2.793  7.744  1.00   13.83 ? 674  LEU A O   1 
ATOM   1031 C CB  . LEU A 1 133 ? 43.214 -4.140  9.769  1.00   12.85 ? 674  LEU A CB  1 
ATOM   1032 C CG  . LEU A 1 133 ? 42.370 -4.269  11.035 1.00   12.20 ? 674  LEU A CG  1 
ATOM   1033 C CD1 . LEU A 1 133 ? 43.131 -5.056  12.075 1.00   14.00 ? 674  LEU A CD1 1 
ATOM   1034 C CD2 . LEU A 1 133 ? 42.023 -2.886  11.560 1.00   12.17 ? 674  LEU A CD2 1 
ATOM   1035 N N   . ALA A 1 134 ? 43.214 -3.658  6.178  1.00   12.73 ? 675  ALA A N   1 
ATOM   1036 C CA  . ALA A 1 134 ? 44.130 -3.381  5.083  1.00   12.78 ? 675  ALA A CA  1 
ATOM   1037 C C   . ALA A 1 134 ? 44.236 -1.880  4.805  1.00   14.18 ? 675  ALA A C   1 
ATOM   1038 O O   . ALA A 1 134 ? 43.328 -1.111  5.130  1.00   13.29 ? 675  ALA A O   1 
ATOM   1039 C CB  . ALA A 1 134 ? 43.679 -4.112  3.843  1.00   12.53 ? 675  ALA A CB  1 
ATOM   1040 N N   . SER A 1 135 ? 45.356 -1.478  4.200  1.00   15.94 ? 676  SER A N   1 
ATOM   1041 C CA  . SER A 1 135 ? 45.638 -0.077  3.869  1.00   16.69 ? 676  SER A CA  1 
ATOM   1042 C C   . SER A 1 135 ? 45.725 0.822   5.082  1.00   17.82 ? 676  SER A C   1 
ATOM   1043 O O   . SER A 1 135 ? 45.356 1.993   5.030  1.00   17.99 ? 676  SER A O   1 
ATOM   1044 C CB  . SER A 1 135 ? 44.599 0.490   2.909  1.00   15.15 ? 676  SER A CB  1 
ATOM   1045 O OG  . SER A 1 135 ? 44.879 0.051   1.594  1.00   19.37 ? 676  SER A OG  1 
ATOM   1046 N N   . ASN A 1 136 ? 46.209 0.268   6.184  1.00   18.55 ? 677  ASN A N   1 
ATOM   1047 C CA  . ASN A 1 136 ? 46.360 1.057   7.386  1.00   19.13 ? 677  ASN A CA  1 
ATOM   1048 C C   . ASN A 1 136 ? 47.814 1.095   7.828  1.00   19.94 ? 677  ASN A C   1 
ATOM   1049 O O   . ASN A 1 136 ? 48.451 0.060   8.021  1.00   19.17 ? 677  ASN A O   1 
ATOM   1050 C CB  . ASN A 1 136 ? 45.460 0.518   8.488  1.00   17.82 ? 677  ASN A CB  1 
ATOM   1051 C CG  . ASN A 1 136 ? 44.091 1.149   8.453  1.00   17.05 ? 677  ASN A CG  1 
ATOM   1052 O OD1 . ASN A 1 136 ? 43.957 2.359   8.618  1.00   17.28 ? 677  ASN A OD1 1 
ATOM   1053 N ND2 . ASN A 1 136 ? 43.068 0.341   8.228  1.00   15.33 ? 677  ASN A ND2 1 
ATOM   1054 N N   . PRO A 1 137 ? 48.365 2.310   7.959  1.00   20.84 ? 678  PRO A N   1 
ATOM   1055 C CA  . PRO A 1 137 ? 49.751 2.527   8.372  1.00   22.06 ? 678  PRO A CA  1 
ATOM   1056 C C   . PRO A 1 137 ? 49.946 2.243   9.858  1.00   23.18 ? 678  PRO A C   1 
ATOM   1057 O O   . PRO A 1 137 ? 50.016 3.167   10.676 1.00   23.22 ? 678  PRO A O   1 
ATOM   1058 C CB  . PRO A 1 137 ? 49.978 3.992   8.024  1.00   21.69 ? 678  PRO A CB  1 
ATOM   1059 C CG  . PRO A 1 137 ? 48.640 4.590   8.302  1.00   20.63 ? 678  PRO A CG  1 
ATOM   1060 C CD  . PRO A 1 137 ? 47.708 3.594   7.657  1.00   19.96 ? 678  PRO A CD  1 
ATOM   1061 N N   . PHE A 1 138 ? 50.016 0.962   10.205 1.00   23.70 ? 679  PHE A N   1 
ATOM   1062 C CA  . PHE A 1 138 ? 50.212 0.584   11.592 1.00   24.98 ? 679  PHE A CA  1 
ATOM   1063 C C   . PHE A 1 138 ? 51.650 0.866   12.004 1.00   25.76 ? 679  PHE A C   1 
ATOM   1064 O O   . PHE A 1 138 ? 52.595 0.517   11.289 1.00   25.50 ? 679  PHE A O   1 
ATOM   1065 C CB  . PHE A 1 138 ? 49.894 -0.904  11.803 1.00   24.99 ? 679  PHE A CB  1 
ATOM   1066 C CG  . PHE A 1 138 ? 48.421 -1.219  11.808 1.00   25.24 ? 679  PHE A CG  1 
ATOM   1067 C CD1 . PHE A 1 138 ? 47.818 -1.825  10.709 1.00   23.84 ? 679  PHE A CD1 1 
ATOM   1068 C CD2 . PHE A 1 138 ? 47.632 -0.892  12.908 1.00   24.77 ? 679  PHE A CD2 1 
ATOM   1069 C CE1 . PHE A 1 138 ? 46.456 -2.102  10.701 1.00   21.00 ? 679  PHE A CE1 1 
ATOM   1070 C CE2 . PHE A 1 138 ? 46.266 -1.165  12.910 1.00   23.50 ? 679  PHE A CE2 1 
ATOM   1071 C CZ  . PHE A 1 138 ? 45.679 -1.773  11.799 1.00   23.29 ? 679  PHE A CZ  1 
ATOM   1072 N N   . ASN A 1 139 ? 51.810 1.524   13.149 1.00   26.88 ? 680  ASN A N   1 
ATOM   1073 C CA  . ASN A 1 139 ? 53.136 1.827   13.671 1.00   27.24 ? 680  ASN A CA  1 
ATOM   1074 C C   . ASN A 1 139 ? 53.506 0.654   14.565 1.00   27.17 ? 680  ASN A C   1 
ATOM   1075 O O   . ASN A 1 139 ? 53.005 0.515   15.684 1.00   26.49 ? 680  ASN A O   1 
ATOM   1076 C CB  . ASN A 1 139 ? 53.118 3.118   14.472 1.00   28.81 ? 680  ASN A CB  1 
ATOM   1077 C CG  . ASN A 1 139 ? 54.466 3.784   14.499 1.00   30.90 ? 680  ASN A CG  1 
ATOM   1078 O OD1 . ASN A 1 139 ? 55.393 3.307   15.146 1.00   32.16 ? 680  ASN A OD1 1 
ATOM   1079 N ND2 . ASN A 1 139 ? 54.593 4.886   13.769 1.00   34.19 ? 680  ASN A ND2 1 
ATOM   1080 N N   . CYS A 1 140 ? 54.383 -0.194  14.045 1.00   27.83 ? 681  CYS A N   1 
ATOM   1081 C CA  . CYS A 1 140 ? 54.800 -1.398  14.731 1.00   28.34 ? 681  CYS A CA  1 
ATOM   1082 C C   . CYS A 1 140 ? 55.962 -1.243  15.690 1.00   28.99 ? 681  CYS A C   1 
ATOM   1083 O O   . CYS A 1 140 ? 57.093 -1.620  15.380 1.00   29.35 ? 681  CYS A O   1 
ATOM   1084 C CB  . CYS A 1 140 ? 55.102 -2.475  13.691 1.00   28.71 ? 681  CYS A CB  1 
ATOM   1085 S SG  . CYS A 1 140 ? 53.605 -3.002  12.792 1.00   29.37 ? 681  CYS A SG  1 
ATOM   1086 N N   . ASN A 1 141 ? 55.668 -0.689  16.863 1.00   29.21 ? 682  ASN A N   1 
ATOM   1087 C CA  . ASN A 1 141 ? 56.675 -0.493  17.892 1.00   29.42 ? 682  ASN A CA  1 
ATOM   1088 C C   . ASN A 1 141 ? 56.216 -1.148  19.200 1.00   29.76 ? 682  ASN A C   1 
ATOM   1089 O O   . ASN A 1 141 ? 55.300 -1.972  19.196 1.00   30.27 ? 682  ASN A O   1 
ATOM   1090 C CB  . ASN A 1 141 ? 56.941 1.002   18.092 1.00   29.00 ? 682  ASN A CB  1 
ATOM   1091 C CG  . ASN A 1 141 ? 55.686 1.786   18.400 1.00   28.74 ? 682  ASN A CG  1 
ATOM   1092 O OD1 . ASN A 1 141 ? 54.775 1.281   19.053 1.00   30.67 ? 682  ASN A OD1 1 
ATOM   1093 N ND2 . ASN A 1 141 ? 55.639 3.036   17.952 1.00   24.94 ? 682  ASN A ND2 1 
ATOM   1094 N N   . CYS A 1 142 ? 56.852 -0.788  20.311 1.00   29.68 ? 683  CYS A N   1 
ATOM   1095 C CA  . CYS A 1 142 ? 56.516 -1.354  21.620 1.00   29.49 ? 683  CYS A CA  1 
ATOM   1096 C C   . CYS A 1 142 ? 55.037 -1.163  21.998 1.00   29.06 ? 683  CYS A C   1 
ATOM   1097 O O   . CYS A 1 142 ? 54.477 -1.940  22.780 1.00   28.84 ? 683  CYS A O   1 
ATOM   1098 C CB  . CYS A 1 142 ? 57.396 -0.716  22.704 1.00   30.03 ? 683  CYS A CB  1 
ATOM   1099 S SG  . CYS A 1 142 ? 57.159 1.086   22.803 1.00   33.17 ? 683  CYS A SG  1 
ATOM   1100 N N   . HIS A 1 143 ? 54.414 -0.128  21.442 1.00   27.99 ? 684  HIS A N   1 
ATOM   1101 C CA  . HIS A 1 143 ? 53.016 0.194   21.732 1.00   27.29 ? 684  HIS A CA  1 
ATOM   1102 C C   . HIS A 1 143 ? 51.962 -0.736  21.110 1.00   27.43 ? 684  HIS A C   1 
ATOM   1103 O O   . HIS A 1 143 ? 50.825 -0.806  21.596 1.00   27.18 ? 684  HIS A O   1 
ATOM   1104 C CB  . HIS A 1 143 ? 52.724 1.625   21.286 1.00   26.41 ? 684  HIS A CB  1 
ATOM   1105 C CG  . HIS A 1 143 ? 53.323 2.679   22.164 1.00   25.08 ? 684  HIS A CG  1 
ATOM   1106 N ND1 . HIS A 1 143 ? 52.728 3.098   23.335 1.00   23.48 ? 684  HIS A ND1 1 
ATOM   1107 C CD2 . HIS A 1 143 ? 54.437 3.433   22.017 1.00   24.22 ? 684  HIS A CD2 1 
ATOM   1108 C CE1 . HIS A 1 143 ? 53.447 4.070   23.869 1.00   22.65 ? 684  HIS A CE1 1 
ATOM   1109 N NE2 . HIS A 1 143 ? 54.489 4.292   23.088 1.00   24.32 ? 684  HIS A NE2 1 
ATOM   1110 N N   . LEU A 1 144 ? 52.327 -1.437  20.041 1.00   26.89 ? 685  LEU A N   1 
ATOM   1111 C CA  . LEU A 1 144 ? 51.391 -2.324  19.369 1.00   27.48 ? 685  LEU A CA  1 
ATOM   1112 C C   . LEU A 1 144 ? 51.818 -3.778  19.507 1.00   28.26 ? 685  LEU A C   1 
ATOM   1113 O O   . LEU A 1 144 ? 51.337 -4.647  18.782 1.00   28.65 ? 685  LEU A O   1 
ATOM   1114 C CB  . LEU A 1 144 ? 51.292 -1.942  17.886 1.00   28.74 ? 685  LEU A CB  1 
ATOM   1115 C CG  . LEU A 1 144 ? 50.100 -2.420  17.040 1.00   29.03 ? 685  LEU A CG  1 
ATOM   1116 C CD1 . LEU A 1 144 ? 48.803 -1.818  17.567 1.00   27.88 ? 685  LEU A CD1 1 
ATOM   1117 C CD2 . LEU A 1 144 ? 50.311 -2.003  15.592 1.00   28.87 ? 685  LEU A CD2 1 
ATOM   1118 N N   . ALA A 1 145 ? 52.727 -4.043  20.441 1.00   29.02 ? 686  ALA A N   1 
ATOM   1119 C CA  . ALA A 1 145 ? 53.210 -5.401  20.675 1.00   28.71 ? 686  ALA A CA  1 
ATOM   1120 C C   . ALA A 1 145 ? 52.091 -6.270  21.209 1.00   29.01 ? 686  ALA A C   1 
ATOM   1121 O O   . ALA A 1 145 ? 52.003 -7.439  20.851 1.00   30.54 ? 686  ALA A O   1 
ATOM   1122 C CB  . ALA A 1 145 ? 54.363 -5.390  21.657 1.00   28.67 ? 686  ALA A CB  1 
ATOM   1123 N N   . TRP A 1 146 ? 51.241 -5.706  22.066 1.00   28.75 ? 687  TRP A N   1 
ATOM   1124 C CA  . TRP A 1 146 ? 50.118 -6.451  22.628 1.00   28.40 ? 687  TRP A CA  1 
ATOM   1125 C C   . TRP A 1 146 ? 49.157 -6.877  21.516 1.00   28.25 ? 687  TRP A C   1 
ATOM   1126 O O   . TRP A 1 146 ? 48.712 -8.021  21.470 1.00   27.59 ? 687  TRP A O   1 
ATOM   1127 C CB  . TRP A 1 146 ? 49.346 -5.594  23.630 1.00   29.41 ? 687  TRP A CB  1 
ATOM   1128 C CG  . TRP A 1 146 ? 48.559 -4.500  22.972 1.00   32.67 ? 687  TRP A CG  1 
ATOM   1129 C CD1 . TRP A 1 146 ? 48.990 -3.236  22.681 1.00   35.40 ? 687  TRP A CD1 1 
ATOM   1130 C CD2 . TRP A 1 146 ? 47.233 -4.603  22.435 1.00   33.34 ? 687  TRP A CD2 1 
ATOM   1131 N NE1 . TRP A 1 146 ? 48.018 -2.547  21.993 1.00   35.59 ? 687  TRP A NE1 1 
ATOM   1132 C CE2 . TRP A 1 146 ? 46.929 -3.363  21.827 1.00   35.01 ? 687  TRP A CE2 1 
ATOM   1133 C CE3 . TRP A 1 146 ? 46.275 -5.624  22.403 1.00   32.21 ? 687  TRP A CE3 1 
ATOM   1134 C CZ2 . TRP A 1 146 ? 45.704 -3.117  21.195 1.00   33.69 ? 687  TRP A CZ2 1 
ATOM   1135 C CZ3 . TRP A 1 146 ? 45.059 -5.380  21.775 1.00   32.26 ? 687  TRP A CZ3 1 
ATOM   1136 C CH2 . TRP A 1 146 ? 44.786 -4.135  21.180 1.00   33.87 ? 687  TRP A CH2 1 
ATOM   1137 N N   . PHE A 1 147 ? 48.851 -5.940  20.622 1.00   28.76 ? 688  PHE A N   1 
ATOM   1138 C CA  . PHE A 1 147 ? 47.934 -6.166  19.509 1.00   29.61 ? 688  PHE A CA  1 
ATOM   1139 C C   . PHE A 1 147 ? 48.349 -7.275  18.550 1.00   30.16 ? 688  PHE A C   1 
ATOM   1140 O O   . PHE A 1 147 ? 47.507 -8.026  18.059 1.00   29.69 ? 688  PHE A O   1 
ATOM   1141 C CB  . PHE A 1 147 ? 47.747 -4.873  18.717 1.00   30.06 ? 688  PHE A CB  1 
ATOM   1142 C CG  . PHE A 1 147 ? 46.727 -4.983  17.623 1.00   31.79 ? 688  PHE A CG  1 
ATOM   1143 C CD1 . PHE A 1 147 ? 45.386 -5.206  17.926 1.00   31.81 ? 688  PHE A CD1 1 
ATOM   1144 C CD2 . PHE A 1 147 ? 47.108 -4.904  16.288 1.00   32.96 ? 688  PHE A CD2 1 
ATOM   1145 C CE1 . PHE A 1 147 ? 44.442 -5.352  16.919 1.00   32.16 ? 688  PHE A CE1 1 
ATOM   1146 C CE2 . PHE A 1 147 ? 46.166 -5.048  15.270 1.00   33.87 ? 688  PHE A CE2 1 
ATOM   1147 C CZ  . PHE A 1 147 ? 44.831 -5.273  15.589 1.00   33.30 ? 688  PHE A CZ  1 
ATOM   1148 N N   . ALA A 1 148 ? 49.643 -7.363  18.267 1.00   31.00 ? 689  ALA A N   1 
ATOM   1149 C CA  . ALA A 1 148 ? 50.154 -8.391  17.371 1.00   32.72 ? 689  ALA A CA  1 
ATOM   1150 C C   . ALA A 1 148 ? 49.729 -9.771  17.855 1.00   34.25 ? 689  ALA A C   1 
ATOM   1151 O O   . ALA A 1 148 ? 49.116 -10.546 17.116 1.00   34.07 ? 689  ALA A O   1 
ATOM   1152 C CB  . ALA A 1 148 ? 51.667 -8.318  17.311 1.00   33.06 ? 689  ALA A CB  1 
ATOM   1153 N N   . GLU A 1 149 ? 50.065 -10.060 19.110 1.00   35.95 ? 690  GLU A N   1 
ATOM   1154 C CA  . GLU A 1 149 ? 49.754 -11.337 19.740 1.00   37.36 ? 690  GLU A CA  1 
ATOM   1155 C C   . GLU A 1 149 ? 48.249 -11.539 19.922 1.00   37.59 ? 690  GLU A C   1 
ATOM   1156 O O   . GLU A 1 149 ? 47.805 -12.628 20.283 1.00   37.79 ? 690  GLU A O   1 
ATOM   1157 C CB  . GLU A 1 149 ? 50.449 -11.430 21.102 1.00   39.48 ? 690  GLU A CB  1 
ATOM   1158 C CG  . GLU A 1 149 ? 51.855 -10.834 21.136 1.00   43.86 ? 690  GLU A CG  1 
ATOM   1159 C CD  . GLU A 1 149 ? 52.822 -11.508 20.173 1.00   46.55 ? 690  GLU A CD  1 
ATOM   1160 O OE1 . GLU A 1 149 ? 53.194 -12.682 20.404 1.00   48.58 ? 690  GLU A OE1 1 
ATOM   1161 O OE2 . GLU A 1 149 ? 53.212 -10.858 19.179 1.00   47.84 ? 690  GLU A OE2 1 
ATOM   1162 N N   . TRP A 1 150 ? 47.467 -10.492 19.678 1.00   37.72 ? 691  TRP A N   1 
ATOM   1163 C CA  . TRP A 1 150 ? 46.016 -10.589 19.816 1.00   37.95 ? 691  TRP A CA  1 
ATOM   1164 C C   . TRP A 1 150 ? 45.376 -11.120 18.531 1.00   38.41 ? 691  TRP A C   1 
ATOM   1165 O O   . TRP A 1 150 ? 44.347 -11.798 18.566 1.00   37.93 ? 691  TRP A O   1 
ATOM   1166 C CB  . TRP A 1 150 ? 45.418 -9.225  20.145 1.00   37.17 ? 691  TRP A CB  1 
ATOM   1167 C CG  . TRP A 1 150 ? 43.936 -9.281  20.247 1.00   37.29 ? 691  TRP A CG  1 
ATOM   1168 C CD1 . TRP A 1 150 ? 43.197 -9.707  21.319 1.00   37.59 ? 691  TRP A CD1 1 
ATOM   1169 C CD2 . TRP A 1 150 ? 43.002 -8.990  19.206 1.00   37.40 ? 691  TRP A CD2 1 
ATOM   1170 N NE1 . TRP A 1 150 ? 41.859 -9.704  21.003 1.00   37.10 ? 691  TRP A NE1 1 
ATOM   1171 C CE2 . TRP A 1 150 ? 41.711 -9.268  19.711 1.00   37.07 ? 691  TRP A CE2 1 
ATOM   1172 C CE3 . TRP A 1 150 ? 43.129 -8.523  17.890 1.00   36.43 ? 691  TRP A CE3 1 
ATOM   1173 C CZ2 . TRP A 1 150 ? 40.556 -9.095  18.946 1.00   36.09 ? 691  TRP A CZ2 1 
ATOM   1174 C CZ3 . TRP A 1 150 ? 41.978 -8.352  17.129 1.00   36.42 ? 691  TRP A CZ3 1 
ATOM   1175 C CH2 . TRP A 1 150 ? 40.710 -8.639  17.661 1.00   36.42 ? 691  TRP A CH2 1 
ATOM   1176 N N   . LEU A 1 151 ? 45.992 -10.792 17.400 1.00   39.06 ? 692  LEU A N   1 
ATOM   1177 C CA  . LEU A 1 151 ? 45.508 -11.219 16.096 1.00   39.69 ? 692  LEU A CA  1 
ATOM   1178 C C   . LEU A 1 151 ? 45.779 -12.703 15.901 1.00   41.31 ? 692  LEU A C   1 
ATOM   1179 O O   . LEU A 1 151 ? 44.896 -13.465 15.487 1.00   40.72 ? 692  LEU A O   1 
ATOM   1180 C CB  . LEU A 1 151 ? 46.217 -10.431 14.993 1.00   38.12 ? 692  LEU A CB  1 
ATOM   1181 C CG  . LEU A 1 151 ? 45.945 -8.933  14.862 1.00   36.09 ? 692  LEU A CG  1 
ATOM   1182 C CD1 . LEU A 1 151 ? 46.979 -8.311  13.937 1.00   35.16 ? 692  LEU A CD1 1 
ATOM   1183 C CD2 . LEU A 1 151 ? 44.543 -8.710  14.329 1.00   33.29 ? 692  LEU A CD2 1 
ATOM   1184 N N   . ARG A 1 152 ? 47.011 -13.110 16.200 1.00   43.10 ? 693  ARG A N   1 
ATOM   1185 C CA  . ARG A 1 152 ? 47.402 -14.506 16.050 1.00   44.55 ? 693  ARG A CA  1 
ATOM   1186 C C   . ARG A 1 152 ? 46.677 -15.385 17.058 1.00   44.78 ? 693  ARG A C   1 
ATOM   1187 O O   . ARG A 1 152 ? 46.703 -16.607 16.954 1.00   44.40 ? 693  ARG A O   1 
ATOM   1188 C CB  . ARG A 1 152 ? 48.913 -14.669 16.230 1.00   45.16 ? 693  ARG A CB  1 
ATOM   1189 C CG  . ARG A 1 152 ? 49.394 -14.460 17.649 1.00   47.63 ? 693  ARG A CG  1 
ATOM   1190 C CD  . ARG A 1 152 ? 50.723 -15.160 17.861 1.00   49.62 ? 693  ARG A CD  1 
ATOM   1191 N NE  . ARG A 1 152 ? 51.739 -14.708 16.915 1.00   50.05 ? 693  ARG A NE  1 
ATOM   1192 C CZ  . ARG A 1 152 ? 52.240 -13.479 16.898 1.00   51.49 ? 693  ARG A CZ  1 
ATOM   1193 N NH1 . ARG A 1 152 ? 51.815 -12.585 17.775 1.00   52.50 ? 693  ARG A NH1 1 
ATOM   1194 N NH2 . ARG A 1 152 ? 53.172 -13.144 16.015 1.00   52.76 ? 693  ARG A NH2 1 
ATOM   1195 N N   . LYS A 1 153 ? 46.033 -14.758 18.035 1.00   45.71 ? 694  LYS A N   1 
ATOM   1196 C CA  . LYS A 1 153 ? 45.308 -15.510 19.045 1.00   47.07 ? 694  LYS A CA  1 
ATOM   1197 C C   . LYS A 1 153 ? 43.908 -15.764 18.527 1.00   47.65 ? 694  LYS A C   1 
ATOM   1198 O O   . LYS A 1 153 ? 43.579 -16.882 18.137 1.00   48.03 ? 694  LYS A O   1 
ATOM   1199 C CB  . LYS A 1 153 ? 45.238 -14.733 20.364 1.00   47.79 ? 694  LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 153 ? 44.947 -15.615 21.578 1.00   48.85 ? 694  LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 153 ? 43.582 -16.299 21.489 1.00   49.66 ? 694  LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 153 ? 43.525 -17.569 22.341 1.00   50.23 ? 694  LYS A CE  1 
ATOM   1203 N NZ  . LYS A 1 153 ? 43.850 -17.339 23.776 1.00   48.69 ? 694  LYS A NZ  1 
ATOM   1204 N N   . LYS A 1 154 ? 43.089 -14.718 18.532 1.00   48.26 ? 695  LYS A N   1 
ATOM   1205 C CA  . LYS A 1 154 ? 41.719 -14.813 18.056 1.00   48.84 ? 695  LYS A CA  1 
ATOM   1206 C C   . LYS A 1 154 ? 41.653 -15.597 16.749 1.00   49.36 ? 695  LYS A C   1 
ATOM   1207 O O   . LYS A 1 154 ? 40.652 -16.254 16.462 1.00   49.42 ? 695  LYS A O   1 
ATOM   1208 C CB  . LYS A 1 154 ? 41.140 -13.412 17.868 1.00   48.75 ? 695  LYS A CB  1 
ATOM   1209 C CG  . LYS A 1 154 ? 40.561 -12.809 19.138 1.00   48.74 ? 695  LYS A CG  1 
ATOM   1210 C CD  . LYS A 1 154 ? 39.130 -13.285 19.366 1.00   49.05 ? 695  LYS A CD  1 
ATOM   1211 C CE  . LYS A 1 154 ? 38.186 -12.762 18.270 1.00   48.44 ? 695  LYS A CE  1 
ATOM   1212 N NZ  . LYS A 1 154 ? 36.765 -13.206 18.442 1.00   47.52 ? 695  LYS A NZ  1 
ATOM   1213 N N   . SER A 1 155 ? 42.726 -15.533 15.965 1.00   49.85 ? 696  SER A N   1 
ATOM   1214 C CA  . SER A 1 155 ? 42.793 -16.256 14.700 1.00   51.33 ? 696  SER A CA  1 
ATOM   1215 C C   . SER A 1 155 ? 41.726 -15.795 13.706 1.00   51.88 ? 696  SER A C   1 
ATOM   1216 O O   . SER A 1 155 ? 40.578 -16.245 13.749 1.00   52.03 ? 696  SER A O   1 
ATOM   1217 C CB  . SER A 1 155 ? 42.636 -17.757 14.951 1.00   52.30 ? 696  SER A CB  1 
ATOM   1218 O OG  . SER A 1 155 ? 43.558 -18.212 15.927 1.00   54.85 ? 696  SER A OG  1 
ATOM   1219 N N   . LEU A 1 156 ? 42.116 -14.907 12.802 1.00   52.06 ? 697  LEU A N   1 
ATOM   1220 C CA  . LEU A 1 156 ? 41.201 -14.386 11.804 1.00   52.52 ? 697  LEU A CA  1 
ATOM   1221 C C   . LEU A 1 156 ? 41.916 -14.380 10.462 0.0000 52.45 ? 697  LEU A C   1 
ATOM   1222 O O   . LEU A 1 156 ? 42.969 -14.999 10.312 0.0000 52.52 ? 697  LEU A O   1 
ATOM   1223 C CB  . LEU A 1 156 ? 40.789 -12.961 12.181 1.00   53.44 ? 697  LEU A CB  1 
ATOM   1224 C CG  . LEU A 1 156 ? 40.185 -12.768 13.577 1.00   54.80 ? 697  LEU A CG  1 
ATOM   1225 C CD1 . LEU A 1 156 ? 40.046 -11.285 13.878 1.00   55.40 ? 697  LEU A CD1 1 
ATOM   1226 C CD2 . LEU A 1 156 ? 38.833 -13.460 13.661 1.00   55.32 ? 697  LEU A CD2 1 
ATOM   1227 N N   . ASN A 1 157 ? 41.345 -13.683 9.485  0.0000 52.39 ? 698  ASN A N   1 
ATOM   1228 C CA  . ASN A 1 157 ? 41.966 -13.592 8.171  0.0000 52.25 ? 698  ASN A CA  1 
ATOM   1229 C C   . ASN A 1 157 ? 43.217 -12.738 8.333  0.0000 52.00 ? 698  ASN A C   1 
ATOM   1230 O O   . ASN A 1 157 ? 43.857 -12.348 7.357  0.0000 52.11 ? 698  ASN A O   1 
ATOM   1231 C CB  . ASN A 1 157 ? 41.009 -12.937 7.172  0.0000 52.54 ? 698  ASN A CB  1 
ATOM   1232 C CG  . ASN A 1 157 ? 39.734 -13.734 6.979  0.0000 52.83 ? 698  ASN A CG  1 
ATOM   1233 O OD1 . ASN A 1 157 ? 39.768 -14.892 6.562  0.0000 53.26 ? 698  ASN A OD1 1 
ATOM   1234 N ND2 . ASN A 1 157 ? 38.598 -13.115 7.281  0.0000 53.06 ? 698  ASN A ND2 1 
ATOM   1235 N N   . GLY A 1 158 ? 43.552 -12.458 9.590  1.00   51.91 ? 699  GLY A N   1 
ATOM   1236 C CA  . GLY A 1 158 ? 44.716 -11.650 9.905  1.00   51.17 ? 699  GLY A CA  1 
ATOM   1237 C C   . GLY A 1 158 ? 44.388 -10.171 9.846  1.00   50.34 ? 699  GLY A C   1 
ATOM   1238 O O   . GLY A 1 158 ? 45.084 -9.347  10.437 1.00   50.44 ? 699  GLY A O   1 
ATOM   1239 N N   . GLY A 1 159 ? 43.310 -9.840  9.138  1.00   49.42 ? 700  GLY A N   1 
ATOM   1240 C CA  . GLY A 1 159 ? 42.908 -8.453  8.987  1.00   47.42 ? 700  GLY A CA  1 
ATOM   1241 C C   . GLY A 1 159 ? 43.602 -7.815  7.795  1.00   45.87 ? 700  GLY A C   1 
ATOM   1242 O O   . GLY A 1 159 ? 43.274 -6.695  7.404  1.00   45.54 ? 700  GLY A O   1 
ATOM   1243 N N   . ALA A 1 160 ? 44.560 -8.543  7.217  1.00   44.24 ? 701  ALA A N   1 
ATOM   1244 C CA  . ALA A 1 160 ? 45.337 -8.076  6.071  1.00   42.27 ? 701  ALA A CA  1 
ATOM   1245 C C   . ALA A 1 160 ? 46.144 -6.855  6.499  1.00   41.09 ? 701  ALA A C   1 
ATOM   1246 O O   . ALA A 1 160 ? 46.651 -6.096  5.665  1.00   40.46 ? 701  ALA A O   1 
ATOM   1247 C CB  . ALA A 1 160 ? 44.412 -7.725  4.911  1.00   41.45 ? 701  ALA A CB  1 
ATOM   1248 N N   . ALA A 1 161 ? 46.257 -6.687  7.816  1.00   39.62 ? 702  ALA A N   1 
ATOM   1249 C CA  . ALA A 1 161 ? 46.981 -5.573  8.416  1.00   38.24 ? 702  ALA A CA  1 
ATOM   1250 C C   . ALA A 1 161 ? 48.494 -5.674  8.225  1.00   37.38 ? 702  ALA A C   1 
ATOM   1251 O O   . ALA A 1 161 ? 49.094 -6.733  8.428  1.00   36.47 ? 702  ALA A O   1 
ATOM   1252 C CB  . ALA A 1 161 ? 46.648 -5.492  9.894  1.00   37.81 ? 702  ALA A CB  1 
ATOM   1253 N N   . ARG A 1 162 ? 49.108 -4.562  7.839  1.00   36.61 ? 703  ARG A N   1 
ATOM   1254 C CA  . ARG A 1 162 ? 50.544 -4.530  7.623  1.00   36.51 ? 703  ARG A CA  1 
ATOM   1255 C C   . ARG A 1 162 ? 51.185 -3.343  8.329  1.00   36.40 ? 703  ARG A C   1 
ATOM   1256 O O   . ARG A 1 162 ? 50.525 -2.344  8.597  1.00   35.79 ? 703  ARG A O   1 
ATOM   1257 C CB  . ARG A 1 162 ? 50.850 -4.443  6.129  1.00   37.57 ? 703  ARG A CB  1 
ATOM   1258 C CG  . ARG A 1 162 ? 50.474 -5.662  5.302  1.00   38.68 ? 703  ARG A CG  1 
ATOM   1259 C CD  . ARG A 1 162 ? 50.899 -5.438  3.854  1.00   41.94 ? 703  ARG A CD  1 
ATOM   1260 N NE  . ARG A 1 162 ? 50.572 -6.548  2.963  1.00   45.71 ? 703  ARG A NE  1 
ATOM   1261 C CZ  . ARG A 1 162 ? 51.008 -7.795  3.122  1.00   48.79 ? 703  ARG A CZ  1 
ATOM   1262 N NH1 . ARG A 1 162 ? 51.789 -8.106  4.151  1.00   49.80 ? 703  ARG A NH1 1 
ATOM   1263 N NH2 . ARG A 1 162 ? 50.677 -8.731  2.239  1.00   49.76 ? 703  ARG A NH2 1 
ATOM   1264 N N   . CYS A 1 163 ? 52.475 -3.454  8.625  1.00   36.81 ? 704  CYS A N   1 
ATOM   1265 C CA  . CYS A 1 163 ? 53.182 -2.365  9.288  1.00   37.93 ? 704  CYS A CA  1 
ATOM   1266 C C   . CYS A 1 163 ? 53.488 -1.267  8.284  1.00   39.60 ? 704  CYS A C   1 
ATOM   1267 O O   . CYS A 1 163 ? 53.883 -1.543  7.154  1.00   40.14 ? 704  CYS A O   1 
ATOM   1268 C CB  . CYS A 1 163 ? 54.491 -2.861  9.907  1.00   35.79 ? 704  CYS A CB  1 
ATOM   1269 S SG  . CYS A 1 163 ? 54.287 -4.096  11.223 1.00   29.01 ? 704  CYS A SG  1 
ATOM   1270 N N   . GLY A 1 164 ? 53.312 -0.020  8.697  1.00   41.24 ? 705  GLY A N   1 
ATOM   1271 C CA  . GLY A 1 164 ? 53.586 1.080   7.793  1.00   44.17 ? 705  GLY A CA  1 
ATOM   1272 C C   . GLY A 1 164 ? 54.431 2.185   8.403  1.00   46.41 ? 705  GLY A C   1 
ATOM   1273 O O   . GLY A 1 164 ? 54.267 3.355   8.043  1.00   46.34 ? 705  GLY A O   1 
ATOM   1274 N N   . ALA A 1 165 ? 55.332 1.822   9.319  1.00   48.38 ? 706  ALA A N   1 
ATOM   1275 C CA  . ALA A 1 165 ? 56.201 2.801   9.974  1.00   50.48 ? 706  ALA A CA  1 
ATOM   1276 C C   . ALA A 1 165 ? 57.639 2.307   10.190 1.00   52.29 ? 706  ALA A C   1 
ATOM   1277 O O   . ALA A 1 165 ? 58.597 2.922   9.700  1.00   53.22 ? 706  ALA A O   1 
ATOM   1278 C CB  . ALA A 1 165 ? 55.591 3.233   11.308 1.00   51.29 ? 706  ALA A CB  1 
ATOM   1279 N N   . PRO A 1 166 ? 57.817 1.201   10.936 1.00   52.60 ? 707  PRO A N   1 
ATOM   1280 C CA  . PRO A 1 166 ? 59.186 0.709   11.156 1.00   52.54 ? 707  PRO A CA  1 
ATOM   1281 C C   . PRO A 1 166 ? 59.838 0.262   9.846  1.00   52.64 ? 707  PRO A C   1 
ATOM   1282 O O   . PRO A 1 166 ? 59.770 -0.914  9.482  1.00   52.44 ? 707  PRO A O   1 
ATOM   1283 C CB  . PRO A 1 166 ? 58.985 -0.454  12.125 1.00   53.13 ? 707  PRO A CB  1 
ATOM   1284 C CG  . PRO A 1 166 ? 57.697 -0.091  12.843 1.00   53.41 ? 707  PRO A CG  1 
ATOM   1285 C CD  . PRO A 1 166 ? 56.842 0.424   11.721 1.00   52.01 ? 707  PRO A CD  1 
ATOM   1286 N N   . SER A 1 167 ? 60.462 1.214   9.153  1.00   52.49 ? 708  SER A N   1 
ATOM   1287 C CA  . SER A 1 167 ? 61.135 0.977   7.870  1.00   52.10 ? 708  SER A CA  1 
ATOM   1288 C C   . SER A 1 167 ? 61.462 -0.486  7.606  1.00   51.72 ? 708  SER A C   1 
ATOM   1289 O O   . SER A 1 167 ? 61.055 -1.052  6.594  1.00   51.30 ? 708  SER A O   1 
ATOM   1290 C CB  . SER A 1 167 ? 62.431 1.788   7.800  1.00   51.71 ? 708  SER A CB  1 
ATOM   1291 O OG  . SER A 1 167 ? 62.209 3.129   8.193  1.00   52.13 ? 708  SER A OG  1 
ATOM   1292 N N   . LYS A 1 168 ? 62.202 -1.086  8.531  1.00   51.66 ? 709  LYS A N   1 
ATOM   1293 C CA  . LYS A 1 168 ? 62.613 -2.479  8.419  1.00   51.86 ? 709  LYS A CA  1 
ATOM   1294 C C   . LYS A 1 168 ? 61.442 -3.436  8.221  1.00   51.69 ? 709  LYS A C   1 
ATOM   1295 O O   . LYS A 1 168 ? 61.394 -4.171  7.232  1.00   51.70 ? 709  LYS A O   1 
ATOM   1296 C CB  . LYS A 1 168 ? 63.413 -2.896  9.663  1.00   51.70 ? 709  LYS A CB  1 
ATOM   1297 C CG  . LYS A 1 168 ? 64.712 -2.125  9.854  1.00   52.18 ? 709  LYS A CG  1 
ATOM   1298 C CD  . LYS A 1 168 ? 64.464 -0.650  10.173 1.00   52.87 ? 709  LYS A CD  1 
ATOM   1299 C CE  . LYS A 1 168 ? 64.146 -0.425  11.648 1.00   52.71 ? 709  LYS A CE  1 
ATOM   1300 N NZ  . LYS A 1 168 ? 63.026 -1.273  12.140 1.00   53.71 ? 709  LYS A NZ  1 
ATOM   1301 N N   . VAL A 1 169 ? 60.501 -3.420  9.159  1.00   51.47 ? 710  VAL A N   1 
ATOM   1302 C CA  . VAL A 1 169 ? 59.346 -4.306  9.094  1.00   51.31 ? 710  VAL A CA  1 
ATOM   1303 C C   . VAL A 1 169 ? 58.222 -3.790  8.199  1.00   50.87 ? 710  VAL A C   1 
ATOM   1304 O O   . VAL A 1 169 ? 57.191 -4.440  8.058  1.00   50.74 ? 710  VAL A O   1 
ATOM   1305 C CB  . VAL A 1 169 ? 58.773 -4.559  10.502 1.00   51.92 ? 710  VAL A CB  1 
ATOM   1306 C CG1 . VAL A 1 169 ? 59.888 -4.981  11.446 1.00   51.55 ? 710  VAL A CG1 1 
ATOM   1307 C CG2 . VAL A 1 169 ? 58.074 -3.310  11.013 1.00   52.65 ? 710  VAL A CG2 1 
ATOM   1308 N N   . ARG A 1 170 ? 58.422 -2.623  7.599  1.00   50.73 ? 711  ARG A N   1 
ATOM   1309 C CA  . ARG A 1 170 ? 57.419 -2.028  6.720  1.00   50.57 ? 711  ARG A CA  1 
ATOM   1310 C C   . ARG A 1 170 ? 56.770 -3.059  5.803  1.00   49.87 ? 711  ARG A C   1 
ATOM   1311 O O   . ARG A 1 170 ? 57.388 -4.068  5.452  1.00   49.83 ? 711  ARG A O   1 
ATOM   1312 C CB  . ARG A 1 170 ? 58.056 -0.931  5.871  1.00   51.80 ? 711  ARG A CB  1 
ATOM   1313 C CG  . ARG A 1 170 ? 57.114 -0.268  4.886  1.00   53.59 ? 711  ARG A CG  1 
ATOM   1314 C CD  . ARG A 1 170 ? 57.856 0.808   4.125  1.00   56.24 ? 711  ARG A CD  1 
ATOM   1315 N NE  . ARG A 1 170 ? 56.992 1.579   3.241  1.00   59.10 ? 711  ARG A NE  1 
ATOM   1316 C CZ  . ARG A 1 170 ? 57.425 2.567   2.465  1.00   62.25 ? 711  ARG A CZ  1 
ATOM   1317 N NH1 . ARG A 1 170 ? 58.714 2.894   2.472  1.00   62.12 ? 711  ARG A NH1 1 
ATOM   1318 N NH2 . ARG A 1 170 ? 56.576 3.228   1.683  1.00   62.22 ? 711  ARG A NH2 1 
ATOM   1319 N N   . ASP A 1 171 ? 55.520 -2.792  5.427  1.00   48.52 ? 712  ASP A N   1 
ATOM   1320 C CA  . ASP A 1 171 ? 54.748 -3.669  4.553  1.00   47.57 ? 712  ASP A CA  1 
ATOM   1321 C C   . ASP A 1 171 ? 54.637 -5.130  4.993  1.00   46.33 ? 712  ASP A C   1 
ATOM   1322 O O   . ASP A 1 171 ? 54.062 -5.955  4.281  1.00   46.00 ? 712  ASP A O   1 
ATOM   1323 C CB  . ASP A 1 171 ? 55.302 -3.612  3.127  1.00   48.43 ? 712  ASP A CB  1 
ATOM   1324 C CG  . ASP A 1 171 ? 54.533 -2.648  2.243  1.00   49.49 ? 712  ASP A CG  1 
ATOM   1325 O OD1 . ASP A 1 171 ? 53.289 -2.786  2.165  1.00   49.57 ? 712  ASP A OD1 1 
ATOM   1326 O OD2 . ASP A 1 171 ? 55.167 -1.760  1.629  1.00   48.70 ? 712  ASP A OD2 1 
ATOM   1327 N N   . VAL A 1 172 ? 55.177 -5.452  6.161  1.00   45.07 ? 713  VAL A N   1 
ATOM   1328 C CA  . VAL A 1 172 ? 55.119 -6.820  6.658  1.00   44.12 ? 713  VAL A CA  1 
ATOM   1329 C C   . VAL A 1 172 ? 53.839 -7.020  7.469  1.00   43.42 ? 713  VAL A C   1 
ATOM   1330 O O   . VAL A 1 172 ? 53.310 -6.074  8.053  1.00   43.15 ? 713  VAL A O   1 
ATOM   1331 C CB  . VAL A 1 172 ? 56.352 -7.144  7.554  1.00   44.18 ? 713  VAL A CB  1 
ATOM   1332 C CG1 . VAL A 1 172 ? 56.313 -8.597  8.004  1.00   42.89 ? 713  VAL A CG1 1 
ATOM   1333 C CG2 . VAL A 1 172 ? 57.641 -6.860  6.793  1.00   43.04 ? 713  VAL A CG2 1 
ATOM   1334 N N   . GLN A 1 173 ? 53.342 -8.252  7.493  1.00   42.88 ? 714  GLN A N   1 
ATOM   1335 C CA  . GLN A 1 173 ? 52.137 -8.574  8.243  1.00   42.24 ? 714  GLN A CA  1 
ATOM   1336 C C   . GLN A 1 173 ? 52.387 -8.567  9.745  1.00   42.00 ? 714  GLN A C   1 
ATOM   1337 O O   . GLN A 1 173 ? 53.247 -9.291  10.238 1.00   41.82 ? 714  GLN A O   1 
ATOM   1338 C CB  . GLN A 1 173 ? 51.614 -9.948  7.838  1.00   41.68 ? 714  GLN A CB  1 
ATOM   1339 C CG  . GLN A 1 173 ? 50.928 -9.987  6.493  1.00   42.16 ? 714  GLN A CG  1 
ATOM   1340 C CD  . GLN A 1 173 ? 50.200 -11.298 6.268  1.00   42.77 ? 714  GLN A CD  1 
ATOM   1341 O OE1 . GLN A 1 173 ? 49.442 -11.759 7.130  1.00   41.38 ? 714  GLN A OE1 1 
ATOM   1342 N NE2 . GLN A 1 173 ? 50.418 -11.904 5.106  1.00   41.50 ? 714  GLN A NE2 1 
ATOM   1343 N N   . ILE A 1 174 ? 51.626 -7.751  10.467 1.00   42.55 ? 715  ILE A N   1 
ATOM   1344 C CA  . ILE A 1 174 ? 51.752 -7.649  11.922 1.00   42.99 ? 715  ILE A CA  1 
ATOM   1345 C C   . ILE A 1 174 ? 51.863 -9.042  12.538 1.00   43.72 ? 715  ILE A C   1 
ATOM   1346 O O   . ILE A 1 174 ? 52.787 -9.339  13.293 1.00   43.30 ? 715  ILE A O   1 
ATOM   1347 C CB  . ILE A 1 174 ? 50.511 -6.979  12.551 1.00   41.95 ? 715  ILE A CB  1 
ATOM   1348 C CG1 . ILE A 1 174 ? 50.051 -5.795  11.703 1.00   41.38 ? 715  ILE A CG1 1 
ATOM   1349 C CG2 . ILE A 1 174 ? 50.829 -6.529  13.950 1.00   41.85 ? 715  ILE A CG2 1 
ATOM   1350 C CD1 . ILE A 1 174 ? 51.125 -4.798  11.398 1.00   41.38 ? 715  ILE A CD1 1 
ATOM   1351 N N   . LYS A 1 175 ? 50.897 -9.884  12.195 1.00   44.85 ? 716  LYS A N   1 
ATOM   1352 C CA  . LYS A 1 175 ? 50.809 -11.254 12.681 1.00   45.94 ? 716  LYS A CA  1 
ATOM   1353 C C   . LYS A 1 175 ? 52.039 -12.095 12.340 1.00   46.75 ? 716  LYS A C   1 
ATOM   1354 O O   . LYS A 1 175 ? 52.337 -13.078 13.020 1.00   46.61 ? 716  LYS A O   1 
ATOM   1355 C CB  . LYS A 1 175 ? 49.553 -11.898 12.099 1.00   45.65 ? 716  LYS A CB  1 
ATOM   1356 C CG  . LYS A 1 175 ? 49.303 -13.329 12.521 1.00   45.82 ? 716  LYS A CG  1 
ATOM   1357 C CD  . LYS A 1 175 ? 48.095 -13.897 11.779 1.00   45.36 ? 716  LYS A CD  1 
ATOM   1358 C CE  . LYS A 1 175 ? 48.172 -13.622 10.272 1.00   43.87 ? 716  LYS A CE  1 
ATOM   1359 N NZ  . LYS A 1 175 ? 49.464 -14.051 9.662  1.00   40.68 ? 716  LYS A NZ  1 
ATOM   1360 N N   . ASP A 1 176 ? 52.748 -11.708 11.286 1.00   47.55 ? 717  ASP A N   1 
ATOM   1361 C CA  . ASP A 1 176 ? 53.947 -12.424 10.858 1.00   48.22 ? 717  ASP A CA  1 
ATOM   1362 C C   . ASP A 1 176 ? 55.192 -11.955 11.603 1.00   48.74 ? 717  ASP A C   1 
ATOM   1363 O O   . ASP A 1 176 ? 56.313 -12.285 11.217 1.00   48.99 ? 717  ASP A O   1 
ATOM   1364 C CB  . ASP A 1 176 ? 54.168 -12.235 9.354  1.00   48.45 ? 717  ASP A CB  1 
ATOM   1365 C CG  . ASP A 1 176 ? 53.280 -13.130 8.513  1.00   47.49 ? 717  ASP A CG  1 
ATOM   1366 O OD1 . ASP A 1 176 ? 52.124 -13.378 8.919  1.00   48.23 ? 717  ASP A OD1 1 
ATOM   1367 O OD2 . ASP A 1 176 ? 53.740 -13.572 7.438  1.00   45.87 ? 717  ASP A OD2 1 
ATOM   1368 N N   . LEU A 1 177 ? 54.999 -11.181 12.663 1.00   49.07 ? 718  LEU A N   1 
ATOM   1369 C CA  . LEU A 1 177 ? 56.125 -10.682 13.439 1.00   49.20 ? 718  LEU A CA  1 
ATOM   1370 C C   . LEU A 1 177 ? 55.993 -11.066 14.901 1.00   49.88 ? 718  LEU A C   1 
ATOM   1371 O O   . LEU A 1 177 ? 54.916 -10.958 15.490 1.00   49.97 ? 718  LEU A O   1 
ATOM   1372 C CB  . LEU A 1 177 ? 56.221 -9.158  13.330 1.00   48.32 ? 718  LEU A CB  1 
ATOM   1373 C CG  . LEU A 1 177 ? 56.584 -8.566  11.971 1.00   48.04 ? 718  LEU A CG  1 
ATOM   1374 C CD1 . LEU A 1 177 ? 56.464 -7.050  12.020 1.00   47.50 ? 718  LEU A CD1 1 
ATOM   1375 C CD2 . LEU A 1 177 ? 57.997 -8.984  11.601 1.00   47.24 ? 718  LEU A CD2 1 
ATOM   1376 N N   . PRO A 1 178 ? 57.092 -11.538 15.505 1.00   50.61 ? 719  PRO A N   1 
ATOM   1377 C CA  . PRO A 1 178 ? 57.064 -11.926 16.916 1.00   50.77 ? 719  PRO A CA  1 
ATOM   1378 C C   . PRO A 1 178 ? 57.149 -10.661 17.761 1.00   51.00 ? 719  PRO A C   1 
ATOM   1379 O O   . PRO A 1 178 ? 57.907 -9.748  17.436 1.00   50.76 ? 719  PRO A O   1 
ATOM   1380 C CB  . PRO A 1 178 ? 58.302 -12.805 17.047 1.00   50.81 ? 719  PRO A CB  1 
ATOM   1381 C CG  . PRO A 1 178 ? 59.263 -12.144 16.100 1.00   50.12 ? 719  PRO A CG  1 
ATOM   1382 C CD  . PRO A 1 178 ? 58.395 -11.861 14.893 1.00   50.62 ? 719  PRO A CD  1 
ATOM   1383 N N   . HIS A 1 179 ? 56.369 -10.603 18.835 1.00   51.54 ? 720  HIS A N   1 
ATOM   1384 C CA  . HIS A 1 179 ? 56.368 -9.433  19.711 1.00   52.65 ? 720  HIS A CA  1 
ATOM   1385 C C   . HIS A 1 179 ? 57.790 -9.017  20.082 1.00   52.44 ? 720  HIS A C   1 
ATOM   1386 O O   . HIS A 1 179 ? 58.017 -7.920  20.600 1.00   52.21 ? 720  HIS A O   1 
ATOM   1387 C CB  . HIS A 1 179 ? 55.563 -9.721  20.980 1.00   54.92 ? 720  HIS A CB  1 
ATOM   1388 C CG  . HIS A 1 179 ? 56.042 -10.918 21.739 1.00   59.04 ? 720  HIS A CG  1 
ATOM   1389 N ND1 . HIS A 1 179 ? 56.141 -12.170 21.169 1.00   60.67 ? 720  HIS A ND1 1 
ATOM   1390 C CD2 . HIS A 1 179 ? 56.459 -11.054 23.021 1.00   60.80 ? 720  HIS A CD2 1 
ATOM   1391 C CE1 . HIS A 1 179 ? 56.599 -13.025 22.066 1.00   62.15 ? 720  HIS A CE1 1 
ATOM   1392 N NE2 . HIS A 1 179 ? 56.800 -12.374 23.198 1.00   61.96 ? 720  HIS A NE2 1 
ATOM   1393 N N   . SER A 1 180 ? 58.744 -9.901  19.809 1.00   51.88 ? 721  SER A N   1 
ATOM   1394 C CA  . SER A 1 180 ? 60.140 -9.629  20.103 1.00   51.47 ? 721  SER A CA  1 
ATOM   1395 C C   . SER A 1 180 ? 60.704 -8.548  19.180 1.00   50.80 ? 721  SER A C   1 
ATOM   1396 O O   . SER A 1 180 ? 61.624 -7.818  19.563 1.00   50.86 ? 721  SER A O   1 
ATOM   1397 C CB  . SER A 1 180 ? 60.960 -10.914 19.968 1.00   51.84 ? 721  SER A CB  1 
ATOM   1398 O OG  . SER A 1 180 ? 60.803 -11.482 18.680 1.00   52.52 ? 721  SER A OG  1 
ATOM   1399 N N   . GLU A 1 181 ? 60.157 -8.448  17.969 1.00   49.76 ? 722  GLU A N   1 
ATOM   1400 C CA  . GLU A 1 181 ? 60.620 -7.446  17.010 1.00   48.80 ? 722  GLU A CA  1 
ATOM   1401 C C   . GLU A 1 181 ? 59.803 -6.175  17.162 1.00   47.79 ? 722  GLU A C   1 
ATOM   1402 O O   . GLU A 1 181 ? 60.120 -5.143  16.574 1.00   46.83 ? 722  GLU A O   1 
ATOM   1403 C CB  . GLU A 1 181 ? 60.501 -7.965  15.575 1.00   49.50 ? 722  GLU A CB  1 
ATOM   1404 C CG  . GLU A 1 181 ? 61.219 -9.284  15.320 1.00   52.83 ? 722  GLU A CG  1 
ATOM   1405 C CD  . GLU A 1 181 ? 62.705 -9.244  15.669 1.00   54.45 ? 722  GLU A CD  1 
ATOM   1406 O OE1 . GLU A 1 181 ? 63.038 -9.065  16.862 1.00   55.57 ? 722  GLU A OE1 1 
ATOM   1407 O OE2 . GLU A 1 181 ? 63.540 -9.399  14.749 1.00   54.55 ? 722  GLU A OE2 1 
ATOM   1408 N N   . PHE A 1 182 ? 58.739 -6.261  17.952 1.00   47.57 ? 723  PHE A N   1 
ATOM   1409 C CA  . PHE A 1 182 ? 57.894 -5.105  18.190 1.00   47.20 ? 723  PHE A CA  1 
ATOM   1410 C C   . PHE A 1 182 ? 58.509 -4.273  19.286 1.00   47.05 ? 723  PHE A C   1 
ATOM   1411 O O   . PHE A 1 182 ? 58.105 -4.359  20.443 1.00   47.01 ? 723  PHE A O   1 
ATOM   1412 C CB  . PHE A 1 182 ? 56.490 -5.520  18.620 1.00   46.87 ? 723  PHE A CB  1 
ATOM   1413 C CG  . PHE A 1 182 ? 55.665 -6.095  17.517 1.00   46.34 ? 723  PHE A CG  1 
ATOM   1414 C CD1 . PHE A 1 182 ? 55.858 -7.407  17.098 1.00   46.41 ? 723  PHE A CD1 1 
ATOM   1415 C CD2 . PHE A 1 182 ? 54.687 -5.325  16.896 1.00   45.93 ? 723  PHE A CD2 1 
ATOM   1416 C CE1 . PHE A 1 182 ? 55.085 -7.951  16.073 1.00   47.04 ? 723  PHE A CE1 1 
ATOM   1417 C CE2 . PHE A 1 182 ? 53.909 -5.856  15.871 1.00   46.81 ? 723  PHE A CE2 1 
ATOM   1418 C CZ  . PHE A 1 182 ? 54.109 -7.176  15.458 1.00   46.76 ? 723  PHE A CZ  1 
ATOM   1419 N N   . LYS A 1 183 ? 59.502 -3.477  18.926 1.00   47.27 ? 724  LYS A N   1 
ATOM   1420 C CA  . LYS A 1 183 ? 60.140 -2.631  19.914 1.00   47.57 ? 724  LYS A CA  1 
ATOM   1421 C C   . LYS A 1 183 ? 60.291 -1.229  19.367 1.00   47.45 ? 724  LYS A C   1 
ATOM   1422 O O   . LYS A 1 183 ? 60.694 -1.036  18.222 1.00   47.63 ? 724  LYS A O   1 
ATOM   1423 C CB  . LYS A 1 183 ? 61.514 -3.192  20.325 1.00   47.67 ? 724  LYS A CB  1 
ATOM   1424 C CG  . LYS A 1 183 ? 62.661 -2.951  19.349 1.00   47.34 ? 724  LYS A CG  1 
ATOM   1425 C CD  . LYS A 1 183 ? 62.498 -3.728  18.054 1.00   47.77 ? 724  LYS A CD  1 
ATOM   1426 C CE  . LYS A 1 183 ? 63.735 -3.598  17.156 1.00   47.84 ? 724  LYS A CE  1 
ATOM   1427 N NZ  . LYS A 1 183 ? 64.950 -4.262  17.720 1.00   46.65 ? 724  LYS A NZ  1 
ATOM   1428 N N   . CYS A 1 184 ? 59.928 -0.255  20.190 1.00   47.55 ? 725  CYS A N   1 
ATOM   1429 C CA  . CYS A 1 184 ? 60.044 1.148   19.823 1.00   47.38 ? 725  CYS A CA  1 
ATOM   1430 C C   . CYS A 1 184 ? 61.364 1.593   20.463 1.00   48.10 ? 725  CYS A C   1 
ATOM   1431 O O   . CYS A 1 184 ? 61.906 0.888   21.318 1.00   48.29 ? 725  CYS A O   1 
ATOM   1432 C CB  . CYS A 1 184 ? 58.880 1.946   20.412 1.00   43.94 ? 725  CYS A CB  1 
ATOM   1433 S SG  . CYS A 1 184 ? 58.930 1.858   22.213 1.00   37.52 ? 725  CYS A SG  1 
ATOM   1434 N N   . SER A 1 185 ? 61.879 2.747   20.045 1.00   48.86 ? 726  SER A N   1 
ATOM   1435 C CA  . SER A 1 185 ? 63.134 3.272   20.578 1.00   49.16 ? 726  SER A CA  1 
ATOM   1436 C C   . SER A 1 185 ? 63.556 4.546   19.845 1.00   49.29 ? 726  SER A C   1 
ATOM   1437 O O   . SER A 1 185 ? 63.765 4.535   18.628 1.00   49.11 ? 726  SER A O   1 
ATOM   1438 C CB  . SER A 1 185 ? 64.248 2.221   20.460 1.00   49.79 ? 726  SER A CB  1 
ATOM   1439 O OG  . SER A 1 185 ? 64.526 1.905   19.105 1.00   51.92 ? 726  SER A OG  1 
ATOM   1440 N N   . SER A 1 186 ? 63.680 5.638   20.598 1.00   49.49 ? 727  SER A N   1 
ATOM   1441 C CA  . SER A 1 186 ? 64.080 6.928   20.044 1.00   49.67 ? 727  SER A CA  1 
ATOM   1442 C C   . SER A 1 186 ? 63.235 7.294   18.831 1.00   49.82 ? 727  SER A C   1 
ATOM   1443 O O   . SER A 1 186 ? 62.328 8.121   18.925 1.00   50.12 ? 727  SER A O   1 
ATOM   1444 C CB  . SER A 1 186 ? 65.563 6.904   19.653 1.00   49.58 ? 727  SER A CB  1 
ATOM   1445 O OG  . SER A 1 186 ? 66.390 6.723   20.793 1.00   48.13 ? 727  SER A OG  1 
ATOM   1446 N N   . GLU A 1 190 ? 56.717 6.721   20.122 1.00   53.43 ? 731  GLU A N   1 
ATOM   1447 C CA  . GLU A 1 190 ? 55.410 6.858   20.757 1.00   53.38 ? 731  GLU A CA  1 
ATOM   1448 C C   . GLU A 1 190 ? 54.350 5.945   20.153 1.00   52.85 ? 731  GLU A C   1 
ATOM   1449 O O   . GLU A 1 190 ? 54.652 5.010   19.409 1.00   52.44 ? 731  GLU A O   1 
ATOM   1450 C CB  . GLU A 1 190 ? 54.913 8.306   20.671 1.00   54.15 ? 731  GLU A CB  1 
ATOM   1451 C CG  . GLU A 1 190 ? 55.639 9.296   21.567 1.00   56.70 ? 731  GLU A CG  1 
ATOM   1452 C CD  . GLU A 1 190 ? 54.964 10.659  21.582 1.00   58.82 ? 731  GLU A CD  1 
ATOM   1453 O OE1 . GLU A 1 190 ? 54.871 11.294  20.505 1.00   59.71 ? 731  GLU A OE1 1 
ATOM   1454 O OE2 . GLU A 1 190 ? 54.524 11.093  22.671 1.00   59.17 ? 731  GLU A OE2 1 
ATOM   1455 N N   . GLY A 1 191 ? 53.100 6.236   20.497 1.00   52.77 ? 732  GLY A N   1 
ATOM   1456 C CA  . GLY A 1 191 ? 51.971 5.472   20.003 1.00   52.95 ? 732  GLY A CA  1 
ATOM   1457 C C   . GLY A 1 191 ? 50.742 6.359   20.008 1.00   53.12 ? 732  GLY A C   1 
ATOM   1458 O O   . GLY A 1 191 ? 50.518 7.120   19.062 1.00   52.88 ? 732  GLY A O   1 
ATOM   1459 N N   . CYS A 1 192 ? 49.955 6.275   21.080 1.00   53.17 ? 733  CYS A N   1 
ATOM   1460 C CA  . CYS A 1 192 ? 48.741 7.080   21.211 1.00   53.40 ? 733  CYS A CA  1 
ATOM   1461 C C   . CYS A 1 192 ? 48.294 7.311   22.649 1.00   54.39 ? 733  CYS A C   1 
ATOM   1462 O O   . CYS A 1 192 ? 49.002 6.858   23.581 1.00   54.93 ? 733  CYS A O   1 
ATOM   1463 C CB  . CYS A 1 192 ? 47.586 6.436   20.457 1.00   51.60 ? 733  CYS A CB  1 
ATOM   1464 S SG  . CYS A 1 192 ? 47.669 6.581   18.648 1.00   49.36 ? 733  CYS A SG  1 
ATOM   1465 O OXT . CYS A 1 192 ? 47.223 7.943   22.814 1.00   54.98 ? 733  CYS A OXT 1 
HETATM 1466 O O   . HOH B 2 .   ? 16.014 -1.151  14.143 1.00   7.42  ? 2001 HOH A O   1 
HETATM 1467 O O   . HOH B 2 .   ? 25.140 6.756   19.978 1.00   8.24  ? 2002 HOH A O   1 
HETATM 1468 O O   . HOH B 2 .   ? 24.010 3.416   21.249 1.00   9.14  ? 2003 HOH A O   1 
HETATM 1469 O O   . HOH B 2 .   ? 37.238 0.558   21.390 1.00   14.56 ? 2004 HOH A O   1 
HETATM 1470 O O   . HOH B 2 .   ? 47.441 -2.371  7.412  1.00   12.67 ? 2005 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   542 542 ASP ASP A . n 
A 1 2   CYS 2   543 543 CYS CYS A . n 
A 1 3   PRO 3   544 544 PRO PRO A . n 
A 1 4   ALA 4   545 545 ALA ALA A . n 
A 1 5   MET 5   546 546 MET MET A . n 
A 1 6   CYS 6   547 547 CYS CYS A . n 
A 1 7   HIS 7   548 548 HIS HIS A . n 
A 1 8   CYS 8   549 549 CYS CYS A . n 
A 1 9   GLU 9   550 550 GLU GLU A . n 
A 1 10  GLY 10  551 551 GLY GLY A . n 
A 1 11  THR 11  552 552 THR THR A . n 
A 1 12  THR 12  553 553 THR THR A . n 
A 1 13  VAL 13  554 554 VAL VAL A . n 
A 1 14  ASP 14  555 555 ASP ASP A . n 
A 1 15  CYS 15  556 556 CYS CYS A . n 
A 1 16  THR 16  557 557 THR THR A . n 
A 1 17  GLY 17  558 558 GLY GLY A . n 
A 1 18  ARG 18  559 559 ARG ARG A . n 
A 1 19  GLY 19  560 560 GLY GLY A . n 
A 1 20  LEU 20  561 561 LEU LEU A . n 
A 1 21  LYS 21  562 562 LYS LYS A . n 
A 1 22  GLU 22  563 563 GLU GLU A . n 
A 1 23  ILE 23  564 564 ILE ILE A . n 
A 1 24  PRO 24  565 565 PRO PRO A . n 
A 1 25  ARG 25  566 566 ARG ARG A . n 
A 1 26  ASP 26  567 567 ASP ASP A . n 
A 1 27  ILE 27  568 568 ILE ILE A . n 
A 1 28  PRO 28  569 569 PRO PRO A . n 
A 1 29  LEU 29  570 570 LEU LEU A . n 
A 1 30  HIS 30  571 571 HIS HIS A . n 
A 1 31  THR 31  572 572 THR THR A . n 
A 1 32  THR 32  573 573 THR THR A . n 
A 1 33  GLU 33  574 574 GLU GLU A . n 
A 1 34  LEU 34  575 575 LEU LEU A . n 
A 1 35  LEU 35  576 576 LEU LEU A . n 
A 1 36  LEU 36  577 577 LEU LEU A . n 
A 1 37  ASN 37  578 578 ASN ASN A . n 
A 1 38  ASP 38  579 579 ASP ASP A . n 
A 1 39  ASN 39  580 580 ASN ASN A . n 
A 1 40  GLU 40  581 581 GLU GLU A . n 
A 1 41  LEU 41  582 582 LEU LEU A . n 
A 1 42  GLY 42  583 583 GLY GLY A . n 
A 1 43  ARG 43  584 584 ARG ARG A . n 
A 1 44  ILE 44  585 585 ILE ILE A . n 
A 1 45  SER 45  586 586 SER SER A . n 
A 1 46  SER 46  587 587 SER SER A . n 
A 1 47  ASP 47  588 588 ASP ASP A . n 
A 1 48  GLY 48  589 589 GLY GLY A . n 
A 1 49  LEU 49  590 590 LEU LEU A . n 
A 1 50  PHE 50  591 591 PHE PHE A . n 
A 1 51  GLY 51  592 592 GLY GLY A . n 
A 1 52  ARG 52  593 593 ARG ARG A . n 
A 1 53  LEU 53  594 594 LEU LEU A . n 
A 1 54  PRO 54  595 595 PRO PRO A . n 
A 1 55  HIS 55  596 596 HIS HIS A . n 
A 1 56  LEU 56  597 597 LEU LEU A . n 
A 1 57  VAL 57  598 598 VAL VAL A . n 
A 1 58  LYS 58  599 599 LYS LYS A . n 
A 1 59  LEU 59  600 600 LEU LEU A . n 
A 1 60  GLU 60  601 601 GLU GLU A . n 
A 1 61  LEU 61  602 602 LEU LEU A . n 
A 1 62  LYS 62  603 603 LYS LYS A . n 
A 1 63  ARG 63  604 604 ARG ARG A . n 
A 1 64  ASN 64  605 605 ASN ASN A . n 
A 1 65  GLN 65  606 606 GLN GLN A . n 
A 1 66  LEU 66  607 607 LEU LEU A . n 
A 1 67  THR 67  608 608 THR THR A . n 
A 1 68  GLY 68  609 609 GLY GLY A . n 
A 1 69  ILE 69  610 610 ILE ILE A . n 
A 1 70  GLU 70  611 611 GLU GLU A . n 
A 1 71  PRO 71  612 612 PRO PRO A . n 
A 1 72  ASN 72  613 613 ASN ASN A . n 
A 1 73  ALA 73  614 614 ALA ALA A . n 
A 1 74  PHE 74  615 615 PHE PHE A . n 
A 1 75  GLU 75  616 616 GLU GLU A . n 
A 1 76  GLY 76  617 617 GLY GLY A . n 
A 1 77  ALA 77  618 618 ALA ALA A . n 
A 1 78  SER 78  619 619 SER SER A . n 
A 1 79  HIS 79  620 620 HIS HIS A . n 
A 1 80  ILE 80  621 621 ILE ILE A . n 
A 1 81  GLN 81  622 622 GLN GLN A . n 
A 1 82  GLU 82  623 623 GLU GLU A . n 
A 1 83  LEU 83  624 624 LEU LEU A . n 
A 1 84  GLN 84  625 625 GLN GLN A . n 
A 1 85  LEU 85  626 626 LEU LEU A . n 
A 1 86  GLY 86  627 627 GLY GLY A . n 
A 1 87  GLU 87  628 628 GLU GLU A . n 
A 1 88  ASN 88  629 629 ASN ASN A . n 
A 1 89  LYS 89  630 630 LYS LYS A . n 
A 1 90  ILE 90  631 631 ILE ILE A . n 
A 1 91  LYS 91  632 632 LYS LYS A . n 
A 1 92  GLU 92  633 633 GLU GLU A . n 
A 1 93  ILE 93  634 634 ILE ILE A . n 
A 1 94  SER 94  635 635 SER SER A . n 
A 1 95  ASN 95  636 636 ASN ASN A . n 
A 1 96  LYS 96  637 637 LYS LYS A . n 
A 1 97  MET 97  638 638 MET MET A . n 
A 1 98  PHE 98  639 639 PHE PHE A . n 
A 1 99  LEU 99  640 640 LEU LEU A . n 
A 1 100 GLY 100 641 641 GLY GLY A . n 
A 1 101 LEU 101 642 642 LEU LEU A . n 
A 1 102 HIS 102 643 643 HIS HIS A . n 
A 1 103 GLN 103 644 644 GLN GLN A . n 
A 1 104 LEU 104 645 645 LEU LEU A . n 
A 1 105 LYS 105 646 646 LYS LYS A . n 
A 1 106 THR 106 647 647 THR THR A . n 
A 1 107 LEU 107 648 648 LEU LEU A . n 
A 1 108 ASN 108 649 649 ASN ASN A . n 
A 1 109 LEU 109 650 650 LEU LEU A . n 
A 1 110 TYR 110 651 651 TYR TYR A . n 
A 1 111 ASP 111 652 652 ASP ASP A . n 
A 1 112 ASN 112 653 653 ASN ASN A . n 
A 1 113 GLN 113 654 654 GLN GLN A . n 
A 1 114 ILE 114 655 655 ILE ILE A . n 
A 1 115 SER 115 656 656 SER SER A . n 
A 1 116 CYS 116 657 657 CYS CYS A . n 
A 1 117 VAL 117 658 658 VAL VAL A . n 
A 1 118 MET 118 659 659 MET MET A . n 
A 1 119 PRO 119 660 660 PRO PRO A . n 
A 1 120 GLY 120 661 661 GLY GLY A . n 
A 1 121 SER 121 662 662 SER SER A . n 
A 1 122 PHE 122 663 663 PHE PHE A . n 
A 1 123 GLU 123 664 664 GLU GLU A . n 
A 1 124 HIS 124 665 665 HIS HIS A . n 
A 1 125 LEU 125 666 666 LEU LEU A . n 
A 1 126 ASN 126 667 667 ASN ASN A . n 
A 1 127 SER 127 668 668 SER SER A . n 
A 1 128 LEU 128 669 669 LEU LEU A . n 
A 1 129 THR 129 670 670 THR THR A . n 
A 1 130 SER 130 671 671 SER SER A . n 
A 1 131 LEU 131 672 672 LEU LEU A . n 
A 1 132 ASN 132 673 673 ASN ASN A . n 
A 1 133 LEU 133 674 674 LEU LEU A . n 
A 1 134 ALA 134 675 675 ALA ALA A . n 
A 1 135 SER 135 676 676 SER SER A . n 
A 1 136 ASN 136 677 677 ASN ASN A . n 
A 1 137 PRO 137 678 678 PRO PRO A . n 
A 1 138 PHE 138 679 679 PHE PHE A . n 
A 1 139 ASN 139 680 680 ASN ASN A . n 
A 1 140 CYS 140 681 681 CYS CYS A . n 
A 1 141 ASN 141 682 682 ASN ASN A . n 
A 1 142 CYS 142 683 683 CYS CYS A . n 
A 1 143 HIS 143 684 684 HIS HIS A . n 
A 1 144 LEU 144 685 685 LEU LEU A . n 
A 1 145 ALA 145 686 686 ALA ALA A . n 
A 1 146 TRP 146 687 687 TRP TRP A . n 
A 1 147 PHE 147 688 688 PHE PHE A . n 
A 1 148 ALA 148 689 689 ALA ALA A . n 
A 1 149 GLU 149 690 690 GLU GLU A . n 
A 1 150 TRP 150 691 691 TRP TRP A . n 
A 1 151 LEU 151 692 692 LEU LEU A . n 
A 1 152 ARG 152 693 693 ARG ARG A . n 
A 1 153 LYS 153 694 694 LYS LYS A . n 
A 1 154 LYS 154 695 695 LYS LYS A . n 
A 1 155 SER 155 696 696 SER SER A . n 
A 1 156 LEU 156 697 697 LEU LEU A . n 
A 1 157 ASN 157 698 698 ASN ASN A . n 
A 1 158 GLY 158 699 699 GLY GLY A . n 
A 1 159 GLY 159 700 700 GLY GLY A . n 
A 1 160 ALA 160 701 701 ALA ALA A . n 
A 1 161 ALA 161 702 702 ALA ALA A . n 
A 1 162 ARG 162 703 703 ARG ARG A . n 
A 1 163 CYS 163 704 704 CYS CYS A . n 
A 1 164 GLY 164 705 705 GLY GLY A . n 
A 1 165 ALA 165 706 706 ALA ALA A . n 
A 1 166 PRO 166 707 707 PRO PRO A . n 
A 1 167 SER 167 708 708 SER SER A . n 
A 1 168 LYS 168 709 709 LYS LYS A . n 
A 1 169 VAL 169 710 710 VAL VAL A . n 
A 1 170 ARG 170 711 711 ARG ARG A . n 
A 1 171 ASP 171 712 712 ASP ASP A . n 
A 1 172 VAL 172 713 713 VAL VAL A . n 
A 1 173 GLN 173 714 714 GLN GLN A . n 
A 1 174 ILE 174 715 715 ILE ILE A . n 
A 1 175 LYS 175 716 716 LYS LYS A . n 
A 1 176 ASP 176 717 717 ASP ASP A . n 
A 1 177 LEU 177 718 718 LEU LEU A . n 
A 1 178 PRO 178 719 719 PRO PRO A . n 
A 1 179 HIS 179 720 720 HIS HIS A . n 
A 1 180 SER 180 721 721 SER SER A . n 
A 1 181 GLU 181 722 722 GLU GLU A . n 
A 1 182 PHE 182 723 723 PHE PHE A . n 
A 1 183 LYS 183 724 724 LYS LYS A . n 
A 1 184 CYS 184 725 725 CYS CYS A . n 
A 1 185 SER 185 726 726 SER SER A . n 
A 1 186 SER 186 727 727 SER SER A . n 
A 1 187 GLU 187 728 ?   ?   ?   A . n 
A 1 188 ASN 188 729 ?   ?   ?   A . n 
A 1 189 SER 189 730 ?   ?   ?   A . n 
A 1 190 GLU 190 731 731 GLU GLU A . n 
A 1 191 GLY 191 732 732 GLY GLY A . n 
A 1 192 CYS 192 733 733 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1 2001 2001 HOH HOH A . 
B 2 HOH 2 2002 2002 HOH HOH A . 
B 2 HOH 3 2003 2003 HOH HOH A . 
B 2 HOH 4 2004 2004 HOH HOH A . 
B 2 HOH 5 2005 2005 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-10-25 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen                  
2 4 'Structure model' pdbx_unobs_or_zero_occ_atoms    
3 4 'Structure model' pdbx_unobs_or_zero_occ_residues 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.gene_src_common_name'          
2 4 'Structure model' '_entity_src_gen.host_org_common_name'          
3 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
CNS    refinement       1.1 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .   ? 2 ? ? ? ? 
SCALA  'data scaling'   .   ? 3 ? ? ? ? 
AMoRE  phasing          .   ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 546 ? ? -94.58  38.60   
2  1 ASP A 567 ? ? -100.17 63.70   
3  1 SER A 587 ? ? -108.84 78.04   
4  1 ARG A 604 ? ? 43.69   70.42   
5  1 ALA A 618 ? ? -102.04 56.23   
6  1 ASN A 629 ? ? -124.38 -169.13 
7  1 ASN A 653 ? ? -112.33 -152.06 
8  1 LEU A 666 ? ? -108.02 75.48   
9  1 ASN A 682 ? ? -125.29 -163.98 
10 1 LYS A 694 ? ? -87.16  -74.21  
11 1 SER A 696 ? ? 62.32   97.25   
12 1 ASN A 698 ? ? -69.68  9.36    
13 1 ALA A 706 ? ? -140.86 -59.47  
14 1 PRO A 707 ? ? -64.27  87.22   
15 1 SER A 708 ? ? -18.89  -56.41  
16 1 ARG A 711 ? ? -41.81  151.32  
17 1 ASP A 712 ? ? 53.83   4.00    
18 1 HIS A 720 ? ? -48.54  -13.51  
19 1 SER A 726 ? ? 175.18  120.26  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 728 ? A GLU 187 
2 1 Y 1 A ASN 729 ? A ASN 188 
3 1 Y 1 A SER 730 ? A SER 189 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#