data_1WFO
# 
_entry.id   1WFO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1WFO         
RCSB  RCSB023527   
WWPDB D_1000023527 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002101486.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WFO 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-26 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagashima, T.'                                          1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     'The eighth FN3 domain of human sidekick-2' 
_citation.journal_abbrev            'TO BE PUBLISHED' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nagashima, T.' 1 
primary 'Hayashi, F.'   2 
primary 'Yokoyama, S.'  3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'sidekick 2' 
_entity.formula_weight             13736.438 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'FN3 domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Drosophila sidekick-like, chicken sidekick 2-like' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGRIGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTANTATVEVL
APSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKRSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGRIGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTANTATVEVL
APSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKRSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002101486.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   ILE n 
1 10  GLY n 
1 11  ASP n 
1 12  GLY n 
1 13  SER n 
1 14  PRO n 
1 15  SER n 
1 16  HIS n 
1 17  PRO n 
1 18  PRO n 
1 19  ILE n 
1 20  LEU n 
1 21  GLU n 
1 22  ARG n 
1 23  THR n 
1 24  LEU n 
1 25  ASP n 
1 26  ASP n 
1 27  VAL n 
1 28  PRO n 
1 29  GLY n 
1 30  PRO n 
1 31  PRO n 
1 32  MET n 
1 33  GLY n 
1 34  ILE n 
1 35  LEU n 
1 36  PHE n 
1 37  PRO n 
1 38  GLU n 
1 39  VAL n 
1 40  ARG n 
1 41  THR n 
1 42  THR n 
1 43  SER n 
1 44  VAL n 
1 45  ARG n 
1 46  LEU n 
1 47  ILE n 
1 48  TRP n 
1 49  GLN n 
1 50  PRO n 
1 51  PRO n 
1 52  ALA n 
1 53  ALA n 
1 54  PRO n 
1 55  ASN n 
1 56  GLY n 
1 57  ILE n 
1 58  ILE n 
1 59  LEU n 
1 60  ALA n 
1 61  TYR n 
1 62  GLN n 
1 63  ILE n 
1 64  THR n 
1 65  HIS n 
1 66  ARG n 
1 67  LEU n 
1 68  ASN n 
1 69  THR n 
1 70  THR n 
1 71  THR n 
1 72  ALA n 
1 73  ASN n 
1 74  THR n 
1 75  ALA n 
1 76  THR n 
1 77  VAL n 
1 78  GLU n 
1 79  VAL n 
1 80  LEU n 
1 81  ALA n 
1 82  PRO n 
1 83  SER n 
1 84  ALA n 
1 85  ARG n 
1 86  GLN n 
1 87  TYR n 
1 88  THR n 
1 89  ALA n 
1 90  THR n 
1 91  GLY n 
1 92  LEU n 
1 93  LYS n 
1 94  PRO n 
1 95  GLU n 
1 96  SER n 
1 97  VAL n 
1 98  TYR n 
1 99  LEU n 
1 100 PHE n 
1 101 ARG n 
1 102 ILE n 
1 103 THR n 
1 104 ALA n 
1 105 GLN n 
1 106 THR n 
1 107 ARG n 
1 108 LYS n 
1 109 GLY n 
1 110 TRP n 
1 111 GLY n 
1 112 GLU n 
1 113 ALA n 
1 114 ALA n 
1 115 GLU n 
1 116 ALA n 
1 117 LEU n 
1 118 VAL n 
1 119 VAL n 
1 120 THR n 
1 121 THR n 
1 122 GLU n 
1 123 LYS n 
1 124 ARG n 
1 125 SER n 
1 126 GLY n 
1 127 PRO n 
1 128 SER n 
1 129 SER n 
1 130 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA fh00815' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040223-52 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q58EX2_HUMAN 
_struct_ref.pdbx_db_accession          Q58EX2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RIGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTANTATVEVLAPSARQY
TATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKR
;
_struct_ref.pdbx_align_begin           905 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WFO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 124 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q58EX2 
_struct_ref_seq.db_align_beg                  905 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1021 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WFO GLY A 1   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 1   1  
1 1WFO SER A 2   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 2   2  
1 1WFO SER A 3   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 3   3  
1 1WFO GLY A 4   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 4   4  
1 1WFO SER A 5   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 5   5  
1 1WFO SER A 6   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 6   6  
1 1WFO GLY A 7   ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 7   7  
1 1WFO SER A 125 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 125 8  
1 1WFO GLY A 126 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 126 9  
1 1WFO PRO A 127 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 127 10 
1 1WFO SER A 128 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 128 11 
1 1WFO SER A 129 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 129 12 
1 1WFO GLY A 130 ? UNP Q58EX2 ? ? 'CLONING ARTIFACT' 130 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      220mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.00mM 13C/15N-labeled protein; 20mM d-TRIS, 200mM NaCl, 1mM d-DTT, 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           1WFO 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1WFO 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WFO 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR    6.1C     collection           Varian          1 
NMRPipe 20020425 processing           'Delaglio, F.'  2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
Kujira  0.8992   'data analysis'      'Kobayashi, N.' 4 
CYANA   1.0.7    'structure solution' 'Guentert, P.'  5 
CYANA   1.0.7    refinement           'Guentert, P.'  6 
# 
_exptl.entry_id          1WFO 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1WFO 
_struct.title                     'The eighth FN3 domain of human sidekick-2' 
_struct.pdbx_descriptor           'sidekick 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WFO 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
'sidekick-2, fn3, cell adhesion, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 35  ? VAL A 39  ? LEU A 35  VAL A 39  
A 2 SER A 43  ? ILE A 47  ? SER A 43  ILE A 47  
A 3 GLN A 86  ? THR A 90  ? GLN A 86  THR A 90  
B 1 VAL A 77  ? LEU A 80  ? VAL A 77  LEU A 80  
B 2 ALA A 60  ? LEU A 67  ? ALA A 60  LEU A 67  
B 3 VAL A 97  ? GLN A 105 ? VAL A 97  GLN A 105 
B 4 TRP A 110 ? VAL A 119 ? TRP A 110 VAL A 119 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 38  ? N GLU A 38  O ARG A 45  ? O ARG A 45  
A 2 3 N VAL A 44  ? N VAL A 44  O ALA A 89  ? O ALA A 89  
B 1 2 O GLU A 78  ? O GLU A 78  N ILE A 63  ? N ILE A 63  
B 2 3 N ALA A 60  ? N ALA A 60  O GLN A 105 ? O GLN A 105 
B 3 4 N PHE A 100 ? N PHE A 100 O ALA A 116 ? O ALA A 116 
# 
_database_PDB_matrix.entry_id          1WFO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1WFO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 83.305  8.098   -33.803 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 82.057  7.373   -33.632 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 80.867  8.212   -34.102 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 81.018  9.394   -34.407 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 83.249  8.901   -34.398 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 82.094  6.441   -34.194 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 81.928  7.108   -32.582 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 79.710  7.567   -34.144 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 78.495  8.238   -34.572 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 77.325  7.252   -34.575 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 77.527  6.045   -34.451 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 78.668  8.861   -35.959 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 78.446  10.268  -35.944 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 79.596  6.606   -33.894 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 78.328  9.028   -33.839 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 79.674  8.656   -36.325 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 77.973  8.392   -36.656 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 77.578  10.483  -36.391 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 76.129  7.802   -34.717 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 74.927  6.986   -34.738 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 73.691  7.877   -34.870 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 73.788  9.099   -34.765 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 74.826  6.122   -33.479 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 74.604  4.749   -33.790 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 75.973  8.785   -34.817 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 75.030  6.343   -35.612 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 75.744  6.219   -32.899 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 74.013  6.488   -32.852 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 74.373  4.651   -34.758 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 72.556  7.232   -35.099 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 71.303  7.951   -35.247 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 70.143  7.162   -34.637 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 70.343  6.076   -34.094 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 72.486  6.238   -35.184 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 71.379  8.925   -34.763 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 71.107  8.134   -36.303 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 68.954  7.737   -34.747 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 67.762  7.101   -34.213 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 66.525  7.929   -34.565 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 66.643  9.054   -35.048 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 67.866  6.920   -32.697 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 67.955  8.169   -32.016 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 68.800  8.620   -35.190 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 67.717  6.123   -34.693 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 66.996  6.372   -32.337 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 68.743  6.316   -32.464 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 68.217  8.020   -31.062 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 65.366  7.341   -34.310 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 64.108  8.010   -34.594 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 62.935  7.116   -34.186 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 63.082  5.898   -34.092 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 64.003  8.380   -36.075 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 64.310  9.752   -36.306 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 65.278  6.425   -33.917 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 64.122  8.919   -33.993 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 64.682  7.754   -36.654 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 62.994  8.170   -36.431 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 65.174  9.830   -36.804 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 61.798  7.755   -33.954 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 60.601  7.032   -33.558 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 59.340  7.819   -33.922 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 59.402  8.776   -34.691 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 61.687  8.745   -34.032 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 60.581  6.059   -34.047 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 60.622  6.848   -32.484 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8   ? 58.226  7.385   -33.352 1.00 0.00 ? 8   ARG A N    1  
ATOM 67    C CA   . ARG A 1 8   ? 56.952  8.037   -33.607 1.00 0.00 ? 8   ARG A CA   1  
ATOM 68    C C    . ARG A 1 8   ? 56.136  8.131   -32.316 1.00 0.00 ? 8   ARG A C    1  
ATOM 69    O O    . ARG A 1 8   ? 56.307  7.318   -31.409 1.00 0.00 ? 8   ARG A O    1  
ATOM 70    C CB   . ARG A 1 8   ? 56.144  7.274   -34.659 1.00 0.00 ? 8   ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8   ? 56.807  7.367   -36.034 1.00 0.00 ? 8   ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8   ? 57.846  6.258   -36.218 1.00 0.00 ? 8   ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8   ? 58.938  6.729   -37.098 1.00 0.00 ? 8   ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8   ? 58.886  6.709   -38.437 1.00 0.00 ? 8   ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8   ? 57.794  6.242   -39.058 1.00 0.00 ? 8   ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8   ? 59.925  7.157   -39.155 1.00 0.00 ? 8   ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8   ? 58.184  6.605   -32.727 1.00 0.00 ? 8   ARG A H    1  
ATOM 78    H HA   . ARG A 1 8   ? 57.215  9.027   -33.978 1.00 0.00 ? 8   ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8   ? 56.054  6.228   -34.365 1.00 0.00 ? 8   ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8   ? 55.133  7.679   -34.710 1.00 0.00 ? 8   ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8   ? 56.049  7.293   -36.813 1.00 0.00 ? 8   ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8   ? 57.286  8.340   -36.146 1.00 0.00 ? 8   ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8   ? 58.249  5.962   -35.250 1.00 0.00 ? 8   ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8   ? 57.374  5.375   -36.650 1.00 0.00 ? 8   ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8   ? 59.768  7.084   -36.667 1.00 0.00 ? 8   ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8   ? 57.019  5.908   -38.522 1.00 0.00 ? 8   ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8   ? 57.755  6.227   -40.057 1.00 0.00 ? 8   ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8   ? 60.740  7.506   -38.692 1.00 0.00 ? 8   ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8   ? 59.886  7.142   -40.154 1.00 0.00 ? 8   ARG A HH22 1  
ATOM 90    N N    . ILE A 1 9   ? 55.267  9.130   -32.275 1.00 0.00 ? 9   ILE A N    1  
ATOM 91    C CA   . ILE A 1 9   ? 54.425  9.341   -31.110 1.00 0.00 ? 9   ILE A CA   1  
ATOM 92    C C    . ILE A 1 9   ? 52.993  8.915   -31.438 1.00 0.00 ? 9   ILE A C    1  
ATOM 93    O O    . ILE A 1 9   ? 52.674  8.633   -32.592 1.00 0.00 ? 9   ILE A O    1  
ATOM 94    C CB   . ILE A 1 9   ? 54.539  10.787  -30.621 1.00 0.00 ? 9   ILE A CB   1  
ATOM 95    C CG1  . ILE A 1 9   ? 54.043  11.767  -31.685 1.00 0.00 ? 9   ILE A CG1  1  
ATOM 96    C CG2  . ILE A 1 9   ? 55.967  11.102  -30.172 1.00 0.00 ? 9   ILE A CG2  1  
ATOM 97    C CD1  . ILE A 1 9   ? 53.249  12.911  -31.050 1.00 0.00 ? 9   ILE A CD1  1  
ATOM 98    H H    . ILE A 1 9   ? 55.135  9.787   -33.017 1.00 0.00 ? 9   ILE A H    1  
ATOM 99    H HA   . ILE A 1 9   ? 54.802  8.701   -30.313 1.00 0.00 ? 9   ILE A HA   1  
ATOM 100   H HB   . ILE A 1 9   ? 53.895  10.904  -29.749 1.00 0.00 ? 9   ILE A HB   1  
ATOM 101   H HG12 . ILE A 1 9   ? 54.892  12.171  -32.237 1.00 0.00 ? 9   ILE A HG12 1  
ATOM 102   H HG13 . ILE A 1 9   ? 53.416  11.241  -32.406 1.00 0.00 ? 9   ILE A HG13 1  
ATOM 103   H HG21 . ILE A 1 9   ? 56.276  10.385  -29.412 1.00 0.00 ? 9   ILE A HG21 1  
ATOM 104   H HG22 . ILE A 1 9   ? 56.640  11.037  -31.028 1.00 0.00 ? 9   ILE A HG22 1  
ATOM 105   H HG23 . ILE A 1 9   ? 56.004  12.109  -29.757 1.00 0.00 ? 9   ILE A HG23 1  
ATOM 106   H HD11 . ILE A 1 9   ? 53.654  13.129  -30.062 1.00 0.00 ? 9   ILE A HD11 1  
ATOM 107   H HD12 . ILE A 1 9   ? 53.325  13.798  -31.679 1.00 0.00 ? 9   ILE A HD12 1  
ATOM 108   H HD13 . ILE A 1 9   ? 52.203  12.619  -30.958 1.00 0.00 ? 9   ILE A HD13 1  
ATOM 109   N N    . GLY A 1 10  ? 52.167  8.881   -30.402 1.00 0.00 ? 10  GLY A N    1  
ATOM 110   C CA   . GLY A 1 10  ? 50.776  8.493   -30.566 1.00 0.00 ? 10  GLY A CA   1  
ATOM 111   C C    . GLY A 1 10  ? 50.154  8.104   -29.223 1.00 0.00 ? 10  GLY A C    1  
ATOM 112   O O    . GLY A 1 10  ? 50.868  7.851   -28.254 1.00 0.00 ? 10  GLY A O    1  
ATOM 113   H H    . GLY A 1 10  ? 52.434  9.111   -29.466 1.00 0.00 ? 10  GLY A H    1  
ATOM 114   H HA2  . GLY A 1 10  ? 50.215  9.317   -31.006 1.00 0.00 ? 10  GLY A HA2  1  
ATOM 115   H HA3  . GLY A 1 10  ? 50.708  7.655   -31.259 1.00 0.00 ? 10  GLY A HA3  1  
ATOM 116   N N    . ASP A 1 11  ? 48.829  8.070   -29.209 1.00 0.00 ? 11  ASP A N    1  
ATOM 117   C CA   . ASP A 1 11  ? 48.103  7.716   -28.002 1.00 0.00 ? 11  ASP A CA   1  
ATOM 118   C C    . ASP A 1 11  ? 46.600  7.828   -28.265 1.00 0.00 ? 11  ASP A C    1  
ATOM 119   O O    . ASP A 1 11  ? 46.183  8.411   -29.265 1.00 0.00 ? 11  ASP A O    1  
ATOM 120   C CB   . ASP A 1 11  ? 48.453  8.661   -26.851 1.00 0.00 ? 11  ASP A CB   1  
ATOM 121   C CG   . ASP A 1 11  ? 48.475  10.146  -27.218 1.00 0.00 ? 11  ASP A CG   1  
ATOM 122   O OD1  . ASP A 1 11  ? 49.551  10.608  -27.654 1.00 0.00 ? 11  ASP A OD1  1  
ATOM 123   O OD2  . ASP A 1 11  ? 47.414  10.787  -27.054 1.00 0.00 ? 11  ASP A OD2  1  
ATOM 124   H H    . ASP A 1 11  ? 48.256  8.277   -30.002 1.00 0.00 ? 11  ASP A H    1  
ATOM 125   H HA   . ASP A 1 11  ? 48.411  6.696   -27.771 1.00 0.00 ? 11  ASP A HA   1  
ATOM 126   H HB2  . ASP A 1 11  ? 47.734  8.512   -26.046 1.00 0.00 ? 11  ASP A HB2  1  
ATOM 127   H HB3  . ASP A 1 11  ? 49.432  8.385   -26.459 1.00 0.00 ? 11  ASP A HB3  1  
ATOM 128   N N    . GLY A 1 12  ? 45.827  7.261   -27.350 1.00 0.00 ? 12  GLY A N    1  
ATOM 129   C CA   . GLY A 1 12  ? 44.380  7.290   -27.470 1.00 0.00 ? 12  GLY A CA   1  
ATOM 130   C C    . GLY A 1 12  ? 43.741  6.140   -26.690 1.00 0.00 ? 12  GLY A C    1  
ATOM 131   O O    . GLY A 1 12  ? 44.163  4.991   -26.815 1.00 0.00 ? 12  GLY A O    1  
ATOM 132   H H    . GLY A 1 12  ? 46.174  6.790   -26.539 1.00 0.00 ? 12  GLY A H    1  
ATOM 133   H HA2  . GLY A 1 12  ? 43.999  8.242   -27.099 1.00 0.00 ? 12  GLY A HA2  1  
ATOM 134   H HA3  . GLY A 1 12  ? 44.097  7.223   -28.521 1.00 0.00 ? 12  GLY A HA3  1  
ATOM 135   N N    . SER A 1 13  ? 42.735  6.488   -25.902 1.00 0.00 ? 13  SER A N    1  
ATOM 136   C CA   . SER A 1 13  ? 42.034  5.499   -25.101 1.00 0.00 ? 13  SER A CA   1  
ATOM 137   C C    . SER A 1 13  ? 40.851  6.150   -24.382 1.00 0.00 ? 13  SER A C    1  
ATOM 138   O O    . SER A 1 13  ? 40.999  6.659   -23.272 1.00 0.00 ? 13  SER A O    1  
ATOM 139   C CB   . SER A 1 13  ? 42.975  4.843   -24.088 1.00 0.00 ? 13  SER A CB   1  
ATOM 140   O OG   . SER A 1 13  ? 43.083  3.437   -24.292 1.00 0.00 ? 13  SER A OG   1  
ATOM 141   H H    . SER A 1 13  ? 42.398  7.425   -25.806 1.00 0.00 ? 13  SER A H    1  
ATOM 142   H HA   . SER A 1 13  ? 41.685  4.749   -25.810 1.00 0.00 ? 13  SER A HA   1  
ATOM 143   H HB2  . SER A 1 13  ? 43.963  5.297   -24.165 1.00 0.00 ? 13  SER A HB2  1  
ATOM 144   H HB3  . SER A 1 13  ? 42.613  5.036   -23.079 1.00 0.00 ? 13  SER A HB3  1  
ATOM 145   H HG   . SER A 1 13  ? 43.184  3.240   -25.267 1.00 0.00 ? 13  SER A HG   1  
ATOM 146   N N    . PRO A 1 14  ? 39.674  6.112   -25.061 1.00 0.00 ? 14  PRO A N    1  
ATOM 147   C CA   . PRO A 1 14  ? 38.466  6.693   -24.499 1.00 0.00 ? 14  PRO A CA   1  
ATOM 148   C C    . PRO A 1 14  ? 37.895  5.805   -23.391 1.00 0.00 ? 14  PRO A C    1  
ATOM 149   O O    . PRO A 1 14  ? 38.376  4.694   -23.172 1.00 0.00 ? 14  PRO A O    1  
ATOM 150   C CB   . PRO A 1 14  ? 37.521  6.853   -25.678 1.00 0.00 ? 14  PRO A CB   1  
ATOM 151   C CG   . PRO A 1 14  ? 38.052  5.934   -26.767 1.00 0.00 ? 14  PRO A CG   1  
ATOM 152   C CD   . PRO A 1 14  ? 39.462  5.518   -26.378 1.00 0.00 ? 14  PRO A CD   1  
ATOM 153   H HA   . PRO A 1 14  ? 38.672  7.571   -24.067 1.00 0.00 ? 14  PRO A HA   1  
ATOM 154   H HB2  . PRO A 1 14  ? 36.502  6.582   -25.402 1.00 0.00 ? 14  PRO A HB2  1  
ATOM 155   H HB3  . PRO A 1 14  ? 37.493  7.887   -26.020 1.00 0.00 ? 14  PRO A HB3  1  
ATOM 156   H HG2  . PRO A 1 14  ? 37.412  5.059   -26.874 1.00 0.00 ? 14  PRO A HG2  1  
ATOM 157   H HG3  . PRO A 1 14  ? 38.057  6.445   -27.729 1.00 0.00 ? 14  PRO A HG3  1  
ATOM 158   H HD2  . PRO A 1 14  ? 39.559  4.433   -26.343 1.00 0.00 ? 14  PRO A HD2  1  
ATOM 159   H HD3  . PRO A 1 14  ? 40.194  5.880   -27.099 1.00 0.00 ? 14  PRO A HD3  1  
ATOM 160   N N    . SER A 1 15  ? 36.878  6.328   -22.723 1.00 0.00 ? 15  SER A N    1  
ATOM 161   C CA   . SER A 1 15  ? 36.236  5.596   -21.644 1.00 0.00 ? 15  SER A CA   1  
ATOM 162   C C    . SER A 1 15  ? 34.850  6.181   -21.367 1.00 0.00 ? 15  SER A C    1  
ATOM 163   O O    . SER A 1 15  ? 34.428  7.128   -22.029 1.00 0.00 ? 15  SER A O    1  
ATOM 164   C CB   . SER A 1 15  ? 37.089  5.629   -20.374 1.00 0.00 ? 15  SER A CB   1  
ATOM 165   O OG   . SER A 1 15  ? 37.125  6.927   -19.788 1.00 0.00 ? 15  SER A OG   1  
ATOM 166   H H    . SER A 1 15  ? 36.493  7.232   -22.908 1.00 0.00 ? 15  SER A H    1  
ATOM 167   H HA   . SER A 1 15  ? 36.154  4.570   -22.000 1.00 0.00 ? 15  SER A HA   1  
ATOM 168   H HB2  . SER A 1 15  ? 36.691  4.916   -19.652 1.00 0.00 ? 15  SER A HB2  1  
ATOM 169   H HB3  . SER A 1 15  ? 38.104  5.310   -20.610 1.00 0.00 ? 15  SER A HB3  1  
ATOM 170   H HG   . SER A 1 15  ? 36.689  6.908   -18.888 1.00 0.00 ? 15  SER A HG   1  
ATOM 171   N N    . HIS A 1 16  ? 34.179  5.592   -20.388 1.00 0.00 ? 16  HIS A N    1  
ATOM 172   C CA   . HIS A 1 16  ? 32.849  6.043   -20.016 1.00 0.00 ? 16  HIS A CA   1  
ATOM 173   C C    . HIS A 1 16  ? 32.632  5.821   -18.517 1.00 0.00 ? 16  HIS A C    1  
ATOM 174   O O    . HIS A 1 16  ? 33.128  4.847   -17.953 1.00 0.00 ? 16  HIS A O    1  
ATOM 175   C CB   . HIS A 1 16  ? 31.783  5.361   -20.876 1.00 0.00 ? 16  HIS A CB   1  
ATOM 176   C CG   . HIS A 1 16  ? 32.060  3.903   -21.155 1.00 0.00 ? 16  HIS A CG   1  
ATOM 177   N ND1  . HIS A 1 16  ? 31.502  3.225   -22.225 1.00 0.00 ? 16  HIS A ND1  1  
ATOM 178   C CD2  . HIS A 1 16  ? 32.840  3.001   -20.492 1.00 0.00 ? 16  HIS A CD2  1  
ATOM 179   C CE1  . HIS A 1 16  ? 31.933  1.973   -22.197 1.00 0.00 ? 16  HIS A CE1  1  
ATOM 180   N NE2  . HIS A 1 16  ? 32.762  1.836   -21.122 1.00 0.00 ? 16  HIS A NE2  1  
ATOM 181   H H    . HIS A 1 16  ? 34.529  4.823   -19.854 1.00 0.00 ? 16  HIS A H    1  
ATOM 182   H HA   . HIS A 1 16  ? 32.811  7.112   -20.225 1.00 0.00 ? 16  HIS A HA   1  
ATOM 183   H HB2  . HIS A 1 16  ? 30.818  5.449   -20.378 1.00 0.00 ? 16  HIS A HB2  1  
ATOM 184   H HB3  . HIS A 1 16  ? 31.702  5.892   -21.825 1.00 0.00 ? 16  HIS A HB3  1  
ATOM 185   H HD1  . HIS A 1 16  ? 30.879  3.615   -22.903 1.00 0.00 ? 16  HIS A HD1  1  
ATOM 186   H HD2  . HIS A 1 16  ? 33.428  3.204   -19.597 1.00 0.00 ? 16  HIS A HD2  1  
ATOM 187   H HE1  . HIS A 1 16  ? 31.672  1.189   -22.908 1.00 0.00 ? 16  HIS A HE1  1  
ATOM 188   N N    . PRO A 1 17  ? 31.871  6.764   -17.901 1.00 0.00 ? 17  PRO A N    1  
ATOM 189   C CA   . PRO A 1 17  ? 31.583  6.681   -16.479 1.00 0.00 ? 17  PRO A CA   1  
ATOM 190   C C    . PRO A 1 17  ? 30.537  5.601   -16.194 1.00 0.00 ? 17  PRO A C    1  
ATOM 191   O O    . PRO A 1 17  ? 29.622  5.392   -16.990 1.00 0.00 ? 17  PRO A O    1  
ATOM 192   C CB   . PRO A 1 17  ? 31.119  8.075   -16.089 1.00 0.00 ? 17  PRO A CB   1  
ATOM 193   C CG   . PRO A 1 17  ? 30.721  8.759   -17.387 1.00 0.00 ? 17  PRO A CG   1  
ATOM 194   C CD   . PRO A 1 17  ? 31.267  7.931   -18.538 1.00 0.00 ? 17  PRO A CD   1  
ATOM 195   H HA   . PRO A 1 17  ? 32.402  6.408   -15.974 1.00 0.00 ? 17  PRO A HA   1  
ATOM 196   H HB2  . PRO A 1 17  ? 30.277  8.027   -15.399 1.00 0.00 ? 17  PRO A HB2  1  
ATOM 197   H HB3  . PRO A 1 17  ? 31.914  8.624   -15.585 1.00 0.00 ? 17  PRO A HB3  1  
ATOM 198   H HG2  . PRO A 1 17  ? 29.636  8.843   -17.457 1.00 0.00 ? 17  PRO A HG2  1  
ATOM 199   H HG3  . PRO A 1 17  ? 31.121  9.772   -17.422 1.00 0.00 ? 17  PRO A HG3  1  
ATOM 200   H HD2  . PRO A 1 17  ? 30.475  7.639   -19.227 1.00 0.00 ? 17  PRO A HD2  1  
ATOM 201   H HD3  . PRO A 1 17  ? 32.002  8.491   -19.115 1.00 0.00 ? 17  PRO A HD3  1  
ATOM 202   N N    . PRO A 1 18  ? 30.711  4.926   -15.026 1.00 0.00 ? 18  PRO A N    1  
ATOM 203   C CA   . PRO A 1 18  ? 29.793  3.873   -14.627 1.00 0.00 ? 18  PRO A CA   1  
ATOM 204   C C    . PRO A 1 18  ? 28.470  4.458   -14.131 1.00 0.00 ? 18  PRO A C    1  
ATOM 205   O O    . PRO A 1 18  ? 28.460  5.440   -13.390 1.00 0.00 ? 18  PRO A O    1  
ATOM 206   C CB   . PRO A 1 18  ? 30.535  3.090   -13.555 1.00 0.00 ? 18  PRO A CB   1  
ATOM 207   C CG   . PRO A 1 18  ? 31.646  4.004   -13.066 1.00 0.00 ? 18  PRO A CG   1  
ATOM 208   C CD   . PRO A 1 18  ? 31.782  5.146   -14.059 1.00 0.00 ? 18  PRO A CD   1  
ATOM 209   H HA   . PRO A 1 18  ? 29.561  3.298   -15.411 1.00 0.00 ? 18  PRO A HA   1  
ATOM 210   H HB2  . PRO A 1 18  ? 29.867  2.816   -12.739 1.00 0.00 ? 18  PRO A HB2  1  
ATOM 211   H HB3  . PRO A 1 18  ? 30.941  2.163   -13.960 1.00 0.00 ? 18  PRO A HB3  1  
ATOM 212   H HG2  . PRO A 1 18  ? 31.415  4.388   -12.072 1.00 0.00 ? 18  PRO A HG2  1  
ATOM 213   H HG3  . PRO A 1 18  ? 32.584  3.455   -12.984 1.00 0.00 ? 18  PRO A HG3  1  
ATOM 214   H HD2  . PRO A 1 18  ? 31.679  6.113   -13.568 1.00 0.00 ? 18  PRO A HD2  1  
ATOM 215   H HD3  . PRO A 1 18  ? 32.760  5.136   -14.542 1.00 0.00 ? 18  PRO A HD3  1  
ATOM 216   N N    . ILE A 1 19  ? 27.384  3.831   -14.559 1.00 0.00 ? 19  ILE A N    1  
ATOM 217   C CA   . ILE A 1 19  ? 26.058  4.277   -14.168 1.00 0.00 ? 19  ILE A CA   1  
ATOM 218   C C    . ILE A 1 19  ? 25.686  3.643   -12.826 1.00 0.00 ? 19  ILE A C    1  
ATOM 219   O O    . ILE A 1 19  ? 26.474  2.894   -12.250 1.00 0.00 ? 19  ILE A O    1  
ATOM 220   C CB   . ILE A 1 19  ? 25.048  3.996   -15.282 1.00 0.00 ? 19  ILE A CB   1  
ATOM 221   C CG1  . ILE A 1 19  ? 25.701  4.123   -16.660 1.00 0.00 ? 19  ILE A CG1  1  
ATOM 222   C CG2  . ILE A 1 19  ? 23.817  4.894   -15.146 1.00 0.00 ? 19  ILE A CG2  1  
ATOM 223   C CD1  . ILE A 1 19  ? 26.164  2.759   -17.175 1.00 0.00 ? 19  ILE A CD1  1  
ATOM 224   H H    . ILE A 1 19  ? 27.401  3.033   -15.162 1.00 0.00 ? 19  ILE A H    1  
ATOM 225   H HA   . ILE A 1 19  ? 26.102  5.359   -14.039 1.00 0.00 ? 19  ILE A HA   1  
ATOM 226   H HB   . ILE A 1 19  ? 24.706  2.966   -15.181 1.00 0.00 ? 19  ILE A HB   1  
ATOM 227   H HG12 . ILE A 1 19  ? 24.992  4.560   -17.363 1.00 0.00 ? 19  ILE A HG12 1  
ATOM 228   H HG13 . ILE A 1 19  ? 26.551  4.802   -16.602 1.00 0.00 ? 19  ILE A HG13 1  
ATOM 229   H HG21 . ILE A 1 19  ? 23.572  5.325   -16.117 1.00 0.00 ? 19  ILE A HG21 1  
ATOM 230   H HG22 . ILE A 1 19  ? 22.974  4.304   -14.787 1.00 0.00 ? 19  ILE A HG22 1  
ATOM 231   H HG23 . ILE A 1 19  ? 24.028  5.695   -14.436 1.00 0.00 ? 19  ILE A HG23 1  
ATOM 232   H HD11 . ILE A 1 19  ? 25.660  2.535   -18.115 1.00 0.00 ? 19  ILE A HD11 1  
ATOM 233   H HD12 . ILE A 1 19  ? 27.242  2.779   -17.337 1.00 0.00 ? 19  ILE A HD12 1  
ATOM 234   H HD13 . ILE A 1 19  ? 25.921  1.992   -16.441 1.00 0.00 ? 19  ILE A HD13 1  
ATOM 235   N N    . LEU A 1 20  ? 24.486  3.968   -12.367 1.00 0.00 ? 20  LEU A N    1  
ATOM 236   C CA   . LEU A 1 20  ? 24.001  3.439   -11.103 1.00 0.00 ? 20  LEU A CA   1  
ATOM 237   C C    . LEU A 1 20  ? 24.966  3.836   -9.985  1.00 0.00 ? 20  LEU A C    1  
ATOM 238   O O    . LEU A 1 20  ? 25.483  2.977   -9.272  1.00 0.00 ? 20  LEU A O    1  
ATOM 239   C CB   . LEU A 1 20  ? 23.768  1.931   -11.208 1.00 0.00 ? 20  LEU A CB   1  
ATOM 240   C CG   . LEU A 1 20  ? 23.155  1.260   -9.977  1.00 0.00 ? 20  LEU A CG   1  
ATOM 241   C CD1  . LEU A 1 20  ? 21.702  0.858   -10.238 1.00 0.00 ? 20  LEU A CD1  1  
ATOM 242   C CD2  . LEU A 1 20  ? 24.004  0.072   -9.519  1.00 0.00 ? 20  LEU A CD2  1  
ATOM 243   H H    . LEU A 1 20  ? 23.852  4.578   -12.841 1.00 0.00 ? 20  LEU A H    1  
ATOM 244   H HA   . LEU A 1 20  ? 23.034  3.902   -10.906 1.00 0.00 ? 20  LEU A HA   1  
ATOM 245   H HB2  . LEU A 1 20  ? 23.118  1.742   -12.062 1.00 0.00 ? 20  LEU A HB2  1  
ATOM 246   H HB3  . LEU A 1 20  ? 24.722  1.449   -11.421 1.00 0.00 ? 20  LEU A HB3  1  
ATOM 247   H HG   . LEU A 1 20  ? 23.147  1.984   -9.162  1.00 0.00 ? 20  LEU A HG   1  
ATOM 248   H HD11 . LEU A 1 20  ? 21.444  0.001   -9.616  1.00 0.00 ? 20  LEU A HD11 1  
ATOM 249   H HD12 . LEU A 1 20  ? 21.044  1.694   -9.996  1.00 0.00 ? 20  LEU A HD12 1  
ATOM 250   H HD13 . LEU A 1 20  ? 21.581  0.594   -11.289 1.00 0.00 ? 20  LEU A HD13 1  
ATOM 251   H HD21 . LEU A 1 20  ? 23.429  -0.538  -8.822  1.00 0.00 ? 20  LEU A HD21 1  
ATOM 252   H HD22 . LEU A 1 20  ? 24.283  -0.529  -10.384 1.00 0.00 ? 20  LEU A HD22 1  
ATOM 253   H HD23 . LEU A 1 20  ? 24.904  0.439   -9.025  1.00 0.00 ? 20  LEU A HD23 1  
ATOM 254   N N    . GLU A 1 21  ? 25.180  5.138   -9.866  1.00 0.00 ? 21  GLU A N    1  
ATOM 255   C CA   . GLU A 1 21  ? 26.074  5.660   -8.846  1.00 0.00 ? 21  GLU A CA   1  
ATOM 256   C C    . GLU A 1 21  ? 25.379  6.763   -8.044  1.00 0.00 ? 21  GLU A C    1  
ATOM 257   O O    . GLU A 1 21  ? 25.524  7.945   -8.353  1.00 0.00 ? 21  GLU A O    1  
ATOM 258   C CB   . GLU A 1 21  ? 27.375  6.171   -9.467  1.00 0.00 ? 21  GLU A CB   1  
ATOM 259   C CG   . GLU A 1 21  ? 28.589  5.476   -8.846  1.00 0.00 ? 21  GLU A CG   1  
ATOM 260   C CD   . GLU A 1 21  ? 29.756  5.424   -9.834  1.00 0.00 ? 21  GLU A CD   1  
ATOM 261   O OE1  . GLU A 1 21  ? 29.952  6.441   -10.534 1.00 0.00 ? 21  GLU A OE1  1  
ATOM 262   O OE2  . GLU A 1 21  ? 30.426  4.369   -9.866  1.00 0.00 ? 21  GLU A OE2  1  
ATOM 263   H H    . GLU A 1 21  ? 24.755  5.831   -10.450 1.00 0.00 ? 21  GLU A H    1  
ATOM 264   H HA   . GLU A 1 21  ? 26.296  4.814   -8.196  1.00 0.00 ? 21  GLU A HA   1  
ATOM 265   H HB2  . GLU A 1 21  ? 27.363  5.996   -10.543 1.00 0.00 ? 21  GLU A HB2  1  
ATOM 266   H HB3  . GLU A 1 21  ? 27.454  7.248   -9.321  1.00 0.00 ? 21  GLU A HB3  1  
ATOM 267   H HG2  . GLU A 1 21  ? 28.894  6.007   -7.944  1.00 0.00 ? 21  GLU A HG2  1  
ATOM 268   H HG3  . GLU A 1 21  ? 28.318  4.464   -8.544  1.00 0.00 ? 21  GLU A HG3  1  
ATOM 269   N N    . ARG A 1 22  ? 24.639  6.337   -7.031  1.00 0.00 ? 22  ARG A N    1  
ATOM 270   C CA   . ARG A 1 22  ? 23.921  7.273   -6.183  1.00 0.00 ? 22  ARG A CA   1  
ATOM 271   C C    . ARG A 1 22  ? 24.815  7.739   -5.032  1.00 0.00 ? 22  ARG A C    1  
ATOM 272   O O    . ARG A 1 22  ? 25.246  6.932   -4.210  1.00 0.00 ? 22  ARG A O    1  
ATOM 273   C CB   . ARG A 1 22  ? 22.653  6.637   -5.610  1.00 0.00 ? 22  ARG A CB   1  
ATOM 274   C CG   . ARG A 1 22  ? 22.998  5.507   -4.639  1.00 0.00 ? 22  ARG A CG   1  
ATOM 275   C CD   . ARG A 1 22  ? 22.052  4.318   -4.823  1.00 0.00 ? 22  ARG A CD   1  
ATOM 276   N NE   . ARG A 1 22  ? 22.655  3.329   -5.744  1.00 0.00 ? 22  ARG A NE   1  
ATOM 277   C CZ   . ARG A 1 22  ? 22.274  2.047   -5.823  1.00 0.00 ? 22  ARG A CZ   1  
ATOM 278   N NH1  . ARG A 1 22  ? 21.290  1.591   -5.037  1.00 0.00 ? 22  ARG A NH1  1  
ATOM 279   N NH2  . ARG A 1 22  ? 22.878  1.221   -6.689  1.00 0.00 ? 22  ARG A NH2  1  
ATOM 280   H H    . ARG A 1 22  ? 24.526  5.374   -6.787  1.00 0.00 ? 22  ARG A H    1  
ATOM 281   H HA   . ARG A 1 22  ? 23.664  8.104   -6.841  1.00 0.00 ? 22  ARG A HA   1  
ATOM 282   H HB2  . ARG A 1 22  ? 22.062  7.396   -5.097  1.00 0.00 ? 22  ARG A HB2  1  
ATOM 283   H HB3  . ARG A 1 22  ? 22.038  6.249   -6.422  1.00 0.00 ? 22  ARG A HB3  1  
ATOM 284   H HG2  . ARG A 1 22  ? 24.027  5.185   -4.799  1.00 0.00 ? 22  ARG A HG2  1  
ATOM 285   H HG3  . ARG A 1 22  ? 22.934  5.872   -3.613  1.00 0.00 ? 22  ARG A HG3  1  
ATOM 286   H HD2  . ARG A 1 22  ? 21.848  3.853   -3.858  1.00 0.00 ? 22  ARG A HD2  1  
ATOM 287   H HD3  . ARG A 1 22  ? 21.096  4.662   -5.219  1.00 0.00 ? 22  ARG A HD3  1  
ATOM 288   H HE   . ARG A 1 22  ? 23.393  3.637   -6.344  1.00 0.00 ? 22  ARG A HE   1  
ATOM 289   H HH11 . ARG A 1 22  ? 20.839  2.207   -4.391  1.00 0.00 ? 22  ARG A HH11 1  
ATOM 290   H HH12 . ARG A 1 22  ? 21.006  0.633   -5.096  1.00 0.00 ? 22  ARG A HH12 1  
ATOM 291   H HH21 . ARG A 1 22  ? 23.613  1.562   -7.275  1.00 0.00 ? 22  ARG A HH21 1  
ATOM 292   H HH22 . ARG A 1 22  ? 22.594  0.264   -6.748  1.00 0.00 ? 22  ARG A HH22 1  
ATOM 293   N N    . THR A 1 23  ? 25.067  9.040   -5.010  1.00 0.00 ? 23  THR A N    1  
ATOM 294   C CA   . THR A 1 23  ? 25.901  9.623   -3.973  1.00 0.00 ? 23  THR A CA   1  
ATOM 295   C C    . THR A 1 23  ? 25.073  9.904   -2.717  1.00 0.00 ? 23  THR A C    1  
ATOM 296   O O    . THR A 1 23  ? 25.443  9.489   -1.620  1.00 0.00 ? 23  THR A O    1  
ATOM 297   C CB   . THR A 1 23  ? 26.571  10.871  -4.551  1.00 0.00 ? 23  THR A CB   1  
ATOM 298   O OG1  . THR A 1 23  ? 27.683  10.361  -5.281  1.00 0.00 ? 23  THR A OG1  1  
ATOM 299   C CG2  . THR A 1 23  ? 27.205  11.749  -3.470  1.00 0.00 ? 23  THR A CG2  1  
ATOM 300   H H    . THR A 1 23  ? 24.712  9.690   -5.682  1.00 0.00 ? 23  THR A H    1  
ATOM 301   H HA   . THR A 1 23  ? 26.664  8.895   -3.696  1.00 0.00 ? 23  THR A HA   1  
ATOM 302   H HB   . THR A 1 23  ? 25.869  11.444  -5.156  1.00 0.00 ? 23  THR A HB   1  
ATOM 303   H HG1  . THR A 1 23  ? 28.258  9.803   -4.683  1.00 0.00 ? 23  THR A HG1  1  
ATOM 304   H HG21 . THR A 1 23  ? 26.426  12.140  -2.816  1.00 0.00 ? 23  THR A HG21 1  
ATOM 305   H HG22 . THR A 1 23  ? 27.907  11.155  -2.885  1.00 0.00 ? 23  THR A HG22 1  
ATOM 306   H HG23 . THR A 1 23  ? 27.735  12.578  -3.940  1.00 0.00 ? 23  THR A HG23 1  
ATOM 307   N N    . LEU A 1 24  ? 23.969  10.607  -2.920  1.00 0.00 ? 24  LEU A N    1  
ATOM 308   C CA   . LEU A 1 24  ? 23.086  10.948  -1.818  1.00 0.00 ? 24  LEU A CA   1  
ATOM 309   C C    . LEU A 1 24  ? 21.908  9.971   -1.793  1.00 0.00 ? 24  LEU A C    1  
ATOM 310   O O    . LEU A 1 24  ? 21.750  9.160   -2.704  1.00 0.00 ? 24  LEU A O    1  
ATOM 311   C CB   . LEU A 1 24  ? 22.664  12.416  -1.904  1.00 0.00 ? 24  LEU A CB   1  
ATOM 312   C CG   . LEU A 1 24  ? 23.801  13.440  -1.932  1.00 0.00 ? 24  LEU A CG   1  
ATOM 313   C CD1  . LEU A 1 24  ? 23.406  14.676  -2.742  1.00 0.00 ? 24  LEU A CD1  1  
ATOM 314   C CD2  . LEU A 1 24  ? 24.249  13.802  -0.515  1.00 0.00 ? 24  LEU A CD2  1  
ATOM 315   H H    . LEU A 1 24  ? 23.676  10.941  -3.816  1.00 0.00 ? 24  LEU A H    1  
ATOM 316   H HA   . LEU A 1 24  ? 23.654  10.829  -0.896  1.00 0.00 ? 24  LEU A HA   1  
ATOM 317   H HB2  . LEU A 1 24  ? 22.061  12.549  -2.802  1.00 0.00 ? 24  LEU A HB2  1  
ATOM 318   H HB3  . LEU A 1 24  ? 22.022  12.640  -1.053  1.00 0.00 ? 24  LEU A HB3  1  
ATOM 319   H HG   . LEU A 1 24  ? 24.657  12.987  -2.434  1.00 0.00 ? 24  LEU A HG   1  
ATOM 320   H HD11 . LEU A 1 24  ? 23.152  15.490  -2.062  1.00 0.00 ? 24  LEU A HD11 1  
ATOM 321   H HD12 . LEU A 1 24  ? 24.241  14.979  -3.374  1.00 0.00 ? 24  LEU A HD12 1  
ATOM 322   H HD13 . LEU A 1 24  ? 22.544  14.442  -3.366  1.00 0.00 ? 24  LEU A HD13 1  
ATOM 323   H HD21 . LEU A 1 24  ? 23.373  13.944  0.118   1.00 0.00 ? 24  LEU A HD21 1  
ATOM 324   H HD22 . LEU A 1 24  ? 24.862  12.996  -0.110  1.00 0.00 ? 24  LEU A HD22 1  
ATOM 325   H HD23 . LEU A 1 24  ? 24.831  14.723  -0.541  1.00 0.00 ? 24  LEU A HD23 1  
ATOM 326   N N    . ASP A 1 25  ? 21.113  10.081  -0.739  1.00 0.00 ? 25  ASP A N    1  
ATOM 327   C CA   . ASP A 1 25  ? 19.955  9.217   -0.582  1.00 0.00 ? 25  ASP A CA   1  
ATOM 328   C C    . ASP A 1 25  ? 18.696  9.978   -1.004  1.00 0.00 ? 25  ASP A C    1  
ATOM 329   O O    . ASP A 1 25  ? 18.694  11.207  -1.045  1.00 0.00 ? 25  ASP A O    1  
ATOM 330   C CB   . ASP A 1 25  ? 19.781  8.787   0.876   1.00 0.00 ? 25  ASP A CB   1  
ATOM 331   C CG   . ASP A 1 25  ? 21.046  8.246   1.545   1.00 0.00 ? 25  ASP A CG   1  
ATOM 332   O OD1  . ASP A 1 25  ? 21.883  7.683   0.806   1.00 0.00 ? 25  ASP A OD1  1  
ATOM 333   O OD2  . ASP A 1 25  ? 21.148  8.407   2.780   1.00 0.00 ? 25  ASP A OD2  1  
ATOM 334   H H    . ASP A 1 25  ? 21.249  10.743  -0.002  1.00 0.00 ? 25  ASP A H    1  
ATOM 335   H HA   . ASP A 1 25  ? 20.153  8.354   -1.218  1.00 0.00 ? 25  ASP A HA   1  
ATOM 336   H HB2  . ASP A 1 25  ? 19.421  9.641   1.450   1.00 0.00 ? 25  ASP A HB2  1  
ATOM 337   H HB3  . ASP A 1 25  ? 19.007  8.022   0.923   1.00 0.00 ? 25  ASP A HB3  1  
ATOM 338   N N    . ASP A 1 26  ? 17.656  9.215   -1.306  1.00 0.00 ? 26  ASP A N    1  
ATOM 339   C CA   . ASP A 1 26  ? 16.394  9.802   -1.723  1.00 0.00 ? 26  ASP A CA   1  
ATOM 340   C C    . ASP A 1 26  ? 15.371  8.688   -1.956  1.00 0.00 ? 26  ASP A C    1  
ATOM 341   O O    . ASP A 1 26  ? 15.729  7.589   -2.377  1.00 0.00 ? 26  ASP A O    1  
ATOM 342   C CB   . ASP A 1 26  ? 16.553  10.579  -3.032  1.00 0.00 ? 26  ASP A CB   1  
ATOM 343   C CG   . ASP A 1 26  ? 17.919  10.437  -3.706  1.00 0.00 ? 26  ASP A CG   1  
ATOM 344   O OD1  . ASP A 1 26  ? 18.261  9.287   -4.058  1.00 0.00 ? 26  ASP A OD1  1  
ATOM 345   O OD2  . ASP A 1 26  ? 18.590  11.481  -3.854  1.00 0.00 ? 26  ASP A OD2  1  
ATOM 346   H H    . ASP A 1 26  ? 17.666  8.216   -1.270  1.00 0.00 ? 26  ASP A H    1  
ATOM 347   H HA   . ASP A 1 26  ? 16.106  10.469  -0.911  1.00 0.00 ? 26  ASP A HA   1  
ATOM 348   H HB2  . ASP A 1 26  ? 15.784  10.248  -3.729  1.00 0.00 ? 26  ASP A HB2  1  
ATOM 349   H HB3  . ASP A 1 26  ? 16.370  11.635  -2.834  1.00 0.00 ? 26  ASP A HB3  1  
ATOM 350   N N    . VAL A 1 27  ? 14.117  9.011   -1.674  1.00 0.00 ? 27  VAL A N    1  
ATOM 351   C CA   . VAL A 1 27  ? 13.040  8.051   -1.848  1.00 0.00 ? 27  VAL A CA   1  
ATOM 352   C C    . VAL A 1 27  ? 13.033  7.556   -3.295  1.00 0.00 ? 27  VAL A C    1  
ATOM 353   O O    . VAL A 1 27  ? 13.592  8.203   -4.179  1.00 0.00 ? 27  VAL A O    1  
ATOM 354   C CB   . VAL A 1 27  ? 11.709  8.676   -1.423  1.00 0.00 ? 27  VAL A CB   1  
ATOM 355   C CG1  . VAL A 1 27  ? 11.577  8.701   0.101   1.00 0.00 ? 27  VAL A CG1  1  
ATOM 356   C CG2  . VAL A 1 27  ? 11.550  10.080  -2.010  1.00 0.00 ? 27  VAL A CG2  1  
ATOM 357   H H    . VAL A 1 27  ? 13.834  9.907   -1.333  1.00 0.00 ? 27  VAL A H    1  
ATOM 358   H HA   . VAL A 1 27  ? 13.242  7.207   -1.189  1.00 0.00 ? 27  VAL A HA   1  
ATOM 359   H HB   . VAL A 1 27  ? 10.906  8.055   -1.818  1.00 0.00 ? 27  VAL A HB   1  
ATOM 360   H HG11 . VAL A 1 27  ? 11.953  9.650   0.483   1.00 0.00 ? 27  VAL A HG11 1  
ATOM 361   H HG12 . VAL A 1 27  ? 10.529  8.587   0.377   1.00 0.00 ? 27  VAL A HG12 1  
ATOM 362   H HG13 . VAL A 1 27  ? 12.156  7.883   0.530   1.00 0.00 ? 27  VAL A HG13 1  
ATOM 363   H HG21 . VAL A 1 27  ? 11.981  10.106  -3.011  1.00 0.00 ? 27  VAL A HG21 1  
ATOM 364   H HG22 . VAL A 1 27  ? 10.491  10.334  -2.063  1.00 0.00 ? 27  VAL A HG22 1  
ATOM 365   H HG23 . VAL A 1 27  ? 12.065  10.800  -1.374  1.00 0.00 ? 27  VAL A HG23 1  
ATOM 366   N N    . PRO A 1 28  ? 12.375  6.383   -3.498  1.00 0.00 ? 28  PRO A N    1  
ATOM 367   C CA   . PRO A 1 28  ? 12.288  5.793   -4.823  1.00 0.00 ? 28  PRO A CA   1  
ATOM 368   C C    . PRO A 1 28  ? 11.281  6.547   -5.693  1.00 0.00 ? 28  PRO A C    1  
ATOM 369   O O    . PRO A 1 28  ? 10.664  7.511   -5.242  1.00 0.00 ? 28  PRO A O    1  
ATOM 370   C CB   . PRO A 1 28  ? 11.897  4.344   -4.583  1.00 0.00 ? 28  PRO A CB   1  
ATOM 371   C CG   . PRO A 1 28  ? 11.329  4.292   -3.174  1.00 0.00 ? 28  PRO A CG   1  
ATOM 372   C CD   . PRO A 1 28  ? 11.701  5.589   -2.474  1.00 0.00 ? 28  PRO A CD   1  
ATOM 373   H HA   . PRO A 1 28  ? 13.166  5.867   -5.294  1.00 0.00 ? 28  PRO A HA   1  
ATOM 374   H HB2  . PRO A 1 28  ? 11.160  4.012   -5.314  1.00 0.00 ? 28  PRO A HB2  1  
ATOM 375   H HB3  . PRO A 1 28  ? 12.761  3.686   -4.681  1.00 0.00 ? 28  PRO A HB3  1  
ATOM 376   H HG2  . PRO A 1 28  ? 10.247  4.171   -3.204  1.00 0.00 ? 28  PRO A HG2  1  
ATOM 377   H HG3  . PRO A 1 28  ? 11.732  3.437   -2.632  1.00 0.00 ? 28  PRO A HG3  1  
ATOM 378   H HD2  . PRO A 1 28  ? 10.817  6.102   -2.095  1.00 0.00 ? 28  PRO A HD2  1  
ATOM 379   H HD3  . PRO A 1 28  ? 12.353  5.406   -1.621  1.00 0.00 ? 28  PRO A HD3  1  
ATOM 380   N N    . GLY A 1 29  ? 11.145  6.080   -6.926  1.00 0.00 ? 29  GLY A N    1  
ATOM 381   C CA   . GLY A 1 29  ? 10.224  6.699   -7.863  1.00 0.00 ? 29  GLY A CA   1  
ATOM 382   C C    . GLY A 1 29  ? 8.901   5.932   -7.919  1.00 0.00 ? 29  GLY A C    1  
ATOM 383   O O    . GLY A 1 29  ? 8.632   5.089   -7.064  1.00 0.00 ? 29  GLY A O    1  
ATOM 384   H H    . GLY A 1 29  ? 11.651  5.296   -7.285  1.00 0.00 ? 29  GLY A H    1  
ATOM 385   H HA2  . GLY A 1 29  ? 10.037  7.732   -7.568  1.00 0.00 ? 29  GLY A HA2  1  
ATOM 386   H HA3  . GLY A 1 29  ? 10.674  6.727   -8.856  1.00 0.00 ? 29  GLY A HA3  1  
ATOM 387   N N    . PRO A 1 30  ? 8.089   6.261   -8.959  1.00 0.00 ? 30  PRO A N    1  
ATOM 388   C CA   . PRO A 1 30  ? 6.801   5.612   -9.137  1.00 0.00 ? 30  PRO A CA   1  
ATOM 389   C C    . PRO A 1 30  ? 6.973   4.190   -9.675  1.00 0.00 ? 30  PRO A C    1  
ATOM 390   O O    . PRO A 1 30  ? 7.739   3.965   -10.610 1.00 0.00 ? 30  PRO A O    1  
ATOM 391   C CB   . PRO A 1 30  ? 6.033   6.517   -10.086 1.00 0.00 ? 30  PRO A CB   1  
ATOM 392   C CG   . PRO A 1 30  ? 7.076   7.388   -10.768 1.00 0.00 ? 30  PRO A CG   1  
ATOM 393   C CD   . PRO A 1 30  ? 8.375   7.254   -9.990  1.00 0.00 ? 30  PRO A CD   1  
ATOM 394   H HA   . PRO A 1 30  ? 6.336   5.517   -8.257  1.00 0.00 ? 30  PRO A HA   1  
ATOM 395   H HB2  . PRO A 1 30  ? 5.474   5.933   -10.817 1.00 0.00 ? 30  PRO A HB2  1  
ATOM 396   H HB3  . PRO A 1 30  ? 5.309   7.126   -9.545  1.00 0.00 ? 30  PRO A HB3  1  
ATOM 397   H HG2  . PRO A 1 30  ? 7.217   7.077   -11.803 1.00 0.00 ? 30  PRO A HG2  1  
ATOM 398   H HG3  . PRO A 1 30  ? 6.750   8.428   -10.790 1.00 0.00 ? 30  PRO A HG3  1  
ATOM 399   H HD2  . PRO A 1 30  ? 9.192   6.931   -10.636 1.00 0.00 ? 30  PRO A HD2  1  
ATOM 400   H HD3  . PRO A 1 30  ? 8.674   8.206   -9.551  1.00 0.00 ? 30  PRO A HD3  1  
ATOM 401   N N    . PRO A 1 31  ? 6.227   3.243   -9.045  1.00 0.00 ? 31  PRO A N    1  
ATOM 402   C CA   . PRO A 1 31  ? 6.289   1.849   -9.450  1.00 0.00 ? 31  PRO A CA   1  
ATOM 403   C C    . PRO A 1 31  ? 5.530   1.625   -10.760 1.00 0.00 ? 31  PRO A C    1  
ATOM 404   O O    . PRO A 1 31  ? 4.302   1.672   -10.785 1.00 0.00 ? 31  PRO A O    1  
ATOM 405   C CB   . PRO A 1 31  ? 5.702   1.074   -8.283  1.00 0.00 ? 31  PRO A CB   1  
ATOM 406   C CG   . PRO A 1 31  ? 4.910   2.083   -7.468  1.00 0.00 ? 31  PRO A CG   1  
ATOM 407   C CD   . PRO A 1 31  ? 5.308   3.474   -7.934  1.00 0.00 ? 31  PRO A CD   1  
ATOM 408   H HA   . PRO A 1 31  ? 7.236   1.583   -9.633  1.00 0.00 ? 31  PRO A HA   1  
ATOM 409   H HB2  . PRO A 1 31  ? 5.060   0.266   -8.634  1.00 0.00 ? 31  PRO A HB2  1  
ATOM 410   H HB3  . PRO A 1 31  ? 6.488   0.617   -7.681  1.00 0.00 ? 31  PRO A HB3  1  
ATOM 411   H HG2  . PRO A 1 31  ? 3.839   1.928   -7.603  1.00 0.00 ? 31  PRO A HG2  1  
ATOM 412   H HG3  . PRO A 1 31  ? 5.117   1.963   -6.405  1.00 0.00 ? 31  PRO A HG3  1  
ATOM 413   H HD2  . PRO A 1 31  ? 4.439   4.050   -8.252  1.00 0.00 ? 31  PRO A HD2  1  
ATOM 414   H HD3  . PRO A 1 31  ? 5.788   4.037   -7.134  1.00 0.00 ? 31  PRO A HD3  1  
ATOM 415   N N    . MET A 1 32  ? 6.294   1.386   -11.816 1.00 0.00 ? 32  MET A N    1  
ATOM 416   C CA   . MET A 1 32  ? 5.710   1.154   -13.125 1.00 0.00 ? 32  MET A CA   1  
ATOM 417   C C    . MET A 1 32  ? 5.398   -0.330  -13.332 1.00 0.00 ? 32  MET A C    1  
ATOM 418   O O    . MET A 1 32  ? 5.944   -1.185  -12.636 1.00 0.00 ? 32  MET A O    1  
ATOM 419   C CB   . MET A 1 32  ? 6.680   1.627   -14.209 1.00 0.00 ? 32  MET A CB   1  
ATOM 420   C CG   . MET A 1 32  ? 8.038   0.936   -14.069 1.00 0.00 ? 32  MET A CG   1  
ATOM 421   S SD   . MET A 1 32  ? 8.963   1.094   -15.587 1.00 0.00 ? 32  MET A SD   1  
ATOM 422   C CE   . MET A 1 32  ? 10.618  0.831   -14.971 1.00 0.00 ? 32  MET A CE   1  
ATOM 423   H H    . MET A 1 32  ? 7.293   1.350   -11.786 1.00 0.00 ? 32  MET A H    1  
ATOM 424   H HA   . MET A 1 32  ? 4.786   1.732   -13.140 1.00 0.00 ? 32  MET A HA   1  
ATOM 425   H HB2  . MET A 1 32  ? 6.262   1.418   -15.194 1.00 0.00 ? 32  MET A HB2  1  
ATOM 426   H HB3  . MET A 1 32  ? 6.809   2.708   -14.140 1.00 0.00 ? 32  MET A HB3  1  
ATOM 427   H HG2  . MET A 1 32  ? 8.598   1.379   -13.245 1.00 0.00 ? 32  MET A HG2  1  
ATOM 428   H HG3  . MET A 1 32  ? 7.896   -0.117  -13.828 1.00 0.00 ? 32  MET A HG3  1  
ATOM 429   H HE1  . MET A 1 32  ? 10.614  0.000   -14.265 1.00 0.00 ? 32  MET A HE1  1  
ATOM 430   H HE2  . MET A 1 32  ? 11.282  0.598   -15.803 1.00 0.00 ? 32  MET A HE2  1  
ATOM 431   H HE3  . MET A 1 32  ? 10.966  1.733   -14.469 1.00 0.00 ? 32  MET A HE3  1  
ATOM 432   N N    . GLY A 1 33  ? 4.521   -0.590  -14.291 1.00 0.00 ? 33  GLY A N    1  
ATOM 433   C CA   . GLY A 1 33  ? 4.131   -1.955  -14.597 1.00 0.00 ? 33  GLY A CA   1  
ATOM 434   C C    . GLY A 1 33  ? 2.925   -2.382  -13.757 1.00 0.00 ? 33  GLY A C    1  
ATOM 435   O O    . GLY A 1 33  ? 2.904   -3.484  -13.210 1.00 0.00 ? 33  GLY A O    1  
ATOM 436   H H    . GLY A 1 33  ? 4.082   0.112   -14.852 1.00 0.00 ? 33  GLY A H    1  
ATOM 437   H HA2  . GLY A 1 33  ? 3.888   -2.039  -15.657 1.00 0.00 ? 33  GLY A HA2  1  
ATOM 438   H HA3  . GLY A 1 33  ? 4.967   -2.628  -14.408 1.00 0.00 ? 33  GLY A HA3  1  
ATOM 439   N N    . ILE A 1 34  ? 1.951   -1.488  -13.681 1.00 0.00 ? 34  ILE A N    1  
ATOM 440   C CA   . ILE A 1 34  ? 0.745   -1.759  -12.917 1.00 0.00 ? 34  ILE A CA   1  
ATOM 441   C C    . ILE A 1 34  ? -0.315  -2.363  -13.841 1.00 0.00 ? 34  ILE A C    1  
ATOM 442   O O    . ILE A 1 34  ? -0.932  -1.651  -14.632 1.00 0.00 ? 34  ILE A O    1  
ATOM 443   C CB   . ILE A 1 34  ? 0.278   -0.497  -12.188 1.00 0.00 ? 34  ILE A CB   1  
ATOM 444   C CG1  . ILE A 1 34  ? 1.471   0.344   -11.728 1.00 0.00 ? 34  ILE A CG1  1  
ATOM 445   C CG2  . ILE A 1 34  ? -0.657  -0.847  -11.029 1.00 0.00 ? 34  ILE A CG2  1  
ATOM 446   C CD1  . ILE A 1 34  ? 2.368   -0.451  -10.778 1.00 0.00 ? 34  ILE A CD1  1  
ATOM 447   H H    . ILE A 1 34  ? 1.975   -0.594  -14.129 1.00 0.00 ? 34  ILE A H    1  
ATOM 448   H HA   . ILE A 1 34  ? 0.999   -2.495  -12.155 1.00 0.00 ? 34  ILE A HA   1  
ATOM 449   H HB   . ILE A 1 34  ? -0.293  0.111   -12.890 1.00 0.00 ? 34  ILE A HB   1  
ATOM 450   H HG12 . ILE A 1 34  ? 2.048   0.667   -12.595 1.00 0.00 ? 34  ILE A HG12 1  
ATOM 451   H HG13 . ILE A 1 34  ? 1.114   1.245   -11.229 1.00 0.00 ? 34  ILE A HG13 1  
ATOM 452   H HG21 . ILE A 1 34  ? -0.613  -0.061  -10.276 1.00 0.00 ? 34  ILE A HG21 1  
ATOM 453   H HG22 . ILE A 1 34  ? -1.678  -0.938  -11.401 1.00 0.00 ? 34  ILE A HG22 1  
ATOM 454   H HG23 . ILE A 1 34  ? -0.347  -1.793  -10.585 1.00 0.00 ? 34  ILE A HG23 1  
ATOM 455   H HD11 . ILE A 1 34  ? 3.389   -0.452  -11.159 1.00 0.00 ? 34  ILE A HD11 1  
ATOM 456   H HD12 . ILE A 1 34  ? 2.349   0.009   -9.790  1.00 0.00 ? 34  ILE A HD12 1  
ATOM 457   H HD13 . ILE A 1 34  ? 2.005   -1.477  -10.709 1.00 0.00 ? 34  ILE A HD13 1  
ATOM 458   N N    . LEU A 1 35  ? -0.492  -3.669  -13.711 1.00 0.00 ? 35  LEU A N    1  
ATOM 459   C CA   . LEU A 1 35  ? -1.466  -4.377  -14.524 1.00 0.00 ? 35  LEU A CA   1  
ATOM 460   C C    . LEU A 1 35  ? -2.376  -5.207  -13.616 1.00 0.00 ? 35  LEU A C    1  
ATOM 461   O O    . LEU A 1 35  ? -1.959  -5.642  -12.544 1.00 0.00 ? 35  LEU A O    1  
ATOM 462   C CB   . LEU A 1 35  ? -0.764  -5.198  -15.607 1.00 0.00 ? 35  LEU A CB   1  
ATOM 463   C CG   . LEU A 1 35  ? 0.022   -4.400  -16.650 1.00 0.00 ? 35  LEU A CG   1  
ATOM 464   C CD1  . LEU A 1 35  ? -0.893  -3.433  -17.404 1.00 0.00 ? 35  LEU A CD1  1  
ATOM 465   C CD2  . LEU A 1 35  ? 1.211   -3.682  -16.008 1.00 0.00 ? 35  LEU A CD2  1  
ATOM 466   H H    . LEU A 1 35  ? 0.014   -4.241  -13.065 1.00 0.00 ? 35  LEU A H    1  
ATOM 467   H HA   . LEU A 1 35  ? -2.075  -3.628  -15.031 1.00 0.00 ? 35  LEU A HA   1  
ATOM 468   H HB2  . LEU A 1 35  ? -0.081  -5.895  -15.122 1.00 0.00 ? 35  LEU A HB2  1  
ATOM 469   H HB3  . LEU A 1 35  ? -1.514  -5.795  -16.126 1.00 0.00 ? 35  LEU A HB3  1  
ATOM 470   H HG   . LEU A 1 35  ? 0.426   -5.099  -17.382 1.00 0.00 ? 35  LEU A HG   1  
ATOM 471   H HD11 . LEU A 1 35  ? -1.902  -3.843  -17.443 1.00 0.00 ? 35  LEU A HD11 1  
ATOM 472   H HD12 . LEU A 1 35  ? -0.910  -2.473  -16.889 1.00 0.00 ? 35  LEU A HD12 1  
ATOM 473   H HD13 . LEU A 1 35  ? -0.518  -3.295  -18.419 1.00 0.00 ? 35  LEU A HD13 1  
ATOM 474   H HD21 . LEU A 1 35  ? 0.980   -2.622  -15.900 1.00 0.00 ? 35  LEU A HD21 1  
ATOM 475   H HD22 . LEU A 1 35  ? 1.409   -4.112  -15.027 1.00 0.00 ? 35  LEU A HD22 1  
ATOM 476   H HD23 . LEU A 1 35  ? 2.091   -3.799  -16.641 1.00 0.00 ? 35  LEU A HD23 1  
ATOM 477   N N    . PHE A 1 36  ? -3.602  -5.402  -14.079 1.00 0.00 ? 36  PHE A N    1  
ATOM 478   C CA   . PHE A 1 36  ? -4.574  -6.173  -13.322 1.00 0.00 ? 36  PHE A CA   1  
ATOM 479   C C    . PHE A 1 36  ? -4.936  -7.467  -14.053 1.00 0.00 ? 36  PHE A C    1  
ATOM 480   O O    . PHE A 1 36  ? -5.856  -7.487  -14.869 1.00 0.00 ? 36  PHE A O    1  
ATOM 481   C CB   . PHE A 1 36  ? -5.828  -5.306  -13.192 1.00 0.00 ? 36  PHE A CB   1  
ATOM 482   C CG   . PHE A 1 36  ? -5.694  -4.166  -12.180 1.00 0.00 ? 36  PHE A CG   1  
ATOM 483   C CD1  . PHE A 1 36  ? -5.232  -2.952  -12.581 1.00 0.00 ? 36  PHE A CD1  1  
ATOM 484   C CD2  . PHE A 1 36  ? -6.038  -4.368  -10.880 1.00 0.00 ? 36  PHE A CD2  1  
ATOM 485   C CE1  . PHE A 1 36  ? -5.108  -1.894  -11.641 1.00 0.00 ? 36  PHE A CE1  1  
ATOM 486   C CE2  . PHE A 1 36  ? -5.915  -3.310  -9.940  1.00 0.00 ? 36  PHE A CE2  1  
ATOM 487   C CZ   . PHE A 1 36  ? -5.452  -2.096  -10.341 1.00 0.00 ? 36  PHE A CZ   1  
ATOM 488   H H    . PHE A 1 36  ? -3.933  -5.045  -14.952 1.00 0.00 ? 36  PHE A H    1  
ATOM 489   H HA   . PHE A 1 36  ? -4.118  -6.415  -12.362 1.00 0.00 ? 36  PHE A HA   1  
ATOM 490   H HB2  . PHE A 1 36  ? -6.069  -4.885  -14.168 1.00 0.00 ? 36  PHE A HB2  1  
ATOM 491   H HB3  . PHE A 1 36  ? -6.666  -5.939  -12.902 1.00 0.00 ? 36  PHE A HB3  1  
ATOM 492   H HD1  . PHE A 1 36  ? -4.957  -2.790  -13.623 1.00 0.00 ? 36  PHE A HD1  1  
ATOM 493   H HD2  . PHE A 1 36  ? -6.409  -5.342  -10.558 1.00 0.00 ? 36  PHE A HD2  1  
ATOM 494   H HE1  . PHE A 1 36  ? -4.738  -0.921  -11.962 1.00 0.00 ? 36  PHE A HE1  1  
ATOM 495   H HE2  . PHE A 1 36  ? -6.190  -3.472  -8.898  1.00 0.00 ? 36  PHE A HE2  1  
ATOM 496   H HZ   . PHE A 1 36  ? -5.357  -1.284  -9.620  1.00 0.00 ? 36  PHE A HZ   1  
ATOM 497   N N    . PRO A 1 37  ? -4.175  -8.545  -13.724 1.00 0.00 ? 37  PRO A N    1  
ATOM 498   C CA   . PRO A 1 37  ? -4.407  -9.841  -14.339 1.00 0.00 ? 37  PRO A CA   1  
ATOM 499   C C    . PRO A 1 37  ? -5.659  -10.506 -13.763 1.00 0.00 ? 37  PRO A C    1  
ATOM 500   O O    . PRO A 1 37  ? -6.534  -10.942 -14.509 1.00 0.00 ? 37  PRO A O    1  
ATOM 501   C CB   . PRO A 1 37  ? -3.138  -10.635 -14.075 1.00 0.00 ? 37  PRO A CB   1  
ATOM 502   C CG   . PRO A 1 37  ? -2.433  -9.926  -12.930 1.00 0.00 ? 37  PRO A CG   1  
ATOM 503   C CD   . PRO A 1 37  ? -3.078  -8.559  -12.761 1.00 0.00 ? 37  PRO A CD   1  
ATOM 504   H HA   . PRO A 1 37  ? -4.580  -9.734  -15.318 1.00 0.00 ? 37  PRO A HA   1  
ATOM 505   H HB2  . PRO A 1 37  ? -3.370  -11.666 -13.812 1.00 0.00 ? 37  PRO A HB2  1  
ATOM 506   H HB3  . PRO A 1 37  ? -2.505  -10.667 -14.962 1.00 0.00 ? 37  PRO A HB3  1  
ATOM 507   H HG2  . PRO A 1 37  ? -2.521  -10.505 -12.011 1.00 0.00 ? 37  PRO A HG2  1  
ATOM 508   H HG3  . PRO A 1 37  ? -1.369  -9.822  -13.142 1.00 0.00 ? 37  PRO A HG3  1  
ATOM 509   H HD2  . PRO A 1 37  ? -3.442  -8.416  -11.744 1.00 0.00 ? 37  PRO A HD2  1  
ATOM 510   H HD3  . PRO A 1 37  ? -2.366  -7.758  -12.960 1.00 0.00 ? 37  PRO A HD3  1  
ATOM 511   N N    . GLU A 1 38  ? -5.704  -10.562 -12.440 1.00 0.00 ? 38  GLU A N    1  
ATOM 512   C CA   . GLU A 1 38  ? -6.834  -11.166 -11.755 1.00 0.00 ? 38  GLU A CA   1  
ATOM 513   C C    . GLU A 1 38  ? -7.615  -10.103 -10.979 1.00 0.00 ? 38  GLU A C    1  
ATOM 514   O O    . GLU A 1 38  ? -7.097  -9.519  -10.028 1.00 0.00 ? 38  GLU A O    1  
ATOM 515   C CB   . GLU A 1 38  ? -6.375  -12.294 -10.829 1.00 0.00 ? 38  GLU A CB   1  
ATOM 516   C CG   . GLU A 1 38  ? -7.546  -12.844 -10.012 1.00 0.00 ? 38  GLU A CG   1  
ATOM 517   C CD   . GLU A 1 38  ? -7.056  -13.821 -8.942  1.00 0.00 ? 38  GLU A CD   1  
ATOM 518   O OE1  . GLU A 1 38  ? -6.119  -14.586 -9.257  1.00 0.00 ? 38  GLU A OE1  1  
ATOM 519   O OE2  . GLU A 1 38  ? -7.631  -13.782 -7.832  1.00 0.00 ? 38  GLU A OE2  1  
ATOM 520   H H    . GLU A 1 38  ? -4.988  -10.205 -11.840 1.00 0.00 ? 38  GLU A H    1  
ATOM 521   H HA   . GLU A 1 38  ? -7.461  -11.583 -12.543 1.00 0.00 ? 38  GLU A HA   1  
ATOM 522   H HB2  . GLU A 1 38  ? -5.930  -13.095 -11.419 1.00 0.00 ? 38  GLU A HB2  1  
ATOM 523   H HB3  . GLU A 1 38  ? -5.600  -11.925 -10.158 1.00 0.00 ? 38  GLU A HB3  1  
ATOM 524   H HG2  . GLU A 1 38  ? -8.083  -12.021 -9.540  1.00 0.00 ? 38  GLU A HG2  1  
ATOM 525   H HG3  . GLU A 1 38  ? -8.251  -13.347 -10.674 1.00 0.00 ? 38  GLU A HG3  1  
ATOM 526   N N    . VAL A 1 39  ? -8.847  -9.884  -11.414 1.00 0.00 ? 39  VAL A N    1  
ATOM 527   C CA   . VAL A 1 39  ? -9.703  -8.901  -10.772 1.00 0.00 ? 39  VAL A CA   1  
ATOM 528   C C    . VAL A 1 39  ? -11.136 -9.436  -10.722 1.00 0.00 ? 39  VAL A C    1  
ATOM 529   O O    . VAL A 1 39  ? -11.769 -9.622  -11.760 1.00 0.00 ? 39  VAL A O    1  
ATOM 530   C CB   . VAL A 1 39  ? -9.591  -7.557  -11.495 1.00 0.00 ? 39  VAL A CB   1  
ATOM 531   C CG1  . VAL A 1 39  ? -10.635 -6.567  -10.975 1.00 0.00 ? 39  VAL A CG1  1  
ATOM 532   C CG2  . VAL A 1 39  ? -8.179  -6.983  -11.369 1.00 0.00 ? 39  VAL A CG2  1  
ATOM 533   H H    . VAL A 1 39  ? -9.260  -10.363 -12.189 1.00 0.00 ? 39  VAL A H    1  
ATOM 534   H HA   . VAL A 1 39  ? -9.343  -8.767  -9.752  1.00 0.00 ? 39  VAL A HA   1  
ATOM 535   H HB   . VAL A 1 39  ? -9.790  -7.728  -12.553 1.00 0.00 ? 39  VAL A HB   1  
ATOM 536   H HG11 . VAL A 1 39  ? -10.794 -5.784  -11.717 1.00 0.00 ? 39  VAL A HG11 1  
ATOM 537   H HG12 . VAL A 1 39  ? -11.573 -7.090  -10.792 1.00 0.00 ? 39  VAL A HG12 1  
ATOM 538   H HG13 . VAL A 1 39  ? -10.281 -6.120  -10.046 1.00 0.00 ? 39  VAL A HG13 1  
ATOM 539   H HG21 . VAL A 1 39  ? -8.190  -5.928  -11.643 1.00 0.00 ? 39  VAL A HG21 1  
ATOM 540   H HG22 . VAL A 1 39  ? -7.835  -7.087  -10.339 1.00 0.00 ? 39  VAL A HG22 1  
ATOM 541   H HG23 . VAL A 1 39  ? -7.506  -7.525  -12.033 1.00 0.00 ? 39  VAL A HG23 1  
ATOM 542   N N    . ARG A 1 40  ? -11.605 -9.666  -9.505  1.00 0.00 ? 40  ARG A N    1  
ATOM 543   C CA   . ARG A 1 40  ? -12.952 -10.175 -9.306  1.00 0.00 ? 40  ARG A CA   1  
ATOM 544   C C    . ARG A 1 40  ? -13.852 -9.082  -8.728  1.00 0.00 ? 40  ARG A C    1  
ATOM 545   O O    . ARG A 1 40  ? -13.509 -7.902  -8.772  1.00 0.00 ? 40  ARG A O    1  
ATOM 546   C CB   . ARG A 1 40  ? -12.951 -11.379 -8.361  1.00 0.00 ? 40  ARG A CB   1  
ATOM 547   C CG   . ARG A 1 40  ? -11.723 -12.261 -8.597  1.00 0.00 ? 40  ARG A CG   1  
ATOM 548   C CD   . ARG A 1 40  ? -11.684 -13.423 -7.603  1.00 0.00 ? 40  ARG A CD   1  
ATOM 549   N NE   . ARG A 1 40  ? -12.205 -14.653 -8.241  1.00 0.00 ? 40  ARG A NE   1  
ATOM 550   C CZ   . ARG A 1 40  ? -12.121 -15.874 -7.697  1.00 0.00 ? 40  ARG A CZ   1  
ATOM 551   N NH1  . ARG A 1 40  ? -11.536 -16.038 -6.503  1.00 0.00 ? 40  ARG A NH1  1  
ATOM 552   N NH2  . ARG A 1 40  ? -12.622 -16.933 -8.348  1.00 0.00 ? 40  ARG A NH2  1  
ATOM 553   H H    . ARG A 1 40  ? -11.084 -9.512  -8.666  1.00 0.00 ? 40  ARG A H    1  
ATOM 554   H HA   . ARG A 1 40  ? -13.286 -10.475 -10.299 1.00 0.00 ? 40  ARG A HA   1  
ATOM 555   H HB2  . ARG A 1 40  ? -12.963 -11.034 -7.327  1.00 0.00 ? 40  ARG A HB2  1  
ATOM 556   H HB3  . ARG A 1 40  ? -13.858 -11.965 -8.512  1.00 0.00 ? 40  ARG A HB3  1  
ATOM 557   H HG2  . ARG A 1 40  ? -11.740 -12.649 -9.615  1.00 0.00 ? 40  ARG A HG2  1  
ATOM 558   H HG3  . ARG A 1 40  ? -10.817 -11.662 -8.498  1.00 0.00 ? 40  ARG A HG3  1  
ATOM 559   H HD2  . ARG A 1 40  ? -10.662 -13.586 -7.261  1.00 0.00 ? 40  ARG A HD2  1  
ATOM 560   H HD3  . ARG A 1 40  ? -12.279 -13.180 -6.723  1.00 0.00 ? 40  ARG A HD3  1  
ATOM 561   H HE   . ARG A 1 40  ? -12.648 -14.566 -9.133  1.00 0.00 ? 40  ARG A HE   1  
ATOM 562   H HH11 . ARG A 1 40  ? -11.162 -15.248 -6.017  1.00 0.00 ? 40  ARG A HH11 1  
ATOM 563   H HH12 . ARG A 1 40  ? -11.473 -16.950 -6.097  1.00 0.00 ? 40  ARG A HH12 1  
ATOM 564   H HH21 . ARG A 1 40  ? -13.058 -16.812 -9.240  1.00 0.00 ? 40  ARG A HH21 1  
ATOM 565   H HH22 . ARG A 1 40  ? -12.559 -17.845 -7.943  1.00 0.00 ? 40  ARG A HH22 1  
ATOM 566   N N    . THR A 1 41  ? -14.988 -9.514  -8.198  1.00 0.00 ? 41  THR A N    1  
ATOM 567   C CA   . THR A 1 41  ? -15.940 -8.587  -7.612  1.00 0.00 ? 41  THR A CA   1  
ATOM 568   C C    . THR A 1 41  ? -15.390 -8.012  -6.305  1.00 0.00 ? 41  THR A C    1  
ATOM 569   O O    . THR A 1 41  ? -14.929 -6.872  -6.270  1.00 0.00 ? 41  THR A O    1  
ATOM 570   C CB   . THR A 1 41  ? -17.271 -9.322  -7.439  1.00 0.00 ? 41  THR A CB   1  
ATOM 571   O OG1  . THR A 1 41  ? -16.891 -10.671 -7.183  1.00 0.00 ? 41  THR A OG1  1  
ATOM 572   C CG2  . THR A 1 41  ? -18.070 -9.400  -8.741  1.00 0.00 ? 41  THR A CG2  1  
ATOM 573   H H    . THR A 1 41  ? -15.259 -10.476 -8.166  1.00 0.00 ? 41  THR A H    1  
ATOM 574   H HA   . THR A 1 41  ? -16.073 -7.751  -8.298  1.00 0.00 ? 41  THR A HA   1  
ATOM 575   H HB   . THR A 1 41  ? -17.865 -8.871  -6.644  1.00 0.00 ? 41  THR A HB   1  
ATOM 576   H HG1  . THR A 1 41  ? -17.334 -10.999 -6.349  1.00 0.00 ? 41  THR A HG1  1  
ATOM 577   H HG21 . THR A 1 41  ? -17.720 -8.630  -9.429  1.00 0.00 ? 41  THR A HG21 1  
ATOM 578   H HG22 . THR A 1 41  ? -17.932 -10.382 -9.194  1.00 0.00 ? 41  THR A HG22 1  
ATOM 579   H HG23 . THR A 1 41  ? -19.128 -9.244  -8.529  1.00 0.00 ? 41  THR A HG23 1  
ATOM 580   N N    . THR A 1 42  ? -15.456 -8.827  -5.263  1.00 0.00 ? 42  THR A N    1  
ATOM 581   C CA   . THR A 1 42  ? -14.970 -8.414  -3.957  1.00 0.00 ? 42  THR A CA   1  
ATOM 582   C C    . THR A 1 42  ? -13.597 -9.030  -3.680  1.00 0.00 ? 42  THR A C    1  
ATOM 583   O O    . THR A 1 42  ? -13.279 -9.356  -2.537  1.00 0.00 ? 42  THR A O    1  
ATOM 584   C CB   . THR A 1 42  ? -16.027 -8.791  -2.918  1.00 0.00 ? 42  THR A CB   1  
ATOM 585   O OG1  . THR A 1 42  ? -16.088 -10.213 -2.985  1.00 0.00 ? 42  THR A OG1  1  
ATOM 586   C CG2  . THR A 1 42  ? -17.432 -8.339  -3.321  1.00 0.00 ? 42  THR A CG2  1  
ATOM 587   H H    . THR A 1 42  ? -15.832 -9.753  -5.300  1.00 0.00 ? 42  THR A H    1  
ATOM 588   H HA   . THR A 1 42  ? -14.838 -7.332  -3.966  1.00 0.00 ? 42  THR A HA   1  
ATOM 589   H HB   . THR A 1 42  ? -15.761 -8.405  -1.934  1.00 0.00 ? 42  THR A HB   1  
ATOM 590   H HG1  . THR A 1 42  ? -15.204 -10.606 -2.730  1.00 0.00 ? 42  THR A HG1  1  
ATOM 591   H HG21 . THR A 1 42  ? -17.701 -7.444  -2.759  1.00 0.00 ? 42  THR A HG21 1  
ATOM 592   H HG22 . THR A 1 42  ? -17.450 -8.117  -4.388  1.00 0.00 ? 42  THR A HG22 1  
ATOM 593   H HG23 . THR A 1 42  ? -18.146 -9.133  -3.102  1.00 0.00 ? 42  THR A HG23 1  
ATOM 594   N N    . SER A 1 43  ? -12.821 -9.171  -4.744  1.00 0.00 ? 43  SER A N    1  
ATOM 595   C CA   . SER A 1 43  ? -11.490 -9.743  -4.630  1.00 0.00 ? 43  SER A CA   1  
ATOM 596   C C    . SER A 1 43  ? -10.719 -9.539  -5.935  1.00 0.00 ? 43  SER A C    1  
ATOM 597   O O    . SER A 1 43  ? -11.071 -10.114 -6.964  1.00 0.00 ? 43  SER A O    1  
ATOM 598   C CB   . SER A 1 43  ? -11.558 -11.231 -4.280  1.00 0.00 ? 43  SER A CB   1  
ATOM 599   O OG   . SER A 1 43  ? -12.617 -11.893 -4.965  1.00 0.00 ? 43  SER A OG   1  
ATOM 600   H H    . SER A 1 43  ? -13.088 -8.904  -5.670  1.00 0.00 ? 43  SER A H    1  
ATOM 601   H HA   . SER A 1 43  ? -11.012 -9.200  -3.814  1.00 0.00 ? 43  SER A HA   1  
ATOM 602   H HB2  . SER A 1 43  ? -10.610 -11.706 -4.532  1.00 0.00 ? 43  SER A HB2  1  
ATOM 603   H HB3  . SER A 1 43  ? -11.695 -11.344 -3.204  1.00 0.00 ? 43  SER A HB3  1  
ATOM 604   H HG   . SER A 1 43  ? -13.324 -12.172 -4.315  1.00 0.00 ? 43  SER A HG   1  
ATOM 605   N N    . VAL A 1 44  ? -9.682  -8.720  -5.851  1.00 0.00 ? 44  VAL A N    1  
ATOM 606   C CA   . VAL A 1 44  ? -8.858  -8.433  -7.013  1.00 0.00 ? 44  VAL A CA   1  
ATOM 607   C C    . VAL A 1 44  ? -7.396  -8.748  -6.687  1.00 0.00 ? 44  VAL A C    1  
ATOM 608   O O    . VAL A 1 44  ? -7.054  -8.994  -5.531  1.00 0.00 ? 44  VAL A O    1  
ATOM 609   C CB   . VAL A 1 44  ? -9.072  -6.987  -7.462  1.00 0.00 ? 44  VAL A CB   1  
ATOM 610   C CG1  . VAL A 1 44  ? -10.557 -6.621  -7.444  1.00 0.00 ? 44  VAL A CG1  1  
ATOM 611   C CG2  . VAL A 1 44  ? -8.258  -6.019  -6.601  1.00 0.00 ? 44  VAL A CG2  1  
ATOM 612   H H    . VAL A 1 44  ? -9.402  -8.256  -5.010  1.00 0.00 ? 44  VAL A H    1  
ATOM 613   H HA   . VAL A 1 44  ? -9.186  -9.089  -7.819  1.00 0.00 ? 44  VAL A HA   1  
ATOM 614   H HB   . VAL A 1 44  ? -8.718  -6.899  -8.490  1.00 0.00 ? 44  VAL A HB   1  
ATOM 615   H HG11 . VAL A 1 44  ? -10.681 -5.585  -7.761  1.00 0.00 ? 44  VAL A HG11 1  
ATOM 616   H HG12 . VAL A 1 44  ? -11.101 -7.276  -8.124  1.00 0.00 ? 44  VAL A HG12 1  
ATOM 617   H HG13 . VAL A 1 44  ? -10.948 -6.740  -6.434  1.00 0.00 ? 44  VAL A HG13 1  
ATOM 618   H HG21 . VAL A 1 44  ? -7.747  -6.574  -5.815  1.00 0.00 ? 44  VAL A HG21 1  
ATOM 619   H HG22 . VAL A 1 44  ? -7.522  -5.509  -7.224  1.00 0.00 ? 44  VAL A HG22 1  
ATOM 620   H HG23 . VAL A 1 44  ? -8.925  -5.283  -6.152  1.00 0.00 ? 44  VAL A HG23 1  
ATOM 621   N N    . ARG A 1 45  ? -6.574  -8.729  -7.726  1.00 0.00 ? 45  ARG A N    1  
ATOM 622   C CA   . ARG A 1 45  ? -5.158  -9.009  -7.564  1.00 0.00 ? 45  ARG A CA   1  
ATOM 623   C C    . ARG A 1 45  ? -4.360  -8.390  -8.713  1.00 0.00 ? 45  ARG A C    1  
ATOM 624   O O    . ARG A 1 45  ? -4.391  -8.891  -9.836  1.00 0.00 ? 45  ARG A O    1  
ATOM 625   C CB   . ARG A 1 45  ? -4.895  -10.516 -7.524  1.00 0.00 ? 45  ARG A CB   1  
ATOM 626   C CG   . ARG A 1 45  ? -3.401  -10.809 -7.378  1.00 0.00 ? 45  ARG A CG   1  
ATOM 627   C CD   . ARG A 1 45  ? -3.012  -12.075 -8.143  1.00 0.00 ? 45  ARG A CD   1  
ATOM 628   N NE   . ARG A 1 45  ? -2.980  -13.234 -7.222  1.00 0.00 ? 45  ARG A NE   1  
ATOM 629   C CZ   . ARG A 1 45  ? -2.030  -13.433 -6.299  1.00 0.00 ? 45  ARG A CZ   1  
ATOM 630   N NH1  . ARG A 1 45  ? -1.028  -12.553 -6.168  1.00 0.00 ? 45  ARG A NH1  1  
ATOM 631   N NH2  . ARG A 1 45  ? -2.081  -14.512 -5.507  1.00 0.00 ? 45  ARG A NH2  1  
ATOM 632   H H    . ARG A 1 45  ? -6.861  -8.528  -8.662  1.00 0.00 ? 45  ARG A H    1  
ATOM 633   H HA   . ARG A 1 45  ? -4.890  -8.554  -6.610  1.00 0.00 ? 45  ARG A HA   1  
ATOM 634   H HB2  . ARG A 1 45  ? -5.440  -10.962 -6.691  1.00 0.00 ? 45  ARG A HB2  1  
ATOM 635   H HB3  . ARG A 1 45  ? -5.272  -10.979 -8.436  1.00 0.00 ? 45  ARG A HB3  1  
ATOM 636   H HG2  . ARG A 1 45  ? -2.823  -9.963  -7.750  1.00 0.00 ? 45  ARG A HG2  1  
ATOM 637   H HG3  . ARG A 1 45  ? -3.151  -10.926 -6.323  1.00 0.00 ? 45  ARG A HG3  1  
ATOM 638   H HD2  . ARG A 1 45  ? -3.726  -12.258 -8.946  1.00 0.00 ? 45  ARG A HD2  1  
ATOM 639   H HD3  . ARG A 1 45  ? -2.036  -11.944 -8.609  1.00 0.00 ? 45  ARG A HD3  1  
ATOM 640   H HE   . ARG A 1 45  ? -3.713  -13.910 -7.294  1.00 0.00 ? 45  ARG A HE   1  
ATOM 641   H HH11 . ARG A 1 45  ? -0.989  -11.748 -6.759  1.00 0.00 ? 45  ARG A HH11 1  
ATOM 642   H HH12 . ARG A 1 45  ? -0.318  -12.702 -5.479  1.00 0.00 ? 45  ARG A HH12 1  
ATOM 643   H HH21 . ARG A 1 45  ? -2.829  -15.169 -5.605  1.00 0.00 ? 45  ARG A HH21 1  
ATOM 644   H HH22 . ARG A 1 45  ? -1.372  -14.662 -4.818  1.00 0.00 ? 45  ARG A HH22 1  
ATOM 645   N N    . LEU A 1 46  ? -3.663  -7.310  -8.392  1.00 0.00 ? 46  LEU A N    1  
ATOM 646   C CA   . LEU A 1 46  ? -2.858  -6.617  -9.384  1.00 0.00 ? 46  LEU A CA   1  
ATOM 647   C C    . LEU A 1 46  ? -1.379  -6.925  -9.140  1.00 0.00 ? 46  LEU A C    1  
ATOM 648   O O    . LEU A 1 46  ? -1.024  -7.513  -8.119  1.00 0.00 ? 46  LEU A O    1  
ATOM 649   C CB   . LEU A 1 46  ? -3.182  -5.122  -9.387  1.00 0.00 ? 46  LEU A CB   1  
ATOM 650   C CG   . LEU A 1 46  ? -2.386  -4.261  -8.405  1.00 0.00 ? 46  LEU A CG   1  
ATOM 651   C CD1  . LEU A 1 46  ? -2.372  -2.796  -8.846  1.00 0.00 ? 46  LEU A CD1  1  
ATOM 652   C CD2  . LEU A 1 46  ? -2.915  -4.424  -6.978  1.00 0.00 ? 46  LEU A CD2  1  
ATOM 653   H H    . LEU A 1 46  ? -3.642  -6.909  -7.476  1.00 0.00 ? 46  LEU A H    1  
ATOM 654   H HA   . LEU A 1 46  ? -3.136  -7.009  -10.362 1.00 0.00 ? 46  LEU A HA   1  
ATOM 655   H HB2  . LEU A 1 46  ? -3.017  -4.737  -10.393 1.00 0.00 ? 46  LEU A HB2  1  
ATOM 656   H HB3  . LEU A 1 46  ? -4.243  -5.000  -9.169  1.00 0.00 ? 46  LEU A HB3  1  
ATOM 657   H HG   . LEU A 1 46  ? -1.352  -4.607  -8.406  1.00 0.00 ? 46  LEU A HG   1  
ATOM 658   H HD11 . LEU A 1 46  ? -1.391  -2.365  -8.645  1.00 0.00 ? 46  LEU A HD11 1  
ATOM 659   H HD12 . LEU A 1 46  ? -2.583  -2.736  -9.914  1.00 0.00 ? 46  LEU A HD12 1  
ATOM 660   H HD13 . LEU A 1 46  ? -3.131  -2.243  -8.294  1.00 0.00 ? 46  LEU A HD13 1  
ATOM 661   H HD21 . LEU A 1 46  ? -2.843  -3.472  -6.453  1.00 0.00 ? 46  LEU A HD21 1  
ATOM 662   H HD22 . LEU A 1 46  ? -3.956  -4.744  -7.012  1.00 0.00 ? 46  LEU A HD22 1  
ATOM 663   H HD23 . LEU A 1 46  ? -2.321  -5.174  -6.455  1.00 0.00 ? 46  LEU A HD23 1  
ATOM 664   N N    . ILE A 1 47  ? -0.557  -6.514  -10.094 1.00 0.00 ? 47  ILE A N    1  
ATOM 665   C CA   . ILE A 1 47  ? 0.875   -6.739  -9.996  1.00 0.00 ? 47  ILE A CA   1  
ATOM 666   C C    . ILE A 1 47  ? 1.617   -5.481  -10.451 1.00 0.00 ? 47  ILE A C    1  
ATOM 667   O O    . ILE A 1 47  ? 1.215   -4.835  -11.417 1.00 0.00 ? 47  ILE A O    1  
ATOM 668   C CB   . ILE A 1 47  ? 1.274   -8.001  -10.764 1.00 0.00 ? 47  ILE A CB   1  
ATOM 669   C CG1  . ILE A 1 47  ? 1.402   -7.713  -12.262 1.00 0.00 ? 47  ILE A CG1  1  
ATOM 670   C CG2  . ILE A 1 47  ? 0.299   -9.145  -10.483 1.00 0.00 ? 47  ILE A CG2  1  
ATOM 671   C CD1  . ILE A 1 47  ? 0.061   -7.276  -12.853 1.00 0.00 ? 47  ILE A CD1  1  
ATOM 672   H H    . ILE A 1 47  ? -0.854  -6.037  -10.921 1.00 0.00 ? 47  ILE A H    1  
ATOM 673   H HA   . ILE A 1 47  ? 1.107   -6.915  -8.945  1.00 0.00 ? 47  ILE A HA   1  
ATOM 674   H HB   . ILE A 1 47  ? 2.255   -8.319  -10.413 1.00 0.00 ? 47  ILE A HB   1  
ATOM 675   H HG12 . ILE A 1 47  ? 2.146   -6.932  -12.423 1.00 0.00 ? 47  ILE A HG12 1  
ATOM 676   H HG13 . ILE A 1 47  ? 1.759   -8.604  -12.778 1.00 0.00 ? 47  ILE A HG13 1  
ATOM 677   H HG21 . ILE A 1 47  ? -0.186  -8.981  -9.520  1.00 0.00 ? 47  ILE A HG21 1  
ATOM 678   H HG22 . ILE A 1 47  ? -0.456  -9.181  -11.268 1.00 0.00 ? 47  ILE A HG22 1  
ATOM 679   H HG23 . ILE A 1 47  ? 0.843   -10.089 -10.459 1.00 0.00 ? 47  ILE A HG23 1  
ATOM 680   H HD11 . ILE A 1 47  ? -0.734  -7.469  -12.133 1.00 0.00 ? 47  ILE A HD11 1  
ATOM 681   H HD12 . ILE A 1 47  ? 0.093   -6.211  -13.081 1.00 0.00 ? 47  ILE A HD12 1  
ATOM 682   H HD13 . ILE A 1 47  ? -0.133  -7.837  -13.767 1.00 0.00 ? 47  ILE A HD13 1  
ATOM 683   N N    . TRP A 1 48  ? 2.688   -5.172  -9.734  1.00 0.00 ? 48  TRP A N    1  
ATOM 684   C CA   . TRP A 1 48  ? 3.489   -4.003  -10.053 1.00 0.00 ? 48  TRP A CA   1  
ATOM 685   C C    . TRP A 1 48  ? 4.959   -4.428  -10.074 1.00 0.00 ? 48  TRP A C    1  
ATOM 686   O O    . TRP A 1 48  ? 5.275   -5.591  -9.828  1.00 0.00 ? 48  TRP A O    1  
ATOM 687   C CB   . TRP A 1 48  ? 3.212   -2.863  -9.071  1.00 0.00 ? 48  TRP A CB   1  
ATOM 688   C CG   . TRP A 1 48  ? 3.720   -3.126  -7.652  1.00 0.00 ? 48  TRP A CG   1  
ATOM 689   C CD1  . TRP A 1 48  ? 4.859   -2.697  -7.091  1.00 0.00 ? 48  TRP A CD1  1  
ATOM 690   C CD2  . TRP A 1 48  ? 3.057   -3.901  -6.631  1.00 0.00 ? 48  TRP A CD2  1  
ATOM 691   N NE1  . TRP A 1 48  ? 4.978   -3.136  -5.788  1.00 0.00 ? 48  TRP A NE1  1  
ATOM 692   C CE2  . TRP A 1 48  ? 3.847   -3.892  -5.500  1.00 0.00 ? 48  TRP A CE2  1  
ATOM 693   C CE3  . TRP A 1 48  ? 1.830   -4.587  -6.663  1.00 0.00 ? 48  TRP A CE3  1  
ATOM 694   C CZ2  . TRP A 1 48  ? 3.498   -4.552  -4.315  1.00 0.00 ? 48  TRP A CZ2  1  
ATOM 695   C CZ3  . TRP A 1 48  ? 1.496   -5.242  -5.471  1.00 0.00 ? 48  TRP A CZ3  1  
ATOM 696   C CH2  . TRP A 1 48  ? 2.280   -5.242  -4.324  1.00 0.00 ? 48  TRP A CH2  1  
ATOM 697   H H    . TRP A 1 48  ? 3.008   -5.703  -8.950  1.00 0.00 ? 48  TRP A H    1  
ATOM 698   H HA   . TRP A 1 48  ? 3.189   -3.651  -11.040 1.00 0.00 ? 48  TRP A HA   1  
ATOM 699   H HB2  . TRP A 1 48  ? 3.674   -1.951  -9.448  1.00 0.00 ? 48  TRP A HB2  1  
ATOM 700   H HB3  . TRP A 1 48  ? 2.137   -2.683  -9.033  1.00 0.00 ? 48  TRP A HB3  1  
ATOM 701   H HD1  . TRP A 1 48  ? 5.598   -2.078  -7.599  1.00 0.00 ? 48  TRP A HD1  1  
ATOM 702   H HE1  . TRP A 1 48  ? 5.805   -2.929  -5.110  1.00 0.00 ? 48  TRP A HE1  1  
ATOM 703   H HE3  . TRP A 1 48  ? 1.189   -4.610  -7.543  1.00 0.00 ? 48  TRP A HE3  1  
ATOM 704   H HZ2  . TRP A 1 48  ? 4.140   -4.530  -3.435  1.00 0.00 ? 48  TRP A HZ2  1  
ATOM 705   H HZ3  . TRP A 1 48  ? 0.554   -5.790  -5.441  1.00 0.00 ? 48  TRP A HZ3  1  
ATOM 706   H HH2  . TRP A 1 48  ? 1.948   -5.778  -3.434  1.00 0.00 ? 48  TRP A HH2  1  
ATOM 707   N N    . GLN A 1 49  ? 5.817   -3.464  -10.372 1.00 0.00 ? 49  GLN A N    1  
ATOM 708   C CA   . GLN A 1 49  ? 7.246   -3.724  -10.429 1.00 0.00 ? 49  GLN A CA   1  
ATOM 709   C C    . GLN A 1 49  ? 8.018   -2.605  -9.728  1.00 0.00 ? 49  GLN A C    1  
ATOM 710   O O    . GLN A 1 49  ? 7.494   -1.508  -9.540  1.00 0.00 ? 49  GLN A O    1  
ATOM 711   C CB   . GLN A 1 49  ? 7.715   -3.892  -11.875 1.00 0.00 ? 49  GLN A CB   1  
ATOM 712   C CG   . GLN A 1 49  ? 7.358   -5.281  -12.410 1.00 0.00 ? 49  GLN A CG   1  
ATOM 713   C CD   . GLN A 1 49  ? 7.643   -5.380  -13.910 1.00 0.00 ? 49  GLN A CD   1  
ATOM 714   O OE1  . GLN A 1 49  ? 8.550   -4.758  -14.438 1.00 0.00 ? 49  GLN A OE1  1  
ATOM 715   N NE2  . GLN A 1 49  ? 6.822   -6.197  -14.564 1.00 0.00 ? 49  GLN A NE2  1  
ATOM 716   H H    . GLN A 1 49  ? 5.551   -2.521  -10.572 1.00 0.00 ? 49  GLN A H    1  
ATOM 717   H HA   . GLN A 1 49  ? 7.390   -4.664  -9.895  1.00 0.00 ? 49  GLN A HA   1  
ATOM 718   H HB2  . GLN A 1 49  ? 7.255   -3.128  -12.502 1.00 0.00 ? 49  GLN A HB2  1  
ATOM 719   H HB3  . GLN A 1 49  ? 8.793   -3.744  -11.931 1.00 0.00 ? 49  GLN A HB3  1  
ATOM 720   H HG2  . GLN A 1 49  ? 7.931   -6.039  -11.876 1.00 0.00 ? 49  GLN A HG2  1  
ATOM 721   H HG3  . GLN A 1 49  ? 6.304   -5.487  -12.222 1.00 0.00 ? 49  GLN A HG3  1  
ATOM 722   H HE21 . GLN A 1 49  ? 6.098   -6.678  -14.070 1.00 0.00 ? 49  GLN A HE21 1  
ATOM 723   H HE22 . GLN A 1 49  ? 6.928   -6.329  -15.549 1.00 0.00 ? 49  GLN A HE22 1  
ATOM 724   N N    . PRO A 1 50  ? 9.284   -2.928  -9.351  1.00 0.00 ? 50  PRO A N    1  
ATOM 725   C CA   . PRO A 1 50  ? 10.133  -1.962  -8.675  1.00 0.00 ? 50  PRO A CA   1  
ATOM 726   C C    . PRO A 1 50  ? 10.657  -0.912  -9.656  1.00 0.00 ? 50  PRO A C    1  
ATOM 727   O O    . PRO A 1 50  ? 10.783  -1.180  -10.850 1.00 0.00 ? 50  PRO A O    1  
ATOM 728   C CB   . PRO A 1 50  ? 11.241  -2.788  -8.042  1.00 0.00 ? 50  PRO A CB   1  
ATOM 729   C CG   . PRO A 1 50  ? 11.234  -4.123  -8.769  1.00 0.00 ? 50  PRO A CG   1  
ATOM 730   C CD   . PRO A 1 50  ? 9.937   -4.217  -9.558  1.00 0.00 ? 50  PRO A CD   1  
ATOM 731   H HA   . PRO A 1 50  ? 9.608   -1.459  -7.989  1.00 0.00 ? 50  PRO A HA   1  
ATOM 732   H HB2  . PRO A 1 50  ? 12.206  -2.292  -8.146  1.00 0.00 ? 50  PRO A HB2  1  
ATOM 733   H HB3  . PRO A 1 50  ? 11.066  -2.924  -6.975  1.00 0.00 ? 50  PRO A HB3  1  
ATOM 734   H HG2  . PRO A 1 50  ? 12.093  -4.199  -9.437  1.00 0.00 ? 50  PRO A HG2  1  
ATOM 735   H HG3  . PRO A 1 50  ? 11.309  -4.946  -8.058  1.00 0.00 ? 50  PRO A HG3  1  
ATOM 736   H HD2  . PRO A 1 50  ? 10.129  -4.399  -10.615 1.00 0.00 ? 50  PRO A HD2  1  
ATOM 737   H HD3  . PRO A 1 50  ? 9.316   -5.038  -9.201  1.00 0.00 ? 50  PRO A HD3  1  
ATOM 738   N N    . PRO A 1 51  ? 10.956  0.294   -9.102  1.00 0.00 ? 51  PRO A N    1  
ATOM 739   C CA   . PRO A 1 51  ? 11.463  1.386   -9.915  1.00 0.00 ? 51  PRO A CA   1  
ATOM 740   C C    . PRO A 1 51  ? 12.928  1.156   -10.290 1.00 0.00 ? 51  PRO A C    1  
ATOM 741   O O    . PRO A 1 51  ? 13.788  1.060   -9.416  1.00 0.00 ? 51  PRO A O    1  
ATOM 742   C CB   . PRO A 1 51  ? 11.254  2.634   -9.072  1.00 0.00 ? 51  PRO A CB   1  
ATOM 743   C CG   . PRO A 1 51  ? 11.070  2.146   -7.644  1.00 0.00 ? 51  PRO A CG   1  
ATOM 744   C CD   . PRO A 1 51  ? 10.819  0.647   -7.692  1.00 0.00 ? 51  PRO A CD   1  
ATOM 745   H HA   . PRO A 1 51  ? 10.964  1.436   -10.780 1.00 0.00 ? 51  PRO A HA   1  
ATOM 746   H HB2  . PRO A 1 51  ? 12.110  3.304   -9.148  1.00 0.00 ? 51  PRO A HB2  1  
ATOM 747   H HB3  . PRO A 1 51  ? 10.381  3.192   -9.410  1.00 0.00 ? 51  PRO A HB3  1  
ATOM 748   H HG2  . PRO A 1 51  ? 11.955  2.366   -7.048  1.00 0.00 ? 51  PRO A HG2  1  
ATOM 749   H HG3  . PRO A 1 51  ? 10.232  2.658   -7.171  1.00 0.00 ? 51  PRO A HG3  1  
ATOM 750   H HD2  . PRO A 1 51  ? 11.538  0.106   -7.077  1.00 0.00 ? 51  PRO A HD2  1  
ATOM 751   H HD3  . PRO A 1 51  ? 9.827   0.399   -7.316  1.00 0.00 ? 51  PRO A HD3  1  
ATOM 752   N N    . ALA A 1 52  ? 13.167  1.075   -11.590 1.00 0.00 ? 52  ALA A N    1  
ATOM 753   C CA   . ALA A 1 52  ? 14.514  0.859   -12.092 1.00 0.00 ? 52  ALA A CA   1  
ATOM 754   C C    . ALA A 1 52  ? 15.495  1.724   -11.297 1.00 0.00 ? 52  ALA A C    1  
ATOM 755   O O    . ALA A 1 52  ? 16.662  1.367   -11.148 1.00 0.00 ? 52  ALA A O    1  
ATOM 756   C CB   . ALA A 1 52  ? 14.555  1.158   -13.591 1.00 0.00 ? 52  ALA A CB   1  
ATOM 757   H H    . ALA A 1 52  ? 12.462  1.155   -12.295 1.00 0.00 ? 52  ALA A H    1  
ATOM 758   H HA   . ALA A 1 52  ? 14.761  -0.192  -11.936 1.00 0.00 ? 52  ALA A HA   1  
ATOM 759   H HB1  . ALA A 1 52  ? 13.555  1.419   -13.937 1.00 0.00 ? 52  ALA A HB1  1  
ATOM 760   H HB2  . ALA A 1 52  ? 15.233  1.991   -13.777 1.00 0.00 ? 52  ALA A HB2  1  
ATOM 761   H HB3  . ALA A 1 52  ? 14.906  0.277   -14.128 1.00 0.00 ? 52  ALA A HB3  1  
ATOM 762   N N    . ALA A 1 53  ? 14.984  2.844   -10.808 1.00 0.00 ? 53  ALA A N    1  
ATOM 763   C CA   . ALA A 1 53  ? 15.800  3.763   -10.033 1.00 0.00 ? 53  ALA A CA   1  
ATOM 764   C C    . ALA A 1 53  ? 15.249  3.849   -8.608  1.00 0.00 ? 53  ALA A C    1  
ATOM 765   O O    . ALA A 1 53  ? 14.460  4.740   -8.297  1.00 0.00 ? 53  ALA A O    1  
ATOM 766   C CB   . ALA A 1 53  ? 15.835  5.125   -10.728 1.00 0.00 ? 53  ALA A CB   1  
ATOM 767   H H    . ALA A 1 53  ? 14.033  3.127   -10.934 1.00 0.00 ? 53  ALA A H    1  
ATOM 768   H HA   . ALA A 1 53  ? 16.812  3.360   -9.999  1.00 0.00 ? 53  ALA A HA   1  
ATOM 769   H HB1  . ALA A 1 53  ? 14.962  5.707   -10.433 1.00 0.00 ? 53  ALA A HB1  1  
ATOM 770   H HB2  . ALA A 1 53  ? 16.741  5.658   -10.438 1.00 0.00 ? 53  ALA A HB2  1  
ATOM 771   H HB3  . ALA A 1 53  ? 15.829  4.982   -11.809 1.00 0.00 ? 53  ALA A HB3  1  
ATOM 772   N N    . PRO A 1 54  ? 15.699  2.887   -7.759  1.00 0.00 ? 54  PRO A N    1  
ATOM 773   C CA   . PRO A 1 54  ? 15.260  2.846   -6.375  1.00 0.00 ? 54  PRO A CA   1  
ATOM 774   C C    . PRO A 1 54  ? 15.941  3.940   -5.551  1.00 0.00 ? 54  PRO A C    1  
ATOM 775   O O    . PRO A 1 54  ? 15.332  4.514   -4.649  1.00 0.00 ? 54  PRO A O    1  
ATOM 776   C CB   . PRO A 1 54  ? 15.598  1.444   -5.896  1.00 0.00 ? 54  PRO A CB   1  
ATOM 777   C CG   . PRO A 1 54  ? 16.629  0.906   -6.875  1.00 0.00 ? 54  PRO A CG   1  
ATOM 778   C CD   . PRO A 1 54  ? 16.633  1.816   -8.093  1.00 0.00 ? 54  PRO A CD   1  
ATOM 779   H HA   . PRO A 1 54  ? 14.279  3.031   -6.316  1.00 0.00 ? 54  PRO A HA   1  
ATOM 780   H HB2  . PRO A 1 54  ? 15.997  1.463   -4.881  1.00 0.00 ? 54  PRO A HB2  1  
ATOM 781   H HB3  . PRO A 1 54  ? 14.710  0.812   -5.877  1.00 0.00 ? 54  PRO A HB3  1  
ATOM 782   H HG2  . PRO A 1 54  ? 17.616  0.880   -6.415  1.00 0.00 ? 54  PRO A HG2  1  
ATOM 783   H HG3  . PRO A 1 54  ? 16.384  -0.116  -7.164  1.00 0.00 ? 54  PRO A HG3  1  
ATOM 784   H HD2  . PRO A 1 54  ? 17.631  2.209   -8.290  1.00 0.00 ? 54  PRO A HD2  1  
ATOM 785   H HD3  . PRO A 1 54  ? 16.318  1.281   -8.989  1.00 0.00 ? 54  PRO A HD3  1  
ATOM 786   N N    . ASN A 1 55  ? 17.196  4.196   -5.890  1.00 0.00 ? 55  ASN A N    1  
ATOM 787   C CA   . ASN A 1 55  ? 17.967  5.211   -5.192  1.00 0.00 ? 55  ASN A CA   1  
ATOM 788   C C    . ASN A 1 55  ? 17.704  5.103   -3.689  1.00 0.00 ? 55  ASN A C    1  
ATOM 789   O O    . ASN A 1 55  ? 17.500  6.113   -3.017  1.00 0.00 ? 55  ASN A O    1  
ATOM 790   C CB   . ASN A 1 55  ? 17.563  6.617   -5.643  1.00 0.00 ? 55  ASN A CB   1  
ATOM 791   C CG   . ASN A 1 55  ? 17.081  6.609   -7.095  1.00 0.00 ? 55  ASN A CG   1  
ATOM 792   O OD1  . ASN A 1 55  ? 17.859  6.554   -8.034  1.00 0.00 ? 55  ASN A OD1  1  
ATOM 793   N ND2  . ASN A 1 55  ? 15.759  6.668   -7.227  1.00 0.00 ? 55  ASN A ND2  1  
ATOM 794   H H    . ASN A 1 55  ? 17.684  3.725   -6.624  1.00 0.00 ? 55  ASN A H    1  
ATOM 795   H HA   . ASN A 1 55  ? 19.007  5.008   -5.449  1.00 0.00 ? 55  ASN A HA   1  
ATOM 796   H HB2  . ASN A 1 55  ? 16.773  6.997   -4.996  1.00 0.00 ? 55  ASN A HB2  1  
ATOM 797   H HB3  . ASN A 1 55  ? 18.412  7.293   -5.541  1.00 0.00 ? 55  ASN A HB3  1  
ATOM 798   H HD21 . ASN A 1 55  ? 15.178  6.712   -6.415  1.00 0.00 ? 55  ASN A HD21 1  
ATOM 799   H HD22 . ASN A 1 55  ? 15.347  6.668   -8.138  1.00 0.00 ? 55  ASN A HD22 1  
ATOM 800   N N    . GLY A 1 56  ? 17.716  3.870   -3.206  1.00 0.00 ? 56  GLY A N    1  
ATOM 801   C CA   . GLY A 1 56  ? 17.481  3.616   -1.795  1.00 0.00 ? 56  GLY A CA   1  
ATOM 802   C C    . GLY A 1 56  ? 16.864  2.233   -1.581  1.00 0.00 ? 56  GLY A C    1  
ATOM 803   O O    . GLY A 1 56  ? 15.931  1.850   -2.286  1.00 0.00 ? 56  GLY A O    1  
ATOM 804   H H    . GLY A 1 56  ? 17.883  3.054   -3.760  1.00 0.00 ? 56  GLY A H    1  
ATOM 805   H HA2  . GLY A 1 56  ? 18.421  3.687   -1.247  1.00 0.00 ? 56  GLY A HA2  1  
ATOM 806   H HA3  . GLY A 1 56  ? 16.818  4.381   -1.390  1.00 0.00 ? 56  GLY A HA3  1  
ATOM 807   N N    . ILE A 1 57  ? 17.409  1.520   -0.606  1.00 0.00 ? 57  ILE A N    1  
ATOM 808   C CA   . ILE A 1 57  ? 16.923  0.188   -0.291  1.00 0.00 ? 57  ILE A CA   1  
ATOM 809   C C    . ILE A 1 57  ? 15.456  0.272   0.135   1.00 0.00 ? 57  ILE A C    1  
ATOM 810   O O    . ILE A 1 57  ? 15.105  1.059   1.013   1.00 0.00 ? 57  ILE A O    1  
ATOM 811   C CB   . ILE A 1 57  ? 17.828  -0.481  0.746   1.00 0.00 ? 57  ILE A CB   1  
ATOM 812   C CG1  . ILE A 1 57  ? 19.074  -1.074  0.085   1.00 0.00 ? 57  ILE A CG1  1  
ATOM 813   C CG2  . ILE A 1 57  ? 17.055  -1.525  1.555   1.00 0.00 ? 57  ILE A CG2  1  
ATOM 814   C CD1  . ILE A 1 57  ? 19.589  -0.163  -1.031  1.00 0.00 ? 57  ILE A CD1  1  
ATOM 815   H H    . ILE A 1 57  ? 18.167  1.839   -0.038  1.00 0.00 ? 57  ILE A H    1  
ATOM 816   H HA   . ILE A 1 57  ? 16.984  -0.406  -1.203  1.00 0.00 ? 57  ILE A HA   1  
ATOM 817   H HB   . ILE A 1 57  ? 18.167  0.282   1.446   1.00 0.00 ? 57  ILE A HB   1  
ATOM 818   H HG12 . ILE A 1 57  ? 19.854  -1.216  0.833   1.00 0.00 ? 57  ILE A HG12 1  
ATOM 819   H HG13 . ILE A 1 57  ? 18.840  -2.058  -0.322  1.00 0.00 ? 57  ILE A HG13 1  
ATOM 820   H HG21 . ILE A 1 57  ? 16.258  -1.944  0.940   1.00 0.00 ? 57  ILE A HG21 1  
ATOM 821   H HG22 . ILE A 1 57  ? 17.734  -2.321  1.862   1.00 0.00 ? 57  ILE A HG22 1  
ATOM 822   H HG23 . ILE A 1 57  ? 16.625  -1.054  2.438   1.00 0.00 ? 57  ILE A HG23 1  
ATOM 823   H HD11 . ILE A 1 57  ? 18.859  -0.130  -1.839  1.00 0.00 ? 57  ILE A HD11 1  
ATOM 824   H HD12 . ILE A 1 57  ? 19.742  0.842   -0.638  1.00 0.00 ? 57  ILE A HD12 1  
ATOM 825   H HD13 . ILE A 1 57  ? 20.534  -0.552  -1.410  1.00 0.00 ? 57  ILE A HD13 1  
ATOM 826   N N    . ILE A 1 58  ? 14.638  -0.550  -0.507  1.00 0.00 ? 58  ILE A N    1  
ATOM 827   C CA   . ILE A 1 58  ? 13.217  -0.578  -0.205  1.00 0.00 ? 58  ILE A CA   1  
ATOM 828   C C    . ILE A 1 58  ? 12.998  -1.300  1.127   1.00 0.00 ? 58  ILE A C    1  
ATOM 829   O O    . ILE A 1 58  ? 13.502  -2.403  1.330   1.00 0.00 ? 58  ILE A O    1  
ATOM 830   C CB   . ILE A 1 58  ? 12.434  -1.186  -1.370  1.00 0.00 ? 58  ILE A CB   1  
ATOM 831   C CG1  . ILE A 1 58  ? 12.842  -0.545  -2.698  1.00 0.00 ? 58  ILE A CG1  1  
ATOM 832   C CG2  . ILE A 1 58  ? 10.927  -1.090  -1.127  1.00 0.00 ? 58  ILE A CG2  1  
ATOM 833   C CD1  . ILE A 1 58  ? 12.499  0.946   -2.716  1.00 0.00 ? 58  ILE A CD1  1  
ATOM 834   H H    . ILE A 1 58  ? 14.932  -1.187  -1.219  1.00 0.00 ? 58  ILE A H    1  
ATOM 835   H HA   . ILE A 1 58  ? 12.886  0.454   -0.097  1.00 0.00 ? 58  ILE A HA   1  
ATOM 836   H HB   . ILE A 1 58  ? 12.683  -2.245  -1.433  1.00 0.00 ? 58  ILE A HB   1  
ATOM 837   H HG12 . ILE A 1 58  ? 13.913  -0.678  -2.856  1.00 0.00 ? 58  ILE A HG12 1  
ATOM 838   H HG13 . ILE A 1 58  ? 12.334  -1.049  -3.520  1.00 0.00 ? 58  ILE A HG13 1  
ATOM 839   H HG21 . ILE A 1 58  ? 10.525  -2.085  -0.937  1.00 0.00 ? 58  ILE A HG21 1  
ATOM 840   H HG22 . ILE A 1 58  ? 10.738  -0.452  -0.263  1.00 0.00 ? 58  ILE A HG22 1  
ATOM 841   H HG23 . ILE A 1 58  ? 10.443  -0.664  -2.006  1.00 0.00 ? 58  ILE A HG23 1  
ATOM 842   H HD11 . ILE A 1 58  ? 11.599  1.119   -2.126  1.00 0.00 ? 58  ILE A HD11 1  
ATOM 843   H HD12 . ILE A 1 58  ? 13.327  1.514   -2.291  1.00 0.00 ? 58  ILE A HD12 1  
ATOM 844   H HD13 . ILE A 1 58  ? 12.328  1.267   -3.743  1.00 0.00 ? 58  ILE A HD13 1  
ATOM 845   N N    . LEU A 1 59  ? 12.244  -0.647  1.999   1.00 0.00 ? 59  LEU A N    1  
ATOM 846   C CA   . LEU A 1 59  ? 11.951  -1.213  3.305   1.00 0.00 ? 59  LEU A CA   1  
ATOM 847   C C    . LEU A 1 59  ? 10.586  -1.902  3.264   1.00 0.00 ? 59  LEU A C    1  
ATOM 848   O O    . LEU A 1 59  ? 10.322  -2.813  4.047   1.00 0.00 ? 59  LEU A O    1  
ATOM 849   C CB   . LEU A 1 59  ? 12.066  -0.141  4.391   1.00 0.00 ? 59  LEU A CB   1  
ATOM 850   C CG   . LEU A 1 59  ? 13.488  0.252   4.798   1.00 0.00 ? 59  LEU A CG   1  
ATOM 851   C CD1  . LEU A 1 59  ? 14.405  0.334   3.576   1.00 0.00 ? 59  LEU A CD1  1  
ATOM 852   C CD2  . LEU A 1 59  ? 13.488  1.554   5.603   1.00 0.00 ? 59  LEU A CD2  1  
ATOM 853   H H    . LEU A 1 59  ? 11.838  0.250   1.827   1.00 0.00 ? 59  LEU A H    1  
ATOM 854   H HA   . LEU A 1 59  ? 12.712  -1.965  3.514   1.00 0.00 ? 59  LEU A HA   1  
ATOM 855   H HB2  . LEU A 1 59  ? 11.547  0.754   4.047   1.00 0.00 ? 59  LEU A HB2  1  
ATOM 856   H HB3  . LEU A 1 59  ? 11.540  -0.493  5.279   1.00 0.00 ? 59  LEU A HB3  1  
ATOM 857   H HG   . LEU A 1 59  ? 13.885  -0.528  5.448   1.00 0.00 ? 59  LEU A HG   1  
ATOM 858   H HD11 . LEU A 1 59  ? 14.311  -0.580  2.990   1.00 0.00 ? 59  LEU A HD11 1  
ATOM 859   H HD12 . LEU A 1 59  ? 14.119  1.189   2.964   1.00 0.00 ? 59  LEU A HD12 1  
ATOM 860   H HD13 . LEU A 1 59  ? 15.438  0.450   3.904   1.00 0.00 ? 59  LEU A HD13 1  
ATOM 861   H HD21 . LEU A 1 59  ? 12.466  1.918   5.704   1.00 0.00 ? 59  LEU A HD21 1  
ATOM 862   H HD22 . LEU A 1 59  ? 13.908  1.369   6.591   1.00 0.00 ? 59  LEU A HD22 1  
ATOM 863   H HD23 . LEU A 1 59  ? 14.090  2.300   5.085   1.00 0.00 ? 59  LEU A HD23 1  
ATOM 864   N N    . ALA A 1 60  ? 9.754   -1.440  2.342   1.00 0.00 ? 60  ALA A N    1  
ATOM 865   C CA   . ALA A 1 60  ? 8.422   -2.001  2.188   1.00 0.00 ? 60  ALA A CA   1  
ATOM 866   C C    . ALA A 1 60  ? 7.649   -1.188  1.147   1.00 0.00 ? 60  ALA A C    1  
ATOM 867   O O    . ALA A 1 60  ? 8.207   -0.296  0.511   1.00 0.00 ? 60  ALA A O    1  
ATOM 868   C CB   . ALA A 1 60  ? 7.719   -2.028  3.546   1.00 0.00 ? 60  ALA A CB   1  
ATOM 869   H H    . ALA A 1 60  ? 9.976   -0.699  1.709   1.00 0.00 ? 60  ALA A H    1  
ATOM 870   H HA   . ALA A 1 60  ? 8.532   -3.024  1.829   1.00 0.00 ? 60  ALA A HA   1  
ATOM 871   H HB1  . ALA A 1 60  ? 6.686   -1.702  3.427   1.00 0.00 ? 60  ALA A HB1  1  
ATOM 872   H HB2  . ALA A 1 60  ? 7.736   -3.042  3.944   1.00 0.00 ? 60  ALA A HB2  1  
ATOM 873   H HB3  . ALA A 1 60  ? 8.234   -1.359  4.235   1.00 0.00 ? 60  ALA A HB3  1  
ATOM 874   N N    . TYR A 1 61  ? 6.376   -1.527  1.006   1.00 0.00 ? 61  TYR A N    1  
ATOM 875   C CA   . TYR A 1 61  ? 5.520   -0.840  0.053   1.00 0.00 ? 61  TYR A CA   1  
ATOM 876   C C    . TYR A 1 61  ? 4.147   -0.548  0.661   1.00 0.00 ? 61  TYR A C    1  
ATOM 877   O O    . TYR A 1 61  ? 3.852   -0.980  1.774   1.00 0.00 ? 61  TYR A O    1  
ATOM 878   C CB   . TYR A 1 61  ? 5.349   -1.798  -1.127  1.00 0.00 ? 61  TYR A CB   1  
ATOM 879   C CG   . TYR A 1 61  ? 6.494   -1.748  -2.140  1.00 0.00 ? 61  TYR A CG   1  
ATOM 880   C CD1  . TYR A 1 61  ? 7.690   -2.377  -1.862  1.00 0.00 ? 61  TYR A CD1  1  
ATOM 881   C CD2  . TYR A 1 61  ? 6.330   -1.073  -3.333  1.00 0.00 ? 61  TYR A CD2  1  
ATOM 882   C CE1  . TYR A 1 61  ? 8.767   -2.330  -2.816  1.00 0.00 ? 61  TYR A CE1  1  
ATOM 883   C CE2  . TYR A 1 61  ? 7.408   -1.025  -4.287  1.00 0.00 ? 61  TYR A CE2  1  
ATOM 884   C CZ   . TYR A 1 61  ? 8.573   -1.656  -3.981  1.00 0.00 ? 61  TYR A CZ   1  
ATOM 885   O OH   . TYR A 1 61  ? 9.591   -1.611  -4.882  1.00 0.00 ? 61  TYR A OH   1  
ATOM 886   H H    . TYR A 1 61  ? 5.929   -2.253  1.528   1.00 0.00 ? 61  TYR A H    1  
ATOM 887   H HA   . TYR A 1 61  ? 6.000   0.103   -0.211  1.00 0.00 ? 61  TYR A HA   1  
ATOM 888   H HB2  . TYR A 1 61  ? 5.259   -2.815  -0.746  1.00 0.00 ? 61  TYR A HB2  1  
ATOM 889   H HB3  . TYR A 1 61  ? 4.414   -1.565  -1.638  1.00 0.00 ? 61  TYR A HB3  1  
ATOM 890   H HD1  . TYR A 1 61  ? 7.819   -2.910  -0.920  1.00 0.00 ? 61  TYR A HD1  1  
ATOM 891   H HD2  . TYR A 1 61  ? 5.386   -0.575  -3.553  1.00 0.00 ? 61  TYR A HD2  1  
ATOM 892   H HE1  . TYR A 1 61  ? 9.717   -2.823  -2.609  1.00 0.00 ? 61  TYR A HE1  1  
ATOM 893   H HE2  . TYR A 1 61  ? 7.292   -0.496  -5.233  1.00 0.00 ? 61  TYR A HE2  1  
ATOM 894   H HH   . TYR A 1 61  ? 10.214  -2.380  -4.733  1.00 0.00 ? 61  TYR A HH   1  
ATOM 895   N N    . GLN A 1 62  ? 3.343   0.184   -0.096  1.00 0.00 ? 62  GLN A N    1  
ATOM 896   C CA   . GLN A 1 62  ? 2.008   0.539   0.354   1.00 0.00 ? 62  GLN A CA   1  
ATOM 897   C C    . GLN A 1 62  ? 1.021   0.480   -0.814  1.00 0.00 ? 62  GLN A C    1  
ATOM 898   O O    . GLN A 1 62  ? 1.309   0.979   -1.901  1.00 0.00 ? 62  GLN A O    1  
ATOM 899   C CB   . GLN A 1 62  ? 1.999   1.921   1.009   1.00 0.00 ? 62  GLN A CB   1  
ATOM 900   C CG   . GLN A 1 62  ? 0.634   2.227   1.628   1.00 0.00 ? 62  GLN A CG   1  
ATOM 901   C CD   . GLN A 1 62  ? 0.706   3.454   2.538   1.00 0.00 ? 62  GLN A CD   1  
ATOM 902   O OE1  . GLN A 1 62  ? 1.362   3.458   3.567   1.00 0.00 ? 62  GLN A OE1  1  
ATOM 903   N NE2  . GLN A 1 62  ? -0.001  4.493   2.103   1.00 0.00 ? 62  GLN A NE2  1  
ATOM 904   H H    . GLN A 1 62  ? 3.590   0.532   -1.001  1.00 0.00 ? 62  GLN A H    1  
ATOM 905   H HA   . GLN A 1 62  ? 1.744   -0.211  1.099   1.00 0.00 ? 62  GLN A HA   1  
ATOM 906   H HB2  . GLN A 1 62  ? 2.770   1.968   1.779   1.00 0.00 ? 62  GLN A HB2  1  
ATOM 907   H HB3  . GLN A 1 62  ? 2.244   2.681   0.267   1.00 0.00 ? 62  GLN A HB3  1  
ATOM 908   H HG2  . GLN A 1 62  ? -0.097  2.398   0.838   1.00 0.00 ? 62  GLN A HG2  1  
ATOM 909   H HG3  . GLN A 1 62  ? 0.289   1.365   2.200   1.00 0.00 ? 62  GLN A HG3  1  
ATOM 910   H HE21 . GLN A 1 62  ? -0.517  4.424   1.250   1.00 0.00 ? 62  GLN A HE21 1  
ATOM 911   H HE22 . GLN A 1 62  ? -0.017  5.343   2.630   1.00 0.00 ? 62  GLN A HE22 1  
ATOM 912   N N    . ILE A 1 63  ? -0.123  -0.135  -0.550  1.00 0.00 ? 63  ILE A N    1  
ATOM 913   C CA   . ILE A 1 63  ? -1.154  -0.266  -1.566  1.00 0.00 ? 63  ILE A CA   1  
ATOM 914   C C    . ILE A 1 63  ? -2.471  0.292   -1.023  1.00 0.00 ? 63  ILE A C    1  
ATOM 915   O O    . ILE A 1 63  ? -3.135  -0.352  -0.213  1.00 0.00 ? 63  ILE A O    1  
ATOM 916   C CB   . ILE A 1 63  ? -1.251  -1.715  -2.047  1.00 0.00 ? 63  ILE A CB   1  
ATOM 917   C CG1  . ILE A 1 63  ? -0.627  -1.875  -3.434  1.00 0.00 ? 63  ILE A CG1  1  
ATOM 918   C CG2  . ILE A 1 63  ? -2.699  -2.209  -2.009  1.00 0.00 ? 63  ILE A CG2  1  
ATOM 919   C CD1  . ILE A 1 63  ? 0.228   -3.141  -3.508  1.00 0.00 ? 63  ILE A CD1  1  
ATOM 920   H H    . ILE A 1 63  ? -0.349  -0.538  0.336   1.00 0.00 ? 63  ILE A H    1  
ATOM 921   H HA   . ILE A 1 63  ? -0.849  0.338   -2.420  1.00 0.00 ? 63  ILE A HA   1  
ATOM 922   H HB   . ILE A 1 63  ? -0.679  -2.341  -1.362  1.00 0.00 ? 63  ILE A HB   1  
ATOM 923   H HG12 . ILE A 1 63  ? -1.413  -1.918  -4.188  1.00 0.00 ? 63  ILE A HG12 1  
ATOM 924   H HG13 . ILE A 1 63  ? -0.013  -1.004  -3.664  1.00 0.00 ? 63  ILE A HG13 1  
ATOM 925   H HG21 . ILE A 1 63  ? -2.982  -2.425  -0.979  1.00 0.00 ? 63  ILE A HG21 1  
ATOM 926   H HG22 . ILE A 1 63  ? -3.356  -1.439  -2.413  1.00 0.00 ? 63  ILE A HG22 1  
ATOM 927   H HG23 . ILE A 1 63  ? -2.789  -3.115  -2.608  1.00 0.00 ? 63  ILE A HG23 1  
ATOM 928   H HD11 . ILE A 1 63  ? 1.166   -2.978  -2.977  1.00 0.00 ? 63  ILE A HD11 1  
ATOM 929   H HD12 . ILE A 1 63  ? -0.310  -3.970  -3.048  1.00 0.00 ? 63  ILE A HD12 1  
ATOM 930   H HD13 . ILE A 1 63  ? 0.438   -3.378  -4.551  1.00 0.00 ? 63  ILE A HD13 1  
ATOM 931   N N    . THR A 1 64  ? -2.810  1.484   -1.492  1.00 0.00 ? 64  THR A N    1  
ATOM 932   C CA   . THR A 1 64  ? -4.036  2.136   -1.064  1.00 0.00 ? 64  THR A CA   1  
ATOM 933   C C    . THR A 1 64  ? -5.192  1.762   -1.995  1.00 0.00 ? 64  THR A C    1  
ATOM 934   O O    . THR A 1 64  ? -5.113  1.975   -3.204  1.00 0.00 ? 64  THR A O    1  
ATOM 935   C CB   . THR A 1 64  ? -3.773  3.641   -0.997  1.00 0.00 ? 64  THR A CB   1  
ATOM 936   O OG1  . THR A 1 64  ? -3.703  4.043   -2.362  1.00 0.00 ? 64  THR A OG1  1  
ATOM 937   C CG2  . THR A 1 64  ? -2.386  3.969   -0.441  1.00 0.00 ? 64  THR A CG2  1  
ATOM 938   H H    . THR A 1 64  ? -2.264  2.001   -2.151  1.00 0.00 ? 64  THR A H    1  
ATOM 939   H HA   . THR A 1 64  ? -4.293  1.766   -0.071  1.00 0.00 ? 64  THR A HA   1  
ATOM 940   H HB   . THR A 1 64  ? -4.551  4.147   -0.426  1.00 0.00 ? 64  THR A HB   1  
ATOM 941   H HG1  . THR A 1 64  ? -4.625  4.184   -2.725  1.00 0.00 ? 64  THR A HG1  1  
ATOM 942   H HG21 . THR A 1 64  ? -1.910  3.053   -0.090  1.00 0.00 ? 64  THR A HG21 1  
ATOM 943   H HG22 . THR A 1 64  ? -1.776  4.417   -1.226  1.00 0.00 ? 64  THR A HG22 1  
ATOM 944   H HG23 . THR A 1 64  ? -2.483  4.669   0.388   1.00 0.00 ? 64  THR A HG23 1  
ATOM 945   N N    . HIS A 1 65  ? -6.237  1.211   -1.396  1.00 0.00 ? 65  HIS A N    1  
ATOM 946   C CA   . HIS A 1 65  ? -7.407  0.805   -2.156  1.00 0.00 ? 65  HIS A CA   1  
ATOM 947   C C    . HIS A 1 65  ? -8.630  1.588   -1.673  1.00 0.00 ? 65  HIS A C    1  
ATOM 948   O O    . HIS A 1 65  ? -8.918  1.620   -0.478  1.00 0.00 ? 65  HIS A O    1  
ATOM 949   C CB   . HIS A 1 65  ? -7.606  -0.710  -2.081  1.00 0.00 ? 65  HIS A CB   1  
ATOM 950   C CG   . HIS A 1 65  ? -7.382  -1.291  -0.706  1.00 0.00 ? 65  HIS A CG   1  
ATOM 951   N ND1  . HIS A 1 65  ? -6.135  -1.689  -0.254  1.00 0.00 ? 65  HIS A ND1  1  
ATOM 952   C CD2  . HIS A 1 65  ? -8.257  -1.537  0.311   1.00 0.00 ? 65  HIS A CD2  1  
ATOM 953   C CE1  . HIS A 1 65  ? -6.266  -2.152  0.981   1.00 0.00 ? 65  HIS A CE1  1  
ATOM 954   N NE2  . HIS A 1 65  ? -7.582  -2.058  1.329   1.00 0.00 ? 65  HIS A NE2  1  
ATOM 955   H H    . HIS A 1 65  ? -6.293  1.041   -0.412  1.00 0.00 ? 65  HIS A H    1  
ATOM 956   H HA   . HIS A 1 65  ? -7.209  1.063   -3.197  1.00 0.00 ? 65  HIS A HA   1  
ATOM 957   H HB2  . HIS A 1 65  ? -8.618  -0.950  -2.406  1.00 0.00 ? 65  HIS A HB2  1  
ATOM 958   H HB3  . HIS A 1 65  ? -6.924  -1.190  -2.783  1.00 0.00 ? 65  HIS A HB3  1  
ATOM 959   H HD1  . HIS A 1 65  ? -5.281  -1.635  -0.771  1.00 0.00 ? 65  HIS A HD1  1  
ATOM 960   H HD2  . HIS A 1 65  ? -9.328  -1.339  0.291   1.00 0.00 ? 65  HIS A HD2  1  
ATOM 961   H HE1  . HIS A 1 65  ? -5.464  -2.540  1.608   1.00 0.00 ? 65  HIS A HE1  1  
ATOM 962   N N    . ARG A 1 66  ? -9.316  2.199   -2.627  1.00 0.00 ? 66  ARG A N    1  
ATOM 963   C CA   . ARG A 1 66  ? -10.501 2.980   -2.314  1.00 0.00 ? 66  ARG A CA   1  
ATOM 964   C C    . ARG A 1 66  ? -11.426 3.053   -3.531  1.00 0.00 ? 66  ARG A C    1  
ATOM 965   O O    . ARG A 1 66  ? -10.994 2.815   -4.658  1.00 0.00 ? 66  ARG A O    1  
ATOM 966   C CB   . ARG A 1 66  ? -10.127 4.399   -1.880  1.00 0.00 ? 66  ARG A CB   1  
ATOM 967   C CG   . ARG A 1 66  ? -9.803  5.275   -3.092  1.00 0.00 ? 66  ARG A CG   1  
ATOM 968   C CD   . ARG A 1 66  ? -8.774  6.348   -2.732  1.00 0.00 ? 66  ARG A CD   1  
ATOM 969   N NE   . ARG A 1 66  ? -9.111  7.620   -3.410  1.00 0.00 ? 66  ARG A NE   1  
ATOM 970   C CZ   . ARG A 1 66  ? -8.334  8.712   -3.389  1.00 0.00 ? 66  ARG A CZ   1  
ATOM 971   N NH1  . ARG A 1 66  ? -7.171  8.693   -2.724  1.00 0.00 ? 66  ARG A NH1  1  
ATOM 972   N NH2  . ARG A 1 66  ? -8.720  9.821   -4.033  1.00 0.00 ? 66  ARG A NH2  1  
ATOM 973   H H    . ARG A 1 66  ? -9.075  2.168   -3.597  1.00 0.00 ? 66  ARG A H    1  
ATOM 974   H HA   . ARG A 1 66  ? -10.977 2.446   -1.491  1.00 0.00 ? 66  ARG A HA   1  
ATOM 975   H HB2  . ARG A 1 66  ? -10.951 4.839   -1.318  1.00 0.00 ? 66  ARG A HB2  1  
ATOM 976   H HB3  . ARG A 1 66  ? -9.267  4.364   -1.212  1.00 0.00 ? 66  ARG A HB3  1  
ATOM 977   H HG2  . ARG A 1 66  ? -9.419  4.655   -3.902  1.00 0.00 ? 66  ARG A HG2  1  
ATOM 978   H HG3  . ARG A 1 66  ? -10.715 5.748   -3.457  1.00 0.00 ? 66  ARG A HG3  1  
ATOM 979   H HD2  . ARG A 1 66  ? -8.753  6.497   -1.653  1.00 0.00 ? 66  ARG A HD2  1  
ATOM 980   H HD3  . ARG A 1 66  ? -7.777  6.022   -3.028  1.00 0.00 ? 66  ARG A HD3  1  
ATOM 981   H HE   . ARG A 1 66  ? -9.973  7.668   -3.916  1.00 0.00 ? 66  ARG A HE   1  
ATOM 982   H HH11 . ARG A 1 66  ? -6.883  7.865   -2.243  1.00 0.00 ? 66  ARG A HH11 1  
ATOM 983   H HH12 . ARG A 1 66  ? -6.591  9.508   -2.708  1.00 0.00 ? 66  ARG A HH12 1  
ATOM 984   H HH21 . ARG A 1 66  ? -9.588  9.835   -4.530  1.00 0.00 ? 66  ARG A HH21 1  
ATOM 985   H HH22 . ARG A 1 66  ? -8.141  10.636  -4.018  1.00 0.00 ? 66  ARG A HH22 1  
ATOM 986   N N    . LEU A 1 67  ? -12.680 3.383   -3.262  1.00 0.00 ? 67  LEU A N    1  
ATOM 987   C CA   . LEU A 1 67  ? -13.669 3.490   -4.321  1.00 0.00 ? 67  LEU A CA   1  
ATOM 988   C C    . LEU A 1 67  ? -13.572 4.874   -4.966  1.00 0.00 ? 67  LEU A C    1  
ATOM 989   O O    . LEU A 1 67  ? -13.739 5.890   -4.293  1.00 0.00 ? 67  LEU A O    1  
ATOM 990   C CB   . LEU A 1 67  ? -15.064 3.157   -3.787  1.00 0.00 ? 67  LEU A CB   1  
ATOM 991   C CG   . LEU A 1 67  ? -15.586 1.753   -4.101  1.00 0.00 ? 67  LEU A CG   1  
ATOM 992   C CD1  . LEU A 1 67  ? -17.076 1.636   -3.776  1.00 0.00 ? 67  LEU A CD1  1  
ATOM 993   C CD2  . LEU A 1 67  ? -15.284 1.368   -5.551  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 994   H H    . LEU A 1 67  ? -13.023 3.574   -2.342  1.00 0.00 ? 67  LEU A H    1  
ATOM 995   H HA   . LEU A 1 67  ? -13.425 2.740   -5.073  1.00 0.00 ? 67  LEU A HA   1  
ATOM 996   H HB2  . LEU A 1 67  ? -15.058 3.287   -2.705  1.00 0.00 ? 67  LEU A HB2  1  
ATOM 997   H HB3  . LEU A 1 67  ? -15.769 3.884   -4.191  1.00 0.00 ? 67  LEU A HB3  1  
ATOM 998   H HG   . LEU A 1 67  ? -15.060 1.043   -3.463  1.00 0.00 ? 67  LEU A HG   1  
ATOM 999   H HD11 . LEU A 1 67  ? -17.366 2.447   -3.107  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 1000  H HD12 . LEU A 1 67  ? -17.655 1.700   -4.697  1.00 0.00 ? 67  LEU A HD12 1  
ATOM 1001  H HD13 . LEU A 1 67  ? -17.268 0.679   -3.291  1.00 0.00 ? 67  LEU A HD13 1  
ATOM 1002  H HD21 . LEU A 1 67  ? -14.245 1.049   -5.633  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 1003  H HD22 . LEU A 1 67  ? -15.940 0.553   -5.854  1.00 0.00 ? 67  LEU A HD22 1  
ATOM 1004  H HD23 . LEU A 1 67  ? -15.451 2.229   -6.198  1.00 0.00 ? 67  LEU A HD23 1  
ATOM 1005  N N    . ASN A 1 68  ? -13.301 4.869   -6.263  1.00 0.00 ? 68  ASN A N    1  
ATOM 1006  C CA   . ASN A 1 68  ? -13.179 6.112   -7.006  1.00 0.00 ? 68  ASN A CA   1  
ATOM 1007  C C    . ASN A 1 68  ? -14.452 6.940   -6.819  1.00 0.00 ? 68  ASN A C    1  
ATOM 1008  O O    . ASN A 1 68  ? -14.400 8.169   -6.805  1.00 0.00 ? 68  ASN A O    1  
ATOM 1009  C CB   . ASN A 1 68  ? -13.005 5.844   -8.502  1.00 0.00 ? 68  ASN A CB   1  
ATOM 1010  C CG   . ASN A 1 68  ? -12.143 6.925   -9.157  1.00 0.00 ? 68  ASN A CG   1  
ATOM 1011  O OD1  . ASN A 1 68  ? -11.513 7.737   -8.498  1.00 0.00 ? 68  ASN A OD1  1  
ATOM 1012  N ND2  . ASN A 1 68  ? -12.150 6.892   -10.486 1.00 0.00 ? 68  ASN A ND2  1  
ATOM 1013  H H    . ASN A 1 68  ? -13.166 4.039   -6.803  1.00 0.00 ? 68  ASN A H    1  
ATOM 1014  H HA   . ASN A 1 68  ? -12.297 6.605   -6.598  1.00 0.00 ? 68  ASN A HA   1  
ATOM 1015  H HB2  . ASN A 1 68  ? -12.544 4.868   -8.649  1.00 0.00 ? 68  ASN A HB2  1  
ATOM 1016  H HB3  . ASN A 1 68  ? -13.982 5.811   -8.985  1.00 0.00 ? 68  ASN A HB3  1  
ATOM 1017  H HD21 . ASN A 1 68  ? -12.689 6.200   -10.966 1.00 0.00 ? 68  ASN A HD21 1  
ATOM 1018  H HD22 . ASN A 1 68  ? -11.617 7.559   -11.006 1.00 0.00 ? 68  ASN A HD22 1  
ATOM 1019  N N    . THR A 1 69  ? -15.564 6.234   -6.679  1.00 0.00 ? 69  THR A N    1  
ATOM 1020  C CA   . THR A 1 69  ? -16.848 6.889   -6.494  1.00 0.00 ? 69  THR A CA   1  
ATOM 1021  C C    . THR A 1 69  ? -17.633 6.212   -5.368  1.00 0.00 ? 69  THR A C    1  
ATOM 1022  O O    . THR A 1 69  ? -18.216 5.147   -5.567  1.00 0.00 ? 69  THR A O    1  
ATOM 1023  C CB   . THR A 1 69  ? -17.581 6.882   -7.836  1.00 0.00 ? 69  THR A CB   1  
ATOM 1024  O OG1  . THR A 1 69  ? -17.836 5.502   -8.085  1.00 0.00 ? 69  THR A OG1  1  
ATOM 1025  C CG2  . THR A 1 69  ? -16.681 7.310   -8.997  1.00 0.00 ? 69  THR A CG2  1  
ATOM 1026  H H    . THR A 1 69  ? -15.597 5.235   -6.692  1.00 0.00 ? 69  THR A H    1  
ATOM 1027  H HA   . THR A 1 69  ? -16.667 7.918   -6.183  1.00 0.00 ? 69  THR A HA   1  
ATOM 1028  H HB   . THR A 1 69  ? -18.479 7.497   -7.793  1.00 0.00 ? 69  THR A HB   1  
ATOM 1029  H HG1  . THR A 1 69  ? -18.477 5.145   -7.407  1.00 0.00 ? 69  THR A HG1  1  
ATOM 1030  H HG21 . THR A 1 69  ? -15.692 6.868   -8.873  1.00 0.00 ? 69  THR A HG21 1  
ATOM 1031  H HG22 . THR A 1 69  ? -17.115 6.970   -9.938  1.00 0.00 ? 69  THR A HG22 1  
ATOM 1032  H HG23 . THR A 1 69  ? -16.595 8.396   -9.009  1.00 0.00 ? 69  THR A HG23 1  
ATOM 1033  N N    . THR A 1 70  ? -17.625 6.859   -4.212  1.00 0.00 ? 70  THR A N    1  
ATOM 1034  C CA   . THR A 1 70  ? -18.329 6.333   -3.055  1.00 0.00 ? 70  THR A CA   1  
ATOM 1035  C C    . THR A 1 70  ? -18.233 7.311   -1.883  1.00 0.00 ? 70  THR A C    1  
ATOM 1036  O O    . THR A 1 70  ? -17.894 8.479   -2.069  1.00 0.00 ? 70  THR A O    1  
ATOM 1037  C CB   . THR A 1 70  ? -17.756 4.950   -2.741  1.00 0.00 ? 70  THR A CB   1  
ATOM 1038  O OG1  . THR A 1 70  ? -18.697 4.382   -1.835  1.00 0.00 ? 70  THR A OG1  1  
ATOM 1039  C CG2  . THR A 1 70  ? -16.459 5.023   -1.934  1.00 0.00 ? 70  THR A CG2  1  
ATOM 1040  H H    . THR A 1 70  ? -17.149 7.725   -4.059  1.00 0.00 ? 70  THR A H    1  
ATOM 1041  H HA   . THR A 1 70  ? -19.385 6.241   -3.309  1.00 0.00 ? 70  THR A HA   1  
ATOM 1042  H HB   . THR A 1 70  ? -17.615 4.371   -3.654  1.00 0.00 ? 70  THR A HB   1  
ATOM 1043  H HG1  . THR A 1 70  ? -19.360 3.825   -2.334  1.00 0.00 ? 70  THR A HG1  1  
ATOM 1044  H HG21 . THR A 1 70  ? -15.620 5.192   -2.609  1.00 0.00 ? 70  THR A HG21 1  
ATOM 1045  H HG22 . THR A 1 70  ? -16.521 5.844   -1.219  1.00 0.00 ? 70  THR A HG22 1  
ATOM 1046  H HG23 . THR A 1 70  ? -16.311 4.086   -1.398  1.00 0.00 ? 70  THR A HG23 1  
ATOM 1047  N N    . THR A 1 71  ? -18.539 6.799   -0.700  1.00 0.00 ? 71  THR A N    1  
ATOM 1048  C CA   . THR A 1 71  ? -18.491 7.612   0.503   1.00 0.00 ? 71  THR A CA   1  
ATOM 1049  C C    . THR A 1 71  ? -17.692 6.901   1.597   1.00 0.00 ? 71  THR A C    1  
ATOM 1050  O O    . THR A 1 71  ? -17.569 5.677   1.584   1.00 0.00 ? 71  THR A O    1  
ATOM 1051  C CB   . THR A 1 71  ? -19.930 7.934   0.913   1.00 0.00 ? 71  THR A CB   1  
ATOM 1052  O OG1  . THR A 1 71  ? -20.093 9.306   0.562   1.00 0.00 ? 71  THR A OG1  1  
ATOM 1053  C CG2  . THR A 1 71  ? -20.125 7.913   2.431   1.00 0.00 ? 71  THR A CG2  1  
ATOM 1054  H H    . THR A 1 71  ? -18.814 5.848   -0.556  1.00 0.00 ? 71  THR A H    1  
ATOM 1055  H HA   . THR A 1 71  ? -17.963 8.537   0.272   1.00 0.00 ? 71  THR A HA   1  
ATOM 1056  H HB   . THR A 1 71  ? -20.634 7.264   0.421   1.00 0.00 ? 71  THR A HB   1  
ATOM 1057  H HG1  . THR A 1 71  ? -20.984 9.635   0.872   1.00 0.00 ? 71  THR A HG1  1  
ATOM 1058  H HG21 . THR A 1 71  ? -21.166 8.131   2.666   1.00 0.00 ? 71  THR A HG21 1  
ATOM 1059  H HG22 . THR A 1 71  ? -19.864 6.927   2.817   1.00 0.00 ? 71  THR A HG22 1  
ATOM 1060  H HG23 . THR A 1 71  ? -19.483 8.664   2.890   1.00 0.00 ? 71  THR A HG23 1  
ATOM 1061  N N    . ALA A 1 72  ? -17.170 7.698   2.518   1.00 0.00 ? 72  ALA A N    1  
ATOM 1062  C CA   . ALA A 1 72  ? -16.387 7.160   3.616   1.00 0.00 ? 72  ALA A CA   1  
ATOM 1063  C C    . ALA A 1 72  ? -15.561 8.284   4.246   1.00 0.00 ? 72  ALA A C    1  
ATOM 1064  O O    . ALA A 1 72  ? -15.781 9.459   3.956   1.00 0.00 ? 72  ALA A O    1  
ATOM 1065  C CB   . ALA A 1 72  ? -15.515 6.011   3.107   1.00 0.00 ? 72  ALA A CB   1  
ATOM 1066  H H    . ALA A 1 72  ? -17.276 8.693   2.521   1.00 0.00 ? 72  ALA A H    1  
ATOM 1067  H HA   . ALA A 1 72  ? -17.082 6.771   4.360   1.00 0.00 ? 72  ALA A HA   1  
ATOM 1068  H HB1  . ALA A 1 72  ? -15.388 6.101   2.028   1.00 0.00 ? 72  ALA A HB1  1  
ATOM 1069  H HB2  . ALA A 1 72  ? -14.540 6.052   3.592   1.00 0.00 ? 72  ALA A HB2  1  
ATOM 1070  H HB3  . ALA A 1 72  ? -15.996 5.060   3.338   1.00 0.00 ? 72  ALA A HB3  1  
ATOM 1071  N N    . ASN A 1 73  ? -14.627 7.883   5.097   1.00 0.00 ? 73  ASN A N    1  
ATOM 1072  C CA   . ASN A 1 73  ? -13.767 8.842   5.770   1.00 0.00 ? 73  ASN A CA   1  
ATOM 1073  C C    . ASN A 1 73  ? -12.412 8.890   5.061   1.00 0.00 ? 73  ASN A C    1  
ATOM 1074  O O    . ASN A 1 73  ? -11.938 9.964   4.692   1.00 0.00 ? 73  ASN A O    1  
ATOM 1075  C CB   . ASN A 1 73  ? -13.525 8.437   7.225   1.00 0.00 ? 73  ASN A CB   1  
ATOM 1076  C CG   . ASN A 1 73  ? -12.965 9.609   8.034   1.00 0.00 ? 73  ASN A CG   1  
ATOM 1077  O OD1  . ASN A 1 73  ? -13.442 10.730  7.964   1.00 0.00 ? 73  ASN A OD1  1  
ATOM 1078  N ND2  . ASN A 1 73  ? -11.928 9.289   8.802   1.00 0.00 ? 73  ASN A ND2  1  
ATOM 1079  H H    . ASN A 1 73  ? -14.454 6.926   5.327   1.00 0.00 ? 73  ASN A H    1  
ATOM 1080  H HA   . ASN A 1 73  ? -14.300 9.791   5.716   1.00 0.00 ? 73  ASN A HA   1  
ATOM 1081  H HB2  . ASN A 1 73  ? -14.459 8.096   7.672   1.00 0.00 ? 73  ASN A HB2  1  
ATOM 1082  H HB3  . ASN A 1 73  ? -12.829 7.599   7.263   1.00 0.00 ? 73  ASN A HB3  1  
ATOM 1083  H HD21 . ASN A 1 73  ? -11.584 8.350   8.813   1.00 0.00 ? 73  ASN A HD21 1  
ATOM 1084  H HD22 . ASN A 1 73  ? -11.491 9.987   9.370   1.00 0.00 ? 73  ASN A HD22 1  
ATOM 1085  N N    . THR A 1 74  ? -11.826 7.714   4.891   1.00 0.00 ? 74  THR A N    1  
ATOM 1086  C CA   . THR A 1 74  ? -10.535 7.608   4.233   1.00 0.00 ? 74  THR A CA   1  
ATOM 1087  C C    . THR A 1 74  ? -10.421 6.274   3.493   1.00 0.00 ? 74  THR A C    1  
ATOM 1088  O O    . THR A 1 74  ? -11.415 5.573   3.313   1.00 0.00 ? 74  THR A O    1  
ATOM 1089  C CB   . THR A 1 74  ? -9.448  7.812   5.290   1.00 0.00 ? 74  THR A CB   1  
ATOM 1090  O OG1  . THR A 1 74  ? -9.868  6.999   6.382   1.00 0.00 ? 74  THR A OG1  1  
ATOM 1091  C CG2  . THR A 1 74  ? -9.446  9.231   5.862   1.00 0.00 ? 74  THR A CG2  1  
ATOM 1092  H H    . THR A 1 74  ? -12.218 6.845   5.194   1.00 0.00 ? 74  THR A H    1  
ATOM 1093  H HA   . THR A 1 74  ? -10.466 8.397   3.484   1.00 0.00 ? 74  THR A HA   1  
ATOM 1094  H HB   . THR A 1 74  ? -8.467  7.550   4.895   1.00 0.00 ? 74  THR A HB   1  
ATOM 1095  H HG1  . THR A 1 74  ? -9.485  6.080   6.291   1.00 0.00 ? 74  THR A HG1  1  
ATOM 1096  H HG21 . THR A 1 74  ? -8.621  9.337   6.567   1.00 0.00 ? 74  THR A HG21 1  
ATOM 1097  H HG22 . THR A 1 74  ? -9.325  9.949   5.051   1.00 0.00 ? 74  THR A HG22 1  
ATOM 1098  H HG23 . THR A 1 74  ? -10.389 9.418   6.375   1.00 0.00 ? 74  THR A HG23 1  
ATOM 1099  N N    . ALA A 1 75  ? -9.199  5.963   3.085   1.00 0.00 ? 75  ALA A N    1  
ATOM 1100  C CA   . ALA A 1 75  ? -8.942  4.725   2.369   1.00 0.00 ? 75  ALA A CA   1  
ATOM 1101  C C    . ALA A 1 75  ? -7.996  3.851   3.194   1.00 0.00 ? 75  ALA A C    1  
ATOM 1102  O O    . ALA A 1 75  ? -6.944  4.312   3.634   1.00 0.00 ? 75  ALA A O    1  
ATOM 1103  C CB   . ALA A 1 75  ? -8.380  5.045   0.982   1.00 0.00 ? 75  ALA A CB   1  
ATOM 1104  H H    . ALA A 1 75  ? -8.396  6.539   3.236   1.00 0.00 ? 75  ALA A H    1  
ATOM 1105  H HA   . ALA A 1 75  ? -9.893  4.207   2.251   1.00 0.00 ? 75  ALA A HA   1  
ATOM 1106  H HB1  . ALA A 1 75  ? -8.080  4.120   0.490   1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1107  H HB2  . ALA A 1 75  ? -9.145  5.543   0.386   1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1108  H HB3  . ALA A 1 75  ? -7.515  5.700   1.083   1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1109  N N    . THR A 1 76  ? -8.405  2.604   3.379   1.00 0.00 ? 76  THR A N    1  
ATOM 1110  C CA   . THR A 1 76  ? -7.607  1.661   4.143   1.00 0.00 ? 76  THR A CA   1  
ATOM 1111  C C    . THR A 1 76  ? -6.407  1.188   3.321   1.00 0.00 ? 76  THR A C    1  
ATOM 1112  O O    . THR A 1 76  ? -6.522  0.254   2.529   1.00 0.00 ? 76  THR A O    1  
ATOM 1113  C CB   . THR A 1 76  ? -8.523  0.521   4.592   1.00 0.00 ? 76  THR A CB   1  
ATOM 1114  O OG1  . THR A 1 76  ? -9.312  1.097   5.629   1.00 0.00 ? 76  THR A OG1  1  
ATOM 1115  C CG2  . THR A 1 76  ? -7.758  -0.606  5.289   1.00 0.00 ? 76  THR A CG2  1  
ATOM 1116  H H    . THR A 1 76  ? -9.262  2.237   3.017   1.00 0.00 ? 76  THR A H    1  
ATOM 1117  H HA   . THR A 1 76  ? -7.211  2.176   5.019   1.00 0.00 ? 76  THR A HA   1  
ATOM 1118  H HB   . THR A 1 76  ? -9.105  0.136   3.754   1.00 0.00 ? 76  THR A HB   1  
ATOM 1119  H HG1  . THR A 1 76  ? -10.188 0.619   5.698   1.00 0.00 ? 76  THR A HG1  1  
ATOM 1120  H HG21 . THR A 1 76  ? -6.690  -0.390  5.263   1.00 0.00 ? 76  THR A HG21 1  
ATOM 1121  H HG22 . THR A 1 76  ? -8.089  -0.684  6.324   1.00 0.00 ? 76  THR A HG22 1  
ATOM 1122  H HG23 . THR A 1 76  ? -7.950  -1.548  4.775   1.00 0.00 ? 76  THR A HG23 1  
ATOM 1123  N N    . VAL A 1 77  ? -5.282  1.854   3.537   1.00 0.00 ? 77  VAL A N    1  
ATOM 1124  C CA   . VAL A 1 77  ? -4.062  1.514   2.825   1.00 0.00 ? 77  VAL A CA   1  
ATOM 1125  C C    . VAL A 1 77  ? -3.353  0.371   3.554   1.00 0.00 ? 77  VAL A C    1  
ATOM 1126  O O    . VAL A 1 77  ? -3.407  0.284   4.780   1.00 0.00 ? 77  VAL A O    1  
ATOM 1127  C CB   . VAL A 1 77  ? -3.184  2.757   2.667   1.00 0.00 ? 77  VAL A CB   1  
ATOM 1128  C CG1  . VAL A 1 77  ? -4.033  4.030   2.660   1.00 0.00 ? 77  VAL A CG1  1  
ATOM 1129  C CG2  . VAL A 1 77  ? -2.116  2.816   3.760   1.00 0.00 ? 77  VAL A CG2  1  
ATOM 1130  H H    . VAL A 1 77  ? -5.197  2.613   4.183   1.00 0.00 ? 77  VAL A H    1  
ATOM 1131  H HA   . VAL A 1 77  ? -4.346  1.172   1.830   1.00 0.00 ? 77  VAL A HA   1  
ATOM 1132  H HB   . VAL A 1 77  ? -2.676  2.688   1.705   1.00 0.00 ? 77  VAL A HB   1  
ATOM 1133  H HG11 . VAL A 1 77  ? -5.004  3.816   2.214   1.00 0.00 ? 77  VAL A HG11 1  
ATOM 1134  H HG12 . VAL A 1 77  ? -4.171  4.380   3.683   1.00 0.00 ? 77  VAL A HG12 1  
ATOM 1135  H HG13 . VAL A 1 77  ? -3.527  4.800   2.077   1.00 0.00 ? 77  VAL A HG13 1  
ATOM 1136  H HG21 . VAL A 1 77  ? -1.214  2.310   3.415   1.00 0.00 ? 77  VAL A HG21 1  
ATOM 1137  H HG22 . VAL A 1 77  ? -1.884  3.857   3.986   1.00 0.00 ? 77  VAL A HG22 1  
ATOM 1138  H HG23 . VAL A 1 77  ? -2.487  2.324   4.659   1.00 0.00 ? 77  VAL A HG23 1  
ATOM 1139  N N    . GLU A 1 78  ? -2.706  -0.478  2.770   1.00 0.00 ? 78  GLU A N    1  
ATOM 1140  C CA   . GLU A 1 78  ? -1.988  -1.613  3.326   1.00 0.00 ? 78  GLU A CA   1  
ATOM 1141  C C    . GLU A 1 78  ? -0.501  -1.521  2.978   1.00 0.00 ? 78  GLU A C    1  
ATOM 1142  O O    . GLU A 1 78  ? -0.143  -1.199  1.846   1.00 0.00 ? 78  GLU A O    1  
ATOM 1143  C CB   . GLU A 1 78  ? -2.585  -2.933  2.836   1.00 0.00 ? 78  GLU A CB   1  
ATOM 1144  C CG   . GLU A 1 78  ? -1.697  -4.116  3.228   1.00 0.00 ? 78  GLU A CG   1  
ATOM 1145  C CD   . GLU A 1 78  ? -2.479  -5.137  4.056   1.00 0.00 ? 78  GLU A CD   1  
ATOM 1146  O OE1  . GLU A 1 78  ? -3.278  -5.875  3.441   1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1147  O OE2  . GLU A 1 78  ? -2.259  -5.158  5.287   1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1148  H H    . GLU A 1 78  ? -2.668  -0.401  1.773   1.00 0.00 ? 78  GLU A H    1  
ATOM 1149  H HA   . GLU A 1 78  ? -2.121  -1.539  4.405   1.00 0.00 ? 78  GLU A HA   1  
ATOM 1150  H HB2  . GLU A 1 78  ? -3.581  -3.066  3.259   1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1151  H HB3  . GLU A 1 78  ? -2.701  -2.905  1.752   1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1152  H HG2  . GLU A 1 78  ? -1.304  -4.594  2.330   1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1153  H HG3  . GLU A 1 78  ? -0.840  -3.758  3.799   1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1154  N N    . VAL A 1 79  ? 0.325   -1.810  3.973   1.00 0.00 ? 79  VAL A N    1  
ATOM 1155  C CA   . VAL A 1 79  ? 1.766   -1.765  3.787   1.00 0.00 ? 79  VAL A CA   1  
ATOM 1156  C C    . VAL A 1 79  ? 2.279   -3.170  3.467   1.00 0.00 ? 79  VAL A C    1  
ATOM 1157  O O    . VAL A 1 79  ? 1.975   -4.123  4.182   1.00 0.00 ? 79  VAL A O    1  
ATOM 1158  C CB   . VAL A 1 79  ? 2.433   -1.150  5.019   1.00 0.00 ? 79  VAL A CB   1  
ATOM 1159  C CG1  . VAL A 1 79  ? 3.822   -1.751  5.246   1.00 0.00 ? 79  VAL A CG1  1  
ATOM 1160  C CG2  . VAL A 1 79  ? 2.507   0.373   4.900   1.00 0.00 ? 79  VAL A CG2  1  
ATOM 1161  H H    . VAL A 1 79  ? 0.026   -2.072  4.891   1.00 0.00 ? 79  VAL A H    1  
ATOM 1162  H HA   . VAL A 1 79  ? 1.967   -1.115  2.935   1.00 0.00 ? 79  VAL A HA   1  
ATOM 1163  H HB   . VAL A 1 79  ? 1.819   -1.389  5.887   1.00 0.00 ? 79  VAL A HB   1  
ATOM 1164  H HG11 . VAL A 1 79  ? 4.411   -1.078  5.871   1.00 0.00 ? 79  VAL A HG11 1  
ATOM 1165  H HG12 . VAL A 1 79  ? 3.724   -2.715  5.744   1.00 0.00 ? 79  VAL A HG12 1  
ATOM 1166  H HG13 . VAL A 1 79  ? 4.321   -1.886  4.287   1.00 0.00 ? 79  VAL A HG13 1  
ATOM 1167  H HG21 . VAL A 1 79  ? 1.520   0.767   4.658   1.00 0.00 ? 79  VAL A HG21 1  
ATOM 1168  H HG22 . VAL A 1 79  ? 2.845   0.796   5.846   1.00 0.00 ? 79  VAL A HG22 1  
ATOM 1169  H HG23 . VAL A 1 79  ? 3.210   0.643   4.111   1.00 0.00 ? 79  VAL A HG23 1  
ATOM 1170  N N    . LEU A 1 80  ? 3.049   -3.254  2.392   1.00 0.00 ? 80  LEU A N    1  
ATOM 1171  C CA   . LEU A 1 80  ? 3.607   -4.527  1.968   1.00 0.00 ? 80  LEU A CA   1  
ATOM 1172  C C    . LEU A 1 80  ? 5.108   -4.545  2.266   1.00 0.00 ? 80  LEU A C    1  
ATOM 1173  O O    . LEU A 1 80  ? 5.678   -3.529  2.662   1.00 0.00 ? 80  LEU A O    1  
ATOM 1174  C CB   . LEU A 1 80  ? 3.268   -4.799  0.502   1.00 0.00 ? 80  LEU A CB   1  
ATOM 1175  C CG   . LEU A 1 80  ? 1.802   -5.116  0.200   1.00 0.00 ? 80  LEU A CG   1  
ATOM 1176  C CD1  . LEU A 1 80  ? 1.318   -4.350  -1.033  1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1177  C CD2  . LEU A 1 80  ? 1.584   -6.624  0.059   1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1178  H H    . LEU A 1 80  ? 3.291   -2.473  1.815   1.00 0.00 ? 80  LEU A H    1  
ATOM 1179  H HA   . LEU A 1 80  ? 3.128   -5.307  2.560   1.00 0.00 ? 80  LEU A HA   1  
ATOM 1180  H HB2  . LEU A 1 80  ? 3.559   -3.929  -0.086  1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1181  H HB3  . LEU A 1 80  ? 3.878   -5.635  0.158   1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1182  H HG   . LEU A 1 80  ? 1.199   -4.781  1.044   1.00 0.00 ? 80  LEU A HG   1  
ATOM 1183  H HD11 . LEU A 1 80  ? 0.309   -4.674  -1.289  1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1184  H HD12 . LEU A 1 80  ? 1.313   -3.281  -0.818  1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1185  H HD13 . LEU A 1 80  ? 1.987   -4.549  -1.870  1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1186  H HD21 . LEU A 1 80  ? 0.817   -6.947  0.762   1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1187  H HD22 . LEU A 1 80  ? 1.265   -6.852  -0.958  1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1188  H HD23 . LEU A 1 80  ? 2.517   -7.147  0.274   1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1189  N N    . ALA A 1 81  ? 5.705   -5.710  2.065   1.00 0.00 ? 81  ALA A N    1  
ATOM 1190  C CA   . ALA A 1 81  ? 7.128   -5.874  2.307   1.00 0.00 ? 81  ALA A CA   1  
ATOM 1191  C C    . ALA A 1 81  ? 7.912   -5.265  1.143   1.00 0.00 ? 81  ALA A C    1  
ATOM 1192  O O    . ALA A 1 81  ? 7.336   -4.930  0.109   1.00 0.00 ? 81  ALA A O    1  
ATOM 1193  C CB   . ALA A 1 81  ? 7.444   -7.357  2.510   1.00 0.00 ? 81  ALA A CB   1  
ATOM 1194  H H    . ALA A 1 81  ? 5.234   -6.531  1.743   1.00 0.00 ? 81  ALA A H    1  
ATOM 1195  H HA   . ALA A 1 81  ? 7.373   -5.334  3.222   1.00 0.00 ? 81  ALA A HA   1  
ATOM 1196  H HB1  . ALA A 1 81  ? 6.523   -7.936  2.449   1.00 0.00 ? 81  ALA A HB1  1  
ATOM 1197  H HB2  . ALA A 1 81  ? 8.136   -7.690  1.736   1.00 0.00 ? 81  ALA A HB2  1  
ATOM 1198  H HB3  . ALA A 1 81  ? 7.900   -7.500  3.490   1.00 0.00 ? 81  ALA A HB3  1  
ATOM 1199  N N    . PRO A 1 82  ? 9.249   -5.135  1.356   1.00 0.00 ? 82  PRO A N    1  
ATOM 1200  C CA   . PRO A 1 82  ? 10.118  -4.572  0.337   1.00 0.00 ? 82  PRO A CA   1  
ATOM 1201  C C    . PRO A 1 82  ? 10.360  -5.575  -0.793  1.00 0.00 ? 82  PRO A C    1  
ATOM 1202  O O    . PRO A 1 82  ? 11.010  -5.253  -1.786  1.00 0.00 ? 82  PRO A O    1  
ATOM 1203  C CB   . PRO A 1 82  ? 11.391  -4.189  1.073   1.00 0.00 ? 82  PRO A CB   1  
ATOM 1204  C CG   . PRO A 1 82  ? 11.371  -4.971  2.377   1.00 0.00 ? 82  PRO A CG   1  
ATOM 1205  C CD   . PRO A 1 82  ? 9.966   -5.520  2.568   1.00 0.00 ? 82  PRO A CD   1  
ATOM 1206  H HA   . PRO A 1 82  ? 9.684   -3.779  -0.090  1.00 0.00 ? 82  PRO A HA   1  
ATOM 1207  H HB2  . PRO A 1 82  ? 12.274  -4.437  0.483   1.00 0.00 ? 82  PRO A HB2  1  
ATOM 1208  H HB3  . PRO A 1 82  ? 11.426  -3.116  1.262   1.00 0.00 ? 82  PRO A HB3  1  
ATOM 1209  H HG2  . PRO A 1 82  ? 12.097  -5.782  2.347   1.00 0.00 ? 82  PRO A HG2  1  
ATOM 1210  H HG3  . PRO A 1 82  ? 11.646  -4.327  3.212   1.00 0.00 ? 82  PRO A HG3  1  
ATOM 1211  H HD2  . PRO A 1 82  ? 9.978   -6.603  2.694   1.00 0.00 ? 82  PRO A HD2  1  
ATOM 1212  H HD3  . PRO A 1 82  ? 9.495   -5.101  3.457   1.00 0.00 ? 82  PRO A HD3  1  
ATOM 1213  N N    . SER A 1 83  ? 9.825   -6.772  -0.603  1.00 0.00 ? 83  SER A N    1  
ATOM 1214  C CA   . SER A 1 83  ? 9.974   -7.825  -1.594  1.00 0.00 ? 83  SER A CA   1  
ATOM 1215  C C    . SER A 1 83  ? 8.600   -8.252  -2.114  1.00 0.00 ? 83  SER A C    1  
ATOM 1216  O O    . SER A 1 83  ? 8.391   -9.420  -2.438  1.00 0.00 ? 83  SER A O    1  
ATOM 1217  C CB   . SER A 1 83  ? 10.719  -9.028  -1.011  1.00 0.00 ? 83  SER A CB   1  
ATOM 1218  O OG   . SER A 1 83  ? 9.996   -9.638  0.055   1.00 0.00 ? 83  SER A OG   1  
ATOM 1219  H H    . SER A 1 83  ? 9.297   -7.027  0.208   1.00 0.00 ? 83  SER A H    1  
ATOM 1220  H HA   . SER A 1 83  ? 10.567  -7.385  -2.395  1.00 0.00 ? 83  SER A HA   1  
ATOM 1221  H HB2  . SER A 1 83  ? 10.893  -9.762  -1.798  1.00 0.00 ? 83  SER A HB2  1  
ATOM 1222  H HB3  . SER A 1 83  ? 11.696  -8.709  -0.650  1.00 0.00 ? 83  SER A HB3  1  
ATOM 1223  H HG   . SER A 1 83  ? 10.533  -10.383 0.450   1.00 0.00 ? 83  SER A HG   1  
ATOM 1224  N N    . ALA A 1 84  ? 7.700   -7.283  -2.179  1.00 0.00 ? 84  ALA A N    1  
ATOM 1225  C CA   . ALA A 1 84  ? 6.352   -7.544  -2.655  1.00 0.00 ? 84  ALA A CA   1  
ATOM 1226  C C    . ALA A 1 84  ? 6.140   -6.829  -3.991  1.00 0.00 ? 84  ALA A C    1  
ATOM 1227  O O    . ALA A 1 84  ? 6.269   -5.609  -4.073  1.00 0.00 ? 84  ALA A O    1  
ATOM 1228  C CB   . ALA A 1 84  ? 5.341   -7.107  -1.593  1.00 0.00 ? 84  ALA A CB   1  
ATOM 1229  H H    . ALA A 1 84  ? 7.878   -6.335  -1.914  1.00 0.00 ? 84  ALA A H    1  
ATOM 1230  H HA   . ALA A 1 84  ? 6.257   -8.619  -2.809  1.00 0.00 ? 84  ALA A HA   1  
ATOM 1231  H HB1  . ALA A 1 84  ? 5.147   -7.936  -0.913  1.00 0.00 ? 84  ALA A HB1  1  
ATOM 1232  H HB2  . ALA A 1 84  ? 5.745   -6.264  -1.033  1.00 0.00 ? 84  ALA A HB2  1  
ATOM 1233  H HB3  . ALA A 1 84  ? 4.411   -6.809  -2.077  1.00 0.00 ? 84  ALA A HB3  1  
ATOM 1234  N N    . ARG A 1 85  ? 5.818   -7.620  -5.004  1.00 0.00 ? 85  ARG A N    1  
ATOM 1235  C CA   . ARG A 1 85  ? 5.587   -7.078  -6.333  1.00 0.00 ? 85  ARG A CA   1  
ATOM 1236  C C    . ARG A 1 85  ? 4.094   -7.106  -6.665  1.00 0.00 ? 85  ARG A C    1  
ATOM 1237  O O    . ARG A 1 85  ? 3.630   -6.352  -7.519  1.00 0.00 ? 85  ARG A O    1  
ATOM 1238  C CB   . ARG A 1 85  ? 6.353   -7.871  -7.393  1.00 0.00 ? 85  ARG A CB   1  
ATOM 1239  C CG   . ARG A 1 85  ? 7.486   -7.035  -7.991  1.00 0.00 ? 85  ARG A CG   1  
ATOM 1240  C CD   . ARG A 1 85  ? 8.818   -7.343  -7.303  1.00 0.00 ? 85  ARG A CD   1  
ATOM 1241  N NE   . ARG A 1 85  ? 9.674   -8.152  -8.198  1.00 0.00 ? 85  ARG A NE   1  
ATOM 1242  C CZ   . ARG A 1 85  ? 10.767  -8.816  -7.795  1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1243  N NH1  . ARG A 1 85  ? 11.142  -8.770  -6.510  1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1244  N NH2  . ARG A 1 85  ? 11.484  -9.525  -8.678  1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1245  H H    . ARG A 1 85  ? 5.715   -8.612  -4.929  1.00 0.00 ? 85  ARG A H    1  
ATOM 1246  H HA   . ARG A 1 85  ? 5.959   -6.054  -6.284  1.00 0.00 ? 85  ARG A HA   1  
ATOM 1247  H HB2  . ARG A 1 85  ? 6.762   -8.778  -6.948  1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1248  H HB3  . ARG A 1 85  ? 5.671   -8.183  -8.183  1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1249  H HG2  . ARG A 1 85  ? 7.569   -7.238  -9.058  1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1250  H HG3  . ARG A 1 85  ? 7.255   -5.975  -7.885  1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1251  H HD2  . ARG A 1 85  ? 9.325   -6.415  -7.042  1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1252  H HD3  . ARG A 1 85  ? 8.640   -7.882  -6.372  1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1253  H HE   . ARG A 1 85  ? 9.423   -8.207  -9.164  1.00 0.00 ? 85  ARG A HE   1  
ATOM 1254  H HH11 . ARG A 1 85  ? 10.607  -8.241  -5.851  1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1255  H HH12 . ARG A 1 85  ? 11.957  -9.265  -6.209  1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1256  H HH21 . ARG A 1 85  ? 11.204  -9.559  -9.637  1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1257  H HH22 . ARG A 1 85  ? 12.299  -10.020 -8.377  1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1258  N N    . GLN A 1 86  ? 3.383   -7.984  -5.973  1.00 0.00 ? 86  GLN A N    1  
ATOM 1259  C CA   . GLN A 1 86  ? 1.951   -8.120  -6.184  1.00 0.00 ? 86  GLN A CA   1  
ATOM 1260  C C    . GLN A 1 86  ? 1.204   -7.985  -4.856  1.00 0.00 ? 86  GLN A C    1  
ATOM 1261  O O    . GLN A 1 86  ? 1.822   -7.935  -3.794  1.00 0.00 ? 86  GLN A O    1  
ATOM 1262  C CB   . GLN A 1 86  ? 1.622   -9.450  -6.865  1.00 0.00 ? 86  GLN A CB   1  
ATOM 1263  C CG   . GLN A 1 86  ? 2.596   -9.735  -8.010  1.00 0.00 ? 86  GLN A CG   1  
ATOM 1264  C CD   . GLN A 1 86  ? 3.235   -11.117 -7.855  1.00 0.00 ? 86  GLN A CD   1  
ATOM 1265  O OE1  . GLN A 1 86  ? 4.035   -11.363 -6.968  1.00 0.00 ? 86  GLN A OE1  1  
ATOM 1266  N NE2  . GLN A 1 86  ? 2.838   -12.002 -8.765  1.00 0.00 ? 86  GLN A NE2  1  
ATOM 1267  H H    . GLN A 1 86  ? 3.768   -8.594  -5.280  1.00 0.00 ? 86  GLN A H    1  
ATOM 1268  H HA   . GLN A 1 86  ? 1.677   -7.301  -6.848  1.00 0.00 ? 86  GLN A HA   1  
ATOM 1269  H HB2  . GLN A 1 86  ? 1.667   -10.258 -6.135  1.00 0.00 ? 86  GLN A HB2  1  
ATOM 1270  H HB3  . GLN A 1 86  ? 0.602   -9.423  -7.249  1.00 0.00 ? 86  GLN A HB3  1  
ATOM 1271  H HG2  . GLN A 1 86  ? 2.070   -9.679  -8.963  1.00 0.00 ? 86  GLN A HG2  1  
ATOM 1272  H HG3  . GLN A 1 86  ? 3.374   -8.972  -8.030  1.00 0.00 ? 86  GLN A HG3  1  
ATOM 1273  H HE21 . GLN A 1 86  ? 2.178   -11.735 -9.467  1.00 0.00 ? 86  GLN A HE21 1  
ATOM 1274  H HE22 . GLN A 1 86  ? 3.200   -12.934 -8.747  1.00 0.00 ? 86  GLN A HE22 1  
ATOM 1275  N N    . TYR A 1 87  ? -0.116  -7.930  -4.960  1.00 0.00 ? 87  TYR A N    1  
ATOM 1276  C CA   . TYR A 1 87  ? -0.954  -7.801  -3.780  1.00 0.00 ? 87  TYR A CA   1  
ATOM 1277  C C    . TYR A 1 87  ? -2.391  -8.236  -4.078  1.00 0.00 ? 87  TYR A C    1  
ATOM 1278  O O    . TYR A 1 87  ? -2.805  -8.271  -5.235  1.00 0.00 ? 87  TYR A O    1  
ATOM 1279  C CB   . TYR A 1 87  ? -0.949  -6.314  -3.419  1.00 0.00 ? 87  TYR A CB   1  
ATOM 1280  C CG   . TYR A 1 87  ? -2.014  -5.919  -2.393  1.00 0.00 ? 87  TYR A CG   1  
ATOM 1281  C CD1  . TYR A 1 87  ? -1.761  -6.069  -1.045  1.00 0.00 ? 87  TYR A CD1  1  
ATOM 1282  C CD2  . TYR A 1 87  ? -3.226  -5.413  -2.817  1.00 0.00 ? 87  TYR A CD2  1  
ATOM 1283  C CE1  . TYR A 1 87  ? -2.763  -5.697  -0.079  1.00 0.00 ? 87  TYR A CE1  1  
ATOM 1284  C CE2  . TYR A 1 87  ? -4.228  -5.042  -1.851  1.00 0.00 ? 87  TYR A CE2  1  
ATOM 1285  C CZ   . TYR A 1 87  ? -3.947  -5.202  -0.530  1.00 0.00 ? 87  TYR A CZ   1  
ATOM 1286  O OH   . TYR A 1 87  ? -4.893  -4.851  0.382   1.00 0.00 ? 87  TYR A OH   1  
ATOM 1287  H H    . TYR A 1 87  ? -0.611  -7.971  -5.827  1.00 0.00 ? 87  TYR A H    1  
ATOM 1288  H HA   . TYR A 1 87  ? -0.542  -8.444  -3.002  1.00 0.00 ? 87  TYR A HA   1  
ATOM 1289  H HB2  . TYR A 1 87  ? 0.033   -6.049  -3.028  1.00 0.00 ? 87  TYR A HB2  1  
ATOM 1290  H HB3  . TYR A 1 87  ? -1.100  -5.730  -4.327  1.00 0.00 ? 87  TYR A HB3  1  
ATOM 1291  H HD1  . TYR A 1 87  ? -0.804  -6.469  -0.710  1.00 0.00 ? 87  TYR A HD1  1  
ATOM 1292  H HD2  . TYR A 1 87  ? -3.425  -5.295  -3.882  1.00 0.00 ? 87  TYR A HD2  1  
ATOM 1293  H HE1  . TYR A 1 87  ? -2.577  -5.810  0.989   1.00 0.00 ? 87  TYR A HE1  1  
ATOM 1294  H HE2  . TYR A 1 87  ? -5.189  -4.641  -2.172  1.00 0.00 ? 87  TYR A HE2  1  
ATOM 1295  H HH   . TYR A 1 87  ? -4.509  -4.203  1.040   1.00 0.00 ? 87  TYR A HH   1  
ATOM 1296  N N    . THR A 1 88  ? -3.111  -8.558  -3.013  1.00 0.00 ? 88  THR A N    1  
ATOM 1297  C CA   . THR A 1 88  ? -4.492  -8.990  -3.146  1.00 0.00 ? 88  THR A CA   1  
ATOM 1298  C C    . THR A 1 88  ? -5.418  -8.066  -2.353  1.00 0.00 ? 88  THR A C    1  
ATOM 1299  O O    . THR A 1 88  ? -5.167  -7.785  -1.182  1.00 0.00 ? 88  THR A O    1  
ATOM 1300  C CB   . THR A 1 88  ? -4.574  -10.454 -2.708  1.00 0.00 ? 88  THR A CB   1  
ATOM 1301  O OG1  . THR A 1 88  ? -3.812  -11.153 -3.689  1.00 0.00 ? 88  THR A OG1  1  
ATOM 1302  C CG2  . THR A 1 88  ? -5.984  -11.030 -2.852  1.00 0.00 ? 88  THR A CG2  1  
ATOM 1303  H H    . THR A 1 88  ? -2.766  -8.528  -2.075  1.00 0.00 ? 88  THR A H    1  
ATOM 1304  H HA   . THR A 1 88  ? -4.778  -8.907  -4.194  1.00 0.00 ? 88  THR A HA   1  
ATOM 1305  H HB   . THR A 1 88  ? -4.204  -10.577 -1.690  1.00 0.00 ? 88  THR A HB   1  
ATOM 1306  H HG1  . THR A 1 88  ? -4.155  -10.941 -4.603  1.00 0.00 ? 88  THR A HG1  1  
ATOM 1307  H HG21 . THR A 1 88  ? -5.921  -12.098 -3.057  1.00 0.00 ? 88  THR A HG21 1  
ATOM 1308  H HG22 . THR A 1 88  ? -6.538  -10.869 -1.926  1.00 0.00 ? 88  THR A HG22 1  
ATOM 1309  H HG23 . THR A 1 88  ? -6.498  -10.531 -3.673  1.00 0.00 ? 88  THR A HG23 1  
ATOM 1310  N N    . ALA A 1 89  ? -6.470  -7.618  -3.023  1.00 0.00 ? 89  ALA A N    1  
ATOM 1311  C CA   . ALA A 1 89  ? -7.435  -6.732  -2.396  1.00 0.00 ? 89  ALA A CA   1  
ATOM 1312  C C    . ALA A 1 89  ? -8.765  -7.469  -2.229  1.00 0.00 ? 89  ALA A C    1  
ATOM 1313  O O    . ALA A 1 89  ? -9.409  -7.826  -3.214  1.00 0.00 ? 89  ALA A O    1  
ATOM 1314  C CB   . ALA A 1 89  ? -7.576  -5.457  -3.231  1.00 0.00 ? 89  ALA A CB   1  
ATOM 1315  H H    . ALA A 1 89  ? -6.667  -7.852  -3.976  1.00 0.00 ? 89  ALA A H    1  
ATOM 1316  H HA   . ALA A 1 89  ? -7.050  -6.465  -1.412  1.00 0.00 ? 89  ALA A HA   1  
ATOM 1317  H HB1  . ALA A 1 89  ? -6.588  -5.112  -3.537  1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1318  H HB2  . ALA A 1 89  ? -8.177  -5.667  -4.115  1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1319  H HB3  . ALA A 1 89  ? -8.062  -4.685  -2.636  1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1320  N N    . THR A 1 90  ? -9.137  -7.675  -0.974  1.00 0.00 ? 90  THR A N    1  
ATOM 1321  C CA   . THR A 1 90  ? -10.379 -8.363  -0.665  1.00 0.00 ? 90  THR A CA   1  
ATOM 1322  C C    . THR A 1 90  ? -11.341 -7.425  0.067   1.00 0.00 ? 90  THR A C    1  
ATOM 1323  O O    . THR A 1 90  ? -10.909 -6.502  0.756   1.00 0.00 ? 90  THR A O    1  
ATOM 1324  C CB   . THR A 1 90  ? -10.035 -9.624  0.131   1.00 0.00 ? 90  THR A CB   1  
ATOM 1325  O OG1  . THR A 1 90  ? -9.228  -9.147  1.204   1.00 0.00 ? 90  THR A OG1  1  
ATOM 1326  C CG2  . THR A 1 90  ? -9.112  -10.569 -0.639  1.00 0.00 ? 90  THR A CG2  1  
ATOM 1327  H H    . THR A 1 90  ? -8.608  -7.381  -0.178  1.00 0.00 ? 90  THR A H    1  
ATOM 1328  H HA   . THR A 1 90  ? -10.858 -8.644  -1.603  1.00 0.00 ? 90  THR A HA   1  
ATOM 1329  H HB   . THR A 1 90  ? -10.940 -10.139 0.453   1.00 0.00 ? 90  THR A HB   1  
ATOM 1330  H HG1  . THR A 1 90  ? -9.805  -8.748  1.916   1.00 0.00 ? 90  THR A HG1  1  
ATOM 1331  H HG21 . THR A 1 90  ? -9.554  -10.798 -1.609  1.00 0.00 ? 90  THR A HG21 1  
ATOM 1332  H HG22 . THR A 1 90  ? -8.143  -10.092 -0.785  1.00 0.00 ? 90  THR A HG22 1  
ATOM 1333  H HG23 . THR A 1 90  ? -8.981  -11.491 -0.073  1.00 0.00 ? 90  THR A HG23 1  
ATOM 1334  N N    . GLY A 1 91  ? -12.626 -7.694  -0.106  1.00 0.00 ? 91  GLY A N    1  
ATOM 1335  C CA   . GLY A 1 91  ? -13.653 -6.886  0.530   1.00 0.00 ? 91  GLY A CA   1  
ATOM 1336  C C    . GLY A 1 91  ? -13.899 -5.596  -0.255  1.00 0.00 ? 91  GLY A C    1  
ATOM 1337  O O    . GLY A 1 91  ? -13.811 -4.501  0.299   1.00 0.00 ? 91  GLY A O    1  
ATOM 1338  H H    . GLY A 1 91  ? -12.969 -8.447  -0.668  1.00 0.00 ? 91  GLY A H    1  
ATOM 1339  H HA2  . GLY A 1 91  ? -14.579 -7.456  0.599   1.00 0.00 ? 91  GLY A HA2  1  
ATOM 1340  H HA3  . GLY A 1 91  ? -13.351 -6.644  1.548   1.00 0.00 ? 91  GLY A HA3  1  
ATOM 1341  N N    . LEU A 1 92  ? -14.203 -5.768  -1.533  1.00 0.00 ? 92  LEU A N    1  
ATOM 1342  C CA   . LEU A 1 92  ? -14.463 -4.631  -2.400  1.00 0.00 ? 92  LEU A CA   1  
ATOM 1343  C C    . LEU A 1 92  ? -15.870 -4.754  -2.989  1.00 0.00 ? 92  LEU A C    1  
ATOM 1344  O O    . LEU A 1 92  ? -16.312 -5.853  -3.323  1.00 0.00 ? 92  LEU A O    1  
ATOM 1345  C CB   . LEU A 1 92  ? -13.364 -4.500  -3.456  1.00 0.00 ? 92  LEU A CB   1  
ATOM 1346  C CG   . LEU A 1 92  ? -11.932 -4.729  -2.966  1.00 0.00 ? 92  LEU A CG   1  
ATOM 1347  C CD1  . LEU A 1 92  ? -11.040 -5.239  -4.100  1.00 0.00 ? 92  LEU A CD1  1  
ATOM 1348  C CD2  . LEU A 1 92  ? -11.366 -3.465  -2.316  1.00 0.00 ? 92  LEU A CD2  1  
ATOM 1349  H H    . LEU A 1 92  ? -14.273 -6.661  -1.977  1.00 0.00 ? 92  LEU A H    1  
ATOM 1350  H HA   . LEU A 1 92  ? -14.425 -3.733  -1.782  1.00 0.00 ? 92  LEU A HA   1  
ATOM 1351  H HB2  . LEU A 1 92  ? -13.571 -5.209  -4.257  1.00 0.00 ? 92  LEU A HB2  1  
ATOM 1352  H HB3  . LEU A 1 92  ? -13.422 -3.502  -3.891  1.00 0.00 ? 92  LEU A HB3  1  
ATOM 1353  H HG   . LEU A 1 92  ? -11.953 -5.504  -2.200  1.00 0.00 ? 92  LEU A HG   1  
ATOM 1354  H HD11 . LEU A 1 92  ? -11.388 -4.830  -5.048  1.00 0.00 ? 92  LEU A HD11 1  
ATOM 1355  H HD12 . LEU A 1 92  ? -10.012 -4.924  -3.923  1.00 0.00 ? 92  LEU A HD12 1  
ATOM 1356  H HD13 . LEU A 1 92  ? -11.085 -6.328  -4.136  1.00 0.00 ? 92  LEU A HD13 1  
ATOM 1357  H HD21 . LEU A 1 92  ? -12.187 -2.829  -1.984  1.00 0.00 ? 92  LEU A HD21 1  
ATOM 1358  H HD22 . LEU A 1 92  ? -10.751 -3.741  -1.460  1.00 0.00 ? 92  LEU A HD22 1  
ATOM 1359  H HD23 . LEU A 1 92  ? -10.758 -2.924  -3.042  1.00 0.00 ? 92  LEU A HD23 1  
ATOM 1360  N N    . LYS A 1 93  ? -16.533 -3.613  -3.098  1.00 0.00 ? 93  LYS A N    1  
ATOM 1361  C CA   . LYS A 1 93  ? -17.881 -3.580  -3.640  1.00 0.00 ? 93  LYS A CA   1  
ATOM 1362  C C    . LYS A 1 93  ? -17.820 -3.768  -5.158  1.00 0.00 ? 93  LYS A C    1  
ATOM 1363  O O    . LYS A 1 93  ? -17.067 -3.078  -5.842  1.00 0.00 ? 93  LYS A O    1  
ATOM 1364  C CB   . LYS A 1 93  ? -18.602 -2.301  -3.208  1.00 0.00 ? 93  LYS A CB   1  
ATOM 1365  C CG   . LYS A 1 93  ? -19.940 -2.154  -3.934  1.00 0.00 ? 93  LYS A CG   1  
ATOM 1366  C CD   . LYS A 1 93  ? -20.048 -0.786  -4.612  1.00 0.00 ? 93  LYS A CD   1  
ATOM 1367  C CE   . LYS A 1 93  ? -20.132 0.335   -3.574  1.00 0.00 ? 93  LYS A CE   1  
ATOM 1368  N NZ   . LYS A 1 93  ? -20.372 1.637   -4.235  1.00 0.00 ? 93  LYS A NZ   1  
ATOM 1369  H H    . LYS A 1 93  ? -16.166 -2.724  -2.824  1.00 0.00 ? 93  LYS A H    1  
ATOM 1370  H HA   . LYS A 1 93  ? -18.427 -4.419  -3.210  1.00 0.00 ? 93  LYS A HA   1  
ATOM 1371  H HB2  . LYS A 1 93  ? -18.768 -2.320  -2.131  1.00 0.00 ? 93  LYS A HB2  1  
ATOM 1372  H HB3  . LYS A 1 93  ? -17.972 -1.436  -3.417  1.00 0.00 ? 93  LYS A HB3  1  
ATOM 1373  H HG2  . LYS A 1 93  ? -20.042 -2.942  -4.680  1.00 0.00 ? 93  LYS A HG2  1  
ATOM 1374  H HG3  . LYS A 1 93  ? -20.758 -2.278  -3.225  1.00 0.00 ? 93  LYS A HG3  1  
ATOM 1375  H HD2  . LYS A 1 93  ? -19.183 -0.626  -5.256  1.00 0.00 ? 93  LYS A HD2  1  
ATOM 1376  H HD3  . LYS A 1 93  ? -20.930 -0.761  -5.251  1.00 0.00 ? 93  LYS A HD3  1  
ATOM 1377  H HE2  . LYS A 1 93  ? -20.936 0.125   -2.868  1.00 0.00 ? 93  LYS A HE2  1  
ATOM 1378  H HE3  . LYS A 1 93  ? -19.207 0.377   -2.999  1.00 0.00 ? 93  LYS A HE3  1  
ATOM 1379  H HZ1  . LYS A 1 93  ? -20.027 1.603   -5.173  1.00 0.00 ? 93  LYS A HZ1  1  
ATOM 1380  H HZ2  . LYS A 1 93  ? -21.353 1.829   -4.248  1.00 0.00 ? 93  LYS A HZ2  1  
ATOM 1381  H HZ3  . LYS A 1 93  ? -19.897 2.359   -3.732  1.00 0.00 ? 93  LYS A HZ3  1  
ATOM 1382  N N    . PRO A 1 94  ? -18.645 -4.731  -5.651  1.00 0.00 ? 94  PRO A N    1  
ATOM 1383  C CA   . PRO A 1 94  ? -18.692 -5.018  -7.074  1.00 0.00 ? 94  PRO A CA   1  
ATOM 1384  C C    . PRO A 1 94  ? -19.455 -3.928  -7.829  1.00 0.00 ? 94  PRO A C    1  
ATOM 1385  O O    . PRO A 1 94  ? -20.216 -3.170  -7.230  1.00 0.00 ? 94  PRO A O    1  
ATOM 1386  C CB   . PRO A 1 94  ? -19.349 -6.385  -7.178  1.00 0.00 ? 94  PRO A CB   1  
ATOM 1387  C CG   . PRO A 1 94  ? -20.064 -6.605  -5.855  1.00 0.00 ? 94  PRO A CG   1  
ATOM 1388  C CD   . PRO A 1 94  ? -19.551 -5.567  -4.870  1.00 0.00 ? 94  PRO A CD   1  
ATOM 1389  H HA   . PRO A 1 94  ? -17.768 -5.021  -7.459  1.00 0.00 ? 94  PRO A HA   1  
ATOM 1390  H HB2  . PRO A 1 94  ? -20.051 -6.418  -8.011  1.00 0.00 ? 94  PRO A HB2  1  
ATOM 1391  H HB3  . PRO A 1 94  ? -18.607 -7.163  -7.355  1.00 0.00 ? 94  PRO A HB3  1  
ATOM 1392  H HG2  . PRO A 1 94  ? -21.142 -6.510  -5.983  1.00 0.00 ? 94  PRO A HG2  1  
ATOM 1393  H HG3  . PRO A 1 94  ? -19.875 -7.612  -5.482  1.00 0.00 ? 94  PRO A HG3  1  
ATOM 1394  H HD2  . PRO A 1 94  ? -20.368 -4.981  -4.450  1.00 0.00 ? 94  PRO A HD2  1  
ATOM 1395  H HD3  . PRO A 1 94  ? -19.033 -6.037  -4.033  1.00 0.00 ? 94  PRO A HD3  1  
ATOM 1396  N N    . GLU A 1 95  ? -19.226 -3.885  -9.133  1.00 0.00 ? 95  GLU A N    1  
ATOM 1397  C CA   . GLU A 1 95  ? -19.883 -2.901  -9.976  1.00 0.00 ? 95  GLU A CA   1  
ATOM 1398  C C    . GLU A 1 95  ? -19.413 -1.491  -9.612  1.00 0.00 ? 95  GLU A C    1  
ATOM 1399  O O    . GLU A 1 95  ? -20.228 -0.586  -9.439  1.00 0.00 ? 95  GLU A O    1  
ATOM 1400  C CB   . GLU A 1 95  ? -21.405 -3.015  -9.869  1.00 0.00 ? 95  GLU A CB   1  
ATOM 1401  C CG   . GLU A 1 95  ? -21.945 -4.076  -10.831 1.00 0.00 ? 95  GLU A CG   1  
ATOM 1402  C CD   . GLU A 1 95  ? -22.926 -3.460  -11.831 1.00 0.00 ? 95  GLU A CD   1  
ATOM 1403  O OE1  . GLU A 1 95  ? -22.448 -3.025  -12.901 1.00 0.00 ? 95  GLU A OE1  1  
ATOM 1404  O OE2  . GLU A 1 95  ? -24.132 -3.439  -11.502 1.00 0.00 ? 95  GLU A OE2  1  
ATOM 1405  H H    . GLU A 1 95  ? -18.606 -4.506  -9.613  1.00 0.00 ? 95  GLU A H    1  
ATOM 1406  H HA   . GLU A 1 95  ? -19.578 -3.141  -10.995 1.00 0.00 ? 95  GLU A HA   1  
ATOM 1407  H HB2  . GLU A 1 95  ? -21.683 -3.272  -8.847  1.00 0.00 ? 95  GLU A HB2  1  
ATOM 1408  H HB3  . GLU A 1 95  ? -21.863 -2.051  -10.091 1.00 0.00 ? 95  GLU A HB3  1  
ATOM 1409  H HG2  . GLU A 1 95  ? -21.117 -4.540  -11.367 1.00 0.00 ? 95  GLU A HG2  1  
ATOM 1410  H HG3  . GLU A 1 95  ? -22.442 -4.865  -10.267 1.00 0.00 ? 95  GLU A HG3  1  
ATOM 1411  N N    . SER A 1 96  ? -18.100 -1.349  -9.507  1.00 0.00 ? 96  SER A N    1  
ATOM 1412  C CA   . SER A 1 96  ? -17.511 -0.065  -9.167  1.00 0.00 ? 96  SER A CA   1  
ATOM 1413  C C    . SER A 1 96  ? -16.058 -0.012  -9.645  1.00 0.00 ? 96  SER A C    1  
ATOM 1414  O O    . SER A 1 96  ? -15.591 -0.926  -10.323 1.00 0.00 ? 96  SER A O    1  
ATOM 1415  C CB   . SER A 1 96  ? -17.583 0.192   -7.661  1.00 0.00 ? 96  SER A CB   1  
ATOM 1416  O OG   . SER A 1 96  ? -18.927 0.331   -7.207  1.00 0.00 ? 96  SER A OG   1  
ATOM 1417  H H    . SER A 1 96  ? -17.444 -2.090  -9.650  1.00 0.00 ? 96  SER A H    1  
ATOM 1418  H HA   . SER A 1 96  ? -18.113 0.677   -9.691  1.00 0.00 ? 96  SER A HA   1  
ATOM 1419  H HB2  . SER A 1 96  ? -17.104 -0.630  -7.129  1.00 0.00 ? 96  SER A HB2  1  
ATOM 1420  H HB3  . SER A 1 96  ? -17.024 1.096   -7.420  1.00 0.00 ? 96  SER A HB3  1  
ATOM 1421  H HG   . SER A 1 96  ? -19.398 -0.550  -7.257  1.00 0.00 ? 96  SER A HG   1  
ATOM 1422  N N    . VAL A 1 97  ? -15.385 1.066   -9.272  1.00 0.00 ? 97  VAL A N    1  
ATOM 1423  C CA   . VAL A 1 97  ? -13.995 1.250   -9.654  1.00 0.00 ? 97  VAL A CA   1  
ATOM 1424  C C    . VAL A 1 97  ? -13.163 1.553   -8.407  1.00 0.00 ? 97  VAL A C    1  
ATOM 1425  O O    . VAL A 1 97  ? -13.599 2.301   -7.532  1.00 0.00 ? 97  VAL A O    1  
ATOM 1426  C CB   . VAL A 1 97  ? -13.886 2.337   -10.725 1.00 0.00 ? 97  VAL A CB   1  
ATOM 1427  C CG1  . VAL A 1 97  ? -12.491 2.351   -11.353 1.00 0.00 ? 97  VAL A CG1  1  
ATOM 1428  C CG2  . VAL A 1 97  ? -14.967 2.165   -11.794 1.00 0.00 ? 97  VAL A CG2  1  
ATOM 1429  H H    . VAL A 1 97  ? -15.772 1.804   -8.720  1.00 0.00 ? 97  VAL A H    1  
ATOM 1430  H HA   . VAL A 1 97  ? -13.647 0.313   -10.089 1.00 0.00 ? 97  VAL A HA   1  
ATOM 1431  H HB   . VAL A 1 97  ? -14.045 3.301   -10.241 1.00 0.00 ? 97  VAL A HB   1  
ATOM 1432  H HG11 . VAL A 1 97  ? -11.749 2.097   -10.595 1.00 0.00 ? 97  VAL A HG11 1  
ATOM 1433  H HG12 . VAL A 1 97  ? -12.449 1.621   -12.161 1.00 0.00 ? 97  VAL A HG12 1  
ATOM 1434  H HG13 . VAL A 1 97  ? -12.280 3.345   -11.749 1.00 0.00 ? 97  VAL A HG13 1  
ATOM 1435  H HG21 . VAL A 1 97  ? -14.502 2.135   -12.779 1.00 0.00 ? 97  VAL A HG21 1  
ATOM 1436  H HG22 . VAL A 1 97  ? -15.506 1.234   -11.619 1.00 0.00 ? 97  VAL A HG22 1  
ATOM 1437  H HG23 . VAL A 1 97  ? -15.663 3.002   -11.746 1.00 0.00 ? 97  VAL A HG23 1  
ATOM 1438  N N    . TYR A 1 98  ? -11.980 0.958   -8.364  1.00 0.00 ? 98  TYR A N    1  
ATOM 1439  C CA   . TYR A 1 98  ? -11.084 1.156   -7.238  1.00 0.00 ? 98  TYR A CA   1  
ATOM 1440  C C    . TYR A 1 98  ? -9.719  1.665   -7.706  1.00 0.00 ? 98  TYR A C    1  
ATOM 1441  O O    . TYR A 1 98  ? -9.174  1.172   -8.692  1.00 0.00 ? 98  TYR A O    1  
ATOM 1442  C CB   . TYR A 1 98  ? -10.908 -0.220  -6.592  1.00 0.00 ? 98  TYR A CB   1  
ATOM 1443  C CG   . TYR A 1 98  ? -11.989 -0.570  -5.568  1.00 0.00 ? 98  TYR A CG   1  
ATOM 1444  C CD1  . TYR A 1 98  ? -13.221 -1.023  -5.993  1.00 0.00 ? 98  TYR A CD1  1  
ATOM 1445  C CD2  . TYR A 1 98  ? -11.732 -0.433  -4.219  1.00 0.00 ? 98  TYR A CD2  1  
ATOM 1446  C CE1  . TYR A 1 98  ? -14.239 -1.353  -5.029  1.00 0.00 ? 98  TYR A CE1  1  
ATOM 1447  C CE2  . TYR A 1 98  ? -12.750 -0.763  -3.255  1.00 0.00 ? 98  TYR A CE2  1  
ATOM 1448  C CZ   . TYR A 1 98  ? -13.953 -1.206  -3.708  1.00 0.00 ? 98  TYR A CZ   1  
ATOM 1449  O OH   . TYR A 1 98  ? -14.914 -1.517  -2.798  1.00 0.00 ? 98  TYR A OH   1  
ATOM 1450  H H    . TYR A 1 98  ? -11.633 0.352   -9.079  1.00 0.00 ? 98  TYR A H    1  
ATOM 1451  H HA   . TYR A 1 98  ? -11.532 1.897   -6.576  1.00 0.00 ? 98  TYR A HA   1  
ATOM 1452  H HB2  . TYR A 1 98  ? -10.903 -0.979  -7.375  1.00 0.00 ? 98  TYR A HB2  1  
ATOM 1453  H HB3  . TYR A 1 98  ? -9.933  -0.260  -6.105  1.00 0.00 ? 98  TYR A HB3  1  
ATOM 1454  H HD1  . TYR A 1 98  ? -13.424 -1.131  -7.059  1.00 0.00 ? 98  TYR A HD1  1  
ATOM 1455  H HD2  . TYR A 1 98  ? -10.759 -0.075  -3.883  1.00 0.00 ? 98  TYR A HD2  1  
ATOM 1456  H HE1  . TYR A 1 98  ? -15.217 -1.711  -5.352  1.00 0.00 ? 98  TYR A HE1  1  
ATOM 1457  H HE2  . TYR A 1 98  ? -12.560 -0.659  -2.187  1.00 0.00 ? 98  TYR A HE2  1  
ATOM 1458  H HH   . TYR A 1 98  ? -15.641 -0.831  -2.820  1.00 0.00 ? 98  TYR A HH   1  
ATOM 1459  N N    . LEU A 1 99  ? -9.206  2.645   -6.976  1.00 0.00 ? 99  LEU A N    1  
ATOM 1460  C CA   . LEU A 1 99  ? -7.916  3.226   -7.305  1.00 0.00 ? 99  LEU A CA   1  
ATOM 1461  C C    . LEU A 1 99  ? -6.834  2.580   -6.436  1.00 0.00 ? 99  LEU A C    1  
ATOM 1462  O O    . LEU A 1 99  ? -6.885  2.667   -5.210  1.00 0.00 ? 99  LEU A O    1  
ATOM 1463  C CB   . LEU A 1 99  ? -7.969  4.750   -7.188  1.00 0.00 ? 99  LEU A CB   1  
ATOM 1464  C CG   . LEU A 1 99  ? -6.635  5.482   -7.346  1.00 0.00 ? 99  LEU A CG   1  
ATOM 1465  C CD1  . LEU A 1 99  ? -5.862  5.503   -6.025  1.00 0.00 ? 99  LEU A CD1  1  
ATOM 1466  C CD2  . LEU A 1 99  ? -5.809  4.879   -8.484  1.00 0.00 ? 99  LEU A CD2  1  
ATOM 1467  H H    . LEU A 1 99  ? -9.656  3.040   -6.176  1.00 0.00 ? 99  LEU A H    1  
ATOM 1468  H HA   . LEU A 1 99  ? -7.707  2.989   -8.348  1.00 0.00 ? 99  LEU A HA   1  
ATOM 1469  H HB2  . LEU A 1 99  ? -8.659  5.128   -7.943  1.00 0.00 ? 99  LEU A HB2  1  
ATOM 1470  H HB3  . LEU A 1 99  ? -8.389  5.006   -6.216  1.00 0.00 ? 99  LEU A HB3  1  
ATOM 1471  H HG   . LEU A 1 99  ? -6.843  6.518   -7.613  1.00 0.00 ? 99  LEU A HG   1  
ATOM 1472  H HD11 . LEU A 1 99  ? -5.937  6.493   -5.576  1.00 0.00 ? 99  LEU A HD11 1  
ATOM 1473  H HD12 . LEU A 1 99  ? -6.284  4.763   -5.346  1.00 0.00 ? 99  LEU A HD12 1  
ATOM 1474  H HD13 . LEU A 1 99  ? -4.815  5.267   -6.214  1.00 0.00 ? 99  LEU A HD13 1  
ATOM 1475  H HD21 . LEU A 1 99  ? -5.884  3.792   -8.450  1.00 0.00 ? 99  LEU A HD21 1  
ATOM 1476  H HD22 . LEU A 1 99  ? -6.189  5.240   -9.439  1.00 0.00 ? 99  LEU A HD22 1  
ATOM 1477  H HD23 . LEU A 1 99  ? -4.766  5.175   -8.372  1.00 0.00 ? 99  LEU A HD23 1  
ATOM 1478  N N    . PHE A 1 100 ? -5.882  1.948   -7.105  1.00 0.00 ? 100 PHE A N    1  
ATOM 1479  C CA   . PHE A 1 100 ? -4.790  1.288   -6.409  1.00 0.00 ? 100 PHE A CA   1  
ATOM 1480  C C    . PHE A 1 100 ? -3.503  2.109   -6.504  1.00 0.00 ? 100 PHE A C    1  
ATOM 1481  O O    . PHE A 1 100 ? -2.930  2.249   -7.584  1.00 0.00 ? 100 PHE A O    1  
ATOM 1482  C CB   . PHE A 1 100 ? -4.572  -0.062  -7.096  1.00 0.00 ? 100 PHE A CB   1  
ATOM 1483  C CG   . PHE A 1 100 ? -5.468  -1.183  -6.564  1.00 0.00 ? 100 PHE A CG   1  
ATOM 1484  C CD1  . PHE A 1 100 ? -6.782  -1.225  -6.910  1.00 0.00 ? 100 PHE A CD1  1  
ATOM 1485  C CD2  . PHE A 1 100 ? -4.949  -2.136  -5.744  1.00 0.00 ? 100 PHE A CD2  1  
ATOM 1486  C CE1  . PHE A 1 100 ? -7.613  -2.266  -6.416  1.00 0.00 ? 100 PHE A CE1  1  
ATOM 1487  C CE2  . PHE A 1 100 ? -5.780  -3.176  -5.250  1.00 0.00 ? 100 PHE A CE2  1  
ATOM 1488  C CZ   . PHE A 1 100 ? -7.094  -3.219  -5.596  1.00 0.00 ? 100 PHE A CZ   1  
ATOM 1489  H H    . PHE A 1 100 ? -5.848  1.882   -8.102  1.00 0.00 ? 100 PHE A H    1  
ATOM 1490  H HA   . PHE A 1 100 ? -5.083  1.195   -5.363  1.00 0.00 ? 100 PHE A HA   1  
ATOM 1491  H HB2  . PHE A 1 100 ? -4.749  0.054   -8.165  1.00 0.00 ? 100 PHE A HB2  1  
ATOM 1492  H HB3  . PHE A 1 100 ? -3.530  -0.355  -6.975  1.00 0.00 ? 100 PHE A HB3  1  
ATOM 1493  H HD1  . PHE A 1 100 ? -7.198  -0.461  -7.567  1.00 0.00 ? 100 PHE A HD1  1  
ATOM 1494  H HD2  . PHE A 1 100 ? -3.896  -2.101  -5.466  1.00 0.00 ? 100 PHE A HD2  1  
ATOM 1495  H HE1  . PHE A 1 100 ? -8.666  -2.300  -6.694  1.00 0.00 ? 100 PHE A HE1  1  
ATOM 1496  H HE2  . PHE A 1 100 ? -5.364  -3.940  -4.593  1.00 0.00 ? 100 PHE A HE2  1  
ATOM 1497  H HZ   . PHE A 1 100 ? -7.732  -4.017  -5.217  1.00 0.00 ? 100 PHE A HZ   1  
ATOM 1498  N N    . ARG A 1 101 ? -3.086  2.631   -5.361  1.00 0.00 ? 101 ARG A N    1  
ATOM 1499  C CA   . ARG A 1 101 ? -1.877  3.435   -5.302  1.00 0.00 ? 101 ARG A CA   1  
ATOM 1500  C C    . ARG A 1 101 ? -0.732  2.628   -4.685  1.00 0.00 ? 101 ARG A C    1  
ATOM 1501  O O    . ARG A 1 101 ? -0.769  2.298   -3.501  1.00 0.00 ? 101 ARG A O    1  
ATOM 1502  C CB   . ARG A 1 101 ? -2.098  4.705   -4.477  1.00 0.00 ? 101 ARG A CB   1  
ATOM 1503  C CG   . ARG A 1 101 ? -1.247  5.859   -5.008  1.00 0.00 ? 101 ARG A CG   1  
ATOM 1504  C CD   . ARG A 1 101 ? -2.028  7.175   -4.979  1.00 0.00 ? 101 ARG A CD   1  
ATOM 1505  N NE   . ARG A 1 101 ? -2.173  7.647   -3.584  1.00 0.00 ? 101 ARG A NE   1  
ATOM 1506  C CZ   . ARG A 1 101 ? -1.266  8.402   -2.949  1.00 0.00 ? 101 ARG A CZ   1  
ATOM 1507  N NH1  . ARG A 1 101 ? -0.144  8.775   -3.580  1.00 0.00 ? 101 ARG A NH1  1  
ATOM 1508  N NH2  . ARG A 1 101 ? -1.481  8.784   -1.683  1.00 0.00 ? 101 ARG A NH2  1  
ATOM 1509  H H    . ARG A 1 101 ? -3.557  2.513   -4.487  1.00 0.00 ? 101 ARG A H    1  
ATOM 1510  H HA   . ARG A 1 101 ? -1.661  3.691   -6.339  1.00 0.00 ? 101 ARG A HA   1  
ATOM 1511  H HB2  . ARG A 1 101 ? -3.152  4.982   -4.506  1.00 0.00 ? 101 ARG A HB2  1  
ATOM 1512  H HB3  . ARG A 1 101 ? -1.848  4.513   -3.434  1.00 0.00 ? 101 ARG A HB3  1  
ATOM 1513  H HG2  . ARG A 1 101 ? -0.343  5.956   -4.407  1.00 0.00 ? 101 ARG A HG2  1  
ATOM 1514  H HG3  . ARG A 1 101 ? -0.930  5.643   -6.028  1.00 0.00 ? 101 ARG A HG3  1  
ATOM 1515  H HD2  . ARG A 1 101 ? -1.512  7.927   -5.575  1.00 0.00 ? 101 ARG A HD2  1  
ATOM 1516  H HD3  . ARG A 1 101 ? -3.012  7.033   -5.428  1.00 0.00 ? 101 ARG A HD3  1  
ATOM 1517  H HE   . ARG A 1 101 ? -2.998  7.386   -3.084  1.00 0.00 ? 101 ARG A HE   1  
ATOM 1518  H HH11 . ARG A 1 101 ? 0.016   8.490   -4.525  1.00 0.00 ? 101 ARG A HH11 1  
ATOM 1519  H HH12 . ARG A 1 101 ? 0.532   9.339   -3.106  1.00 0.00 ? 101 ARG A HH12 1  
ATOM 1520  H HH21 . ARG A 1 101 ? -2.318  8.506   -1.212  1.00 0.00 ? 101 ARG A HH21 1  
ATOM 1521  H HH22 . ARG A 1 101 ? -0.804  9.348   -1.209  1.00 0.00 ? 101 ARG A HH22 1  
ATOM 1522  N N    . ILE A 1 102 ? 0.257   2.334   -5.516  1.00 0.00 ? 102 ILE A N    1  
ATOM 1523  C CA   . ILE A 1 102 ? 1.410   1.572   -5.068  1.00 0.00 ? 102 ILE A CA   1  
ATOM 1524  C C    . ILE A 1 102 ? 2.552   2.534   -4.731  1.00 0.00 ? 102 ILE A C    1  
ATOM 1525  O O    . ILE A 1 102 ? 2.816   3.475   -5.477  1.00 0.00 ? 102 ILE A O    1  
ATOM 1526  C CB   . ILE A 1 102 ? 1.786   0.510   -6.102  1.00 0.00 ? 102 ILE A CB   1  
ATOM 1527  C CG1  . ILE A 1 102 ? 0.696   -0.559  -6.212  1.00 0.00 ? 102 ILE A CG1  1  
ATOM 1528  C CG2  . ILE A 1 102 ? 3.155   -0.098  -5.792  1.00 0.00 ? 102 ILE A CG2  1  
ATOM 1529  C CD1  . ILE A 1 102 ? 0.632   -1.134  -7.628  1.00 0.00 ? 102 ILE A CD1  1  
ATOM 1530  H H    . ILE A 1 102 ? 0.279   2.607   -6.478  1.00 0.00 ? 102 ILE A H    1  
ATOM 1531  H HA   . ILE A 1 102 ? 1.121   1.047   -4.157  1.00 0.00 ? 102 ILE A HA   1  
ATOM 1532  H HB   . ILE A 1 102 ? 1.861   0.993   -7.076  1.00 0.00 ? 102 ILE A HB   1  
ATOM 1533  H HG12 . ILE A 1 102 ? 0.894   -1.359  -5.499  1.00 0.00 ? 102 ILE A HG12 1  
ATOM 1534  H HG13 . ILE A 1 102 ? -0.269  -0.127  -5.947  1.00 0.00 ? 102 ILE A HG13 1  
ATOM 1535  H HG21 . ILE A 1 102 ? 3.065   -0.786  -4.952  1.00 0.00 ? 102 ILE A HG21 1  
ATOM 1536  H HG22 . ILE A 1 102 ? 3.520   -0.637  -6.666  1.00 0.00 ? 102 ILE A HG22 1  
ATOM 1537  H HG23 . ILE A 1 102 ? 3.856   0.697   -5.537  1.00 0.00 ? 102 ILE A HG23 1  
ATOM 1538  H HD11 . ILE A 1 102 ? 0.405   -2.199  -7.578  1.00 0.00 ? 102 ILE A HD11 1  
ATOM 1539  H HD12 . ILE A 1 102 ? -0.147  -0.622  -8.193  1.00 0.00 ? 102 ILE A HD12 1  
ATOM 1540  H HD13 . ILE A 1 102 ? 1.593   -0.991  -8.122  1.00 0.00 ? 102 ILE A HD13 1  
ATOM 1541  N N    . THR A 1 103 ? 3.198   2.264   -3.606  1.00 0.00 ? 103 THR A N    1  
ATOM 1542  C CA   . THR A 1 103 ? 4.305   3.093   -3.162  1.00 0.00 ? 103 THR A CA   1  
ATOM 1543  C C    . THR A 1 103 ? 5.349   2.244   -2.433  1.00 0.00 ? 103 THR A C    1  
ATOM 1544  O O    . THR A 1 103 ? 5.054   1.133   -1.994  1.00 0.00 ? 103 THR A O    1  
ATOM 1545  C CB   . THR A 1 103 ? 3.734   4.223   -2.302  1.00 0.00 ? 103 THR A CB   1  
ATOM 1546  O OG1  . THR A 1 103 ? 2.559   4.629   -2.999  1.00 0.00 ? 103 THR A OG1  1  
ATOM 1547  C CG2  . THR A 1 103 ? 4.621   5.469   -2.310  1.00 0.00 ? 103 THR A CG2  1  
ATOM 1548  H H    . THR A 1 103 ? 2.977   1.496   -3.005  1.00 0.00 ? 103 THR A H    1  
ATOM 1549  H HA   . THR A 1 103 ? 4.793   3.515   -4.040  1.00 0.00 ? 103 THR A HA   1  
ATOM 1550  H HB   . THR A 1 103 ? 3.550   3.882   -1.284  1.00 0.00 ? 103 THR A HB   1  
ATOM 1551  H HG1  . THR A 1 103 ? 2.041   5.280   -2.444  1.00 0.00 ? 103 THR A HG1  1  
ATOM 1552  H HG21 . THR A 1 103 ? 5.653   5.183   -2.106  1.00 0.00 ? 103 THR A HG21 1  
ATOM 1553  H HG22 . THR A 1 103 ? 4.564   5.950   -3.286  1.00 0.00 ? 103 THR A HG22 1  
ATOM 1554  H HG23 . THR A 1 103 ? 4.278   6.164   -1.542  1.00 0.00 ? 103 THR A HG23 1  
ATOM 1555  N N    . ALA A 1 104 ? 6.547   2.798   -2.328  1.00 0.00 ? 104 ALA A N    1  
ATOM 1556  C CA   . ALA A 1 104 ? 7.636   2.106   -1.661  1.00 0.00 ? 104 ALA A CA   1  
ATOM 1557  C C    . ALA A 1 104 ? 8.078   2.916   -0.440  1.00 0.00 ? 104 ALA A C    1  
ATOM 1558  O O    . ALA A 1 104 ? 7.852   4.123   -0.377  1.00 0.00 ? 104 ALA A O    1  
ATOM 1559  C CB   . ALA A 1 104 ? 8.779   1.875   -2.652  1.00 0.00 ? 104 ALA A CB   1  
ATOM 1560  H H    . ALA A 1 104 ? 6.779   3.702   -2.688  1.00 0.00 ? 104 ALA A H    1  
ATOM 1561  H HA   . ALA A 1 104 ? 7.260   1.138   -1.328  1.00 0.00 ? 104 ALA A HA   1  
ATOM 1562  H HB1  . ALA A 1 104 ? 9.719   1.782   -2.108  1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1563  H HB2  . ALA A 1 104 ? 8.592   0.960   -3.214  1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1564  H HB3  . ALA A 1 104 ? 8.839   2.719   -3.340  1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1565  N N    . GLN A 1 105 ? 8.701   2.219   0.499   1.00 0.00 ? 105 GLN A N    1  
ATOM 1566  C CA   . GLN A 1 105 ? 9.177   2.858   1.714   1.00 0.00 ? 105 GLN A CA   1  
ATOM 1567  C C    . GLN A 1 105 ? 10.693  2.696   1.840   1.00 0.00 ? 105 GLN A C    1  
ATOM 1568  O O    . GLN A 1 105 ? 11.207  1.580   1.795   1.00 0.00 ? 105 GLN A O    1  
ATOM 1569  C CB   . GLN A 1 105 ? 8.461   2.298   2.945   1.00 0.00 ? 105 GLN A CB   1  
ATOM 1570  C CG   . GLN A 1 105 ? 8.848   3.074   4.205   1.00 0.00 ? 105 GLN A CG   1  
ATOM 1571  C CD   . GLN A 1 105 ? 8.898   2.151   5.424   1.00 0.00 ? 105 GLN A CD   1  
ATOM 1572  O OE1  . GLN A 1 105 ? 9.831   1.391   5.622   1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1573  N NE2  . GLN A 1 105 ? 7.843   2.259   6.227   1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1574  H H    . GLN A 1 105 ? 8.881   1.237   0.440   1.00 0.00 ? 105 GLN A H    1  
ATOM 1575  H HA   . GLN A 1 105 ? 8.925   3.913   1.604   1.00 0.00 ? 105 GLN A HA   1  
ATOM 1576  H HB2  . GLN A 1 105 ? 7.382   2.351   2.798   1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1577  H HB3  . GLN A 1 105 ? 8.714   1.245   3.069   1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1578  H HG2  . GLN A 1 105 ? 9.821   3.545   4.062   1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1579  H HG3  . GLN A 1 105 ? 8.129   3.874   4.379   1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1580  H HE21 . GLN A 1 105 ? 7.110   2.903   6.007   1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1581  H HE22 . GLN A 1 105 ? 7.783   1.696   7.052   1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1582  N N    . THR A 1 106 ? 11.366  3.827   1.997   1.00 0.00 ? 106 THR A N    1  
ATOM 1583  C CA   . THR A 1 106 ? 12.812  3.824   2.130   1.00 0.00 ? 106 THR A CA   1  
ATOM 1584  C C    . THR A 1 106 ? 13.229  4.514   3.430   1.00 0.00 ? 106 THR A C    1  
ATOM 1585  O O    . THR A 1 106 ? 12.392  4.782   4.291   1.00 0.00 ? 106 THR A O    1  
ATOM 1586  C CB   . THR A 1 106 ? 13.403  4.478   0.879   1.00 0.00 ? 106 THR A CB   1  
ATOM 1587  O OG1  . THR A 1 106 ? 12.471  5.505   0.550   1.00 0.00 ? 106 THR A OG1  1  
ATOM 1588  C CG2  . THR A 1 106 ? 13.378  3.548   -0.336  1.00 0.00 ? 106 THR A CG2  1  
ATOM 1589  H H    . THR A 1 106 ? 10.939  4.731   2.032   1.00 0.00 ? 106 THR A H    1  
ATOM 1590  H HA   . THR A 1 106 ? 13.150  2.790   2.194   1.00 0.00 ? 106 THR A HA   1  
ATOM 1591  H HB   . THR A 1 106 ? 14.413  4.841   1.070   1.00 0.00 ? 106 THR A HB   1  
ATOM 1592  H HG1  . THR A 1 106 ? 11.622  5.100   0.211   1.00 0.00 ? 106 THR A HG1  1  
ATOM 1593  H HG21 . THR A 1 106 ? 14.067  3.921   -1.093  1.00 0.00 ? 106 THR A HG21 1  
ATOM 1594  H HG22 . THR A 1 106 ? 13.679  2.546   -0.032  1.00 0.00 ? 106 THR A HG22 1  
ATOM 1595  H HG23 . THR A 1 106 ? 12.369  3.516   -0.747  1.00 0.00 ? 106 THR A HG23 1  
ATOM 1596  N N    . ARG A 1 107 ? 14.523  4.781   3.533   1.00 0.00 ? 107 ARG A N    1  
ATOM 1597  C CA   . ARG A 1 107 ? 15.061  5.434   4.714   1.00 0.00 ? 107 ARG A CA   1  
ATOM 1598  C C    . ARG A 1 107 ? 14.701  6.921   4.709   1.00 0.00 ? 107 ARG A C    1  
ATOM 1599  O O    . ARG A 1 107 ? 14.848  7.602   5.723   1.00 0.00 ? 107 ARG A O    1  
ATOM 1600  C CB   . ARG A 1 107 ? 16.583  5.285   4.781   1.00 0.00 ? 107 ARG A CB   1  
ATOM 1601  C CG   . ARG A 1 107 ? 17.261  6.090   3.670   1.00 0.00 ? 107 ARG A CG   1  
ATOM 1602  C CD   . ARG A 1 107 ? 18.779  5.900   3.704   1.00 0.00 ? 107 ARG A CD   1  
ATOM 1603  N NE   . ARG A 1 107 ? 19.266  5.480   2.371   1.00 0.00 ? 107 ARG A NE   1  
ATOM 1604  C CZ   . ARG A 1 107 ? 19.295  4.209   1.948   1.00 0.00 ? 107 ARG A CZ   1  
ATOM 1605  N NH1  . ARG A 1 107 ? 18.864  3.226   2.749   1.00 0.00 ? 107 ARG A NH1  1  
ATOM 1606  N NH2  . ARG A 1 107 ? 19.754  3.922   0.722   1.00 0.00 ? 107 ARG A NH2  1  
ATOM 1607  H H    . ARG A 1 107 ? 15.197  4.559   2.828   1.00 0.00 ? 107 ARG A H    1  
ATOM 1608  H HA   . ARG A 1 107 ? 14.594  4.920   5.554   1.00 0.00 ? 107 ARG A HA   1  
ATOM 1609  H HB2  . ARG A 1 107 ? 16.942  5.624   5.752   1.00 0.00 ? 107 ARG A HB2  1  
ATOM 1610  H HB3  . ARG A 1 107 ? 16.853  4.233   4.690   1.00 0.00 ? 107 ARG A HB3  1  
ATOM 1611  H HG2  . ARG A 1 107 ? 16.873  5.777   2.701   1.00 0.00 ? 107 ARG A HG2  1  
ATOM 1612  H HG3  . ARG A 1 107 ? 17.021  7.147   3.784   1.00 0.00 ? 107 ARG A HG3  1  
ATOM 1613  H HD2  . ARG A 1 107 ? 19.264  6.829   4.002   1.00 0.00 ? 107 ARG A HD2  1  
ATOM 1614  H HD3  . ARG A 1 107 ? 19.043  5.150   4.450   1.00 0.00 ? 107 ARG A HD3  1  
ATOM 1615  H HE   . ARG A 1 107 ? 19.595  6.190   1.748   1.00 0.00 ? 107 ARG A HE   1  
ATOM 1616  H HH11 . ARG A 1 107 ? 18.521  3.440   3.664   1.00 0.00 ? 107 ARG A HH11 1  
ATOM 1617  H HH12 . ARG A 1 107 ? 18.885  2.277   2.433   1.00 0.00 ? 107 ARG A HH12 1  
ATOM 1618  H HH21 . ARG A 1 107 ? 20.076  4.656   0.124   1.00 0.00 ? 107 ARG A HH21 1  
ATOM 1619  H HH22 . ARG A 1 107 ? 19.775  2.973   0.406   1.00 0.00 ? 107 ARG A HH22 1  
ATOM 1620  N N    . LYS A 1 108 ? 14.234  7.380   3.557   1.00 0.00 ? 108 LYS A N    1  
ATOM 1621  C CA   . LYS A 1 108 ? 13.851  8.774   3.408   1.00 0.00 ? 108 LYS A CA   1  
ATOM 1622  C C    . LYS A 1 108 ? 12.344  8.911   3.632   1.00 0.00 ? 108 LYS A C    1  
ATOM 1623  O O    . LYS A 1 108 ? 11.883  9.913   4.176   1.00 0.00 ? 108 LYS A O    1  
ATOM 1624  C CB   . LYS A 1 108 ? 14.324  9.317   2.058   1.00 0.00 ? 108 LYS A CB   1  
ATOM 1625  C CG   . LYS A 1 108 ? 15.786  8.947   1.799   1.00 0.00 ? 108 LYS A CG   1  
ATOM 1626  C CD   . LYS A 1 108 ? 16.709  9.608   2.825   1.00 0.00 ? 108 LYS A CD   1  
ATOM 1627  C CE   . LYS A 1 108 ? 16.578  11.131  2.779   1.00 0.00 ? 108 LYS A CE   1  
ATOM 1628  N NZ   . LYS A 1 108 ? 17.915  11.765  2.739   1.00 0.00 ? 108 LYS A NZ   1  
ATOM 1629  H H    . LYS A 1 108 ? 14.117  6.819   2.738   1.00 0.00 ? 108 LYS A H    1  
ATOM 1630  H HA   . LYS A 1 108 ? 14.369  9.340   4.182   1.00 0.00 ? 108 LYS A HA   1  
ATOM 1631  H HB2  . LYS A 1 108 ? 13.698  8.917   1.260   1.00 0.00 ? 108 LYS A HB2  1  
ATOM 1632  H HB3  . LYS A 1 108 ? 14.211  10.401  2.038   1.00 0.00 ? 108 LYS A HB3  1  
ATOM 1633  H HG2  . LYS A 1 108 ? 15.904  7.864   1.843   1.00 0.00 ? 108 LYS A HG2  1  
ATOM 1634  H HG3  . LYS A 1 108 ? 16.072  9.258   0.794   1.00 0.00 ? 108 LYS A HG3  1  
ATOM 1635  H HD2  . LYS A 1 108 ? 16.463  9.249   3.825   1.00 0.00 ? 108 LYS A HD2  1  
ATOM 1636  H HD3  . LYS A 1 108 ? 17.742  9.321   2.628   1.00 0.00 ? 108 LYS A HD3  1  
ATOM 1637  H HE2  . LYS A 1 108 ? 16.003  11.426  1.901   1.00 0.00 ? 108 LYS A HE2  1  
ATOM 1638  H HE3  . LYS A 1 108 ? 16.029  11.482  3.652   1.00 0.00 ? 108 LYS A HE3  1  
ATOM 1639  H HZ1  . LYS A 1 108 ? 18.391  11.486  1.905   1.00 0.00 ? 108 LYS A HZ1  1  
ATOM 1640  H HZ2  . LYS A 1 108 ? 17.813  12.760  2.748   1.00 0.00 ? 108 LYS A HZ2  1  
ATOM 1641  H HZ3  . LYS A 1 108 ? 18.445  11.477  3.537   1.00 0.00 ? 108 LYS A HZ3  1  
ATOM 1642  N N    . GLY A 1 109 ? 11.619  7.890   3.201   1.00 0.00 ? 109 GLY A N    1  
ATOM 1643  C CA   . GLY A 1 109 ? 10.173  7.884   3.348   1.00 0.00 ? 109 GLY A CA   1  
ATOM 1644  C C    . GLY A 1 109 ? 9.505   7.181   2.165   1.00 0.00 ? 109 GLY A C    1  
ATOM 1645  O O    . GLY A 1 109 ? 10.036  6.206   1.636   1.00 0.00 ? 109 GLY A O    1  
ATOM 1646  H H    . GLY A 1 109 ? 12.002  7.078   2.759   1.00 0.00 ? 109 GLY A H    1  
ATOM 1647  H HA2  . GLY A 1 109 ? 9.900   7.380   4.276   1.00 0.00 ? 109 GLY A HA2  1  
ATOM 1648  H HA3  . GLY A 1 109 ? 9.807   8.908   3.421   1.00 0.00 ? 109 GLY A HA3  1  
ATOM 1649  N N    . TRP A 1 110 ? 8.349   7.705   1.783   1.00 0.00 ? 110 TRP A N    1  
ATOM 1650  C CA   . TRP A 1 110 ? 7.602   7.140   0.672   1.00 0.00 ? 110 TRP A CA   1  
ATOM 1651  C C    . TRP A 1 110 ? 7.764   8.073   -0.530  1.00 0.00 ? 110 TRP A C    1  
ATOM 1652  O O    . TRP A 1 110 ? 7.432   9.255   -0.451  1.00 0.00 ? 110 TRP A O    1  
ATOM 1653  C CB   . TRP A 1 110 ? 6.139   6.908   1.056   1.00 0.00 ? 110 TRP A CB   1  
ATOM 1654  C CG   . TRP A 1 110 ? 5.949   5.950   2.233   1.00 0.00 ? 110 TRP A CG   1  
ATOM 1655  C CD1  . TRP A 1 110 ? 6.035   6.224   3.542   1.00 0.00 ? 110 TRP A CD1  1  
ATOM 1656  C CD2  . TRP A 1 110 ? 5.637   4.543   2.155   1.00 0.00 ? 110 TRP A CD2  1  
ATOM 1657  N NE1  . TRP A 1 110 ? 5.801   5.102   4.310   1.00 0.00 ? 110 TRP A NE1  1  
ATOM 1658  C CE2  . TRP A 1 110 ? 5.551   4.047   3.440   1.00 0.00 ? 110 TRP A CE2  1  
ATOM 1659  C CE3  . TRP A 1 110 ? 5.433   3.717   1.036   1.00 0.00 ? 110 TRP A CE3  1  
ATOM 1660  C CZ2  . TRP A 1 110 ? 5.260   2.708   3.727   1.00 0.00 ? 110 TRP A CZ2  1  
ATOM 1661  C CZ3  . TRP A 1 110 ? 5.143   2.381   1.340   1.00 0.00 ? 110 TRP A CZ3  1  
ATOM 1662  C CH2  . TRP A 1 110 ? 5.053   1.866   2.628   1.00 0.00 ? 110 TRP A CH2  1  
ATOM 1663  H H    . TRP A 1 110 ? 7.924   8.498   2.218   1.00 0.00 ? 110 TRP A H    1  
ATOM 1664  H HA   . TRP A 1 110 ? 8.030   6.163   0.445   1.00 0.00 ? 110 TRP A HA   1  
ATOM 1665  H HB2  . TRP A 1 110 ? 5.683   7.866   1.303   1.00 0.00 ? 110 TRP A HB2  1  
ATOM 1666  H HB3  . TRP A 1 110 ? 5.605   6.514   0.191   1.00 0.00 ? 110 TRP A HB3  1  
ATOM 1667  H HD1  . TRP A 1 110 ? 6.260   7.210   3.949   1.00 0.00 ? 110 TRP A HD1  1  
ATOM 1668  H HE1  . TRP A 1 110 ? 5.810   5.052   5.399   1.00 0.00 ? 110 TRP A HE1  1  
ATOM 1669  H HE3  . TRP A 1 110 ? 5.495   4.084   0.012   1.00 0.00 ? 110 TRP A HE3  1  
ATOM 1670  H HZ2  . TRP A 1 110 ? 5.198   2.341   4.752   1.00 0.00 ? 110 TRP A HZ2  1  
ATOM 1671  H HZ3  . TRP A 1 110 ? 4.976   1.697   0.508   1.00 0.00 ? 110 TRP A HZ3  1  
ATOM 1672  H HH2  . TRP A 1 110 ? 4.823   0.812   2.781   1.00 0.00 ? 110 TRP A HH2  1  
ATOM 1673  N N    . GLY A 1 111 ? 8.273   7.507   -1.614  1.00 0.00 ? 111 GLY A N    1  
ATOM 1674  C CA   . GLY A 1 111 ? 8.483   8.274   -2.830  1.00 0.00 ? 111 GLY A CA   1  
ATOM 1675  C C    . GLY A 1 111 ? 7.224   8.280   -3.699  1.00 0.00 ? 111 GLY A C    1  
ATOM 1676  O O    . GLY A 1 111 ? 6.114   8.132   -3.190  1.00 0.00 ? 111 GLY A O    1  
ATOM 1677  H H    . GLY A 1 111 ? 8.540   6.545   -1.670  1.00 0.00 ? 111 GLY A H    1  
ATOM 1678  H HA2  . GLY A 1 111 ? 8.758   9.298   -2.576  1.00 0.00 ? 111 GLY A HA2  1  
ATOM 1679  H HA3  . GLY A 1 111 ? 9.315   7.851   -3.392  1.00 0.00 ? 111 GLY A HA3  1  
ATOM 1680  N N    . GLU A 1 112 ? 7.438   8.451   -4.995  1.00 0.00 ? 112 GLU A N    1  
ATOM 1681  C CA   . GLU A 1 112 ? 6.334   8.478   -5.939  1.00 0.00 ? 112 GLU A CA   1  
ATOM 1682  C C    . GLU A 1 112 ? 5.405   7.286   -5.703  1.00 0.00 ? 112 GLU A C    1  
ATOM 1683  O O    . GLU A 1 112 ? 5.795   6.305   -5.071  1.00 0.00 ? 112 GLU A O    1  
ATOM 1684  C CB   . GLU A 1 112 ? 6.846   8.497   -7.381  1.00 0.00 ? 112 GLU A CB   1  
ATOM 1685  C CG   . GLU A 1 112 ? 6.565   9.846   -8.045  1.00 0.00 ? 112 GLU A CG   1  
ATOM 1686  C CD   . GLU A 1 112 ? 7.865   10.610  -8.308  1.00 0.00 ? 112 GLU A CD   1  
ATOM 1687  O OE1  . GLU A 1 112 ? 8.756   10.532  -7.434  1.00 0.00 ? 112 GLU A OE1  1  
ATOM 1688  O OE2  . GLU A 1 112 ? 7.939   11.253  -9.377  1.00 0.00 ? 112 GLU A OE2  1  
ATOM 1689  H H    . GLU A 1 112 ? 8.345   8.571   -5.401  1.00 0.00 ? 112 GLU A H    1  
ATOM 1690  H HA   . GLU A 1 112 ? 5.803   9.408   -5.737  1.00 0.00 ? 112 GLU A HA   1  
ATOM 1691  H HB2  . GLU A 1 112 ? 7.918   8.298   -7.393  1.00 0.00 ? 112 GLU A HB2  1  
ATOM 1692  H HB3  . GLU A 1 112 ? 6.368   7.700   -7.951  1.00 0.00 ? 112 GLU A HB3  1  
ATOM 1693  H HG2  . GLU A 1 112 ? 6.035   9.690   -8.985  1.00 0.00 ? 112 GLU A HG2  1  
ATOM 1694  H HG3  . GLU A 1 112 ? 5.913   10.441  -7.406  1.00 0.00 ? 112 GLU A HG3  1  
ATOM 1695  N N    . ALA A 1 113 ? 4.193   7.409   -6.224  1.00 0.00 ? 113 ALA A N    1  
ATOM 1696  C CA   . ALA A 1 113 ? 3.205   6.354   -6.078  1.00 0.00 ? 113 ALA A CA   1  
ATOM 1697  C C    . ALA A 1 113 ? 2.503   6.129   -7.418  1.00 0.00 ? 113 ALA A C    1  
ATOM 1698  O O    . ALA A 1 113 ? 2.120   7.085   -8.090  1.00 0.00 ? 113 ALA A O    1  
ATOM 1699  C CB   . ALA A 1 113 ? 2.226   6.722   -4.961  1.00 0.00 ? 113 ALA A CB   1  
ATOM 1700  H H    . ALA A 1 113 ? 3.883   8.210   -6.737  1.00 0.00 ? 113 ALA A H    1  
ATOM 1701  H HA   . ALA A 1 113 ? 3.732   5.442   -5.795  1.00 0.00 ? 113 ALA A HA   1  
ATOM 1702  H HB1  . ALA A 1 113 ? 1.701   5.827   -4.627  1.00 0.00 ? 113 ALA A HB1  1  
ATOM 1703  H HB2  . ALA A 1 113 ? 2.774   7.155   -4.125  1.00 0.00 ? 113 ALA A HB2  1  
ATOM 1704  H HB3  . ALA A 1 113 ? 1.503   7.447   -5.336  1.00 0.00 ? 113 ALA A HB3  1  
ATOM 1705  N N    . ALA A 1 114 ? 2.356   4.859   -7.767  1.00 0.00 ? 114 ALA A N    1  
ATOM 1706  C CA   . ALA A 1 114 ? 1.707   4.497   -9.016  1.00 0.00 ? 114 ALA A CA   1  
ATOM 1707  C C    . ALA A 1 114 ? 0.215   4.270   -8.762  1.00 0.00 ? 114 ALA A C    1  
ATOM 1708  O O    . ALA A 1 114 ? -0.159  3.415   -7.961  1.00 0.00 ? 114 ALA A O    1  
ATOM 1709  C CB   . ALA A 1 114 ? 2.392   3.264   -9.608  1.00 0.00 ? 114 ALA A CB   1  
ATOM 1710  H H    . ALA A 1 114 ? 2.670   4.087   -7.215  1.00 0.00 ? 114 ALA A H    1  
ATOM 1711  H HA   . ALA A 1 114 ? 1.826   5.331   -9.707  1.00 0.00 ? 114 ALA A HA   1  
ATOM 1712  H HB1  . ALA A 1 114 ? 1.850   2.939   -10.497 1.00 0.00 ? 114 ALA A HB1  1  
ATOM 1713  H HB2  . ALA A 1 114 ? 3.418   3.513   -9.879  1.00 0.00 ? 114 ALA A HB2  1  
ATOM 1714  H HB3  . ALA A 1 114 ? 2.395   2.461   -8.871  1.00 0.00 ? 114 ALA A HB3  1  
ATOM 1715  N N    . GLU A 1 115 ? -0.597  5.050   -9.461  1.00 0.00 ? 115 GLU A N    1  
ATOM 1716  C CA   . GLU A 1 115 ? -2.039  4.944   -9.322  1.00 0.00 ? 115 GLU A CA   1  
ATOM 1717  C C    . GLU A 1 115 ? -2.624  4.119   -10.470 1.00 0.00 ? 115 GLU A C    1  
ATOM 1718  O O    . GLU A 1 115 ? -2.397  4.427   -11.639 1.00 0.00 ? 115 GLU A O    1  
ATOM 1719  C CB   . GLU A 1 115 ? -2.687  6.329   -9.257  1.00 0.00 ? 115 GLU A CB   1  
ATOM 1720  C CG   . GLU A 1 115 ? -2.926  6.755   -7.807  1.00 0.00 ? 115 GLU A CG   1  
ATOM 1721  C CD   . GLU A 1 115 ? -4.023  7.819   -7.722  1.00 0.00 ? 115 GLU A CD   1  
ATOM 1722  O OE1  . GLU A 1 115 ? -4.855  7.851   -8.654  1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1723  O OE2  . GLU A 1 115 ? -4.004  8.575   -6.727  1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1724  H H    . GLU A 1 115 ? -0.284  5.743   -10.111 1.00 0.00 ? 115 GLU A H    1  
ATOM 1725  H HA   . GLU A 1 115 ? -2.202  4.429   -8.375  1.00 0.00 ? 115 GLU A HA   1  
ATOM 1726  H HB2  . GLU A 1 115 ? -2.045  7.058   -9.753  1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1727  H HB3  . GLU A 1 115 ? -3.633  6.318   -9.798  1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1728  H HG2  . GLU A 1 115 ? -3.209  5.887   -7.211  1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1729  H HG3  . GLU A 1 115 ? -2.002  7.146   -7.382  1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1730  N N    . ALA A 1 116 ? -3.367  3.087   -10.096 1.00 0.00 ? 116 ALA A N    1  
ATOM 1731  C CA   . ALA A 1 116 ? -3.986  2.215   -11.080 1.00 0.00 ? 116 ALA A CA   1  
ATOM 1732  C C    . ALA A 1 116 ? -5.429  1.927   -10.663 1.00 0.00 ? 116 ALA A C    1  
ATOM 1733  O O    . ALA A 1 116 ? -5.681  1.501   -9.537  1.00 0.00 ? 116 ALA A O    1  
ATOM 1734  C CB   . ALA A 1 116 ? -3.155  0.939   -11.226 1.00 0.00 ? 116 ALA A CB   1  
ATOM 1735  H H    . ALA A 1 116 ? -3.547  2.844   -9.143  1.00 0.00 ? 116 ALA A H    1  
ATOM 1736  H HA   . ALA A 1 116 ? -3.990  2.742   -12.034 1.00 0.00 ? 116 ALA A HA   1  
ATOM 1737  H HB1  . ALA A 1 116 ? -3.616  0.138   -10.648 1.00 0.00 ? 116 ALA A HB1  1  
ATOM 1738  H HB2  . ALA A 1 116 ? -3.113  0.651   -12.276 1.00 0.00 ? 116 ALA A HB2  1  
ATOM 1739  H HB3  . ALA A 1 116 ? -2.145  1.118   -10.857 1.00 0.00 ? 116 ALA A HB3  1  
ATOM 1740  N N    . LEU A 1 117 ? -6.341  2.172   -11.593 1.00 0.00 ? 117 LEU A N    1  
ATOM 1741  C CA   . LEU A 1 117 ? -7.752  1.944   -11.336 1.00 0.00 ? 117 LEU A CA   1  
ATOM 1742  C C    . LEU A 1 117 ? -8.128  0.532   -11.791 1.00 0.00 ? 117 LEU A C    1  
ATOM 1743  O O    . LEU A 1 117 ? -7.528  -0.003  -12.722 1.00 0.00 ? 117 LEU A O    1  
ATOM 1744  C CB   . LEU A 1 117 ? -8.599  3.044   -11.981 1.00 0.00 ? 117 LEU A CB   1  
ATOM 1745  C CG   . LEU A 1 117 ? -8.583  4.402   -11.276 1.00 0.00 ? 117 LEU A CG   1  
ATOM 1746  C CD1  . LEU A 1 117 ? -8.353  5.536   -12.276 1.00 0.00 ? 117 LEU A CD1  1  
ATOM 1747  C CD2  . LEU A 1 117 ? -9.860  4.609   -10.458 1.00 0.00 ? 117 LEU A CD2  1  
ATOM 1748  H H    . LEU A 1 117 ? -6.128  2.518   -12.506 1.00 0.00 ? 117 LEU A H    1  
ATOM 1749  H HA   . LEU A 1 117 ? -7.903  2.011   -10.259 1.00 0.00 ? 117 LEU A HA   1  
ATOM 1750  H HB2  . LEU A 1 117 ? -8.256  3.185   -13.006 1.00 0.00 ? 117 LEU A HB2  1  
ATOM 1751  H HB3  . LEU A 1 117 ? -9.630  2.696   -12.034 1.00 0.00 ? 117 LEU A HB3  1  
ATOM 1752  H HG   . LEU A 1 117 ? -7.747  4.414   -10.577 1.00 0.00 ? 117 LEU A HG   1  
ATOM 1753  H HD11 . LEU A 1 117 ? -7.333  5.484   -12.656 1.00 0.00 ? 117 LEU A HD11 1  
ATOM 1754  H HD12 . LEU A 1 117 ? -9.055  5.438   -13.105 1.00 0.00 ? 117 LEU A HD12 1  
ATOM 1755  H HD13 . LEU A 1 117 ? -8.508  6.494   -11.781 1.00 0.00 ? 117 LEU A HD13 1  
ATOM 1756  H HD21 . LEU A 1 117 ? -10.003 3.762   -9.787  1.00 0.00 ? 117 LEU A HD21 1  
ATOM 1757  H HD22 . LEU A 1 117 ? -9.772  5.525   -9.873  1.00 0.00 ? 117 LEU A HD22 1  
ATOM 1758  H HD23 . LEU A 1 117 ? -10.714 4.688   -11.130 1.00 0.00 ? 117 LEU A HD23 1  
ATOM 1759  N N    . VAL A 1 118 ? -9.118  -0.030  -11.114 1.00 0.00 ? 118 VAL A N    1  
ATOM 1760  C CA   . VAL A 1 118 ? -9.581  -1.369  -11.437 1.00 0.00 ? 118 VAL A CA   1  
ATOM 1761  C C    . VAL A 1 118 ? -11.053 -1.504  -11.042 1.00 0.00 ? 118 VAL A C    1  
ATOM 1762  O O    . VAL A 1 118 ? -11.433 -1.161  -9.924  1.00 0.00 ? 118 VAL A O    1  
ATOM 1763  C CB   . VAL A 1 118 ? -8.683  -2.409  -10.764 1.00 0.00 ? 118 VAL A CB   1  
ATOM 1764  C CG1  . VAL A 1 118 ? -8.588  -2.159  -9.258  1.00 0.00 ? 118 VAL A CG1  1  
ATOM 1765  C CG2  . VAL A 1 118 ? -9.176  -3.828  -11.055 1.00 0.00 ? 118 VAL A CG2  1  
ATOM 1766  H H    . VAL A 1 118 ? -9.600  0.413   -10.358 1.00 0.00 ? 118 VAL A H    1  
ATOM 1767  H HA   . VAL A 1 118 ? -9.494  -1.495  -12.516 1.00 0.00 ? 118 VAL A HA   1  
ATOM 1768  H HB   . VAL A 1 118 ? -7.682  -2.310  -11.184 1.00 0.00 ? 118 VAL A HB   1  
ATOM 1769  H HG11 . VAL A 1 118 ? -9.244  -1.332  -8.985  1.00 0.00 ? 118 VAL A HG11 1  
ATOM 1770  H HG12 . VAL A 1 118 ? -8.893  -3.057  -8.721  1.00 0.00 ? 118 VAL A HG12 1  
ATOM 1771  H HG13 . VAL A 1 118 ? -7.560  -1.910  -8.995  1.00 0.00 ? 118 VAL A HG13 1  
ATOM 1772  H HG21 . VAL A 1 118 ? -10.261 -3.862  -10.963 1.00 0.00 ? 118 VAL A HG21 1  
ATOM 1773  H HG22 . VAL A 1 118 ? -8.888  -4.112  -12.067 1.00 0.00 ? 118 VAL A HG22 1  
ATOM 1774  H HG23 . VAL A 1 118 ? -8.728  -4.521  -10.342 1.00 0.00 ? 118 VAL A HG23 1  
ATOM 1775  N N    . VAL A 1 119 ? -11.840 -2.006  -11.982 1.00 0.00 ? 119 VAL A N    1  
ATOM 1776  C CA   . VAL A 1 119 ? -13.262 -2.191  -11.747 1.00 0.00 ? 119 VAL A CA   1  
ATOM 1777  C C    . VAL A 1 119 ? -13.501 -3.586  -11.165 1.00 0.00 ? 119 VAL A C    1  
ATOM 1778  O O    . VAL A 1 119 ? -12.708 -4.499  -11.388 1.00 0.00 ? 119 VAL A O    1  
ATOM 1779  C CB   . VAL A 1 119 ? -14.044 -1.939  -13.038 1.00 0.00 ? 119 VAL A CB   1  
ATOM 1780  C CG1  . VAL A 1 119 ? -15.392 -2.663  -13.012 1.00 0.00 ? 119 VAL A CG1  1  
ATOM 1781  C CG2  . VAL A 1 119 ? -14.230 -0.441  -13.283 1.00 0.00 ? 119 VAL A CG2  1  
ATOM 1782  H H    . VAL A 1 119 ? -11.523 -2.282  -12.889 1.00 0.00 ? 119 VAL A H    1  
ATOM 1783  H HA   . VAL A 1 119 ? -13.574 -1.447  -11.013 1.00 0.00 ? 119 VAL A HA   1  
ATOM 1784  H HB   . VAL A 1 119 ? -13.462 -2.344  -13.866 1.00 0.00 ? 119 VAL A HB   1  
ATOM 1785  H HG11 . VAL A 1 119 ? -15.225 -3.740  -12.984 1.00 0.00 ? 119 VAL A HG11 1  
ATOM 1786  H HG12 . VAL A 1 119 ? -15.951 -2.358  -12.128 1.00 0.00 ? 119 VAL A HG12 1  
ATOM 1787  H HG13 . VAL A 1 119 ? -15.959 -2.406  -13.907 1.00 0.00 ? 119 VAL A HG13 1  
ATOM 1788  H HG21 . VAL A 1 119 ? -13.900 0.115   -12.405 1.00 0.00 ? 119 VAL A HG21 1  
ATOM 1789  H HG22 . VAL A 1 119 ? -13.640 -0.138  -14.148 1.00 0.00 ? 119 VAL A HG22 1  
ATOM 1790  H HG23 . VAL A 1 119 ? -15.283 -0.231  -13.470 1.00 0.00 ? 119 VAL A HG23 1  
ATOM 1791  N N    . THR A 1 120 ? -14.597 -3.707  -10.431 1.00 0.00 ? 120 THR A N    1  
ATOM 1792  C CA   . THR A 1 120 ? -14.950 -4.975  -9.817  1.00 0.00 ? 120 THR A CA   1  
ATOM 1793  C C    . THR A 1 120 ? -16.146 -5.602  -10.536 1.00 0.00 ? 120 THR A C    1  
ATOM 1794  O O    . THR A 1 120 ? -17.252 -5.064  -10.495 1.00 0.00 ? 120 THR A O    1  
ATOM 1795  C CB   . THR A 1 120 ? -15.200 -4.725  -8.328  1.00 0.00 ? 120 THR A CB   1  
ATOM 1796  O OG1  . THR A 1 120 ? -15.972 -3.528  -8.301  1.00 0.00 ? 120 THR A OG1  1  
ATOM 1797  C CG2  . THR A 1 120 ? -13.920 -4.360  -7.573  1.00 0.00 ? 120 THR A CG2  1  
ATOM 1798  H H    . THR A 1 120 ? -15.237 -2.959  -10.255 1.00 0.00 ? 120 THR A H    1  
ATOM 1799  H HA   . THR A 1 120 ? -14.111 -5.660  -9.935  1.00 0.00 ? 120 THR A HA   1  
ATOM 1800  H HB   . THR A 1 120 ? -15.693 -5.581  -7.867  1.00 0.00 ? 120 THR A HB   1  
ATOM 1801  H HG1  . THR A 1 120 ? -16.874 -3.695  -8.700  1.00 0.00 ? 120 THR A HG1  1  
ATOM 1802  H HG21 . THR A 1 120 ? -13.057 -4.759  -8.106  1.00 0.00 ? 120 THR A HG21 1  
ATOM 1803  H HG22 . THR A 1 120 ? -13.836 -3.275  -7.505  1.00 0.00 ? 120 THR A HG22 1  
ATOM 1804  H HG23 . THR A 1 120 ? -13.956 -4.785  -6.570  1.00 0.00 ? 120 THR A HG23 1  
ATOM 1805  N N    . THR A 1 121 ? -15.884 -6.731  -11.179 1.00 0.00 ? 121 THR A N    1  
ATOM 1806  C CA   . THR A 1 121 ? -16.925 -7.437  -11.906 1.00 0.00 ? 121 THR A CA   1  
ATOM 1807  C C    . THR A 1 121 ? -16.376 -8.738  -12.493 1.00 0.00 ? 121 THR A C    1  
ATOM 1808  O O    . THR A 1 121 ? -15.169 -8.974  -12.470 1.00 0.00 ? 121 THR A O    1  
ATOM 1809  C CB   . THR A 1 121 ? -17.492 -6.485  -12.962 1.00 0.00 ? 121 THR A CB   1  
ATOM 1810  O OG1  . THR A 1 121 ? -18.386 -7.298  -13.717 1.00 0.00 ? 121 THR A OG1  1  
ATOM 1811  C CG2  . THR A 1 121 ? -16.438 -6.045  -13.980 1.00 0.00 ? 121 THR A CG2  1  
ATOM 1812  H H    . THR A 1 121 ? -14.982 -7.162  -11.207 1.00 0.00 ? 121 THR A H    1  
ATOM 1813  H HA   . THR A 1 121 ? -17.711 -7.710  -11.202 1.00 0.00 ? 121 THR A HA   1  
ATOM 1814  H HB   . THR A 1 121 ? -17.966 -5.623  -12.494 1.00 0.00 ? 121 THR A HB   1  
ATOM 1815  H HG1  . THR A 1 121 ? -18.855 -6.744  -14.405 1.00 0.00 ? 121 THR A HG1  1  
ATOM 1816  H HG21 . THR A 1 121 ? -16.632 -5.015  -14.280 1.00 0.00 ? 121 THR A HG21 1  
ATOM 1817  H HG22 . THR A 1 121 ? -15.448 -6.112  -13.529 1.00 0.00 ? 121 THR A HG22 1  
ATOM 1818  H HG23 . THR A 1 121 ? -16.485 -6.693  -14.854 1.00 0.00 ? 121 THR A HG23 1  
ATOM 1819  N N    . GLU A 1 122 ? -17.289 -9.550  -13.006 1.00 0.00 ? 122 GLU A N    1  
ATOM 1820  C CA   . GLU A 1 122 ? -16.912 -10.822 -13.598 1.00 0.00 ? 122 GLU A CA   1  
ATOM 1821  C C    . GLU A 1 122 ? -16.676 -10.659 -15.101 1.00 0.00 ? 122 GLU A C    1  
ATOM 1822  O O    . GLU A 1 122 ? -15.884 -11.392 -15.692 1.00 0.00 ? 122 GLU A O    1  
ATOM 1823  C CB   . GLU A 1 122 ? -17.971 -11.891 -13.323 1.00 0.00 ? 122 GLU A CB   1  
ATOM 1824  C CG   . GLU A 1 122 ? -18.194 -12.067 -11.820 1.00 0.00 ? 122 GLU A CG   1  
ATOM 1825  C CD   . GLU A 1 122 ? -19.572 -12.670 -11.537 1.00 0.00 ? 122 GLU A CD   1  
ATOM 1826  O OE1  . GLU A 1 122 ? -19.997 -13.520 -12.349 1.00 0.00 ? 122 GLU A OE1  1  
ATOM 1827  O OE2  . GLU A 1 122 ? -20.169 -12.267 -10.515 1.00 0.00 ? 122 GLU A OE2  1  
ATOM 1828  H H    . GLU A 1 122 ? -18.269 -9.351  -13.021 1.00 0.00 ? 122 GLU A H    1  
ATOM 1829  H HA   . GLU A 1 122 ? -15.982 -11.106 -13.106 1.00 0.00 ? 122 GLU A HA   1  
ATOM 1830  H HB2  . GLU A 1 122 ? -18.909 -11.611 -13.803 1.00 0.00 ? 122 GLU A HB2  1  
ATOM 1831  H HB3  . GLU A 1 122 ? -17.659 -12.839 -13.762 1.00 0.00 ? 122 GLU A HB3  1  
ATOM 1832  H HG2  . GLU A 1 122 ? -17.419 -12.713 -11.407 1.00 0.00 ? 122 GLU A HG2  1  
ATOM 1833  H HG3  . GLU A 1 122 ? -18.106 -11.103 -11.320 1.00 0.00 ? 122 GLU A HG3  1  
ATOM 1834  N N    . LYS A 1 123 ? -17.376 -9.692  -15.676 1.00 0.00 ? 123 LYS A N    1  
ATOM 1835  C CA   . LYS A 1 123 ? -17.253 -9.423  -17.099 1.00 0.00 ? 123 LYS A CA   1  
ATOM 1836  C C    . LYS A 1 123 ? -15.946 -8.672  -17.360 1.00 0.00 ? 123 LYS A C    1  
ATOM 1837  O O    . LYS A 1 123 ? -15.764 -7.552  -16.885 1.00 0.00 ? 123 LYS A O    1  
ATOM 1838  C CB   . LYS A 1 123 ? -18.495 -8.695  -17.616 1.00 0.00 ? 123 LYS A CB   1  
ATOM 1839  C CG   . LYS A 1 123 ? -19.708 -9.627  -17.639 1.00 0.00 ? 123 LYS A CG   1  
ATOM 1840  C CD   . LYS A 1 123 ? -20.731 -9.221  -16.576 1.00 0.00 ? 123 LYS A CD   1  
ATOM 1841  C CE   . LYS A 1 123 ? -22.076 -8.872  -17.215 1.00 0.00 ? 123 LYS A CE   1  
ATOM 1842  N NZ   . LYS A 1 123 ? -22.729 -10.089 -17.747 1.00 0.00 ? 123 LYS A NZ   1  
ATOM 1843  H H    . LYS A 1 123 ? -18.018 -9.100  -15.188 1.00 0.00 ? 123 LYS A H    1  
ATOM 1844  H HA   . LYS A 1 123 ? -17.207 -10.385 -17.610 1.00 0.00 ? 123 LYS A HA   1  
ATOM 1845  H HB2  . LYS A 1 123 ? -18.706 -7.833  -16.983 1.00 0.00 ? 123 LYS A HB2  1  
ATOM 1846  H HB3  . LYS A 1 123 ? -18.306 -8.314  -18.620 1.00 0.00 ? 123 LYS A HB3  1  
ATOM 1847  H HG2  . LYS A 1 123 ? -20.172 -9.601  -18.624 1.00 0.00 ? 123 LYS A HG2  1  
ATOM 1848  H HG3  . LYS A 1 123 ? -19.385 -10.653 -17.465 1.00 0.00 ? 123 LYS A HG3  1  
ATOM 1849  H HD2  . LYS A 1 123 ? -20.863 -10.035 -15.863 1.00 0.00 ? 123 LYS A HD2  1  
ATOM 1850  H HD3  . LYS A 1 123 ? -20.357 -8.364  -16.015 1.00 0.00 ? 123 LYS A HD3  1  
ATOM 1851  H HE2  . LYS A 1 123 ? -22.724 -8.397  -16.477 1.00 0.00 ? 123 LYS A HE2  1  
ATOM 1852  H HE3  . LYS A 1 123 ? -21.927 -8.151  -18.019 1.00 0.00 ? 123 LYS A HE3  1  
ATOM 1853  H HZ1  . LYS A 1 123 ? -22.836 -10.004 -18.738 1.00 0.00 ? 123 LYS A HZ1  1  
ATOM 1854  H HZ2  . LYS A 1 123 ? -22.164 -10.887 -17.540 1.00 0.00 ? 123 LYS A HZ2  1  
ATOM 1855  H HZ3  . LYS A 1 123 ? -23.628 -10.198 -17.323 1.00 0.00 ? 123 LYS A HZ3  1  
ATOM 1856  N N    . ARG A 1 124 ? -15.069 -9.319  -18.114 1.00 0.00 ? 124 ARG A N    1  
ATOM 1857  C CA   . ARG A 1 124 ? -13.784 -8.726  -18.443 1.00 0.00 ? 124 ARG A CA   1  
ATOM 1858  C C    . ARG A 1 124 ? -13.972 -7.553  -19.408 1.00 0.00 ? 124 ARG A C    1  
ATOM 1859  O O    . ARG A 1 124 ? -14.714 -7.661  -20.383 1.00 0.00 ? 124 ARG A O    1  
ATOM 1860  C CB   . ARG A 1 124 ? -12.849 -9.756  -19.080 1.00 0.00 ? 124 ARG A CB   1  
ATOM 1861  C CG   . ARG A 1 124 ? -11.660 -10.056 -18.165 1.00 0.00 ? 124 ARG A CG   1  
ATOM 1862  C CD   . ARG A 1 124 ? -11.943 -11.270 -17.278 1.00 0.00 ? 124 ARG A CD   1  
ATOM 1863  N NE   . ARG A 1 124 ? -10.705 -12.060 -17.092 1.00 0.00 ? 124 ARG A NE   1  
ATOM 1864  C CZ   . ARG A 1 124 ? -10.087 -12.732 -18.073 1.00 0.00 ? 124 ARG A CZ   1  
ATOM 1865  N NH1  . ARG A 1 124 ? -10.588 -12.714 -19.315 1.00 0.00 ? 124 ARG A NH1  1  
ATOM 1866  N NH2  . ARG A 1 124 ? -8.968  -13.421 -17.812 1.00 0.00 ? 124 ARG A NH2  1  
ATOM 1867  H H    . ARG A 1 124 ? -15.225 -10.230 -18.496 1.00 0.00 ? 124 ARG A H    1  
ATOM 1868  H HA   . ARG A 1 124 ? -13.380 -8.388  -17.489 1.00 0.00 ? 124 ARG A HA   1  
ATOM 1869  H HB2  . ARG A 1 124 ? -13.399 -10.676 -19.281 1.00 0.00 ? 124 ARG A HB2  1  
ATOM 1870  H HB3  . ARG A 1 124 ? -12.490 -9.383  -20.039 1.00 0.00 ? 124 ARG A HB3  1  
ATOM 1871  H HG2  . ARG A 1 124 ? -10.770 -10.241 -18.768 1.00 0.00 ? 124 ARG A HG2  1  
ATOM 1872  H HG3  . ARG A 1 124 ? -11.448 -9.187  -17.542 1.00 0.00 ? 124 ARG A HG3  1  
ATOM 1873  H HD2  . ARG A 1 124 ? -12.324 -10.943 -16.311 1.00 0.00 ? 124 ARG A HD2  1  
ATOM 1874  H HD3  . ARG A 1 124 ? -12.715 -11.891 -17.733 1.00 0.00 ? 124 ARG A HD3  1  
ATOM 1875  H HE   . ARG A 1 124 ? -10.304 -12.094 -16.176 1.00 0.00 ? 124 ARG A HE   1  
ATOM 1876  H HH11 . ARG A 1 124 ? -11.423 -12.199 -19.511 1.00 0.00 ? 124 ARG A HH11 1  
ATOM 1877  H HH12 . ARG A 1 124 ? -10.127 -13.215 -20.048 1.00 0.00 ? 124 ARG A HH12 1  
ATOM 1878  H HH21 . ARG A 1 124 ? -8.594  -13.435 -16.884 1.00 0.00 ? 124 ARG A HH21 1  
ATOM 1879  H HH22 . ARG A 1 124 ? -8.507  -13.923 -18.544 1.00 0.00 ? 124 ARG A HH22 1  
ATOM 1880  N N    . SER A 1 125 ? -13.288 -6.461  -19.102 1.00 0.00 ? 125 SER A N    1  
ATOM 1881  C CA   . SER A 1 125 ? -13.371 -5.270  -19.930 1.00 0.00 ? 125 SER A CA   1  
ATOM 1882  C C    . SER A 1 125 ? -12.010 -4.573  -19.981 1.00 0.00 ? 125 SER A C    1  
ATOM 1883  O O    . SER A 1 125 ? -11.354 -4.408  -18.954 1.00 0.00 ? 125 SER A O    1  
ATOM 1884  C CB   . SER A 1 125 ? -14.440 -4.308  -19.407 1.00 0.00 ? 125 SER A CB   1  
ATOM 1885  O OG   . SER A 1 125 ? -15.304 -3.855  -20.445 1.00 0.00 ? 125 SER A OG   1  
ATOM 1886  H H    . SER A 1 125 ? -12.687 -6.382  -18.307 1.00 0.00 ? 125 SER A H    1  
ATOM 1887  H HA   . SER A 1 125 ? -13.656 -5.626  -20.920 1.00 0.00 ? 125 SER A HA   1  
ATOM 1888  H HB2  . SER A 1 125 ? -15.029 -4.806  -18.636 1.00 0.00 ? 125 SER A HB2  1  
ATOM 1889  H HB3  . SER A 1 125 ? -13.958 -3.452  -18.936 1.00 0.00 ? 125 SER A HB3  1  
ATOM 1890  H HG   . SER A 1 125 ? -16.166 -3.530  -20.055 1.00 0.00 ? 125 SER A HG   1  
ATOM 1891  N N    . GLY A 1 126 ? -11.626 -4.183  -21.188 1.00 0.00 ? 126 GLY A N    1  
ATOM 1892  C CA   . GLY A 1 126 ? -10.355 -3.507  -21.387 1.00 0.00 ? 126 GLY A CA   1  
ATOM 1893  C C    . GLY A 1 126 ? -10.304 -2.826  -22.756 1.00 0.00 ? 126 GLY A C    1  
ATOM 1894  O O    . GLY A 1 126 ? -10.122 -3.489  -23.776 1.00 0.00 ? 126 GLY A O    1  
ATOM 1895  H H    . GLY A 1 126 ? -12.165 -4.321  -22.018 1.00 0.00 ? 126 GLY A H    1  
ATOM 1896  H HA2  . GLY A 1 126 ? -10.206 -2.765  -20.602 1.00 0.00 ? 126 GLY A HA2  1  
ATOM 1897  H HA3  . GLY A 1 126 ? -9.540  -4.226  -21.304 1.00 0.00 ? 126 GLY A HA3  1  
ATOM 1898  N N    . PRO A 1 127 ? -10.473 -1.477  -22.734 1.00 0.00 ? 127 PRO A N    1  
ATOM 1899  C CA   . PRO A 1 127 ? -10.448 -0.699  -23.961 1.00 0.00 ? 127 PRO A CA   1  
ATOM 1900  C C    . PRO A 1 127 ? -9.018  -0.546  -24.484 1.00 0.00 ? 127 PRO A C    1  
ATOM 1901  O O    . PRO A 1 127 ? -8.786  -0.598  -25.691 1.00 0.00 ? 127 PRO A O    1  
ATOM 1902  C CB   . PRO A 1 127 ? -11.093 0.629   -23.598 1.00 0.00 ? 127 PRO A CB   1  
ATOM 1903  C CG   . PRO A 1 127 ? -11.032 0.721   -22.082 1.00 0.00 ? 127 PRO A CG   1  
ATOM 1904  C CD   . PRO A 1 127 ? -10.691 -0.659  -21.544 1.00 0.00 ? 127 PRO A CD   1  
ATOM 1905  H HA   . PRO A 1 127 ? -10.954 -1.172  -24.682 1.00 0.00 ? 127 PRO A HA   1  
ATOM 1906  H HB2  . PRO A 1 127 ? -10.562 1.460   -24.061 1.00 0.00 ? 127 PRO A HB2  1  
ATOM 1907  H HB3  . PRO A 1 127 ? -12.123 0.672   -23.951 1.00 0.00 ? 127 PRO A HB3  1  
ATOM 1908  H HG2  . PRO A 1 127 ? -10.280 1.447   -21.773 1.00 0.00 ? 127 PRO A HG2  1  
ATOM 1909  H HG3  . PRO A 1 127 ? -11.987 1.061   -21.681 1.00 0.00 ? 127 PRO A HG3  1  
ATOM 1910  H HD2  . PRO A 1 127 ? -9.801  -0.630  -20.915 1.00 0.00 ? 127 PRO A HD2  1  
ATOM 1911  H HD3  . PRO A 1 127 ? -11.501 -1.057  -20.933 1.00 0.00 ? 127 PRO A HD3  1  
ATOM 1912  N N    . SER A 1 128 ? -8.097  -0.361  -23.550 1.00 0.00 ? 128 SER A N    1  
ATOM 1913  C CA   . SER A 1 128 ? -6.696  -0.201  -23.902 1.00 0.00 ? 128 SER A CA   1  
ATOM 1914  C C    . SER A 1 128 ? -6.535  0.952   -24.895 1.00 0.00 ? 128 SER A C    1  
ATOM 1915  O O    . SER A 1 128 ? -6.888  0.822   -26.066 1.00 0.00 ? 128 SER A O    1  
ATOM 1916  C CB   . SER A 1 128 ? -6.125  -1.492  -24.491 1.00 0.00 ? 128 SER A CB   1  
ATOM 1917  O OG   . SER A 1 128 ? -5.320  -2.197  -23.551 1.00 0.00 ? 128 SER A OG   1  
ATOM 1918  H H    . SER A 1 128 ? -8.294  -0.321  -22.570 1.00 0.00 ? 128 SER A H    1  
ATOM 1919  H HA   . SER A 1 128 ? -6.188  0.027   -22.965 1.00 0.00 ? 128 SER A HA   1  
ATOM 1920  H HB2  . SER A 1 128 ? -6.943  -2.133  -24.821 1.00 0.00 ? 128 SER A HB2  1  
ATOM 1921  H HB3  . SER A 1 128 ? -5.530  -1.256  -25.373 1.00 0.00 ? 128 SER A HB3  1  
ATOM 1922  H HG   . SER A 1 128 ? -4.509  -1.658  -23.321 1.00 0.00 ? 128 SER A HG   1  
ATOM 1923  N N    . SER A 1 129 ? -6.001  2.055   -24.390 1.00 0.00 ? 129 SER A N    1  
ATOM 1924  C CA   . SER A 1 129 ? -5.789  3.230   -25.218 1.00 0.00 ? 129 SER A CA   1  
ATOM 1925  C C    . SER A 1 129 ? -5.168  4.353   -24.384 1.00 0.00 ? 129 SER A C    1  
ATOM 1926  O O    . SER A 1 129 ? -5.391  4.429   -23.176 1.00 0.00 ? 129 SER A O    1  
ATOM 1927  C CB   . SER A 1 129 ? -7.100  3.702   -25.851 1.00 0.00 ? 129 SER A CB   1  
ATOM 1928  O OG   . SER A 1 129 ? -7.286  3.164   -27.157 1.00 0.00 ? 129 SER A OG   1  
ATOM 1929  H H    . SER A 1 129 ? -5.717  2.153   -23.436 1.00 0.00 ? 129 SER A H    1  
ATOM 1930  H HA   . SER A 1 129 ? -5.102  2.911   -26.001 1.00 0.00 ? 129 SER A HA   1  
ATOM 1931  H HB2  . SER A 1 129 ? -7.936  3.409   -25.215 1.00 0.00 ? 129 SER A HB2  1  
ATOM 1932  H HB3  . SER A 1 129 ? -7.106  4.791   -25.903 1.00 0.00 ? 129 SER A HB3  1  
ATOM 1933  H HG   . SER A 1 129 ? -6.496  2.607   -27.413 1.00 0.00 ? 129 SER A HG   1  
ATOM 1934  N N    . GLY A 1 130 ? -4.402  5.196   -25.061 1.00 0.00 ? 130 GLY A N    1  
ATOM 1935  C CA   . GLY A 1 130 ? -3.748  6.310   -24.397 1.00 0.00 ? 130 GLY A CA   1  
ATOM 1936  C C    . GLY A 1 130 ? -2.266  6.013   -24.160 1.00 0.00 ? 130 GLY A C    1  
ATOM 1937  O O    . GLY A 1 130 ? -1.482  6.923   -23.891 1.00 0.00 ? 130 GLY A O    1  
ATOM 1938  H H    . GLY A 1 130 ? -4.227  5.126   -26.043 1.00 0.00 ? 130 GLY A H    1  
ATOM 1939  H HA2  . GLY A 1 130 ? -3.850  7.210   -25.004 1.00 0.00 ? 130 GLY A HA2  1  
ATOM 1940  H HA3  . GLY A 1 130 ? -4.240  6.511   -23.445 1.00 0.00 ? 130 GLY A HA3  1  
ATOM 1941  N N    . GLY A 1 1   ? 1.184   38.270  -16.006 1.00 0.00 ? 1   GLY A N    2  
ATOM 1942  C CA   . GLY A 1 1   ? 1.290   36.821  -16.054 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1943  C C    . GLY A 1 1   ? 0.011   36.161  -15.535 1.00 0.00 ? 1   GLY A C    2  
ATOM 1944  O O    . GLY A 1 1   ? -0.627  36.672  -14.616 1.00 0.00 ? 1   GLY A O    2  
ATOM 1945  H H1   . GLY A 1 1   ? 0.250   38.624  -15.974 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1946  H HA2  . GLY A 1 1   ? 1.479   36.501  -17.078 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1947  H HA3  . GLY A 1 1   ? 2.140   36.495  -15.456 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1948  N N    . SER A 1 2   ? -0.325  35.034  -16.146 1.00 0.00 ? 2   SER A N    2  
ATOM 1949  C CA   . SER A 1 2   ? -1.516  34.298  -15.758 1.00 0.00 ? 2   SER A CA   2  
ATOM 1950  C C    . SER A 1 2   ? -1.474  32.886  -16.345 1.00 0.00 ? 2   SER A C    2  
ATOM 1951  O O    . SER A 1 2   ? -0.703  32.616  -17.265 1.00 0.00 ? 2   SER A O    2  
ATOM 1952  C CB   . SER A 1 2   ? -2.784  35.024  -16.211 1.00 0.00 ? 2   SER A CB   2  
ATOM 1953  O OG   . SER A 1 2   ? -3.677  35.266  -15.127 1.00 0.00 ? 2   SER A OG   2  
ATOM 1954  H H    . SER A 1 2   ? 0.199   34.625  -16.893 1.00 0.00 ? 2   SER A H    2  
ATOM 1955  H HA   . SER A 1 2   ? -1.490  34.261  -14.669 1.00 0.00 ? 2   SER A HA   2  
ATOM 1956  H HB2  . SER A 1 2   ? -2.513  35.972  -16.676 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1957  H HB3  . SER A 1 2   ? -3.290  34.429  -16.972 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1958  H HG   . SER A 1 2   ? -3.352  36.039  -14.582 1.00 0.00 ? 2   SER A HG   2  
ATOM 1959  N N    . SER A 1 3   ? -2.312  32.023  -15.789 1.00 0.00 ? 3   SER A N    2  
ATOM 1960  C CA   . SER A 1 3   ? -2.379  30.646  -16.247 1.00 0.00 ? 3   SER A CA   2  
ATOM 1961  C C    . SER A 1 3   ? -3.468  29.893  -15.479 1.00 0.00 ? 3   SER A C    2  
ATOM 1962  O O    . SER A 1 3   ? -4.005  30.402  -14.496 1.00 0.00 ? 3   SER A O    2  
ATOM 1963  C CB   . SER A 1 3   ? -1.030  29.943  -16.081 1.00 0.00 ? 3   SER A CB   2  
ATOM 1964  O OG   . SER A 1 3   ? -0.850  28.902  -17.037 1.00 0.00 ? 3   SER A OG   2  
ATOM 1965  H H    . SER A 1 3   ? -2.935  32.251  -15.041 1.00 0.00 ? 3   SER A H    2  
ATOM 1966  H HA   . SER A 1 3   ? -2.630  30.706  -17.306 1.00 0.00 ? 3   SER A HA   2  
ATOM 1967  H HB2  . SER A 1 3   ? -0.227  30.673  -16.184 1.00 0.00 ? 3   SER A HB2  2  
ATOM 1968  H HB3  . SER A 1 3   ? -0.958  29.529  -15.076 1.00 0.00 ? 3   SER A HB3  2  
ATOM 1969  H HG   . SER A 1 3   ? -0.329  28.151  -16.631 1.00 0.00 ? 3   SER A HG   2  
ATOM 1970  N N    . GLY A 1 4   ? -3.761  28.692  -15.957 1.00 0.00 ? 4   GLY A N    2  
ATOM 1971  C CA   . GLY A 1 4   ? -4.775  27.864  -15.328 1.00 0.00 ? 4   GLY A CA   2  
ATOM 1972  C C    . GLY A 1 4   ? -4.863  26.495  -16.006 1.00 0.00 ? 4   GLY A C    2  
ATOM 1973  O O    . GLY A 1 4   ? -4.995  26.410  -17.226 1.00 0.00 ? 4   GLY A O    2  
ATOM 1974  H H    . GLY A 1 4   ? -3.319  28.285  -16.756 1.00 0.00 ? 4   GLY A H    2  
ATOM 1975  H HA2  . GLY A 1 4   ? -4.541  27.736  -14.271 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1976  H HA3  . GLY A 1 4   ? -5.742  28.363  -15.382 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1977  N N    . SER A 1 5   ? -4.787  25.457  -15.185 1.00 0.00 ? 5   SER A N    2  
ATOM 1978  C CA   . SER A 1 5   ? -4.857  24.097  -15.690 1.00 0.00 ? 5   SER A CA   2  
ATOM 1979  C C    . SER A 1 5   ? -4.974  23.112  -14.525 1.00 0.00 ? 5   SER A C    2  
ATOM 1980  O O    . SER A 1 5   ? -4.253  23.227  -13.535 1.00 0.00 ? 5   SER A O    2  
ATOM 1981  C CB   . SER A 1 5   ? -3.633  23.764  -16.546 1.00 0.00 ? 5   SER A CB   2  
ATOM 1982  O OG   . SER A 1 5   ? -2.414  24.085  -15.882 1.00 0.00 ? 5   SER A OG   2  
ATOM 1983  H H    . SER A 1 5   ? -4.681  25.535  -14.194 1.00 0.00 ? 5   SER A H    2  
ATOM 1984  H HA   . SER A 1 5   ? -5.753  24.065  -16.310 1.00 0.00 ? 5   SER A HA   2  
ATOM 1985  H HB2  . SER A 1 5   ? -3.643  22.703  -16.794 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1986  H HB3  . SER A 1 5   ? -3.689  24.312  -17.487 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1987  H HG   . SER A 1 5   ? -2.606  24.579  -15.034 1.00 0.00 ? 5   SER A HG   2  
ATOM 1988  N N    . SER A 1 6   ? -5.887  22.165  -14.683 1.00 0.00 ? 6   SER A N    2  
ATOM 1989  C CA   . SER A 1 6   ? -6.107  21.160  -13.656 1.00 0.00 ? 6   SER A CA   2  
ATOM 1990  C C    . SER A 1 6   ? -7.066  20.085  -14.173 1.00 0.00 ? 6   SER A C    2  
ATOM 1991  O O    . SER A 1 6   ? -7.980  20.381  -14.942 1.00 0.00 ? 6   SER A O    2  
ATOM 1992  C CB   . SER A 1 6   ? -6.659  21.791  -12.377 1.00 0.00 ? 6   SER A CB   2  
ATOM 1993  O OG   . SER A 1 6   ? -8.025  22.173  -12.515 1.00 0.00 ? 6   SER A OG   2  
ATOM 1994  H H    . SER A 1 6   ? -6.469  22.077  -15.491 1.00 0.00 ? 6   SER A H    2  
ATOM 1995  H HA   . SER A 1 6   ? -5.125  20.732  -13.456 1.00 0.00 ? 6   SER A HA   2  
ATOM 1996  H HB2  . SER A 1 6   ? -6.561  21.084  -11.552 1.00 0.00 ? 6   SER A HB2  2  
ATOM 1997  H HB3  . SER A 1 6   ? -6.062  22.666  -12.118 1.00 0.00 ? 6   SER A HB3  2  
ATOM 1998  H HG   . SER A 1 6   ? -8.087  23.146  -12.734 1.00 0.00 ? 6   SER A HG   2  
ATOM 1999  N N    . GLY A 1 7   ? -6.825  18.860  -13.731 1.00 0.00 ? 7   GLY A N    2  
ATOM 2000  C CA   . GLY A 1 7   ? -7.655  17.740  -14.139 1.00 0.00 ? 7   GLY A CA   2  
ATOM 2001  C C    . GLY A 1 7   ? -6.861  16.752  -14.996 1.00 0.00 ? 7   GLY A C    2  
ATOM 2002  O O    . GLY A 1 7   ? -5.901  16.146  -14.523 1.00 0.00 ? 7   GLY A O    2  
ATOM 2003  H H    . GLY A 1 7   ? -6.079  18.628  -13.106 1.00 0.00 ? 7   GLY A H    2  
ATOM 2004  H HA2  . GLY A 1 7   ? -8.044  17.230  -13.258 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 2005  H HA3  . GLY A 1 7   ? -8.514  18.105  -14.702 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 2006  N N    . ARG A 1 8   ? -7.290  16.621  -16.243 1.00 0.00 ? 8   ARG A N    2  
ATOM 2007  C CA   . ARG A 1 8   ? -6.631  15.717  -17.170 1.00 0.00 ? 8   ARG A CA   2  
ATOM 2008  C C    . ARG A 1 8   ? -6.692  14.281  -16.646 1.00 0.00 ? 8   ARG A C    2  
ATOM 2009  O O    . ARG A 1 8   ? -6.648  14.055  -15.438 1.00 0.00 ? 8   ARG A O    2  
ATOM 2010  C CB   . ARG A 1 8   ? -5.169  16.114  -17.381 1.00 0.00 ? 8   ARG A CB   2  
ATOM 2011  C CG   . ARG A 1 8   ? -4.889  16.416  -18.855 1.00 0.00 ? 8   ARG A CG   2  
ATOM 2012  C CD   . ARG A 1 8   ? -4.274  15.203  -19.555 1.00 0.00 ? 8   ARG A CD   2  
ATOM 2013  N NE   . ARG A 1 8   ? -4.844  15.060  -20.914 1.00 0.00 ? 8   ARG A NE   2  
ATOM 2014  C CZ   . ARG A 1 8   ? -4.477  14.113  -21.787 1.00 0.00 ? 8   ARG A CZ   2  
ATOM 2015  N NH1  . ARG A 1 8   ? -3.537  13.218  -21.450 1.00 0.00 ? 8   ARG A NH1  2  
ATOM 2016  N NH2  . ARG A 1 8   ? -5.048  14.060  -22.998 1.00 0.00 ? 8   ARG A NH2  2  
ATOM 2017  H H    . ARG A 1 8   ? -8.072  17.118  -16.620 1.00 0.00 ? 8   ARG A H    2  
ATOM 2018  H HA   . ARG A 1 8   ? -7.188  15.819  -18.102 1.00 0.00 ? 8   ARG A HA   2  
ATOM 2019  H HB2  . ARG A 1 8   ? -4.935  16.991  -16.776 1.00 0.00 ? 8   ARG A HB2  2  
ATOM 2020  H HB3  . ARG A 1 8   ? -4.517  15.310  -17.041 1.00 0.00 ? 8   ARG A HB3  2  
ATOM 2021  H HG2  . ARG A 1 8   ? -5.816  16.698  -19.354 1.00 0.00 ? 8   ARG A HG2  2  
ATOM 2022  H HG3  . ARG A 1 8   ? -4.212  17.267  -18.933 1.00 0.00 ? 8   ARG A HG3  2  
ATOM 2023  H HD2  . ARG A 1 8   ? -3.192  15.317  -19.616 1.00 0.00 ? 8   ARG A HD2  2  
ATOM 2024  H HD3  . ARG A 1 8   ? -4.467  14.301  -18.975 1.00 0.00 ? 8   ARG A HD3  2  
ATOM 2025  H HE   . ARG A 1 8   ? -5.548  15.712  -21.197 1.00 0.00 ? 8   ARG A HE   2  
ATOM 2026  H HH11 . ARG A 1 8   ? -3.111  13.258  -20.546 1.00 0.00 ? 8   ARG A HH11 2  
ATOM 2027  H HH12 . ARG A 1 8   ? -3.263  12.511  -22.101 1.00 0.00 ? 8   ARG A HH12 2  
ATOM 2028  H HH21 . ARG A 1 8   ? -5.749  14.727  -23.250 1.00 0.00 ? 8   ARG A HH21 2  
ATOM 2029  H HH22 . ARG A 1 8   ? -4.774  13.353  -23.650 1.00 0.00 ? 8   ARG A HH22 2  
ATOM 2030  N N    . ILE A 1 9   ? -6.793  13.348  -17.581 1.00 0.00 ? 9   ILE A N    2  
ATOM 2031  C CA   . ILE A 1 9   ? -6.861  11.940  -17.229 1.00 0.00 ? 9   ILE A CA   2  
ATOM 2032  C C    . ILE A 1 9   ? -5.535  11.513  -16.596 1.00 0.00 ? 9   ILE A C    2  
ATOM 2033  O O    . ILE A 1 9   ? -4.542  11.323  -17.296 1.00 0.00 ? 9   ILE A O    2  
ATOM 2034  C CB   . ILE A 1 9   ? -7.260  11.102  -18.445 1.00 0.00 ? 9   ILE A CB   2  
ATOM 2035  C CG1  . ILE A 1 9   ? -8.672  11.458  -18.917 1.00 0.00 ? 9   ILE A CG1  2  
ATOM 2036  C CG2  . ILE A 1 9   ? -7.114  9.607   -18.152 1.00 0.00 ? 9   ILE A CG2  2  
ATOM 2037  C CD1  . ILE A 1 9   ? -8.712  11.640  -20.435 1.00 0.00 ? 9   ILE A CD1  2  
ATOM 2038  H H    . ILE A 1 9   ? -6.829  13.540  -18.562 1.00 0.00 ? 9   ILE A H    2  
ATOM 2039  H HA   . ILE A 1 9   ? -7.651  11.827  -16.486 1.00 0.00 ? 9   ILE A HA   2  
ATOM 2040  H HB   . ILE A 1 9   ? -6.578  11.338  -19.261 1.00 0.00 ? 9   ILE A HB   2  
ATOM 2041  H HG12 . ILE A 1 9   ? -9.366  10.671  -18.623 1.00 0.00 ? 9   ILE A HG12 2  
ATOM 2042  H HG13 . ILE A 1 9   ? -9.002  12.374  -18.427 1.00 0.00 ? 9   ILE A HG13 2  
ATOM 2043  H HG21 . ILE A 1 9   ? -6.147  9.259   -18.516 1.00 0.00 ? 9   ILE A HG21 2  
ATOM 2044  H HG22 . ILE A 1 9   ? -7.180  9.439   -17.078 1.00 0.00 ? 9   ILE A HG22 2  
ATOM 2045  H HG23 . ILE A 1 9   ? -7.910  9.058   -18.655 1.00 0.00 ? 9   ILE A HG23 2  
ATOM 2046  H HD11 . ILE A 1 9   ? -9.628  12.161  -20.714 1.00 0.00 ? 9   ILE A HD11 2  
ATOM 2047  H HD12 . ILE A 1 9   ? -7.850  12.226  -20.754 1.00 0.00 ? 9   ILE A HD12 2  
ATOM 2048  H HD13 . ILE A 1 9   ? -8.687  10.664  -20.919 1.00 0.00 ? 9   ILE A HD13 2  
ATOM 2049  N N    . GLY A 1 10  ? -5.563  11.374  -15.278 1.00 0.00 ? 10  GLY A N    2  
ATOM 2050  C CA   . GLY A 1 10  ? -4.375  10.973  -14.543 1.00 0.00 ? 10  GLY A CA   2  
ATOM 2051  C C    . GLY A 1 10  ? -3.760  9.707   -15.144 1.00 0.00 ? 10  GLY A C    2  
ATOM 2052  O O    . GLY A 1 10  ? -4.333  8.624   -15.037 1.00 0.00 ? 10  GLY A O    2  
ATOM 2053  H H    . GLY A 1 10  ? -6.375  11.531  -14.716 1.00 0.00 ? 10  GLY A H    2  
ATOM 2054  H HA2  . GLY A 1 10  ? -3.643  11.780  -14.560 1.00 0.00 ? 10  GLY A HA2  2  
ATOM 2055  H HA3  . GLY A 1 10  ? -4.632  10.797  -13.499 1.00 0.00 ? 10  GLY A HA3  2  
ATOM 2056  N N    . ASP A 1 11  ? -2.602  9.886   -15.761 1.00 0.00 ? 11  ASP A N    2  
ATOM 2057  C CA   . ASP A 1 11  ? -1.903  8.772   -16.379 1.00 0.00 ? 11  ASP A CA   2  
ATOM 2058  C C    . ASP A 1 11  ? -0.496  9.218   -16.782 1.00 0.00 ? 11  ASP A C    2  
ATOM 2059  O O    . ASP A 1 11  ? -0.309  10.335  -17.262 1.00 0.00 ? 11  ASP A O    2  
ATOM 2060  C CB   . ASP A 1 11  ? -2.628  8.297   -17.640 1.00 0.00 ? 11  ASP A CB   2  
ATOM 2061  C CG   . ASP A 1 11  ? -2.916  6.796   -17.694 1.00 0.00 ? 11  ASP A CG   2  
ATOM 2062  O OD1  . ASP A 1 11  ? -3.614  6.318   -16.773 1.00 0.00 ? 11  ASP A OD1  2  
ATOM 2063  O OD2  . ASP A 1 11  ? -2.432  6.159   -18.654 1.00 0.00 ? 11  ASP A OD2  2  
ATOM 2064  H H    . ASP A 1 11  ? -2.142  10.771  -15.843 1.00 0.00 ? 11  ASP A H    2  
ATOM 2065  H HA   . ASP A 1 11  ? -1.891  7.987   -15.622 1.00 0.00 ? 11  ASP A HA   2  
ATOM 2066  H HB2  . ASP A 1 11  ? -3.572  8.836   -17.722 1.00 0.00 ? 11  ASP A HB2  2  
ATOM 2067  H HB3  . ASP A 1 11  ? -2.029  8.569   -18.509 1.00 0.00 ? 11  ASP A HB3  2  
ATOM 2068  N N    . GLY A 1 12  ? 0.457   8.322   -16.573 1.00 0.00 ? 12  GLY A N    2  
ATOM 2069  C CA   . GLY A 1 12  ? 1.841   8.610   -16.908 1.00 0.00 ? 12  GLY A CA   2  
ATOM 2070  C C    . GLY A 1 12  ? 2.702   7.348   -16.814 1.00 0.00 ? 12  GLY A C    2  
ATOM 2071  O O    . GLY A 1 12  ? 2.973   6.858   -15.719 1.00 0.00 ? 12  GLY A O    2  
ATOM 2072  H H    . GLY A 1 12  ? 0.297   7.416   -16.182 1.00 0.00 ? 12  GLY A H    2  
ATOM 2073  H HA2  . GLY A 1 12  ? 1.897   9.018   -17.918 1.00 0.00 ? 12  GLY A HA2  2  
ATOM 2074  H HA3  . GLY A 1 12  ? 2.232   9.372   -16.234 1.00 0.00 ? 12  GLY A HA3  2  
ATOM 2075  N N    . SER A 1 13  ? 3.108   6.859   -17.977 1.00 0.00 ? 13  SER A N    2  
ATOM 2076  C CA   . SER A 1 13  ? 3.932   5.664   -18.039 1.00 0.00 ? 13  SER A CA   2  
ATOM 2077  C C    . SER A 1 13  ? 4.719   5.639   -19.351 1.00 0.00 ? 13  SER A C    2  
ATOM 2078  O O    . SER A 1 13  ? 4.357   4.923   -20.283 1.00 0.00 ? 13  SER A O    2  
ATOM 2079  C CB   . SER A 1 13  ? 3.080   4.400   -17.907 1.00 0.00 ? 13  SER A CB   2  
ATOM 2080  O OG   . SER A 1 13  ? 2.428   4.325   -16.642 1.00 0.00 ? 13  SER A OG   2  
ATOM 2081  H H    . SER A 1 13  ? 2.883   7.264   -18.863 1.00 0.00 ? 13  SER A H    2  
ATOM 2082  H HA   . SER A 1 13  ? 4.609   5.736   -17.188 1.00 0.00 ? 13  SER A HA   2  
ATOM 2083  H HB2  . SER A 1 13  ? 2.334   4.381   -18.702 1.00 0.00 ? 13  SER A HB2  2  
ATOM 2084  H HB3  . SER A 1 13  ? 3.711   3.522   -18.043 1.00 0.00 ? 13  SER A HB3  2  
ATOM 2085  H HG   . SER A 1 13  ? 1.438   4.394   -16.763 1.00 0.00 ? 13  SER A HG   2  
ATOM 2086  N N    . PRO A 1 14  ? 5.810   6.451   -19.382 1.00 0.00 ? 14  PRO A N    2  
ATOM 2087  C CA   . PRO A 1 14  ? 6.651   6.529   -20.564 1.00 0.00 ? 14  PRO A CA   2  
ATOM 2088  C C    . PRO A 1 14  ? 7.531   5.284   -20.693 1.00 0.00 ? 14  PRO A C    2  
ATOM 2089  O O    . PRO A 1 14  ? 7.751   4.570   -19.716 1.00 0.00 ? 14  PRO A O    2  
ATOM 2090  C CB   . PRO A 1 14  ? 7.454   7.808   -20.392 1.00 0.00 ? 14  PRO A CB   2  
ATOM 2091  C CG   . PRO A 1 14  ? 7.374   8.155   -18.914 1.00 0.00 ? 14  PRO A CG   2  
ATOM 2092  C CD   . PRO A 1 14  ? 6.269   7.313   -18.297 1.00 0.00 ? 14  PRO A CD   2  
ATOM 2093  H HA   . PRO A 1 14  ? 6.088   6.553   -21.390 1.00 0.00 ? 14  PRO A HA   2  
ATOM 2094  H HB2  . PRO A 1 14  ? 8.488   7.665   -20.704 1.00 0.00 ? 14  PRO A HB2  2  
ATOM 2095  H HB3  . PRO A 1 14  ? 7.044   8.612   -21.004 1.00 0.00 ? 14  PRO A HB3  2  
ATOM 2096  H HG2  . PRO A 1 14  ? 8.326   7.954   -18.423 1.00 0.00 ? 14  PRO A HG2  2  
ATOM 2097  H HG3  . PRO A 1 14  ? 7.165   9.216   -18.782 1.00 0.00 ? 14  PRO A HG3  2  
ATOM 2098  H HD2  . PRO A 1 14  ? 6.640   6.728   -17.456 1.00 0.00 ? 14  PRO A HD2  2  
ATOM 2099  H HD3  . PRO A 1 14  ? 5.460   7.938   -17.918 1.00 0.00 ? 14  PRO A HD3  2  
ATOM 2100  N N    . SER A 1 15  ? 8.011   5.061   -21.908 1.00 0.00 ? 15  SER A N    2  
ATOM 2101  C CA   . SER A 1 15  ? 8.862   3.915   -22.178 1.00 0.00 ? 15  SER A CA   2  
ATOM 2102  C C    . SER A 1 15  ? 10.281  4.383   -22.509 1.00 0.00 ? 15  SER A C    2  
ATOM 2103  O O    . SER A 1 15  ? 10.615  4.587   -23.675 1.00 0.00 ? 15  SER A O    2  
ATOM 2104  C CB   . SER A 1 15  ? 8.301   3.070   -23.324 1.00 0.00 ? 15  SER A CB   2  
ATOM 2105  O OG   . SER A 1 15  ? 8.430   1.674   -23.070 1.00 0.00 ? 15  SER A OG   2  
ATOM 2106  H H    . SER A 1 15  ? 7.827   5.647   -22.698 1.00 0.00 ? 15  SER A H    2  
ATOM 2107  H HA   . SER A 1 15  ? 8.857   3.329   -21.259 1.00 0.00 ? 15  SER A HA   2  
ATOM 2108  H HB2  . SER A 1 15  ? 7.250   3.315   -23.474 1.00 0.00 ? 15  SER A HB2  2  
ATOM 2109  H HB3  . SER A 1 15  ? 8.822   3.320   -24.248 1.00 0.00 ? 15  SER A HB3  2  
ATOM 2110  H HG   . SER A 1 15  ? 7.837   1.408   -22.310 1.00 0.00 ? 15  SER A HG   2  
ATOM 2111  N N    . HIS A 1 16  ? 11.078  4.539   -21.462 1.00 0.00 ? 16  HIS A N    2  
ATOM 2112  C CA   . HIS A 1 16  ? 12.453  4.979   -21.627 1.00 0.00 ? 16  HIS A CA   2  
ATOM 2113  C C    . HIS A 1 16  ? 13.319  4.384   -20.515 1.00 0.00 ? 16  HIS A C    2  
ATOM 2114  O O    . HIS A 1 16  ? 12.805  3.978   -19.473 1.00 0.00 ? 16  HIS A O    2  
ATOM 2115  C CB   . HIS A 1 16  ? 12.531  6.505   -21.687 1.00 0.00 ? 16  HIS A CB   2  
ATOM 2116  C CG   . HIS A 1 16  ? 12.554  7.173   -20.333 1.00 0.00 ? 16  HIS A CG   2  
ATOM 2117  N ND1  . HIS A 1 16  ? 11.618  6.907   -19.349 1.00 0.00 ? 16  HIS A ND1  2  
ATOM 2118  C CD2  . HIS A 1 16  ? 13.410  8.097   -19.810 1.00 0.00 ? 16  HIS A CD2  2  
ATOM 2119  C CE1  . HIS A 1 16  ? 11.906  7.643   -18.287 1.00 0.00 ? 16  HIS A CE1  2  
ATOM 2120  N NE2  . HIS A 1 16  ? 13.017  8.381   -18.574 1.00 0.00 ? 16  HIS A NE2  2  
ATOM 2121  H H    . HIS A 1 16  ? 10.798  4.370   -20.517 1.00 0.00 ? 16  HIS A H    2  
ATOM 2122  H HA   . HIS A 1 16  ? 12.792  4.590   -22.587 1.00 0.00 ? 16  HIS A HA   2  
ATOM 2123  H HB2  . HIS A 1 16  ? 13.427  6.792   -22.238 1.00 0.00 ? 16  HIS A HB2  2  
ATOM 2124  H HB3  . HIS A 1 16  ? 11.677  6.881   -22.251 1.00 0.00 ? 16  HIS A HB3  2  
ATOM 2125  H HD1  . HIS A 1 16  ? 10.854  6.267   -19.427 1.00 0.00 ? 16  HIS A HD1  2  
ATOM 2126  H HD2  . HIS A 1 16  ? 14.271  8.530   -20.320 1.00 0.00 ? 16  HIS A HD2  2  
ATOM 2127  H HE1  . HIS A 1 16  ? 11.353  7.658   -17.347 1.00 0.00 ? 16  HIS A HE1  2  
ATOM 2128  N N    . PRO A 1 17  ? 14.652  4.351   -20.780 1.00 0.00 ? 17  PRO A N    2  
ATOM 2129  C CA   . PRO A 1 17  ? 15.594  3.813   -19.814 1.00 0.00 ? 17  PRO A CA   2  
ATOM 2130  C C    . PRO A 1 17  ? 15.813  4.791   -18.658 1.00 0.00 ? 17  PRO A C    2  
ATOM 2131  O O    . PRO A 1 17  ? 15.479  5.970   -18.766 1.00 0.00 ? 17  PRO A O    2  
ATOM 2132  C CB   . PRO A 1 17  ? 16.861  3.540   -20.609 1.00 0.00 ? 17  PRO A CB   2  
ATOM 2133  C CG   . PRO A 1 17  ? 16.739  4.362   -21.882 1.00 0.00 ? 17  PRO A CG   2  
ATOM 2134  C CD   . PRO A 1 17  ? 15.296  4.823   -22.002 1.00 0.00 ? 17  PRO A CD   2  
ATOM 2135  H HA   . PRO A 1 17  ? 15.229  2.979   -19.400 1.00 0.00 ? 17  PRO A HA   2  
ATOM 2136  H HB2  . PRO A 1 17  ? 17.747  3.826   -20.043 1.00 0.00 ? 17  PRO A HB2  2  
ATOM 2137  H HB3  . PRO A 1 17  ? 16.957  2.479   -20.837 1.00 0.00 ? 17  PRO A HB3  2  
ATOM 2138  H HG2  . PRO A 1 17  ? 17.412  5.219   -21.848 1.00 0.00 ? 17  PRO A HG2  2  
ATOM 2139  H HG3  . PRO A 1 17  ? 17.023  3.767   -22.749 1.00 0.00 ? 17  PRO A HG3  2  
ATOM 2140  H HD2  . PRO A 1 17  ? 15.232  5.908   -22.089 1.00 0.00 ? 17  PRO A HD2  2  
ATOM 2141  H HD3  . PRO A 1 17  ? 14.819  4.404   -22.888 1.00 0.00 ? 17  PRO A HD3  2  
ATOM 2142  N N    . PRO A 1 18  ? 16.389  4.252   -17.550 1.00 0.00 ? 18  PRO A N    2  
ATOM 2143  C CA   . PRO A 1 18  ? 16.656  5.064   -16.375 1.00 0.00 ? 18  PRO A CA   2  
ATOM 2144  C C    . PRO A 1 18  ? 17.865  5.975   -16.602 1.00 0.00 ? 18  PRO A C    2  
ATOM 2145  O O    . PRO A 1 18  ? 18.956  5.499   -16.913 1.00 0.00 ? 18  PRO A O    2  
ATOM 2146  C CB   . PRO A 1 18  ? 16.867  4.068   -15.247 1.00 0.00 ? 18  PRO A CB   2  
ATOM 2147  C CG   . PRO A 1 18  ? 17.170  2.737   -15.918 1.00 0.00 ? 18  PRO A CG   2  
ATOM 2148  C CD   . PRO A 1 18  ? 16.798  2.860   -17.386 1.00 0.00 ? 18  PRO A CD   2  
ATOM 2149  H HA   . PRO A 1 18  ? 15.885  5.674   -16.192 1.00 0.00 ? 18  PRO A HA   2  
ATOM 2150  H HB2  . PRO A 1 18  ? 17.689  4.376   -14.602 1.00 0.00 ? 18  PRO A HB2  2  
ATOM 2151  H HB3  . PRO A 1 18  ? 15.979  3.995   -14.619 1.00 0.00 ? 18  PRO A HB3  2  
ATOM 2152  H HG2  . PRO A 1 18  ? 18.225  2.488   -15.811 1.00 0.00 ? 18  PRO A HG2  2  
ATOM 2153  H HG3  . PRO A 1 18  ? 16.603  1.935   -15.446 1.00 0.00 ? 18  PRO A HG3  2  
ATOM 2154  H HD2  . PRO A 1 18  ? 17.643  2.618   -18.030 1.00 0.00 ? 18  PRO A HD2  2  
ATOM 2155  H HD3  . PRO A 1 18  ? 15.990  2.177   -17.649 1.00 0.00 ? 18  PRO A HD3  2  
ATOM 2156  N N    . ILE A 1 19  ? 17.630  7.268   -16.437 1.00 0.00 ? 19  ILE A N    2  
ATOM 2157  C CA   . ILE A 1 19  ? 18.686  8.250   -16.620 1.00 0.00 ? 19  ILE A CA   2  
ATOM 2158  C C    . ILE A 1 19  ? 19.398  8.481   -15.286 1.00 0.00 ? 19  ILE A C    2  
ATOM 2159  O O    . ILE A 1 19  ? 18.766  8.470   -14.231 1.00 0.00 ? 19  ILE A O    2  
ATOM 2160  C CB   . ILE A 1 19  ? 18.126  9.528   -17.248 1.00 0.00 ? 19  ILE A CB   2  
ATOM 2161  C CG1  . ILE A 1 19  ? 17.615  9.264   -18.666 1.00 0.00 ? 19  ILE A CG1  2  
ATOM 2162  C CG2  . ILE A 1 19  ? 19.161  10.655  -17.212 1.00 0.00 ? 19  ILE A CG2  2  
ATOM 2163  C CD1  . ILE A 1 19  ? 18.763  8.875   -19.599 1.00 0.00 ? 19  ILE A CD1  2  
ATOM 2164  H H    . ILE A 1 19  ? 16.740  7.647   -16.185 1.00 0.00 ? 19  ILE A H    2  
ATOM 2165  H HA   . ILE A 1 19  ? 19.403  7.831   -17.327 1.00 0.00 ? 19  ILE A HA   2  
ATOM 2166  H HB   . ILE A 1 19  ? 17.273  9.855   -16.654 1.00 0.00 ? 19  ILE A HB   2  
ATOM 2167  H HG12 . ILE A 1 19  ? 16.872  8.467   -18.645 1.00 0.00 ? 19  ILE A HG12 2  
ATOM 2168  H HG13 . ILE A 1 19  ? 17.116  10.155  -19.048 1.00 0.00 ? 19  ILE A HG13 2  
ATOM 2169  H HG21 . ILE A 1 19  ? 20.130  10.268  -17.526 1.00 0.00 ? 19  ILE A HG21 2  
ATOM 2170  H HG22 . ILE A 1 19  ? 18.852  11.453  -17.887 1.00 0.00 ? 19  ILE A HG22 2  
ATOM 2171  H HG23 . ILE A 1 19  ? 19.237  11.046  -16.198 1.00 0.00 ? 19  ILE A HG23 2  
ATOM 2172  H HD11 . ILE A 1 19  ? 19.707  8.938   -19.060 1.00 0.00 ? 19  ILE A HD11 2  
ATOM 2173  H HD12 . ILE A 1 19  ? 18.614  7.855   -19.953 1.00 0.00 ? 19  ILE A HD12 2  
ATOM 2174  H HD13 . ILE A 1 19  ? 18.784  9.555   -20.451 1.00 0.00 ? 19  ILE A HD13 2  
ATOM 2175  N N    . LEU A 1 20  ? 20.704  8.684   -15.376 1.00 0.00 ? 20  LEU A N    2  
ATOM 2176  C CA   . LEU A 1 20  ? 21.509  8.917   -14.190 1.00 0.00 ? 20  LEU A CA   2  
ATOM 2177  C C    . LEU A 1 20  ? 21.193  10.305  -13.629 1.00 0.00 ? 20  LEU A C    2  
ATOM 2178  O O    . LEU A 1 20  ? 22.041  11.196  -13.654 1.00 0.00 ? 20  LEU A O    2  
ATOM 2179  C CB   . LEU A 1 20  ? 22.993  8.701   -14.497 1.00 0.00 ? 20  LEU A CB   2  
ATOM 2180  C CG   . LEU A 1 20  ? 23.965  9.003   -13.355 1.00 0.00 ? 20  LEU A CG   2  
ATOM 2181  C CD1  . LEU A 1 20  ? 24.716  7.741   -12.927 1.00 0.00 ? 20  LEU A CD1  2  
ATOM 2182  C CD2  . LEU A 1 20  ? 24.920  10.137  -13.734 1.00 0.00 ? 20  LEU A CD2  2  
ATOM 2183  H H    . LEU A 1 20  ? 21.211  8.691   -16.239 1.00 0.00 ? 20  LEU A H    2  
ATOM 2184  H HA   . LEU A 1 20  ? 21.222  8.171   -13.448 1.00 0.00 ? 20  LEU A HA   2  
ATOM 2185  H HB2  . LEU A 1 20  ? 23.133  7.664   -14.803 1.00 0.00 ? 20  LEU A HB2  2  
ATOM 2186  H HB3  . LEU A 1 20  ? 23.261  9.324   -15.351 1.00 0.00 ? 20  LEU A HB3  2  
ATOM 2187  H HG   . LEU A 1 20  ? 23.388  9.342   -12.495 1.00 0.00 ? 20  LEU A HG   2  
ATOM 2188  H HD11 . LEU A 1 20  ? 25.705  7.732   -13.386 1.00 0.00 ? 20  LEU A HD11 2  
ATOM 2189  H HD12 . LEU A 1 20  ? 24.819  7.730   -11.841 1.00 0.00 ? 20  LEU A HD12 2  
ATOM 2190  H HD13 . LEU A 1 20  ? 24.159  6.860   -13.247 1.00 0.00 ? 20  LEU A HD13 2  
ATOM 2191  H HD21 . LEU A 1 20  ? 24.989  10.207  -14.819 1.00 0.00 ? 20  LEU A HD21 2  
ATOM 2192  H HD22 . LEU A 1 20  ? 24.544  11.078  -13.332 1.00 0.00 ? 20  LEU A HD22 2  
ATOM 2193  H HD23 . LEU A 1 20  ? 25.908  9.934   -13.319 1.00 0.00 ? 20  LEU A HD23 2  
ATOM 2194  N N    . GLU A 1 21  ? 19.972  10.445  -13.135 1.00 0.00 ? 21  GLU A N    2  
ATOM 2195  C CA   . GLU A 1 21  ? 19.534  11.709  -12.569 1.00 0.00 ? 21  GLU A CA   2  
ATOM 2196  C C    . GLU A 1 21  ? 19.510  11.627  -11.041 1.00 0.00 ? 21  GLU A C    2  
ATOM 2197  O O    . GLU A 1 21  ? 19.432  10.537  -10.476 1.00 0.00 ? 21  GLU A O    2  
ATOM 2198  C CB   . GLU A 1 21  ? 18.163  12.109  -13.118 1.00 0.00 ? 21  GLU A CB   2  
ATOM 2199  C CG   . GLU A 1 21  ? 18.299  12.844  -14.453 1.00 0.00 ? 21  GLU A CG   2  
ATOM 2200  C CD   . GLU A 1 21  ? 18.018  14.339  -14.287 1.00 0.00 ? 21  GLU A CD   2  
ATOM 2201  O OE1  . GLU A 1 21  ? 16.876  14.661  -13.894 1.00 0.00 ? 21  GLU A OE1  2  
ATOM 2202  O OE2  . GLU A 1 21  ? 18.951  15.126  -14.557 1.00 0.00 ? 21  GLU A OE2  2  
ATOM 2203  H H    . GLU A 1 21  ? 19.289  9.715   -13.118 1.00 0.00 ? 21  GLU A H    2  
ATOM 2204  H HA   . GLU A 1 21  ? 20.274  12.442  -12.889 1.00 0.00 ? 21  GLU A HA   2  
ATOM 2205  H HB2  . GLU A 1 21  ? 17.546  11.220  -13.249 1.00 0.00 ? 21  GLU A HB2  2  
ATOM 2206  H HB3  . GLU A 1 21  ? 17.651  12.748  -12.398 1.00 0.00 ? 21  GLU A HB3  2  
ATOM 2207  H HG2  . GLU A 1 21  ? 19.305  12.702  -14.849 1.00 0.00 ? 21  GLU A HG2  2  
ATOM 2208  H HG3  . GLU A 1 21  ? 17.607  12.419  -15.179 1.00 0.00 ? 21  GLU A HG3  2  
ATOM 2209  N N    . ARG A 1 22  ? 19.580  12.793  -10.417 1.00 0.00 ? 22  ARG A N    2  
ATOM 2210  C CA   . ARG A 1 22  ? 19.567  12.867  -8.966  1.00 0.00 ? 22  ARG A CA   2  
ATOM 2211  C C    . ARG A 1 22  ? 20.603  11.907  -8.377  1.00 0.00 ? 22  ARG A C    2  
ATOM 2212  O O    . ARG A 1 22  ? 20.343  10.712  -8.246  1.00 0.00 ? 22  ARG A O    2  
ATOM 2213  C CB   . ARG A 1 22  ? 18.185  12.521  -8.408  1.00 0.00 ? 22  ARG A CB   2  
ATOM 2214  C CG   . ARG A 1 22  ? 17.661  13.641  -7.507  1.00 0.00 ? 22  ARG A CG   2  
ATOM 2215  C CD   . ARG A 1 22  ? 16.187  13.423  -7.163  1.00 0.00 ? 22  ARG A CD   2  
ATOM 2216  N NE   . ARG A 1 22  ? 15.339  13.758  -8.329  1.00 0.00 ? 22  ARG A NE   2  
ATOM 2217  C CZ   . ARG A 1 22  ? 14.042  13.438  -8.433  1.00 0.00 ? 22  ARG A CZ   2  
ATOM 2218  N NH1  . ARG A 1 22  ? 13.436  12.772  -7.441  1.00 0.00 ? 22  ARG A NH1  2  
ATOM 2219  N NH2  . ARG A 1 22  ? 13.352  13.784  -9.528  1.00 0.00 ? 22  ARG A NH2  2  
ATOM 2220  H H    . ARG A 1 22  ? 19.643  13.675  -10.884 1.00 0.00 ? 22  ARG A H    2  
ATOM 2221  H HA   . ARG A 1 22  ? 19.819  13.903  -8.737  1.00 0.00 ? 22  ARG A HA   2  
ATOM 2222  H HB2  . ARG A 1 22  ? 17.489  12.354  -9.230  1.00 0.00 ? 22  ARG A HB2  2  
ATOM 2223  H HB3  . ARG A 1 22  ? 18.240  11.590  -7.844  1.00 0.00 ? 22  ARG A HB3  2  
ATOM 2224  H HG2  . ARG A 1 22  ? 18.250  13.681  -6.591  1.00 0.00 ? 22  ARG A HG2  2  
ATOM 2225  H HG3  . ARG A 1 22  ? 17.783  14.602  -8.007  1.00 0.00 ? 22  ARG A HG3  2  
ATOM 2226  H HD2  . ARG A 1 22  ? 16.022  12.385  -6.870  1.00 0.00 ? 22  ARG A HD2  2  
ATOM 2227  H HD3  . ARG A 1 22  ? 15.908  14.042  -6.310  1.00 0.00 ? 22  ARG A HD3  2  
ATOM 2228  H HE   . ARG A 1 22  ? 15.762  14.255  -9.087  1.00 0.00 ? 22  ARG A HE   2  
ATOM 2229  H HH11 . ARG A 1 22  ? 13.951  12.514  -6.623  1.00 0.00 ? 22  ARG A HH11 2  
ATOM 2230  H HH12 . ARG A 1 22  ? 12.468  12.533  -7.518  1.00 0.00 ? 22  ARG A HH12 2  
ATOM 2231  H HH21 . ARG A 1 22  ? 13.805  14.281  -10.268 1.00 0.00 ? 22  ARG A HH21 2  
ATOM 2232  H HH22 . ARG A 1 22  ? 12.384  13.545  -9.605  1.00 0.00 ? 22  ARG A HH22 2  
ATOM 2233  N N    . THR A 1 23  ? 21.755  12.466  -8.037  1.00 0.00 ? 23  THR A N    2  
ATOM 2234  C CA   . THR A 1 23  ? 22.831  11.674  -7.465  1.00 0.00 ? 23  THR A CA   2  
ATOM 2235  C C    . THR A 1 23  ? 22.526  11.336  -6.005  1.00 0.00 ? 23  THR A C    2  
ATOM 2236  O O    . THR A 1 23  ? 22.384  10.166  -5.651  1.00 0.00 ? 23  THR A O    2  
ATOM 2237  C CB   . THR A 1 23  ? 24.137  12.448  -7.649  1.00 0.00 ? 23  THR A CB   2  
ATOM 2238  O OG1  . THR A 1 23  ? 24.609  12.034  -8.929  1.00 0.00 ? 23  THR A OG1  2  
ATOM 2239  C CG2  . THR A 1 23  ? 25.231  11.990  -6.683  1.00 0.00 ? 23  THR A CG2  2  
ATOM 2240  H H    . THR A 1 23  ? 21.959  13.439  -8.147  1.00 0.00 ? 23  THR A H    2  
ATOM 2241  H HA   . THR A 1 23  ? 22.888  10.730  -8.007  1.00 0.00 ? 23  THR A HA   2  
ATOM 2242  H HB   . THR A 1 23  ? 23.969  13.522  -7.566  1.00 0.00 ? 23  THR A HB   2  
ATOM 2243  H HG1  . THR A 1 23  ? 24.612  11.036  -8.985  1.00 0.00 ? 23  THR A HG1  2  
ATOM 2244  H HG21 . THR A 1 23  ? 26.057  12.701  -6.704  1.00 0.00 ? 23  THR A HG21 2  
ATOM 2245  H HG22 . THR A 1 23  ? 24.824  11.936  -5.673  1.00 0.00 ? 23  THR A HG22 2  
ATOM 2246  H HG23 . THR A 1 23  ? 25.592  11.006  -6.982  1.00 0.00 ? 23  THR A HG23 2  
ATOM 2247  N N    . LEU A 1 24  ? 22.433  12.381  -5.196  1.00 0.00 ? 24  LEU A N    2  
ATOM 2248  C CA   . LEU A 1 24  ? 22.148  12.209  -3.781  1.00 0.00 ? 24  LEU A CA   2  
ATOM 2249  C C    . LEU A 1 24  ? 20.961  11.258  -3.617  1.00 0.00 ? 24  LEU A C    2  
ATOM 2250  O O    . LEU A 1 24  ? 20.060  11.233  -4.455  1.00 0.00 ? 24  LEU A O    2  
ATOM 2251  C CB   . LEU A 1 24  ? 21.945  13.568  -3.107  1.00 0.00 ? 24  LEU A CB   2  
ATOM 2252  C CG   . LEU A 1 24  ? 23.200  14.222  -2.525  1.00 0.00 ? 24  LEU A CG   2  
ATOM 2253  C CD1  . LEU A 1 24  ? 23.604  13.556  -1.208  1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2254  C CD2  . LEU A 1 24  ? 24.342  14.219  -3.543  1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2255  H H    . LEU A 1 24  ? 22.550  13.329  -5.491  1.00 0.00 ? 24  LEU A H    2  
ATOM 2256  H HA   . LEU A 1 24  ? 23.024  11.750  -3.324  1.00 0.00 ? 24  LEU A HA   2  
ATOM 2257  H HB2  . LEU A 1 24  ? 21.508  14.251  -3.835  1.00 0.00 ? 24  LEU A HB2  2  
ATOM 2258  H HB3  . LEU A 1 24  ? 21.216  13.448  -2.305  1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2259  H HG   . LEU A 1 24  ? 22.970  15.264  -2.302  1.00 0.00 ? 24  LEU A HG   2  
ATOM 2260  H HD11 . LEU A 1 24  ? 23.450  12.480  -1.283  1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2261  H HD12 . LEU A 1 24  ? 24.656  13.760  -1.006  1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2262  H HD13 . LEU A 1 24  ? 22.995  13.955  -0.397  1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2263  H HD21 . LEU A 1 24  ? 24.682  13.196  -3.705  1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2264  H HD22 . LEU A 1 24  ? 23.990  14.639  -4.485  1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2265  H HD23 . LEU A 1 24  ? 25.168  14.820  -3.164  1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2266  N N    . ASP A 1 25  ? 20.998  10.499  -2.532  1.00 0.00 ? 25  ASP A N    2  
ATOM 2267  C CA   . ASP A 1 25  ? 19.936  9.548   -2.247  1.00 0.00 ? 25  ASP A CA   2  
ATOM 2268  C C    . ASP A 1 25  ? 18.610  10.299  -2.105  1.00 0.00 ? 25  ASP A C    2  
ATOM 2269  O O    . ASP A 1 25  ? 18.598  11.510  -1.891  1.00 0.00 ? 25  ASP A O    2  
ATOM 2270  C CB   . ASP A 1 25  ? 20.201  8.804   -0.936  1.00 0.00 ? 25  ASP A CB   2  
ATOM 2271  C CG   . ASP A 1 25  ? 20.266  7.281   -1.060  1.00 0.00 ? 25  ASP A CG   2  
ATOM 2272  O OD1  . ASP A 1 25  ? 19.189  6.655   -0.949  1.00 0.00 ? 25  ASP A OD1  2  
ATOM 2273  O OD2  . ASP A 1 25  ? 21.391  6.775   -1.263  1.00 0.00 ? 25  ASP A OD2  2  
ATOM 2274  H H    . ASP A 1 25  ? 21.734  10.526  -1.855  1.00 0.00 ? 25  ASP A H    2  
ATOM 2275  H HA   . ASP A 1 25  ? 19.937  8.858   -3.090  1.00 0.00 ? 25  ASP A HA   2  
ATOM 2276  H HB2  . ASP A 1 25  ? 21.142  9.160   -0.517  1.00 0.00 ? 25  ASP A HB2  2  
ATOM 2277  H HB3  . ASP A 1 25  ? 19.416  9.062   -0.225  1.00 0.00 ? 25  ASP A HB3  2  
ATOM 2278  N N    . ASP A 1 26  ? 17.526  9.548   -2.230  1.00 0.00 ? 26  ASP A N    2  
ATOM 2279  C CA   . ASP A 1 26  ? 16.198  10.126  -2.119  1.00 0.00 ? 26  ASP A CA   2  
ATOM 2280  C C    . ASP A 1 26  ? 15.150  9.041   -2.373  1.00 0.00 ? 26  ASP A C    2  
ATOM 2281  O O    . ASP A 1 26  ? 15.424  8.057   -3.059  1.00 0.00 ? 26  ASP A O    2  
ATOM 2282  C CB   . ASP A 1 26  ? 15.991  11.234  -3.153  1.00 0.00 ? 26  ASP A CB   2  
ATOM 2283  C CG   . ASP A 1 26  ? 16.694  11.007  -4.493  1.00 0.00 ? 26  ASP A CG   2  
ATOM 2284  O OD1  . ASP A 1 26  ? 16.596  9.869   -4.999  1.00 0.00 ? 26  ASP A OD1  2  
ATOM 2285  O OD2  . ASP A 1 26  ? 17.314  11.977  -4.980  1.00 0.00 ? 26  ASP A OD2  2  
ATOM 2286  H H    . ASP A 1 26  ? 17.545  8.563   -2.404  1.00 0.00 ? 26  ASP A H    2  
ATOM 2287  H HA   . ASP A 1 26  ? 16.145  10.528  -1.107  1.00 0.00 ? 26  ASP A HA   2  
ATOM 2288  H HB2  . ASP A 1 26  ? 14.922  11.347  -3.335  1.00 0.00 ? 26  ASP A HB2  2  
ATOM 2289  H HB3  . ASP A 1 26  ? 16.343  12.176  -2.730  1.00 0.00 ? 26  ASP A HB3  2  
ATOM 2290  N N    . VAL A 1 27  ? 13.972  9.256   -1.807  1.00 0.00 ? 27  VAL A N    2  
ATOM 2291  C CA   . VAL A 1 27  ? 12.882  8.308   -1.964  1.00 0.00 ? 27  VAL A CA   2  
ATOM 2292  C C    . VAL A 1 27  ? 12.860  7.797   -3.406  1.00 0.00 ? 27  VAL A C    2  
ATOM 2293  O O    . VAL A 1 27  ? 13.387  8.448   -4.307  1.00 0.00 ? 27  VAL A O    2  
ATOM 2294  C CB   . VAL A 1 27  ? 11.562  8.953   -1.537  1.00 0.00 ? 27  VAL A CB   2  
ATOM 2295  C CG1  . VAL A 1 27  ? 11.479  9.078   -0.015  1.00 0.00 ? 27  VAL A CG1  2  
ATOM 2296  C CG2  . VAL A 1 27  ? 11.375  10.315  -2.210  1.00 0.00 ? 27  VAL A CG2  2  
ATOM 2297  H H    . VAL A 1 27  ? 13.757  10.058  -1.250  1.00 0.00 ? 27  VAL A H    2  
ATOM 2298  H HA   . VAL A 1 27  ? 13.078  7.468   -1.297  1.00 0.00 ? 27  VAL A HA   2  
ATOM 2299  H HB   . VAL A 1 27  ? 10.750  8.304   -1.865  1.00 0.00 ? 27  VAL A HB   2  
ATOM 2300  H HG11 . VAL A 1 27  ? 12.094  9.915   0.315   1.00 0.00 ? 27  VAL A HG11 2  
ATOM 2301  H HG12 . VAL A 1 27  ? 10.443  9.250   0.280   1.00 0.00 ? 27  VAL A HG12 2  
ATOM 2302  H HG13 . VAL A 1 27  ? 11.840  8.158   0.445   1.00 0.00 ? 27  VAL A HG13 2  
ATOM 2303  H HG21 . VAL A 1 27  ? 10.746  10.946  -1.583  1.00 0.00 ? 27  VAL A HG21 2  
ATOM 2304  H HG22 . VAL A 1 27  ? 12.347  10.790  -2.345  1.00 0.00 ? 27  VAL A HG22 2  
ATOM 2305  H HG23 . VAL A 1 27  ? 10.899  10.178  -3.181  1.00 0.00 ? 27  VAL A HG23 2  
ATOM 2306  N N    . PRO A 1 28  ? 12.228  6.606   -3.584  1.00 0.00 ? 28  PRO A N    2  
ATOM 2307  C CA   . PRO A 1 28  ? 12.130  6.001   -4.901  1.00 0.00 ? 28  PRO A CA   2  
ATOM 2308  C C    . PRO A 1 28  ? 11.088  6.721   -5.760  1.00 0.00 ? 28  PRO A C    2  
ATOM 2309  O O    . PRO A 1 28  ? 10.345  7.565   -5.262  1.00 0.00 ? 28  PRO A O    2  
ATOM 2310  C CB   . PRO A 1 28  ? 11.780  4.545   -4.640  1.00 0.00 ? 28  PRO A CB   2  
ATOM 2311  C CG   . PRO A 1 28  ? 11.239  4.494   -3.220  1.00 0.00 ? 28  PRO A CG   2  
ATOM 2312  C CD   . PRO A 1 28  ? 11.592  5.808   -2.540  1.00 0.00 ? 28  PRO A CD   2  
ATOM 2313  H HA   . PRO A 1 28  ? 12.997  6.091   -5.390  1.00 0.00 ? 28  PRO A HA   2  
ATOM 2314  H HB2  . PRO A 1 28  ? 11.037  4.188   -5.353  1.00 0.00 ? 28  PRO A HB2  2  
ATOM 2315  H HB3  . PRO A 1 28  ? 12.657  3.907   -4.747  1.00 0.00 ? 28  PRO A HB3  2  
ATOM 2316  H HG2  . PRO A 1 28  ? 10.160  4.346   -3.227  1.00 0.00 ? 28  PRO A HG2  2  
ATOM 2317  H HG3  . PRO A 1 28  ? 11.673  3.655   -2.676  1.00 0.00 ? 28  PRO A HG3  2  
ATOM 2318  H HD2  . PRO A 1 28  ? 10.703  6.302   -2.149  1.00 0.00 ? 28  PRO A HD2  2  
ATOM 2319  H HD3  . PRO A 1 28  ? 12.265  5.649   -1.697  1.00 0.00 ? 28  PRO A HD3  2  
ATOM 2320  N N    . GLY A 1 29  ? 11.068  6.361   -7.035  1.00 0.00 ? 29  GLY A N    2  
ATOM 2321  C CA   . GLY A 1 29  ? 10.130  6.963   -7.967  1.00 0.00 ? 29  GLY A CA   2  
ATOM 2322  C C    . GLY A 1 29  ? 8.812   6.186   -7.997  1.00 0.00 ? 29  GLY A C    2  
ATOM 2323  O O    . GLY A 1 29  ? 8.553   5.363   -7.121  1.00 0.00 ? 29  GLY A O    2  
ATOM 2324  H H    . GLY A 1 29  ? 11.676  5.674   -7.431  1.00 0.00 ? 29  GLY A H    2  
ATOM 2325  H HA2  . GLY A 1 29  ? 9.940   7.997   -7.681  1.00 0.00 ? 29  GLY A HA2  2  
ATOM 2326  H HA3  . GLY A 1 29  ? 10.567  6.983   -8.966  1.00 0.00 ? 29  GLY A HA3  2  
ATOM 2327  N N    . PRO A 1 30  ? 7.993   6.484   -9.041  1.00 0.00 ? 30  PRO A N    2  
ATOM 2328  C CA   . PRO A 1 30  ? 6.708   5.823   -9.196  1.00 0.00 ? 30  PRO A CA   2  
ATOM 2329  C C    . PRO A 1 30  ? 6.886   4.390   -9.700  1.00 0.00 ? 30  PRO A C    2  
ATOM 2330  O O    . PRO A 1 30  ? 7.654   4.146   -10.630 1.00 0.00 ? 30  PRO A O    2  
ATOM 2331  C CB   . PRO A 1 30  ? 5.929   6.700   -10.163 1.00 0.00 ? 30  PRO A CB   2  
ATOM 2332  C CG   . PRO A 1 30  ? 6.963   7.561   -10.871 1.00 0.00 ? 30  PRO A CG   2  
ATOM 2333  C CD   . PRO A 1 30  ? 8.267   7.454   -10.097 1.00 0.00 ? 30  PRO A CD   2  
ATOM 2334  H HA   . PRO A 1 30  ? 6.248   5.747   -8.312  1.00 0.00 ? 30  PRO A HA   2  
ATOM 2335  H HB2  . PRO A 1 30  ? 5.371   6.094   -10.877 1.00 0.00 ? 30  PRO A HB2  2  
ATOM 2336  H HB3  . PRO A 1 30  ? 5.204   7.317   -9.633  1.00 0.00 ? 30  PRO A HB3  2  
ATOM 2337  H HG2  . PRO A 1 30  ? 7.100   7.225   -11.899 1.00 0.00 ? 30  PRO A HG2  2  
ATOM 2338  H HG3  . PRO A 1 30  ? 6.630   8.598   -10.916 1.00 0.00 ? 30  PRO A HG3  2  
ATOM 2339  H HD2  . PRO A 1 30  ? 9.082   7.121   -10.739 1.00 0.00 ? 30  PRO A HD2  2  
ATOM 2340  H HD3  . PRO A 1 30  ? 8.561   8.418   -9.683  1.00 0.00 ? 30  PRO A HD3  2  
ATOM 2341  N N    . PRO A 1 31  ? 6.146   3.455   -9.047  1.00 0.00 ? 31  PRO A N    2  
ATOM 2342  C CA   . PRO A 1 31  ? 6.214   2.052   -9.419  1.00 0.00 ? 31  PRO A CA   2  
ATOM 2343  C C    . PRO A 1 31  ? 5.456   1.792   -10.722 1.00 0.00 ? 31  PRO A C    2  
ATOM 2344  O O    . PRO A 1 31  ? 4.227   1.829   -10.747 1.00 0.00 ? 31  PRO A O    2  
ATOM 2345  C CB   . PRO A 1 31  ? 5.631   1.301   -8.233  1.00 0.00 ? 31  PRO A CB   2  
ATOM 2346  C CG   . PRO A 1 31  ? 4.835   2.326   -7.442  1.00 0.00 ? 31  PRO A CG   2  
ATOM 2347  C CD   . PRO A 1 31  ? 5.227   3.707   -7.941  1.00 0.00 ? 31  PRO A CD   2  
ATOM 2348  H HA   . PRO A 1 31  ? 7.162   1.786   -9.597  1.00 0.00 ? 31  PRO A HA   2  
ATOM 2349  H HB2  . PRO A 1 31  ? 4.993   0.482   -8.564  1.00 0.00 ? 31  PRO A HB2  2  
ATOM 2350  H HB3  . PRO A 1 31  ? 6.420   0.863   -7.622  1.00 0.00 ? 31  PRO A HB3  2  
ATOM 2351  H HG2  . PRO A 1 31  ? 3.765   2.162   -7.572  1.00 0.00 ? 31  PRO A HG2  2  
ATOM 2352  H HG3  . PRO A 1 31  ? 5.044   2.232   -6.376  1.00 0.00 ? 31  PRO A HG3  2  
ATOM 2353  H HD2  . PRO A 1 31  ? 4.354   4.271   -8.272  1.00 0.00 ? 31  PRO A HD2  2  
ATOM 2354  H HD3  . PRO A 1 31  ? 5.704   4.292   -7.155  1.00 0.00 ? 31  PRO A HD3  2  
ATOM 2355  N N    . MET A 1 32  ? 6.220   1.536   -11.773 1.00 0.00 ? 32  MET A N    2  
ATOM 2356  C CA   . MET A 1 32  ? 5.636   1.270   -13.077 1.00 0.00 ? 32  MET A CA   2  
ATOM 2357  C C    . MET A 1 32  ? 5.406   -0.229  -13.279 1.00 0.00 ? 32  MET A C    2  
ATOM 2358  O O    . MET A 1 32  ? 5.986   -1.051  -12.572 1.00 0.00 ? 32  MET A O    2  
ATOM 2359  C CB   . MET A 1 32  ? 6.567   1.796   -14.171 1.00 0.00 ? 32  MET A CB   2  
ATOM 2360  C CG   . MET A 1 32  ? 7.959   1.173   -14.053 1.00 0.00 ? 32  MET A CG   2  
ATOM 2361  S SD   . MET A 1 32  ? 8.803   1.261   -15.623 1.00 0.00 ? 32  MET A SD   2  
ATOM 2362  C CE   . MET A 1 32  ? 10.441  0.758   -15.123 1.00 0.00 ? 32  MET A CE   2  
ATOM 2363  H H    . MET A 1 32  ? 7.220   1.507   -11.745 1.00 0.00 ? 32  MET A H    2  
ATOM 2364  H HA   . MET A 1 32  ? 4.681   1.795   -13.082 1.00 0.00 ? 32  MET A HA   2  
ATOM 2365  H HB2  . MET A 1 32  ? 6.146   1.571   -15.151 1.00 0.00 ? 32  MET A HB2  2  
ATOM 2366  H HB3  . MET A 1 32  ? 6.643   2.881   -14.098 1.00 0.00 ? 32  MET A HB3  2  
ATOM 2367  H HG2  . MET A 1 32  ? 8.537   1.695   -13.290 1.00 0.00 ? 32  MET A HG2  2  
ATOM 2368  H HG3  . MET A 1 32  ? 7.876   0.134   -13.733 1.00 0.00 ? 32  MET A HG3  2  
ATOM 2369  H HE1  . MET A 1 32  ? 11.069  0.635   -16.006 1.00 0.00 ? 32  MET A HE1  2  
ATOM 2370  H HE2  . MET A 1 32  ? 10.873  1.520   -14.475 1.00 0.00 ? 32  MET A HE2  2  
ATOM 2371  H HE3  . MET A 1 32  ? 10.383  -0.187  -14.584 1.00 0.00 ? 32  MET A HE3  2  
ATOM 2372  N N    . GLY A 1 33  ? 4.558   -0.539  -14.249 1.00 0.00 ? 33  GLY A N    2  
ATOM 2373  C CA   . GLY A 1 33  ? 4.244   -1.925  -14.553 1.00 0.00 ? 33  GLY A CA   2  
ATOM 2374  C C    . GLY A 1 33  ? 3.025   -2.399  -13.758 1.00 0.00 ? 33  GLY A C    2  
ATOM 2375  O O    . GLY A 1 33  ? 2.986   -3.538  -13.296 1.00 0.00 ? 33  GLY A O    2  
ATOM 2376  H H    . GLY A 1 33  ? 4.090   0.135   -14.820 1.00 0.00 ? 33  GLY A H    2  
ATOM 2377  H HA2  . GLY A 1 33  ? 4.050   -2.031  -15.621 1.00 0.00 ? 33  GLY A HA2  2  
ATOM 2378  H HA3  . GLY A 1 33  ? 5.102   -2.555  -14.321 1.00 0.00 ? 33  GLY A HA3  2  
ATOM 2379  N N    . ILE A 1 34  ? 2.061   -1.500  -13.623 1.00 0.00 ? 34  ILE A N    2  
ATOM 2380  C CA   . ILE A 1 34  ? 0.845   -1.812  -12.892 1.00 0.00 ? 34  ILE A CA   2  
ATOM 2381  C C    . ILE A 1 34  ? -0.164  -2.462  -13.842 1.00 0.00 ? 34  ILE A C    2  
ATOM 2382  O O    . ILE A 1 34  ? -0.683  -1.807  -14.744 1.00 0.00 ? 34  ILE A O    2  
ATOM 2383  C CB   . ILE A 1 34  ? 0.309   -0.565  -12.186 1.00 0.00 ? 34  ILE A CB   2  
ATOM 2384  C CG1  . ILE A 1 34  ? 1.455   0.314   -11.682 1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2385  C CG2  . ILE A 1 34  ? -0.659  -0.943  -11.064 1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2386  C CD1  . ILE A 1 34  ? 2.417   -0.489  -10.803 1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2387  H H    . ILE A 1 34  ? 2.101   -0.576  -14.003 1.00 0.00 ? 34  ILE A H    2  
ATOM 2388  H HA   . ILE A 1 34  ? 1.105   -2.534  -12.118 1.00 0.00 ? 34  ILE A HA   2  
ATOM 2389  H HB   . ILE A 1 34  ? -0.253  0.023   -12.912 1.00 0.00 ? 34  ILE A HB   2  
ATOM 2390  H HG12 . ILE A 1 34  ? 1.996   0.734   -12.530 1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2391  H HG13 . ILE A 1 34  ? 1.052   1.153   -11.114 1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2392  H HG21 . ILE A 1 34  ? -0.372  -1.908  -10.646 1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2393  H HG22 . ILE A 1 34  ? -0.625  -0.184  -10.283 1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2394  H HG23 . ILE A 1 34  ? -1.671  -1.008  -11.464 1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2395  H HD11 . ILE A 1 34  ? 3.402   -0.512  -11.270 1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2396  H HD12 . ILE A 1 34  ? 2.490   -0.020  -9.822  1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2397  H HD13 . ILE A 1 34  ? 2.043   -1.507  -10.693 1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2398  N N    . LEU A 1 35  ? -0.411  -3.742  -13.605 1.00 0.00 ? 35  LEU A N    2  
ATOM 2399  C CA   . LEU A 1 35  ? -1.348  -4.488  -14.428 1.00 0.00 ? 35  LEU A CA   2  
ATOM 2400  C C    . LEU A 1 35  ? -2.269  -5.311  -13.526 1.00 0.00 ? 35  LEU A C    2  
ATOM 2401  O O    . LEU A 1 35  ? -1.869  -5.729  -12.440 1.00 0.00 ? 35  LEU A O    2  
ATOM 2402  C CB   . LEU A 1 35  ? -0.600  -5.322  -15.470 1.00 0.00 ? 35  LEU A CB   2  
ATOM 2403  C CG   . LEU A 1 35  ? 0.268   -4.541  -16.458 1.00 0.00 ? 35  LEU A CG   2  
ATOM 2404  C CD1  . LEU A 1 35  ? 1.156   -5.484  -17.273 1.00 0.00 ? 35  LEU A CD1  2  
ATOM 2405  C CD2  . LEU A 1 35  ? -0.591  -3.645  -17.353 1.00 0.00 ? 35  LEU A CD2  2  
ATOM 2406  H H    . LEU A 1 35  ? 0.015   -4.267  -12.869 1.00 0.00 ? 35  LEU A H    2  
ATOM 2407  H HA   . LEU A 1 35  ? -1.955  -3.763  -14.971 1.00 0.00 ? 35  LEU A HA   2  
ATOM 2408  H HB2  . LEU A 1 35  ? 0.034   -6.037  -14.946 1.00 0.00 ? 35  LEU A HB2  2  
ATOM 2409  H HB3  . LEU A 1 35  ? -1.331  -5.900  -16.037 1.00 0.00 ? 35  LEU A HB3  2  
ATOM 2410  H HG   . LEU A 1 35  ? 0.930   -3.887  -15.889 1.00 0.00 ? 35  LEU A HG   2  
ATOM 2411  H HD11 . LEU A 1 35  ? 0.529   -6.168  -17.846 1.00 0.00 ? 35  LEU A HD11 2  
ATOM 2412  H HD12 . LEU A 1 35  ? 1.775   -4.901  -17.954 1.00 0.00 ? 35  LEU A HD12 2  
ATOM 2413  H HD13 . LEU A 1 35  ? 1.795   -6.054  -16.599 1.00 0.00 ? 35  LEU A HD13 2  
ATOM 2414  H HD21 . LEU A 1 35  ? -1.576  -3.520  -16.904 1.00 0.00 ? 35  LEU A HD21 2  
ATOM 2415  H HD22 . LEU A 1 35  ? -0.113  -2.671  -17.459 1.00 0.00 ? 35  LEU A HD22 2  
ATOM 2416  H HD23 . LEU A 1 35  ? -0.696  -4.107  -18.335 1.00 0.00 ? 35  LEU A HD23 2  
ATOM 2417  N N    . PHE A 1 36  ? -3.485  -5.521  -14.009 1.00 0.00 ? 36  PHE A N    2  
ATOM 2418  C CA   . PHE A 1 36  ? -4.466  -6.288  -13.260 1.00 0.00 ? 36  PHE A CA   2  
ATOM 2419  C C    . PHE A 1 36  ? -4.799  -7.599  -13.974 1.00 0.00 ? 36  PHE A C    2  
ATOM 2420  O O    . PHE A 1 36  ? -5.693  -7.641  -14.818 1.00 0.00 ? 36  PHE A O    2  
ATOM 2421  C CB   . PHE A 1 36  ? -5.732  -5.432  -13.174 1.00 0.00 ? 36  PHE A CB   2  
ATOM 2422  C CG   . PHE A 1 36  ? -5.615  -4.242  -12.220 1.00 0.00 ? 36  PHE A CG   2  
ATOM 2423  C CD1  . PHE A 1 36  ? -5.905  -4.397  -10.900 1.00 0.00 ? 36  PHE A CD1  2  
ATOM 2424  C CD2  . PHE A 1 36  ? -5.221  -3.028  -12.691 1.00 0.00 ? 36  PHE A CD2  2  
ATOM 2425  C CE1  . PHE A 1 36  ? -5.796  -3.293  -10.015 1.00 0.00 ? 36  PHE A CE1  2  
ATOM 2426  C CE2  . PHE A 1 36  ? -5.113  -1.924  -11.806 1.00 0.00 ? 36  PHE A CE2  2  
ATOM 2427  C CZ   . PHE A 1 36  ? -5.403  -2.079  -10.486 1.00 0.00 ? 36  PHE A CZ   2  
ATOM 2428  H H    . PHE A 1 36  ? -3.802  -5.178  -14.893 1.00 0.00 ? 36  PHE A H    2  
ATOM 2429  H HA   . PHE A 1 36  ? -4.030  -6.507  -12.286 1.00 0.00 ? 36  PHE A HA   2  
ATOM 2430  H HB2  . PHE A 1 36  ? -5.977  -5.063  -14.170 1.00 0.00 ? 36  PHE A HB2  2  
ATOM 2431  H HB3  . PHE A 1 36  ? -6.562  -6.061  -12.854 1.00 0.00 ? 36  PHE A HB3  2  
ATOM 2432  H HD1  . PHE A 1 36  ? -6.220  -5.370  -10.523 1.00 0.00 ? 36  PHE A HD1  2  
ATOM 2433  H HD2  . PHE A 1 36  ? -4.989  -2.904  -13.749 1.00 0.00 ? 36  PHE A HD2  2  
ATOM 2434  H HE1  . PHE A 1 36  ? -6.029  -3.418  -8.957  1.00 0.00 ? 36  PHE A HE1  2  
ATOM 2435  H HE2  . PHE A 1 36  ? -4.797  -0.951  -12.183 1.00 0.00 ? 36  PHE A HE2  2  
ATOM 2436  H HZ   . PHE A 1 36  ? -5.319  -1.231  -9.806  1.00 0.00 ? 36  PHE A HZ   2  
ATOM 2437  N N    . PRO A 1 37  ? -4.042  -8.665  -13.600 1.00 0.00 ? 37  PRO A N    2  
ATOM 2438  C CA   . PRO A 1 37  ? -4.247  -9.975  -14.196 1.00 0.00 ? 37  PRO A CA   2  
ATOM 2439  C C    . PRO A 1 37  ? -5.512  -10.636 -13.644 1.00 0.00 ? 37  PRO A C    2  
ATOM 2440  O O    . PRO A 1 37  ? -6.344  -11.125 -14.406 1.00 0.00 ? 37  PRO A O    2  
ATOM 2441  C CB   . PRO A 1 37  ? -2.982  -10.755 -13.877 1.00 0.00 ? 37  PRO A CB   2  
ATOM 2442  C CG   . PRO A 1 37  ? -2.317  -10.018 -12.726 1.00 0.00 ? 37  PRO A CG   2  
ATOM 2443  C CD   . PRO A 1 37  ? -2.974  -8.652  -12.605 1.00 0.00 ? 37  PRO A CD   2  
ATOM 2444  H HA   . PRO A 1 37  ? -4.391  -9.889  -15.182 1.00 0.00 ? 37  PRO A HA   2  
ATOM 2445  H HB2  . PRO A 1 37  ? -3.216  -11.782 -13.599 1.00 0.00 ? 37  PRO A HB2  2  
ATOM 2446  H HB3  . PRO A 1 37  ? -2.323  -10.801 -14.744 1.00 0.00 ? 37  PRO A HB3  2  
ATOM 2447  H HG2  . PRO A 1 37  ? -2.428  -10.579 -11.798 1.00 0.00 ? 37  PRO A HG2  2  
ATOM 2448  H HG3  . PRO A 1 37  ? -1.247  -9.912  -12.908 1.00 0.00 ? 37  PRO A HG3  2  
ATOM 2449  H HD2  . PRO A 1 37  ? -3.369  -8.491  -11.602 1.00 0.00 ? 37  PRO A HD2  2  
ATOM 2450  H HD3  . PRO A 1 37  ? -2.261  -7.851  -12.799 1.00 0.00 ? 37  PRO A HD3  2  
ATOM 2451  N N    . GLU A 1 38  ? -5.617  -10.628 -12.323 1.00 0.00 ? 38  GLU A N    2  
ATOM 2452  C CA   . GLU A 1 38  ? -6.766  -11.220 -11.660 1.00 0.00 ? 38  GLU A CA   2  
ATOM 2453  C C    . GLU A 1 38  ? -7.562  -10.146 -10.916 1.00 0.00 ? 38  GLU A C    2  
ATOM 2454  O O    . GLU A 1 38  ? -7.054  -9.529  -9.980  1.00 0.00 ? 38  GLU A O    2  
ATOM 2455  C CB   . GLU A 1 38  ? -6.335  -12.340 -10.711 1.00 0.00 ? 38  GLU A CB   2  
ATOM 2456  C CG   . GLU A 1 38  ? -7.517  -12.838 -9.877  1.00 0.00 ? 38  GLU A CG   2  
ATOM 2457  C CD   . GLU A 1 38  ? -7.050  -13.803 -8.785  1.00 0.00 ? 38  GLU A CD   2  
ATOM 2458  O OE1  . GLU A 1 38  ? -6.644  -13.297 -7.717  1.00 0.00 ? 38  GLU A OE1  2  
ATOM 2459  O OE2  . GLU A 1 38  ? -7.110  -15.024 -9.044  1.00 0.00 ? 38  GLU A OE2  2  
ATOM 2460  H H    . GLU A 1 38  ? -4.936  -10.227 -11.710 1.00 0.00 ? 38  GLU A H    2  
ATOM 2461  H HA   . GLU A 1 38  ? -7.375  -11.644 -12.459 1.00 0.00 ? 38  GLU A HA   2  
ATOM 2462  H HB2  . GLU A 1 38  ? -5.916  -13.167 -11.285 1.00 0.00 ? 38  GLU A HB2  2  
ATOM 2463  H HB3  . GLU A 1 38  ? -5.546  -11.978 -10.051 1.00 0.00 ? 38  GLU A HB3  2  
ATOM 2464  H HG2  . GLU A 1 38  ? -8.029  -11.989 -9.423  1.00 0.00 ? 38  GLU A HG2  2  
ATOM 2465  H HG3  . GLU A 1 38  ? -8.238  -13.336 -10.524 1.00 0.00 ? 38  GLU A HG3  2  
ATOM 2466  N N    . VAL A 1 39  ? -8.796  -9.956  -11.358 1.00 0.00 ? 39  VAL A N    2  
ATOM 2467  C CA   . VAL A 1 39  ? -9.666  -8.967  -10.745 1.00 0.00 ? 39  VAL A CA   2  
ATOM 2468  C C    . VAL A 1 39  ? -11.087 -9.528  -10.660 1.00 0.00 ? 39  VAL A C    2  
ATOM 2469  O O    . VAL A 1 39  ? -11.659 -9.936  -11.670 1.00 0.00 ? 39  VAL A O    2  
ATOM 2470  C CB   . VAL A 1 39  ? -9.589  -7.650  -11.520 1.00 0.00 ? 39  VAL A CB   2  
ATOM 2471  C CG1  . VAL A 1 39  ? -10.671 -6.674  -11.052 1.00 0.00 ? 39  VAL A CG1  2  
ATOM 2472  C CG2  . VAL A 1 39  ? -8.198  -7.024  -11.401 1.00 0.00 ? 39  VAL A CG2  2  
ATOM 2473  H H    . VAL A 1 39  ? -9.201  -10.462 -12.119 1.00 0.00 ? 39  VAL A H    2  
ATOM 2474  H HA   . VAL A 1 39  ? -9.299  -8.786  -9.735  1.00 0.00 ? 39  VAL A HA   2  
ATOM 2475  H HB   . VAL A 1 39  ? -9.768  -7.869  -12.573 1.00 0.00 ? 39  VAL A HB   2  
ATOM 2476  H HG11 . VAL A 1 39  ? -10.372 -6.227  -10.104 1.00 0.00 ? 39  VAL A HG11 2  
ATOM 2477  H HG12 . VAL A 1 39  ? -10.801 -5.891  -11.799 1.00 0.00 ? 39  VAL A HG12 2  
ATOM 2478  H HG13 . VAL A 1 39  ? -11.611 -7.210  -10.921 1.00 0.00 ? 39  VAL A HG13 2  
ATOM 2479  H HG21 . VAL A 1 39  ? -7.891  -7.017  -10.354 1.00 0.00 ? 39  VAL A HG21 2  
ATOM 2480  H HG22 . VAL A 1 39  ? -7.486  -7.608  -11.984 1.00 0.00 ? 39  VAL A HG22 2  
ATOM 2481  H HG23 . VAL A 1 39  ? -8.225  -6.002  -11.778 1.00 0.00 ? 39  VAL A HG23 2  
ATOM 2482  N N    . ARG A 1 40  ? -11.616 -9.530  -9.445  1.00 0.00 ? 40  ARG A N    2  
ATOM 2483  C CA   . ARG A 1 40  ? -12.959 -10.034 -9.215  1.00 0.00 ? 40  ARG A CA   2  
ATOM 2484  C C    . ARG A 1 40  ? -13.852 -8.927  -8.651  1.00 0.00 ? 40  ARG A C    2  
ATOM 2485  O O    . ARG A 1 40  ? -13.503 -7.749  -8.716  1.00 0.00 ? 40  ARG A O    2  
ATOM 2486  C CB   . ARG A 1 40  ? -12.945 -11.215 -8.241  1.00 0.00 ? 40  ARG A CB   2  
ATOM 2487  C CG   . ARG A 1 40  ? -11.608 -11.955 -8.297  1.00 0.00 ? 40  ARG A CG   2  
ATOM 2488  C CD   . ARG A 1 40  ? -11.571 -13.098 -7.280  1.00 0.00 ? 40  ARG A CD   2  
ATOM 2489  N NE   . ARG A 1 40  ? -12.025 -14.355 -7.915  1.00 0.00 ? 40  ARG A NE   2  
ATOM 2490  C CZ   . ARG A 1 40  ? -12.258 -15.493 -7.247  1.00 0.00 ? 40  ARG A CZ   2  
ATOM 2491  N NH1  . ARG A 1 40  ? -12.081 -15.539 -5.920  1.00 0.00 ? 40  ARG A NH1  2  
ATOM 2492  N NH2  . ARG A 1 40  ? -12.668 -16.585 -7.907  1.00 0.00 ? 40  ARG A NH2  2  
ATOM 2493  H H    . ARG A 1 40  ? -11.144 -9.197  -8.629  1.00 0.00 ? 40  ARG A H    2  
ATOM 2494  H HA   . ARG A 1 40  ? -13.308 -10.357 -10.196 1.00 0.00 ? 40  ARG A HA   2  
ATOM 2495  H HB2  . ARG A 1 40  ? -13.125 -10.857 -7.228  1.00 0.00 ? 40  ARG A HB2  2  
ATOM 2496  H HB3  . ARG A 1 40  ? -13.756 -11.902 -8.486  1.00 0.00 ? 40  ARG A HB3  2  
ATOM 2497  H HG2  . ARG A 1 40  ? -11.448 -12.350 -9.300  1.00 0.00 ? 40  ARG A HG2  2  
ATOM 2498  H HG3  . ARG A 1 40  ? -10.794 -11.258 -8.095  1.00 0.00 ? 40  ARG A HG3  2  
ATOM 2499  H HD2  . ARG A 1 40  ? -10.559 -13.220 -6.895  1.00 0.00 ? 40  ARG A HD2  2  
ATOM 2500  H HD3  . ARG A 1 40  ? -12.210 -12.859 -6.429  1.00 0.00 ? 40  ARG A HD3  2  
ATOM 2501  H HE   . ARG A 1 40  ? -12.167 -14.355 -8.905  1.00 0.00 ? 40  ARG A HE   2  
ATOM 2502  H HH11 . ARG A 1 40  ? -11.775 -14.724 -5.428  1.00 0.00 ? 40  ARG A HH11 2  
ATOM 2503  H HH12 . ARG A 1 40  ? -12.255 -16.388 -5.421  1.00 0.00 ? 40  ARG A HH12 2  
ATOM 2504  H HH21 . ARG A 1 40  ? -12.800 -16.551 -8.897  1.00 0.00 ? 40  ARG A HH21 2  
ATOM 2505  H HH22 . ARG A 1 40  ? -12.842 -17.434 -7.408  1.00 0.00 ? 40  ARG A HH22 2  
ATOM 2506  N N    . THR A 1 41  ? -14.987 -9.345  -8.109  1.00 0.00 ? 41  THR A N    2  
ATOM 2507  C CA   . THR A 1 41  ? -15.932 -8.403  -7.534  1.00 0.00 ? 41  THR A CA   2  
ATOM 2508  C C    . THR A 1 41  ? -15.373 -7.808  -6.240  1.00 0.00 ? 41  THR A C    2  
ATOM 2509  O O    . THR A 1 41  ? -14.755 -6.745  -6.258  1.00 0.00 ? 41  THR A O    2  
ATOM 2510  C CB   . THR A 1 41  ? -17.265 -9.129  -7.342  1.00 0.00 ? 41  THR A CB   2  
ATOM 2511  O OG1  . THR A 1 41  ? -16.890 -10.476 -7.065  1.00 0.00 ? 41  THR A OG1  2  
ATOM 2512  C CG2  . THR A 1 41  ? -18.072 -9.226  -8.638  1.00 0.00 ? 41  THR A CG2  2  
ATOM 2513  H H    . THR A 1 41  ? -15.263 -10.304 -8.060  1.00 0.00 ? 41  THR A H    2  
ATOM 2514  H HA   . THR A 1 41  ? -16.065 -7.578  -8.234  1.00 0.00 ? 41  THR A HA   2  
ATOM 2515  H HB   . THR A 1 41  ? -17.853 -8.662  -6.551  1.00 0.00 ? 41  THR A HB   2  
ATOM 2516  H HG1  . THR A 1 41  ? -17.592 -10.919 -6.507  1.00 0.00 ? 41  THR A HG1  2  
ATOM 2517  H HG21 . THR A 1 41  ? -17.825 -10.156 -9.151  1.00 0.00 ? 41  THR A HG21 2  
ATOM 2518  H HG22 . THR A 1 41  ? -19.137 -9.211  -8.406  1.00 0.00 ? 41  THR A HG22 2  
ATOM 2519  H HG23 . THR A 1 41  ? -17.828 -8.381  -9.282  1.00 0.00 ? 41  THR A HG23 2  
ATOM 2520  N N    . THR A 1 42  ? -15.608 -8.521  -5.148  1.00 0.00 ? 42  THR A N    2  
ATOM 2521  C CA   . THR A 1 42  ? -15.135 -8.077  -3.848  1.00 0.00 ? 42  THR A CA   2  
ATOM 2522  C C    . THR A 1 42  ? -13.717 -8.592  -3.592  1.00 0.00 ? 42  THR A C    2  
ATOM 2523  O O    . THR A 1 42  ? -13.273 -8.656  -2.447  1.00 0.00 ? 42  THR A O    2  
ATOM 2524  C CB   . THR A 1 42  ? -16.147 -8.534  -2.795  1.00 0.00 ? 42  THR A CB   2  
ATOM 2525  O OG1  . THR A 1 42  ? -16.168 -9.953  -2.928  1.00 0.00 ? 42  THR A OG1  2  
ATOM 2526  C CG2  . THR A 1 42  ? -17.577 -8.107  -3.133  1.00 0.00 ? 42  THR A CG2  2  
ATOM 2527  H H    . THR A 1 42  ? -16.111 -9.385  -5.142  1.00 0.00 ? 42  THR A H    2  
ATOM 2528  H HA   . THR A 1 42  ? -15.084 -6.988  -3.855  1.00 0.00 ? 42  THR A HA   2  
ATOM 2529  H HB   . THR A 1 42  ? -15.860 -8.186  -1.803  1.00 0.00 ? 42  THR A HB   2  
ATOM 2530  H HG1  . THR A 1 42  ? -15.792 -10.379 -2.105  1.00 0.00 ? 42  THR A HG1  2  
ATOM 2531  H HG21 . THR A 1 42  ? -18.240 -8.969  -3.061  1.00 0.00 ? 42  THR A HG21 2  
ATOM 2532  H HG22 . THR A 1 42  ? -17.902 -7.339  -2.431  1.00 0.00 ? 42  THR A HG22 2  
ATOM 2533  H HG23 . THR A 1 42  ? -17.607 -7.708  -4.147  1.00 0.00 ? 42  THR A HG23 2  
ATOM 2534  N N    . SER A 1 43  ? -13.046 -8.946  -4.678  1.00 0.00 ? 43  SER A N    2  
ATOM 2535  C CA   . SER A 1 43  ? -11.687 -9.453  -4.586  1.00 0.00 ? 43  SER A CA   2  
ATOM 2536  C C    . SER A 1 43  ? -10.948 -9.213  -5.903  1.00 0.00 ? 43  SER A C    2  
ATOM 2537  O O    . SER A 1 43  ? -11.511 -9.408  -6.979  1.00 0.00 ? 43  SER A O    2  
ATOM 2538  C CB   . SER A 1 43  ? -11.678 -10.943 -4.236  1.00 0.00 ? 43  SER A CB   2  
ATOM 2539  O OG   . SER A 1 43  ? -12.996 -11.479 -4.148  1.00 0.00 ? 43  SER A OG   2  
ATOM 2540  H H    . SER A 1 43  ? -13.414 -8.891  -5.606  1.00 0.00 ? 43  SER A H    2  
ATOM 2541  H HA   . SER A 1 43  ? -11.223 -8.889  -3.777  1.00 0.00 ? 43  SER A HA   2  
ATOM 2542  H HB2  . SER A 1 43  ? -11.115 -11.489 -4.993  1.00 0.00 ? 43  SER A HB2  2  
ATOM 2543  H HB3  . SER A 1 43  ? -11.162 -11.090 -3.287  1.00 0.00 ? 43  SER A HB3  2  
ATOM 2544  H HG   . SER A 1 43  ? -13.453 -11.410 -5.034  1.00 0.00 ? 43  SER A HG   2  
ATOM 2545  N N    . VAL A 1 44  ? -9.698  -8.792  -5.775  1.00 0.00 ? 44  VAL A N    2  
ATOM 2546  C CA   . VAL A 1 44  ? -8.876  -8.523  -6.943  1.00 0.00 ? 44  VAL A CA   2  
ATOM 2547  C C    . VAL A 1 44  ? -7.416  -8.846  -6.619  1.00 0.00 ? 44  VAL A C    2  
ATOM 2548  O O    . VAL A 1 44  ? -7.088  -9.177  -5.480  1.00 0.00 ? 44  VAL A O    2  
ATOM 2549  C CB   . VAL A 1 44  ? -9.080  -7.078  -7.404  1.00 0.00 ? 44  VAL A CB   2  
ATOM 2550  C CG1  . VAL A 1 44  ? -10.554 -6.679  -7.320  1.00 0.00 ? 44  VAL A CG1  2  
ATOM 2551  C CG2  . VAL A 1 44  ? -8.204  -6.117  -6.599  1.00 0.00 ? 44  VAL A CG2  2  
ATOM 2552  H H    . VAL A 1 44  ? -9.248  -8.636  -4.896  1.00 0.00 ? 44  VAL A H    2  
ATOM 2553  H HA   . VAL A 1 44  ? -9.213  -9.183  -7.742  1.00 0.00 ? 44  VAL A HA   2  
ATOM 2554  H HB   . VAL A 1 44  ? -8.775  -7.014  -8.449  1.00 0.00 ? 44  VAL A HB   2  
ATOM 2555  H HG11 . VAL A 1 44  ? -10.897 -6.771  -6.289  1.00 0.00 ? 44  VAL A HG11 2  
ATOM 2556  H HG12 . VAL A 1 44  ? -10.670 -5.646  -7.650  1.00 0.00 ? 44  VAL A HG12 2  
ATOM 2557  H HG13 . VAL A 1 44  ? -11.146 -7.334  -7.959  1.00 0.00 ? 44  VAL A HG13 2  
ATOM 2558  H HG21 . VAL A 1 44  ? -8.814  -5.293  -6.229  1.00 0.00 ? 44  VAL A HG21 2  
ATOM 2559  H HG22 . VAL A 1 44  ? -7.761  -6.648  -5.756  1.00 0.00 ? 44  VAL A HG22 2  
ATOM 2560  H HG23 . VAL A 1 44  ? -7.412  -5.724  -7.238  1.00 0.00 ? 44  VAL A HG23 2  
ATOM 2561  N N    . ARG A 1 45  ? -6.579  -8.740  -7.640  1.00 0.00 ? 45  ARG A N    2  
ATOM 2562  C CA   . ARG A 1 45  ? -5.162  -9.018  -7.478  1.00 0.00 ? 45  ARG A CA   2  
ATOM 2563  C C    . ARG A 1 45  ? -4.365  -8.396  -8.627  1.00 0.00 ? 45  ARG A C    2  
ATOM 2564  O O    . ARG A 1 45  ? -4.433  -8.868  -9.761  1.00 0.00 ? 45  ARG A O    2  
ATOM 2565  C CB   . ARG A 1 45  ? -4.897  -10.524 -7.439  1.00 0.00 ? 45  ARG A CB   2  
ATOM 2566  C CG   . ARG A 1 45  ? -3.401  -10.814 -7.294  1.00 0.00 ? 45  ARG A CG   2  
ATOM 2567  C CD   . ARG A 1 45  ? -3.011  -12.078 -8.063  1.00 0.00 ? 45  ARG A CD   2  
ATOM 2568  N NE   . ARG A 1 45  ? -3.008  -13.244 -7.151  1.00 0.00 ? 45  ARG A NE   2  
ATOM 2569  C CZ   . ARG A 1 45  ? -1.974  -13.584 -6.370  1.00 0.00 ? 45  ARG A CZ   2  
ATOM 2570  N NH1  . ARG A 1 45  ? -0.853  -12.850 -6.384  1.00 0.00 ? 45  ARG A NH1  2  
ATOM 2571  N NH2  . ARG A 1 45  ? -2.060  -14.659 -5.574  1.00 0.00 ? 45  ARG A NH2  2  
ATOM 2572  H H    . ARG A 1 45  ? -6.854  -8.471  -8.563  1.00 0.00 ? 45  ARG A H    2  
ATOM 2573  H HA   . ARG A 1 45  ? -4.896  -8.562  -6.525  1.00 0.00 ? 45  ARG A HA   2  
ATOM 2574  H HB2  . ARG A 1 45  ? -5.439  -10.971 -6.606  1.00 0.00 ? 45  ARG A HB2  2  
ATOM 2575  H HB3  . ARG A 1 45  ? -5.274  -10.987 -8.351  1.00 0.00 ? 45  ARG A HB3  2  
ATOM 2576  H HG2  . ARG A 1 45  ? -2.825  -9.966  -7.665  1.00 0.00 ? 45  ARG A HG2  2  
ATOM 2577  H HG3  . ARG A 1 45  ? -3.150  -10.933 -6.240  1.00 0.00 ? 45  ARG A HG3  2  
ATOM 2578  H HD2  . ARG A 1 45  ? -3.711  -12.247 -8.881  1.00 0.00 ? 45  ARG A HD2  2  
ATOM 2579  H HD3  . ARG A 1 45  ? -2.024  -11.952 -8.508  1.00 0.00 ? 45  ARG A HD3  2  
ATOM 2580  H HE   . ARG A 1 45  ? -3.829  -13.813 -7.116  1.00 0.00 ? 45  ARG A HE   2  
ATOM 2581  H HH11 . ARG A 1 45  ? -0.788  -12.048 -6.978  1.00 0.00 ? 45  ARG A HH11 2  
ATOM 2582  H HH12 . ARG A 1 45  ? -0.081  -13.103 -5.801  1.00 0.00 ? 45  ARG A HH12 2  
ATOM 2583  H HH21 . ARG A 1 45  ? -2.897  -15.207 -5.563  1.00 0.00 ? 45  ARG A HH21 2  
ATOM 2584  H HH22 . ARG A 1 45  ? -1.289  -14.913 -4.991  1.00 0.00 ? 45  ARG A HH22 2  
ATOM 2585  N N    . LEU A 1 46  ? -3.627  -7.347  -8.294  1.00 0.00 ? 46  LEU A N    2  
ATOM 2586  C CA   . LEU A 1 46  ? -2.818  -6.657  -9.283  1.00 0.00 ? 46  LEU A CA   2  
ATOM 2587  C C    . LEU A 1 46  ? -1.339  -6.945  -9.018  1.00 0.00 ? 46  LEU A C    2  
ATOM 2588  O O    . LEU A 1 46  ? -0.989  -7.509  -7.982  1.00 0.00 ? 46  LEU A O    2  
ATOM 2589  C CB   . LEU A 1 46  ? -3.159  -5.165  -9.307  1.00 0.00 ? 46  LEU A CB   2  
ATOM 2590  C CG   . LEU A 1 46  ? -2.339  -4.275  -8.371  1.00 0.00 ? 46  LEU A CG   2  
ATOM 2591  C CD1  . LEU A 1 46  ? -2.326  -2.826  -8.863  1.00 0.00 ? 46  LEU A CD1  2  
ATOM 2592  C CD2  . LEU A 1 46  ? -2.842  -4.386  -6.930  1.00 0.00 ? 46  LEU A CD2  2  
ATOM 2593  H H    . LEU A 1 46  ? -3.577  -6.970  -7.369  1.00 0.00 ? 46  LEU A H    2  
ATOM 2594  H HA   . LEU A 1 46  ? -3.080  -7.063  -10.260 1.00 0.00 ? 46  LEU A HA   2  
ATOM 2595  H HB2  . LEU A 1 46  ? -3.032  -4.800  -10.327 1.00 0.00 ? 46  LEU A HB2  2  
ATOM 2596  H HB3  . LEU A 1 46  ? -4.213  -5.050  -9.056  1.00 0.00 ? 46  LEU A HB3  2  
ATOM 2597  H HG   . LEU A 1 46  ? -1.308  -4.627  -8.380  1.00 0.00 ? 46  LEU A HG   2  
ATOM 2598  H HD11 . LEU A 1 46  ? -2.855  -2.195  -8.149  1.00 0.00 ? 46  LEU A HD11 2  
ATOM 2599  H HD12 . LEU A 1 46  ? -1.296  -2.484  -8.958  1.00 0.00 ? 46  LEU A HD12 2  
ATOM 2600  H HD13 . LEU A 1 46  ? -2.819  -2.768  -9.834  1.00 0.00 ? 46  LEU A HD13 2  
ATOM 2601  H HD21 . LEU A 1 46  ? -2.676  -3.441  -6.413  1.00 0.00 ? 46  LEU A HD21 2  
ATOM 2602  H HD22 . LEU A 1 46  ? -3.908  -4.615  -6.934  1.00 0.00 ? 46  LEU A HD22 2  
ATOM 2603  H HD23 . LEU A 1 46  ? -2.301  -5.181  -6.416  1.00 0.00 ? 46  LEU A HD23 2  
ATOM 2604  N N    . ILE A 1 47  ? -0.511  -6.546  -9.972  1.00 0.00 ? 47  ILE A N    2  
ATOM 2605  C CA   . ILE A 1 47  ? 0.922   -6.755  -9.855  1.00 0.00 ? 47  ILE A CA   2  
ATOM 2606  C C    . ILE A 1 47  ? 1.657   -5.506  -10.344 1.00 0.00 ? 47  ILE A C    2  
ATOM 2607  O O    . ILE A 1 47  ? 1.255   -4.891  -11.331 1.00 0.00 ? 47  ILE A O    2  
ATOM 2608  C CB   . ILE A 1 47  ? 1.338   -8.037  -10.579 1.00 0.00 ? 47  ILE A CB   2  
ATOM 2609  C CG1  . ILE A 1 47  ? 1.493   -7.792  -12.082 1.00 0.00 ? 47  ILE A CG1  2  
ATOM 2610  C CG2  . ILE A 1 47  ? 0.361   -9.176  -10.282 1.00 0.00 ? 47  ILE A CG2  2  
ATOM 2611  C CD1  . ILE A 1 47  ? 0.157   -7.394  -12.713 1.00 0.00 ? 47  ILE A CD1  2  
ATOM 2612  H H    . ILE A 1 47  ? -0.804  -6.088  -10.812 1.00 0.00 ? 47  ILE A H    2  
ATOM 2613  H HA   . ILE A 1 47  ? 1.146   -6.896  -8.797  1.00 0.00 ? 47  ILE A HA   2  
ATOM 2614  H HB   . ILE A 1 47  ? 2.313   -8.342  -10.201 1.00 0.00 ? 47  ILE A HB   2  
ATOM 2615  H HG12 . ILE A 1 47  ? 2.228   -7.005  -12.251 1.00 0.00 ? 47  ILE A HG12 2  
ATOM 2616  H HG13 . ILE A 1 47  ? 1.873   -8.693  -12.563 1.00 0.00 ? 47  ILE A HG13 2  
ATOM 2617  H HG21 . ILE A 1 47  ? 0.545   -9.560  -9.278  1.00 0.00 ? 47  ILE A HG21 2  
ATOM 2618  H HG22 . ILE A 1 47  ? -0.661  -8.804  -10.347 1.00 0.00 ? 47  ILE A HG22 2  
ATOM 2619  H HG23 . ILE A 1 47  ? 0.504   -9.976  -11.009 1.00 0.00 ? 47  ILE A HG23 2  
ATOM 2620  H HD11 . ILE A 1 47  ? -0.013  -7.991  -13.609 1.00 0.00 ? 47  ILE A HD11 2  
ATOM 2621  H HD12 . ILE A 1 47  ? -0.649  -7.572  -12.000 1.00 0.00 ? 47  ILE A HD12 2  
ATOM 2622  H HD13 . ILE A 1 47  ? 0.181   -6.338  -12.979 1.00 0.00 ? 47  ILE A HD13 2  
ATOM 2623  N N    . TRP A 1 48  ? 2.722   -5.167  -9.632  1.00 0.00 ? 48  TRP A N    2  
ATOM 2624  C CA   . TRP A 1 48  ? 3.516   -4.002  -9.982  1.00 0.00 ? 48  TRP A CA   2  
ATOM 2625  C C    . TRP A 1 48  ? 4.988   -4.420  -9.992  1.00 0.00 ? 48  TRP A C    2  
ATOM 2626  O O    . TRP A 1 48  ? 5.310   -5.579  -9.737  1.00 0.00 ? 48  TRP A O    2  
ATOM 2627  C CB   . TRP A 1 48  ? 3.232   -2.838  -9.030  1.00 0.00 ? 48  TRP A CB   2  
ATOM 2628  C CG   . TRP A 1 48  ? 3.701   -3.080  -7.594  1.00 0.00 ? 48  TRP A CG   2  
ATOM 2629  C CD1  . TRP A 1 48  ? 4.817   -2.629  -7.004  1.00 0.00 ? 48  TRP A CD1  2  
ATOM 2630  C CD2  . TRP A 1 48  ? 3.018   -3.853  -6.585  1.00 0.00 ? 48  TRP A CD2  2  
ATOM 2631  N NE1  . TRP A 1 48  ? 4.902   -3.053  -5.693  1.00 0.00 ? 48  TRP A NE1  2  
ATOM 2632  C CE2  . TRP A 1 48  ? 3.773   -3.821  -5.430  1.00 0.00 ? 48  TRP A CE2  2  
ATOM 2633  C CE3  . TRP A 1 48  ? 1.801   -4.555  -6.645  1.00 0.00 ? 48  TRP A CE3  2  
ATOM 2634  C CZ2  . TRP A 1 48  ? 3.397   -4.473  -4.250  1.00 0.00 ? 48  TRP A CZ2  2  
ATOM 2635  C CZ3  . TRP A 1 48  ? 1.440   -5.201  -5.457  1.00 0.00 ? 48  TRP A CZ3  2  
ATOM 2636  C CH2  . TRP A 1 48  ? 2.189   -5.179  -4.287  1.00 0.00 ? 48  TRP A CH2  2  
ATOM 2637  H H    . TRP A 1 48  ? 3.042   -5.672  -8.831  1.00 0.00 ? 48  TRP A H    2  
ATOM 2638  H HA   . TRP A 1 48  ? 3.214   -3.679  -10.978 1.00 0.00 ? 48  TRP A HA   2  
ATOM 2639  H HB2  . TRP A 1 48  ? 3.718   -1.941  -9.414  1.00 0.00 ? 48  TRP A HB2  2  
ATOM 2640  H HB3  . TRP A 1 48  ? 2.160   -2.642  -9.023  1.00 0.00 ? 48  TRP A HB3  2  
ATOM 2641  H HD1  . TRP A 1 48  ? 5.563   -2.006  -7.497  1.00 0.00 ? 48  TRP A HD1  2  
ATOM 2642  H HE1  . TRP A 1 48  ? 5.706   -2.828  -4.993  1.00 0.00 ? 48  TRP A HE1  2  
ATOM 2643  H HE3  . TRP A 1 48  ? 1.187   -4.595  -7.544  1.00 0.00 ? 48  TRP A HE3  2  
ATOM 2644  H HZ2  . TRP A 1 48  ? 4.012   -4.433  -3.351  1.00 0.00 ? 48  TRP A HZ2  2  
ATOM 2645  H HZ3  . TRP A 1 48  ? 0.504   -5.761  -5.449  1.00 0.00 ? 48  TRP A HZ3  2  
ATOM 2646  H HH2  . TRP A 1 48  ? 1.838   -5.709  -3.402  1.00 0.00 ? 48  TRP A HH2  2  
ATOM 2647  N N    . GLN A 1 49  ? 5.843   -3.452  -10.289 1.00 0.00 ? 49  GLN A N    2  
ATOM 2648  C CA   . GLN A 1 49  ? 7.273   -3.704  -10.336 1.00 0.00 ? 49  GLN A CA   2  
ATOM 2649  C C    . GLN A 1 49  ? 8.036   -2.567  -9.653  1.00 0.00 ? 49  GLN A C    2  
ATOM 2650  O O    . GLN A 1 49  ? 7.492   -1.482  -9.454  1.00 0.00 ? 49  GLN A O    2  
ATOM 2651  C CB   . GLN A 1 49  ? 7.749   -3.895  -11.777 1.00 0.00 ? 49  GLN A CB   2  
ATOM 2652  C CG   . GLN A 1 49  ? 7.693   -5.370  -12.182 1.00 0.00 ? 49  GLN A CG   2  
ATOM 2653  C CD   . GLN A 1 49  ? 8.561   -5.633  -13.414 1.00 0.00 ? 49  GLN A CD   2  
ATOM 2654  O OE1  . GLN A 1 49  ? 9.679   -6.113  -13.327 1.00 0.00 ? 49  GLN A OE1  2  
ATOM 2655  N NE2  . GLN A 1 49  ? 7.986   -5.293  -14.564 1.00 0.00 ? 49  GLN A NE2  2  
ATOM 2656  H H    . GLN A 1 49  ? 5.573   -2.511  -10.495 1.00 0.00 ? 49  GLN A H    2  
ATOM 2657  H HA   . GLN A 1 49  ? 7.421   -4.633  -9.784  1.00 0.00 ? 49  GLN A HA   2  
ATOM 2658  H HB2  . GLN A 1 49  ? 7.128   -3.306  -12.450 1.00 0.00 ? 49  GLN A HB2  2  
ATOM 2659  H HB3  . GLN A 1 49  ? 8.769   -3.525  -11.879 1.00 0.00 ? 49  GLN A HB3  2  
ATOM 2660  H HG2  . GLN A 1 49  ? 8.033   -5.991  -11.354 1.00 0.00 ? 49  GLN A HG2  2  
ATOM 2661  H HG3  . GLN A 1 49  ? 6.662   -5.654  -12.392 1.00 0.00 ? 49  GLN A HG3  2  
ATOM 2662  H HE21 . GLN A 1 49  ? 7.065   -4.904  -14.566 1.00 0.00 ? 49  GLN A HE21 2  
ATOM 2663  H HE22 . GLN A 1 49  ? 8.474   -5.428  -15.426 1.00 0.00 ? 49  GLN A HE22 2  
ATOM 2664  N N    . PRO A 1 50  ? 9.316   -2.863  -9.302  1.00 0.00 ? 50  PRO A N    2  
ATOM 2665  C CA   . PRO A 1 50  ? 10.159  -1.878  -8.646  1.00 0.00 ? 50  PRO A CA   2  
ATOM 2666  C C    . PRO A 1 50  ? 10.639  -0.817  -9.639  1.00 0.00 ? 50  PRO A C    2  
ATOM 2667  O O    . PRO A 1 50  ? 10.753  -1.087  -10.833 1.00 0.00 ? 50  PRO A O    2  
ATOM 2668  C CB   . PRO A 1 50  ? 11.298  -2.679  -8.036  1.00 0.00 ? 50  PRO A CB   2  
ATOM 2669  C CG   . PRO A 1 50  ? 11.304  -4.014  -8.762  1.00 0.00 ? 50  PRO A CG   2  
ATOM 2670  C CD   . PRO A 1 50  ? 9.993   -4.138  -9.522  1.00 0.00 ? 50  PRO A CD   2  
ATOM 2671  H HA   . PRO A 1 50  ? 9.638   -1.385  -7.949  1.00 0.00 ? 50  PRO A HA   2  
ATOM 2672  H HB2  . PRO A 1 50  ? 12.249  -2.162  -8.161  1.00 0.00 ? 50  PRO A HB2  2  
ATOM 2673  H HB3  . PRO A 1 50  ? 11.148  -2.817  -6.965  1.00 0.00 ? 50  PRO A HB3  2  
ATOM 2674  H HG2  . PRO A 1 50  ? 12.149  -4.073  -9.447  1.00 0.00 ? 50  PRO A HG2  2  
ATOM 2675  H HG3  . PRO A 1 50  ? 11.411  -4.834  -8.051  1.00 0.00 ? 50  PRO A HG3  2  
ATOM 2676  H HD2  . PRO A 1 50  ? 10.166  -4.317  -10.583 1.00 0.00 ? 50  PRO A HD2  2  
ATOM 2677  H HD3  . PRO A 1 50  ? 9.397   -4.971  -9.151  1.00 0.00 ? 50  PRO A HD3  2  
ATOM 2678  N N    . PRO A 1 51  ? 10.913  0.398   -9.093  1.00 0.00 ? 51  PRO A N    2  
ATOM 2679  C CA   . PRO A 1 51  ? 11.377  1.500   -9.918  1.00 0.00 ? 51  PRO A CA   2  
ATOM 2680  C C    . PRO A 1 51  ? 12.843  1.309   -10.314 1.00 0.00 ? 51  PRO A C    2  
ATOM 2681  O O    . PRO A 1 51  ? 13.710  1.172   -9.453  1.00 0.00 ? 51  PRO A O    2  
ATOM 2682  C CB   . PRO A 1 51  ? 11.147  2.745   -9.077  1.00 0.00 ? 51  PRO A CB   2  
ATOM 2683  C CG   . PRO A 1 51  ? 10.998  2.258   -7.644  1.00 0.00 ? 51  PRO A CG   2  
ATOM 2684  C CD   . PRO A 1 51  ? 10.788  0.754   -7.683  1.00 0.00 ? 51  PRO A CD   2  
ATOM 2685  H HA   . PRO A 1 51  ? 10.864  1.533   -10.776 1.00 0.00 ? 51  PRO A HA   2  
ATOM 2686  H HB2  . PRO A 1 51  ? 11.983  3.439   -9.168  1.00 0.00 ? 51  PRO A HB2  2  
ATOM 2687  H HB3  . PRO A 1 51  ? 10.254  3.278   -9.403  1.00 0.00 ? 51  PRO A HB3  2  
ATOM 2688  H HG2  . PRO A 1 51  ? 11.887  2.505   -7.063  1.00 0.00 ? 51  PRO A HG2  2  
ATOM 2689  H HG3  . PRO A 1 51  ? 10.154  2.749   -7.160  1.00 0.00 ? 51  PRO A HG3  2  
ATOM 2690  H HD2  . PRO A 1 51  ? 11.530  0.234   -7.077  1.00 0.00 ? 51  PRO A HD2  2  
ATOM 2691  H HD3  . PRO A 1 51  ? 9.809   0.480   -7.291  1.00 0.00 ? 51  PRO A HD3  2  
ATOM 2692  N N    . ALA A 1 52  ? 13.074  1.305   -11.619 1.00 0.00 ? 52  ALA A N    2  
ATOM 2693  C CA   . ALA A 1 52  ? 14.419  1.133   -12.140 1.00 0.00 ? 52  ALA A CA   2  
ATOM 2694  C C    . ALA A 1 52  ? 15.392  1.981   -11.319 1.00 0.00 ? 52  ALA A C    2  
ATOM 2695  O O    . ALA A 1 52  ? 16.560  1.624   -11.169 1.00 0.00 ? 52  ALA A O    2  
ATOM 2696  C CB   . ALA A 1 52  ? 14.442  1.495   -13.626 1.00 0.00 ? 52  ALA A CB   2  
ATOM 2697  H H    . ALA A 1 52  ? 12.363  1.417   -12.313 1.00 0.00 ? 52  ALA A H    2  
ATOM 2698  H HA   . ALA A 1 52  ? 14.686  0.081   -12.031 1.00 0.00 ? 52  ALA A HA   2  
ATOM 2699  H HB1  . ALA A 1 52  ? 13.439  1.776   -13.947 1.00 0.00 ? 52  ALA A HB1  2  
ATOM 2700  H HB2  . ALA A 1 52  ? 15.122  2.331   -13.786 1.00 0.00 ? 52  ALA A HB2  2  
ATOM 2701  H HB3  . ALA A 1 52  ? 14.780  0.635   -14.205 1.00 0.00 ? 52  ALA A HB3  2  
ATOM 2702  N N    . ALA A 1 53  ? 14.875  3.089   -10.807 1.00 0.00 ? 53  ALA A N    2  
ATOM 2703  C CA   . ALA A 1 53  ? 15.684  3.991   -10.005 1.00 0.00 ? 53  ALA A CA   2  
ATOM 2704  C C    . ALA A 1 53  ? 15.121  4.045   -8.583  1.00 0.00 ? 53  ALA A C    2  
ATOM 2705  O O    . ALA A 1 53  ? 14.339  4.936   -8.255  1.00 0.00 ? 53  ALA A O    2  
ATOM 2706  C CB   . ALA A 1 53  ? 15.724  5.368   -10.669 1.00 0.00 ? 53  ALA A CB   2  
ATOM 2707  H H    . ALA A 1 53  ? 13.925  3.372   -10.933 1.00 0.00 ? 53  ALA A H    2  
ATOM 2708  H HA   . ALA A 1 53  ? 16.696  3.588   -9.971  1.00 0.00 ? 53  ALA A HA   2  
ATOM 2709  H HB1  . ALA A 1 53  ? 14.840  5.937   -10.380 1.00 0.00 ? 53  ALA A HB1  2  
ATOM 2710  H HB2  . ALA A 1 53  ? 16.619  5.901   -10.347 1.00 0.00 ? 53  ALA A HB2  2  
ATOM 2711  H HB3  . ALA A 1 53  ? 15.742  5.249   -11.752 1.00 0.00 ? 53  ALA A HB3  2  
ATOM 2712  N N    . PRO A 1 54  ? 15.552  3.055   -7.756  1.00 0.00 ? 54  PRO A N    2  
ATOM 2713  C CA   . PRO A 1 54  ? 15.100  2.982   -6.377  1.00 0.00 ? 54  PRO A CA   2  
ATOM 2714  C C    . PRO A 1 54  ? 15.786  4.045   -5.518  1.00 0.00 ? 54  PRO A C    2  
ATOM 2715  O O    . PRO A 1 54  ? 15.180  4.589   -4.595  1.00 0.00 ? 54  PRO A O    2  
ATOM 2716  C CB   . PRO A 1 54  ? 15.419  1.563   -5.934  1.00 0.00 ? 54  PRO A CB   2  
ATOM 2717  C CG   . PRO A 1 54  ? 16.452  1.041   -6.918  1.00 0.00 ? 54  PRO A CG   2  
ATOM 2718  C CD   . PRO A 1 54  ? 16.478  1.983   -8.111  1.00 0.00 ? 54  PRO A CD   2  
ATOM 2719  H HA   . PRO A 1 54  ? 14.121  3.176   -6.322  1.00 0.00 ? 54  PRO A HA   2  
ATOM 2720  H HB2  . PRO A 1 54  ? 15.808  1.551   -4.915  1.00 0.00 ? 54  PRO A HB2  2  
ATOM 2721  H HB3  . PRO A 1 54  ? 14.524  0.941   -5.940  1.00 0.00 ? 54  PRO A HB3  2  
ATOM 2722  H HG2  . PRO A 1 54  ? 17.435  0.991   -6.450  1.00 0.00 ? 54  PRO A HG2  2  
ATOM 2723  H HG3  . PRO A 1 54  ? 16.199  0.029   -7.236  1.00 0.00 ? 54  PRO A HG3  2  
ATOM 2724  H HD2  . PRO A 1 54  ? 17.482  2.370   -8.288  1.00 0.00 ? 54  PRO A HD2  2  
ATOM 2725  H HD3  . PRO A 1 54  ? 16.166  1.476   -9.023  1.00 0.00 ? 54  PRO A HD3  2  
ATOM 2726  N N    . ASN A 1 55  ? 17.041  4.311   -5.851  1.00 0.00 ? 55  ASN A N    2  
ATOM 2727  C CA   . ASN A 1 55  ? 17.815  5.300   -5.122  1.00 0.00 ? 55  ASN A CA   2  
ATOM 2728  C C    . ASN A 1 55  ? 17.535  5.158   -3.624  1.00 0.00 ? 55  ASN A C    2  
ATOM 2729  O O    . ASN A 1 55  ? 17.404  6.155   -2.916  1.00 0.00 ? 55  ASN A O    2  
ATOM 2730  C CB   . ASN A 1 55  ? 17.431  6.720   -5.542  1.00 0.00 ? 55  ASN A CB   2  
ATOM 2731  C CG   . ASN A 1 55  ? 17.044  6.769   -7.021  1.00 0.00 ? 55  ASN A CG   2  
ATOM 2732  O OD1  . ASN A 1 55  ? 17.881  6.812   -7.907  1.00 0.00 ? 55  ASN A OD1  2  
ATOM 2733  N ND2  . ASN A 1 55  ? 15.732  6.759   -7.237  1.00 0.00 ? 55  ASN A ND2  2  
ATOM 2734  H H    . ASN A 1 55  ? 17.526  3.865   -6.603  1.00 0.00 ? 55  ASN A H    2  
ATOM 2735  H HA   . ASN A 1 55  ? 18.855  5.092   -5.373  1.00 0.00 ? 55  ASN A HA   2  
ATOM 2736  H HB2  . ASN A 1 55  ? 16.598  7.071   -4.932  1.00 0.00 ? 55  ASN A HB2  2  
ATOM 2737  H HB3  . ASN A 1 55  ? 18.267  7.396   -5.359  1.00 0.00 ? 55  ASN A HB3  2  
ATOM 2738  H HD21 . ASN A 1 55  ? 15.098  6.723   -6.465  1.00 0.00 ? 55  ASN A HD21 2  
ATOM 2739  H HD22 . ASN A 1 55  ? 15.379  6.788   -8.173  1.00 0.00 ? 55  ASN A HD22 2  
ATOM 2740  N N    . GLY A 1 56  ? 17.452  3.910   -3.186  1.00 0.00 ? 56  GLY A N    2  
ATOM 2741  C CA   . GLY A 1 56  ? 17.190  3.625   -1.786  1.00 0.00 ? 56  GLY A CA   2  
ATOM 2742  C C    . GLY A 1 56  ? 16.690  2.190   -1.603  1.00 0.00 ? 56  GLY A C    2  
ATOM 2743  O O    . GLY A 1 56  ? 15.768  1.758   -2.293  1.00 0.00 ? 56  GLY A O    2  
ATOM 2744  H H    . GLY A 1 56  ? 17.561  3.105   -3.769  1.00 0.00 ? 56  GLY A H    2  
ATOM 2745  H HA2  . GLY A 1 56  ? 18.100  3.773   -1.204  1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2746  H HA3  . GLY A 1 56  ? 16.448  4.324   -1.401  1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2747  N N    . ILE A 1 57  ? 17.321  1.492   -0.670  1.00 0.00 ? 57  ILE A N    2  
ATOM 2748  C CA   . ILE A 1 57  ? 16.952  0.116   -0.388  1.00 0.00 ? 57  ILE A CA   2  
ATOM 2749  C C    . ILE A 1 57  ? 15.496  0.069   0.083   1.00 0.00 ? 57  ILE A C    2  
ATOM 2750  O O    . ILE A 1 57  ? 15.175  0.552   1.167   1.00 0.00 ? 57  ILE A O    2  
ATOM 2751  C CB   . ILE A 1 57  ? 17.938  -0.512  0.599   1.00 0.00 ? 57  ILE A CB   2  
ATOM 2752  C CG1  . ILE A 1 57  ? 19.197  -1.000  -0.119  1.00 0.00 ? 57  ILE A CG1  2  
ATOM 2753  C CG2  . ILE A 1 57  ? 17.270  -1.627  1.407   1.00 0.00 ? 57  ILE A CG2  2  
ATOM 2754  C CD1  . ILE A 1 57  ? 19.622  -0.015  -1.211  1.00 0.00 ? 57  ILE A CD1  2  
ATOM 2755  H H    . ILE A 1 57  ? 18.070  1.851   -0.114  1.00 0.00 ? 57  ILE A H    2  
ATOM 2756  H HA   . ILE A 1 57  ? 17.031  -0.442  -1.321  1.00 0.00 ? 57  ILE A HA   2  
ATOM 2757  H HB   . ILE A 1 57  ? 18.248  0.256   1.307   1.00 0.00 ? 57  ILE A HB   2  
ATOM 2758  H HG12 . ILE A 1 57  ? 20.007  -1.122  0.600   1.00 0.00 ? 57  ILE A HG12 2  
ATOM 2759  H HG13 . ILE A 1 57  ? 19.013  -1.980  -0.560  1.00 0.00 ? 57  ILE A HG13 2  
ATOM 2760  H HG21 . ILE A 1 57  ? 16.662  -1.189  2.198   1.00 0.00 ? 57  ILE A HG21 2  
ATOM 2761  H HG22 . ILE A 1 57  ? 16.637  -2.223  0.749   1.00 0.00 ? 57  ILE A HG22 2  
ATOM 2762  H HG23 . ILE A 1 57  ? 18.036  -2.264  1.849   1.00 0.00 ? 57  ILE A HG23 2  
ATOM 2763  H HD11 . ILE A 1 57  ? 20.592  -0.312  -1.610  1.00 0.00 ? 57  ILE A HD11 2  
ATOM 2764  H HD12 . ILE A 1 57  ? 18.883  -0.020  -2.012  1.00 0.00 ? 57  ILE A HD12 2  
ATOM 2765  H HD13 . ILE A 1 57  ? 19.693  0.987   -0.788  1.00 0.00 ? 57  ILE A HD13 2  
ATOM 2766  N N    . ILE A 1 58  ? 14.655  -0.518  -0.757  1.00 0.00 ? 58  ILE A N    2  
ATOM 2767  C CA   . ILE A 1 58  ? 13.242  -0.634  -0.440  1.00 0.00 ? 58  ILE A CA   2  
ATOM 2768  C C    . ILE A 1 58  ? 13.079  -1.401  0.874   1.00 0.00 ? 58  ILE A C    2  
ATOM 2769  O O    . ILE A 1 58  ? 13.661  -2.471  1.048   1.00 0.00 ? 58  ILE A O    2  
ATOM 2770  C CB   . ILE A 1 58  ? 12.480  -1.254  -1.613  1.00 0.00 ? 58  ILE A CB   2  
ATOM 2771  C CG1  . ILE A 1 58  ? 12.736  -0.478  -2.906  1.00 0.00 ? 58  ILE A CG1  2  
ATOM 2772  C CG2  . ILE A 1 58  ? 10.986  -1.366  -1.298  1.00 0.00 ? 58  ILE A CG2  2  
ATOM 2773  C CD1  . ILE A 1 58  ? 12.358  0.996   -2.745  1.00 0.00 ? 58  ILE A CD1  2  
ATOM 2774  H H    . ILE A 1 58  ? 14.925  -0.908  -1.637  1.00 0.00 ? 58  ILE A H    2  
ATOM 2775  H HA   . ILE A 1 58  ? 12.854  0.375   -0.301  1.00 0.00 ? 58  ILE A HA   2  
ATOM 2776  H HB   . ILE A 1 58  ? 12.853  -2.267  -1.766  1.00 0.00 ? 58  ILE A HB   2  
ATOM 2777  H HG12 . ILE A 1 58  ? 13.788  -0.559  -3.180  1.00 0.00 ? 58  ILE A HG12 2  
ATOM 2778  H HG13 . ILE A 1 58  ? 12.160  -0.918  -3.719  1.00 0.00 ? 58  ILE A HG13 2  
ATOM 2779  H HG21 . ILE A 1 58  ? 10.410  -0.922  -2.110  1.00 0.00 ? 58  ILE A HG21 2  
ATOM 2780  H HG22 . ILE A 1 58  ? 10.715  -2.416  -1.192  1.00 0.00 ? 58  ILE A HG22 2  
ATOM 2781  H HG23 . ILE A 1 58  ? 10.770  -0.839  -0.369  1.00 0.00 ? 58  ILE A HG23 2  
ATOM 2782  H HD11 . ILE A 1 58  ? 12.247  1.452   -3.728  1.00 0.00 ? 58  ILE A HD11 2  
ATOM 2783  H HD12 . ILE A 1 58  ? 11.417  1.072   -2.201  1.00 0.00 ? 58  ILE A HD12 2  
ATOM 2784  H HD13 . ILE A 1 58  ? 13.141  1.514   -2.191  1.00 0.00 ? 58  ILE A HD13 2  
ATOM 2785  N N    . LEU A 1 59  ? 12.286  -0.824  1.765   1.00 0.00 ? 59  LEU A N    2  
ATOM 2786  C CA   . LEU A 1 59  ? 12.040  -1.440  3.057   1.00 0.00 ? 59  LEU A CA   2  
ATOM 2787  C C    . LEU A 1 59  ? 10.662  -2.105  3.046   1.00 0.00 ? 59  LEU A C    2  
ATOM 2788  O O    . LEU A 1 59  ? 10.407  -3.025  3.822   1.00 0.00 ? 59  LEU A O    2  
ATOM 2789  C CB   . LEU A 1 59  ? 12.220  -0.417  4.181   1.00 0.00 ? 59  LEU A CB   2  
ATOM 2790  C CG   . LEU A 1 59  ? 13.475  0.454   4.100   1.00 0.00 ? 59  LEU A CG   2  
ATOM 2791  C CD1  . LEU A 1 59  ? 13.497  1.489   5.226   1.00 0.00 ? 59  LEU A CD1  2  
ATOM 2792  C CD2  . LEU A 1 59  ? 14.740  -0.406  4.086   1.00 0.00 ? 59  LEU A CD2  2  
ATOM 2793  H H    . LEU A 1 59  ? 11.817  0.046   1.615   1.00 0.00 ? 59  LEU A H    2  
ATOM 2794  H HA   . LEU A 1 59  ? 12.795  -2.213  3.200   1.00 0.00 ? 59  LEU A HA   2  
ATOM 2795  H HB2  . LEU A 1 59  ? 11.348  0.236   4.194   1.00 0.00 ? 59  LEU A HB2  2  
ATOM 2796  H HB3  . LEU A 1 59  ? 12.233  -0.951  5.132   1.00 0.00 ? 59  LEU A HB3  2  
ATOM 2797  H HG   . LEU A 1 59  ? 13.449  1.003   3.159   1.00 0.00 ? 59  LEU A HG   2  
ATOM 2798  H HD11 . LEU A 1 59  ? 13.921  1.039   6.124   1.00 0.00 ? 59  LEU A HD11 2  
ATOM 2799  H HD12 . LEU A 1 59  ? 14.107  2.341   4.925   1.00 0.00 ? 59  LEU A HD12 2  
ATOM 2800  H HD13 . LEU A 1 59  ? 12.481  1.824   5.432   1.00 0.00 ? 59  LEU A HD13 2  
ATOM 2801  H HD21 . LEU A 1 59  ? 15.597  0.203   4.376   1.00 0.00 ? 59  LEU A HD21 2  
ATOM 2802  H HD22 . LEU A 1 59  ? 14.626  -1.231  4.790   1.00 0.00 ? 59  LEU A HD22 2  
ATOM 2803  H HD23 . LEU A 1 59  ? 14.899  -0.803  3.084   1.00 0.00 ? 59  LEU A HD23 2  
ATOM 2804  N N    . ALA A 1 60  ? 9.810   -1.614  2.158   1.00 0.00 ? 60  ALA A N    2  
ATOM 2805  C CA   . ALA A 1 60  ? 8.465   -2.149  2.036   1.00 0.00 ? 60  ALA A CA   2  
ATOM 2806  C C    . ALA A 1 60  ? 7.682   -1.321  1.015   1.00 0.00 ? 60  ALA A C    2  
ATOM 2807  O O    . ALA A 1 60  ? 8.254   -0.481  0.322   1.00 0.00 ? 60  ALA A O    2  
ATOM 2808  C CB   . ALA A 1 60  ? 7.794   -2.164  3.411   1.00 0.00 ? 60  ALA A CB   2  
ATOM 2809  H H    . ALA A 1 60  ? 10.026  -0.865  1.531   1.00 0.00 ? 60  ALA A H    2  
ATOM 2810  H HA   . ALA A 1 60  ? 8.547   -3.174  1.674   1.00 0.00 ? 60  ALA A HA   2  
ATOM 2811  H HB1  . ALA A 1 60  ? 8.390   -1.579  4.112   1.00 0.00 ? 60  ALA A HB1  2  
ATOM 2812  H HB2  . ALA A 1 60  ? 6.797   -1.732  3.334   1.00 0.00 ? 60  ALA A HB2  2  
ATOM 2813  H HB3  . ALA A 1 60  ? 7.719   -3.191  3.768   1.00 0.00 ? 60  ALA A HB3  2  
ATOM 2814  N N    . TYR A 1 61  ? 6.386   -1.587  0.954   1.00 0.00 ? 61  TYR A N    2  
ATOM 2815  C CA   . TYR A 1 61  ? 5.519   -0.878  0.029   1.00 0.00 ? 61  TYR A CA   2  
ATOM 2816  C C    . TYR A 1 61  ? 4.146   -0.619  0.653   1.00 0.00 ? 61  TYR A C    2  
ATOM 2817  O O    . TYR A 1 61  ? 3.853   -1.110  1.742   1.00 0.00 ? 61  TYR A O    2  
ATOM 2818  C CB   . TYR A 1 61  ? 5.350   -1.798  -1.182  1.00 0.00 ? 61  TYR A CB   2  
ATOM 2819  C CG   . TYR A 1 61  ? 6.494   -1.710  -2.194  1.00 0.00 ? 61  TYR A CG   2  
ATOM 2820  C CD1  . TYR A 1 61  ? 7.651   -2.435  -1.992  1.00 0.00 ? 61  TYR A CD1  2  
ATOM 2821  C CD2  . TYR A 1 61  ? 6.369   -0.907  -3.309  1.00 0.00 ? 61  TYR A CD2  2  
ATOM 2822  C CE1  . TYR A 1 61  ? 8.728   -2.353  -2.944  1.00 0.00 ? 61  TYR A CE1  2  
ATOM 2823  C CE2  . TYR A 1 61  ? 7.446   -0.824  -4.261  1.00 0.00 ? 61  TYR A CE2  2  
ATOM 2824  C CZ   . TYR A 1 61  ? 8.572   -1.551  -4.032  1.00 0.00 ? 61  TYR A CZ   2  
ATOM 2825  O OH   . TYR A 1 61  ? 9.589   -1.474  -4.932  1.00 0.00 ? 61  TYR A OH   2  
ATOM 2826  H H    . TYR A 1 61  ? 5.928   -2.273  1.521   1.00 0.00 ? 61  TYR A H    2  
ATOM 2827  H HA   . TYR A 1 61  ? 5.988   0.077   -0.207  1.00 0.00 ? 61  TYR A HA   2  
ATOM 2828  H HB2  . TYR A 1 61  ? 5.265   -2.827  -0.834  1.00 0.00 ? 61  TYR A HB2  2  
ATOM 2829  H HB3  . TYR A 1 61  ? 4.415   -1.553  -1.685  1.00 0.00 ? 61  TYR A HB3  2  
ATOM 2830  H HD1  . TYR A 1 61  ? 7.750   -3.070  -1.111  1.00 0.00 ? 61  TYR A HD1  2  
ATOM 2831  H HD2  . TYR A 1 61  ? 5.456   -0.334  -3.468  1.00 0.00 ? 61  TYR A HD2  2  
ATOM 2832  H HE1  . TYR A 1 61  ? 9.647   -2.920  -2.797  1.00 0.00 ? 61  TYR A HE1  2  
ATOM 2833  H HE2  . TYR A 1 61  ? 7.361   -0.194  -5.146  1.00 0.00 ? 61  TYR A HE2  2  
ATOM 2834  H HH   . TYR A 1 61  ? 10.454  -1.716  -4.492  1.00 0.00 ? 61  TYR A HH   2  
ATOM 2835  N N    . GLN A 1 62  ? 3.341   0.151   -0.064  1.00 0.00 ? 62  GLN A N    2  
ATOM 2836  C CA   . GLN A 1 62  ? 2.006   0.481   0.405   1.00 0.00 ? 62  GLN A CA   2  
ATOM 2837  C C    . GLN A 1 62  ? 1.005   0.412   -0.750  1.00 0.00 ? 62  GLN A C    2  
ATOM 2838  O O    . GLN A 1 62  ? 1.305   0.841   -1.863  1.00 0.00 ? 62  GLN A O    2  
ATOM 2839  C CB   . GLN A 1 62  ? 1.983   1.859   1.069   1.00 0.00 ? 62  GLN A CB   2  
ATOM 2840  C CG   . GLN A 1 62  ? 0.657   2.096   1.795   1.00 0.00 ? 62  GLN A CG   2  
ATOM 2841  C CD   . GLN A 1 62  ? 0.626   3.483   2.441   1.00 0.00 ? 62  GLN A CD   2  
ATOM 2842  O OE1  . GLN A 1 62  ? 1.117   3.697   3.537   1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2843  N NE2  . GLN A 1 62  ? 0.023   4.410   1.702   1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2844  H H    . GLN A 1 62  ? 3.587   0.546   -0.949  1.00 0.00 ? 62  GLN A H    2  
ATOM 2845  H HA   . GLN A 1 62  ? 1.765   -0.278  1.149   1.00 0.00 ? 62  GLN A HA   2  
ATOM 2846  H HB2  . GLN A 1 62  ? 2.809   1.940   1.777   1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2847  H HB3  . GLN A 1 62  ? 2.133   2.632   0.316   1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2848  H HG2  . GLN A 1 62  ? -0.169  2.000   1.091   1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2849  H HG3  . GLN A 1 62  ? 0.515   1.332   2.559   1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2850  H HE21 . GLN A 1 62  ? -0.359  4.168   0.810   1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2851  H HE22 . GLN A 1 62  ? -0.048  5.349   2.038   1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2852  N N    . ILE A 1 63  ? -0.165  -0.131  -0.445  1.00 0.00 ? 63  ILE A N    2  
ATOM 2853  C CA   . ILE A 1 63  ? -1.212  -0.262  -1.444  1.00 0.00 ? 63  ILE A CA   2  
ATOM 2854  C C    . ILE A 1 63  ? -2.532  0.249   -0.863  1.00 0.00 ? 63  ILE A C    2  
ATOM 2855  O O    . ILE A 1 63  ? -3.043  -0.307  0.107   1.00 0.00 ? 63  ILE A O    2  
ATOM 2856  C CB   . ILE A 1 63  ? -1.283  -1.700  -1.961  1.00 0.00 ? 63  ILE A CB   2  
ATOM 2857  C CG1  . ILE A 1 63  ? -0.485  -1.858  -3.256  1.00 0.00 ? 63  ILE A CG1  2  
ATOM 2858  C CG2  . ILE A 1 63  ? -2.736  -2.152  -2.124  1.00 0.00 ? 63  ILE A CG2  2  
ATOM 2859  C CD1  . ILE A 1 63  ? 0.205   -3.222  -3.313  1.00 0.00 ? 63  ILE A CD1  2  
ATOM 2860  H H    . ILE A 1 63  ? -0.401  -0.478  0.462   1.00 0.00 ? 63  ILE A H    2  
ATOM 2861  H HA   . ILE A 1 63  ? -0.938  0.371   -2.289  1.00 0.00 ? 63  ILE A HA   2  
ATOM 2862  H HB   . ILE A 1 63  ? -0.824  -2.353  -1.218  1.00 0.00 ? 63  ILE A HB   2  
ATOM 2863  H HG12 . ILE A 1 63  ? -1.149  -1.746  -4.113  1.00 0.00 ? 63  ILE A HG12 2  
ATOM 2864  H HG13 . ILE A 1 63  ? 0.262   -1.066  -3.326  1.00 0.00 ? 63  ILE A HG13 2  
ATOM 2865  H HG21 . ILE A 1 63  ? -3.274  -1.431  -2.738  1.00 0.00 ? 63  ILE A HG21 2  
ATOM 2866  H HG22 . ILE A 1 63  ? -2.760  -3.129  -2.607  1.00 0.00 ? 63  ILE A HG22 2  
ATOM 2867  H HG23 . ILE A 1 63  ? -3.208  -2.220  -1.144  1.00 0.00 ? 63  ILE A HG23 2  
ATOM 2868  H HD11 . ILE A 1 63  ? 0.199   -3.590  -4.339  1.00 0.00 ? 63  ILE A HD11 2  
ATOM 2869  H HD12 . ILE A 1 63  ? 1.234   -3.124  -2.968  1.00 0.00 ? 63  ILE A HD12 2  
ATOM 2870  H HD13 . ILE A 1 63  ? -0.328  -3.925  -2.672  1.00 0.00 ? 63  ILE A HD13 2  
ATOM 2871  N N    . THR A 1 64  ? -3.045  1.303   -1.481  1.00 0.00 ? 64  THR A N    2  
ATOM 2872  C CA   . THR A 1 64  ? -4.295  1.895   -1.037  1.00 0.00 ? 64  THR A CA   2  
ATOM 2873  C C    . THR A 1 64  ? -5.383  1.700   -2.095  1.00 0.00 ? 64  THR A C    2  
ATOM 2874  O O    . THR A 1 64  ? -5.172  1.996   -3.270  1.00 0.00 ? 64  THR A O    2  
ATOM 2875  C CB   . THR A 1 64  ? -4.030  3.364   -0.703  1.00 0.00 ? 64  THR A CB   2  
ATOM 2876  O OG1  . THR A 1 64  ? -3.690  3.950   -1.956  1.00 0.00 ? 64  THR A OG1  2  
ATOM 2877  C CG2  . THR A 1 64  ? -2.774  3.553   0.150   1.00 0.00 ? 64  THR A CG2  2  
ATOM 2878  H H    . THR A 1 64  ? -2.622  1.749   -2.270  1.00 0.00 ? 64  THR A H    2  
ATOM 2879  H HA   . THR A 1 64  ? -4.624  1.371   -0.140  1.00 0.00 ? 64  THR A HA   2  
ATOM 2880  H HB   . THR A 1 64  ? -4.898  3.817   -0.223  1.00 0.00 ? 64  THR A HB   2  
ATOM 2881  H HG1  . THR A 1 64  ? -4.221  4.785   -2.099  1.00 0.00 ? 64  THR A HG1  2  
ATOM 2882  H HG21 . THR A 1 64  ? -2.842  2.928   1.041   1.00 0.00 ? 64  THR A HG21 2  
ATOM 2883  H HG22 . THR A 1 64  ? -1.896  3.267   -0.428  1.00 0.00 ? 64  THR A HG22 2  
ATOM 2884  H HG23 . THR A 1 64  ? -2.690  4.599   0.446   1.00 0.00 ? 64  THR A HG23 2  
ATOM 2885  N N    . HIS A 1 65  ? -6.524  1.202   -1.641  1.00 0.00 ? 65  HIS A N    2  
ATOM 2886  C CA   . HIS A 1 65  ? -7.645  0.963   -2.533  1.00 0.00 ? 65  HIS A CA   2  
ATOM 2887  C C    . HIS A 1 65  ? -8.886  1.685   -2.003  1.00 0.00 ? 65  HIS A C    2  
ATOM 2888  O O    . HIS A 1 65  ? -9.231  1.552   -0.830  1.00 0.00 ? 65  HIS A O    2  
ATOM 2889  C CB   . HIS A 1 65  ? -7.871  -0.537  -2.733  1.00 0.00 ? 65  HIS A CB   2  
ATOM 2890  C CG   . HIS A 1 65  ? -7.897  -1.330  -1.448  1.00 0.00 ? 65  HIS A CG   2  
ATOM 2891  N ND1  . HIS A 1 65  ? -8.810  -1.090  -0.437  1.00 0.00 ? 65  HIS A ND1  2  
ATOM 2892  C CD2  . HIS A 1 65  ? -7.113  -2.362  -1.022  1.00 0.00 ? 65  HIS A CD2  2  
ATOM 2893  C CE1  . HIS A 1 65  ? -8.577  -1.944  0.549   1.00 0.00 ? 65  HIS A CE1  2  
ATOM 2894  N NE2  . HIS A 1 65  ? -7.525  -2.731  0.184   1.00 0.00 ? 65  HIS A NE2  2  
ATOM 2895  H H    . HIS A 1 65  ? -6.687  0.963   -0.683  1.00 0.00 ? 65  HIS A H    2  
ATOM 2896  H HA   . HIS A 1 65  ? -7.372  1.390   -3.499  1.00 0.00 ? 65  HIS A HA   2  
ATOM 2897  H HB2  . HIS A 1 65  ? -8.815  -0.685  -3.258  1.00 0.00 ? 65  HIS A HB2  2  
ATOM 2898  H HB3  . HIS A 1 65  ? -7.083  -0.930  -3.375  1.00 0.00 ? 65  HIS A HB3  2  
ATOM 2899  H HD1  . HIS A 1 65  ? -9.525  -0.390  -0.448  1.00 0.00 ? 65  HIS A HD1  2  
ATOM 2900  H HD2  . HIS A 1 65  ? -6.289  -2.808  -1.579  1.00 0.00 ? 65  HIS A HD2  2  
ATOM 2901  H HE1  . HIS A 1 65  ? -9.129  -2.006  1.487   1.00 0.00 ? 65  HIS A HE1  2  
ATOM 2902  N N    . ARG A 1 66  ? -9.522  2.432   -2.893  1.00 0.00 ? 66  ARG A N    2  
ATOM 2903  C CA   . ARG A 1 66  ? -10.717 3.174   -2.529  1.00 0.00 ? 66  ARG A CA   2  
ATOM 2904  C C    . ARG A 1 66  ? -11.495 3.577   -3.784  1.00 0.00 ? 66  ARG A C    2  
ATOM 2905  O O    . ARG A 1 66  ? -10.902 3.987   -4.780  1.00 0.00 ? 66  ARG A O    2  
ATOM 2906  C CB   . ARG A 1 66  ? -10.363 4.431   -1.731  1.00 0.00 ? 66  ARG A CB   2  
ATOM 2907  C CG   . ARG A 1 66  ? -9.849  5.538   -2.653  1.00 0.00 ? 66  ARG A CG   2  
ATOM 2908  C CD   . ARG A 1 66  ? -9.023  6.563   -1.872  1.00 0.00 ? 66  ARG A CD   2  
ATOM 2909  N NE   . ARG A 1 66  ? -9.010  7.856   -2.591  1.00 0.00 ? 66  ARG A NE   2  
ATOM 2910  C CZ   . ARG A 1 66  ? -10.085 8.643   -2.741  1.00 0.00 ? 66  ARG A CZ   2  
ATOM 2911  N NH1  . ARG A 1 66  ? -11.264 8.273   -2.223  1.00 0.00 ? 66  ARG A NH1  2  
ATOM 2912  N NH2  . ARG A 1 66  ? -9.980  9.800   -3.408  1.00 0.00 ? 66  ARG A NH2  2  
ATOM 2913  H H    . ARG A 1 66  ? -9.235  2.534   -3.845  1.00 0.00 ? 66  ARG A H    2  
ATOM 2914  H HA   . ARG A 1 66  ? -11.296 2.486   -1.913  1.00 0.00 ? 66  ARG A HA   2  
ATOM 2915  H HB2  . ARG A 1 66  ? -11.242 4.782   -1.190  1.00 0.00 ? 66  ARG A HB2  2  
ATOM 2916  H HB3  . ARG A 1 66  ? -9.605  4.192   -0.986  1.00 0.00 ? 66  ARG A HB3  2  
ATOM 2917  H HG2  . ARG A 1 66  ? -9.240  5.103   -3.446  1.00 0.00 ? 66  ARG A HG2  2  
ATOM 2918  H HG3  . ARG A 1 66  ? -10.691 6.036   -3.135  1.00 0.00 ? 66  ARG A HG3  2  
ATOM 2919  H HD2  . ARG A 1 66  ? -9.442  6.695   -0.875  1.00 0.00 ? 66  ARG A HD2  2  
ATOM 2920  H HD3  . ARG A 1 66  ? -8.004  6.198   -1.744  1.00 0.00 ? 66  ARG A HD3  2  
ATOM 2921  H HE   . ARG A 1 66  ? -8.146  8.163   -2.989  1.00 0.00 ? 66  ARG A HE   2  
ATOM 2922  H HH11 . ARG A 1 66  ? -11.342 7.409   -1.725  1.00 0.00 ? 66  ARG A HH11 2  
ATOM 2923  H HH12 . ARG A 1 66  ? -12.066 8.860   -2.335  1.00 0.00 ? 66  ARG A HH12 2  
ATOM 2924  H HH21 . ARG A 1 66  ? -9.100  10.077  -3.794  1.00 0.00 ? 66  ARG A HH21 2  
ATOM 2925  H HH22 . ARG A 1 66  ? -10.781 10.388  -3.520  1.00 0.00 ? 66  ARG A HH22 2  
ATOM 2926  N N    . LEU A 1 67  ? -12.810 3.445   -3.694  1.00 0.00 ? 67  LEU A N    2  
ATOM 2927  C CA   . LEU A 1 67  ? -13.675 3.789   -4.809  1.00 0.00 ? 67  LEU A CA   2  
ATOM 2928  C C    . LEU A 1 67  ? -13.135 5.045   -5.498  1.00 0.00 ? 67  LEU A C    2  
ATOM 2929  O O    . LEU A 1 67  ? -12.845 6.042   -4.840  1.00 0.00 ? 67  LEU A O    2  
ATOM 2930  C CB   . LEU A 1 67  ? -15.126 3.920   -4.342  1.00 0.00 ? 67  LEU A CB   2  
ATOM 2931  C CG   . LEU A 1 67  ? -15.927 2.618   -4.271  1.00 0.00 ? 67  LEU A CG   2  
ATOM 2932  C CD1  . LEU A 1 67  ? -16.650 2.346   -5.592  1.00 0.00 ? 67  LEU A CD1  2  
ATOM 2933  C CD2  . LEU A 1 67  ? -15.034 1.447   -3.854  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 2934  H H    . LEU A 1 67  ? -13.284 3.110   -2.880  1.00 0.00 ? 67  LEU A H    2  
ATOM 2935  H HA   . LEU A 1 67  ? -13.637 2.963   -5.519  1.00 0.00 ? 67  LEU A HA   2  
ATOM 2936  H HB2  . LEU A 1 67  ? -15.129 4.380   -3.354  1.00 0.00 ? 67  LEU A HB2  2  
ATOM 2937  H HB3  . LEU A 1 67  ? -15.643 4.605   -5.014  1.00 0.00 ? 67  LEU A HB3  2  
ATOM 2938  H HG   . LEU A 1 67  ? -16.692 2.729   -3.502  1.00 0.00 ? 67  LEU A HG   2  
ATOM 2939  H HD11 . LEU A 1 67  ? -17.153 1.381   -5.538  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 2940  H HD12 . LEU A 1 67  ? -17.385 3.130   -5.772  1.00 0.00 ? 67  LEU A HD12 2  
ATOM 2941  H HD13 . LEU A 1 67  ? -15.925 2.333   -6.406  1.00 0.00 ? 67  LEU A HD13 2  
ATOM 2942  H HD21 . LEU A 1 67  ? -15.635 0.541   -3.781  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 2943  H HD22 . LEU A 1 67  ? -14.251 1.305   -4.598  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 2944  H HD23 . LEU A 1 67  ? -14.582 1.662   -2.886  1.00 0.00 ? 67  LEU A HD23 2  
ATOM 2945  N N    . ASN A 1 68  ? -13.017 4.954   -6.815  1.00 0.00 ? 68  ASN A N    2  
ATOM 2946  C CA   . ASN A 1 68  ? -12.518 6.070   -7.600  1.00 0.00 ? 68  ASN A CA   2  
ATOM 2947  C C    . ASN A 1 68  ? -13.502 7.237   -7.502  1.00 0.00 ? 68  ASN A C    2  
ATOM 2948  O O    . ASN A 1 68  ? -13.196 8.349   -7.930  1.00 0.00 ? 68  ASN A O    2  
ATOM 2949  C CB   . ASN A 1 68  ? -12.381 5.688   -9.075  1.00 0.00 ? 68  ASN A CB   2  
ATOM 2950  C CG   . ASN A 1 68  ? -11.675 6.793   -9.864  1.00 0.00 ? 68  ASN A CG   2  
ATOM 2951  O OD1  . ASN A 1 68  ? -10.947 7.609   -9.324  1.00 0.00 ? 68  ASN A OD1  2  
ATOM 2952  N ND2  . ASN A 1 68  ? -11.930 6.772   -11.169 1.00 0.00 ? 68  ASN A ND2  2  
ATOM 2953  H H    . ASN A 1 68  ? -13.255 4.139   -7.343  1.00 0.00 ? 68  ASN A H    2  
ATOM 2954  H HA   . ASN A 1 68  ? -11.544 6.308   -7.172  1.00 0.00 ? 68  ASN A HA   2  
ATOM 2955  H HB2  . ASN A 1 68  ? -11.821 4.758   -9.164  1.00 0.00 ? 68  ASN A HB2  2  
ATOM 2956  H HB3  . ASN A 1 68  ? -13.369 5.507   -9.500  1.00 0.00 ? 68  ASN A HB3  2  
ATOM 2957  H HD21 . ASN A 1 68  ? -12.538 6.075   -11.550 1.00 0.00 ? 68  ASN A HD21 2  
ATOM 2958  H HD22 . ASN A 1 68  ? -11.515 7.455   -11.771 1.00 0.00 ? 68  ASN A HD22 2  
ATOM 2959  N N    . THR A 1 69  ? -14.664 6.945   -6.937  1.00 0.00 ? 69  THR A N    2  
ATOM 2960  C CA   . THR A 1 69  ? -15.695 7.956   -6.778  1.00 0.00 ? 69  THR A CA   2  
ATOM 2961  C C    . THR A 1 69  ? -16.890 7.383   -6.014  1.00 0.00 ? 69  THR A C    2  
ATOM 2962  O O    . THR A 1 69  ? -17.637 6.563   -6.547  1.00 0.00 ? 69  THR A O    2  
ATOM 2963  C CB   . THR A 1 69  ? -16.057 8.484   -8.167  1.00 0.00 ? 69  THR A CB   2  
ATOM 2964  O OG1  . THR A 1 69  ? -17.480 8.566   -8.148  1.00 0.00 ? 69  THR A OG1  2  
ATOM 2965  C CG2  . THR A 1 69  ? -15.757 7.472   -9.275  1.00 0.00 ? 69  THR A CG2  2  
ATOM 2966  H H    . THR A 1 69  ? -14.905 6.038   -6.592  1.00 0.00 ? 69  THR A H    2  
ATOM 2967  H HA   . THR A 1 69  ? -15.289 8.768   -6.174  1.00 0.00 ? 69  THR A HA   2  
ATOM 2968  H HB   . THR A 1 69  ? -15.562 9.435   -8.364  1.00 0.00 ? 69  THR A HB   2  
ATOM 2969  H HG1  . THR A 1 69  ? -17.875 7.648   -8.180  1.00 0.00 ? 69  THR A HG1  2  
ATOM 2970  H HG21 . THR A 1 69  ? -15.936 6.463   -8.904  1.00 0.00 ? 69  THR A HG21 2  
ATOM 2971  H HG22 . THR A 1 69  ? -16.406 7.666   -10.129 1.00 0.00 ? 69  THR A HG22 2  
ATOM 2972  H HG23 . THR A 1 69  ? -14.715 7.567   -9.582  1.00 0.00 ? 69  THR A HG23 2  
ATOM 2973  N N    . THR A 1 70  ? -17.035 7.838   -4.778  1.00 0.00 ? 70  THR A N    2  
ATOM 2974  C CA   . THR A 1 70  ? -18.128 7.381   -3.936  1.00 0.00 ? 70  THR A CA   2  
ATOM 2975  C C    . THR A 1 70  ? -18.127 8.136   -2.606  1.00 0.00 ? 70  THR A C    2  
ATOM 2976  O O    . THR A 1 70  ? -17.379 9.098   -2.434  1.00 0.00 ? 70  THR A O    2  
ATOM 2977  C CB   . THR A 1 70  ? -17.998 5.865   -3.775  1.00 0.00 ? 70  THR A CB   2  
ATOM 2978  O OG1  . THR A 1 70  ? -19.346 5.404   -3.736  1.00 0.00 ? 70  THR A OG1  2  
ATOM 2979  C CG2  . THR A 1 70  ? -17.429 5.468   -2.411  1.00 0.00 ? 70  THR A CG2  2  
ATOM 2980  H H    . THR A 1 70  ? -16.424 8.505   -4.353  1.00 0.00 ? 70  THR A H    2  
ATOM 2981  H HA   . THR A 1 70  ? -19.068 7.615   -4.436  1.00 0.00 ? 70  THR A HA   2  
ATOM 2982  H HB   . THR A 1 70  ? -17.406 5.437   -4.583  1.00 0.00 ? 70  THR A HB   2  
ATOM 2983  H HG1  . THR A 1 70  ? -19.376 4.422   -3.922  1.00 0.00 ? 70  THR A HG1  2  
ATOM 2984  H HG21 . THR A 1 70  ? -16.655 6.178   -2.120  1.00 0.00 ? 70  THR A HG21 2  
ATOM 2985  H HG22 . THR A 1 70  ? -18.227 5.476   -1.668  1.00 0.00 ? 70  THR A HG22 2  
ATOM 2986  H HG23 . THR A 1 70  ? -17.000 4.468   -2.474  1.00 0.00 ? 70  THR A HG23 2  
ATOM 2987  N N    . THR A 1 71  ? -18.974 7.672   -1.698  1.00 0.00 ? 71  THR A N    2  
ATOM 2988  C CA   . THR A 1 71  ? -19.080 8.292   -0.388  1.00 0.00 ? 71  THR A CA   2  
ATOM 2989  C C    . THR A 1 71  ? -18.645 7.311   0.702   1.00 0.00 ? 71  THR A C    2  
ATOM 2990  O O    . THR A 1 71  ? -19.366 6.366   1.017   1.00 0.00 ? 71  THR A O    2  
ATOM 2991  C CB   . THR A 1 71  ? -20.516 8.793   -0.217  1.00 0.00 ? 71  THR A CB   2  
ATOM 2992  O OG1  . THR A 1 71  ? -21.310 7.615   -0.335  1.00 0.00 ? 71  THR A OG1  2  
ATOM 2993  C CG2  . THR A 1 71  ? -20.973 9.669   -1.385  1.00 0.00 ? 71  THR A CG2  2  
ATOM 2994  H H    . THR A 1 71  ? -19.578 6.890   -1.846  1.00 0.00 ? 71  THR A H    2  
ATOM 2995  H HA   . THR A 1 71  ? -18.393 9.137   -0.351  1.00 0.00 ? 71  THR A HA   2  
ATOM 2996  H HB   . THR A 1 71  ? -20.635 9.315   0.732   1.00 0.00 ? 71  THR A HB   2  
ATOM 2997  H HG1  . THR A 1 71  ? -21.681 7.363   0.559   1.00 0.00 ? 71  THR A HG1  2  
ATOM 2998  H HG21 . THR A 1 71  ? -20.284 9.549   -2.221  1.00 0.00 ? 71  THR A HG21 2  
ATOM 2999  H HG22 . THR A 1 71  ? -21.975 9.369   -1.694  1.00 0.00 ? 71  THR A HG22 2  
ATOM 3000  H HG23 . THR A 1 71  ? -20.987 10.713  -1.073  1.00 0.00 ? 71  THR A HG23 2  
ATOM 3001  N N    . ALA A 1 72  ? -17.466 7.570   1.250   1.00 0.00 ? 72  ALA A N    2  
ATOM 3002  C CA   . ALA A 1 72  ? -16.926 6.722   2.299   1.00 0.00 ? 72  ALA A CA   2  
ATOM 3003  C C    . ALA A 1 72  ? -16.300 7.599   3.385   1.00 0.00 ? 72  ALA A C    2  
ATOM 3004  O O    . ALA A 1 72  ? -16.487 8.814   3.392   1.00 0.00 ? 72  ALA A O    2  
ATOM 3005  C CB   . ALA A 1 72  ? -15.923 5.737   1.694   1.00 0.00 ? 72  ALA A CB   2  
ATOM 3006  H H    . ALA A 1 72  ? -16.885 8.341   0.989   1.00 0.00 ? 72  ALA A H    2  
ATOM 3007  H HA   . ALA A 1 72  ? -17.754 6.159   2.730   1.00 0.00 ? 72  ALA A HA   2  
ATOM 3008  H HB1  . ALA A 1 72  ? -15.887 5.874   0.613   1.00 0.00 ? 72  ALA A HB1  2  
ATOM 3009  H HB2  . ALA A 1 72  ? -14.935 5.919   2.117   1.00 0.00 ? 72  ALA A HB2  2  
ATOM 3010  H HB3  . ALA A 1 72  ? -16.234 4.718   1.921   1.00 0.00 ? 72  ALA A HB3  2  
ATOM 3011  N N    . ASN A 1 73  ? -15.568 6.947   4.278   1.00 0.00 ? 73  ASN A N    2  
ATOM 3012  C CA   . ASN A 1 73  ? -14.913 7.652   5.367   1.00 0.00 ? 73  ASN A CA   2  
ATOM 3013  C C    . ASN A 1 73  ? -13.424 7.801   5.049   1.00 0.00 ? 73  ASN A C    2  
ATOM 3014  O O    . ASN A 1 73  ? -12.901 8.914   5.013   1.00 0.00 ? 73  ASN A O    2  
ATOM 3015  C CB   . ASN A 1 73  ? -15.042 6.878   6.680   1.00 0.00 ? 73  ASN A CB   2  
ATOM 3016  C CG   . ASN A 1 73  ? -15.295 7.827   7.853   1.00 0.00 ? 73  ASN A CG   2  
ATOM 3017  O OD1  . ASN A 1 73  ? -16.415 8.218   8.138   1.00 0.00 ? 73  ASN A OD1  2  
ATOM 3018  N ND2  . ASN A 1 73  ? -14.195 8.174   8.515   1.00 0.00 ? 73  ASN A ND2  2  
ATOM 3019  H H    . ASN A 1 73  ? -15.421 5.958   4.265   1.00 0.00 ? 73  ASN A H    2  
ATOM 3020  H HA   . ASN A 1 73  ? -15.423 8.613   5.434   1.00 0.00 ? 73  ASN A HA   2  
ATOM 3021  H HB2  . ASN A 1 73  ? -15.859 6.161   6.605   1.00 0.00 ? 73  ASN A HB2  2  
ATOM 3022  H HB3  . ASN A 1 73  ? -14.131 6.306   6.860   1.00 0.00 ? 73  ASN A HB3  2  
ATOM 3023  H HD21 . ASN A 1 73  ? -13.306 7.817   8.229   1.00 0.00 ? 73  ASN A HD21 2  
ATOM 3024  H HD22 . ASN A 1 73  ? -14.257 8.792   9.299   1.00 0.00 ? 73  ASN A HD22 2  
ATOM 3025  N N    . THR A 1 74  ? -12.783 6.663   4.827   1.00 0.00 ? 74  THR A N    2  
ATOM 3026  C CA   . THR A 1 74  ? -11.364 6.652   4.514   1.00 0.00 ? 74  THR A CA   2  
ATOM 3027  C C    . THR A 1 74  ? -10.997 5.382   3.745   1.00 0.00 ? 74  THR A C    2  
ATOM 3028  O O    . THR A 1 74  ? -11.800 4.455   3.651   1.00 0.00 ? 74  THR A O    2  
ATOM 3029  C CB   . THR A 1 74  ? -10.589 6.815   5.823   1.00 0.00 ? 74  THR A CB   2  
ATOM 3030  O OG1  . THR A 1 74  ? -9.951  8.082   5.694   1.00 0.00 ? 74  THR A OG1  2  
ATOM 3031  C CG2  . THR A 1 74  ? -9.430  5.824   5.945   1.00 0.00 ? 74  THR A CG2  2  
ATOM 3032  H H    . THR A 1 74  ? -13.215 5.762   4.858   1.00 0.00 ? 74  THR A H    2  
ATOM 3033  H HA   . THR A 1 74  ? -11.151 7.496   3.858   1.00 0.00 ? 74  THR A HA   2  
ATOM 3034  H HB   . THR A 1 74  ? -11.257 6.741   6.682   1.00 0.00 ? 74  THR A HB   2  
ATOM 3035  H HG1  . THR A 1 74  ? -9.391  8.267   6.502   1.00 0.00 ? 74  THR A HG1  2  
ATOM 3036  H HG21 . THR A 1 74  ? -8.984  5.906   6.936   1.00 0.00 ? 74  THR A HG21 2  
ATOM 3037  H HG22 . THR A 1 74  ? -9.801  4.810   5.796   1.00 0.00 ? 74  THR A HG22 2  
ATOM 3038  H HG23 . THR A 1 74  ? -8.678  6.050   5.188   1.00 0.00 ? 74  THR A HG23 2  
ATOM 3039  N N    . ALA A 1 75  ? -9.783  5.380   3.214   1.00 0.00 ? 75  ALA A N    2  
ATOM 3040  C CA   . ALA A 1 75  ? -9.300  4.238   2.456   1.00 0.00 ? 75  ALA A CA   2  
ATOM 3041  C C    . ALA A 1 75  ? -8.466  3.339   3.371   1.00 0.00 ? 75  ALA A C    2  
ATOM 3042  O O    . ALA A 1 75  ? -7.863  3.814   4.332   1.00 0.00 ? 75  ALA A O    2  
ATOM 3043  C CB   . ALA A 1 75  ? -8.507  4.729   1.242   1.00 0.00 ? 75  ALA A CB   2  
ATOM 3044  H H    . ALA A 1 75  ? -9.136  6.138   3.295   1.00 0.00 ? 75  ALA A H    2  
ATOM 3045  H HA   . ALA A 1 75  ? -10.168 3.681   2.105   1.00 0.00 ? 75  ALA A HA   2  
ATOM 3046  H HB1  . ALA A 1 75  ? -9.157  5.326   0.602   1.00 0.00 ? 75  ALA A HB1  2  
ATOM 3047  H HB2  . ALA A 1 75  ? -7.669  5.339   1.579   1.00 0.00 ? 75  ALA A HB2  2  
ATOM 3048  H HB3  . ALA A 1 75  ? -8.132  3.873   0.683   1.00 0.00 ? 75  ALA A HB3  2  
ATOM 3049  N N    . THR A 1 76  ? -8.460  2.056   3.041   1.00 0.00 ? 76  THR A N    2  
ATOM 3050  C CA   . THR A 1 76  ? -7.711  1.086   3.822   1.00 0.00 ? 76  THR A CA   2  
ATOM 3051  C C    . THR A 1 76  ? -6.282  0.961   3.288   1.00 0.00 ? 76  THR A C    2  
ATOM 3052  O O    . THR A 1 76  ? -6.050  0.305   2.274   1.00 0.00 ? 76  THR A O    2  
ATOM 3053  C CB   . THR A 1 76  ? -8.484  -0.234  3.804   1.00 0.00 ? 76  THR A CB   2  
ATOM 3054  O OG1  . THR A 1 76  ? -9.671  0.049   4.539   1.00 0.00 ? 76  THR A OG1  2  
ATOM 3055  C CG2  . THR A 1 76  ? -7.793  -1.328  4.620   1.00 0.00 ? 76  THR A CG2  2  
ATOM 3056  H H    . THR A 1 76  ? -8.954  1.677   2.258   1.00 0.00 ? 76  THR A H    2  
ATOM 3057  H HA   . THR A 1 76  ? -7.638  1.452   4.846   1.00 0.00 ? 76  THR A HA   2  
ATOM 3058  H HB   . THR A 1 76  ? -8.664  -0.566  2.781   1.00 0.00 ? 76  THR A HB   2  
ATOM 3059  H HG1  . THR A 1 76  ? -9.443  0.259   5.489   1.00 0.00 ? 76  THR A HG1  2  
ATOM 3060  H HG21 . THR A 1 76  ? -8.233  -2.296  4.377   1.00 0.00 ? 76  THR A HG21 2  
ATOM 3061  H HG22 . THR A 1 76  ? -6.729  -1.343  4.381   1.00 0.00 ? 76  THR A HG22 2  
ATOM 3062  H HG23 . THR A 1 76  ? -7.924  -1.127  5.683   1.00 0.00 ? 76  THR A HG23 2  
ATOM 3063  N N    . VAL A 1 77  ? -5.362  1.601   3.995   1.00 0.00 ? 77  VAL A N    2  
ATOM 3064  C CA   . VAL A 1 77  ? -3.963  1.570   3.605   1.00 0.00 ? 77  VAL A CA   2  
ATOM 3065  C C    . VAL A 1 77  ? -3.303  0.320   4.192   1.00 0.00 ? 77  VAL A C    2  
ATOM 3066  O O    . VAL A 1 77  ? -3.482  0.013   5.369   1.00 0.00 ? 77  VAL A O    2  
ATOM 3067  C CB   . VAL A 1 77  ? -3.272  2.867   4.031   1.00 0.00 ? 77  VAL A CB   2  
ATOM 3068  C CG1  . VAL A 1 77  ? -1.765  2.793   3.780   1.00 0.00 ? 77  VAL A CG1  2  
ATOM 3069  C CG2  . VAL A 1 77  ? -3.888  4.074   3.322   1.00 0.00 ? 77  VAL A CG2  2  
ATOM 3070  H H    . VAL A 1 77  ? -5.560  2.132   4.819   1.00 0.00 ? 77  VAL A H    2  
ATOM 3071  H HA   . VAL A 1 77  ? -3.926  1.509   2.518   1.00 0.00 ? 77  VAL A HA   2  
ATOM 3072  H HB   . VAL A 1 77  ? -3.427  2.993   5.103   1.00 0.00 ? 77  VAL A HB   2  
ATOM 3073  H HG11 . VAL A 1 77  ? -1.302  2.155   4.533   1.00 0.00 ? 77  VAL A HG11 2  
ATOM 3074  H HG12 . VAL A 1 77  ? -1.581  2.377   2.789   1.00 0.00 ? 77  VAL A HG12 2  
ATOM 3075  H HG13 . VAL A 1 77  ? -1.337  3.794   3.839   1.00 0.00 ? 77  VAL A HG13 2  
ATOM 3076  H HG21 . VAL A 1 77  ? -3.158  4.504   2.636   1.00 0.00 ? 77  VAL A HG21 2  
ATOM 3077  H HG22 . VAL A 1 77  ? -4.769  3.757   2.763   1.00 0.00 ? 77  VAL A HG22 2  
ATOM 3078  H HG23 . VAL A 1 77  ? -4.176  4.822   4.061   1.00 0.00 ? 77  VAL A HG23 2  
ATOM 3079  N N    . GLU A 1 78  ? -2.552  -0.367  3.343   1.00 0.00 ? 78  GLU A N    2  
ATOM 3080  C CA   . GLU A 1 78  ? -1.864  -1.576  3.762   1.00 0.00 ? 78  GLU A CA   2  
ATOM 3081  C C    . GLU A 1 78  ? -0.385  -1.506  3.376   1.00 0.00 ? 78  GLU A C    2  
ATOM 3082  O O    . GLU A 1 78  ? -0.049  -1.110  2.261   1.00 0.00 ? 78  GLU A O    2  
ATOM 3083  C CB   . GLU A 1 78  ? -2.528  -2.819  3.167   1.00 0.00 ? 78  GLU A CB   2  
ATOM 3084  C CG   . GLU A 1 78  ? -1.635  -4.051  3.334   1.00 0.00 ? 78  GLU A CG   2  
ATOM 3085  C CD   . GLU A 1 78  ? -2.408  -5.204  3.976   1.00 0.00 ? 78  GLU A CD   2  
ATOM 3086  O OE1  . GLU A 1 78  ? -3.483  -5.539  3.434   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3087  O OE2  . GLU A 1 78  ? -1.906  -5.725  4.996   1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3088  H H    . GLU A 1 78  ? -2.411  -0.110  2.387   1.00 0.00 ? 78  GLU A H    2  
ATOM 3089  H HA   . GLU A 1 78  ? -1.962  -1.604  4.847   1.00 0.00 ? 78  GLU A HA   2  
ATOM 3090  H HB2  . GLU A 1 78  ? -3.487  -2.992  3.654   1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3091  H HB3  . GLU A 1 78  ? -2.733  -2.655  2.109   1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3092  H HG2  . GLU A 1 78  ? -1.253  -4.361  2.362   1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3093  H HG3  . GLU A 1 78  ? -0.773  -3.798  3.950   1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3094  N N    . VAL A 1 79  ? 0.459   -1.896  4.319   1.00 0.00 ? 79  VAL A N    2  
ATOM 3095  C CA   . VAL A 1 79  ? 1.894   -1.883  4.092   1.00 0.00 ? 79  VAL A CA   2  
ATOM 3096  C C    . VAL A 1 79  ? 2.355   -3.284  3.685   1.00 0.00 ? 79  VAL A C    2  
ATOM 3097  O O    . VAL A 1 79  ? 2.000   -4.270  4.330   1.00 0.00 ? 79  VAL A O    2  
ATOM 3098  C CB   . VAL A 1 79  ? 2.616   -1.353  5.333   1.00 0.00 ? 79  VAL A CB   2  
ATOM 3099  C CG1  . VAL A 1 79  ? 3.992   -2.005  5.487   1.00 0.00 ? 79  VAL A CG1  2  
ATOM 3100  C CG2  . VAL A 1 79  ? 2.733   0.172   5.290   1.00 0.00 ? 79  VAL A CG2  2  
ATOM 3101  H H    . VAL A 1 79  ? 0.178   -2.217  5.224   1.00 0.00 ? 79  VAL A H    2  
ATOM 3102  H HA   . VAL A 1 79  ? 2.090   -1.196  3.269   1.00 0.00 ? 79  VAL A HA   2  
ATOM 3103  H HB   . VAL A 1 79  ? 2.020   -1.619  6.206   1.00 0.00 ? 79  VAL A HB   2  
ATOM 3104  H HG11 . VAL A 1 79  ? 3.900   -2.908  6.090   1.00 0.00 ? 79  VAL A HG11 2  
ATOM 3105  H HG12 . VAL A 1 79  ? 4.384   -2.263  4.503   1.00 0.00 ? 79  VAL A HG12 2  
ATOM 3106  H HG13 . VAL A 1 79  ? 4.671   -1.308  5.977   1.00 0.00 ? 79  VAL A HG13 2  
ATOM 3107  H HG21 . VAL A 1 79  ? 1.749   0.607   5.118   1.00 0.00 ? 79  VAL A HG21 2  
ATOM 3108  H HG22 . VAL A 1 79  ? 3.130   0.532   6.239   1.00 0.00 ? 79  VAL A HG22 2  
ATOM 3109  H HG23 . VAL A 1 79  ? 3.405   0.462   4.482   1.00 0.00 ? 79  VAL A HG23 2  
ATOM 3110  N N    . LEU A 1 80  ? 3.138   -3.328  2.617   1.00 0.00 ? 80  LEU A N    2  
ATOM 3111  C CA   . LEU A 1 80  ? 3.651   -4.592  2.117   1.00 0.00 ? 80  LEU A CA   2  
ATOM 3112  C C    . LEU A 1 80  ? 5.163   -4.649  2.343   1.00 0.00 ? 80  LEU A C    2  
ATOM 3113  O O    . LEU A 1 80  ? 5.773   -3.659  2.745   1.00 0.00 ? 80  LEU A O    2  
ATOM 3114  C CB   . LEU A 1 80  ? 3.240   -4.797  0.658   1.00 0.00 ? 80  LEU A CB   2  
ATOM 3115  C CG   . LEU A 1 80  ? 1.758   -5.089  0.413   1.00 0.00 ? 80  LEU A CG   2  
ATOM 3116  C CD1  . LEU A 1 80  ? 1.228   -4.280  -0.772  1.00 0.00 ? 80  LEU A CD1  2  
ATOM 3117  C CD2  . LEU A 1 80  ? 1.516   -6.589  0.238   1.00 0.00 ? 80  LEU A CD2  2  
ATOM 3118  H H    . LEU A 1 80  ? 3.422   -2.522  2.099   1.00 0.00 ? 80  LEU A H    2  
ATOM 3119  H HA   . LEU A 1 80  ? 3.184   -5.387  2.698   1.00 0.00 ? 80  LEU A HA   2  
ATOM 3120  H HB2  . LEU A 1 80  ? 3.511   -3.904  0.095   1.00 0.00 ? 80  LEU A HB2  2  
ATOM 3121  H HB3  . LEU A 1 80  ? 3.824   -5.621  0.248   1.00 0.00 ? 80  LEU A HB3  2  
ATOM 3122  H HG   . LEU A 1 80  ? 1.198   -4.774  1.294   1.00 0.00 ? 80  LEU A HG   2  
ATOM 3123  H HD11 . LEU A 1 80  ? 0.139   -4.334  -0.791  1.00 0.00 ? 80  LEU A HD11 2  
ATOM 3124  H HD12 . LEU A 1 80  ? 1.539   -3.240  -0.671  1.00 0.00 ? 80  LEU A HD12 2  
ATOM 3125  H HD13 . LEU A 1 80  ? 1.628   -4.690  -1.700  1.00 0.00 ? 80  LEU A HD13 2  
ATOM 3126  H HD21 . LEU A 1 80  ? 2.352   -7.144  0.664   1.00 0.00 ? 80  LEU A HD21 2  
ATOM 3127  H HD22 . LEU A 1 80  ? 0.595   -6.871  0.748   1.00 0.00 ? 80  LEU A HD22 2  
ATOM 3128  H HD23 . LEU A 1 80  ? 1.430   -6.822  -0.824  1.00 0.00 ? 80  LEU A HD23 2  
ATOM 3129  N N    . ALA A 1 81  ? 5.725   -5.819  2.075   1.00 0.00 ? 81  ALA A N    2  
ATOM 3130  C CA   . ALA A 1 81  ? 7.155   -6.018  2.245   1.00 0.00 ? 81  ALA A CA   2  
ATOM 3131  C C    . ALA A 1 81  ? 7.895   -5.405  1.054   1.00 0.00 ? 81  ALA A C    2  
ATOM 3132  O O    . ALA A 1 81  ? 7.279   -5.048  0.052   1.00 0.00 ? 81  ALA A O    2  
ATOM 3133  C CB   . ALA A 1 81  ? 7.446   -7.512  2.406   1.00 0.00 ? 81  ALA A CB   2  
ATOM 3134  H H    . ALA A 1 81  ? 5.223   -6.619  1.749   1.00 0.00 ? 81  ALA A H    2  
ATOM 3135  H HA   . ALA A 1 81  ? 7.456   -5.501  3.155   1.00 0.00 ? 81  ALA A HA   2  
ATOM 3136  H HB1  . ALA A 1 81  ? 7.886   -7.692  3.388   1.00 0.00 ? 81  ALA A HB1  2  
ATOM 3137  H HB2  . ALA A 1 81  ? 6.518   -8.075  2.315   1.00 0.00 ? 81  ALA A HB2  2  
ATOM 3138  H HB3  . ALA A 1 81  ? 8.143   -7.832  1.632   1.00 0.00 ? 81  ALA A HB3  2  
ATOM 3139  N N    . PRO A 1 82  ? 9.243   -5.301  1.208   1.00 0.00 ? 82  PRO A N    2  
ATOM 3140  C CA   . PRO A 1 82  ? 10.074  -4.737  0.158   1.00 0.00 ? 82  PRO A CA   2  
ATOM 3141  C C    . PRO A 1 82  ? 10.248  -5.728  -0.995  1.00 0.00 ? 82  PRO A C    2  
ATOM 3142  O O    . PRO A 1 82  ? 10.830  -5.391  -2.025  1.00 0.00 ? 82  PRO A O    2  
ATOM 3143  C CB   . PRO A 1 82  ? 11.385  -4.384  0.841   1.00 0.00 ? 82  PRO A CB   2  
ATOM 3144  C CG   . PRO A 1 82  ? 11.410  -5.184  2.133   1.00 0.00 ? 82  PRO A CG   2  
ATOM 3145  C CD   . PRO A 1 82  ? 10.007  -5.714  2.381   1.00 0.00 ? 82  PRO A CD   2  
ATOM 3146  H HA   . PRO A 1 82  ? 9.634   -3.931  -0.238  1.00 0.00 ? 82  PRO A HA   2  
ATOM 3147  H HB2  . PRO A 1 82  ? 12.236  -4.638  0.208   1.00 0.00 ? 82  PRO A HB2  2  
ATOM 3148  H HB3  . PRO A 1 82  ? 11.446  -3.315  1.042   1.00 0.00 ? 82  PRO A HB3  2  
ATOM 3149  H HG2  . PRO A 1 82  ? 12.122  -6.007  2.060   1.00 0.00 ? 82  PRO A HG2  2  
ATOM 3150  H HG3  . PRO A 1 82  ? 11.734  -4.557  2.964   1.00 0.00 ? 82  PRO A HG3  2  
ATOM 3151  H HD2  . PRO A 1 82  ? 10.007  -6.798  2.492   1.00 0.00 ? 82  PRO A HD2  2  
ATOM 3152  H HD3  . PRO A 1 82  ? 9.583   -5.300  3.296   1.00 0.00 ? 82  PRO A HD3  2  
ATOM 3153  N N    . SER A 1 83  ? 9.733   -6.930  -0.782  1.00 0.00 ? 83  SER A N    2  
ATOM 3154  C CA   . SER A 1 83  ? 9.824   -7.972  -1.791  1.00 0.00 ? 83  SER A CA   2  
ATOM 3155  C C    . SER A 1 83  ? 8.425   -8.349  -2.282  1.00 0.00 ? 83  SER A C    2  
ATOM 3156  O O    . SER A 1 83  ? 8.175   -9.502  -2.630  1.00 0.00 ? 83  SER A O    2  
ATOM 3157  C CB   . SER A 1 83  ? 10.545  -9.206  -1.244  1.00 0.00 ? 83  SER A CB   2  
ATOM 3158  O OG   . SER A 1 83  ? 11.543  -9.683  -2.142  1.00 0.00 ? 83  SER A OG   2  
ATOM 3159  H H    . SER A 1 83  ? 9.262   -7.196  0.059   1.00 0.00 ? 83  SER A H    2  
ATOM 3160  H HA   . SER A 1 83  ? 10.410  -7.539  -2.601  1.00 0.00 ? 83  SER A HA   2  
ATOM 3161  H HB2  . SER A 1 83  ? 11.005  -8.963  -0.286  1.00 0.00 ? 83  SER A HB2  2  
ATOM 3162  H HB3  . SER A 1 83  ? 9.819   -9.997  -1.056  1.00 0.00 ? 83  SER A HB3  2  
ATOM 3163  H HG   . SER A 1 83  ? 11.556  -10.683 -2.139  1.00 0.00 ? 83  SER A HG   2  
ATOM 3164  N N    . ALA A 1 84  ? 7.549   -7.355  -2.294  1.00 0.00 ? 84  ALA A N    2  
ATOM 3165  C CA   . ALA A 1 84  ? 6.182   -7.567  -2.737  1.00 0.00 ? 84  ALA A CA   2  
ATOM 3166  C C    . ALA A 1 84  ? 6.022   -7.030  -4.161  1.00 0.00 ? 84  ALA A C    2  
ATOM 3167  O O    . ALA A 1 84  ? 6.176   -5.833  -4.397  1.00 0.00 ? 84  ALA A O    2  
ATOM 3168  C CB   . ALA A 1 84  ? 5.217   -6.904  -1.752  1.00 0.00 ? 84  ALA A CB   2  
ATOM 3169  H H    . ALA A 1 84  ? 7.761   -6.420  -2.009  1.00 0.00 ? 84  ALA A H    2  
ATOM 3170  H HA   . ALA A 1 84  ? 5.997   -8.641  -2.739  1.00 0.00 ? 84  ALA A HA   2  
ATOM 3171  H HB1  . ALA A 1 84  ? 4.267   -6.708  -2.249  1.00 0.00 ? 84  ALA A HB1  2  
ATOM 3172  H HB2  . ALA A 1 84  ? 5.053   -7.567  -0.902  1.00 0.00 ? 84  ALA A HB2  2  
ATOM 3173  H HB3  . ALA A 1 84  ? 5.645   -5.964  -1.402  1.00 0.00 ? 84  ALA A HB3  2  
ATOM 3174  N N    . ARG A 1 85  ? 5.715   -7.942  -5.072  1.00 0.00 ? 85  ARG A N    2  
ATOM 3175  C CA   . ARG A 1 85  ? 5.533   -7.576  -6.466  1.00 0.00 ? 85  ARG A CA   2  
ATOM 3176  C C    . ARG A 1 85  ? 4.043   -7.464  -6.795  1.00 0.00 ? 85  ARG A C    2  
ATOM 3177  O O    . ARG A 1 85  ? 3.663   -6.790  -7.751  1.00 0.00 ? 85  ARG A O    2  
ATOM 3178  C CB   . ARG A 1 85  ? 6.177   -8.606  -7.395  1.00 0.00 ? 85  ARG A CB   2  
ATOM 3179  C CG   . ARG A 1 85  ? 7.146   -7.934  -8.370  1.00 0.00 ? 85  ARG A CG   2  
ATOM 3180  C CD   . ARG A 1 85  ? 8.552   -7.844  -7.772  1.00 0.00 ? 85  ARG A CD   2  
ATOM 3181  N NE   . ARG A 1 85  ? 9.347   -9.028  -8.168  1.00 0.00 ? 85  ARG A NE   2  
ATOM 3182  C CZ   . ARG A 1 85  ? 10.606  -9.254  -7.770  1.00 0.00 ? 85  ARG A CZ   2  
ATOM 3183  N NH1  . ARG A 1 85  ? 11.221  -8.380  -6.963  1.00 0.00 ? 85  ARG A NH1  2  
ATOM 3184  N NH2  . ARG A 1 85  ? 11.251  -10.356 -8.180  1.00 0.00 ? 85  ARG A NH2  2  
ATOM 3185  H H    . ARG A 1 85  ? 5.592   -8.914  -4.871  1.00 0.00 ? 85  ARG A H    2  
ATOM 3186  H HA   . ARG A 1 85  ? 6.030   -6.611  -6.567  1.00 0.00 ? 85  ARG A HA   2  
ATOM 3187  H HB2  . ARG A 1 85  ? 6.709   -9.352  -6.804  1.00 0.00 ? 85  ARG A HB2  2  
ATOM 3188  H HB3  . ARG A 1 85  ? 5.403   -9.133  -7.952  1.00 0.00 ? 85  ARG A HB3  2  
ATOM 3189  H HG2  . ARG A 1 85  ? 7.179   -8.498  -9.302  1.00 0.00 ? 85  ARG A HG2  2  
ATOM 3190  H HG3  . ARG A 1 85  ? 6.787   -6.935  -8.615  1.00 0.00 ? 85  ARG A HG3  2  
ATOM 3191  H HD2  . ARG A 1 85  ? 9.044   -6.934  -8.114  1.00 0.00 ? 85  ARG A HD2  2  
ATOM 3192  H HD3  . ARG A 1 85  ? 8.490   -7.784  -6.685  1.00 0.00 ? 85  ARG A HD3  2  
ATOM 3193  H HE   . ARG A 1 85  ? 8.918   -9.701  -8.771  1.00 0.00 ? 85  ARG A HE   2  
ATOM 3194  H HH11 . ARG A 1 85  ? 10.741  -7.558  -6.657  1.00 0.00 ? 85  ARG A HH11 2  
ATOM 3195  H HH12 . ARG A 1 85  ? 12.161  -8.549  -6.666  1.00 0.00 ? 85  ARG A HH12 2  
ATOM 3196  H HH21 . ARG A 1 85  ? 10.792  -11.008 -8.782  1.00 0.00 ? 85  ARG A HH21 2  
ATOM 3197  H HH22 . ARG A 1 85  ? 12.191  -10.525 -7.883  1.00 0.00 ? 85  ARG A HH22 2  
ATOM 3198  N N    . GLN A 1 86  ? 3.238   -8.135  -5.983  1.00 0.00 ? 86  GLN A N    2  
ATOM 3199  C CA   . GLN A 1 86  ? 1.798   -8.120  -6.176  1.00 0.00 ? 86  GLN A CA   2  
ATOM 3200  C C    . GLN A 1 86  ? 1.082   -8.104  -4.824  1.00 0.00 ? 86  GLN A C    2  
ATOM 3201  O O    . GLN A 1 86  ? 1.701   -8.337  -3.787  1.00 0.00 ? 86  GLN A O    2  
ATOM 3202  C CB   . GLN A 1 86  ? 1.346   -9.311  -7.023  1.00 0.00 ? 86  GLN A CB   2  
ATOM 3203  C CG   . GLN A 1 86  ? 1.447   -10.616 -6.230  1.00 0.00 ? 86  GLN A CG   2  
ATOM 3204  C CD   . GLN A 1 86  ? 2.157   -11.699 -7.045  1.00 0.00 ? 86  GLN A CD   2  
ATOM 3205  O OE1  . GLN A 1 86  ? 2.154   -11.696 -8.265  1.00 0.00 ? 86  GLN A OE1  2  
ATOM 3206  N NE2  . GLN A 1 86  ? 2.763   -12.623 -6.305  1.00 0.00 ? 86  GLN A NE2  2  
ATOM 3207  H H    . GLN A 1 86  ? 3.555   -8.681  -5.208  1.00 0.00 ? 86  GLN A H    2  
ATOM 3208  H HA   . GLN A 1 86  ? 1.588   -7.197  -6.718  1.00 0.00 ? 86  GLN A HA   2  
ATOM 3209  H HB2  . GLN A 1 86  ? 0.317   -9.160  -7.350  1.00 0.00 ? 86  GLN A HB2  2  
ATOM 3210  H HB3  . GLN A 1 86  ? 1.960   -9.379  -7.921  1.00 0.00 ? 86  GLN A HB3  2  
ATOM 3211  H HG2  . GLN A 1 86  ? 1.989   -10.441 -5.301  1.00 0.00 ? 86  GLN A HG2  2  
ATOM 3212  H HG3  . GLN A 1 86  ? 0.449   -10.958 -5.957  1.00 0.00 ? 86  GLN A HG3  2  
ATOM 3213  H HE21 . GLN A 1 86  ? 2.727   -12.567 -5.308  1.00 0.00 ? 86  GLN A HE21 2  
ATOM 3214  H HE22 . GLN A 1 86  ? 3.255   -13.373 -6.747  1.00 0.00 ? 86  GLN A HE22 2  
ATOM 3215  N N    . TYR A 1 87  ? -0.212  -7.826  -4.880  1.00 0.00 ? 87  TYR A N    2  
ATOM 3216  C CA   . TYR A 1 87  ? -1.020  -7.777  -3.673  1.00 0.00 ? 87  TYR A CA   2  
ATOM 3217  C C    . TYR A 1 87  ? -2.461  -8.202  -3.959  1.00 0.00 ? 87  TYR A C    2  
ATOM 3218  O O    . TYR A 1 87  ? -2.963  -8.003  -5.064  1.00 0.00 ? 87  TYR A O    2  
ATOM 3219  C CB   . TYR A 1 87  ? -1.012  -6.315  -3.221  1.00 0.00 ? 87  TYR A CB   2  
ATOM 3220  C CG   . TYR A 1 87  ? -2.122  -5.966  -2.227  1.00 0.00 ? 87  TYR A CG   2  
ATOM 3221  C CD1  . TYR A 1 87  ? -1.945  -6.210  -0.881  1.00 0.00 ? 87  TYR A CD1  2  
ATOM 3222  C CD2  . TYR A 1 87  ? -3.301  -5.407  -2.678  1.00 0.00 ? 87  TYR A CD2  2  
ATOM 3223  C CE1  . TYR A 1 87  ? -2.990  -5.881  0.054   1.00 0.00 ? 87  TYR A CE1  2  
ATOM 3224  C CE2  . TYR A 1 87  ? -4.346  -5.078  -1.743  1.00 0.00 ? 87  TYR A CE2  2  
ATOM 3225  C CZ   . TYR A 1 87  ? -4.138  -5.331  -0.423  1.00 0.00 ? 87  TYR A CZ   2  
ATOM 3226  O OH   . TYR A 1 87  ? -5.125  -5.021  0.460   1.00 0.00 ? 87  TYR A OH   2  
ATOM 3227  H H    . TYR A 1 87  ? -0.708  -7.638  -5.728  1.00 0.00 ? 87  TYR A H    2  
ATOM 3228  H HA   . TYR A 1 87  ? -0.583  -8.463  -2.948  1.00 0.00 ? 87  TYR A HA   2  
ATOM 3229  H HB2  . TYR A 1 87  ? -0.048  -6.091  -2.765  1.00 0.00 ? 87  TYR A HB2  2  
ATOM 3230  H HB3  . TYR A 1 87  ? -1.108  -5.674  -4.097  1.00 0.00 ? 87  TYR A HB3  2  
ATOM 3231  H HD1  . TYR A 1 87  ? -1.014  -6.652  -0.525  1.00 0.00 ? 87  TYR A HD1  2  
ATOM 3232  H HD2  . TYR A 1 87  ? -3.441  -5.214  -3.741  1.00 0.00 ? 87  TYR A HD2  2  
ATOM 3233  H HE1  . TYR A 1 87  ? -2.863  -6.069  1.121   1.00 0.00 ? 87  TYR A HE1  2  
ATOM 3234  H HE2  . TYR A 1 87  ? -5.281  -4.636  -2.085  1.00 0.00 ? 87  TYR A HE2  2  
ATOM 3235  H HH   . TYR A 1 87  ? -5.583  -5.854  0.768   1.00 0.00 ? 87  TYR A HH   2  
ATOM 3236  N N    . THR A 1 88  ? -3.086  -8.782  -2.945  1.00 0.00 ? 88  THR A N    2  
ATOM 3237  C CA   . THR A 1 88  ? -4.460  -9.237  -3.073  1.00 0.00 ? 88  THR A CA   2  
ATOM 3238  C C    . THR A 1 88  ? -5.402  -8.318  -2.294  1.00 0.00 ? 88  THR A C    2  
ATOM 3239  O O    . THR A 1 88  ? -5.236  -8.131  -1.089  1.00 0.00 ? 88  THR A O    2  
ATOM 3240  C CB   . THR A 1 88  ? -4.518  -10.696 -2.617  1.00 0.00 ? 88  THR A CB   2  
ATOM 3241  O OG1  . THR A 1 88  ? -3.444  -11.322 -3.313  1.00 0.00 ? 88  THR A OG1  2  
ATOM 3242  C CG2  . THR A 1 88  ? -5.766  -11.420 -3.128  1.00 0.00 ? 88  THR A CG2  2  
ATOM 3243  H H    . THR A 1 88  ? -2.670  -8.940  -2.049  1.00 0.00 ? 88  THR A H    2  
ATOM 3244  H HA   . THR A 1 88  ? -4.746  -9.173  -4.123  1.00 0.00 ? 88  THR A HA   2  
ATOM 3245  H HB   . THR A 1 88  ? -4.444  -10.768 -1.532  1.00 0.00 ? 88  THR A HB   2  
ATOM 3246  H HG1  . THR A 1 88  ? -3.595  -11.262 -4.300  1.00 0.00 ? 88  THR A HG1  2  
ATOM 3247  H HG21 . THR A 1 88  ? -6.386  -10.722 -3.690  1.00 0.00 ? 88  THR A HG21 2  
ATOM 3248  H HG22 . THR A 1 88  ? -5.467  -12.244 -3.776  1.00 0.00 ? 88  THR A HG22 2  
ATOM 3249  H HG23 . THR A 1 88  ? -6.332  -11.810 -2.282  1.00 0.00 ? 88  THR A HG23 2  
ATOM 3250  N N    . ALA A 1 89  ? -6.370  -7.769  -3.012  1.00 0.00 ? 89  ALA A N    2  
ATOM 3251  C CA   . ALA A 1 89  ? -7.339  -6.874  -2.403  1.00 0.00 ? 89  ALA A CA   2  
ATOM 3252  C C    . ALA A 1 89  ? -8.679  -7.598  -2.263  1.00 0.00 ? 89  ALA A C    2  
ATOM 3253  O O    . ALA A 1 89  ? -9.308  -7.944  -3.262  1.00 0.00 ? 89  ALA A O    2  
ATOM 3254  C CB   . ALA A 1 89  ? -7.450  -5.597  -3.238  1.00 0.00 ? 89  ALA A CB   2  
ATOM 3255  H H    . ALA A 1 89  ? -6.498  -7.926  -3.991  1.00 0.00 ? 89  ALA A H    2  
ATOM 3256  H HA   . ALA A 1 89  ? -6.971  -6.613  -1.410  1.00 0.00 ? 89  ALA A HA   2  
ATOM 3257  H HB1  . ALA A 1 89  ? -8.174  -5.749  -4.039  1.00 0.00 ? 89  ALA A HB1  2  
ATOM 3258  H HB2  . ALA A 1 89  ? -7.779  -4.775  -2.603  1.00 0.00 ? 89  ALA A HB2  2  
ATOM 3259  H HB3  . ALA A 1 89  ? -6.477  -5.357  -3.668  1.00 0.00 ? 89  ALA A HB3  2  
ATOM 3260  N N    . THR A 1 90  ? -9.076  -7.806  -1.017  1.00 0.00 ? 90  THR A N    2  
ATOM 3261  C CA   . THR A 1 90  ? -10.330 -8.483  -0.734  1.00 0.00 ? 90  THR A CA   2  
ATOM 3262  C C    . THR A 1 90  ? -11.295 -7.540  -0.013  1.00 0.00 ? 90  THR A C    2  
ATOM 3263  O O    . THR A 1 90  ? -10.872 -6.554  0.589   1.00 0.00 ? 90  THR A O    2  
ATOM 3264  C CB   . THR A 1 90  ? -10.014 -9.752  0.061   1.00 0.00 ? 90  THR A CB   2  
ATOM 3265  O OG1  . THR A 1 90  ? -9.260  -9.283  1.177   1.00 0.00 ? 90  THR A OG1  2  
ATOM 3266  C CG2  . THR A 1 90  ? -9.048  -10.680 -0.677  1.00 0.00 ? 90  THR A CG2  2  
ATOM 3267  H H    . THR A 1 90  ? -8.558  -7.522  -0.210  1.00 0.00 ? 90  THR A H    2  
ATOM 3268  H HA   . THR A 1 90  ? -10.796 -8.755  -1.681  1.00 0.00 ? 90  THR A HA   2  
ATOM 3269  H HB   . THR A 1 90  ? -10.928 -10.278 0.334   1.00 0.00 ? 90  THR A HB   2  
ATOM 3270  H HG1  . THR A 1 90  ? -9.773  -8.577  1.663   1.00 0.00 ? 90  THR A HG1  2  
ATOM 3271  H HG21 . THR A 1 90  ? -8.059  -10.224 -0.711  1.00 0.00 ? 90  THR A HG21 2  
ATOM 3272  H HG22 . THR A 1 90  ? -8.990  -11.635 -0.154  1.00 0.00 ? 90  THR A HG22 2  
ATOM 3273  H HG23 . THR A 1 90  ? -9.407  -10.844 -1.693  1.00 0.00 ? 90  THR A HG23 2  
ATOM 3274  N N    . GLY A 1 91  ? -12.574 -7.874  -0.099  1.00 0.00 ? 91  GLY A N    2  
ATOM 3275  C CA   . GLY A 1 91  ? -13.603 -7.069  0.537   1.00 0.00 ? 91  GLY A CA   2  
ATOM 3276  C C    . GLY A 1 91  ? -13.779 -5.733  -0.187  1.00 0.00 ? 91  GLY A C    2  
ATOM 3277  O O    . GLY A 1 91  ? -13.530 -4.674  0.387   1.00 0.00 ? 91  GLY A O    2  
ATOM 3278  H H    . GLY A 1 91  ? -12.910 -8.678  -0.591  1.00 0.00 ? 91  GLY A H    2  
ATOM 3279  H HA2  . GLY A 1 91  ? -14.547 -7.614  0.538   1.00 0.00 ? 91  GLY A HA2  2  
ATOM 3280  H HA3  . GLY A 1 91  ? -13.337 -6.890  1.579   1.00 0.00 ? 91  GLY A HA3  2  
ATOM 3281  N N    . LEU A 1 92  ? -14.208 -5.826  -1.438  1.00 0.00 ? 92  LEU A N    2  
ATOM 3282  C CA   . LEU A 1 92  ? -14.420 -4.638  -2.246  1.00 0.00 ? 92  LEU A CA   2  
ATOM 3283  C C    . LEU A 1 92  ? -15.853 -4.641  -2.783  1.00 0.00 ? 92  LEU A C    2  
ATOM 3284  O O    . LEU A 1 92  ? -16.508 -5.682  -2.807  1.00 0.00 ? 92  LEU A O    2  
ATOM 3285  C CB   . LEU A 1 92  ? -13.354 -4.536  -3.339  1.00 0.00 ? 92  LEU A CB   2  
ATOM 3286  C CG   . LEU A 1 92  ? -11.940 -4.962  -2.939  1.00 0.00 ? 92  LEU A CG   2  
ATOM 3287  C CD1  . LEU A 1 92  ? -11.180 -5.533  -4.137  1.00 0.00 ? 92  LEU A CD1  2  
ATOM 3288  C CD2  . LEU A 1 92  ? -11.185 -3.806  -2.279  1.00 0.00 ? 92  LEU A CD2  2  
ATOM 3289  H H    . LEU A 1 92  ? -14.408 -6.691  -1.897  1.00 0.00 ? 92  LEU A H    2  
ATOM 3290  H HA   . LEU A 1 92  ? -14.297 -3.773  -1.595  1.00 0.00 ? 92  LEU A HA   2  
ATOM 3291  H HB2  . LEU A 1 92  ? -13.670 -5.146  -4.185  1.00 0.00 ? 92  LEU A HB2  2  
ATOM 3292  H HB3  . LEU A 1 92  ? -13.317 -3.503  -3.687  1.00 0.00 ? 92  LEU A HB3  2  
ATOM 3293  H HG   . LEU A 1 92  ? -12.020 -5.758  -2.199  1.00 0.00 ? 92  LEU A HG   2  
ATOM 3294  H HD11 . LEU A 1 92  ? -11.194 -6.622  -4.091  1.00 0.00 ? 92  LEU A HD11 2  
ATOM 3295  H HD12 . LEU A 1 92  ? -11.656 -5.203  -5.061  1.00 0.00 ? 92  LEU A HD12 2  
ATOM 3296  H HD13 . LEU A 1 92  ? -10.148 -5.181  -4.114  1.00 0.00 ? 92  LEU A HD13 2  
ATOM 3297  H HD21 . LEU A 1 92  ? -10.426 -4.205  -1.607  1.00 0.00 ? 92  LEU A HD21 2  
ATOM 3298  H HD22 . LEU A 1 92  ? -10.708 -3.198  -3.048  1.00 0.00 ? 92  LEU A HD22 2  
ATOM 3299  H HD23 . LEU A 1 92  ? -11.885 -3.191  -1.713  1.00 0.00 ? 92  LEU A HD23 2  
ATOM 3300  N N    . LYS A 1 93  ? -16.297 -3.465  -3.201  1.00 0.00 ? 93  LYS A N    2  
ATOM 3301  C CA   . LYS A 1 93  ? -17.640 -3.319  -3.735  1.00 0.00 ? 93  LYS A CA   2  
ATOM 3302  C C    . LYS A 1 93  ? -17.610 -3.549  -5.248  1.00 0.00 ? 93  LYS A C    2  
ATOM 3303  O O    . LYS A 1 93  ? -16.843 -2.905  -5.962  1.00 0.00 ? 93  LYS A O    2  
ATOM 3304  C CB   . LYS A 1 93  ? -18.234 -1.968  -3.331  1.00 0.00 ? 93  LYS A CB   2  
ATOM 3305  C CG   . LYS A 1 93  ? -19.554 -1.709  -4.060  1.00 0.00 ? 93  LYS A CG   2  
ATOM 3306  C CD   . LYS A 1 93  ? -19.620 -0.272  -4.581  1.00 0.00 ? 93  LYS A CD   2  
ATOM 3307  C CE   . LYS A 1 93  ? -19.594 0.732   -3.426  1.00 0.00 ? 93  LYS A CE   2  
ATOM 3308  N NZ   . LYS A 1 93  ? -19.683 2.116   -3.941  1.00 0.00 ? 93  LYS A NZ   2  
ATOM 3309  H H    . LYS A 1 93  ? -15.757 -2.623  -3.178  1.00 0.00 ? 93  LYS A H    2  
ATOM 3310  H HA   . LYS A 1 93  ? -18.259 -4.092  -3.280  1.00 0.00 ? 93  LYS A HA   2  
ATOM 3311  H HB2  . LYS A 1 93  ? -18.399 -1.947  -2.254  1.00 0.00 ? 93  LYS A HB2  2  
ATOM 3312  H HB3  . LYS A 1 93  ? -17.526 -1.172  -3.560  1.00 0.00 ? 93  LYS A HB3  2  
ATOM 3313  H HG2  . LYS A 1 93  ? -19.657 -2.406  -4.892  1.00 0.00 ? 93  LYS A HG2  2  
ATOM 3314  H HG3  . LYS A 1 93  ? -20.389 -1.893  -3.384  1.00 0.00 ? 93  LYS A HG3  2  
ATOM 3315  H HD2  . LYS A 1 93  ? -18.779 -0.085  -5.249  1.00 0.00 ? 93  LYS A HD2  2  
ATOM 3316  H HD3  . LYS A 1 93  ? -20.529 -0.135  -5.166  1.00 0.00 ? 93  LYS A HD3  2  
ATOM 3317  H HE2  . LYS A 1 93  ? -20.424 0.535   -2.747  1.00 0.00 ? 93  LYS A HE2  2  
ATOM 3318  H HE3  . LYS A 1 93  ? -18.676 0.610   -2.851  1.00 0.00 ? 93  LYS A HE3  2  
ATOM 3319  H HZ1  . LYS A 1 93  ? -20.364 2.624   -3.414  1.00 0.00 ? 93  LYS A HZ1  2  
ATOM 3320  H HZ2  . LYS A 1 93  ? -18.793 2.563   -3.853  1.00 0.00 ? 93  LYS A HZ2  2  
ATOM 3321  H HZ3  . LYS A 1 93  ? -19.953 2.097   -4.904  1.00 0.00 ? 93  LYS A HZ3  2  
ATOM 3322  N N    . PRO A 1 94  ? -18.476 -4.494  -5.703  1.00 0.00 ? 94  PRO A N    2  
ATOM 3323  C CA   . PRO A 1 94  ? -18.555 -4.817  -7.117  1.00 0.00 ? 94  PRO A CA   2  
ATOM 3324  C C    . PRO A 1 94  ? -19.292 -3.721  -7.889  1.00 0.00 ? 94  PRO A C    2  
ATOM 3325  O O    . PRO A 1 94  ? -19.976 -2.890  -7.294  1.00 0.00 ? 94  PRO A O    2  
ATOM 3326  C CB   . PRO A 1 94  ? -19.262 -6.162  -7.174  1.00 0.00 ? 94  PRO A CB   2  
ATOM 3327  C CG   . PRO A 1 94  ? -19.963 -6.321  -5.834  1.00 0.00 ? 94  PRO A CG   2  
ATOM 3328  C CD   . PRO A 1 94  ? -19.398 -5.277  -4.886  1.00 0.00 ? 94  PRO A CD   2  
ATOM 3329  H HA   . PRO A 1 94  ? -17.639 -4.863  -7.515  1.00 0.00 ? 94  PRO A HA   2  
ATOM 3330  H HB2  . PRO A 1 94  ? -19.978 -6.192  -7.995  1.00 0.00 ? 94  PRO A HB2  2  
ATOM 3331  H HB3  . PRO A 1 94  ? -18.551 -6.970  -7.341  1.00 0.00 ? 94  PRO A HB3  2  
ATOM 3332  H HG2  . PRO A 1 94  ? -21.039 -6.191  -5.949  1.00 0.00 ? 94  PRO A HG2  2  
ATOM 3333  H HG3  . PRO A 1 94  ? -19.804 -7.324  -5.437  1.00 0.00 ? 94  PRO A HG3  2  
ATOM 3334  H HD2  . PRO A 1 94  ? -20.188 -4.651  -4.470  1.00 0.00 ? 94  PRO A HD2  2  
ATOM 3335  H HD3  . PRO A 1 94  ? -18.885 -5.743  -4.044  1.00 0.00 ? 94  PRO A HD3  2  
ATOM 3336  N N    . GLU A 1 95  ? -19.127 -3.755  -9.203  1.00 0.00 ? 95  GLU A N    2  
ATOM 3337  C CA   . GLU A 1 95  ? -19.768 -2.775  -10.063 1.00 0.00 ? 95  GLU A CA   2  
ATOM 3338  C C    . GLU A 1 95  ? -19.311 -1.363  -9.692  1.00 0.00 ? 95  GLU A C    2  
ATOM 3339  O O    . GLU A 1 95  ? -20.127 -0.448  -9.593  1.00 0.00 ? 95  GLU A O    2  
ATOM 3340  C CB   . GLU A 1 95  ? -21.292 -2.894  -9.991  1.00 0.00 ? 95  GLU A CB   2  
ATOM 3341  C CG   . GLU A 1 95  ? -21.802 -3.978  -10.942 1.00 0.00 ? 95  GLU A CG   2  
ATOM 3342  C CD   . GLU A 1 95  ? -23.007 -4.709  -10.345 1.00 0.00 ? 95  GLU A CD   2  
ATOM 3343  O OE1  . GLU A 1 95  ? -24.104 -4.110  -10.371 1.00 0.00 ? 95  GLU A OE1  2  
ATOM 3344  O OE2  . GLU A 1 95  ? -22.803 -5.850  -9.876  1.00 0.00 ? 95  GLU A OE2  2  
ATOM 3345  H H    . GLU A 1 95  ? -18.569 -4.435  -9.680  1.00 0.00 ? 95  GLU A H    2  
ATOM 3346  H HA   . GLU A 1 95  ? -19.438 -3.016  -11.074 1.00 0.00 ? 95  GLU A HA   2  
ATOM 3347  H HB2  . GLU A 1 95  ? -21.593 -3.130  -8.970  1.00 0.00 ? 95  GLU A HB2  2  
ATOM 3348  H HB3  . GLU A 1 95  ? -21.748 -1.938  -10.246 1.00 0.00 ? 95  GLU A HB3  2  
ATOM 3349  H HG2  . GLU A 1 95  ? -22.081 -3.529  -11.895 1.00 0.00 ? 95  GLU A HG2  2  
ATOM 3350  H HG3  . GLU A 1 95  ? -21.005 -4.692  -11.148 1.00 0.00 ? 95  GLU A HG3  2  
ATOM 3351  N N    . SER A 1 96  ? -18.007 -1.230  -9.496  1.00 0.00 ? 96  SER A N    2  
ATOM 3352  C CA   . SER A 1 96  ? -17.431 0.055   -9.137  1.00 0.00 ? 96  SER A CA   2  
ATOM 3353  C C    . SER A 1 96  ? -15.991 0.144   -9.647  1.00 0.00 ? 96  SER A C    2  
ATOM 3354  O O    . SER A 1 96  ? -15.505 -0.773  -10.306 1.00 0.00 ? 96  SER A O    2  
ATOM 3355  C CB   . SER A 1 96  ? -17.473 0.274   -7.624  1.00 0.00 ? 96  SER A CB   2  
ATOM 3356  O OG   . SER A 1 96  ? -18.515 1.168   -7.242  1.00 0.00 ? 96  SER A OG   2  
ATOM 3357  H H    . SER A 1 96  ? -17.350 -1.979  -9.578  1.00 0.00 ? 96  SER A H    2  
ATOM 3358  H HA   . SER A 1 96  ? -18.058 0.799   -9.629  1.00 0.00 ? 96  SER A HA   2  
ATOM 3359  H HB2  . SER A 1 96  ? -17.615 -0.684  -7.122  1.00 0.00 ? 96  SER A HB2  2  
ATOM 3360  H HB3  . SER A 1 96  ? -16.515 0.670   -7.288  1.00 0.00 ? 96  SER A HB3  2  
ATOM 3361  H HG   . SER A 1 96  ? -19.336 0.652   -6.998  1.00 0.00 ? 96  SER A HG   2  
ATOM 3362  N N    . VAL A 1 97  ? -15.350 1.257   -9.322  1.00 0.00 ? 97  VAL A N    2  
ATOM 3363  C CA   . VAL A 1 97  ? -13.976 1.477   -9.738  1.00 0.00 ? 97  VAL A CA   2  
ATOM 3364  C C    . VAL A 1 97  ? -13.107 1.726   -8.504  1.00 0.00 ? 97  VAL A C    2  
ATOM 3365  O O    . VAL A 1 97  ? -13.424 2.583   -7.680  1.00 0.00 ? 97  VAL A O    2  
ATOM 3366  C CB   . VAL A 1 97  ? -13.913 2.620   -10.753 1.00 0.00 ? 97  VAL A CB   2  
ATOM 3367  C CG1  . VAL A 1 97  ? -12.507 2.757   -11.339 1.00 0.00 ? 97  VAL A CG1  2  
ATOM 3368  C CG2  . VAL A 1 97  ? -14.952 2.427   -11.860 1.00 0.00 ? 97  VAL A CG2  2  
ATOM 3369  H H    . VAL A 1 97  ? -15.753 1.998   -8.785  1.00 0.00 ? 97  VAL A H    2  
ATOM 3370  H HA   . VAL A 1 97  ? -13.631 0.568   -10.232 1.00 0.00 ? 97  VAL A HA   2  
ATOM 3371  H HB   . VAL A 1 97  ? -14.150 3.546   -10.230 1.00 0.00 ? 97  VAL A HB   2  
ATOM 3372  H HG11 . VAL A 1 97  ? -12.451 2.213   -12.282 1.00 0.00 ? 97  VAL A HG11 2  
ATOM 3373  H HG12 . VAL A 1 97  ? -12.287 3.810   -11.514 1.00 0.00 ? 97  VAL A HG12 2  
ATOM 3374  H HG13 . VAL A 1 97  ? -11.780 2.346   -10.639 1.00 0.00 ? 97  VAL A HG13 2  
ATOM 3375  H HG21 . VAL A 1 97  ? -14.444 2.234   -12.805 1.00 0.00 ? 97  VAL A HG21 2  
ATOM 3376  H HG22 . VAL A 1 97  ? -15.594 1.581   -11.613 1.00 0.00 ? 97  VAL A HG22 2  
ATOM 3377  H HG23 . VAL A 1 97  ? -15.558 3.329   -11.951 1.00 0.00 ? 97  VAL A HG23 2  
ATOM 3378  N N    . TYR A 1 98  ? -12.028 0.962   -8.415  1.00 0.00 ? 98  TYR A N    2  
ATOM 3379  C CA   . TYR A 1 98  ? -11.111 1.089   -7.295  1.00 0.00 ? 98  TYR A CA   2  
ATOM 3380  C C    . TYR A 1 98  ? -9.731  1.551   -7.766  1.00 0.00 ? 98  TYR A C    2  
ATOM 3381  O O    . TYR A 1 98  ? -9.175  0.994   -8.711  1.00 0.00 ? 98  TYR A O    2  
ATOM 3382  C CB   . TYR A 1 98  ? -10.988 -0.310  -6.689  1.00 0.00 ? 98  TYR A CB   2  
ATOM 3383  C CG   . TYR A 1 98  ? -12.042 -0.622  -5.624  1.00 0.00 ? 98  TYR A CG   2  
ATOM 3384  C CD1  . TYR A 1 98  ? -13.375 -0.696  -5.974  1.00 0.00 ? 98  TYR A CD1  2  
ATOM 3385  C CD2  . TYR A 1 98  ? -11.659 -0.830  -4.315  1.00 0.00 ? 98  TYR A CD2  2  
ATOM 3386  C CE1  . TYR A 1 98  ? -14.367 -0.990  -4.972  1.00 0.00 ? 98  TYR A CE1  2  
ATOM 3387  C CE2  . TYR A 1 98  ? -12.651 -1.124  -3.313  1.00 0.00 ? 98  TYR A CE2  2  
ATOM 3388  C CZ   . TYR A 1 98  ? -13.956 -1.189  -3.691  1.00 0.00 ? 98  TYR A CZ   2  
ATOM 3389  O OH   . TYR A 1 98  ? -14.892 -1.467  -2.744  1.00 0.00 ? 98  TYR A OH   2  
ATOM 3390  H H    . TYR A 1 98  ? -11.777 0.268   -9.089  1.00 0.00 ? 98  TYR A H    2  
ATOM 3391  H HA   . TYR A 1 98  ? -11.520 1.831   -6.608  1.00 0.00 ? 98  TYR A HA   2  
ATOM 3392  H HB2  . TYR A 1 98  ? -11.064 -1.048  -7.488  1.00 0.00 ? 98  TYR A HB2  2  
ATOM 3393  H HB3  . TYR A 1 98  ? -9.998  -0.419  -6.248  1.00 0.00 ? 98  TYR A HB3  2  
ATOM 3394  H HD1  . TYR A 1 98  ? -13.677 -0.532  -7.008  1.00 0.00 ? 98  TYR A HD1  2  
ATOM 3395  H HD2  . TYR A 1 98  ? -10.606 -0.772  -4.039  1.00 0.00 ? 98  TYR A HD2  2  
ATOM 3396  H HE1  . TYR A 1 98  ? -15.423 -1.051  -5.234  1.00 0.00 ? 98  TYR A HE1  2  
ATOM 3397  H HE2  . TYR A 1 98  ? -12.362 -1.290  -2.275  1.00 0.00 ? 98  TYR A HE2  2  
ATOM 3398  H HH   . TYR A 1 98  ? -14.938 -0.721  -2.080  1.00 0.00 ? 98  TYR A HH   2  
ATOM 3399  N N    . LEU A 1 99  ? -9.217  2.565   -7.084  1.00 0.00 ? 99  LEU A N    2  
ATOM 3400  C CA   . LEU A 1 99  ? -7.912  3.108   -7.421  1.00 0.00 ? 99  LEU A CA   2  
ATOM 3401  C C    . LEU A 1 99  ? -6.854  2.484   -6.509  1.00 0.00 ? 99  LEU A C    2  
ATOM 3402  O O    . LEU A 1 99  ? -6.944  2.586   -5.287  1.00 0.00 ? 99  LEU A O    2  
ATOM 3403  C CB   . LEU A 1 99  ? -7.939  4.637   -7.375  1.00 0.00 ? 99  LEU A CB   2  
ATOM 3404  C CG   . LEU A 1 99  ? -6.577  5.333   -7.383  1.00 0.00 ? 99  LEU A CG   2  
ATOM 3405  C CD1  . LEU A 1 99  ? -5.908  5.245   -6.009  1.00 0.00 ? 99  LEU A CD1  2  
ATOM 3406  C CD2  . LEU A 1 99  ? -5.683  4.775   -8.492  1.00 0.00 ? 99  LEU A CD2  2  
ATOM 3407  H H    . LEU A 1 99  ? -9.675  3.012   -6.316  1.00 0.00 ? 99  LEU A H    2  
ATOM 3408  H HA   . LEU A 1 99  ? -7.694  2.820   -8.450  1.00 0.00 ? 99  LEU A HA   2  
ATOM 3409  H HB2  . LEU A 1 99  ? -8.514  4.996   -8.229  1.00 0.00 ? 99  LEU A HB2  2  
ATOM 3410  H HB3  . LEU A 1 99  ? -8.477  4.944   -6.477  1.00 0.00 ? 99  LEU A HB3  2  
ATOM 3411  H HG   . LEU A 1 99  ? -6.735  6.390   -7.597  1.00 0.00 ? 99  LEU A HG   2  
ATOM 3412  H HD11 . LEU A 1 99  ? -5.172  4.442   -6.014  1.00 0.00 ? 99  LEU A HD11 2  
ATOM 3413  H HD12 . LEU A 1 99  ? -5.414  6.190   -5.785  1.00 0.00 ? 99  LEU A HD12 2  
ATOM 3414  H HD13 . LEU A 1 99  ? -6.664  5.042   -5.250  1.00 0.00 ? 99  LEU A HD13 2  
ATOM 3415  H HD21 . LEU A 1 99  ? -5.837  5.349   -9.406  1.00 0.00 ? 99  LEU A HD21 2  
ATOM 3416  H HD22 . LEU A 1 99  ? -4.639  4.849   -8.188  1.00 0.00 ? 99  LEU A HD22 2  
ATOM 3417  H HD23 . LEU A 1 99  ? -5.936  3.730   -8.672  1.00 0.00 ? 99  LEU A HD23 2  
ATOM 3418  N N    . PHE A 1 100 ? -5.874  1.851   -7.138  1.00 0.00 ? 100 PHE A N    2  
ATOM 3419  C CA   . PHE A 1 100 ? -4.800  1.211   -6.399  1.00 0.00 ? 100 PHE A CA   2  
ATOM 3420  C C    . PHE A 1 100 ? -3.530  2.064   -6.427  1.00 0.00 ? 100 PHE A C    2  
ATOM 3421  O O    . PHE A 1 100 ? -2.919  2.239   -7.480  1.00 0.00 ? 100 PHE A O    2  
ATOM 3422  C CB   . PHE A 1 100 ? -4.518  -0.126  -7.088  1.00 0.00 ? 100 PHE A CB   2  
ATOM 3423  C CG   . PHE A 1 100 ? -5.360  -1.289  -6.559  1.00 0.00 ? 100 PHE A CG   2  
ATOM 3424  C CD1  . PHE A 1 100 ? -6.659  -1.415  -6.940  1.00 0.00 ? 100 PHE A CD1  2  
ATOM 3425  C CD2  . PHE A 1 100 ? -4.809  -2.195  -5.708  1.00 0.00 ? 100 PHE A CD2  2  
ATOM 3426  C CE1  . PHE A 1 100 ? -7.441  -2.495  -6.449  1.00 0.00 ? 100 PHE A CE1  2  
ATOM 3427  C CE2  . PHE A 1 100 ? -5.591  -3.275  -5.217  1.00 0.00 ? 100 PHE A CE2  2  
ATOM 3428  C CZ   . PHE A 1 100 ? -6.890  -3.401  -5.598  1.00 0.00 ? 100 PHE A CZ   2  
ATOM 3429  H H    . PHE A 1 100 ? -5.808  1.772   -8.133  1.00 0.00 ? 100 PHE A H    2  
ATOM 3430  H HA   . PHE A 1 100 ? -5.138  1.100   -5.368  1.00 0.00 ? 100 PHE A HA   2  
ATOM 3431  H HB2  . PHE A 1 100 ? -4.698  -0.017  -8.157  1.00 0.00 ? 100 PHE A HB2  2  
ATOM 3432  H HB3  . PHE A 1 100 ? -3.462  -0.370  -6.965  1.00 0.00 ? 100 PHE A HB3  2  
ATOM 3433  H HD1  . PHE A 1 100 ? -7.101  -0.689  -7.621  1.00 0.00 ? 100 PHE A HD1  2  
ATOM 3434  H HD2  . PHE A 1 100 ? -3.768  -2.094  -5.403  1.00 0.00 ? 100 PHE A HD2  2  
ATOM 3435  H HE1  . PHE A 1 100 ? -8.482  -2.596  -6.754  1.00 0.00 ? 100 PHE A HE1  2  
ATOM 3436  H HE2  . PHE A 1 100 ? -5.149  -4.001  -4.535  1.00 0.00 ? 100 PHE A HE2  2  
ATOM 3437  H HZ   . PHE A 1 100 ? -7.490  -4.230  -5.221  1.00 0.00 ? 100 PHE A HZ   2  
ATOM 3438  N N    . ARG A 1 101 ? -3.171  2.573   -5.258  1.00 0.00 ? 101 ARG A N    2  
ATOM 3439  C CA   . ARG A 1 101 ? -1.985  3.403   -5.135  1.00 0.00 ? 101 ARG A CA   2  
ATOM 3440  C C    . ARG A 1 101 ? -0.827  2.592   -4.552  1.00 0.00 ? 101 ARG A C    2  
ATOM 3441  O O    . ARG A 1 101 ? -0.838  2.246   -3.372  1.00 0.00 ? 101 ARG A O    2  
ATOM 3442  C CB   . ARG A 1 101 ? -2.252  4.615   -4.240  1.00 0.00 ? 101 ARG A CB   2  
ATOM 3443  C CG   . ARG A 1 101 ? -1.468  5.837   -4.724  1.00 0.00 ? 101 ARG A CG   2  
ATOM 3444  C CD   . ARG A 1 101 ? -2.330  7.099   -4.664  1.00 0.00 ? 101 ARG A CD   2  
ATOM 3445  N NE   . ARG A 1 101 ? -2.841  7.300   -3.290  1.00 0.00 ? 101 ARG A NE   2  
ATOM 3446  C CZ   . ARG A 1 101 ? -3.607  8.334   -2.916  1.00 0.00 ? 101 ARG A CZ   2  
ATOM 3447  N NH1  . ARG A 1 101 ? -3.956  9.267   -3.812  1.00 0.00 ? 101 ARG A NH1  2  
ATOM 3448  N NH2  . ARG A 1 101 ? -4.025  8.434   -1.647  1.00 0.00 ? 101 ARG A NH2  2  
ATOM 3449  H H    . ARG A 1 101 ? -3.674  2.425   -4.406  1.00 0.00 ? 101 ARG A H    2  
ATOM 3450  H HA   . ARG A 1 101 ? -1.765  3.726   -6.153  1.00 0.00 ? 101 ARG A HA   2  
ATOM 3451  H HB2  . ARG A 1 101 ? -3.318  4.841   -4.235  1.00 0.00 ? 101 ARG A HB2  2  
ATOM 3452  H HB3  . ARG A 1 101 ? -1.971  4.382   -3.213  1.00 0.00 ? 101 ARG A HB3  2  
ATOM 3453  H HG2  . ARG A 1 101 ? -0.579  5.970   -4.108  1.00 0.00 ? 101 ARG A HG2  2  
ATOM 3454  H HG3  . ARG A 1 101 ? -1.127  5.673   -5.746  1.00 0.00 ? 101 ARG A HG3  2  
ATOM 3455  H HD2  . ARG A 1 101 ? -1.744  7.965   -4.973  1.00 0.00 ? 101 ARG A HD2  2  
ATOM 3456  H HD3  . ARG A 1 101 ? -3.164  7.014   -5.362  1.00 0.00 ? 101 ARG A HD3  2  
ATOM 3457  H HE   . ARG A 1 101 ? -2.599  6.621   -2.596  1.00 0.00 ? 101 ARG A HE   2  
ATOM 3458  H HH11 . ARG A 1 101 ? -3.644  9.193   -4.759  1.00 0.00 ? 101 ARG A HH11 2  
ATOM 3459  H HH12 . ARG A 1 101 ? -4.527  10.039  -3.533  1.00 0.00 ? 101 ARG A HH12 2  
ATOM 3460  H HH21 . ARG A 1 101 ? -3.764  7.737   -0.978  1.00 0.00 ? 101 ARG A HH21 2  
ATOM 3461  H HH22 . ARG A 1 101 ? -4.596  9.206   -1.368  1.00 0.00 ? 101 ARG A HH22 2  
ATOM 3462  N N    . ILE A 1 102 ? 0.146   2.311   -5.407  1.00 0.00 ? 102 ILE A N    2  
ATOM 3463  C CA   . ILE A 1 102 ? 1.310   1.547   -4.991  1.00 0.00 ? 102 ILE A CA   2  
ATOM 3464  C C    . ILE A 1 102 ? 2.451   2.508   -4.651  1.00 0.00 ? 102 ILE A C    2  
ATOM 3465  O O    . ILE A 1 102 ? 2.686   3.477   -5.370  1.00 0.00 ? 102 ILE A O    2  
ATOM 3466  C CB   . ILE A 1 102 ? 1.676   0.508   -6.053  1.00 0.00 ? 102 ILE A CB   2  
ATOM 3467  C CG1  . ILE A 1 102 ? 0.586   -0.558  -6.177  1.00 0.00 ? 102 ILE A CG1  2  
ATOM 3468  C CG2  . ILE A 1 102 ? 3.049   -0.106  -5.769  1.00 0.00 ? 102 ILE A CG2  2  
ATOM 3469  C CD1  . ILE A 1 102 ? 0.544   -1.137  -7.593  1.00 0.00 ? 102 ILE A CD1  2  
ATOM 3470  H H    . ILE A 1 102 ? 0.148   2.596   -6.365  1.00 0.00 ? 102 ILE A H    2  
ATOM 3471  H HA   . ILE A 1 102 ? 1.037   1.001   -4.088  1.00 0.00 ? 102 ILE A HA   2  
ATOM 3472  H HB   . ILE A 1 102 ? 1.743   1.014   -7.016  1.00 0.00 ? 102 ILE A HB   2  
ATOM 3473  H HG12 . ILE A 1 102 ? 0.770   -1.356  -5.459  1.00 0.00 ? 102 ILE A HG12 2  
ATOM 3474  H HG13 . ILE A 1 102 ? -0.383  -0.123  -5.929  1.00 0.00 ? 102 ILE A HG13 2  
ATOM 3475  H HG21 . ILE A 1 102 ? 3.363   -0.703  -6.625  1.00 0.00 ? 102 ILE A HG21 2  
ATOM 3476  H HG22 . ILE A 1 102 ? 3.773   0.689   -5.595  1.00 0.00 ? 102 ILE A HG22 2  
ATOM 3477  H HG23 . ILE A 1 102 ? 2.986   -0.741  -4.886  1.00 0.00 ? 102 ILE A HG23 2  
ATOM 3478  H HD11 . ILE A 1 102 ? 0.412   -2.217  -7.540  1.00 0.00 ? 102 ILE A HD11 2  
ATOM 3479  H HD12 . ILE A 1 102 ? -0.289  -0.696  -8.141  1.00 0.00 ? 102 ILE A HD12 2  
ATOM 3480  H HD13 . ILE A 1 102 ? 1.478   -0.909  -8.107  1.00 0.00 ? 102 ILE A HD13 2  
ATOM 3481  N N    . THR A 1 103 ? 3.129   2.205   -3.554  1.00 0.00 ? 103 THR A N    2  
ATOM 3482  C CA   . THR A 1 103 ? 4.240   3.030   -3.109  1.00 0.00 ? 103 THR A CA   2  
ATOM 3483  C C    . THR A 1 103 ? 5.290   2.173   -2.400  1.00 0.00 ? 103 THR A C    2  
ATOM 3484  O O    . THR A 1 103 ? 4.976   1.103   -1.881  1.00 0.00 ? 103 THR A O    2  
ATOM 3485  C CB   . THR A 1 103 ? 3.676   4.149   -2.232  1.00 0.00 ? 103 THR A CB   2  
ATOM 3486  O OG1  . THR A 1 103 ? 2.534   4.610   -2.948  1.00 0.00 ? 103 THR A OG1  2  
ATOM 3487  C CG2  . THR A 1 103 ? 4.598   5.369   -2.175  1.00 0.00 ? 103 THR A CG2  2  
ATOM 3488  H H    . THR A 1 103 ? 2.931   1.415   -2.974  1.00 0.00 ? 103 THR A H    2  
ATOM 3489  H HA   . THR A 1 103 ? 4.720   3.462   -3.987  1.00 0.00 ? 103 THR A HA   2  
ATOM 3490  H HB   . THR A 1 103 ? 3.453   3.783   -1.230  1.00 0.00 ? 103 THR A HB   2  
ATOM 3491  H HG1  . THR A 1 103 ? 1.705   4.197   -2.572  1.00 0.00 ? 103 THR A HG1  2  
ATOM 3492  H HG21 . THR A 1 103 ? 4.395   6.017   -3.028  1.00 0.00 ? 103 THR A HG21 2  
ATOM 3493  H HG22 . THR A 1 103 ? 4.418   5.918   -1.251  1.00 0.00 ? 103 THR A HG22 2  
ATOM 3494  H HG23 . THR A 1 103 ? 5.637   5.042   -2.207  1.00 0.00 ? 103 THR A HG23 2  
ATOM 3495  N N    . ALA A 1 104 ? 6.516   2.675   -2.401  1.00 0.00 ? 104 ALA A N    2  
ATOM 3496  C CA   . ALA A 1 104 ? 7.615   1.969   -1.765  1.00 0.00 ? 104 ALA A CA   2  
ATOM 3497  C C    . ALA A 1 104 ? 8.084   2.760   -0.542  1.00 0.00 ? 104 ALA A C    2  
ATOM 3498  O O    . ALA A 1 104 ? 7.874   3.970   -0.463  1.00 0.00 ? 104 ALA A O    2  
ATOM 3499  C CB   . ALA A 1 104 ? 8.737   1.747   -2.781  1.00 0.00 ? 104 ALA A CB   2  
ATOM 3500  H H    . ALA A 1 104 ? 6.763   3.546   -2.826  1.00 0.00 ? 104 ALA A H    2  
ATOM 3501  H HA   . ALA A 1 104 ? 7.241   0.999   -1.437  1.00 0.00 ? 104 ALA A HA   2  
ATOM 3502  H HB1  . ALA A 1 104 ? 9.234   0.799   -2.573  1.00 0.00 ? 104 ALA A HB1  2  
ATOM 3503  H HB2  . ALA A 1 104 ? 8.316   1.723   -3.787  1.00 0.00 ? 104 ALA A HB2  2  
ATOM 3504  H HB3  . ALA A 1 104 ? 9.459   2.560   -2.709  1.00 0.00 ? 104 ALA A HB3  2  
ATOM 3505  N N    . GLN A 1 105 ? 8.711   2.046   0.381   1.00 0.00 ? 105 GLN A N    2  
ATOM 3506  C CA   . GLN A 1 105 ? 9.212   2.666   1.595   1.00 0.00 ? 105 GLN A CA   2  
ATOM 3507  C C    . GLN A 1 105 ? 10.735  2.543   1.665   1.00 0.00 ? 105 GLN A C    2  
ATOM 3508  O O    . GLN A 1 105 ? 11.278  1.444   1.562   1.00 0.00 ? 105 GLN A O    2  
ATOM 3509  C CB   . GLN A 1 105 ? 8.555   2.055   2.835   1.00 0.00 ? 105 GLN A CB   2  
ATOM 3510  C CG   . GLN A 1 105 ? 9.197   2.590   4.116   1.00 0.00 ? 105 GLN A CG   2  
ATOM 3511  C CD   . GLN A 1 105 ? 8.131   2.969   5.147   1.00 0.00 ? 105 GLN A CD   2  
ATOM 3512  O OE1  . GLN A 1 105 ? 7.926   4.127   5.469   1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3513  N NE2  . GLN A 1 105 ? 7.466   1.929   5.644   1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3514  H H    . GLN A 1 105 ? 8.878   1.062   0.309   1.00 0.00 ? 105 GLN A H    2  
ATOM 3515  H HA   . GLN A 1 105 ? 8.929   3.716   1.522   1.00 0.00 ? 105 GLN A HA   2  
ATOM 3516  H HB2  . GLN A 1 105 ? 7.489   2.283   2.835   1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3517  H HB3  . GLN A 1 105 ? 8.648   0.970   2.802   1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3518  H HG2  . GLN A 1 105 ? 9.862   1.836   4.536   1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3519  H HG3  . GLN A 1 105 ? 9.809   3.462   3.884   1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3520  H HE21 . GLN A 1 105 ? 7.684   1.003   5.336   1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3521  H HE22 . GLN A 1 105 ? 6.749   2.074   6.325   1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3522  N N    . THR A 1 106 ? 11.382  3.685   1.841   1.00 0.00 ? 106 THR A N    2  
ATOM 3523  C CA   . THR A 1 106 ? 12.832  3.719   1.926   1.00 0.00 ? 106 THR A CA   2  
ATOM 3524  C C    . THR A 1 106 ? 13.275  4.382   3.232   1.00 0.00 ? 106 THR A C    2  
ATOM 3525  O O    . THR A 1 106 ? 12.461  4.602   4.127   1.00 0.00 ? 106 THR A O    2  
ATOM 3526  C CB   . THR A 1 106 ? 13.363  4.424   0.676   1.00 0.00 ? 106 THR A CB   2  
ATOM 3527  O OG1  . THR A 1 106 ? 12.451  5.498   0.470   1.00 0.00 ? 106 THR A OG1  2  
ATOM 3528  C CG2  . THR A 1 106 ? 13.222  3.567   -0.584  1.00 0.00 ? 106 THR A CG2  2  
ATOM 3529  H H    . THR A 1 106 ? 10.933  4.575   1.925   1.00 0.00 ? 106 THR A H    2  
ATOM 3530  H HA   . THR A 1 106 ? 13.199  2.693   1.949   1.00 0.00 ? 106 THR A HA   2  
ATOM 3531  H HB   . THR A 1 106 ? 14.396  4.741   0.818   1.00 0.00 ? 106 THR A HB   2  
ATOM 3532  H HG1  . THR A 1 106 ? 11.579  5.146   0.130   1.00 0.00 ? 106 THR A HG1  2  
ATOM 3533  H HG21 . THR A 1 106 ? 13.548  4.141   -1.451  1.00 0.00 ? 106 THR A HG21 2  
ATOM 3534  H HG22 . THR A 1 106 ? 13.838  2.674   -0.487  1.00 0.00 ? 106 THR A HG22 2  
ATOM 3535  H HG23 . THR A 1 106 ? 12.179  3.277   -0.711  1.00 0.00 ? 106 THR A HG23 2  
ATOM 3536  N N    . ARG A 1 107 ? 14.564  4.682   3.299   1.00 0.00 ? 107 ARG A N    2  
ATOM 3537  C CA   . ARG A 1 107 ? 15.124  5.316   4.480   1.00 0.00 ? 107 ARG A CA   2  
ATOM 3538  C C    . ARG A 1 107 ? 14.742  6.797   4.520   1.00 0.00 ? 107 ARG A C    2  
ATOM 3539  O O    . ARG A 1 107 ? 14.892  7.453   5.549   1.00 0.00 ? 107 ARG A O    2  
ATOM 3540  C CB   . ARG A 1 107 ? 16.649  5.189   4.503   1.00 0.00 ? 107 ARG A CB   2  
ATOM 3541  C CG   . ARG A 1 107 ? 17.284  6.005   3.375   1.00 0.00 ? 107 ARG A CG   2  
ATOM 3542  C CD   . ARG A 1 107 ? 18.806  5.853   3.379   1.00 0.00 ? 107 ARG A CD   2  
ATOM 3543  N NE   . ARG A 1 107 ? 19.443  7.143   3.723   1.00 0.00 ? 107 ARG A NE   2  
ATOM 3544  C CZ   . ARG A 1 107 ? 20.746  7.406   3.556   1.00 0.00 ? 107 ARG A CZ   2  
ATOM 3545  N NH1  . ARG A 1 107 ? 21.559  6.469   3.049   1.00 0.00 ? 107 ARG A NH1  2  
ATOM 3546  N NH2  . ARG A 1 107 ? 21.237  8.606   3.897   1.00 0.00 ? 107 ARG A NH2  2  
ATOM 3547  H H    . ARG A 1 107 ? 15.219  4.500   2.566   1.00 0.00 ? 107 ARG A H    2  
ATOM 3548  H HA   . ARG A 1 107 ? 14.687  4.776   5.320   1.00 0.00 ? 107 ARG A HA   2  
ATOM 3549  H HB2  . ARG A 1 107 ? 17.031  5.531   5.464   1.00 0.00 ? 107 ARG A HB2  2  
ATOM 3550  H HB3  . ARG A 1 107 ? 16.931  4.141   4.402   1.00 0.00 ? 107 ARG A HB3  2  
ATOM 3551  H HG2  . ARG A 1 107 ? 16.884  5.677   2.415   1.00 0.00 ? 107 ARG A HG2  2  
ATOM 3552  H HG3  . ARG A 1 107 ? 17.019  7.056   3.488   1.00 0.00 ? 107 ARG A HG3  2  
ATOM 3553  H HD2  . ARG A 1 107 ? 19.102  5.089   4.098   1.00 0.00 ? 107 ARG A HD2  2  
ATOM 3554  H HD3  . ARG A 1 107 ? 19.149  5.518   2.399   1.00 0.00 ? 107 ARG A HD3  2  
ATOM 3555  H HE   . ARG A 1 107 ? 18.864  7.865   4.104   1.00 0.00 ? 107 ARG A HE   2  
ATOM 3556  H HH11 . ARG A 1 107 ? 21.193  5.574   2.795   1.00 0.00 ? 107 ARG A HH11 2  
ATOM 3557  H HH12 . ARG A 1 107 ? 22.532  6.666   2.925   1.00 0.00 ? 107 ARG A HH12 2  
ATOM 3558  H HH21 . ARG A 1 107 ? 20.630  9.305   4.275   1.00 0.00 ? 107 ARG A HH21 2  
ATOM 3559  H HH22 . ARG A 1 107 ? 22.209  8.802   3.773   1.00 0.00 ? 107 ARG A HH22 2  
ATOM 3560  N N    . LYS A 1 108 ? 14.257  7.281   3.385   1.00 0.00 ? 108 LYS A N    2  
ATOM 3561  C CA   . LYS A 1 108 ? 13.852  8.672   3.277   1.00 0.00 ? 108 LYS A CA   2  
ATOM 3562  C C    . LYS A 1 108 ? 12.359  8.790   3.587   1.00 0.00 ? 108 LYS A C    2  
ATOM 3563  O O    . LYS A 1 108 ? 11.923  9.762   4.203   1.00 0.00 ? 108 LYS A O    2  
ATOM 3564  C CB   . LYS A 1 108 ? 14.244  9.239   1.912   1.00 0.00 ? 108 LYS A CB   2  
ATOM 3565  C CG   . LYS A 1 108 ? 15.699  8.903   1.575   1.00 0.00 ? 108 LYS A CG   2  
ATOM 3566  C CD   . LYS A 1 108 ? 16.651  9.477   2.626   1.00 0.00 ? 108 LYS A CD   2  
ATOM 3567  C CE   . LYS A 1 108 ? 16.661  11.007  2.581   1.00 0.00 ? 108 LYS A CE   2  
ATOM 3568  N NZ   . LYS A 1 108 ? 17.333  11.484  1.352   1.00 0.00 ? 108 LYS A NZ   2  
ATOM 3569  H H    . LYS A 1 108 ? 14.138  6.740   2.552   1.00 0.00 ? 108 LYS A H    2  
ATOM 3570  H HA   . LYS A 1 108 ? 14.406  9.233   4.030   1.00 0.00 ? 108 LYS A HA   2  
ATOM 3571  H HB2  . LYS A 1 108 ? 13.587  8.834   1.143   1.00 0.00 ? 108 LYS A HB2  2  
ATOM 3572  H HB3  . LYS A 1 108 ? 14.107  10.321  1.910   1.00 0.00 ? 108 LYS A HB3  2  
ATOM 3573  H HG2  . LYS A 1 108 ? 15.822  7.822   1.519   1.00 0.00 ? 108 LYS A HG2  2  
ATOM 3574  H HG3  . LYS A 1 108 ? 15.951  9.304   0.593   1.00 0.00 ? 108 LYS A HG3  2  
ATOM 3575  H HD2  . LYS A 1 108 ? 16.349  9.141   3.618   1.00 0.00 ? 108 LYS A HD2  2  
ATOM 3576  H HD3  . LYS A 1 108 ? 17.659  9.098   2.455   1.00 0.00 ? 108 LYS A HD3  2  
ATOM 3577  H HE2  . LYS A 1 108 ? 15.639  11.384  2.613   1.00 0.00 ? 108 LYS A HE2  2  
ATOM 3578  H HE3  . LYS A 1 108 ? 17.174  11.399  3.459   1.00 0.00 ? 108 LYS A HE3  2  
ATOM 3579  H HZ1  . LYS A 1 108 ? 17.311  10.764  0.658   1.00 0.00 ? 108 LYS A HZ1  2  
ATOM 3580  H HZ2  . LYS A 1 108 ? 16.860  12.294  1.006   1.00 0.00 ? 108 LYS A HZ2  2  
ATOM 3581  H HZ3  . LYS A 1 108 ? 18.283  11.717  1.560   1.00 0.00 ? 108 LYS A HZ3  2  
ATOM 3582  N N    . GLY A 1 109 ? 11.614  7.787   3.144   1.00 0.00 ? 109 GLY A N    2  
ATOM 3583  C CA   . GLY A 1 109 ? 10.179  7.766   3.366   1.00 0.00 ? 109 GLY A CA   2  
ATOM 3584  C C    . GLY A 1 109 ? 9.455   7.077   2.208   1.00 0.00 ? 109 GLY A C    2  
ATOM 3585  O O    . GLY A 1 109 ? 9.904   6.041   1.719   1.00 0.00 ? 109 GLY A O    2  
ATOM 3586  H H    . GLY A 1 109 ? 11.976  7.001   2.644   1.00 0.00 ? 109 GLY A H    2  
ATOM 3587  H HA2  . GLY A 1 109 ? 9.958   7.246   4.298   1.00 0.00 ? 109 GLY A HA2  2  
ATOM 3588  H HA3  . GLY A 1 109 ? 9.809   8.786   3.475   1.00 0.00 ? 109 GLY A HA3  2  
ATOM 3589  N N    . TRP A 1 110 ? 8.346   7.679   1.802   1.00 0.00 ? 110 TRP A N    2  
ATOM 3590  C CA   . TRP A 1 110 ? 7.556   7.136   0.711   1.00 0.00 ? 110 TRP A CA   2  
ATOM 3591  C C    . TRP A 1 110 ? 7.690   8.081   -0.485  1.00 0.00 ? 110 TRP A C    2  
ATOM 3592  O O    . TRP A 1 110 ? 7.263   9.232   -0.422  1.00 0.00 ? 110 TRP A O    2  
ATOM 3593  C CB   . TRP A 1 110 ? 6.104   6.918   1.141   1.00 0.00 ? 110 TRP A CB   2  
ATOM 3594  C CG   . TRP A 1 110 ? 5.935   5.891   2.263   1.00 0.00 ? 110 TRP A CG   2  
ATOM 3595  C CD1  . TRP A 1 110 ? 6.038   6.089   3.584   1.00 0.00 ? 110 TRP A CD1  2  
ATOM 3596  C CD2  . TRP A 1 110 ? 5.626   4.490   2.107   1.00 0.00 ? 110 TRP A CD2  2  
ATOM 3597  N NE1  . TRP A 1 110 ? 5.819   4.923   4.288   1.00 0.00 ? 110 TRP A NE1  2  
ATOM 3598  C CE2  . TRP A 1 110 ? 5.561   3.920   3.362   1.00 0.00 ? 110 TRP A CE2  2  
ATOM 3599  C CE3  . TRP A 1 110 ? 5.410   3.730   0.944   1.00 0.00 ? 110 TRP A CE3  2  
ATOM 3600  C CZ2  . TRP A 1 110 ? 5.279   2.565   3.574   1.00 0.00 ? 110 TRP A CZ2  2  
ATOM 3601  C CZ3  . TRP A 1 110 ? 5.129   2.378   1.173   1.00 0.00 ? 110 TRP A CZ3  2  
ATOM 3602  C CH2  . TRP A 1 110 ? 5.060   1.788   2.430   1.00 0.00 ? 110 TRP A CH2  2  
ATOM 3603  H H    . TRP A 1 110 ? 7.988   8.521   2.205   1.00 0.00 ? 110 TRP A H    2  
ATOM 3604  H HA   . TRP A 1 110 ? 7.963   6.157   0.460   1.00 0.00 ? 110 TRP A HA   2  
ATOM 3605  H HB2  . TRP A 1 110 ? 5.686   7.870   1.467   1.00 0.00 ? 110 TRP A HB2  2  
ATOM 3606  H HB3  . TRP A 1 110 ? 5.525   6.594   0.276   1.00 0.00 ? 110 TRP A HB3  2  
ATOM 3607  H HD1  . TRP A 1 110 ? 6.265   7.050   4.045   1.00 0.00 ? 110 TRP A HD1  2  
ATOM 3608  H HE1  . TRP A 1 110 ? 5.844   4.809   5.372   1.00 0.00 ? 110 TRP A HE1  2  
ATOM 3609  H HE3  . TRP A 1 110 ? 5.456   4.157   -0.058  1.00 0.00 ? 110 TRP A HE3  2  
ATOM 3610  H HZ2  . TRP A 1 110 ? 5.233   2.138   4.575   1.00 0.00 ? 110 TRP A HZ2  2  
ATOM 3611  H HZ3  . TRP A 1 110 ? 4.953   1.743   0.305   1.00 0.00 ? 110 TRP A HZ3  2  
ATOM 3612  H HH2  . TRP A 1 110 ? 4.836   0.726   2.524   1.00 0.00 ? 110 TRP A HH2  2  
ATOM 3613  N N    . GLY A 1 111 ? 8.285   7.558   -1.548  1.00 0.00 ? 111 GLY A N    2  
ATOM 3614  C CA   . GLY A 1 111 ? 8.481   8.340   -2.756  1.00 0.00 ? 111 GLY A CA   2  
ATOM 3615  C C    . GLY A 1 111 ? 7.180   8.451   -3.554  1.00 0.00 ? 111 GLY A C    2  
ATOM 3616  O O    . GLY A 1 111 ? 6.098   8.538   -2.976  1.00 0.00 ? 111 GLY A O    2  
ATOM 3617  H H    . GLY A 1 111 ? 8.630   6.620   -1.591  1.00 0.00 ? 111 GLY A H    2  
ATOM 3618  H HA2  . GLY A 1 111 ? 8.837   9.337   -2.495  1.00 0.00 ? 111 GLY A HA2  2  
ATOM 3619  H HA3  . GLY A 1 111 ? 9.251   7.878   -3.373  1.00 0.00 ? 111 GLY A HA3  2  
ATOM 3620  N N    . GLU A 1 112 ? 7.328   8.444   -4.871  1.00 0.00 ? 112 GLU A N    2  
ATOM 3621  C CA   . GLU A 1 112 ? 6.179   8.543   -5.754  1.00 0.00 ? 112 GLU A CA   2  
ATOM 3622  C C    . GLU A 1 112 ? 5.236   7.358   -5.533  1.00 0.00 ? 112 GLU A C    2  
ATOM 3623  O O    . GLU A 1 112 ? 5.591   6.397   -4.851  1.00 0.00 ? 112 GLU A O    2  
ATOM 3624  C CB   . GLU A 1 112 ? 6.617   8.629   -7.217  1.00 0.00 ? 112 GLU A CB   2  
ATOM 3625  C CG   . GLU A 1 112 ? 6.395   10.037  -7.774  1.00 0.00 ? 112 GLU A CG   2  
ATOM 3626  C CD   . GLU A 1 112 ? 7.715   10.805  -7.868  1.00 0.00 ? 112 GLU A CD   2  
ATOM 3627  O OE1  . GLU A 1 112 ? 8.229   11.182  -6.793  1.00 0.00 ? 112 GLU A OE1  2  
ATOM 3628  O OE2  . GLU A 1 112 ? 8.179   10.997  -9.012  1.00 0.00 ? 112 GLU A OE2  2  
ATOM 3629  H H    . GLU A 1 112 ? 8.212   8.373   -5.334  1.00 0.00 ? 112 GLU A H    2  
ATOM 3630  H HA   . GLU A 1 112 ? 5.678   9.470   -5.476  1.00 0.00 ? 112 GLU A HA   2  
ATOM 3631  H HB2  . GLU A 1 112 ? 7.671   8.364   -7.301  1.00 0.00 ? 112 GLU A HB2  2  
ATOM 3632  H HB3  . GLU A 1 112 ? 6.058   7.906   -7.811  1.00 0.00 ? 112 GLU A HB3  2  
ATOM 3633  H HG2  . GLU A 1 112 ? 5.936   9.973   -8.761  1.00 0.00 ? 112 GLU A HG2  2  
ATOM 3634  H HG3  . GLU A 1 112 ? 5.699   10.579  -7.134  1.00 0.00 ? 112 GLU A HG3  2  
ATOM 3635  N N    . ALA A 1 113 ? 4.055   7.465   -6.123  1.00 0.00 ? 113 ALA A N    2  
ATOM 3636  C CA   . ALA A 1 113 ? 3.059   6.414   -5.999  1.00 0.00 ? 113 ALA A CA   2  
ATOM 3637  C C    . ALA A 1 113 ? 2.359   6.219   -7.345  1.00 0.00 ? 113 ALA A C    2  
ATOM 3638  O O    . ALA A 1 113 ? 1.952   7.189   -7.983  1.00 0.00 ? 113 ALA A O    2  
ATOM 3639  C CB   . ALA A 1 113 ? 2.079   6.768   -4.878  1.00 0.00 ? 113 ALA A CB   2  
ATOM 3640  H H    . ALA A 1 113 ? 3.774   8.249   -6.676  1.00 0.00 ? 113 ALA A H    2  
ATOM 3641  H HA   . ALA A 1 113 ? 3.579   5.494   -5.733  1.00 0.00 ? 113 ALA A HA   2  
ATOM 3642  H HB1  . ALA A 1 113 ? 1.235   6.079   -4.902  1.00 0.00 ? 113 ALA A HB1  2  
ATOM 3643  H HB2  . ALA A 1 113 ? 2.585   6.690   -3.915  1.00 0.00 ? 113 ALA A HB2  2  
ATOM 3644  H HB3  . ALA A 1 113 ? 1.720   7.787   -5.018  1.00 0.00 ? 113 ALA A HB3  2  
ATOM 3645  N N    . ALA A 1 114 ? 2.239   4.959   -7.737  1.00 0.00 ? 114 ALA A N    2  
ATOM 3646  C CA   . ALA A 1 114 ? 1.595   4.625   -8.996  1.00 0.00 ? 114 ALA A CA   2  
ATOM 3647  C C    . ALA A 1 114 ? 0.119   4.315   -8.742  1.00 0.00 ? 114 ALA A C    2  
ATOM 3648  O O    . ALA A 1 114 ? -0.206  3.416   -7.968  1.00 0.00 ? 114 ALA A O    2  
ATOM 3649  C CB   . ALA A 1 114 ? 2.332   3.456   -9.652  1.00 0.00 ? 114 ALA A CB   2  
ATOM 3650  H H    . ALA A 1 114 ? 2.573   4.176   -7.212  1.00 0.00 ? 114 ALA A H    2  
ATOM 3651  H HA   . ALA A 1 114 ? 1.668   5.496   -9.648  1.00 0.00 ? 114 ALA A HA   2  
ATOM 3652  H HB1  . ALA A 1 114 ? 1.799   3.150   -10.552 1.00 0.00 ? 114 ALA A HB1  2  
ATOM 3653  H HB2  . ALA A 1 114 ? 3.343   3.766   -9.916  1.00 0.00 ? 114 ALA A HB2  2  
ATOM 3654  H HB3  . ALA A 1 114 ? 2.379   2.619   -8.955  1.00 0.00 ? 114 ALA A HB3  2  
ATOM 3655  N N    . GLU A 1 115 ? -0.736  5.077   -9.409  1.00 0.00 ? 115 GLU A N    2  
ATOM 3656  C CA   . GLU A 1 115 ? -2.170  4.895   -9.265  1.00 0.00 ? 115 GLU A CA   2  
ATOM 3657  C C    . GLU A 1 115 ? -2.714  4.037   -10.409 1.00 0.00 ? 115 GLU A C    2  
ATOM 3658  O O    . GLU A 1 115 ? -2.477  4.334   -11.579 1.00 0.00 ? 115 GLU A O    2  
ATOM 3659  C CB   . GLU A 1 115 ? -2.891  6.243   -9.201  1.00 0.00 ? 115 GLU A CB   2  
ATOM 3660  C CG   . GLU A 1 115 ? -2.901  6.792   -7.773  1.00 0.00 ? 115 GLU A CG   2  
ATOM 3661  C CD   . GLU A 1 115 ? -3.599  8.152   -7.713  1.00 0.00 ? 115 GLU A CD   2  
ATOM 3662  O OE1  . GLU A 1 115 ? -3.513  8.879   -8.726  1.00 0.00 ? 115 GLU A OE1  2  
ATOM 3663  O OE2  . GLU A 1 115 ? -4.203  8.434   -6.656  1.00 0.00 ? 115 GLU A OE2  2  
ATOM 3664  H H    . GLU A 1 115 ? -0.463  5.806   -10.036 1.00 0.00 ? 115 GLU A H    2  
ATOM 3665  H HA   . GLU A 1 115 ? -2.303  4.374   -8.317  1.00 0.00 ? 115 GLU A HA   2  
ATOM 3666  H HB2  . GLU A 1 115 ? -2.398  6.955   -9.864  1.00 0.00 ? 115 GLU A HB2  2  
ATOM 3667  H HB3  . GLU A 1 115 ? -3.914  6.130   -9.559  1.00 0.00 ? 115 GLU A HB3  2  
ATOM 3668  H HG2  . GLU A 1 115 ? -3.410  6.089   -7.113  1.00 0.00 ? 115 GLU A HG2  2  
ATOM 3669  H HG3  . GLU A 1 115 ? -1.879  6.888   -7.408  1.00 0.00 ? 115 GLU A HG3  2  
ATOM 3670  N N    . ALA A 1 116 ? -3.432  2.990   -10.031 1.00 0.00 ? 116 ALA A N    2  
ATOM 3671  C CA   . ALA A 1 116 ? -4.011  2.086   -11.011 1.00 0.00 ? 116 ALA A CA   2  
ATOM 3672  C C    . ALA A 1 116 ? -5.470  1.809   -10.643 1.00 0.00 ? 116 ALA A C    2  
ATOM 3673  O O    . ALA A 1 116 ? -5.755  1.293   -9.564  1.00 0.00 ? 116 ALA A O    2  
ATOM 3674  C CB   . ALA A 1 116 ? -3.175  0.807   -11.083 1.00 0.00 ? 116 ALA A CB   2  
ATOM 3675  H H    . ALA A 1 116 ? -3.620  2.755   -9.077  1.00 0.00 ? 116 ALA A H    2  
ATOM 3676  H HA   . ALA A 1 116 ? -3.978  2.583   -11.981 1.00 0.00 ? 116 ALA A HA   2  
ATOM 3677  H HB1  . ALA A 1 116 ? -2.207  0.978   -10.612 1.00 0.00 ? 116 ALA A HB1  2  
ATOM 3678  H HB2  . ALA A 1 116 ? -3.696  0.003   -10.563 1.00 0.00 ? 116 ALA A HB2  2  
ATOM 3679  H HB3  . ALA A 1 116 ? -3.027  0.529   -12.127 1.00 0.00 ? 116 ALA A HB3  2  
ATOM 3680  N N    . LEU A 1 117 ? -6.357  2.164   -11.562 1.00 0.00 ? 117 LEU A N    2  
ATOM 3681  C CA   . LEU A 1 117 ? -7.779  1.960   -11.348 1.00 0.00 ? 117 LEU A CA   2  
ATOM 3682  C C    . LEU A 1 117 ? -8.170  0.566   -11.843 1.00 0.00 ? 117 LEU A C    2  
ATOM 3683  O O    . LEU A 1 117 ? -7.661  0.099   -12.861 1.00 0.00 ? 117 LEU A O    2  
ATOM 3684  C CB   . LEU A 1 117 ? -8.585  3.090   -11.992 1.00 0.00 ? 117 LEU A CB   2  
ATOM 3685  C CG   . LEU A 1 117 ? -8.540  4.440   -11.273 1.00 0.00 ? 117 LEU A CG   2  
ATOM 3686  C CD1  . LEU A 1 117 ? -8.288  5.579   -12.263 1.00 0.00 ? 117 LEU A CD1  2  
ATOM 3687  C CD2  . LEU A 1 117 ? -9.810  4.666   -10.450 1.00 0.00 ? 117 LEU A CD2  2  
ATOM 3688  H H    . LEU A 1 117 ? -6.117  2.583   -12.438 1.00 0.00 ? 117 LEU A H    2  
ATOM 3689  H HA   . LEU A 1 117 ? -7.958  2.008   -10.274 1.00 0.00 ? 117 LEU A HA   2  
ATOM 3690  H HB2  . LEU A 1 117 ? -8.226  3.231   -13.011 1.00 0.00 ? 117 LEU A HB2  2  
ATOM 3691  H HB3  . LEU A 1 117 ? -9.626  2.773   -12.062 1.00 0.00 ? 117 LEU A HB3  2  
ATOM 3692  H HG   . LEU A 1 117 ? -7.702  4.428   -10.576 1.00 0.00 ? 117 LEU A HG   2  
ATOM 3693  H HD11 . LEU A 1 117 ? -7.260  5.527   -12.623 1.00 0.00 ? 117 LEU A HD11 2  
ATOM 3694  H HD12 . LEU A 1 117 ? -8.973  5.487   -13.105 1.00 0.00 ? 117 LEU A HD12 2  
ATOM 3695  H HD13 . LEU A 1 117 ? -8.450  6.535   -11.765 1.00 0.00 ? 117 LEU A HD13 2  
ATOM 3696  H HD21 . LEU A 1 117 ? -9.662  5.512   -9.779  1.00 0.00 ? 117 LEU A HD21 2  
ATOM 3697  H HD22 . LEU A 1 117 ? -10.644 4.875   -11.120 1.00 0.00 ? 117 LEU A HD22 2  
ATOM 3698  H HD23 . LEU A 1 117 ? -10.027 3.772   -9.865  1.00 0.00 ? 117 LEU A HD23 2  
ATOM 3699  N N    . VAL A 1 118 ? -9.071  -0.060  -11.100 1.00 0.00 ? 118 VAL A N    2  
ATOM 3700  C CA   . VAL A 1 118 ? -9.537  -1.391  -11.451 1.00 0.00 ? 118 VAL A CA   2  
ATOM 3701  C C    . VAL A 1 118 ? -11.006 -1.535  -11.050 1.00 0.00 ? 118 VAL A C    2  
ATOM 3702  O O    . VAL A 1 118 ? -11.365 -1.301  -9.897  1.00 0.00 ? 118 VAL A O    2  
ATOM 3703  C CB   . VAL A 1 118 ? -8.635  -2.446  -10.808 1.00 0.00 ? 118 VAL A CB   2  
ATOM 3704  C CG1  . VAL A 1 118 ? -8.580  -2.268  -9.289  1.00 0.00 ? 118 VAL A CG1  2  
ATOM 3705  C CG2  . VAL A 1 118 ? -9.094  -3.858  -11.177 1.00 0.00 ? 118 VAL A CG2  2  
ATOM 3706  H H    . VAL A 1 118 ? -9.481  0.327   -10.274 1.00 0.00 ? 118 VAL A H    2  
ATOM 3707  H HA   . VAL A 1 118 ? -9.456  -1.493  -12.533 1.00 0.00 ? 118 VAL A HA   2  
ATOM 3708  H HB   . VAL A 1 118 ? -7.627  -2.309  -11.198 1.00 0.00 ? 118 VAL A HB   2  
ATOM 3709  H HG11 . VAL A 1 118 ? -8.976  -3.160  -8.804  1.00 0.00 ? 118 VAL A HG11 2  
ATOM 3710  H HG12 . VAL A 1 118 ? -7.546  -2.114  -8.979  1.00 0.00 ? 118 VAL A HG12 2  
ATOM 3711  H HG13 . VAL A 1 118 ? -9.178  -1.403  -9.003  1.00 0.00 ? 118 VAL A HG13 2  
ATOM 3712  H HG21 . VAL A 1 118 ? -8.726  -4.111  -12.172 1.00 0.00 ? 118 VAL A HG21 2  
ATOM 3713  H HG22 . VAL A 1 118 ? -8.700  -4.570  -10.452 1.00 0.00 ? 118 VAL A HG22 2  
ATOM 3714  H HG23 . VAL A 1 118 ? -10.184 -3.899  -11.172 1.00 0.00 ? 118 VAL A HG23 2  
ATOM 3715  N N    . VAL A 1 119 ? -11.817 -1.919  -12.025 1.00 0.00 ? 119 VAL A N    2  
ATOM 3716  C CA   . VAL A 1 119 ? -13.240 -2.097  -11.789 1.00 0.00 ? 119 VAL A CA   2  
ATOM 3717  C C    . VAL A 1 119 ? -13.488 -3.501  -11.234 1.00 0.00 ? 119 VAL A C    2  
ATOM 3718  O O    . VAL A 1 119 ? -12.797 -4.449  -11.601 1.00 0.00 ? 119 VAL A O    2  
ATOM 3719  C CB   . VAL A 1 119 ? -14.023 -1.814  -13.072 1.00 0.00 ? 119 VAL A CB   2  
ATOM 3720  C CG1  . VAL A 1 119 ? -15.380 -2.521  -13.053 1.00 0.00 ? 119 VAL A CG1  2  
ATOM 3721  C CG2  . VAL A 1 119 ? -14.192 -0.309  -13.291 1.00 0.00 ? 119 VAL A CG2  2  
ATOM 3722  H H    . VAL A 1 119 ? -11.518 -2.107  -12.960 1.00 0.00 ? 119 VAL A H    2  
ATOM 3723  H HA   . VAL A 1 119 ? -13.543 -1.365  -11.040 1.00 0.00 ? 119 VAL A HA   2  
ATOM 3724  H HB   . VAL A 1 119 ? -13.450 -2.212  -13.909 1.00 0.00 ? 119 VAL A HB   2  
ATOM 3725  H HG11 . VAL A 1 119 ? -15.927 -2.234  -12.155 1.00 0.00 ? 119 VAL A HG11 2  
ATOM 3726  H HG12 . VAL A 1 119 ? -15.952 -2.232  -13.935 1.00 0.00 ? 119 VAL A HG12 2  
ATOM 3727  H HG13 . VAL A 1 119 ? -15.227 -3.600  -13.057 1.00 0.00 ? 119 VAL A HG13 2  
ATOM 3728  H HG21 . VAL A 1 119 ? -13.371 0.063   -13.904 1.00 0.00 ? 119 VAL A HG21 2  
ATOM 3729  H HG22 . VAL A 1 119 ? -15.138 -0.119  -13.797 1.00 0.00 ? 119 VAL A HG22 2  
ATOM 3730  H HG23 . VAL A 1 119 ? -14.186 0.201   -12.328 1.00 0.00 ? 119 VAL A HG23 2  
ATOM 3731  N N    . THR A 1 120 ? -14.478 -3.589  -10.357 1.00 0.00 ? 120 THR A N    2  
ATOM 3732  C CA   . THR A 1 120 ? -14.827 -4.861  -9.748  1.00 0.00 ? 120 THR A CA   2  
ATOM 3733  C C    . THR A 1 120 ? -16.017 -5.492  -10.473 1.00 0.00 ? 120 THR A C    2  
ATOM 3734  O O    . THR A 1 120 ? -17.118 -4.945  -10.459 1.00 0.00 ? 120 THR A O    2  
ATOM 3735  C CB   . THR A 1 120 ? -15.082 -4.618  -8.259  1.00 0.00 ? 120 THR A CB   2  
ATOM 3736  O OG1  . THR A 1 120 ? -15.830 -3.406  -8.228  1.00 0.00 ? 120 THR A OG1  2  
ATOM 3737  C CG2  . THR A 1 120 ? -13.801 -4.285  -7.492  1.00 0.00 ? 120 THR A CG2  2  
ATOM 3738  H H    . THR A 1 120 ? -15.036 -2.813  -10.063 1.00 0.00 ? 120 THR A H    2  
ATOM 3739  H HA   . THR A 1 120 ? -13.983 -5.541  -9.866  1.00 0.00 ? 120 THR A HA   2  
ATOM 3740  H HB   . THR A 1 120 ? -15.596 -5.467  -7.808  1.00 0.00 ? 120 THR A HB   2  
ATOM 3741  H HG1  . THR A 1 120 ? -16.720 -3.542  -8.664  1.00 0.00 ? 120 THR A HG1  2  
ATOM 3742  H HG21 . THR A 1 120 ? -13.890 -4.638  -6.464  1.00 0.00 ? 120 THR A HG21 2  
ATOM 3743  H HG22 . THR A 1 120 ? -12.953 -4.773  -7.971  1.00 0.00 ? 120 THR A HG22 2  
ATOM 3744  H HG23 . THR A 1 120 ? -13.647 -3.205  -7.493  1.00 0.00 ? 120 THR A HG23 2  
ATOM 3745  N N    . THR A 1 121 ? -15.754 -6.634  -11.091 1.00 0.00 ? 121 THR A N    2  
ATOM 3746  C CA   . THR A 1 121 ? -16.790 -7.345  -11.821 1.00 0.00 ? 121 THR A CA   2  
ATOM 3747  C C    . THR A 1 121 ? -16.244 -8.663  -12.374 1.00 0.00 ? 121 THR A C    2  
ATOM 3748  O O    . THR A 1 121 ? -15.040 -8.911  -12.322 1.00 0.00 ? 121 THR A O    2  
ATOM 3749  C CB   . THR A 1 121 ? -17.333 -6.410  -12.903 1.00 0.00 ? 121 THR A CB   2  
ATOM 3750  O OG1  . THR A 1 121 ? -18.227 -7.228  -13.653 1.00 0.00 ? 121 THR A OG1  2  
ATOM 3751  C CG2  . THR A 1 121 ? -16.261 -6.004  -13.917 1.00 0.00 ? 121 THR A CG2  2  
ATOM 3752  H H    . THR A 1 121 ? -14.856 -7.073  -11.098 1.00 0.00 ? 121 THR A H    2  
ATOM 3753  H HA   . THR A 1 121 ? -17.589 -7.598  -11.124 1.00 0.00 ? 121 THR A HA   2  
ATOM 3754  H HB   . THR A 1 121 ? -17.802 -5.532  -12.459 1.00 0.00 ? 121 THR A HB   2  
ATOM 3755  H HG1  . THR A 1 121 ? -19.095 -7.321  -13.166 1.00 0.00 ? 121 THR A HG1  2  
ATOM 3756  H HG21 . THR A 1 121 ? -16.477 -5.003  -14.292 1.00 0.00 ? 121 THR A HG21 2  
ATOM 3757  H HG22 . THR A 1 121 ? -15.284 -6.008  -13.434 1.00 0.00 ? 121 THR A HG22 2  
ATOM 3758  H HG23 . THR A 1 121 ? -16.260 -6.710  -14.747 1.00 0.00 ? 121 THR A HG23 2  
ATOM 3759  N N    . GLU A 1 122 ? -17.155 -9.473  -12.893 1.00 0.00 ? 122 GLU A N    2  
ATOM 3760  C CA   . GLU A 1 122 ? -16.779 -10.759 -13.456 1.00 0.00 ? 122 GLU A CA   2  
ATOM 3761  C C    . GLU A 1 122 ? -16.477 -10.617 -14.949 1.00 0.00 ? 122 GLU A C    2  
ATOM 3762  O O    . GLU A 1 122 ? -15.658 -11.355 -15.493 1.00 0.00 ? 122 GLU A O    2  
ATOM 3763  C CB   . GLU A 1 122 ? -17.871 -11.803 -13.214 1.00 0.00 ? 122 GLU A CB   2  
ATOM 3764  C CG   . GLU A 1 122 ? -18.163 -11.955 -11.720 1.00 0.00 ? 122 GLU A CG   2  
ATOM 3765  C CD   . GLU A 1 122 ? -19.571 -12.510 -11.490 1.00 0.00 ? 122 GLU A CD   2  
ATOM 3766  O OE1  . GLU A 1 122 ? -19.702 -13.753 -11.515 1.00 0.00 ? 122 GLU A OE1  2  
ATOM 3767  O OE2  . GLU A 1 122 ? -20.483 -11.679 -11.295 1.00 0.00 ? 122 GLU A OE2  2  
ATOM 3768  H H    . GLU A 1 122 ? -18.132 -9.264  -12.932 1.00 0.00 ? 122 GLU A H    2  
ATOM 3769  H HA   . GLU A 1 122 ? -15.876 -11.056 -12.922 1.00 0.00 ? 122 GLU A HA   2  
ATOM 3770  H HB2  . GLU A 1 122 ? -18.781 -11.512 -13.738 1.00 0.00 ? 122 GLU A HB2  2  
ATOM 3771  H HB3  . GLU A 1 122 ? -17.559 -12.763 -13.627 1.00 0.00 ? 122 GLU A HB3  2  
ATOM 3772  H HG2  . GLU A 1 122 ? -17.428 -12.620 -11.268 1.00 0.00 ? 122 GLU A HG2  2  
ATOM 3773  H HG3  . GLU A 1 122 ? -18.065 -10.988 -11.226 1.00 0.00 ? 122 GLU A HG3  2  
ATOM 3774  N N    . LYS A 1 123 ? -17.156 -9.663  -15.569 1.00 0.00 ? 123 LYS A N    2  
ATOM 3775  C CA   . LYS A 1 123 ? -16.971 -9.415  -16.989 1.00 0.00 ? 123 LYS A CA   2  
ATOM 3776  C C    . LYS A 1 123 ? -15.559 -8.875  -17.228 1.00 0.00 ? 123 LYS A C    2  
ATOM 3777  O O    . LYS A 1 123 ? -14.884 -8.456  -16.289 1.00 0.00 ? 123 LYS A O    2  
ATOM 3778  C CB   . LYS A 1 123 ? -18.077 -8.501  -17.522 1.00 0.00 ? 123 LYS A CB   2  
ATOM 3779  C CG   . LYS A 1 123 ? -18.588 -8.993  -18.878 1.00 0.00 ? 123 LYS A CG   2  
ATOM 3780  C CD   . LYS A 1 123 ? -18.377 -7.933  -19.960 1.00 0.00 ? 123 LYS A CD   2  
ATOM 3781  C CE   . LYS A 1 123 ? -19.660 -7.707  -20.763 1.00 0.00 ? 123 LYS A CE   2  
ATOM 3782  N NZ   . LYS A 1 123 ? -19.530 -6.507  -21.619 1.00 0.00 ? 123 LYS A NZ   2  
ATOM 3783  H H    . LYS A 1 123 ? -17.821 -9.067  -15.119 1.00 0.00 ? 123 LYS A H    2  
ATOM 3784  H HA   . LYS A 1 123 ? -17.067 -10.371 -17.503 1.00 0.00 ? 123 LYS A HA   2  
ATOM 3785  H HB2  . LYS A 1 123 ? -18.901 -8.467  -16.809 1.00 0.00 ? 123 LYS A HB2  2  
ATOM 3786  H HB3  . LYS A 1 123 ? -17.698 -7.484  -17.619 1.00 0.00 ? 123 LYS A HB3  2  
ATOM 3787  H HG2  . LYS A 1 123 ? -18.068 -9.910  -19.155 1.00 0.00 ? 123 LYS A HG2  2  
ATOM 3788  H HG3  . LYS A 1 123 ? -19.647 -9.237  -18.804 1.00 0.00 ? 123 LYS A HG3  2  
ATOM 3789  H HD2  . LYS A 1 123 ? -18.061 -6.997  -19.501 1.00 0.00 ? 123 LYS A HD2  2  
ATOM 3790  H HD3  . LYS A 1 123 ? -17.575 -8.246  -20.630 1.00 0.00 ? 123 LYS A HD3  2  
ATOM 3791  H HE2  . LYS A 1 123 ? -19.868 -8.581  -21.381 1.00 0.00 ? 123 LYS A HE2  2  
ATOM 3792  H HE3  . LYS A 1 123 ? -20.504 -7.588  -20.085 1.00 0.00 ? 123 LYS A HE3  2  
ATOM 3793  H HZ1  . LYS A 1 123 ? -20.278 -5.873  -21.420 1.00 0.00 ? 123 LYS A HZ1  2  
ATOM 3794  H HZ2  . LYS A 1 123 ? -18.656 -6.058  -21.435 1.00 0.00 ? 123 LYS A HZ2  2  
ATOM 3795  H HZ3  . LYS A 1 123 ? -19.570 -6.777  -22.581 1.00 0.00 ? 123 LYS A HZ3  2  
ATOM 3796  N N    . ARG A 1 124 ? -15.155 -8.902  -18.489 1.00 0.00 ? 124 ARG A N    2  
ATOM 3797  C CA   . ARG A 1 124 ? -13.836 -8.421  -18.864 1.00 0.00 ? 124 ARG A CA   2  
ATOM 3798  C C    . ARG A 1 124 ? -12.756 -9.177  -18.088 1.00 0.00 ? 124 ARG A C    2  
ATOM 3799  O O    . ARG A 1 124 ? -12.591 -8.973  -16.887 1.00 0.00 ? 124 ARG A O    2  
ATOM 3800  C CB   . ARG A 1 124 ? -13.698 -6.922  -18.587 1.00 0.00 ? 124 ARG A CB   2  
ATOM 3801  C CG   . ARG A 1 124 ? -14.392 -6.098  -19.674 1.00 0.00 ? 124 ARG A CG   2  
ATOM 3802  C CD   . ARG A 1 124 ? -13.658 -4.778  -19.913 1.00 0.00 ? 124 ARG A CD   2  
ATOM 3803  N NE   . ARG A 1 124 ? -14.635 -3.683  -20.106 1.00 0.00 ? 124 ARG A NE   2  
ATOM 3804  C CZ   . ARG A 1 124 ? -14.302 -2.429  -20.441 1.00 0.00 ? 124 ARG A CZ   2  
ATOM 3805  N NH1  . ARG A 1 124 ? -13.015 -2.104  -20.623 1.00 0.00 ? 124 ARG A NH1  2  
ATOM 3806  N NH2  . ARG A 1 124 ? -15.256 -1.500  -20.594 1.00 0.00 ? 124 ARG A NH2  2  
ATOM 3807  H H    . ARG A 1 124 ? -15.711 -9.244  -19.247 1.00 0.00 ? 124 ARG A H    2  
ATOM 3808  H HA   . ARG A 1 124 ? -13.761 -8.617  -19.933 1.00 0.00 ? 124 ARG A HA   2  
ATOM 3809  H HB2  . ARG A 1 124 ? -14.131 -6.687  -17.615 1.00 0.00 ? 124 ARG A HB2  2  
ATOM 3810  H HB3  . ARG A 1 124 ? -12.643 -6.653  -18.540 1.00 0.00 ? 124 ARG A HB3  2  
ATOM 3811  H HG2  . ARG A 1 124 ? -14.431 -6.671  -20.601 1.00 0.00 ? 124 ARG A HG2  2  
ATOM 3812  H HG3  . ARG A 1 124 ? -15.423 -5.897  -19.380 1.00 0.00 ? 124 ARG A HG3  2  
ATOM 3813  H HD2  . ARG A 1 124 ? -13.010 -4.553  -19.066 1.00 0.00 ? 124 ARG A HD2  2  
ATOM 3814  H HD3  . ARG A 1 124 ? -13.017 -4.863  -20.791 1.00 0.00 ? 124 ARG A HD3  2  
ATOM 3815  H HE   . ARG A 1 124 ? -15.604 -3.892  -19.977 1.00 0.00 ? 124 ARG A HE   2  
ATOM 3816  H HH11 . ARG A 1 124 ? -12.303 -2.796  -20.509 1.00 0.00 ? 124 ARG A HH11 2  
ATOM 3817  H HH12 . ARG A 1 124 ? -12.766 -1.168  -20.874 1.00 0.00 ? 124 ARG A HH12 2  
ATOM 3818  H HH21 . ARG A 1 124 ? -16.216 -1.743  -20.458 1.00 0.00 ? 124 ARG A HH21 2  
ATOM 3819  H HH22 . ARG A 1 124 ? -15.007 -0.565  -20.845 1.00 0.00 ? 124 ARG A HH22 2  
ATOM 3820  N N    . SER A 1 125 ? -12.047 -10.035 -18.808 1.00 0.00 ? 125 SER A N    2  
ATOM 3821  C CA   . SER A 1 125 ? -10.987 -10.823 -18.202 1.00 0.00 ? 125 SER A CA   2  
ATOM 3822  C C    . SER A 1 125 ? -9.975  -11.245 -19.269 1.00 0.00 ? 125 SER A C    2  
ATOM 3823  O O    . SER A 1 125 ? -10.301 -12.019 -20.168 1.00 0.00 ? 125 SER A O    2  
ATOM 3824  C CB   . SER A 1 125 ? -11.553 -12.054 -17.491 1.00 0.00 ? 125 SER A CB   2  
ATOM 3825  O OG   . SER A 1 125 ? -12.025 -13.033 -18.412 1.00 0.00 ? 125 SER A OG   2  
ATOM 3826  H H    . SER A 1 125 ? -12.188 -10.196 -19.785 1.00 0.00 ? 125 SER A H    2  
ATOM 3827  H HA   . SER A 1 125 ? -10.519 -10.164 -17.471 1.00 0.00 ? 125 SER A HA   2  
ATOM 3828  H HB2  . SER A 1 125 ? -10.782 -12.493 -16.858 1.00 0.00 ? 125 SER A HB2  2  
ATOM 3829  H HB3  . SER A 1 125 ? -12.368 -11.750 -16.835 1.00 0.00 ? 125 SER A HB3  2  
ATOM 3830  H HG   . SER A 1 125 ? -12.316 -13.853 -17.920 1.00 0.00 ? 125 SER A HG   2  
ATOM 3831  N N    . GLY A 1 126 ? -8.767  -10.719 -19.134 1.00 0.00 ? 126 GLY A N    2  
ATOM 3832  C CA   . GLY A 1 126 ? -7.705  -11.032 -20.075 1.00 0.00 ? 126 GLY A CA   2  
ATOM 3833  C C    . GLY A 1 126 ? -7.206  -9.768  -20.779 1.00 0.00 ? 126 GLY A C    2  
ATOM 3834  O O    . GLY A 1 126 ? -7.864  -8.730  -20.739 1.00 0.00 ? 126 GLY A O    2  
ATOM 3835  H H    . GLY A 1 126 ? -8.509  -10.090 -18.400 1.00 0.00 ? 126 GLY A H    2  
ATOM 3836  H HA2  . GLY A 1 126 ? -6.878  -11.510 -19.550 1.00 0.00 ? 126 GLY A HA2  2  
ATOM 3837  H HA3  . GLY A 1 126 ? -8.068  -11.745 -20.815 1.00 0.00 ? 126 GLY A HA3  2  
ATOM 3838  N N    . PRO A 1 127 ? -6.017  -9.901  -21.426 1.00 0.00 ? 127 PRO A N    2  
ATOM 3839  C CA   . PRO A 1 127 ? -5.423  -8.783  -22.138 1.00 0.00 ? 127 PRO A CA   2  
ATOM 3840  C C    . PRO A 1 127 ? -6.151  -8.525  -23.458 1.00 0.00 ? 127 PRO A C    2  
ATOM 3841  O O    . PRO A 1 127 ? -6.613  -7.413  -23.710 1.00 0.00 ? 127 PRO A O    2  
ATOM 3842  C CB   . PRO A 1 127 ? -3.965  -9.168  -22.329 1.00 0.00 ? 127 PRO A CB   2  
ATOM 3843  C CG   . PRO A 1 127 ? -3.902  -10.674 -22.133 1.00 0.00 ? 127 PRO A CG   2  
ATOM 3844  C CD   . PRO A 1 127 ? -5.210  -11.116 -21.495 1.00 0.00 ? 127 PRO A CD   2  
ATOM 3845  H HA   . PRO A 1 127 ? -5.517  -7.942  -21.605 1.00 0.00 ? 127 PRO A HA   2  
ATOM 3846  H HB2  . PRO A 1 127 ? -3.614  -8.889  -23.322 1.00 0.00 ? 127 PRO A HB2  2  
ATOM 3847  H HB3  . PRO A 1 127 ? -3.328  -8.654  -21.609 1.00 0.00 ? 127 PRO A HB3  2  
ATOM 3848  H HG2  . PRO A 1 127 ? -3.754  -11.178 -23.088 1.00 0.00 ? 127 PRO A HG2  2  
ATOM 3849  H HG3  . PRO A 1 127 ? -3.058  -10.942 -21.497 1.00 0.00 ? 127 PRO A HG3  2  
ATOM 3850  H HD2  . PRO A 1 127 ? -5.701  -11.885 -22.091 1.00 0.00 ? 127 PRO A HD2  2  
ATOM 3851  H HD3  . PRO A 1 127 ? -5.044  -11.538 -20.504 1.00 0.00 ? 127 PRO A HD3  2  
ATOM 3852  N N    . SER A 1 128 ? -6.230  -9.571  -24.268 1.00 0.00 ? 128 SER A N    2  
ATOM 3853  C CA   . SER A 1 128 ? -6.894  -9.471  -25.556 1.00 0.00 ? 128 SER A CA   2  
ATOM 3854  C C    . SER A 1 128 ? -6.342  -8.278  -26.339 1.00 0.00 ? 128 SER A C    2  
ATOM 3855  O O    . SER A 1 128 ? -6.787  -7.147  -26.148 1.00 0.00 ? 128 SER A O    2  
ATOM 3856  C CB   . SER A 1 128 ? -8.409  -9.340  -25.387 1.00 0.00 ? 128 SER A CB   2  
ATOM 3857  O OG   . SER A 1 128 ? -8.956  -10.413 -24.626 1.00 0.00 ? 128 SER A OG   2  
ATOM 3858  H H    . SER A 1 128 ? -5.852  -10.472 -24.056 1.00 0.00 ? 128 SER A H    2  
ATOM 3859  H HA   . SER A 1 128 ? -6.666  -10.405 -26.071 1.00 0.00 ? 128 SER A HA   2  
ATOM 3860  H HB2  . SER A 1 128 ? -8.638  -8.394  -24.896 1.00 0.00 ? 128 SER A HB2  2  
ATOM 3861  H HB3  . SER A 1 128 ? -8.883  -9.313  -26.368 1.00 0.00 ? 128 SER A HB3  2  
ATOM 3862  H HG   . SER A 1 128 ? -9.937  -10.274 -24.495 1.00 0.00 ? 128 SER A HG   2  
ATOM 3863  N N    . SER A 1 129 ? -5.381  -8.571  -27.202 1.00 0.00 ? 129 SER A N    2  
ATOM 3864  C CA   . SER A 1 129 ? -4.763  -7.536  -28.014 1.00 0.00 ? 129 SER A CA   2  
ATOM 3865  C C    . SER A 1 129 ? -5.309  -7.597  -29.442 1.00 0.00 ? 129 SER A C    2  
ATOM 3866  O O    . SER A 1 129 ? -5.972  -8.562  -29.817 1.00 0.00 ? 129 SER A O    2  
ATOM 3867  C CB   . SER A 1 129 ? -3.240  -7.677  -28.021 1.00 0.00 ? 129 SER A CB   2  
ATOM 3868  O OG   . SER A 1 129 ? -2.820  -8.903  -28.613 1.00 0.00 ? 129 SER A OG   2  
ATOM 3869  H H    . SER A 1 129 ? -5.025  -9.493  -27.351 1.00 0.00 ? 129 SER A H    2  
ATOM 3870  H HA   . SER A 1 129 ? -5.038  -6.594  -27.539 1.00 0.00 ? 129 SER A HA   2  
ATOM 3871  H HB2  . SER A 1 129 ? -2.801  -6.841  -28.567 1.00 0.00 ? 129 SER A HB2  2  
ATOM 3872  H HB3  . SER A 1 129 ? -2.866  -7.621  -26.999 1.00 0.00 ? 129 SER A HB3  2  
ATOM 3873  H HG   . SER A 1 129 ? -2.337  -9.461  -27.938 1.00 0.00 ? 129 SER A HG   2  
ATOM 3874  N N    . GLY A 1 130 ? -5.008  -6.553  -30.201 1.00 0.00 ? 130 GLY A N    2  
ATOM 3875  C CA   . GLY A 1 130 ? -5.459  -6.475  -31.580 1.00 0.00 ? 130 GLY A CA   2  
ATOM 3876  C C    . GLY A 1 130 ? -6.831  -5.804  -31.671 1.00 0.00 ? 130 GLY A C    2  
ATOM 3877  O O    . GLY A 1 130 ? -7.095  -4.827  -30.973 1.00 0.00 ? 130 GLY A O    2  
ATOM 3878  H H    . GLY A 1 130 ? -4.467  -5.772  -29.889 1.00 0.00 ? 130 GLY A H    2  
ATOM 3879  H HA2  . GLY A 1 130 ? -4.736  -5.915  -32.172 1.00 0.00 ? 130 GLY A HA2  2  
ATOM 3880  H HA3  . GLY A 1 130 ? -5.512  -7.477  -32.006 1.00 0.00 ? 130 GLY A HA3  2  
ATOM 3881  N N    . GLY A 1 1   ? 63.668  34.597  -1.399  1.00 0.00 ? 1   GLY A N    3  
ATOM 3882  C CA   . GLY A 1 1   ? 63.767  33.271  -1.984  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3883  C C    . GLY A 1 1   ? 62.391  32.753  -2.404  1.00 0.00 ? 1   GLY A C    3  
ATOM 3884  O O    . GLY A 1 1   ? 61.371  33.187  -1.871  1.00 0.00 ? 1   GLY A O    3  
ATOM 3885  H H1   . GLY A 1 1   ? 62.797  35.064  -1.554  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3886  H HA2  . GLY A 1 1   ? 64.428  33.301  -2.851  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3887  H HA3  . GLY A 1 1   ? 64.215  32.585  -1.266  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3888  N N    . SER A 1 2   ? 62.406  31.831  -3.356  1.00 0.00 ? 2   SER A N    3  
ATOM 3889  C CA   . SER A 1 2   ? 61.171  31.249  -3.854  1.00 0.00 ? 2   SER A CA   3  
ATOM 3890  C C    . SER A 1 2   ? 61.478  30.235  -4.958  1.00 0.00 ? 2   SER A C    3  
ATOM 3891  O O    . SER A 1 2   ? 62.600  30.180  -5.460  1.00 0.00 ? 2   SER A O    3  
ATOM 3892  C CB   . SER A 1 2   ? 60.223  32.331  -4.375  1.00 0.00 ? 2   SER A CB   3  
ATOM 3893  O OG   . SER A 1 2   ? 60.882  33.241  -5.252  1.00 0.00 ? 2   SER A OG   3  
ATOM 3894  H H    . SER A 1 2   ? 63.240  31.484  -3.785  1.00 0.00 ? 2   SER A H    3  
ATOM 3895  H HA   . SER A 1 2   ? 60.719  30.754  -2.995  1.00 0.00 ? 2   SER A HA   3  
ATOM 3896  H HB2  . SER A 1 2   ? 59.390  31.861  -4.900  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3897  H HB3  . SER A 1 2   ? 59.800  32.879  -3.534  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3898  H HG   . SER A 1 2   ? 60.541  34.169  -5.100  1.00 0.00 ? 2   SER A HG   3  
ATOM 3899  N N    . SER A 1 3   ? 60.462  29.458  -5.303  1.00 0.00 ? 3   SER A N    3  
ATOM 3900  C CA   . SER A 1 3   ? 60.609  28.449  -6.338  1.00 0.00 ? 3   SER A CA   3  
ATOM 3901  C C    . SER A 1 3   ? 59.260  27.783  -6.616  1.00 0.00 ? 3   SER A C    3  
ATOM 3902  O O    . SER A 1 3   ? 58.339  27.878  -5.806  1.00 0.00 ? 3   SER A O    3  
ATOM 3903  C CB   . SER A 1 3   ? 61.648  27.399  -5.940  1.00 0.00 ? 3   SER A CB   3  
ATOM 3904  O OG   . SER A 1 3   ? 61.165  26.531  -4.918  1.00 0.00 ? 3   SER A OG   3  
ATOM 3905  H H    . SER A 1 3   ? 59.553  29.510  -4.890  1.00 0.00 ? 3   SER A H    3  
ATOM 3906  H HA   . SER A 1 3   ? 60.958  28.988  -7.219  1.00 0.00 ? 3   SER A HA   3  
ATOM 3907  H HB2  . SER A 1 3   ? 61.923  26.811  -6.815  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3908  H HB3  . SER A 1 3   ? 62.553  27.897  -5.593  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3909  H HG   . SER A 1 3   ? 60.669  25.765  -5.327  1.00 0.00 ? 3   SER A HG   3  
ATOM 3910  N N    . GLY A 1 4   ? 59.187  27.124  -7.762  1.00 0.00 ? 4   GLY A N    3  
ATOM 3911  C CA   . GLY A 1 4   ? 57.966  26.442  -8.157  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3912  C C    . GLY A 1 4   ? 58.265  25.299  -9.128  1.00 0.00 ? 4   GLY A C    3  
ATOM 3913  O O    . GLY A 1 4   ? 59.422  25.059  -9.473  1.00 0.00 ? 4   GLY A O    3  
ATOM 3914  H H    . GLY A 1 4   ? 59.941  27.051  -8.415  1.00 0.00 ? 4   GLY A H    3  
ATOM 3915  H HA2  . GLY A 1 4   ? 57.462  26.050  -7.273  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3916  H HA3  . GLY A 1 4   ? 57.283  27.152  -8.624  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3917  N N    . SER A 1 5   ? 57.203  24.623  -9.543  1.00 0.00 ? 5   SER A N    3  
ATOM 3918  C CA   . SER A 1 5   ? 57.338  23.511  -10.468 1.00 0.00 ? 5   SER A CA   3  
ATOM 3919  C C    . SER A 1 5   ? 55.989  23.208  -11.122 1.00 0.00 ? 5   SER A C    3  
ATOM 3920  O O    . SER A 1 5   ? 54.953  23.694  -10.670 1.00 0.00 ? 5   SER A O    3  
ATOM 3921  C CB   . SER A 1 5   ? 57.875  22.266  -9.758  1.00 0.00 ? 5   SER A CB   3  
ATOM 3922  O OG   . SER A 1 5   ? 59.273  22.359  -9.501  1.00 0.00 ? 5   SER A OG   3  
ATOM 3923  H H    . SER A 1 5   ? 56.266  24.825  -9.257  1.00 0.00 ? 5   SER A H    3  
ATOM 3924  H HA   . SER A 1 5   ? 58.060  23.842  -11.214 1.00 0.00 ? 5   SER A HA   3  
ATOM 3925  H HB2  . SER A 1 5   ? 57.342  22.127  -8.817  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3926  H HB3  . SER A 1 5   ? 57.676  21.386  -10.370 1.00 0.00 ? 5   SER A HB3  3  
ATOM 3927  H HG   . SER A 1 5   ? 59.530  21.726  -8.772  1.00 0.00 ? 5   SER A HG   3  
ATOM 3928  N N    . SER A 1 6   ? 56.045  22.408  -12.177 1.00 0.00 ? 6   SER A N    3  
ATOM 3929  C CA   . SER A 1 6   ? 54.840  22.035  -12.898 1.00 0.00 ? 6   SER A CA   3  
ATOM 3930  C C    . SER A 1 6   ? 55.107  20.799  -13.759 1.00 0.00 ? 6   SER A C    3  
ATOM 3931  O O    . SER A 1 6   ? 56.252  20.374  -13.903 1.00 0.00 ? 6   SER A O    3  
ATOM 3932  C CB   . SER A 1 6   ? 54.340  23.190  -13.769 1.00 0.00 ? 6   SER A CB   3  
ATOM 3933  O OG   . SER A 1 6   ? 55.293  23.563  -14.761 1.00 0.00 ? 6   SER A OG   3  
ATOM 3934  H H    . SER A 1 6   ? 56.892  22.018  -12.538 1.00 0.00 ? 6   SER A H    3  
ATOM 3935  H HA   . SER A 1 6   ? 54.100  21.814  -12.129 1.00 0.00 ? 6   SER A HA   3  
ATOM 3936  H HB2  . SER A 1 6   ? 53.407  22.901  -14.253 1.00 0.00 ? 6   SER A HB2  3  
ATOM 3937  H HB3  . SER A 1 6   ? 54.118  24.050  -13.138 1.00 0.00 ? 6   SER A HB3  3  
ATOM 3938  H HG   . SER A 1 6   ? 55.141  23.035  -15.596 1.00 0.00 ? 6   SER A HG   3  
ATOM 3939  N N    . GLY A 1 7   ? 54.030  20.256  -14.308 1.00 0.00 ? 7   GLY A N    3  
ATOM 3940  C CA   . GLY A 1 7   ? 54.134  19.076  -15.150 1.00 0.00 ? 7   GLY A CA   3  
ATOM 3941  C C    . GLY A 1 7   ? 53.061  19.086  -16.242 1.00 0.00 ? 7   GLY A C    3  
ATOM 3942  O O    . GLY A 1 7   ? 52.266  20.021  -16.327 1.00 0.00 ? 7   GLY A O    3  
ATOM 3943  H H    . GLY A 1 7   ? 53.102  20.608  -14.186 1.00 0.00 ? 7   GLY A H    3  
ATOM 3944  H HA2  . GLY A 1 7   ? 55.122  19.037  -15.607 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3945  H HA3  . GLY A 1 7   ? 54.028  18.179  -14.541 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3946  N N    . ARG A 1 8   ? 53.074  18.036  -17.049 1.00 0.00 ? 8   ARG A N    3  
ATOM 3947  C CA   . ARG A 1 8   ? 52.113  17.912  -18.132 1.00 0.00 ? 8   ARG A CA   3  
ATOM 3948  C C    . ARG A 1 8   ? 52.242  16.543  -18.802 1.00 0.00 ? 8   ARG A C    3  
ATOM 3949  O O    . ARG A 1 8   ? 53.344  16.114  -19.140 1.00 0.00 ? 8   ARG A O    3  
ATOM 3950  C CB   . ARG A 1 8   ? 52.320  19.007  -19.180 1.00 0.00 ? 8   ARG A CB   3  
ATOM 3951  C CG   . ARG A 1 8   ? 53.620  18.785  -19.955 1.00 0.00 ? 8   ARG A CG   3  
ATOM 3952  C CD   . ARG A 1 8   ? 53.408  17.809  -21.115 1.00 0.00 ? 8   ARG A CD   3  
ATOM 3953  N NE   . ARG A 1 8   ? 53.593  18.510  -22.406 1.00 0.00 ? 8   ARG A NE   3  
ATOM 3954  C CZ   . ARG A 1 8   ? 53.868  17.892  -23.563 1.00 0.00 ? 8   ARG A CZ   3  
ATOM 3955  N NH1  . ARG A 1 8   ? 53.991  16.559  -23.598 1.00 0.00 ? 8   ARG A NH1  3  
ATOM 3956  N NH2  . ARG A 1 8   ? 54.020  18.609  -24.685 1.00 0.00 ? 8   ARG A NH2  3  
ATOM 3957  H H    . ARG A 1 8   ? 53.725  17.280  -16.973 1.00 0.00 ? 8   ARG A H    3  
ATOM 3958  H HA   . ARG A 1 8   ? 51.140  18.025  -17.654 1.00 0.00 ? 8   ARG A HA   3  
ATOM 3959  H HB2  . ARG A 1 8   ? 51.478  19.017  -19.872 1.00 0.00 ? 8   ARG A HB2  3  
ATOM 3960  H HB3  . ARG A 1 8   ? 52.345  19.982  -18.693 1.00 0.00 ? 8   ARG A HB3  3  
ATOM 3961  H HG2  . ARG A 1 8   ? 53.987  19.737  -20.339 1.00 0.00 ? 8   ARG A HG2  3  
ATOM 3962  H HG3  . ARG A 1 8   ? 54.386  18.395  -19.284 1.00 0.00 ? 8   ARG A HG3  3  
ATOM 3963  H HD2  . ARG A 1 8   ? 54.111  16.980  -21.038 1.00 0.00 ? 8   ARG A HD2  3  
ATOM 3964  H HD3  . ARG A 1 8   ? 52.406  17.384  -21.064 1.00 0.00 ? 8   ARG A HD3  3  
ATOM 3965  H HE   . ARG A 1 8   ? 53.508  19.506  -22.415 1.00 0.00 ? 8   ARG A HE   3  
ATOM 3966  H HH11 . ARG A 1 8   ? 53.877  16.024  -22.760 1.00 0.00 ? 8   ARG A HH11 3  
ATOM 3967  H HH12 . ARG A 1 8   ? 54.196  16.098  -24.461 1.00 0.00 ? 8   ARG A HH12 3  
ATOM 3968  H HH21 . ARG A 1 8   ? 53.928  19.604  -24.659 1.00 0.00 ? 8   ARG A HH21 3  
ATOM 3969  H HH22 . ARG A 1 8   ? 54.225  18.148  -25.548 1.00 0.00 ? 8   ARG A HH22 3  
ATOM 3970  N N    . ILE A 1 9   ? 51.100  15.893  -18.973 1.00 0.00 ? 9   ILE A N    3  
ATOM 3971  C CA   . ILE A 1 9   ? 51.071  14.581  -19.597 1.00 0.00 ? 9   ILE A CA   3  
ATOM 3972  C C    . ILE A 1 9   ? 50.278  14.659  -20.903 1.00 0.00 ? 9   ILE A C    3  
ATOM 3973  O O    . ILE A 1 9   ? 49.393  15.501  -21.047 1.00 0.00 ? 9   ILE A O    3  
ATOM 3974  C CB   . ILE A 1 9   ? 50.539  13.534  -18.617 1.00 0.00 ? 9   ILE A CB   3  
ATOM 3975  C CG1  . ILE A 1 9   ? 51.593  13.183  -17.565 1.00 0.00 ? 9   ILE A CG1  3  
ATOM 3976  C CG2  . ILE A 1 9   ? 50.035  12.294  -19.359 1.00 0.00 ? 9   ILE A CG2  3  
ATOM 3977  C CD1  . ILE A 1 9   ? 50.982  12.358  -16.430 1.00 0.00 ? 9   ILE A CD1  3  
ATOM 3978  H H    . ILE A 1 9   ? 50.207  16.249  -18.695 1.00 0.00 ? 9   ILE A H    3  
ATOM 3979  H HA   . ILE A 1 9   ? 52.100  14.309  -19.833 1.00 0.00 ? 9   ILE A HA   3  
ATOM 3980  H HB   . ILE A 1 9   ? 49.687  13.962  -18.089 1.00 0.00 ? 9   ILE A HB   3  
ATOM 3981  H HG12 . ILE A 1 9   ? 52.405  12.623  -18.030 1.00 0.00 ? 9   ILE A HG12 3  
ATOM 3982  H HG13 . ILE A 1 9   ? 52.028  14.097  -17.161 1.00 0.00 ? 9   ILE A HG13 3  
ATOM 3983  H HG21 . ILE A 1 9   ? 50.745  12.026  -20.142 1.00 0.00 ? 9   ILE A HG21 3  
ATOM 3984  H HG22 . ILE A 1 9   ? 49.938  11.466  -18.658 1.00 0.00 ? 9   ILE A HG22 3  
ATOM 3985  H HG23 . ILE A 1 9   ? 49.065  12.508  -19.806 1.00 0.00 ? 9   ILE A HG23 3  
ATOM 3986  H HD11 . ILE A 1 9   ? 50.864  11.324  -16.756 1.00 0.00 ? 9   ILE A HD11 3  
ATOM 3987  H HD12 . ILE A 1 9   ? 51.639  12.392  -15.561 1.00 0.00 ? 9   ILE A HD12 3  
ATOM 3988  H HD13 . ILE A 1 9   ? 50.008  12.769  -16.166 1.00 0.00 ? 9   ILE A HD13 3  
ATOM 3989  N N    . GLY A 1 10  ? 50.625  13.771  -21.823 1.00 0.00 ? 10  GLY A N    3  
ATOM 3990  C CA   . GLY A 1 10  ? 49.957  13.728  -23.112 1.00 0.00 ? 10  GLY A CA   3  
ATOM 3991  C C    . GLY A 1 10  ? 49.195  12.413  -23.292 1.00 0.00 ? 10  GLY A C    3  
ATOM 3992  O O    . GLY A 1 10  ? 49.613  11.551  -24.064 1.00 0.00 ? 10  GLY A O    3  
ATOM 3993  H H    . GLY A 1 10  ? 51.346  13.089  -21.698 1.00 0.00 ? 10  GLY A H    3  
ATOM 3994  H HA2  . GLY A 1 10  ? 49.266  14.567  -23.195 1.00 0.00 ? 10  GLY A HA2  3  
ATOM 3995  H HA3  . GLY A 1 10  ? 50.691  13.840  -23.910 1.00 0.00 ? 10  GLY A HA3  3  
ATOM 3996  N N    . ASP A 1 11  ? 48.092  12.301  -22.568 1.00 0.00 ? 11  ASP A N    3  
ATOM 3997  C CA   . ASP A 1 11  ? 47.269  11.106  -22.638 1.00 0.00 ? 11  ASP A CA   3  
ATOM 3998  C C    . ASP A 1 11  ? 46.234  11.269  -23.753 1.00 0.00 ? 11  ASP A C    3  
ATOM 3999  O O    . ASP A 1 11  ? 45.795  12.382  -24.039 1.00 0.00 ? 11  ASP A O    3  
ATOM 4000  C CB   . ASP A 1 11  ? 46.517  10.877  -21.325 1.00 0.00 ? 11  ASP A CB   3  
ATOM 4001  C CG   . ASP A 1 11  ? 46.614  9.457   -20.764 1.00 0.00 ? 11  ASP A CG   3  
ATOM 4002  O OD1  . ASP A 1 11  ? 47.139  8.592   -21.497 1.00 0.00 ? 11  ASP A OD1  3  
ATOM 4003  O OD2  . ASP A 1 11  ? 46.160  9.269   -19.614 1.00 0.00 ? 11  ASP A OD2  3  
ATOM 4004  H H    . ASP A 1 11  ? 47.760  13.007  -21.942 1.00 0.00 ? 11  ASP A H    3  
ATOM 4005  H HA   . ASP A 1 11  ? 47.965  10.290  -22.831 1.00 0.00 ? 11  ASP A HA   3  
ATOM 4006  H HB2  . ASP A 1 11  ? 46.899  11.574  -20.579 1.00 0.00 ? 11  ASP A HB2  3  
ATOM 4007  H HB3  . ASP A 1 11  ? 45.466  11.120  -21.479 1.00 0.00 ? 11  ASP A HB3  3  
ATOM 4008  N N    . GLY A 1 12  ? 45.875  10.144  -24.352 1.00 0.00 ? 12  GLY A N    3  
ATOM 4009  C CA   . GLY A 1 12  ? 44.900  10.148  -25.430 1.00 0.00 ? 12  GLY A CA   3  
ATOM 4010  C C    . GLY A 1 12  ? 43.693  9.275   -25.081 1.00 0.00 ? 12  GLY A C    3  
ATOM 4011  O O    . GLY A 1 12  ? 43.832  8.070   -24.879 1.00 0.00 ? 12  GLY A O    3  
ATOM 4012  H H    . GLY A 1 12  ? 46.237  9.243   -24.114 1.00 0.00 ? 12  GLY A H    3  
ATOM 4013  H HA2  . GLY A 1 12  ? 44.571  11.169  -25.623 1.00 0.00 ? 12  GLY A HA2  3  
ATOM 4014  H HA3  . GLY A 1 12  ? 45.364  9.784   -26.347 1.00 0.00 ? 12  GLY A HA3  3  
ATOM 4015  N N    . SER A 1 13  ? 42.536  9.917   -25.021 1.00 0.00 ? 13  SER A N    3  
ATOM 4016  C CA   . SER A 1 13  ? 41.305  9.214   -24.700 1.00 0.00 ? 13  SER A CA   3  
ATOM 4017  C C    . SER A 1 13  ? 40.099  10.022  -25.182 1.00 0.00 ? 13  SER A C    3  
ATOM 4018  O O    . SER A 1 13  ? 39.586  10.871  -24.455 1.00 0.00 ? 13  SER A O    3  
ATOM 4019  C CB   . SER A 1 13  ? 41.199  8.947   -23.197 1.00 0.00 ? 13  SER A CB   3  
ATOM 4020  O OG   . SER A 1 13  ? 41.223  10.153  -22.438 1.00 0.00 ? 13  SER A OG   3  
ATOM 4021  H H    . SER A 1 13  ? 42.431  10.898  -25.187 1.00 0.00 ? 13  SER A H    3  
ATOM 4022  H HA   . SER A 1 13  ? 41.368  8.265   -25.233 1.00 0.00 ? 13  SER A HA   3  
ATOM 4023  H HB2  . SER A 1 13  ? 40.276  8.406   -22.989 1.00 0.00 ? 13  SER A HB2  3  
ATOM 4024  H HB3  . SER A 1 13  ? 42.022  8.305   -22.884 1.00 0.00 ? 13  SER A HB3  3  
ATOM 4025  H HG   . SER A 1 13  ? 41.352  10.937  -23.046 1.00 0.00 ? 13  SER A HG   3  
ATOM 4026  N N    . PRO A 1 14  ? 39.671  9.723   -26.438 1.00 0.00 ? 14  PRO A N    3  
ATOM 4027  C CA   . PRO A 1 14  ? 38.535  10.412  -27.026 1.00 0.00 ? 14  PRO A CA   3  
ATOM 4028  C C    . PRO A 1 14  ? 37.220  9.915   -26.422 1.00 0.00 ? 14  PRO A C    3  
ATOM 4029  O O    . PRO A 1 14  ? 36.947  8.716   -26.420 1.00 0.00 ? 14  PRO A O    3  
ATOM 4030  C CB   . PRO A 1 14  ? 38.642  10.144  -28.518 1.00 0.00 ? 14  PRO A CB   3  
ATOM 4031  C CG   . PRO A 1 14  ? 39.558  8.939   -28.661 1.00 0.00 ? 14  PRO A CG   3  
ATOM 4032  C CD   . PRO A 1 14  ? 40.255  8.723   -27.328 1.00 0.00 ? 14  PRO A CD   3  
ATOM 4033  H HA   . PRO A 1 14  ? 38.578  11.390  -26.821 1.00 0.00 ? 14  PRO A HA   3  
ATOM 4034  H HB2  . PRO A 1 14  ? 37.661  9.942   -28.950 1.00 0.00 ? 14  PRO A HB2  3  
ATOM 4035  H HB3  . PRO A 1 14  ? 39.049  11.009  -29.042 1.00 0.00 ? 14  PRO A HB3  3  
ATOM 4036  H HG2  . PRO A 1 14  ? 38.985  8.055   -28.940 1.00 0.00 ? 14  PRO A HG2  3  
ATOM 4037  H HG3  . PRO A 1 14  ? 40.289  9.108   -29.452 1.00 0.00 ? 14  PRO A HG3  3  
ATOM 4038  H HD2  . PRO A 1 14  ? 40.089  7.713   -26.953 1.00 0.00 ? 14  PRO A HD2  3  
ATOM 4039  H HD3  . PRO A 1 14  ? 41.333  8.856   -27.419 1.00 0.00 ? 14  PRO A HD3  3  
ATOM 4040  N N    . SER A 1 15  ? 36.440  10.863  -25.924 1.00 0.00 ? 15  SER A N    3  
ATOM 4041  C CA   . SER A 1 15  ? 35.160  10.537  -25.318 1.00 0.00 ? 15  SER A CA   3  
ATOM 4042  C C    . SER A 1 15  ? 35.374  9.663   -24.081 1.00 0.00 ? 15  SER A C    3  
ATOM 4043  O O    . SER A 1 15  ? 36.382  8.965   -23.976 1.00 0.00 ? 15  SER A O    3  
ATOM 4044  C CB   . SER A 1 15  ? 34.242  9.829   -26.317 1.00 0.00 ? 15  SER A CB   3  
ATOM 4045  O OG   . SER A 1 15  ? 32.900  10.300  -26.235 1.00 0.00 ? 15  SER A OG   3  
ATOM 4046  H H    . SER A 1 15  ? 36.669  11.837  -25.929 1.00 0.00 ? 15  SER A H    3  
ATOM 4047  H HA   . SER A 1 15  ? 34.721  11.495  -25.038 1.00 0.00 ? 15  SER A HA   3  
ATOM 4048  H HB2  . SER A 1 15  ? 34.620  9.982   -27.328 1.00 0.00 ? 15  SER A HB2  3  
ATOM 4049  H HB3  . SER A 1 15  ? 34.262  8.756   -26.129 1.00 0.00 ? 15  SER A HB3  3  
ATOM 4050  H HG   . SER A 1 15  ? 32.492  10.330  -27.148 1.00 0.00 ? 15  SER A HG   3  
ATOM 4051  N N    . HIS A 1 16  ? 34.409  9.728   -23.175 1.00 0.00 ? 16  HIS A N    3  
ATOM 4052  C CA   . HIS A 1 16  ? 34.479  8.950   -21.950 1.00 0.00 ? 16  HIS A CA   3  
ATOM 4053  C C    . HIS A 1 16  ? 33.175  9.108   -21.166 1.00 0.00 ? 16  HIS A C    3  
ATOM 4054  O O    . HIS A 1 16  ? 32.565  10.176  -21.178 1.00 0.00 ? 16  HIS A O    3  
ATOM 4055  C CB   . HIS A 1 16  ? 35.713  9.337   -21.131 1.00 0.00 ? 16  HIS A CB   3  
ATOM 4056  C CG   . HIS A 1 16  ? 35.673  10.745  -20.588 1.00 0.00 ? 16  HIS A CG   3  
ATOM 4057  N ND1  . HIS A 1 16  ? 35.416  11.848  -21.382 1.00 0.00 ? 16  HIS A ND1  3  
ATOM 4058  C CD2  . HIS A 1 16  ? 35.860  11.217  -19.322 1.00 0.00 ? 16  HIS A CD2  3  
ATOM 4059  C CE1  . HIS A 1 16  ? 35.449  12.931  -20.619 1.00 0.00 ? 16  HIS A CE1  3  
ATOM 4060  N NE2  . HIS A 1 16  ? 35.725  12.537  -19.342 1.00 0.00 ? 16  HIS A NE2  3  
ATOM 4061  H H    . HIS A 1 16  ? 33.592  10.298  -23.268 1.00 0.00 ? 16  HIS A H    3  
ATOM 4062  H HA   . HIS A 1 16  ? 34.591  7.908   -22.247 1.00 0.00 ? 16  HIS A HA   3  
ATOM 4063  H HB2  . HIS A 1 16  ? 35.817  8.640   -20.300 1.00 0.00 ? 16  HIS A HB2  3  
ATOM 4064  H HB3  . HIS A 1 16  ? 36.600  9.224   -21.755 1.00 0.00 ? 16  HIS A HB3  3  
ATOM 4065  H HD1  . HIS A 1 16  ? 35.235  11.832  -22.366 1.00 0.00 ? 16  HIS A HD1  3  
ATOM 4066  H HD2  . HIS A 1 16  ? 36.082  10.612  -18.442 1.00 0.00 ? 16  HIS A HD2  3  
ATOM 4067  H HE1  . HIS A 1 16  ? 35.285  13.955  -20.952 1.00 0.00 ? 16  HIS A HE1  3  
ATOM 4068  N N    . PRO A 1 17  ? 32.775  8.001   -20.486 1.00 0.00 ? 17  PRO A N    3  
ATOM 4069  C CA   . PRO A 1 17  ? 31.554  8.006   -19.699 1.00 0.00 ? 17  PRO A CA   3  
ATOM 4070  C C    . PRO A 1 17  ? 31.747  8.780   -18.393 1.00 0.00 ? 17  PRO A C    3  
ATOM 4071  O O    . PRO A 1 17  ? 32.814  8.721   -17.784 1.00 0.00 ? 17  PRO A O    3  
ATOM 4072  C CB   . PRO A 1 17  ? 31.223  6.539   -19.476 1.00 0.00 ? 17  PRO A CB   3  
ATOM 4073  C CG   . PRO A 1 17  ? 32.510  5.776   -19.744 1.00 0.00 ? 17  PRO A CG   3  
ATOM 4074  C CD   . PRO A 1 17  ? 33.472  6.719   -20.449 1.00 0.00 ? 17  PRO A CD   3  
ATOM 4075  H HA   . PRO A 1 17  ? 30.825  8.480   -20.192 1.00 0.00 ? 17  PRO A HA   3  
ATOM 4076  H HB2  . PRO A 1 17  ? 30.873  6.368   -18.458 1.00 0.00 ? 17  PRO A HB2  3  
ATOM 4077  H HB3  . PRO A 1 17  ? 30.428  6.212   -20.146 1.00 0.00 ? 17  PRO A HB3  3  
ATOM 4078  H HG2  . PRO A 1 17  ? 32.943  5.417   -18.811 1.00 0.00 ? 17  PRO A HG2  3  
ATOM 4079  H HG3  . PRO A 1 17  ? 32.312  4.900   -20.362 1.00 0.00 ? 17  PRO A HG3  3  
ATOM 4080  H HD2  . PRO A 1 17  ? 34.416  6.797   -19.910 1.00 0.00 ? 17  PRO A HD2  3  
ATOM 4081  H HD3  . PRO A 1 17  ? 33.707  6.366   -21.453 1.00 0.00 ? 17  PRO A HD3  3  
ATOM 4082  N N    . PRO A 1 18  ? 30.670  9.508   -17.992 1.00 0.00 ? 18  PRO A N    3  
ATOM 4083  C CA   . PRO A 1 18  ? 30.711  10.293  -16.770 1.00 0.00 ? 18  PRO A CA   3  
ATOM 4084  C C    . PRO A 1 18  ? 30.606  9.394   -15.537 1.00 0.00 ? 18  PRO A C    3  
ATOM 4085  O O    . PRO A 1 18  ? 30.134  8.261   -15.628 1.00 0.00 ? 18  PRO A O    3  
ATOM 4086  C CB   . PRO A 1 18  ? 29.554  11.271  -16.892 1.00 0.00 ? 18  PRO A CB   3  
ATOM 4087  C CG   . PRO A 1 18  ? 28.631  10.694  -17.953 1.00 0.00 ? 18  PRO A CG   3  
ATOM 4088  C CD   . PRO A 1 18  ? 29.391  9.603   -18.689 1.00 0.00 ? 18  PRO A CD   3  
ATOM 4089  H HA   . PRO A 1 18  ? 31.589  10.766  -16.690 1.00 0.00 ? 18  PRO A HA   3  
ATOM 4090  H HB2  . PRO A 1 18  ? 29.034  11.382  -15.941 1.00 0.00 ? 18  PRO A HB2  3  
ATOM 4091  H HB3  . PRO A 1 18  ? 29.908  12.261  -17.179 1.00 0.00 ? 18  PRO A HB3  3  
ATOM 4092  H HG2  . PRO A 1 18  ? 27.728  10.289  -17.495 1.00 0.00 ? 18  PRO A HG2  3  
ATOM 4093  H HG3  . PRO A 1 18  ? 28.314  11.473  -18.648 1.00 0.00 ? 18  PRO A HG3  3  
ATOM 4094  H HD2  . PRO A 1 18  ? 28.852  8.655   -18.657 1.00 0.00 ? 18  PRO A HD2  3  
ATOM 4095  H HD3  . PRO A 1 18  ? 29.530  9.856   -19.740 1.00 0.00 ? 18  PRO A HD3  3  
ATOM 4096  N N    . ILE A 1 19  ? 31.053  9.932   -14.412 1.00 0.00 ? 19  ILE A N    3  
ATOM 4097  C CA   . ILE A 1 19  ? 31.015  9.192   -13.162 1.00 0.00 ? 19  ILE A CA   3  
ATOM 4098  C C    . ILE A 1 19  ? 29.752  9.573   -12.387 1.00 0.00 ? 19  ILE A C    3  
ATOM 4099  O O    . ILE A 1 19  ? 29.425  10.753  -12.266 1.00 0.00 ? 19  ILE A O    3  
ATOM 4100  C CB   . ILE A 1 19  ? 32.309  9.407   -12.373 1.00 0.00 ? 19  ILE A CB   3  
ATOM 4101  C CG1  . ILE A 1 19  ? 33.513  8.845   -13.131 1.00 0.00 ? 19  ILE A CG1  3  
ATOM 4102  C CG2  . ILE A 1 19  ? 32.195  8.822   -10.964 1.00 0.00 ? 19  ILE A CG2  3  
ATOM 4103  C CD1  . ILE A 1 19  ? 34.824  9.383   -12.555 1.00 0.00 ? 19  ILE A CD1  3  
ATOM 4104  H H    . ILE A 1 19  ? 31.435  10.854  -14.346 1.00 0.00 ? 19  ILE A H    3  
ATOM 4105  H HA   . ILE A 1 19  ? 30.961  8.132   -13.411 1.00 0.00 ? 19  ILE A HA   3  
ATOM 4106  H HB   . ILE A 1 19  ? 32.468  10.479  -12.264 1.00 0.00 ? 19  ILE A HB   3  
ATOM 4107  H HG12 . ILE A 1 19  ? 33.506  7.756   -13.076 1.00 0.00 ? 19  ILE A HG12 3  
ATOM 4108  H HG13 . ILE A 1 19  ? 33.439  9.110   -14.186 1.00 0.00 ? 19  ILE A HG13 3  
ATOM 4109  H HG21 . ILE A 1 19  ? 31.426  8.048   -10.952 1.00 0.00 ? 19  ILE A HG21 3  
ATOM 4110  H HG22 . ILE A 1 19  ? 33.151  8.387   -10.672 1.00 0.00 ? 19  ILE A HG22 3  
ATOM 4111  H HG23 . ILE A 1 19  ? 31.926  9.612   -10.263 1.00 0.00 ? 19  ILE A HG23 3  
ATOM 4112  H HD11 . ILE A 1 19  ? 35.582  8.600   -12.585 1.00 0.00 ? 19  ILE A HD11 3  
ATOM 4113  H HD12 . ILE A 1 19  ? 35.158  10.235  -13.146 1.00 0.00 ? 19  ILE A HD12 3  
ATOM 4114  H HD13 . ILE A 1 19  ? 34.665  9.696   -11.523 1.00 0.00 ? 19  ILE A HD13 3  
ATOM 4115  N N    . LEU A 1 20  ? 29.076  8.552   -11.881 1.00 0.00 ? 20  LEU A N    3  
ATOM 4116  C CA   . LEU A 1 20  ? 27.856  8.765   -11.121 1.00 0.00 ? 20  LEU A CA   3  
ATOM 4117  C C    . LEU A 1 20  ? 27.535  7.504   -10.317 1.00 0.00 ? 20  LEU A C    3  
ATOM 4118  O O    . LEU A 1 20  ? 27.168  6.477   -10.886 1.00 0.00 ? 20  LEU A O    3  
ATOM 4119  C CB   . LEU A 1 20  ? 26.721  9.211   -12.044 1.00 0.00 ? 20  LEU A CB   3  
ATOM 4120  C CG   . LEU A 1 20  ? 25.602  10.023  -11.388 1.00 0.00 ? 20  LEU A CG   3  
ATOM 4121  C CD1  . LEU A 1 20  ? 25.750  11.513  -11.700 1.00 0.00 ? 20  LEU A CD1  3  
ATOM 4122  C CD2  . LEU A 1 20  ? 24.227  9.487   -11.790 1.00 0.00 ? 20  LEU A CD2  3  
ATOM 4123  H H    . LEU A 1 20  ? 29.349  7.595   -11.983 1.00 0.00 ? 20  LEU A H    3  
ATOM 4124  H HA   . LEU A 1 20  ? 28.044  9.581   -10.423 1.00 0.00 ? 20  LEU A HA   3  
ATOM 4125  H HB2  . LEU A 1 20  ? 27.148  9.806   -12.852 1.00 0.00 ? 20  LEU A HB2  3  
ATOM 4126  H HB3  . LEU A 1 20  ? 26.280  8.325   -12.500 1.00 0.00 ? 20  LEU A HB3  3  
ATOM 4127  H HG   . LEU A 1 20  ? 25.688  9.911   -10.307 1.00 0.00 ? 20  LEU A HG   3  
ATOM 4128  H HD11 . LEU A 1 20  ? 24.983  12.074  -11.167 1.00 0.00 ? 20  LEU A HD11 3  
ATOM 4129  H HD12 . LEU A 1 20  ? 26.736  11.855  -11.384 1.00 0.00 ? 20  LEU A HD12 3  
ATOM 4130  H HD13 . LEU A 1 20  ? 25.638  11.672  -12.773 1.00 0.00 ? 20  LEU A HD13 3  
ATOM 4131  H HD21 . LEU A 1 20  ? 24.275  9.087   -12.803 1.00 0.00 ? 20  LEU A HD21 3  
ATOM 4132  H HD22 . LEU A 1 20  ? 23.929  8.697   -11.101 1.00 0.00 ? 20  LEU A HD22 3  
ATOM 4133  H HD23 . LEU A 1 20  ? 23.497  10.295  -11.753 1.00 0.00 ? 20  LEU A HD23 3  
ATOM 4134  N N    . GLU A 1 21  ? 27.684  7.622   -9.006  1.00 0.00 ? 21  GLU A N    3  
ATOM 4135  C CA   . GLU A 1 21  ? 27.415  6.505   -8.117  1.00 0.00 ? 21  GLU A CA   3  
ATOM 4136  C C    . GLU A 1 21  ? 26.553  6.960   -6.938  1.00 0.00 ? 21  GLU A C    3  
ATOM 4137  O O    . GLU A 1 21  ? 27.046  7.093   -5.819  1.00 0.00 ? 21  GLU A O    3  
ATOM 4138  C CB   . GLU A 1 21  ? 28.716  5.865   -7.630  1.00 0.00 ? 21  GLU A CB   3  
ATOM 4139  C CG   . GLU A 1 21  ? 29.398  5.084   -8.756  1.00 0.00 ? 21  GLU A CG   3  
ATOM 4140  C CD   . GLU A 1 21  ? 30.898  4.936   -8.490  1.00 0.00 ? 21  GLU A CD   3  
ATOM 4141  O OE1  . GLU A 1 21  ? 31.238  4.598   -7.336  1.00 0.00 ? 21  GLU A OE1  3  
ATOM 4142  O OE2  . GLU A 1 21  ? 31.669  5.164   -9.447  1.00 0.00 ? 21  GLU A OE2  3  
ATOM 4143  H H    . GLU A 1 21  ? 27.983  8.461   -8.551  1.00 0.00 ? 21  GLU A H    3  
ATOM 4144  H HA   . GLU A 1 21  ? 26.865  5.782   -8.720  1.00 0.00 ? 21  GLU A HA   3  
ATOM 4145  H HB2  . GLU A 1 21  ? 29.389  6.638   -7.260  1.00 0.00 ? 21  GLU A HB2  3  
ATOM 4146  H HB3  . GLU A 1 21  ? 28.507  5.197   -6.795  1.00 0.00 ? 21  GLU A HB3  3  
ATOM 4147  H HG2  . GLU A 1 21  ? 28.942  4.098   -8.847  1.00 0.00 ? 21  GLU A HG2  3  
ATOM 4148  H HG3  . GLU A 1 21  ? 29.243  5.597   -9.705  1.00 0.00 ? 21  GLU A HG3  3  
ATOM 4149  N N    . ARG A 1 22  ? 25.280  7.186   -7.229  1.00 0.00 ? 22  ARG A N    3  
ATOM 4150  C CA   . ARG A 1 22  ? 24.345  7.624   -6.207  1.00 0.00 ? 22  ARG A CA   3  
ATOM 4151  C C    . ARG A 1 22  ? 24.992  8.685   -5.314  1.00 0.00 ? 22  ARG A C    3  
ATOM 4152  O O    . ARG A 1 22  ? 25.528  8.366   -4.254  1.00 0.00 ? 22  ARG A O    3  
ATOM 4153  C CB   . ARG A 1 22  ? 23.887  6.449   -5.340  1.00 0.00 ? 22  ARG A CB   3  
ATOM 4154  C CG   . ARG A 1 22  ? 22.845  5.601   -6.073  1.00 0.00 ? 22  ARG A CG   3  
ATOM 4155  C CD   . ARG A 1 22  ? 22.728  4.211   -5.443  1.00 0.00 ? 22  ARG A CD   3  
ATOM 4156  N NE   . ARG A 1 22  ? 22.878  3.170   -6.484  1.00 0.00 ? 22  ARG A NE   3  
ATOM 4157  C CZ   . ARG A 1 22  ? 21.898  2.790   -7.314  1.00 0.00 ? 22  ARG A CZ   3  
ATOM 4158  N NH1  . ARG A 1 22  ? 20.690  3.365   -7.231  1.00 0.00 ? 22  ARG A NH1  3  
ATOM 4159  N NH2  . ARG A 1 22  ? 22.125  1.837   -8.228  1.00 0.00 ? 22  ARG A NH2  3  
ATOM 4160  H H    . ARG A 1 22  ? 24.887  7.076   -8.142  1.00 0.00 ? 22  ARG A H    3  
ATOM 4161  H HA   . ARG A 1 22  ? 23.501  8.038   -6.759  1.00 0.00 ? 22  ARG A HA   3  
ATOM 4162  H HB2  . ARG A 1 22  ? 24.745  5.830   -5.077  1.00 0.00 ? 22  ARG A HB2  3  
ATOM 4163  H HB3  . ARG A 1 22  ? 23.465  6.823   -4.407  1.00 0.00 ? 22  ARG A HB3  3  
ATOM 4164  H HG2  . ARG A 1 22  ? 21.877  6.101   -6.042  1.00 0.00 ? 22  ARG A HG2  3  
ATOM 4165  H HG3  . ARG A 1 22  ? 23.122  5.506   -7.123  1.00 0.00 ? 22  ARG A HG3  3  
ATOM 4166  H HD2  . ARG A 1 22  ? 23.492  4.085   -4.677  1.00 0.00 ? 22  ARG A HD2  3  
ATOM 4167  H HD3  . ARG A 1 22  ? 21.762  4.107   -4.950  1.00 0.00 ? 22  ARG A HD3  3  
ATOM 4168  H HE   . ARG A 1 22  ? 23.767  2.721   -6.572  1.00 0.00 ? 22  ARG A HE   3  
ATOM 4169  H HH11 . ARG A 1 22  ? 20.520  4.076   -6.550  1.00 0.00 ? 22  ARG A HH11 3  
ATOM 4170  H HH12 . ARG A 1 22  ? 19.958  3.081   -7.851  1.00 0.00 ? 22  ARG A HH12 3  
ATOM 4171  H HH21 . ARG A 1 22  ? 23.026  1.408   -8.290  1.00 0.00 ? 22  ARG A HH21 3  
ATOM 4172  H HH22 . ARG A 1 22  ? 21.393  1.554   -8.848  1.00 0.00 ? 22  ARG A HH22 3  
ATOM 4173  N N    . THR A 1 23  ? 24.922  9.924   -5.776  1.00 0.00 ? 23  THR A N    3  
ATOM 4174  C CA   . THR A 1 23  ? 25.494  11.034  -5.033  1.00 0.00 ? 23  THR A CA   3  
ATOM 4175  C C    . THR A 1 23  ? 24.527  11.501  -3.943  1.00 0.00 ? 23  THR A C    3  
ATOM 4176  O O    . THR A 1 23  ? 24.897  11.581  -2.773  1.00 0.00 ? 23  THR A O    3  
ATOM 4177  C CB   . THR A 1 23  ? 25.860  12.133  -6.032  1.00 0.00 ? 23  THR A CB   3  
ATOM 4178  O OG1  . THR A 1 23  ? 27.159  11.767  -6.491  1.00 0.00 ? 23  THR A OG1  3  
ATOM 4179  C CG2  . THR A 1 23  ? 26.072  13.490  -5.358  1.00 0.00 ? 23  THR A CG2  3  
ATOM 4180  H H    . THR A 1 23  ? 24.484  10.175  -6.640  1.00 0.00 ? 23  THR A H    3  
ATOM 4181  H HA   . THR A 1 23  ? 26.396  10.683  -4.532  1.00 0.00 ? 23  THR A HA   3  
ATOM 4182  H HB   . THR A 1 23  ? 25.115  12.203  -6.824  1.00 0.00 ? 23  THR A HB   3  
ATOM 4183  H HG1  . THR A 1 23  ? 27.108  11.429  -7.430  1.00 0.00 ? 23  THR A HG1  3  
ATOM 4184  H HG21 . THR A 1 23  ? 26.788  13.384  -4.544  1.00 0.00 ? 23  THR A HG21 3  
ATOM 4185  H HG22 . THR A 1 23  ? 26.455  14.203  -6.089  1.00 0.00 ? 23  THR A HG22 3  
ATOM 4186  H HG23 . THR A 1 23  ? 25.122  13.851  -4.962  1.00 0.00 ? 23  THR A HG23 3  
ATOM 4187  N N    . LEU A 1 24  ? 23.307  11.797  -4.366  1.00 0.00 ? 24  LEU A N    3  
ATOM 4188  C CA   . LEU A 1 24  ? 22.284  12.254  -3.441  1.00 0.00 ? 24  LEU A CA   3  
ATOM 4189  C C    . LEU A 1 24  ? 21.278  11.127  -3.202  1.00 0.00 ? 24  LEU A C    3  
ATOM 4190  O O    . LEU A 1 24  ? 21.067  10.284  -4.073  1.00 0.00 ? 24  LEU A O    3  
ATOM 4191  C CB   . LEU A 1 24  ? 21.647  13.551  -3.944  1.00 0.00 ? 24  LEU A CB   3  
ATOM 4192  C CG   . LEU A 1 24  ? 21.576  14.699  -2.936  1.00 0.00 ? 24  LEU A CG   3  
ATOM 4193  C CD1  . LEU A 1 24  ? 20.682  14.332  -1.749  1.00 0.00 ? 24  LEU A CD1  3  
ATOM 4194  C CD2  . LEU A 1 24  ? 22.977  15.123  -2.488  1.00 0.00 ? 24  LEU A CD2  3  
ATOM 4195  H H    . LEU A 1 24  ? 23.014  11.729  -5.320  1.00 0.00 ? 24  LEU A H    3  
ATOM 4196  H HA   . LEU A 1 24  ? 22.777  12.483  -2.496  1.00 0.00 ? 24  LEU A HA   3  
ATOM 4197  H HB2  . LEU A 1 24  ? 22.206  13.893  -4.816  1.00 0.00 ? 24  LEU A HB2  3  
ATOM 4198  H HB3  . LEU A 1 24  ? 20.635  13.328  -4.282  1.00 0.00 ? 24  LEU A HB3  3  
ATOM 4199  H HG   . LEU A 1 24  ? 21.122  15.559  -3.428  1.00 0.00 ? 24  LEU A HG   3  
ATOM 4200  H HD11 . LEU A 1 24  ? 19.931  13.611  -2.070  1.00 0.00 ? 24  LEU A HD11 3  
ATOM 4201  H HD12 . LEU A 1 24  ? 21.291  13.895  -0.957  1.00 0.00 ? 24  LEU A HD12 3  
ATOM 4202  H HD13 . LEU A 1 24  ? 20.189  15.229  -1.376  1.00 0.00 ? 24  LEU A HD13 3  
ATOM 4203  H HD21 . LEU A 1 24  ? 23.714  14.744  -3.196  1.00 0.00 ? 24  LEU A HD21 3  
ATOM 4204  H HD22 . LEU A 1 24  ? 23.033  16.211  -2.453  1.00 0.00 ? 24  LEU A HD22 3  
ATOM 4205  H HD23 . LEU A 1 24  ? 23.181  14.716  -1.498  1.00 0.00 ? 24  LEU A HD23 3  
ATOM 4206  N N    . ASP A 1 25  ? 20.684  11.148  -2.018  1.00 0.00 ? 25  ASP A N    3  
ATOM 4207  C CA   . ASP A 1 25  ? 19.705  10.138  -1.654  1.00 0.00 ? 25  ASP A CA   3  
ATOM 4208  C C    . ASP A 1 25  ? 18.316  10.776  -1.600  1.00 0.00 ? 25  ASP A C    3  
ATOM 4209  O O    . ASP A 1 25  ? 18.162  11.897  -1.117  1.00 0.00 ? 25  ASP A O    3  
ATOM 4210  C CB   . ASP A 1 25  ? 20.008  9.548   -0.276  1.00 0.00 ? 25  ASP A CB   3  
ATOM 4211  C CG   . ASP A 1 25  ? 21.372  8.865   -0.150  1.00 0.00 ? 25  ASP A CG   3  
ATOM 4212  O OD1  . ASP A 1 25  ? 21.494  7.740   -0.681  1.00 0.00 ? 25  ASP A OD1  3  
ATOM 4213  O OD2  . ASP A 1 25  ? 22.261  9.483   0.474   1.00 0.00 ? 25  ASP A OD2  3  
ATOM 4214  H H    . ASP A 1 25  ? 20.861  11.837  -1.316  1.00 0.00 ? 25  ASP A H    3  
ATOM 4215  H HA   . ASP A 1 25  ? 19.782  9.372   -2.427  1.00 0.00 ? 25  ASP A HA   3  
ATOM 4216  H HB2  . ASP A 1 25  ? 19.949  10.345  0.465   1.00 0.00 ? 25  ASP A HB2  3  
ATOM 4217  H HB3  . ASP A 1 25  ? 19.232  8.824   -0.028  1.00 0.00 ? 25  ASP A HB3  3  
ATOM 4218  N N    . ASP A 1 26  ? 17.339  10.036  -2.102  1.00 0.00 ? 26  ASP A N    3  
ATOM 4219  C CA   . ASP A 1 26  ? 15.967  10.516  -2.117  1.00 0.00 ? 26  ASP A CA   3  
ATOM 4220  C C    . ASP A 1 26  ? 15.020  9.333   -2.327  1.00 0.00 ? 26  ASP A C    3  
ATOM 4221  O O    . ASP A 1 26  ? 15.398  8.329   -2.928  1.00 0.00 ? 26  ASP A O    3  
ATOM 4222  C CB   . ASP A 1 26  ? 15.744  11.509  -3.259  1.00 0.00 ? 26  ASP A CB   3  
ATOM 4223  C CG   . ASP A 1 26  ? 16.859  11.554  -4.305  1.00 0.00 ? 26  ASP A CG   3  
ATOM 4224  O OD1  . ASP A 1 26  ? 17.899  12.176  -3.999  1.00 0.00 ? 26  ASP A OD1  3  
ATOM 4225  O OD2  . ASP A 1 26  ? 16.647  10.965  -5.387  1.00 0.00 ? 26  ASP A OD2  3  
ATOM 4226  H H    . ASP A 1 26  ? 17.472  9.125   -2.494  1.00 0.00 ? 26  ASP A H    3  
ATOM 4227  H HA   . ASP A 1 26  ? 15.823  10.999  -1.151  1.00 0.00 ? 26  ASP A HA   3  
ATOM 4228  H HB2  . ASP A 1 26  ? 14.807  11.260  -3.758  1.00 0.00 ? 26  ASP A HB2  3  
ATOM 4229  H HB3  . ASP A 1 26  ? 15.624  12.506  -2.835  1.00 0.00 ? 26  ASP A HB3  3  
ATOM 4230  N N    . VAL A 1 27  ? 13.806  9.491   -1.820  1.00 0.00 ? 27  VAL A N    3  
ATOM 4231  C CA   . VAL A 1 27  ? 12.801  8.449   -1.944  1.00 0.00 ? 27  VAL A CA   3  
ATOM 4232  C C    . VAL A 1 27  ? 12.831  7.885   -3.366  1.00 0.00 ? 27  VAL A C    3  
ATOM 4233  O O    . VAL A 1 27  ? 13.327  8.535   -4.285  1.00 0.00 ? 27  VAL A O    3  
ATOM 4234  C CB   . VAL A 1 27  ? 11.428  8.995   -1.547  1.00 0.00 ? 27  VAL A CB   3  
ATOM 4235  C CG1  . VAL A 1 27  ? 11.323  9.159   -0.029  1.00 0.00 ? 27  VAL A CG1  3  
ATOM 4236  C CG2  . VAL A 1 27  ? 11.135  10.315  -2.263  1.00 0.00 ? 27  VAL A CG2  3  
ATOM 4237  H H    . VAL A 1 27  ? 13.506  10.311  -1.333  1.00 0.00 ? 27  VAL A H    3  
ATOM 4238  H HA   . VAL A 1 27  ? 13.064  7.654   -1.246  1.00 0.00 ? 27  VAL A HA   3  
ATOM 4239  H HB   . VAL A 1 27  ? 10.676  8.270   -1.858  1.00 0.00 ? 27  VAL A HB   3  
ATOM 4240  H HG11 . VAL A 1 27  ? 11.238  10.218  0.217   1.00 0.00 ? 27  VAL A HG11 3  
ATOM 4241  H HG12 . VAL A 1 27  ? 10.441  8.630   0.333   1.00 0.00 ? 27  VAL A HG12 3  
ATOM 4242  H HG13 . VAL A 1 27  ? 12.214  8.747   0.444   1.00 0.00 ? 27  VAL A HG13 3  
ATOM 4243  H HG21 . VAL A 1 27  ? 10.588  10.978  -1.592  1.00 0.00 ? 27  VAL A HG21 3  
ATOM 4244  H HG22 . VAL A 1 27  ? 12.073  10.786  -2.555  1.00 0.00 ? 27  VAL A HG22 3  
ATOM 4245  H HG23 . VAL A 1 27  ? 10.534  10.120  -3.151  1.00 0.00 ? 27  VAL A HG23 3  
ATOM 4246  N N    . PRO A 1 28  ? 12.279  6.650   -3.507  1.00 0.00 ? 28  PRO A N    3  
ATOM 4247  C CA   . PRO A 1 28  ? 12.238  5.991   -4.801  1.00 0.00 ? 28  PRO A CA   3  
ATOM 4248  C C    . PRO A 1 28  ? 11.164  6.611   -5.698  1.00 0.00 ? 28  PRO A C    3  
ATOM 4249  O O    . PRO A 1 28  ? 10.286  7.326   -5.217  1.00 0.00 ? 28  PRO A O    3  
ATOM 4250  C CB   . PRO A 1 28  ? 11.978  4.527   -4.489  1.00 0.00 ? 28  PRO A CB   3  
ATOM 4251  C CG   . PRO A 1 28  ? 11.423  4.494   -3.074  1.00 0.00 ? 28  PRO A CG   3  
ATOM 4252  C CD   . PRO A 1 28  ? 11.682  5.851   -2.441  1.00 0.00 ? 28  PRO A CD   3  
ATOM 4253  H HA   . PRO A 1 28  ? 13.104  6.120   -5.284  1.00 0.00 ? 28  PRO A HA   3  
ATOM 4254  H HB2  . PRO A 1 28  ? 11.269  4.096   -5.197  1.00 0.00 ? 28  PRO A HB2  3  
ATOM 4255  H HB3  . PRO A 1 28  ? 12.895  3.943   -4.563  1.00 0.00 ? 28  PRO A HB3  3  
ATOM 4256  H HG2  . PRO A 1 28  ? 10.355  4.276   -3.088  1.00 0.00 ? 28  PRO A HG2  3  
ATOM 4257  H HG3  . PRO A 1 28  ? 11.902  3.705   -2.495  1.00 0.00 ? 28  PRO A HG3  3  
ATOM 4258  H HD2  . PRO A 1 28  ? 10.758  6.302   -2.078  1.00 0.00 ? 28  PRO A HD2  3  
ATOM 4259  H HD3  . PRO A 1 28  ? 12.352  5.768   -1.585  1.00 0.00 ? 28  PRO A HD3  3  
ATOM 4260  N N    . GLY A 1 29  ? 11.269  6.314   -6.985  1.00 0.00 ? 29  GLY A N    3  
ATOM 4261  C CA   . GLY A 1 29  ? 10.318  6.833   -7.953  1.00 0.00 ? 29  GLY A CA   3  
ATOM 4262  C C    . GLY A 1 29  ? 9.011   6.038   -7.918  1.00 0.00 ? 29  GLY A C    3  
ATOM 4263  O O    . GLY A 1 29  ? 8.827   5.177   -7.060  1.00 0.00 ? 29  GLY A O    3  
ATOM 4264  H H    . GLY A 1 29  ? 11.986  5.732   -7.367  1.00 0.00 ? 29  GLY A H    3  
ATOM 4265  H HA2  . GLY A 1 29  ? 10.114  7.883   -7.741  1.00 0.00 ? 29  GLY A HA2  3  
ATOM 4266  H HA3  . GLY A 1 29  ? 10.749  6.788   -8.952  1.00 0.00 ? 29  GLY A HA3  3  
ATOM 4267  N N    . PRO A 1 30  ? 8.114   6.364   -8.887  1.00 0.00 ? 30  PRO A N    3  
ATOM 4268  C CA   . PRO A 1 30  ? 6.830   5.690   -8.976  1.00 0.00 ? 30  PRO A CA   3  
ATOM 4269  C C    . PRO A 1 30  ? 6.989   4.280   -9.549  1.00 0.00 ? 30  PRO A C    3  
ATOM 4270  O O    . PRO A 1 30  ? 7.770   4.067   -10.475 1.00 0.00 ? 30  PRO A O    3  
ATOM 4271  C CB   . PRO A 1 30  ? 5.972   6.592   -9.848  1.00 0.00 ? 30  PRO A CB   3  
ATOM 4272  C CG   . PRO A 1 30  ? 6.940   7.495   -10.593 1.00 0.00 ? 30  PRO A CG   3  
ATOM 4273  C CD   . PRO A 1 30  ? 8.298   7.379   -9.921  1.00 0.00 ? 30  PRO A CD   3  
ATOM 4274  H HA   . PRO A 1 30  ? 6.437   5.572   -8.064  1.00 0.00 ? 30  PRO A HA   3  
ATOM 4275  H HB2  . PRO A 1 30  ? 5.371   6.006   -10.543 1.00 0.00 ? 30  PRO A HB2  3  
ATOM 4276  H HB3  . PRO A 1 30  ? 5.279   7.176   -9.242  1.00 0.00 ? 30  PRO A HB3  3  
ATOM 4277  H HG2  . PRO A 1 30  ? 7.007   7.202   -11.641 1.00 0.00 ? 30  PRO A HG2  3  
ATOM 4278  H HG3  . PRO A 1 30  ? 6.592   8.528   -10.573 1.00 0.00 ? 30  PRO A HG3  3  
ATOM 4279  H HD2  . PRO A 1 30  ? 9.069   7.083   -10.633 1.00 0.00 ? 30  PRO A HD2  3  
ATOM 4280  H HD3  . PRO A 1 30  ? 8.610   8.330   -9.490  1.00 0.00 ? 30  PRO A HD3  3  
ATOM 4281  N N    . PRO A 1 31  ? 6.217   3.329   -8.958  1.00 0.00 ? 31  PRO A N    3  
ATOM 4282  C CA   . PRO A 1 31  ? 6.264   1.946   -9.400  1.00 0.00 ? 31  PRO A CA   3  
ATOM 4283  C C    . PRO A 1 31  ? 5.527   1.769   -10.729 1.00 0.00 ? 31  PRO A C    3  
ATOM 4284  O O    . PRO A 1 31  ? 4.303   1.879   -10.783 1.00 0.00 ? 31  PRO A O    3  
ATOM 4285  C CB   . PRO A 1 31  ? 5.642   1.149   -8.265  1.00 0.00 ? 31  PRO A CB   3  
ATOM 4286  C CG   . PRO A 1 31  ? 4.851   2.149   -7.438  1.00 0.00 ? 31  PRO A CG   3  
ATOM 4287  C CD   . PRO A 1 31  ? 5.281   3.545   -7.859  1.00 0.00 ? 31  PRO A CD   3  
ATOM 4288  H HA   . PRO A 1 31  ? 7.210   1.669   -9.572  1.00 0.00 ? 31  PRO A HA   3  
ATOM 4289  H HB2  . PRO A 1 31  ? 4.994   0.361   -8.650  1.00 0.00 ? 31  PRO A HB2  3  
ATOM 4290  H HB3  . PRO A 1 31  ? 6.409   0.664   -7.661  1.00 0.00 ? 31  PRO A HB3  3  
ATOM 4291  H HG2  . PRO A 1 31  ? 3.781   2.015   -7.597  1.00 0.00 ? 31  PRO A HG2  3  
ATOM 4292  H HG3  . PRO A 1 31  ? 5.036   1.997   -6.374  1.00 0.00 ? 31  PRO A HG3  3  
ATOM 4293  H HD2  . PRO A 1 31  ? 4.427   4.143   -8.177  1.00 0.00 ? 31  PRO A HD2  3  
ATOM 4294  H HD3  . PRO A 1 31  ? 5.754   4.079   -7.035  1.00 0.00 ? 31  PRO A HD3  3  
ATOM 4295  N N    . MET A 1 32  ? 6.303   1.497   -11.768 1.00 0.00 ? 32  MET A N    3  
ATOM 4296  C CA   . MET A 1 32  ? 5.740   1.303   -13.093 1.00 0.00 ? 32  MET A CA   3  
ATOM 4297  C C    . MET A 1 32  ? 5.453   -0.176  -13.356 1.00 0.00 ? 32  MET A C    3  
ATOM 4298  O O    . MET A 1 32  ? 5.986   -1.047  -12.670 1.00 0.00 ? 32  MET A O    3  
ATOM 4299  C CB   . MET A 1 32  ? 6.717   1.829   -14.145 1.00 0.00 ? 32  MET A CB   3  
ATOM 4300  C CG   . MET A 1 32  ? 8.074   1.131   -14.030 1.00 0.00 ? 32  MET A CG   3  
ATOM 4301  S SD   . MET A 1 32  ? 8.976   1.292   -15.562 1.00 0.00 ? 32  MET A SD   3  
ATOM 4302  C CE   . MET A 1 32  ? 10.621  0.892   -14.998 1.00 0.00 ? 32  MET A CE   3  
ATOM 4303  H H    . MET A 1 32  ? 7.298   1.409   -11.714 1.00 0.00 ? 32  MET A H    3  
ATOM 4304  H HA   . MET A 1 32  ? 4.807   1.868   -13.099 1.00 0.00 ? 32  MET A HA   3  
ATOM 4305  H HB2  . MET A 1 32  ? 6.306   1.669   -15.142 1.00 0.00 ? 32  MET A HB2  3  
ATOM 4306  H HB3  . MET A 1 32  ? 6.846   2.905   -14.023 1.00 0.00 ? 32  MET A HB3  3  
ATOM 4307  H HG2  . MET A 1 32  ? 8.649   1.568   -13.213 1.00 0.00 ? 32  MET A HG2  3  
ATOM 4308  H HG3  . MET A 1 32  ? 7.932   0.078   -13.791 1.00 0.00 ? 32  MET A HG3  3  
ATOM 4309  H HE1  . MET A 1 32  ? 11.004  0.045   -15.566 1.00 0.00 ? 32  MET A HE1  3  
ATOM 4310  H HE2  . MET A 1 32  ? 11.274  1.753   -15.143 1.00 0.00 ? 32  MET A HE2  3  
ATOM 4311  H HE3  . MET A 1 32  ? 10.589  0.635   -13.939 1.00 0.00 ? 32  MET A HE3  3  
ATOM 4312  N N    . GLY A 1 33  ? 4.611   -0.415  -14.351 1.00 0.00 ? 33  GLY A N    3  
ATOM 4313  C CA   . GLY A 1 33  ? 4.246   -1.774  -14.713 1.00 0.00 ? 33  GLY A CA   3  
ATOM 4314  C C    . GLY A 1 33  ? 3.062   -2.265  -13.878 1.00 0.00 ? 33  GLY A C    3  
ATOM 4315  O O    . GLY A 1 33  ? 3.111   -3.352  -13.304 1.00 0.00 ? 33  GLY A O    3  
ATOM 4316  H H    . GLY A 1 33  ? 4.181   0.299   -14.903 1.00 0.00 ? 33  GLY A H    3  
ATOM 4317  H HA2  . GLY A 1 33  ? 3.992   -1.816  -15.772 1.00 0.00 ? 33  GLY A HA2  3  
ATOM 4318  H HA3  . GLY A 1 33  ? 5.100   -2.435  -14.564 1.00 0.00 ? 33  GLY A HA3  3  
ATOM 4319  N N    . ILE A 1 34  ? 2.026   -1.441  -13.836 1.00 0.00 ? 34  ILE A N    3  
ATOM 4320  C CA   . ILE A 1 34  ? 0.831   -1.777  -13.081 1.00 0.00 ? 34  ILE A CA   3  
ATOM 4321  C C    . ILE A 1 34  ? -0.188  -2.435  -14.014 1.00 0.00 ? 34  ILE A C    3  
ATOM 4322  O O    . ILE A 1 34  ? -0.618  -1.829  -14.995 1.00 0.00 ? 34  ILE A O    3  
ATOM 4323  C CB   . ILE A 1 34  ? 0.292   -0.545  -12.353 1.00 0.00 ? 34  ILE A CB   3  
ATOM 4324  C CG1  . ILE A 1 34  ? 1.436   0.318   -11.815 1.00 0.00 ? 34  ILE A CG1  3  
ATOM 4325  C CG2  . ILE A 1 34  ? -0.691  -0.945  -11.251 1.00 0.00 ? 34  ILE A CG2  3  
ATOM 4326  C CD1  . ILE A 1 34  ? 2.368   -0.502  -10.921 1.00 0.00 ? 34  ILE A CD1  3  
ATOM 4327  H H    . ILE A 1 34  ? 1.995   -0.558  -14.306 1.00 0.00 ? 34  ILE A H    3  
ATOM 4328  H HA   . ILE A 1 34  ? 1.120   -2.502  -12.319 1.00 0.00 ? 34  ILE A HA   3  
ATOM 4329  H HB   . ILE A 1 34  ? -0.259  0.063   -13.071 1.00 0.00 ? 34  ILE A HB   3  
ATOM 4330  H HG12 . ILE A 1 34  ? 2.002   0.738   -12.647 1.00 0.00 ? 34  ILE A HG12 3  
ATOM 4331  H HG13 . ILE A 1 34  ? 1.029   1.157   -11.250 1.00 0.00 ? 34  ILE A HG13 3  
ATOM 4332  H HG21 . ILE A 1 34  ? -0.641  -0.219  -10.439 1.00 0.00 ? 34  ILE A HG21 3  
ATOM 4333  H HG22 . ILE A 1 34  ? -1.702  -0.967  -11.657 1.00 0.00 ? 34  ILE A HG22 3  
ATOM 4334  H HG23 . ILE A 1 34  ? -0.429  -1.933  -10.872 1.00 0.00 ? 34  ILE A HG23 3  
ATOM 4335  H HD11 . ILE A 1 34  ? 2.442   -0.029  -9.942  1.00 0.00 ? 34  ILE A HD11 3  
ATOM 4336  H HD12 . ILE A 1 34  ? 1.968   -1.510  -10.807 1.00 0.00 ? 34  ILE A HD12 3  
ATOM 4337  H HD13 . ILE A 1 34  ? 3.357   -0.553  -11.376 1.00 0.00 ? 34  ILE A HD13 3  
ATOM 4338  N N    . LEU A 1 35  ? -0.545  -3.665  -13.676 1.00 0.00 ? 35  LEU A N    3  
ATOM 4339  C CA   . LEU A 1 35  ? -1.506  -4.411  -14.471 1.00 0.00 ? 35  LEU A CA   3  
ATOM 4340  C C    . LEU A 1 35  ? -2.399  -5.236  -13.542 1.00 0.00 ? 35  LEU A C    3  
ATOM 4341  O O    . LEU A 1 35  ? -1.977  -5.625  -12.454 1.00 0.00 ? 35  LEU A O    3  
ATOM 4342  C CB   . LEU A 1 35  ? -0.789  -5.244  -15.535 1.00 0.00 ? 35  LEU A CB   3  
ATOM 4343  C CG   . LEU A 1 35  ? 0.038   -4.460  -16.556 1.00 0.00 ? 35  LEU A CG   3  
ATOM 4344  C CD1  . LEU A 1 35  ? 0.935   -5.395  -17.370 1.00 0.00 ? 35  LEU A CD1  3  
ATOM 4345  C CD2  . LEU A 1 35  ? -0.863  -3.606  -17.451 1.00 0.00 ? 35  LEU A CD2  3  
ATOM 4346  H H    . LEU A 1 35  ? -0.191  -4.150  -12.876 1.00 0.00 ? 35  LEU A H    3  
ATOM 4347  H HA   . LEU A 1 35  ? -2.129  -3.686  -14.995 1.00 0.00 ? 35  LEU A HA   3  
ATOM 4348  H HB2  . LEU A 1 35  ? -0.131  -5.952  -15.031 1.00 0.00 ? 35  LEU A HB2  3  
ATOM 4349  H HB3  . LEU A 1 35  ? -1.534  -5.829  -16.073 1.00 0.00 ? 35  LEU A HB3  3  
ATOM 4350  H HG   . LEU A 1 35  ? 0.693   -3.777  -16.014 1.00 0.00 ? 35  LEU A HG   3  
ATOM 4351  H HD11 . LEU A 1 35  ? 1.754   -4.824  -17.806 1.00 0.00 ? 35  LEU A HD11 3  
ATOM 4352  H HD12 . LEU A 1 35  ? 1.338   -6.170  -16.718 1.00 0.00 ? 35  LEU A HD12 3  
ATOM 4353  H HD13 . LEU A 1 35  ? 0.350   -5.857  -18.165 1.00 0.00 ? 35  LEU A HD13 3  
ATOM 4354  H HD21 . LEU A 1 35  ? -0.357  -2.671  -17.689 1.00 0.00 ? 35  LEU A HD21 3  
ATOM 4355  H HD22 . LEU A 1 35  ? -1.077  -4.148  -18.372 1.00 0.00 ? 35  LEU A HD22 3  
ATOM 4356  H HD23 . LEU A 1 35  ? -1.796  -3.393  -16.930 1.00 0.00 ? 35  LEU A HD23 3  
ATOM 4357  N N    . PHE A 1 36  ? -3.616  -5.479  -14.005 1.00 0.00 ? 36  PHE A N    3  
ATOM 4358  C CA   . PHE A 1 36  ? -4.572  -6.251  -13.230 1.00 0.00 ? 36  PHE A CA   3  
ATOM 4359  C C    . PHE A 1 36  ? -4.911  -7.567  -13.931 1.00 0.00 ? 36  PHE A C    3  
ATOM 4360  O O    . PHE A 1 36  ? -5.831  -7.621  -14.747 1.00 0.00 ? 36  PHE A O    3  
ATOM 4361  C CB   . PHE A 1 36  ? -5.842  -5.405  -13.115 1.00 0.00 ? 36  PHE A CB   3  
ATOM 4362  C CG   . PHE A 1 36  ? -5.712  -4.214  -12.164 1.00 0.00 ? 36  PHE A CG   3  
ATOM 4363  C CD1  . PHE A 1 36  ? -6.003  -4.363  -10.843 1.00 0.00 ? 36  PHE A CD1  3  
ATOM 4364  C CD2  . PHE A 1 36  ? -5.306  -3.006  -12.638 1.00 0.00 ? 36  PHE A CD2  3  
ATOM 4365  C CE1  . PHE A 1 36  ? -5.883  -3.258  -9.961  1.00 0.00 ? 36  PHE A CE1  3  
ATOM 4366  C CE2  . PHE A 1 36  ? -5.186  -1.900  -11.755 1.00 0.00 ? 36  PHE A CE2  3  
ATOM 4367  C CZ   . PHE A 1 36  ? -5.477  -2.049  -10.435 1.00 0.00 ? 36  PHE A CZ   3  
ATOM 4368  H H    . PHE A 1 36  ? -3.951  -5.159  -14.891 1.00 0.00 ? 36  PHE A H    3  
ATOM 4369  H HA   . PHE A 1 36  ? -4.109  -6.464  -12.266 1.00 0.00 ? 36  PHE A HA   3  
ATOM 4370  H HB2  . PHE A 1 36  ? -6.113  -5.039  -14.105 1.00 0.00 ? 36  PHE A HB2  3  
ATOM 4371  H HB3  . PHE A 1 36  ? -6.660  -6.041  -12.775 1.00 0.00 ? 36  PHE A HB3  3  
ATOM 4372  H HD1  . PHE A 1 36  ? -6.328  -5.332  -10.463 1.00 0.00 ? 36  PHE A HD1  3  
ATOM 4373  H HD2  . PHE A 1 36  ? -5.074  -2.886  -13.696 1.00 0.00 ? 36  PHE A HD2  3  
ATOM 4374  H HE1  . PHE A 1 36  ? -6.116  -3.377  -8.903  1.00 0.00 ? 36  PHE A HE1  3  
ATOM 4375  H HE2  . PHE A 1 36  ? -4.861  -0.932  -12.136 1.00 0.00 ? 36  PHE A HE2  3  
ATOM 4376  H HZ   . PHE A 1 36  ? -5.385  -1.201  -9.758  1.00 0.00 ? 36  PHE A HZ   3  
ATOM 4377  N N    . PRO A 1 37  ? -4.131  -8.624  -13.580 1.00 0.00 ? 37  PRO A N    3  
ATOM 4378  C CA   . PRO A 1 37  ? -4.340  -9.937  -14.167 1.00 0.00 ? 37  PRO A CA   3  
ATOM 4379  C C    . PRO A 1 37  ? -5.579  -10.611 -13.575 1.00 0.00 ? 37  PRO A C    3  
ATOM 4380  O O    . PRO A 1 37  ? -6.432  -11.106 -14.311 1.00 0.00 ? 37  PRO A O    3  
ATOM 4381  C CB   . PRO A 1 37  ? -3.057  -10.702 -13.887 1.00 0.00 ? 37  PRO A CB   3  
ATOM 4382  C CG   . PRO A 1 37  ? -2.365  -9.956  -12.758 1.00 0.00 ? 37  PRO A CG   3  
ATOM 4383  C CD   . PRO A 1 37  ? -3.033  -8.598  -12.618 1.00 0.00 ? 37  PRO A CD   3  
ATOM 4384  H HA   . PRO A 1 37  ? -4.515  -9.854  -15.148 1.00 0.00 ? 37  PRO A HA   3  
ATOM 4385  H HB2  . PRO A 1 37  ? -3.270  -11.732 -13.601 1.00 0.00 ? 37  PRO A HB2  3  
ATOM 4386  H HB3  . PRO A 1 37  ? -2.424  -10.742 -14.773 1.00 0.00 ? 37  PRO A HB3  3  
ATOM 4387  H HG2  . PRO A 1 37  ? -2.441  -10.516 -11.826 1.00 0.00 ? 37  PRO A HG2  3  
ATOM 4388  H HG3  . PRO A 1 37  ? -1.302  -9.838  -12.972 1.00 0.00 ? 37  PRO A HG3  3  
ATOM 4389  H HD2  . PRO A 1 37  ? -3.399  -8.439  -11.604 1.00 0.00 ? 37  PRO A HD2  3  
ATOM 4390  H HD3  . PRO A 1 37  ? -2.335  -7.789  -12.835 1.00 0.00 ? 37  PRO A HD3  3  
ATOM 4391  N N    . GLU A 1 38  ? -5.640  -10.609 -12.252 1.00 0.00 ? 38  GLU A N    3  
ATOM 4392  C CA   . GLU A 1 38  ? -6.760  -11.215 -11.553 1.00 0.00 ? 38  GLU A CA   3  
ATOM 4393  C C    . GLU A 1 38  ? -7.571  -10.143 -10.821 1.00 0.00 ? 38  GLU A C    3  
ATOM 4394  O O    . GLU A 1 38  ? -7.055  -9.471  -9.929  1.00 0.00 ? 38  GLU A O    3  
ATOM 4395  C CB   . GLU A 1 38  ? -6.282  -12.298 -10.584 1.00 0.00 ? 38  GLU A CB   3  
ATOM 4396  C CG   . GLU A 1 38  ? -7.386  -12.674 -9.594  1.00 0.00 ? 38  GLU A CG   3  
ATOM 4397  C CD   . GLU A 1 38  ? -6.875  -13.676 -8.557  1.00 0.00 ? 38  GLU A CD   3  
ATOM 4398  O OE1  . GLU A 1 38  ? -6.441  -14.767 -8.987  1.00 0.00 ? 38  GLU A OE1  3  
ATOM 4399  O OE2  . GLU A 1 38  ? -6.929  -13.329 -7.357  1.00 0.00 ? 38  GLU A OE2  3  
ATOM 4400  H H    . GLU A 1 38  ? -4.942  -10.205 -11.661 1.00 0.00 ? 38  GLU A H    3  
ATOM 4401  H HA   . GLU A 1 38  ? -7.372  -11.675 -12.330 1.00 0.00 ? 38  GLU A HA   3  
ATOM 4402  H HB2  . GLU A 1 38  ? -5.974  -13.181 -11.143 1.00 0.00 ? 38  GLU A HB2  3  
ATOM 4403  H HB3  . GLU A 1 38  ? -5.407  -11.943 -10.040 1.00 0.00 ? 38  GLU A HB3  3  
ATOM 4404  H HG2  . GLU A 1 38  ? -7.749  -11.778 -9.091  1.00 0.00 ? 38  GLU A HG2  3  
ATOM 4405  H HG3  . GLU A 1 38  ? -8.232  -13.102 -10.132 1.00 0.00 ? 38  GLU A HG3  3  
ATOM 4406  N N    . VAL A 1 39  ? -8.826  -10.017 -11.225 1.00 0.00 ? 39  VAL A N    3  
ATOM 4407  C CA   . VAL A 1 39  ? -9.713  -9.038  -10.619 1.00 0.00 ? 39  VAL A CA   3  
ATOM 4408  C C    . VAL A 1 39  ? -11.109 -9.646  -10.467 1.00 0.00 ? 39  VAL A C    3  
ATOM 4409  O O    . VAL A 1 39  ? -11.735 -10.027 -11.455 1.00 0.00 ? 39  VAL A O    3  
ATOM 4410  C CB   . VAL A 1 39  ? -9.709  -7.748  -11.441 1.00 0.00 ? 39  VAL A CB   3  
ATOM 4411  C CG1  . VAL A 1 39  ? -10.754 -6.761  -10.917 1.00 0.00 ? 39  VAL A CG1  3  
ATOM 4412  C CG2  . VAL A 1 39  ? -8.317  -7.114  -11.460 1.00 0.00 ? 39  VAL A CG2  3  
ATOM 4413  H H    . VAL A 1 39  ? -9.238  -10.567 -11.951 1.00 0.00 ? 39  VAL A H    3  
ATOM 4414  H HA   . VAL A 1 39  ? -9.321  -8.809  -9.628  1.00 0.00 ? 39  VAL A HA   3  
ATOM 4415  H HB   . VAL A 1 39  ? -9.974  -8.004  -12.467 1.00 0.00 ? 39  VAL A HB   3  
ATOM 4416  H HG11 . VAL A 1 39  ? -11.203 -6.228  -11.755 1.00 0.00 ? 39  VAL A HG11 3  
ATOM 4417  H HG12 . VAL A 1 39  ? -11.528 -7.305  -10.376 1.00 0.00 ? 39  VAL A HG12 3  
ATOM 4418  H HG13 . VAL A 1 39  ? -10.275 -6.047  -10.247 1.00 0.00 ? 39  VAL A HG13 3  
ATOM 4419  H HG21 . VAL A 1 39  ? -7.890  -7.146  -10.458 1.00 0.00 ? 39  VAL A HG21 3  
ATOM 4420  H HG22 . VAL A 1 39  ? -7.675  -7.667  -12.146 1.00 0.00 ? 39  VAL A HG22 3  
ATOM 4421  H HG23 . VAL A 1 39  ? -8.394  -6.078  -11.789 1.00 0.00 ? 39  VAL A HG23 3  
ATOM 4422  N N    . ARG A 1 40  ? -11.556 -9.718  -9.222  1.00 0.00 ? 40  ARG A N    3  
ATOM 4423  C CA   . ARG A 1 40  ? -12.866 -10.274 -8.928  1.00 0.00 ? 40  ARG A CA   3  
ATOM 4424  C C    . ARG A 1 40  ? -13.842 -9.158  -8.547  1.00 0.00 ? 40  ARG A C    3  
ATOM 4425  O O    . ARG A 1 40  ? -13.562 -7.981  -8.769  1.00 0.00 ? 40  ARG A O    3  
ATOM 4426  C CB   . ARG A 1 40  ? -12.791 -11.288 -7.786  1.00 0.00 ? 40  ARG A CB   3  
ATOM 4427  C CG   . ARG A 1 40  ? -11.508 -12.117 -7.872  1.00 0.00 ? 40  ARG A CG   3  
ATOM 4428  C CD   . ARG A 1 40  ? -11.488 -12.965 -9.146  1.00 0.00 ? 40  ARG A CD   3  
ATOM 4429  N NE   . ARG A 1 40  ? -10.298 -13.845 -9.149  1.00 0.00 ? 40  ARG A NE   3  
ATOM 4430  C CZ   . ARG A 1 40  ? -10.193 -14.964 -9.878  1.00 0.00 ? 40  ARG A CZ   3  
ATOM 4431  N NH1  . ARG A 1 40  ? -11.207 -15.347 -10.667 1.00 0.00 ? 40  ARG A NH1  3  
ATOM 4432  N NH2  . ARG A 1 40  ? -9.075  -15.701 -9.819  1.00 0.00 ? 40  ARG A NH2  3  
ATOM 4433  H H    . ARG A 1 40  ? -11.041 -9.406  -8.424  1.00 0.00 ? 40  ARG A H    3  
ATOM 4434  H HA   . ARG A 1 40  ? -13.174 -10.766 -9.851  1.00 0.00 ? 40  ARG A HA   3  
ATOM 4435  H HB2  . ARG A 1 40  ? -12.828 -10.767 -6.829  1.00 0.00 ? 40  ARG A HB2  3  
ATOM 4436  H HB3  . ARG A 1 40  ? -13.658 -11.948 -7.823  1.00 0.00 ? 40  ARG A HB3  3  
ATOM 4437  H HG2  . ARG A 1 40  ? -10.642 -11.456 -7.857  1.00 0.00 ? 40  ARG A HG2  3  
ATOM 4438  H HG3  . ARG A 1 40  ? -11.430 -12.765 -6.999  1.00 0.00 ? 40  ARG A HG3  3  
ATOM 4439  H HD2  . ARG A 1 40  ? -12.395 -13.566 -9.207  1.00 0.00 ? 40  ARG A HD2  3  
ATOM 4440  H HD3  . ARG A 1 40  ? -11.474 -12.318 -10.023 1.00 0.00 ? 40  ARG A HD3  3  
ATOM 4441  H HE   . ARG A 1 40  ? -9.523  -13.588 -8.571  1.00 0.00 ? 40  ARG A HE   3  
ATOM 4442  H HH11 . ARG A 1 40  ? -12.041 -14.797 -10.711 1.00 0.00 ? 40  ARG A HH11 3  
ATOM 4443  H HH12 . ARG A 1 40  ? -11.129 -16.182 -11.211 1.00 0.00 ? 40  ARG A HH12 3  
ATOM 4444  H HH21 . ARG A 1 40  ? -8.319  -15.415 -9.230  1.00 0.00 ? 40  ARG A HH21 3  
ATOM 4445  H HH22 . ARG A 1 40  ? -8.997  -16.536 -10.363 1.00 0.00 ? 40  ARG A HH22 3  
ATOM 4446  N N    . THR A 1 41  ? -14.967 -9.568  -7.981  1.00 0.00 ? 41  THR A N    3  
ATOM 4447  C CA   . THR A 1 41  ? -15.986 -8.618  -7.567  1.00 0.00 ? 41  THR A CA   3  
ATOM 4448  C C    . THR A 1 41  ? -15.595 -7.960  -6.242  1.00 0.00 ? 41  THR A C    3  
ATOM 4449  O O    . THR A 1 41  ? -15.184 -6.802  -6.218  1.00 0.00 ? 41  THR A O    3  
ATOM 4450  C CB   . THR A 1 41  ? -17.325 -9.357  -7.507  1.00 0.00 ? 41  THR A CB   3  
ATOM 4451  O OG1  . THR A 1 41  ? -16.974 -10.726 -7.685  1.00 0.00 ? 41  THR A OG1  3  
ATOM 4452  C CG2  . THR A 1 41  ? -18.221 -9.043  -8.706  1.00 0.00 ? 41  THR A CG2  3  
ATOM 4453  H H    . THR A 1 41  ? -15.187 -10.528 -7.804  1.00 0.00 ? 41  THR A H    3  
ATOM 4454  H HA   . THR A 1 41  ? -16.041 -7.826  -8.313  1.00 0.00 ? 41  THR A HA   3  
ATOM 4455  H HB   . THR A 1 41  ? -17.841 -9.150  -6.570  1.00 0.00 ? 41  THR A HB   3  
ATOM 4456  H HG1  . THR A 1 41  ? -16.814 -10.915 -8.654  1.00 0.00 ? 41  THR A HG1  3  
ATOM 4457  H HG21 . THR A 1 41  ? -17.749 -8.276  -9.322  1.00 0.00 ? 41  THR A HG21 3  
ATOM 4458  H HG22 . THR A 1 41  ? -18.365 -9.946  -9.299  1.00 0.00 ? 41  THR A HG22 3  
ATOM 4459  H HG23 . THR A 1 41  ? -19.187 -8.682  -8.353  1.00 0.00 ? 41  THR A HG23 3  
ATOM 4460  N N    . THR A 1 42  ? -15.738 -8.729  -5.172  1.00 0.00 ? 42  THR A N    3  
ATOM 4461  C CA   . THR A 1 42  ? -15.405 -8.235  -3.847  1.00 0.00 ? 42  THR A CA   3  
ATOM 4462  C C    . THR A 1 42  ? -13.940 -8.532  -3.519  1.00 0.00 ? 42  THR A C    3  
ATOM 4463  O O    . THR A 1 42  ? -13.583 -8.705  -2.355  1.00 0.00 ? 42  THR A O    3  
ATOM 4464  C CB   . THR A 1 42  ? -16.387 -8.854  -2.851  1.00 0.00 ? 42  THR A CB   3  
ATOM 4465  O OG1  . THR A 1 42  ? -16.117 -10.252 -2.920  1.00 0.00 ? 42  THR A OG1  3  
ATOM 4466  C CG2  . THR A 1 42  ? -17.842 -8.732  -3.310  1.00 0.00 ? 42  THR A CG2  3  
ATOM 4467  H H    . THR A 1 42  ? -16.073 -9.670  -5.200  1.00 0.00 ? 42  THR A H    3  
ATOM 4468  H HA   . THR A 1 42  ? -15.519 -7.151  -3.845  1.00 0.00 ? 42  THR A HA   3  
ATOM 4469  H HB   . THR A 1 42  ? -16.256 -8.426  -1.857  1.00 0.00 ? 42  THR A HB   3  
ATOM 4470  H HG1  . THR A 1 42  ? -16.678 -10.742 -2.253  1.00 0.00 ? 42  THR A HG1  3  
ATOM 4471  H HG21 . THR A 1 42  ? -18.304 -9.719  -3.318  1.00 0.00 ? 42  THR A HG21 3  
ATOM 4472  H HG22 . THR A 1 42  ? -18.385 -8.082  -2.625  1.00 0.00 ? 42  THR A HG22 3  
ATOM 4473  H HG23 . THR A 1 42  ? -17.871 -8.309  -4.314  1.00 0.00 ? 42  THR A HG23 3  
ATOM 4474  N N    . SER A 1 43  ? -13.131 -8.581  -4.568  1.00 0.00 ? 43  SER A N    3  
ATOM 4475  C CA   . SER A 1 43  ? -11.713 -8.854  -4.406  1.00 0.00 ? 43  SER A CA   3  
ATOM 4476  C C    . SER A 1 43  ? -11.003 -8.746  -5.757  1.00 0.00 ? 43  SER A C    3  
ATOM 4477  O O    . SER A 1 43  ? -11.619 -8.942  -6.804  1.00 0.00 ? 43  SER A O    3  
ATOM 4478  C CB   . SER A 1 43  ? -11.484 -10.237 -3.795  1.00 0.00 ? 43  SER A CB   3  
ATOM 4479  O OG   . SER A 1 43  ? -10.167 -10.720 -4.045  1.00 0.00 ? 43  SER A OG   3  
ATOM 4480  H H    . SER A 1 43  ? -13.429 -8.438  -5.511  1.00 0.00 ? 43  SER A H    3  
ATOM 4481  H HA   . SER A 1 43  ? -11.348 -8.089  -3.721  1.00 0.00 ? 43  SER A HA   3  
ATOM 4482  H HB2  . SER A 1 43  ? -11.655 -10.191 -2.719  1.00 0.00 ? 43  SER A HB2  3  
ATOM 4483  H HB3  . SER A 1 43  ? -12.212 -10.939 -4.203  1.00 0.00 ? 43  SER A HB3  3  
ATOM 4484  H HG   . SER A 1 43  ? -10.195 -11.455 -4.723  1.00 0.00 ? 43  SER A HG   3  
ATOM 4485  N N    . VAL A 1 44  ? -9.716  -8.436  -5.690  1.00 0.00 ? 44  VAL A N    3  
ATOM 4486  C CA   . VAL A 1 44  ? -8.915  -8.301  -6.895  1.00 0.00 ? 44  VAL A CA   3  
ATOM 4487  C C    . VAL A 1 44  ? -7.457  -8.631  -6.573  1.00 0.00 ? 44  VAL A C    3  
ATOM 4488  O O    . VAL A 1 44  ? -7.111  -8.866  -5.416  1.00 0.00 ? 44  VAL A O    3  
ATOM 4489  C CB   . VAL A 1 44  ? -9.095  -6.902  -7.488  1.00 0.00 ? 44  VAL A CB   3  
ATOM 4490  C CG1  . VAL A 1 44  ? -10.571 -6.501  -7.512  1.00 0.00 ? 44  VAL A CG1  3  
ATOM 4491  C CG2  . VAL A 1 44  ? -8.259  -5.872  -6.725  1.00 0.00 ? 44  VAL A CG2  3  
ATOM 4492  H H    . VAL A 1 44  ? -9.223  -8.279  -4.835  1.00 0.00 ? 44  VAL A H    3  
ATOM 4493  H HA   . VAL A 1 44  ? -9.287  -9.025  -7.620  1.00 0.00 ? 44  VAL A HA   3  
ATOM 4494  H HB   . VAL A 1 44  ? -8.738  -6.926  -8.518  1.00 0.00 ? 44  VAL A HB   3  
ATOM 4495  H HG11 . VAL A 1 44  ? -11.136 -7.231  -8.091  1.00 0.00 ? 44  VAL A HG11 3  
ATOM 4496  H HG12 . VAL A 1 44  ? -10.955 -6.470  -6.492  1.00 0.00 ? 44  VAL A HG12 3  
ATOM 4497  H HG13 . VAL A 1 44  ? -10.673 -5.517  -7.969  1.00 0.00 ? 44  VAL A HG13 3  
ATOM 4498  H HG21 . VAL A 1 44  ? -8.778  -5.589  -5.810  1.00 0.00 ? 44  VAL A HG21 3  
ATOM 4499  H HG22 . VAL A 1 44  ? -7.290  -6.304  -6.474  1.00 0.00 ? 44  VAL A HG22 3  
ATOM 4500  H HG23 . VAL A 1 44  ? -8.113  -4.989  -7.348  1.00 0.00 ? 44  VAL A HG23 3  
ATOM 4501  N N    . ARG A 1 45  ? -6.641  -8.639  -7.617  1.00 0.00 ? 45  ARG A N    3  
ATOM 4502  C CA   . ARG A 1 45  ? -5.227  -8.937  -7.459  1.00 0.00 ? 45  ARG A CA   3  
ATOM 4503  C C    . ARG A 1 45  ? -4.424  -8.321  -8.606  1.00 0.00 ? 45  ARG A C    3  
ATOM 4504  O O    . ARG A 1 45  ? -4.433  -8.838  -9.723  1.00 0.00 ? 45  ARG A O    3  
ATOM 4505  C CB   . ARG A 1 45  ? -4.983  -10.447 -7.428  1.00 0.00 ? 45  ARG A CB   3  
ATOM 4506  C CG   . ARG A 1 45  ? -3.495  -10.758 -7.249  1.00 0.00 ? 45  ARG A CG   3  
ATOM 4507  C CD   . ARG A 1 45  ? -3.127  -12.081 -7.923  1.00 0.00 ? 45  ARG A CD   3  
ATOM 4508  N NE   . ARG A 1 45  ? -3.173  -13.183 -6.936  1.00 0.00 ? 45  ARG A NE   3  
ATOM 4509  C CZ   . ARG A 1 45  ? -2.269  -13.358 -5.963  1.00 0.00 ? 45  ARG A CZ   3  
ATOM 4510  N NH1  . ARG A 1 45  ? -1.243  -12.505 -5.840  1.00 0.00 ? 45  ARG A NH1  3  
ATOM 4511  N NH2  . ARG A 1 45  ? -2.391  -14.386 -5.112  1.00 0.00 ? 45  ARG A NH2  3  
ATOM 4512  H H    . ARG A 1 45  ? -6.930  -8.448  -8.554  1.00 0.00 ? 45  ARG A H    3  
ATOM 4513  H HA   . ARG A 1 45  ? -4.953  -8.490  -6.504  1.00 0.00 ? 45  ARG A HA   3  
ATOM 4514  H HB2  . ARG A 1 45  ? -5.552  -10.894 -6.613  1.00 0.00 ? 45  ARG A HB2  3  
ATOM 4515  H HB3  . ARG A 1 45  ? -5.343  -10.897 -8.353  1.00 0.00 ? 45  ARG A HB3  3  
ATOM 4516  H HG2  . ARG A 1 45  ? -2.898  -9.951  -7.673  1.00 0.00 ? 45  ARG A HG2  3  
ATOM 4517  H HG3  . ARG A 1 45  ? -3.256  -10.808 -6.187  1.00 0.00 ? 45  ARG A HG3  3  
ATOM 4518  H HD2  . ARG A 1 45  ? -3.817  -12.286 -8.742  1.00 0.00 ? 45  ARG A HD2  3  
ATOM 4519  H HD3  . ARG A 1 45  ? -2.129  -12.012 -8.357  1.00 0.00 ? 45  ARG A HD3  3  
ATOM 4520  H HE   . ARG A 1 45  ? -3.926  -13.838 -6.999  1.00 0.00 ? 45  ARG A HE   3  
ATOM 4521  H HH11 . ARG A 1 45  ? -1.152  -11.737 -6.475  1.00 0.00 ? 45  ARG A HH11 3  
ATOM 4522  H HH12 . ARG A 1 45  ? -0.568  -12.635 -5.114  1.00 0.00 ? 45  ARG A HH12 3  
ATOM 4523  H HH21 . ARG A 1 45  ? -3.157  -15.022 -5.204  1.00 0.00 ? 45  ARG A HH21 3  
ATOM 4524  H HH22 . ARG A 1 45  ? -1.716  -14.516 -4.386  1.00 0.00 ? 45  ARG A HH22 3  
ATOM 4525  N N    . LEU A 1 46  ? -3.748  -7.226  -8.292  1.00 0.00 ? 46  LEU A N    3  
ATOM 4526  C CA   . LEU A 1 46  ? -2.941  -6.534  -9.282  1.00 0.00 ? 46  LEU A CA   3  
ATOM 4527  C C    . LEU A 1 46  ? -1.462  -6.824  -9.021  1.00 0.00 ? 46  LEU A C    3  
ATOM 4528  O O    . LEU A 1 46  ? -1.110  -7.398  -7.992  1.00 0.00 ? 46  LEU A O    3  
ATOM 4529  C CB   . LEU A 1 46  ? -3.281  -5.043  -9.303  1.00 0.00 ? 46  LEU A CB   3  
ATOM 4530  C CG   . LEU A 1 46  ? -2.433  -4.148  -8.396  1.00 0.00 ? 46  LEU A CG   3  
ATOM 4531  C CD1  . LEU A 1 46  ? -2.417  -2.706  -8.908  1.00 0.00 ? 46  LEU A CD1  3  
ATOM 4532  C CD2  . LEU A 1 46  ? -2.905  -4.236  -6.944  1.00 0.00 ? 46  LEU A CD2  3  
ATOM 4533  H H    . LEU A 1 46  ? -3.746  -6.812  -7.381  1.00 0.00 ? 46  LEU A H    3  
ATOM 4534  H HA   . LEU A 1 46  ? -3.205  -6.939  -10.259 1.00 0.00 ? 46  LEU A HA   3  
ATOM 4535  H HB2  . LEU A 1 46  ? -3.185  -4.683  -10.328 1.00 0.00 ? 46  LEU A HB2  3  
ATOM 4536  H HB3  . LEU A 1 46  ? -4.327  -4.925  -9.021  1.00 0.00 ? 46  LEU A HB3  3  
ATOM 4537  H HG   . LEU A 1 46  ? -1.405  -4.511  -8.424  1.00 0.00 ? 46  LEU A HG   3  
ATOM 4538  H HD11 . LEU A 1 46  ? -1.386  -2.379  -9.039  1.00 0.00 ? 46  LEU A HD11 3  
ATOM 4539  H HD12 . LEU A 1 46  ? -2.940  -2.654  -9.863  1.00 0.00 ? 46  LEU A HD12 3  
ATOM 4540  H HD13 . LEU A 1 46  ? -2.915  -2.059  -8.185  1.00 0.00 ? 46  LEU A HD13 3  
ATOM 4541  H HD21 . LEU A 1 46  ? -3.950  -4.545  -6.919  1.00 0.00 ? 46  LEU A HD21 3  
ATOM 4542  H HD22 . LEU A 1 46  ? -2.298  -4.966  -6.408  1.00 0.00 ? 46  LEU A HD22 3  
ATOM 4543  H HD23 . LEU A 1 46  ? -2.803  -3.260  -6.469  1.00 0.00 ? 46  LEU A HD23 3  
ATOM 4544  N N    . ILE A 1 47  ? -0.634  -6.413  -9.971  1.00 0.00 ? 47  ILE A N    3  
ATOM 4545  C CA   . ILE A 1 47  ? 0.799   -6.622  -9.857  1.00 0.00 ? 47  ILE A CA   3  
ATOM 4546  C C    . ILE A 1 47  ? 1.532   -5.363  -10.325 1.00 0.00 ? 47  ILE A C    3  
ATOM 4547  O O    . ILE A 1 47  ? 1.034   -4.632  -11.180 1.00 0.00 ? 47  ILE A O    3  
ATOM 4548  C CB   . ILE A 1 47  ? 1.217   -7.890  -10.603 1.00 0.00 ? 47  ILE A CB   3  
ATOM 4549  C CG1  . ILE A 1 47  ? 1.386   -7.616  -12.099 1.00 0.00 ? 47  ILE A CG1  3  
ATOM 4550  C CG2  . ILE A 1 47  ? 0.234   -9.032  -10.337 1.00 0.00 ? 47  ILE A CG2  3  
ATOM 4551  C CD1  . ILE A 1 47  ? 0.047   -7.253  -12.744 1.00 0.00 ? 47  ILE A CD1  3  
ATOM 4552  H H    . ILE A 1 47  ? -0.928  -5.947  -10.806 1.00 0.00 ? 47  ILE A H    3  
ATOM 4553  H HA   . ILE A 1 47  ? 1.023   -6.780  -8.802  1.00 0.00 ? 47  ILE A HA   3  
ATOM 4554  H HB   . ILE A 1 47  ? 2.188   -8.206  -10.222 1.00 0.00 ? 47  ILE A HB   3  
ATOM 4555  H HG12 . ILE A 1 47  ? 2.097   -6.803  -12.245 1.00 0.00 ? 47  ILE A HG12 3  
ATOM 4556  H HG13 . ILE A 1 47  ? 1.803   -8.496  -12.589 1.00 0.00 ? 47  ILE A HG13 3  
ATOM 4557  H HG21 . ILE A 1 47  ? 0.401   -9.429  -9.335  1.00 0.00 ? 47  ILE A HG21 3  
ATOM 4558  H HG22 . ILE A 1 47  ? -0.787  -8.658  -10.414 1.00 0.00 ? 47  ILE A HG22 3  
ATOM 4559  H HG23 . ILE A 1 47  ? 0.388   -9.823  -11.071 1.00 0.00 ? 47  ILE A HG23 3  
ATOM 4560  H HD11 . ILE A 1 47  ? -0.756  -7.399  -12.022 1.00 0.00 ? 47  ILE A HD11 3  
ATOM 4561  H HD12 . ILE A 1 47  ? 0.067   -6.210  -13.060 1.00 0.00 ? 47  ILE A HD12 3  
ATOM 4562  H HD13 . ILE A 1 47  ? -0.124  -7.892  -13.611 1.00 0.00 ? 47  ILE A HD13 3  
ATOM 4563  N N    . TRP A 1 48  ? 2.703   -5.148  -9.744  1.00 0.00 ? 48  TRP A N    3  
ATOM 4564  C CA   . TRP A 1 48  ? 3.510   -3.991  -10.091 1.00 0.00 ? 48  TRP A CA   3  
ATOM 4565  C C    . TRP A 1 48  ? 4.974   -4.432  -10.140 1.00 0.00 ? 48  TRP A C    3  
ATOM 4566  O O    . TRP A 1 48  ? 5.276   -5.613  -9.974  1.00 0.00 ? 48  TRP A O    3  
ATOM 4567  C CB   . TRP A 1 48  ? 3.264   -2.839  -9.115  1.00 0.00 ? 48  TRP A CB   3  
ATOM 4568  C CG   . TRP A 1 48  ? 3.757   -3.113  -7.693  1.00 0.00 ? 48  TRP A CG   3  
ATOM 4569  C CD1  . TRP A 1 48  ? 4.910   -2.727  -7.130  1.00 0.00 ? 48  TRP A CD1  3  
ATOM 4570  C CD2  . TRP A 1 48  ? 3.059   -3.852  -6.669  1.00 0.00 ? 48  TRP A CD2  3  
ATOM 4571  N NE1  . TRP A 1 48  ? 5.006   -3.162  -5.824  1.00 0.00 ? 48  TRP A NE1  3  
ATOM 4572  C CE2  . TRP A 1 48  ? 3.845   -3.868  -5.535  1.00 0.00 ? 48  TRP A CE2  3  
ATOM 4573  C CE3  . TRP A 1 48  ? 1.805   -4.487  -6.700  1.00 0.00 ? 48  TRP A CE3  3  
ATOM 4574  C CZ2  . TRP A 1 48  ? 3.464   -4.505  -4.347  1.00 0.00 ? 48  TRP A CZ2  3  
ATOM 4575  C CZ3  . TRP A 1 48  ? 1.439   -5.119  -5.505  1.00 0.00 ? 48  TRP A CZ3  3  
ATOM 4576  C CH2  . TRP A 1 48  ? 2.219   -5.144  -4.355  1.00 0.00 ? 48  TRP A CH2  3  
ATOM 4577  H H    . TRP A 1 48  ? 3.101   -5.748  -9.050  1.00 0.00 ? 48  TRP A H    3  
ATOM 4578  H HA   . TRP A 1 48  ? 3.192   -3.646  -11.075 1.00 0.00 ? 48  TRP A HA   3  
ATOM 4579  H HB2  . TRP A 1 48  ? 3.758   -1.944  -9.494  1.00 0.00 ? 48  TRP A HB2  3  
ATOM 4580  H HB3  . TRP A 1 48  ? 2.196   -2.624  -9.084  1.00 0.00 ? 48  TRP A HB3  3  
ATOM 4581  H HD1  . TRP A 1 48  ? 5.676   -2.143  -7.640  1.00 0.00 ? 48  TRP A HD1  3  
ATOM 4582  H HE1  . TRP A 1 48  ? 5.840   -2.984  -5.145  1.00 0.00 ? 48  TRP A HE1  3  
ATOM 4583  H HE3  . TRP A 1 48  ? 1.165   -4.489  -7.583  1.00 0.00 ? 48  TRP A HE3  3  
ATOM 4584  H HZ2  . TRP A 1 48  ? 4.104   -4.503  -3.464  1.00 0.00 ? 48  TRP A HZ2  3  
ATOM 4585  H HZ3  . TRP A 1 48  ? 0.475   -5.627  -5.475  1.00 0.00 ? 48  TRP A HZ3  3  
ATOM 4586  H HH2  . TRP A 1 48  ? 1.862   -5.659  -3.463  1.00 0.00 ? 48  TRP A HH2  3  
ATOM 4587  N N    . GLN A 1 49  ? 5.845   -3.459  -10.367 1.00 0.00 ? 49  GLN A N    3  
ATOM 4588  C CA   . GLN A 1 49  ? 7.270   -3.732  -10.438 1.00 0.00 ? 49  GLN A CA   3  
ATOM 4589  C C    . GLN A 1 49  ? 8.057   -2.640  -9.712  1.00 0.00 ? 49  GLN A C    3  
ATOM 4590  O O    . GLN A 1 49  ? 7.537   -1.552  -9.470  1.00 0.00 ? 49  GLN A O    3  
ATOM 4591  C CB   . GLN A 1 49  ? 7.730   -3.865  -11.892 1.00 0.00 ? 49  GLN A CB   3  
ATOM 4592  C CG   . GLN A 1 49  ? 7.492   -5.283  -12.415 1.00 0.00 ? 49  GLN A CG   3  
ATOM 4593  C CD   . GLN A 1 49  ? 7.543   -5.320  -13.943 1.00 0.00 ? 49  GLN A CD   3  
ATOM 4594  O OE1  . GLN A 1 49  ? 7.909   -4.359  -14.601 1.00 0.00 ? 49  GLN A OE1  3  
ATOM 4595  N NE2  . GLN A 1 49  ? 7.157   -6.478  -14.470 1.00 0.00 ? 49  GLN A NE2  3  
ATOM 4596  H H    . GLN A 1 49  ? 5.591   -2.501  -10.500 1.00 0.00 ? 49  GLN A H    3  
ATOM 4597  H HA   . GLN A 1 49  ? 7.408   -4.687  -9.931  1.00 0.00 ? 49  GLN A HA   3  
ATOM 4598  H HB2  . GLN A 1 49  ? 7.194   -3.149  -12.514 1.00 0.00 ? 49  GLN A HB2  3  
ATOM 4599  H HB3  . GLN A 1 49  ? 8.790   -3.620  -11.965 1.00 0.00 ? 49  GLN A HB3  3  
ATOM 4600  H HG2  . GLN A 1 49  ? 8.245   -5.957  -12.006 1.00 0.00 ? 49  GLN A HG2  3  
ATOM 4601  H HG3  . GLN A 1 49  ? 6.522   -5.643  -12.071 1.00 0.00 ? 49  GLN A HG3  3  
ATOM 4602  H HE21 . GLN A 1 49  ? 6.868   -7.227  -13.874 1.00 0.00 ? 49  GLN A HE21 3  
ATOM 4603  H HE22 . GLN A 1 49  ? 7.156   -6.600  -15.463 1.00 0.00 ? 49  GLN A HE22 3  
ATOM 4604  N N    . PRO A 1 50  ? 9.331   -2.977  -9.376  1.00 0.00 ? 50  PRO A N    3  
ATOM 4605  C CA   . PRO A 1 50  ? 10.195  -2.037  -8.682  1.00 0.00 ? 50  PRO A CA   3  
ATOM 4606  C C    . PRO A 1 50  ? 10.697  -0.948  -9.632  1.00 0.00 ? 50  PRO A C    3  
ATOM 4607  O O    . PRO A 1 50  ? 10.827  -1.180  -10.833 1.00 0.00 ? 50  PRO A O    3  
ATOM 4608  C CB   . PRO A 1 50  ? 11.317  -2.886  -8.106  1.00 0.00 ? 50  PRO A CB   3  
ATOM 4609  C CG   . PRO A 1 50  ? 11.294  -4.191  -8.884  1.00 0.00 ? 50  PRO A CG   3  
ATOM 4610  C CD   . PRO A 1 50  ? 9.980   -4.256  -9.646  1.00 0.00 ? 50  PRO A CD   3  
ATOM 4611  H HA   . PRO A 1 50  ? 9.685   -1.560  -7.965  1.00 0.00 ? 50  PRO A HA   3  
ATOM 4612  H HB2  . PRO A 1 50  ? 12.279  -2.385  -8.211  1.00 0.00 ? 50  PRO A HB2  3  
ATOM 4613  H HB3  . PRO A 1 50  ? 11.165  -3.063  -7.041  1.00 0.00 ? 50  PRO A HB3  3  
ATOM 4614  H HG2  . PRO A 1 50  ? 12.138  -4.240  -9.572  1.00 0.00 ? 50  PRO A HG2  3  
ATOM 4615  H HG3  . PRO A 1 50  ? 11.385  -5.041  -8.207  1.00 0.00 ? 50  PRO A HG3  3  
ATOM 4616  H HD2  . PRO A 1 50  ? 10.149  -4.396  -10.714 1.00 0.00 ? 50  PRO A HD2  3  
ATOM 4617  H HD3  . PRO A 1 50  ? 9.367   -5.091  -9.308  1.00 0.00 ? 50  PRO A HD3  3  
ATOM 4618  N N    . PRO A 1 51  ? 10.973  0.246   -9.044  1.00 0.00 ? 51  PRO A N    3  
ATOM 4619  C CA   . PRO A 1 51  ? 11.457  1.371   -9.825  1.00 0.00 ? 51  PRO A CA   3  
ATOM 4620  C C    . PRO A 1 51  ? 12.927  1.181   -10.207 1.00 0.00 ? 51  PRO A C    3  
ATOM 4621  O O    . PRO A 1 51  ? 13.778  0.990   -9.340  1.00 0.00 ? 51  PRO A O    3  
ATOM 4622  C CB   . PRO A 1 51  ? 11.225  2.590   -8.947  1.00 0.00 ? 51  PRO A CB   3  
ATOM 4623  C CG   . PRO A 1 51  ? 11.052  2.058   -7.533  1.00 0.00 ? 51  PRO A CG   3  
ATOM 4624  C CD   . PRO A 1 51  ? 10.831  0.557   -7.624  1.00 0.00 ? 51  PRO A CD   3  
ATOM 4625  H HA   . PRO A 1 51  ? 10.957  1.436   -10.688 1.00 0.00 ? 51  PRO A HA   3  
ATOM 4626  H HB2  . PRO A 1 51  ? 12.067  3.279   -9.004  1.00 0.00 ? 51  PRO A HB2  3  
ATOM 4627  H HB3  . PRO A 1 51  ? 10.341  3.140   -9.268  1.00 0.00 ? 51  PRO A HB3  3  
ATOM 4628  H HG2  . PRO A 1 51  ? 11.934  2.278   -6.932  1.00 0.00 ? 51  PRO A HG2  3  
ATOM 4629  H HG3  . PRO A 1 51  ? 10.204  2.539   -7.045  1.00 0.00 ? 51  PRO A HG3  3  
ATOM 4630  H HD2  . PRO A 1 51  ? 11.560  0.012   -7.025  1.00 0.00 ? 51  PRO A HD2  3  
ATOM 4631  H HD3  . PRO A 1 51  ? 9.844   0.279   -7.255  1.00 0.00 ? 51  PRO A HD3  3  
ATOM 4632  N N    . ALA A 1 52  ? 13.180  1.241   -11.506 1.00 0.00 ? 52  ALA A N    3  
ATOM 4633  C CA   . ALA A 1 52  ? 14.532  1.077   -12.014 1.00 0.00 ? 52  ALA A CA   3  
ATOM 4634  C C    . ALA A 1 52  ? 15.489  1.940   -11.189 1.00 0.00 ? 52  ALA A C    3  
ATOM 4635  O O    . ALA A 1 52  ? 16.668  1.614   -11.059 1.00 0.00 ? 52  ALA A O    3  
ATOM 4636  C CB   . ALA A 1 52  ? 14.564  1.430   -13.502 1.00 0.00 ? 52  ALA A CB   3  
ATOM 4637  H H    . ALA A 1 52  ? 12.482  1.396   -12.205 1.00 0.00 ? 52  ALA A H    3  
ATOM 4638  H HA   . ALA A 1 52  ? 14.806  0.029   -11.895 1.00 0.00 ? 52  ALA A HA   3  
ATOM 4639  H HB1  . ALA A 1 52  ? 15.177  2.319   -13.651 1.00 0.00 ? 52  ALA A HB1  3  
ATOM 4640  H HB2  . ALA A 1 52  ? 14.989  0.598   -14.064 1.00 0.00 ? 52  ALA A HB2  3  
ATOM 4641  H HB3  . ALA A 1 52  ? 13.551  1.625   -13.852 1.00 0.00 ? 52  ALA A HB3  3  
ATOM 4642  N N    . ALA A 1 53  ? 14.946  3.023   -10.653 1.00 0.00 ? 53  ALA A N    3  
ATOM 4643  C CA   . ALA A 1 53  ? 15.737  3.935   -9.844  1.00 0.00 ? 53  ALA A CA   3  
ATOM 4644  C C    . ALA A 1 53  ? 15.189  3.950   -8.416  1.00 0.00 ? 53  ALA A C    3  
ATOM 4645  O O    . ALA A 1 53  ? 14.371  4.801   -8.071  1.00 0.00 ? 53  ALA A O    3  
ATOM 4646  C CB   . ALA A 1 53  ? 15.731  5.323   -10.486 1.00 0.00 ? 53  ALA A CB   3  
ATOM 4647  H H    . ALA A 1 53  ? 13.986  3.281   -10.764 1.00 0.00 ? 53  ALA A H    3  
ATOM 4648  H HA   . ALA A 1 53  ? 16.761  3.560   -9.827  1.00 0.00 ? 53  ALA A HA   3  
ATOM 4649  H HB1  . ALA A 1 53  ? 14.867  5.884   -10.131 1.00 0.00 ? 53  ALA A HB1  3  
ATOM 4650  H HB2  . ALA A 1 53  ? 16.645  5.853   -10.215 1.00 0.00 ? 53  ALA A HB2  3  
ATOM 4651  H HB3  . ALA A 1 53  ? 15.678  5.222   -11.570 1.00 0.00 ? 53  ALA A HB3  3  
ATOM 4652  N N    . PRO A 1 54  ? 15.674  2.973   -7.604  1.00 0.00 ? 54  PRO A N    3  
ATOM 4653  C CA   . PRO A 1 54  ? 15.240  2.867   -6.221  1.00 0.00 ? 54  PRO A CA   3  
ATOM 4654  C C    . PRO A 1 54  ? 15.887  3.953   -5.358  1.00 0.00 ? 54  PRO A C    3  
ATOM 4655  O O    . PRO A 1 54  ? 15.267  4.460   -4.425  1.00 0.00 ? 54  PRO A O    3  
ATOM 4656  C CB   . PRO A 1 54  ? 15.629  1.460   -5.794  1.00 0.00 ? 54  PRO A CB   3  
ATOM 4657  C CG   . PRO A 1 54  ? 16.674  0.995   -6.795  1.00 0.00 ? 54  PRO A CG   3  
ATOM 4658  C CD   . PRO A 1 54  ? 16.643  1.948   -7.978  1.00 0.00 ? 54  PRO A CD   3  
ATOM 4659  H HA   . PRO A 1 54  ? 14.254  3.016   -6.154  1.00 0.00 ? 54  PRO A HA   3  
ATOM 4660  H HB2  . PRO A 1 54  ? 16.029  1.456   -4.781  1.00 0.00 ? 54  PRO A HB2  3  
ATOM 4661  H HB3  . PRO A 1 54  ? 14.762  0.798   -5.797  1.00 0.00 ? 54  PRO A HB3  3  
ATOM 4662  H HG2  . PRO A 1 54  ? 17.663  0.985   -6.337  1.00 0.00 ? 54  PRO A HG2  3  
ATOM 4663  H HG3  . PRO A 1 54  ? 16.463  -0.024  -7.120  1.00 0.00 ? 54  PRO A HG3  3  
ATOM 4664  H HD2  . PRO A 1 54  ? 17.626  2.381   -8.163  1.00 0.00 ? 54  PRO A HD2  3  
ATOM 4665  H HD3  . PRO A 1 54  ? 16.344  1.435   -8.893  1.00 0.00 ? 54  PRO A HD3  3  
ATOM 4666  N N    . ASN A 1 55  ? 17.125  4.277   -5.701  1.00 0.00 ? 55  ASN A N    3  
ATOM 4667  C CA   . ASN A 1 55  ? 17.862  5.293   -4.970  1.00 0.00 ? 55  ASN A CA   3  
ATOM 4668  C C    . ASN A 1 55  ? 17.589  5.137   -3.473  1.00 0.00 ? 55  ASN A C    3  
ATOM 4669  O O    . ASN A 1 55  ? 17.353  6.122   -2.776  1.00 0.00 ? 55  ASN A O    3  
ATOM 4670  C CB   . ASN A 1 55  ? 17.423  6.699   -5.387  1.00 0.00 ? 55  ASN A CB   3  
ATOM 4671  C CG   . ASN A 1 55  ? 17.104  6.752   -6.882  1.00 0.00 ? 55  ASN A CG   3  
ATOM 4672  O OD1  . ASN A 1 55  ? 17.964  6.599   -7.733  1.00 0.00 ? 55  ASN A OD1  3  
ATOM 4673  N ND2  . ASN A 1 55  ? 15.822  6.978   -7.154  1.00 0.00 ? 55  ASN A ND2  3  
ATOM 4674  H H    . ASN A 1 55  ? 17.622  3.859   -6.462  1.00 0.00 ? 55  ASN A H    3  
ATOM 4675  H HA   . ASN A 1 55  ? 18.909  5.125   -5.223  1.00 0.00 ? 55  ASN A HA   3  
ATOM 4676  H HB2  . ASN A 1 55  ? 16.545  6.995   -4.813  1.00 0.00 ? 55  ASN A HB2  3  
ATOM 4677  H HB3  . ASN A 1 55  ? 18.212  7.414   -5.154  1.00 0.00 ? 55  ASN A HB3  3  
ATOM 4678  H HD21 . ASN A 1 55  ? 15.166  7.095   -6.408  1.00 0.00 ? 55  ASN A HD21 3  
ATOM 4679  H HD22 . ASN A 1 55  ? 15.513  7.031   -8.103  1.00 0.00 ? 55  ASN A HD22 3  
ATOM 4680  N N    . GLY A 1 56  ? 17.631  3.892   -3.023  1.00 0.00 ? 56  GLY A N    3  
ATOM 4681  C CA   . GLY A 1 56  ? 17.391  3.594   -1.621  1.00 0.00 ? 56  GLY A CA   3  
ATOM 4682  C C    . GLY A 1 56  ? 16.901  2.156   -1.442  1.00 0.00 ? 56  GLY A C    3  
ATOM 4683  O O    . GLY A 1 56  ? 16.033  1.695   -2.182  1.00 0.00 ? 56  GLY A O    3  
ATOM 4684  H H    . GLY A 1 56  ? 17.823  3.096   -3.597  1.00 0.00 ? 56  GLY A H    3  
ATOM 4685  H HA2  . GLY A 1 56  ? 18.308  3.743   -1.052  1.00 0.00 ? 56  GLY A HA2  3  
ATOM 4686  H HA3  . GLY A 1 56  ? 16.651  4.286   -1.220  1.00 0.00 ? 56  GLY A HA3  3  
ATOM 4687  N N    . ILE A 1 57  ? 17.480  1.486   -0.456  1.00 0.00 ? 57  ILE A N    3  
ATOM 4688  C CA   . ILE A 1 57  ? 17.113  0.109   -0.171  1.00 0.00 ? 57  ILE A CA   3  
ATOM 4689  C C    . ILE A 1 57  ? 15.643  0.054   0.247   1.00 0.00 ? 57  ILE A C    3  
ATOM 4690  O O    . ILE A 1 57  ? 15.277  0.548   1.312   1.00 0.00 ? 57  ILE A O    3  
ATOM 4691  C CB   . ILE A 1 57  ? 18.069  -0.497  0.859   1.00 0.00 ? 57  ILE A CB   3  
ATOM 4692  C CG1  . ILE A 1 57  ? 19.376  -0.942  0.200   1.00 0.00 ? 57  ILE A CG1  3  
ATOM 4693  C CG2  . ILE A 1 57  ? 17.396  -1.638  1.626   1.00 0.00 ? 57  ILE A CG2  3  
ATOM 4694  C CD1  . ILE A 1 57  ? 19.815  0.055   -0.874  1.00 0.00 ? 57  ILE A CD1  3  
ATOM 4695  H H    . ILE A 1 57  ? 18.186  1.868   0.140   1.00 0.00 ? 57  ILE A H    3  
ATOM 4696  H HA   . ILE A 1 57  ? 17.232  -0.459  -1.094  1.00 0.00 ? 57  ILE A HA   3  
ATOM 4697  H HB   . ILE A 1 57  ? 18.321  0.275   1.586   1.00 0.00 ? 57  ILE A HB   3  
ATOM 4698  H HG12 . ILE A 1 57  ? 20.155  -1.035  0.956   1.00 0.00 ? 57  ILE A HG12 3  
ATOM 4699  H HG13 . ILE A 1 57  ? 19.245  -1.928  -0.246  1.00 0.00 ? 57  ILE A HG13 3  
ATOM 4700  H HG21 . ILE A 1 57  ? 16.894  -2.302  0.923   1.00 0.00 ? 57  ILE A HG21 3  
ATOM 4701  H HG22 . ILE A 1 57  ? 18.151  -2.198  2.179   1.00 0.00 ? 57  ILE A HG22 3  
ATOM 4702  H HG23 . ILE A 1 57  ? 16.666  -1.226  2.323   1.00 0.00 ? 57  ILE A HG23 3  
ATOM 4703  H HD11 . ILE A 1 57  ? 19.879  1.053   -0.439  1.00 0.00 ? 57  ILE A HD11 3  
ATOM 4704  H HD12 . ILE A 1 57  ? 20.792  -0.235  -1.262  1.00 0.00 ? 57  ILE A HD12 3  
ATOM 4705  H HD13 . ILE A 1 57  ? 19.088  0.059   -1.686  1.00 0.00 ? 57  ILE A HD13 3  
ATOM 4706  N N    . ILE A 1 58  ? 14.838  -0.553  -0.614  1.00 0.00 ? 58  ILE A N    3  
ATOM 4707  C CA   . ILE A 1 58  ? 13.416  -0.679  -0.347  1.00 0.00 ? 58  ILE A CA   3  
ATOM 4708  C C    . ILE A 1 58  ? 13.213  -1.420  0.976   1.00 0.00 ? 58  ILE A C    3  
ATOM 4709  O O    . ILE A 1 58  ? 13.886  -2.413  1.245   1.00 0.00 ? 58  ILE A O    3  
ATOM 4710  C CB   . ILE A 1 58  ? 12.705  -1.334  -1.533  1.00 0.00 ? 58  ILE A CB   3  
ATOM 4711  C CG1  . ILE A 1 58  ? 12.976  -0.566  -2.828  1.00 0.00 ? 58  ILE A CG1  3  
ATOM 4712  C CG2  . ILE A 1 58  ? 11.207  -1.484  -1.259  1.00 0.00 ? 58  ILE A CG2  3  
ATOM 4713  C CD1  . ILE A 1 58  ? 12.456  0.870   -2.733  1.00 0.00 ? 58  ILE A CD1  3  
ATOM 4714  H H    . ILE A 1 58  ? 15.144  -0.952  -1.478  1.00 0.00 ? 58  ILE A H    3  
ATOM 4715  H HA   . ILE A 1 58  ? 13.012  0.328   -0.245  1.00 0.00 ? 58  ILE A HA   3  
ATOM 4716  H HB   . ILE A 1 58  ? 13.110  -2.338  -1.663  1.00 0.00 ? 58  ILE A HB   3  
ATOM 4717  H HG12 . ILE A 1 58  ? 14.047  -0.556  -3.031  1.00 0.00 ? 58  ILE A HG12 3  
ATOM 4718  H HG13 . ILE A 1 58  ? 12.498  -1.075  -3.665  1.00 0.00 ? 58  ILE A HG13 3  
ATOM 4719  H HG21 . ILE A 1 58  ? 10.981  -2.527  -1.036  1.00 0.00 ? 58  ILE A HG21 3  
ATOM 4720  H HG22 . ILE A 1 58  ? 10.929  -0.862  -0.409  1.00 0.00 ? 58  ILE A HG22 3  
ATOM 4721  H HG23 . ILE A 1 58  ? 10.644  -1.171  -2.138  1.00 0.00 ? 58  ILE A HG23 3  
ATOM 4722  H HD11 . ILE A 1 58  ? 11.827  1.086   -3.596  1.00 0.00 ? 58  ILE A HD11 3  
ATOM 4723  H HD12 . ILE A 1 58  ? 11.873  0.985   -1.820  1.00 0.00 ? 58  ILE A HD12 3  
ATOM 4724  H HD13 . ILE A 1 58  ? 13.299  1.561   -2.715  1.00 0.00 ? 58  ILE A HD13 3  
ATOM 4725  N N    . LEU A 1 59  ? 12.283  -0.907  1.768   1.00 0.00 ? 59  LEU A N    3  
ATOM 4726  C CA   . LEU A 1 59  ? 11.983  -1.507  3.057   1.00 0.00 ? 59  LEU A CA   3  
ATOM 4727  C C    . LEU A 1 59  ? 10.595  -2.148  3.006   1.00 0.00 ? 59  LEU A C    3  
ATOM 4728  O O    . LEU A 1 59  ? 10.300  -3.061  3.776   1.00 0.00 ? 59  LEU A O    3  
ATOM 4729  C CB   . LEU A 1 59  ? 12.143  -0.477  4.177   1.00 0.00 ? 59  LEU A CB   3  
ATOM 4730  C CG   . LEU A 1 59  ? 13.410  0.380   4.124   1.00 0.00 ? 59  LEU A CG   3  
ATOM 4731  C CD1  . LEU A 1 59  ? 13.374  1.477   5.190   1.00 0.00 ? 59  LEU A CD1  3  
ATOM 4732  C CD2  . LEU A 1 59  ? 14.665  -0.488  4.237   1.00 0.00 ? 59  LEU A CD2  3  
ATOM 4733  H H    . LEU A 1 59  ? 11.739  -0.098  1.542   1.00 0.00 ? 59  LEU A H    3  
ATOM 4734  H HA   . LEU A 1 59  ? 12.720  -2.291  3.232   1.00 0.00 ? 59  LEU A HA   3  
ATOM 4735  H HB2  . LEU A 1 59  ? 11.279  0.186   4.161   1.00 0.00 ? 59  LEU A HB2  3  
ATOM 4736  H HB3  . LEU A 1 59  ? 12.124  -1.003  5.132   1.00 0.00 ? 59  LEU A HB3  3  
ATOM 4737  H HG   . LEU A 1 59  ? 13.447  0.875   3.154   1.00 0.00 ? 59  LEU A HG   3  
ATOM 4738  H HD11 . LEU A 1 59  ? 13.965  2.329   4.854   1.00 0.00 ? 59  LEU A HD11 3  
ATOM 4739  H HD12 . LEU A 1 59  ? 12.343  1.791   5.354   1.00 0.00 ? 59  LEU A HD12 3  
ATOM 4740  H HD13 . LEU A 1 59  ? 13.789  1.092   6.122   1.00 0.00 ? 59  LEU A HD13 3  
ATOM 4741  H HD21 . LEU A 1 59  ? 14.925  -0.879  3.253   1.00 0.00 ? 59  LEU A HD21 3  
ATOM 4742  H HD22 . LEU A 1 59  ? 15.489  0.113   4.619   1.00 0.00 ? 59  LEU A HD22 3  
ATOM 4743  H HD23 . LEU A 1 59  ? 14.473  -1.317  4.918   1.00 0.00 ? 59  LEU A HD23 3  
ATOM 4744  N N    . ALA A 1 60  ? 9.779   -1.645  2.091   1.00 0.00 ? 60  ALA A N    3  
ATOM 4745  C CA   . ALA A 1 60  ? 8.429   -2.158  1.929   1.00 0.00 ? 60  ALA A CA   3  
ATOM 4746  C C    . ALA A 1 60  ? 7.683   -1.303  0.903   1.00 0.00 ? 60  ALA A C    3  
ATOM 4747  O O    . ALA A 1 60  ? 8.285   -0.468  0.230   1.00 0.00 ? 60  ALA A O    3  
ATOM 4748  C CB   . ALA A 1 60  ? 7.726   -2.184  3.288   1.00 0.00 ? 60  ALA A CB   3  
ATOM 4749  H H    . ALA A 1 60  ? 10.026  -0.903  1.468   1.00 0.00 ? 60  ALA A H    3  
ATOM 4750  H HA   . ALA A 1 60  ? 8.504   -3.178  1.553   1.00 0.00 ? 60  ALA A HA   3  
ATOM 4751  H HB1  . ALA A 1 60  ? 8.314   -1.620  4.012   1.00 0.00 ? 60  ALA A HB1  3  
ATOM 4752  H HB2  . ALA A 1 60  ? 6.738   -1.735  3.194   1.00 0.00 ? 60  ALA A HB2  3  
ATOM 4753  H HB3  . ALA A 1 60  ? 7.626   -3.215  3.626   1.00 0.00 ? 60  ALA A HB3  3  
ATOM 4754  N N    . TYR A 1 61  ? 6.382   -1.540  0.816   1.00 0.00 ? 61  TYR A N    3  
ATOM 4755  C CA   . TYR A 1 61  ? 5.548   -0.803  -0.117  1.00 0.00 ? 61  TYR A CA   3  
ATOM 4756  C C    . TYR A 1 61  ? 4.181   -0.492  0.497   1.00 0.00 ? 61  TYR A C    3  
ATOM 4757  O O    . TYR A 1 61  ? 3.835   -1.025  1.550   1.00 0.00 ? 61  TYR A O    3  
ATOM 4758  C CB   . TYR A 1 61  ? 5.354   -1.720  -1.326  1.00 0.00 ? 61  TYR A CB   3  
ATOM 4759  C CG   . TYR A 1 61  ? 6.505   -1.673  -2.333  1.00 0.00 ? 61  TYR A CG   3  
ATOM 4760  C CD1  . TYR A 1 61  ? 7.688   -2.331  -2.060  1.00 0.00 ? 61  TYR A CD1  3  
ATOM 4761  C CD2  . TYR A 1 61  ? 6.361   -0.974  -3.514  1.00 0.00 ? 61  TYR A CD2  3  
ATOM 4762  C CE1  . TYR A 1 61  ? 8.771   -2.287  -3.008  1.00 0.00 ? 61  TYR A CE1  3  
ATOM 4763  C CE2  . TYR A 1 61  ? 7.444   -0.931  -4.462  1.00 0.00 ? 61  TYR A CE2  3  
ATOM 4764  C CZ   . TYR A 1 61  ? 8.596   -1.590  -4.162  1.00 0.00 ? 61  TYR A CZ   3  
ATOM 4765  O OH   . TYR A 1 61  ? 9.619   -1.548  -5.057  1.00 0.00 ? 61  TYR A OH   3  
ATOM 4766  H H    . TYR A 1 61  ? 5.900   -2.221  1.367   1.00 0.00 ? 61  TYR A H    3  
ATOM 4767  H HA   . TYR A 1 61  ? 6.053   0.134   -0.352  1.00 0.00 ? 61  TYR A HA   3  
ATOM 4768  H HB2  . TYR A 1 61  ? 5.232   -2.745  -0.976  1.00 0.00 ? 61  TYR A HB2  3  
ATOM 4769  H HB3  . TYR A 1 61  ? 4.430   -1.445  -1.834  1.00 0.00 ? 61  TYR A HB3  3  
ATOM 4770  H HD1  . TYR A 1 61  ? 7.801   -2.883  -1.127  1.00 0.00 ? 61  TYR A HD1  3  
ATOM 4771  H HD2  . TYR A 1 61  ? 5.427   -0.455  -3.730  1.00 0.00 ? 61  TYR A HD2  3  
ATOM 4772  H HE1  . TYR A 1 61  ? 9.710   -2.802  -2.805  1.00 0.00 ? 61  TYR A HE1  3  
ATOM 4773  H HE2  . TYR A 1 61  ? 7.344   -0.383  -5.399  1.00 0.00 ? 61  TYR A HE2  3  
ATOM 4774  H HH   . TYR A 1 61  ? 9.792   -2.464  -5.421  1.00 0.00 ? 61  TYR A HH   3  
ATOM 4775  N N    . GLN A 1 62  ? 3.442   0.368   -0.188  1.00 0.00 ? 62  GLN A N    3  
ATOM 4776  C CA   . GLN A 1 62  ? 2.121   0.755   0.277   1.00 0.00 ? 62  GLN A CA   3  
ATOM 4777  C C    . GLN A 1 62  ? 1.107   0.660   -0.865  1.00 0.00 ? 62  GLN A C    3  
ATOM 4778  O O    . GLN A 1 62  ? 1.362   1.143   -1.968  1.00 0.00 ? 62  GLN A O    3  
ATOM 4779  C CB   . GLN A 1 62  ? 2.141   2.163   0.876   1.00 0.00 ? 62  GLN A CB   3  
ATOM 4780  C CG   . GLN A 1 62  ? 0.773   2.533   1.452   1.00 0.00 ? 62  GLN A CG   3  
ATOM 4781  C CD   . GLN A 1 62  ? 0.824   3.892   2.154   1.00 0.00 ? 62  GLN A CD   3  
ATOM 4782  O OE1  . GLN A 1 62  ? 1.873   4.384   2.535   1.00 0.00 ? 62  GLN A OE1  3  
ATOM 4783  N NE2  . GLN A 1 62  ? -0.366  4.468   2.304   1.00 0.00 ? 62  GLN A NE2  3  
ATOM 4784  H H    . GLN A 1 62  ? 3.731   0.796   -1.044  1.00 0.00 ? 62  GLN A H    3  
ATOM 4785  H HA   . GLN A 1 62  ? 1.867   0.038   1.057   1.00 0.00 ? 62  GLN A HA   3  
ATOM 4786  H HB2  . GLN A 1 62  ? 2.897   2.217   1.660   1.00 0.00 ? 62  GLN A HB2  3  
ATOM 4787  H HB3  . GLN A 1 62  ? 2.425   2.884   0.110   1.00 0.00 ? 62  GLN A HB3  3  
ATOM 4788  H HG2  . GLN A 1 62  ? 0.033   2.561   0.652   1.00 0.00 ? 62  GLN A HG2  3  
ATOM 4789  H HG3  . GLN A 1 62  ? 0.451   1.767   2.157   1.00 0.00 ? 62  GLN A HG3  3  
ATOM 4790  H HE21 . GLN A 1 62  ? -1.189  4.010   1.969   1.00 0.00 ? 62  GLN A HE21 3  
ATOM 4791  H HE22 . GLN A 1 62  ? -0.437  5.359   2.752   1.00 0.00 ? 62  GLN A HE22 3  
ATOM 4792  N N    . ILE A 1 63  ? -0.021  0.034   -0.563  1.00 0.00 ? 63  ILE A N    3  
ATOM 4793  C CA   . ILE A 1 63  ? -1.074  -0.130  -1.551  1.00 0.00 ? 63  ILE A CA   3  
ATOM 4794  C C    . ILE A 1 63  ? -2.374  0.464   -1.007  1.00 0.00 ? 63  ILE A C    3  
ATOM 4795  O O    . ILE A 1 63  ? -3.012  -0.124  -0.135  1.00 0.00 ? 63  ILE A O    3  
ATOM 4796  C CB   . ILE A 1 63  ? -1.194  -1.598  -1.966  1.00 0.00 ? 63  ILE A CB   3  
ATOM 4797  C CG1  . ILE A 1 63  ? -0.711  -1.803  -3.403  1.00 0.00 ? 63  ILE A CG1  3  
ATOM 4798  C CG2  . ILE A 1 63  ? -2.622  -2.109  -1.763  1.00 0.00 ? 63  ILE A CG2  3  
ATOM 4799  C CD1  . ILE A 1 63  ? 0.134   -3.072  -3.522  1.00 0.00 ? 63  ILE A CD1  3  
ATOM 4800  H H    . ILE A 1 63  ? -0.220  -0.356  0.336   1.00 0.00 ? 63  ILE A H    3  
ATOM 4801  H HA   . ILE A 1 63  ? -0.781  0.433   -2.437  1.00 0.00 ? 63  ILE A HA   3  
ATOM 4802  H HB   . ILE A 1 63  ? -0.545  -2.190  -1.320  1.00 0.00 ? 63  ILE A HB   3  
ATOM 4803  H HG12 . ILE A 1 63  ? -1.569  -1.868  -4.073  1.00 0.00 ? 63  ILE A HG12 3  
ATOM 4804  H HG13 . ILE A 1 63  ? -0.125  -0.940  -3.720  1.00 0.00 ? 63  ILE A HG13 3  
ATOM 4805  H HG21 . ILE A 1 63  ? -2.811  -2.246  -0.698  1.00 0.00 ? 63  ILE A HG21 3  
ATOM 4806  H HG22 . ILE A 1 63  ? -3.329  -1.385  -2.167  1.00 0.00 ? 63  ILE A HG22 3  
ATOM 4807  H HG23 . ILE A 1 63  ? -2.743  -3.062  -2.278  1.00 0.00 ? 63  ILE A HG23 3  
ATOM 4808  H HD11 . ILE A 1 63  ? -0.405  -3.910  -3.080  1.00 0.00 ? 63  ILE A HD11 3  
ATOM 4809  H HD12 . ILE A 1 63  ? 0.331   -3.281  -4.573  1.00 0.00 ? 63  ILE A HD12 3  
ATOM 4810  H HD13 . ILE A 1 63  ? 1.079   -2.931  -2.996  1.00 0.00 ? 63  ILE A HD13 3  
ATOM 4811  N N    . THR A 1 64  ? -2.729  1.622   -1.544  1.00 0.00 ? 64  THR A N    3  
ATOM 4812  C CA   . THR A 1 64  ? -3.942  2.302   -1.124  1.00 0.00 ? 64  THR A CA   3  
ATOM 4813  C C    . THR A 1 64  ? -5.074  2.038   -2.118  1.00 0.00 ? 64  THR A C    3  
ATOM 4814  O O    . THR A 1 64  ? -4.952  2.352   -3.301  1.00 0.00 ? 64  THR A O    3  
ATOM 4815  C CB   . THR A 1 64  ? -3.616  3.788   -0.954  1.00 0.00 ? 64  THR A CB   3  
ATOM 4816  O OG1  . THR A 1 64  ? -3.518  4.276   -2.290  1.00 0.00 ? 64  THR A OG1  3  
ATOM 4817  C CG2  . THR A 1 64  ? -2.222  4.019   -0.369  1.00 0.00 ? 64  THR A CG2  3  
ATOM 4818  H H    . THR A 1 64  ? -2.204  2.094   -2.253  1.00 0.00 ? 64  THR A H    3  
ATOM 4819  H HA   . THR A 1 64  ? -4.254  1.887   -0.165  1.00 0.00 ? 64  THR A HA   3  
ATOM 4820  H HB   . THR A 1 64  ? -4.378  4.287   -0.355  1.00 0.00 ? 64  THR A HB   3  
ATOM 4821  H HG1  . THR A 1 64  ? -4.391  4.670   -2.575  1.00 0.00 ? 64  THR A HG1  3  
ATOM 4822  H HG21 . THR A 1 64  ? -1.582  4.476   -1.124  1.00 0.00 ? 64  THR A HG21 3  
ATOM 4823  H HG22 . THR A 1 64  ? -2.295  4.680   0.494   1.00 0.00 ? 64  THR A HG22 3  
ATOM 4824  H HG23 . THR A 1 64  ? -1.795  3.065   -0.060  1.00 0.00 ? 64  THR A HG23 3  
ATOM 4825  N N    . HIS A 1 65  ? -6.150  1.462   -1.602  1.00 0.00 ? 65  HIS A N    3  
ATOM 4826  C CA   . HIS A 1 65  ? -7.303  1.152   -2.429  1.00 0.00 ? 65  HIS A CA   3  
ATOM 4827  C C    . HIS A 1 65  ? -8.511  1.958   -1.949  1.00 0.00 ? 65  HIS A C    3  
ATOM 4828  O O    . HIS A 1 65  ? -8.726  2.105   -0.747  1.00 0.00 ? 65  HIS A O    3  
ATOM 4829  C CB   . HIS A 1 65  ? -7.566  -0.355  -2.451  1.00 0.00 ? 65  HIS A CB   3  
ATOM 4830  C CG   . HIS A 1 65  ? -8.245  -0.878  -1.208  1.00 0.00 ? 65  HIS A CG   3  
ATOM 4831  N ND1  . HIS A 1 65  ? -7.588  -1.642  -0.259  1.00 0.00 ? 65  HIS A ND1  3  
ATOM 4832  C CD2  . HIS A 1 65  ? -9.529  -0.739  -0.768  1.00 0.00 ? 65  HIS A CD2  3  
ATOM 4833  C CE1  . HIS A 1 65  ? -8.447  -1.943  0.703   1.00 0.00 ? 65  HIS A CE1  3  
ATOM 4834  N NE2  . HIS A 1 65  ? -9.649  -1.383  0.386   1.00 0.00 ? 65  HIS A NE2  3  
ATOM 4835  H H    . HIS A 1 65  ? -6.241  1.210   -0.638  1.00 0.00 ? 65  HIS A H    3  
ATOM 4836  H HA   . HIS A 1 65  ? -7.051  1.460   -3.444  1.00 0.00 ? 65  HIS A HA   3  
ATOM 4837  H HB2  . HIS A 1 65  ? -8.183  -0.594  -3.318  1.00 0.00 ? 65  HIS A HB2  3  
ATOM 4838  H HB3  . HIS A 1 65  ? -6.618  -0.877  -2.582  1.00 0.00 ? 65  HIS A HB3  3  
ATOM 4839  H HD1  . HIS A 1 65  ? -6.628  -1.919  -0.294  1.00 0.00 ? 65  HIS A HD1  3  
ATOM 4840  H HD2  . HIS A 1 65  ? -10.321 -0.190  -1.279  1.00 0.00 ? 65  HIS A HD2  3  
ATOM 4841  H HE1  . HIS A 1 65  ? -8.231  -2.535  1.593   1.00 0.00 ? 65  HIS A HE1  3  
ATOM 4842  N N    . ARG A 1 66  ? -9.269  2.459   -2.914  1.00 0.00 ? 66  ARG A N    3  
ATOM 4843  C CA   . ARG A 1 66  ? -10.450 3.246   -2.605  1.00 0.00 ? 66  ARG A CA   3  
ATOM 4844  C C    . ARG A 1 66  ? -11.391 3.287   -3.811  1.00 0.00 ? 66  ARG A C    3  
ATOM 4845  O O    . ARG A 1 66  ? -10.950 3.156   -4.952  1.00 0.00 ? 66  ARG A O    3  
ATOM 4846  C CB   . ARG A 1 66  ? -10.073 4.676   -2.213  1.00 0.00 ? 66  ARG A CB   3  
ATOM 4847  C CG   . ARG A 1 66  ? -9.693  5.500   -3.445  1.00 0.00 ? 66  ARG A CG   3  
ATOM 4848  C CD   . ARG A 1 66  ? -9.076  6.840   -3.039  1.00 0.00 ? 66  ARG A CD   3  
ATOM 4849  N NE   . ARG A 1 66  ? -8.398  7.458   -4.200  1.00 0.00 ? 66  ARG A NE   3  
ATOM 4850  C CZ   . ARG A 1 66  ? -7.839  8.675   -4.184  1.00 0.00 ? 66  ARG A CZ   3  
ATOM 4851  N NH1  . ARG A 1 66  ? -7.873  9.413   -3.066  1.00 0.00 ? 66  ARG A NH1  3  
ATOM 4852  N NH2  . ARG A 1 66  ? -7.245  9.155   -5.285  1.00 0.00 ? 66  ARG A NH2  3  
ATOM 4853  H H    . ARG A 1 66  ? -9.087  2.334   -3.889  1.00 0.00 ? 66  ARG A H    3  
ATOM 4854  H HA   . ARG A 1 66  ? -10.915 2.733   -1.763  1.00 0.00 ? 66  ARG A HA   3  
ATOM 4855  H HB2  . ARG A 1 66  ? -10.909 5.149   -1.698  1.00 0.00 ? 66  ARG A HB2  3  
ATOM 4856  H HB3  . ARG A 1 66  ? -9.238  4.656   -1.512  1.00 0.00 ? 66  ARG A HB3  3  
ATOM 4857  H HG2  . ARG A 1 66  ? -8.985  4.941   -4.057  1.00 0.00 ? 66  ARG A HG2  3  
ATOM 4858  H HG3  . ARG A 1 66  ? -10.577 5.673   -4.057  1.00 0.00 ? 66  ARG A HG3  3  
ATOM 4859  H HD2  . ARG A 1 66  ? -9.851  7.508   -2.663  1.00 0.00 ? 66  ARG A HD2  3  
ATOM 4860  H HD3  . ARG A 1 66  ? -8.363  6.691   -2.228  1.00 0.00 ? 66  ARG A HD3  3  
ATOM 4861  H HE   . ARG A 1 66  ? -8.354  6.934   -5.051  1.00 0.00 ? 66  ARG A HE   3  
ATOM 4862  H HH11 . ARG A 1 66  ? -8.317  9.055   -2.244  1.00 0.00 ? 66  ARG A HH11 3  
ATOM 4863  H HH12 . ARG A 1 66  ? -7.456  10.322  -3.053  1.00 0.00 ? 66  ARG A HH12 3  
ATOM 4864  H HH21 . ARG A 1 66  ? -7.219  8.604   -6.119  1.00 0.00 ? 66  ARG A HH21 3  
ATOM 4865  H HH22 . ARG A 1 66  ? -6.828  10.064  -5.272  1.00 0.00 ? 66  ARG A HH22 3  
ATOM 4866  N N    . LEU A 1 67  ? -12.670 3.470   -3.517  1.00 0.00 ? 67  LEU A N    3  
ATOM 4867  C CA   . LEU A 1 67  ? -13.677 3.530   -4.563  1.00 0.00 ? 67  LEU A CA   3  
ATOM 4868  C C    . LEU A 1 67  ? -13.634 4.907   -5.228  1.00 0.00 ? 67  LEU A C    3  
ATOM 4869  O O    . LEU A 1 67  ? -14.020 5.906   -4.622  1.00 0.00 ? 67  LEU A O    3  
ATOM 4870  C CB   . LEU A 1 67  ? -15.052 3.159   -4.005  1.00 0.00 ? 67  LEU A CB   3  
ATOM 4871  C CG   . LEU A 1 67  ? -15.536 1.738   -4.301  1.00 0.00 ? 67  LEU A CG   3  
ATOM 4872  C CD1  . LEU A 1 67  ? -17.014 1.575   -3.942  1.00 0.00 ? 67  LEU A CD1  3  
ATOM 4873  C CD2  . LEU A 1 67  ? -15.254 1.355   -5.755  1.00 0.00 ? 67  LEU A CD2  3  
ATOM 4874  H H    . LEU A 1 67  ? -13.021 3.576   -2.587  1.00 0.00 ? 67  LEU A H    3  
ATOM 4875  H HA   . LEU A 1 67  ? -13.419 2.778   -5.309  1.00 0.00 ? 67  LEU A HA   3  
ATOM 4876  H HB2  . LEU A 1 67  ? -15.033 3.297   -2.924  1.00 0.00 ? 67  LEU A HB2  3  
ATOM 4877  H HB3  . LEU A 1 67  ? -15.785 3.861   -4.403  1.00 0.00 ? 67  LEU A HB3  3  
ATOM 4878  H HG   . LEU A 1 67  ? -14.974 1.048   -3.672  1.00 0.00 ? 67  LEU A HG   3  
ATOM 4879  H HD11 . LEU A 1 67  ? -17.154 0.645   -3.391  1.00 0.00 ? 67  LEU A HD11 3  
ATOM 4880  H HD12 . LEU A 1 67  ? -17.332 2.415   -3.323  1.00 0.00 ? 67  LEU A HD12 3  
ATOM 4881  H HD13 . LEU A 1 67  ? -17.609 1.550   -4.855  1.00 0.00 ? 67  LEU A HD13 3  
ATOM 4882  H HD21 . LEU A 1 67  ? -15.462 2.207   -6.402  1.00 0.00 ? 67  LEU A HD21 3  
ATOM 4883  H HD22 . LEU A 1 67  ? -14.208 1.067   -5.859  1.00 0.00 ? 67  LEU A HD22 3  
ATOM 4884  H HD23 . LEU A 1 67  ? -15.892 0.518   -6.041  1.00 0.00 ? 67  LEU A HD23 3  
ATOM 4885  N N    . ASN A 1 68  ? -13.161 4.917   -6.466  1.00 0.00 ? 68  ASN A N    3  
ATOM 4886  C CA   . ASN A 1 68  ? -13.063 6.156   -7.219  1.00 0.00 ? 68  ASN A CA   3  
ATOM 4887  C C    . ASN A 1 68  ? -14.299 7.015   -6.944  1.00 0.00 ? 68  ASN A C    3  
ATOM 4888  O O    . ASN A 1 68  ? -14.205 8.239   -6.873  1.00 0.00 ? 68  ASN A O    3  
ATOM 4889  C CB   . ASN A 1 68  ? -13.003 5.882   -8.723  1.00 0.00 ? 68  ASN A CB   3  
ATOM 4890  C CG   . ASN A 1 68  ? -12.385 7.065   -9.471  1.00 0.00 ? 68  ASN A CG   3  
ATOM 4891  O OD1  . ASN A 1 68  ? -12.106 8.111   -8.909  1.00 0.00 ? 68  ASN A OD1  3  
ATOM 4892  N ND2  . ASN A 1 68  ? -12.186 6.841   -10.767 1.00 0.00 ? 68  ASN A ND2  3  
ATOM 4893  H H    . ASN A 1 68  ? -12.849 4.101   -6.952  1.00 0.00 ? 68  ASN A H    3  
ATOM 4894  H HA   . ASN A 1 68  ? -12.142 6.628   -6.876  1.00 0.00 ? 68  ASN A HA   3  
ATOM 4895  H HB2  . ASN A 1 68  ? -12.416 4.982   -8.910  1.00 0.00 ? 68  ASN A HB2  3  
ATOM 4896  H HB3  . ASN A 1 68  ? -14.007 5.692   -9.102  1.00 0.00 ? 68  ASN A HB3  3  
ATOM 4897  H HD21 . ASN A 1 68  ? -12.437 5.959   -11.167 1.00 0.00 ? 68  ASN A HD21 3  
ATOM 4898  H HD22 . ASN A 1 68  ? -11.786 7.554   -11.343 1.00 0.00 ? 68  ASN A HD22 3  
ATOM 4899  N N    . THR A 1 69  ? -15.429 6.339   -6.796  1.00 0.00 ? 69  THR A N    3  
ATOM 4900  C CA   . THR A 1 69  ? -16.682 7.025   -6.531  1.00 0.00 ? 69  THR A CA   3  
ATOM 4901  C C    . THR A 1 69  ? -17.475 6.287   -5.450  1.00 0.00 ? 69  THR A C    3  
ATOM 4902  O O    . THR A 1 69  ? -17.971 5.185   -5.683  1.00 0.00 ? 69  THR A O    3  
ATOM 4903  C CB   . THR A 1 69  ? -17.437 7.160   -7.854  1.00 0.00 ? 69  THR A CB   3  
ATOM 4904  O OG1  . THR A 1 69  ? -17.883 5.836   -8.136  1.00 0.00 ? 69  THR A OG1  3  
ATOM 4905  C CG2  . THR A 1 69  ? -16.512 7.498   -9.025  1.00 0.00 ? 69  THR A CG2  3  
ATOM 4906  H H    . THR A 1 69  ? -15.497 5.343   -6.856  1.00 0.00 ? 69  THR A H    3  
ATOM 4907  H HA   . THR A 1 69  ? -16.454 8.016   -6.139  1.00 0.00 ? 69  THR A HA   3  
ATOM 4908  H HB   . THR A 1 69  ? -18.242 7.890   -7.771  1.00 0.00 ? 69  THR A HB   3  
ATOM 4909  H HG1  . THR A 1 69  ? -18.449 5.833   -8.960  1.00 0.00 ? 69  THR A HG1  3  
ATOM 4910  H HG21 . THR A 1 69  ? -15.664 6.812   -9.028  1.00 0.00 ? 69  THR A HG21 3  
ATOM 4911  H HG22 . THR A 1 69  ? -17.061 7.400   -9.962  1.00 0.00 ? 69  THR A HG22 3  
ATOM 4912  H HG23 . THR A 1 69  ? -16.151 8.521   -8.919  1.00 0.00 ? 69  THR A HG23 3  
ATOM 4913  N N    . THR A 1 70  ? -17.570 6.923   -4.292  1.00 0.00 ? 70  THR A N    3  
ATOM 4914  C CA   . THR A 1 70  ? -18.295 6.341   -3.176  1.00 0.00 ? 70  THR A CA   3  
ATOM 4915  C C    . THR A 1 70  ? -18.339 7.319   -2.000  1.00 0.00 ? 70  THR A C    3  
ATOM 4916  O O    . THR A 1 70  ? -18.071 8.508   -2.167  1.00 0.00 ? 70  THR A O    3  
ATOM 4917  C CB   . THR A 1 70  ? -17.636 5.004   -2.830  1.00 0.00 ? 70  THR A CB   3  
ATOM 4918  O OG1  . THR A 1 70  ? -18.450 4.475   -1.787  1.00 0.00 ? 70  THR A OG1  3  
ATOM 4919  C CG2  . THR A 1 70  ? -16.263 5.179   -2.179  1.00 0.00 ? 70  THR A CG2  3  
ATOM 4920  H H    . THR A 1 70  ? -17.164 7.819   -4.111  1.00 0.00 ? 70  THR A H    3  
ATOM 4921  H HA   . THR A 1 70  ? -19.325 6.169   -3.487  1.00 0.00 ? 70  THR A HA   3  
ATOM 4922  H HB   . THR A 1 70  ? -17.571 4.363   -3.709  1.00 0.00 ? 70  THR A HB   3  
ATOM 4923  H HG1  . THR A 1 70  ? -18.660 3.515   -1.970  1.00 0.00 ? 70  THR A HG1  3  
ATOM 4924  H HG21 . THR A 1 70  ? -16.261 6.084   -1.571  1.00 0.00 ? 70  THR A HG21 3  
ATOM 4925  H HG22 . THR A 1 70  ? -16.047 4.317   -1.548  1.00 0.00 ? 70  THR A HG22 3  
ATOM 4926  H HG23 . THR A 1 70  ? -15.501 5.261   -2.954  1.00 0.00 ? 70  THR A HG23 3  
ATOM 4927  N N    . THR A 1 71  ? -18.678 6.782   -0.837  1.00 0.00 ? 71  THR A N    3  
ATOM 4928  C CA   . THR A 1 71  ? -18.760 7.592   0.366   1.00 0.00 ? 71  THR A CA   3  
ATOM 4929  C C    . THR A 1 71  ? -18.490 6.736   1.605   1.00 0.00 ? 71  THR A C    3  
ATOM 4930  O O    . THR A 1 71  ? -19.387 6.057   2.102   1.00 0.00 ? 71  THR A O    3  
ATOM 4931  C CB   . THR A 1 71  ? -20.129 8.274   0.385   1.00 0.00 ? 71  THR A CB   3  
ATOM 4932  O OG1  . THR A 1 71  ? -21.056 7.192   0.346   1.00 0.00 ? 71  THR A OG1  3  
ATOM 4933  C CG2  . THR A 1 71  ? -20.413 9.053   -0.901  1.00 0.00 ? 71  THR A CG2  3  
ATOM 4934  H H    . THR A 1 71  ? -18.894 5.814   -0.710  1.00 0.00 ? 71  THR A H    3  
ATOM 4935  H HA   . THR A 1 71  ? -17.977 8.350   0.324   1.00 0.00 ? 71  THR A HA   3  
ATOM 4936  H HB   . THR A 1 71  ? -20.233 8.915   1.260   1.00 0.00 ? 71  THR A HB   3  
ATOM 4937  H HG1  . THR A 1 71  ? -21.990 7.538   0.433   1.00 0.00 ? 71  THR A HG1  3  
ATOM 4938  H HG21 . THR A 1 71  ? -19.608 9.765   -1.079  1.00 0.00 ? 71  THR A HG21 3  
ATOM 4939  H HG22 . THR A 1 71  ? -20.478 8.360   -1.740  1.00 0.00 ? 71  THR A HG22 3  
ATOM 4940  H HG23 . THR A 1 71  ? -21.357 9.590   -0.800  1.00 0.00 ? 71  THR A HG23 3  
ATOM 4941  N N    . ALA A 1 72  ? -17.250 6.796   2.068   1.00 0.00 ? 72  ALA A N    3  
ATOM 4942  C CA   . ALA A 1 72  ? -16.851 6.034   3.239   1.00 0.00 ? 72  ALA A CA   3  
ATOM 4943  C C    . ALA A 1 72  ? -16.020 6.927   4.164   1.00 0.00 ? 72  ALA A C    3  
ATOM 4944  O O    . ALA A 1 72  ? -15.896 8.127   3.926   1.00 0.00 ? 72  ALA A O    3  
ATOM 4945  C CB   . ALA A 1 72  ? -16.090 4.782   2.799   1.00 0.00 ? 72  ALA A CB   3  
ATOM 4946  H H    . ALA A 1 72  ? -16.526 7.350   1.657   1.00 0.00 ? 72  ALA A H    3  
ATOM 4947  H HA   . ALA A 1 72  ? -17.758 5.729   3.761   1.00 0.00 ? 72  ALA A HA   3  
ATOM 4948  H HB1  . ALA A 1 72  ? -16.648 3.894   3.097   1.00 0.00 ? 72  ALA A HB1  3  
ATOM 4949  H HB2  . ALA A 1 72  ? -15.971 4.791   1.716   1.00 0.00 ? 72  ALA A HB2  3  
ATOM 4950  H HB3  . ALA A 1 72  ? -15.107 4.769   3.272   1.00 0.00 ? 72  ALA A HB3  3  
ATOM 4951  N N    . ASN A 1 73  ? -15.473 6.306   5.198   1.00 0.00 ? 73  ASN A N    3  
ATOM 4952  C CA   . ASN A 1 73  ? -14.658 7.029   6.159   1.00 0.00 ? 73  ASN A CA   3  
ATOM 4953  C C    . ASN A 1 73  ? -13.346 7.450   5.494   1.00 0.00 ? 73  ASN A C    3  
ATOM 4954  O O    . ASN A 1 73  ? -12.938 8.606   5.595   1.00 0.00 ? 73  ASN A O    3  
ATOM 4955  C CB   . ASN A 1 73  ? -14.317 6.150   7.364   1.00 0.00 ? 73  ASN A CB   3  
ATOM 4956  C CG   . ASN A 1 73  ? -13.927 4.738   6.920   1.00 0.00 ? 73  ASN A CG   3  
ATOM 4957  O OD1  . ASN A 1 73  ? -14.736 3.970   6.425   1.00 0.00 ? 73  ASN A OD1  3  
ATOM 4958  N ND2  . ASN A 1 73  ? -12.647 4.441   7.124   1.00 0.00 ? 73  ASN A ND2  3  
ATOM 4959  H H    . ASN A 1 73  ? -15.579 5.329   5.384   1.00 0.00 ? 73  ASN A H    3  
ATOM 4960  H HA   . ASN A 1 73  ? -15.264 7.883   6.464   1.00 0.00 ? 73  ASN A HA   3  
ATOM 4961  H HB2  . ASN A 1 73  ? -13.496 6.598   7.925   1.00 0.00 ? 73  ASN A HB2  3  
ATOM 4962  H HB3  . ASN A 1 73  ? -15.173 6.100   8.037   1.00 0.00 ? 73  ASN A HB3  3  
ATOM 4963  H HD21 . ASN A 1 73  ? -12.036 5.118   7.534   1.00 0.00 ? 73  ASN A HD21 3  
ATOM 4964  H HD22 . ASN A 1 73  ? -12.296 3.541   6.866   1.00 0.00 ? 73  ASN A HD22 3  
ATOM 4965  N N    . THR A 1 74  ? -12.721 6.489   4.830   1.00 0.00 ? 74  THR A N    3  
ATOM 4966  C CA   . THR A 1 74  ? -11.464 6.745   4.148   1.00 0.00 ? 74  THR A CA   3  
ATOM 4967  C C    . THR A 1 74  ? -10.960 5.474   3.463   1.00 0.00 ? 74  THR A C    3  
ATOM 4968  O O    . THR A 1 74  ? -11.579 4.417   3.574   1.00 0.00 ? 74  THR A O    3  
ATOM 4969  C CB   . THR A 1 74  ? -10.479 7.315   5.171   1.00 0.00 ? 74  THR A CB   3  
ATOM 4970  O OG1  . THR A 1 74  ? -9.964  8.485   4.543   1.00 0.00 ? 74  THR A OG1  3  
ATOM 4971  C CG2  . THR A 1 74  ? -9.252  6.422   5.363   1.00 0.00 ? 74  THR A CG2  3  
ATOM 4972  H H    . THR A 1 74  ? -13.060 5.551   4.752   1.00 0.00 ? 74  THR A H    3  
ATOM 4973  H HA   . THR A 1 74  ? -11.642 7.482   3.365   1.00 0.00 ? 74  THR A HA   3  
ATOM 4974  H HB   . THR A 1 74  ? -10.975 7.505   6.124   1.00 0.00 ? 74  THR A HB   3  
ATOM 4975  H HG1  . THR A 1 74  ? -10.324 9.302   4.992   1.00 0.00 ? 74  THR A HG1  3  
ATOM 4976  H HG21 . THR A 1 74  ? -8.713  6.733   6.258   1.00 0.00 ? 74  THR A HG21 3  
ATOM 4977  H HG22 . THR A 1 74  ? -9.569  5.385   5.471   1.00 0.00 ? 74  THR A HG22 3  
ATOM 4978  H HG23 . THR A 1 74  ? -8.598  6.514   4.495   1.00 0.00 ? 74  THR A HG23 3  
ATOM 4979  N N    . ALA A 1 75  ? -9.841  5.618   2.769   1.00 0.00 ? 75  ALA A N    3  
ATOM 4980  C CA   . ALA A 1 75  ? -9.246  4.494   2.065   1.00 0.00 ? 75  ALA A CA   3  
ATOM 4981  C C    . ALA A 1 75  ? -8.310  3.742   3.013   1.00 0.00 ? 75  ALA A C    3  
ATOM 4982  O O    . ALA A 1 75  ? -7.492  4.354   3.699   1.00 0.00 ? 75  ALA A O    3  
ATOM 4983  C CB   . ALA A 1 75  ? -8.526  4.999   0.813   1.00 0.00 ? 75  ALA A CB   3  
ATOM 4984  H H    . ALA A 1 75  ? -9.343  6.481   2.683   1.00 0.00 ? 75  ALA A H    3  
ATOM 4985  H HA   . ALA A 1 75  ? -10.054 3.828   1.761   1.00 0.00 ? 75  ALA A HA   3  
ATOM 4986  H HB1  . ALA A 1 75  ? -9.202  5.626   0.232   1.00 0.00 ? 75  ALA A HB1  3  
ATOM 4987  H HB2  . ALA A 1 75  ? -7.652  5.581   1.106   1.00 0.00 ? 75  ALA A HB2  3  
ATOM 4988  H HB3  . ALA A 1 75  ? -8.209  4.149   0.209   1.00 0.00 ? 75  ALA A HB3  3  
ATOM 4989  N N    . THR A 1 76  ? -8.461  2.426   3.022   1.00 0.00 ? 76  THR A N    3  
ATOM 4990  C CA   . THR A 1 76  ? -7.640  1.584   3.874   1.00 0.00 ? 76  THR A CA   3  
ATOM 4991  C C    . THR A 1 76  ? -6.393  1.116   3.120   1.00 0.00 ? 76  THR A C    3  
ATOM 4992  O O    . THR A 1 76  ? -6.457  0.175   2.331   1.00 0.00 ? 76  THR A O    3  
ATOM 4993  C CB   . THR A 1 76  ? -8.510  0.432   4.382   1.00 0.00 ? 76  THR A CB   3  
ATOM 4994  O OG1  . THR A 1 76  ? -9.284  1.016   5.426   1.00 0.00 ? 76  THR A OG1  3  
ATOM 4995  C CG2  . THR A 1 76  ? -7.693  -0.653  5.086   1.00 0.00 ? 76  THR A CG2  3  
ATOM 4996  H H    . THR A 1 76  ? -9.129  1.936   2.461   1.00 0.00 ? 76  THR A H    3  
ATOM 4997  H HA   . THR A 1 76  ? -7.297  2.181   4.719   1.00 0.00 ? 76  THR A HA   3  
ATOM 4998  H HB   . THR A 1 76  ? -9.105  0.009   3.573   1.00 0.00 ? 76  THR A HB   3  
ATOM 4999  H HG1  . THR A 1 76  ? -9.888  1.720   5.052   1.00 0.00 ? 76  THR A HG1  3  
ATOM 5000  H HG21 . THR A 1 76  ? -7.840  -0.577  6.163   1.00 0.00 ? 76  THR A HG21 3  
ATOM 5001  H HG22 . THR A 1 76  ? -8.021  -1.634  4.743   1.00 0.00 ? 76  THR A HG22 3  
ATOM 5002  H HG23 . THR A 1 76  ? -6.637  -0.521  4.853   1.00 0.00 ? 76  THR A HG23 3  
ATOM 5003  N N    . VAL A 1 77  ? -5.288  1.796   3.390   1.00 0.00 ? 77  VAL A N    3  
ATOM 5004  C CA   . VAL A 1 77  ? -4.029  1.462   2.747   1.00 0.00 ? 77  VAL A CA   3  
ATOM 5005  C C    . VAL A 1 77  ? -3.348  0.333   3.523   1.00 0.00 ? 77  VAL A C    3  
ATOM 5006  O O    . VAL A 1 77  ? -3.471  0.252   4.744   1.00 0.00 ? 77  VAL A O    3  
ATOM 5007  C CB   . VAL A 1 77  ? -3.156  2.713   2.623   1.00 0.00 ? 77  VAL A CB   3  
ATOM 5008  C CG1  . VAL A 1 77  ? -4.017  3.973   2.519   1.00 0.00 ? 77  VAL A CG1  3  
ATOM 5009  C CG2  . VAL A 1 77  ? -2.174  2.814   3.792   1.00 0.00 ? 77  VAL A CG2  3  
ATOM 5010  H H    . VAL A 1 77  ? -5.244  2.560   4.033   1.00 0.00 ? 77  VAL A H    3  
ATOM 5011  H HA   . VAL A 1 77  ? -4.256  1.108   1.741   1.00 0.00 ? 77  VAL A HA   3  
ATOM 5012  H HB   . VAL A 1 77  ? -2.576  2.627   1.704   1.00 0.00 ? 77  VAL A HB   3  
ATOM 5013  H HG11 . VAL A 1 77  ? -4.845  3.792   1.834   1.00 0.00 ? 77  VAL A HG11 3  
ATOM 5014  H HG12 . VAL A 1 77  ? -4.410  4.227   3.504   1.00 0.00 ? 77  VAL A HG12 3  
ATOM 5015  H HG13 . VAL A 1 77  ? -3.410  4.798   2.146   1.00 0.00 ? 77  VAL A HG13 3  
ATOM 5016  H HG21 . VAL A 1 77  ? -2.608  2.341   4.673   1.00 0.00 ? 77  VAL A HG21 3  
ATOM 5017  H HG22 . VAL A 1 77  ? -1.244  2.310   3.529   1.00 0.00 ? 77  VAL A HG22 3  
ATOM 5018  H HG23 . VAL A 1 77  ? -1.971  3.863   4.006   1.00 0.00 ? 77  VAL A HG23 3  
ATOM 5019  N N    . GLU A 1 78  ? -2.645  -0.511  2.782   1.00 0.00 ? 78  GLU A N    3  
ATOM 5020  C CA   . GLU A 1 78  ? -1.944  -1.632  3.386   1.00 0.00 ? 78  GLU A CA   3  
ATOM 5021  C C    . GLU A 1 78  ? -0.459  -1.589  3.021   1.00 0.00 ? 78  GLU A C    3  
ATOM 5022  O O    . GLU A 1 78  ? -0.106  -1.341  1.869   1.00 0.00 ? 78  GLU A O    3  
ATOM 5023  C CB   . GLU A 1 78  ? -2.573  -2.962  2.966   1.00 0.00 ? 78  GLU A CB   3  
ATOM 5024  C CG   . GLU A 1 78  ? -1.631  -4.131  3.259   1.00 0.00 ? 78  GLU A CG   3  
ATOM 5025  C CD   . GLU A 1 78  ? -2.377  -5.281  3.938   1.00 0.00 ? 78  GLU A CD   3  
ATOM 5026  O OE1  . GLU A 1 78  ? -3.258  -4.973  4.770   1.00 0.00 ? 78  GLU A OE1  3  
ATOM 5027  O OE2  . GLU A 1 78  ? -2.051  -6.442  3.609   1.00 0.00 ? 78  GLU A OE2  3  
ATOM 5028  H H    . GLU A 1 78  ? -2.550  -0.439  1.790   1.00 0.00 ? 78  GLU A H    3  
ATOM 5029  H HA   . GLU A 1 78  ? -2.065  -1.504  4.462   1.00 0.00 ? 78  GLU A HA   3  
ATOM 5030  H HB2  . GLU A 1 78  ? -3.514  -3.107  3.497   1.00 0.00 ? 78  GLU A HB2  3  
ATOM 5031  H HB3  . GLU A 1 78  ? -2.809  -2.938  1.902   1.00 0.00 ? 78  GLU A HB3  3  
ATOM 5032  H HG2  . GLU A 1 78  ? -1.182  -4.483  2.330   1.00 0.00 ? 78  GLU A HG2  3  
ATOM 5033  H HG3  . GLU A 1 78  ? -0.815  -3.794  3.899   1.00 0.00 ? 78  GLU A HG3  3  
ATOM 5034  N N    . VAL A 1 79  ? 0.371   -1.834  4.024   1.00 0.00 ? 79  VAL A N    3  
ATOM 5035  C CA   . VAL A 1 79  ? 1.810   -1.826  3.824   1.00 0.00 ? 79  VAL A CA   3  
ATOM 5036  C C    . VAL A 1 79  ? 2.276   -3.233  3.442   1.00 0.00 ? 79  VAL A C    3  
ATOM 5037  O O    . VAL A 1 79  ? 1.924   -4.207  4.105   1.00 0.00 ? 79  VAL A O    3  
ATOM 5038  C CB   . VAL A 1 79  ? 2.510   -1.282  5.071   1.00 0.00 ? 79  VAL A CB   3  
ATOM 5039  C CG1  . VAL A 1 79  ? 3.873   -1.948  5.269   1.00 0.00 ? 79  VAL A CG1  3  
ATOM 5040  C CG2  . VAL A 1 79  ? 2.647   0.240   5.003   1.00 0.00 ? 79  VAL A CG2  3  
ATOM 5041  H H    . VAL A 1 79  ? 0.076   -2.035  4.958   1.00 0.00 ? 79  VAL A H    3  
ATOM 5042  H HA   . VAL A 1 79  ? 2.023   -1.150  2.996   1.00 0.00 ? 79  VAL A HA   3  
ATOM 5043  H HB   . VAL A 1 79  ? 1.890   -1.524  5.935   1.00 0.00 ? 79  VAL A HB   3  
ATOM 5044  H HG11 . VAL A 1 79  ? 4.397   -1.993  4.314   1.00 0.00 ? 79  VAL A HG11 3  
ATOM 5045  H HG12 . VAL A 1 79  ? 4.461   -1.367  5.979   1.00 0.00 ? 79  VAL A HG12 3  
ATOM 5046  H HG13 . VAL A 1 79  ? 3.732   -2.958  5.654   1.00 0.00 ? 79  VAL A HG13 3  
ATOM 5047  H HG21 . VAL A 1 79  ? 1.676   0.683   4.784   1.00 0.00 ? 79  VAL A HG21 3  
ATOM 5048  H HG22 . VAL A 1 79  ? 3.010   0.615   5.960   1.00 0.00 ? 79  VAL A HG22 3  
ATOM 5049  H HG23 . VAL A 1 79  ? 3.354   0.506   4.217   1.00 0.00 ? 79  VAL A HG23 3  
ATOM 5050  N N    . LEU A 1 80  ? 3.059   -3.294  2.376   1.00 0.00 ? 80  LEU A N    3  
ATOM 5051  C CA   . LEU A 1 80  ? 3.576   -4.565  1.898   1.00 0.00 ? 80  LEU A CA   3  
ATOM 5052  C C    . LEU A 1 80  ? 5.081   -4.630  2.164   1.00 0.00 ? 80  LEU A C    3  
ATOM 5053  O O    . LEU A 1 80  ? 5.690   -3.637  2.558   1.00 0.00 ? 80  LEU A O    3  
ATOM 5054  C CB   . LEU A 1 80  ? 3.201   -4.779  0.431   1.00 0.00 ? 80  LEU A CB   3  
ATOM 5055  C CG   . LEU A 1 80  ? 1.728   -5.089  0.153   1.00 0.00 ? 80  LEU A CG   3  
ATOM 5056  C CD1  . LEU A 1 80  ? 1.223   -4.309  -1.062  1.00 0.00 ? 80  LEU A CD1  3  
ATOM 5057  C CD2  . LEU A 1 80  ? 1.504   -6.595  0.002   1.00 0.00 ? 80  LEU A CD2  3  
ATOM 5058  H H    . LEU A 1 80  ? 3.340   -2.496  1.842   1.00 0.00 ? 80  LEU A H    3  
ATOM 5059  H HA   . LEU A 1 80  ? 3.089   -5.352  2.474   1.00 0.00 ? 80  LEU A HA   3  
ATOM 5060  H HB2  . LEU A 1 80  ? 3.475   -3.884  -0.128  1.00 0.00 ? 80  LEU A HB2  3  
ATOM 5061  H HB3  . LEU A 1 80  ? 3.804   -5.597  0.038   1.00 0.00 ? 80  LEU A HB3  3  
ATOM 5062  H HG   . LEU A 1 80  ? 1.142   -4.761  1.012   1.00 0.00 ? 80  LEU A HG   3  
ATOM 5063  H HD11 . LEU A 1 80  ? 0.243   -4.685  -1.354  1.00 0.00 ? 80  LEU A HD11 3  
ATOM 5064  H HD12 . LEU A 1 80  ? 1.146   -3.251  -0.809  1.00 0.00 ? 80  LEU A HD12 3  
ATOM 5065  H HD13 . LEU A 1 80  ? 1.922   -4.433  -1.890  1.00 0.00 ? 80  LEU A HD13 3  
ATOM 5066  H HD21 . LEU A 1 80  ? 0.681   -6.906  0.645   1.00 0.00 ? 80  LEU A HD21 3  
ATOM 5067  H HD22 . LEU A 1 80  ? 1.261   -6.823  -1.036  1.00 0.00 ? 80  LEU A HD22 3  
ATOM 5068  H HD23 . LEU A 1 80  ? 2.410   -7.128  0.288   1.00 0.00 ? 80  LEU A HD23 3  
ATOM 5069  N N    . ALA A 1 81  ? 5.639   -5.811  1.937   1.00 0.00 ? 81  ALA A N    3  
ATOM 5070  C CA   . ALA A 1 81  ? 7.062   -6.019  2.147   1.00 0.00 ? 81  ALA A CA   3  
ATOM 5071  C C    . ALA A 1 81  ? 7.840   -5.410  0.978   1.00 0.00 ? 81  ALA A C    3  
ATOM 5072  O O    . ALA A 1 81  ? 7.253   -5.040  -0.037  1.00 0.00 ? 81  ALA A O    3  
ATOM 5073  C CB   . ALA A 1 81  ? 7.340   -7.514  2.317   1.00 0.00 ? 81  ALA A CB   3  
ATOM 5074  H H    . ALA A 1 81  ? 5.137   -6.614  1.616   1.00 0.00 ? 81  ALA A H    3  
ATOM 5075  H HA   . ALA A 1 81  ? 7.341   -5.503  3.066   1.00 0.00 ? 81  ALA A HA   3  
ATOM 5076  H HB1  . ALA A 1 81  ? 7.950   -7.866  1.485   1.00 0.00 ? 81  ALA A HB1  3  
ATOM 5077  H HB2  . ALA A 1 81  ? 7.871   -7.680  3.254   1.00 0.00 ? 81  ALA A HB2  3  
ATOM 5078  H HB3  . ALA A 1 81  ? 6.396   -8.059  2.332   1.00 0.00 ? 81  ALA A HB3  3  
ATOM 5079  N N    . PRO A 1 82  ? 9.184   -5.323  1.166   1.00 0.00 ? 82  PRO A N    3  
ATOM 5080  C CA   . PRO A 1 82  ? 10.048  -4.765  0.139   1.00 0.00 ? 82  PRO A CA   3  
ATOM 5081  C C    . PRO A 1 82  ? 10.238  -5.754  -1.013  1.00 0.00 ? 82  PRO A C    3  
ATOM 5082  O O    . PRO A 1 82  ? 10.828  -5.412  -2.037  1.00 0.00 ? 82  PRO A O    3  
ATOM 5083  C CB   . PRO A 1 82  ? 11.346  -4.432  0.857   1.00 0.00 ? 82  PRO A CB   3  
ATOM 5084  C CG   . PRO A 1 82  ? 11.329  -5.237  2.146   1.00 0.00 ? 82  PRO A CG   3  
ATOM 5085  C CD   . PRO A 1 82  ? 9.914   -5.750  2.356   1.00 0.00 ? 82  PRO A CD   3  
ATOM 5086  H HA   . PRO A 1 82  ? 9.628   -3.953  -0.264  1.00 0.00 ? 82  PRO A HA   3  
ATOM 5087  H HB2  . PRO A 1 82  ? 12.209  -4.694  0.244   1.00 0.00 ? 82  PRO A HB2  3  
ATOM 5088  H HB3  . PRO A 1 82  ? 11.415  -3.364  1.064   1.00 0.00 ? 82  PRO A HB3  3  
ATOM 5089  H HG2  . PRO A 1 82  ? 12.032  -6.069  2.086   1.00 0.00 ? 82  PRO A HG2  3  
ATOM 5090  H HG3  . PRO A 1 82  ? 11.639  -4.618  2.987   1.00 0.00 ? 82  PRO A HG3  3  
ATOM 5091  H HD2  . PRO A 1 82  ? 9.897   -6.835  2.462   1.00 0.00 ? 82  PRO A HD2  3  
ATOM 5092  H HD3  . PRO A 1 82  ? 9.472   -5.335  3.262   1.00 0.00 ? 82  PRO A HD3  3  
ATOM 5093  N N    . SER A 1 83  ? 9.728   -6.959  -0.807  1.00 0.00 ? 83  SER A N    3  
ATOM 5094  C CA   . SER A 1 83  ? 9.834   -7.999  -1.816  1.00 0.00 ? 83  SER A CA   3  
ATOM 5095  C C    . SER A 1 83  ? 8.442   -8.376  -2.328  1.00 0.00 ? 83  SER A C    3  
ATOM 5096  O O    . SER A 1 83  ? 8.189   -9.536  -2.649  1.00 0.00 ? 83  SER A O    3  
ATOM 5097  C CB   . SER A 1 83  ? 10.548  -9.233  -1.262  1.00 0.00 ? 83  SER A CB   3  
ATOM 5098  O OG   . SER A 1 83  ? 9.804   -9.857  -0.219  1.00 0.00 ? 83  SER A OG   3  
ATOM 5099  H H    . SER A 1 83  ? 9.250   -7.228  0.029   1.00 0.00 ? 83  SER A H    3  
ATOM 5100  H HA   . SER A 1 83  ? 10.432  -7.564  -2.617  1.00 0.00 ? 83  SER A HA   3  
ATOM 5101  H HB2  . SER A 1 83  ? 10.714  -9.949  -2.067  1.00 0.00 ? 83  SER A HB2  3  
ATOM 5102  H HB3  . SER A 1 83  ? 11.529  -8.946  -0.885  1.00 0.00 ? 83  SER A HB3  3  
ATOM 5103  H HG   . SER A 1 83  ? 9.125   -10.480 -0.609  1.00 0.00 ? 83  SER A HG   3  
ATOM 5104  N N    . ALA A 1 84  ? 7.577   -7.374  -2.387  1.00 0.00 ? 84  ALA A N    3  
ATOM 5105  C CA   . ALA A 1 84  ? 6.218   -7.586  -2.854  1.00 0.00 ? 84  ALA A CA   3  
ATOM 5106  C C    . ALA A 1 84  ? 6.097   -7.097  -4.299  1.00 0.00 ? 84  ALA A C    3  
ATOM 5107  O O    . ALA A 1 84  ? 6.328   -5.922  -4.581  1.00 0.00 ? 84  ALA A O    3  
ATOM 5108  C CB   . ALA A 1 84  ? 5.239   -6.878  -1.915  1.00 0.00 ? 84  ALA A CB   3  
ATOM 5109  H H    . ALA A 1 84  ? 7.792   -6.434  -2.124  1.00 0.00 ? 84  ALA A H    3  
ATOM 5110  H HA   . ALA A 1 84  ? 6.020   -8.658  -2.825  1.00 0.00 ? 84  ALA A HA   3  
ATOM 5111  H HB1  . ALA A 1 84  ? 5.160   -7.438  -0.983  1.00 0.00 ? 84  ALA A HB1  3  
ATOM 5112  H HB2  . ALA A 1 84  ? 5.601   -5.872  -1.705  1.00 0.00 ? 84  ALA A HB2  3  
ATOM 5113  H HB3  . ALA A 1 84  ? 4.259   -6.821  -2.389  1.00 0.00 ? 84  ALA A HB3  3  
ATOM 5114  N N    . ARG A 1 85  ? 5.737   -8.022  -5.176  1.00 0.00 ? 85  ARG A N    3  
ATOM 5115  C CA   . ARG A 1 85  ? 5.583   -7.700  -6.584  1.00 0.00 ? 85  ARG A CA   3  
ATOM 5116  C C    . ARG A 1 85  ? 4.100   -7.608  -6.949  1.00 0.00 ? 85  ARG A C    3  
ATOM 5117  O O    . ARG A 1 85  ? 3.749   -7.107  -8.016  1.00 0.00 ? 85  ARG A O    3  
ATOM 5118  C CB   . ARG A 1 85  ? 6.254   -8.754  -7.467  1.00 0.00 ? 85  ARG A CB   3  
ATOM 5119  C CG   . ARG A 1 85  ? 7.137   -8.098  -8.530  1.00 0.00 ? 85  ARG A CG   3  
ATOM 5120  C CD   . ARG A 1 85  ? 6.448   -8.104  -9.896  1.00 0.00 ? 85  ARG A CD   3  
ATOM 5121  N NE   . ARG A 1 85  ? 6.843   -9.310  -10.657 1.00 0.00 ? 85  ARG A NE   3  
ATOM 5122  C CZ   . ARG A 1 85  ? 6.320   -9.656  -11.841 1.00 0.00 ? 85  ARG A CZ   3  
ATOM 5123  N NH1  . ARG A 1 85  ? 5.378   -8.890  -12.407 1.00 0.00 ? 85  ARG A NH1  3  
ATOM 5124  N NH2  . ARG A 1 85  ? 6.740   -10.769 -12.459 1.00 0.00 ? 85  ARG A NH2  3  
ATOM 5125  H H    . ARG A 1 85  ? 5.552   -8.976  -4.938  1.00 0.00 ? 85  ARG A H    3  
ATOM 5126  H HA   . ARG A 1 85  ? 6.077   -6.736  -6.705  1.00 0.00 ? 85  ARG A HA   3  
ATOM 5127  H HB2  . ARG A 1 85  ? 6.856   -9.421  -6.850  1.00 0.00 ? 85  ARG A HB2  3  
ATOM 5128  H HB3  . ARG A 1 85  ? 5.493   -9.367  -7.949  1.00 0.00 ? 85  ARG A HB3  3  
ATOM 5129  H HG2  . ARG A 1 85  ? 7.363   -7.072  -8.237  1.00 0.00 ? 85  ARG A HG2  3  
ATOM 5130  H HG3  . ARG A 1 85  ? 8.087   -8.627  -8.596  1.00 0.00 ? 85  ARG A HG3  3  
ATOM 5131  H HD2  . ARG A 1 85  ? 5.366   -8.084  -9.766  1.00 0.00 ? 85  ARG A HD2  3  
ATOM 5132  H HD3  . ARG A 1 85  ? 6.719   -7.207  -10.453 1.00 0.00 ? 85  ARG A HD3  3  
ATOM 5133  H HE   . ARG A 1 85  ? 7.544   -9.905  -10.262 1.00 0.00 ? 85  ARG A HE   3  
ATOM 5134  H HH11 . ARG A 1 85  ? 5.065   -8.060  -11.946 1.00 0.00 ? 85  ARG A HH11 3  
ATOM 5135  H HH12 . ARG A 1 85  ? 4.988   -9.148  -13.291 1.00 0.00 ? 85  ARG A HH12 3  
ATOM 5136  H HH21 . ARG A 1 85  ? 7.443   -11.341 -12.037 1.00 0.00 ? 85  ARG A HH21 3  
ATOM 5137  H HH22 . ARG A 1 85  ? 6.349   -11.027 -13.343 1.00 0.00 ? 85  ARG A HH22 3  
ATOM 5138  N N    . GLN A 1 86  ? 3.269   -8.099  -6.041  1.00 0.00 ? 86  GLN A N    3  
ATOM 5139  C CA   . GLN A 1 86  ? 1.832   -8.078  -6.254  1.00 0.00 ? 86  GLN A CA   3  
ATOM 5140  C C    . GLN A 1 86  ? 1.096   -8.078  -4.912  1.00 0.00 ? 86  GLN A C    3  
ATOM 5141  O O    . GLN A 1 86  ? 1.691   -8.366  -3.874  1.00 0.00 ? 86  GLN A O    3  
ATOM 5142  C CB   . GLN A 1 86  ? 1.389   -9.258  -7.122  1.00 0.00 ? 86  GLN A CB   3  
ATOM 5143  C CG   . GLN A 1 86  ? 1.667   -10.589 -6.420  1.00 0.00 ? 86  GLN A CG   3  
ATOM 5144  C CD   . GLN A 1 86  ? 1.840   -11.719 -7.437  1.00 0.00 ? 86  GLN A CD   3  
ATOM 5145  O OE1  . GLN A 1 86  ? 1.382   -11.649 -8.566  1.00 0.00 ? 86  GLN A OE1  3  
ATOM 5146  N NE2  . GLN A 1 86  ? 2.525   -12.762 -6.976  1.00 0.00 ? 86  GLN A NE2  3  
ATOM 5147  H H    . GLN A 1 86  ? 3.562   -8.505  -5.176  1.00 0.00 ? 86  GLN A H    3  
ATOM 5148  H HA   . GLN A 1 86  ? 1.631   -7.148  -6.786  1.00 0.00 ? 86  GLN A HA   3  
ATOM 5149  H HB2  . GLN A 1 86  ? 0.324   -9.174  -7.340  1.00 0.00 ? 86  GLN A HB2  3  
ATOM 5150  H HB3  . GLN A 1 86  ? 1.914   -9.229  -8.076  1.00 0.00 ? 86  GLN A HB3  3  
ATOM 5151  H HG2  . GLN A 1 86  ? 2.567   -10.502 -5.811  1.00 0.00 ? 86  GLN A HG2  3  
ATOM 5152  H HG3  . GLN A 1 86  ? 0.846   -10.826 -5.744  1.00 0.00 ? 86  GLN A HG3  3  
ATOM 5153  H HE21 . GLN A 1 86  ? 2.874   -12.756 -6.039  1.00 0.00 ? 86  GLN A HE21 3  
ATOM 5154  H HE22 . GLN A 1 86  ? 2.691   -13.551 -7.567  1.00 0.00 ? 86  GLN A HE22 3  
ATOM 5155  N N    . TYR A 1 87  ? -0.186  -7.752  -4.976  1.00 0.00 ? 87  TYR A N    3  
ATOM 5156  C CA   . TYR A 1 87  ? -1.009  -7.710  -3.779  1.00 0.00 ? 87  TYR A CA   3  
ATOM 5157  C C    . TYR A 1 87  ? -2.430  -8.195  -4.073  1.00 0.00 ? 87  TYR A C    3  
ATOM 5158  O O    . TYR A 1 87  ? -2.907  -8.084  -5.202  1.00 0.00 ? 87  TYR A O    3  
ATOM 5159  C CB   . TYR A 1 87  ? -1.062  -6.241  -3.355  1.00 0.00 ? 87  TYR A CB   3  
ATOM 5160  C CG   . TYR A 1 87  ? -2.097  -5.945  -2.268  1.00 0.00 ? 87  TYR A CG   3  
ATOM 5161  C CD1  . TYR A 1 87  ? -1.843  -6.296  -0.958  1.00 0.00 ? 87  TYR A CD1  3  
ATOM 5162  C CD2  . TYR A 1 87  ? -3.285  -5.325  -2.599  1.00 0.00 ? 87  TYR A CD2  3  
ATOM 5163  C CE1  . TYR A 1 87  ? -2.818  -6.017  0.064   1.00 0.00 ? 87  TYR A CE1  3  
ATOM 5164  C CE2  . TYR A 1 87  ? -4.260  -5.046  -1.576  1.00 0.00 ? 87  TYR A CE2  3  
ATOM 5165  C CZ   . TYR A 1 87  ? -3.978  -5.405  -0.295  1.00 0.00 ? 87  TYR A CZ   3  
ATOM 5166  O OH   . TYR A 1 87  ? -4.899  -5.141  0.670   1.00 0.00 ? 87  TYR A OH   3  
ATOM 5167  H H    . TYR A 1 87  ? -0.662  -7.519  -5.825  1.00 0.00 ? 87  TYR A H    3  
ATOM 5168  H HA   . TYR A 1 87  ? -0.555  -8.367  -3.037  1.00 0.00 ? 87  TYR A HA   3  
ATOM 5169  H HB2  . TYR A 1 87  ? -0.077  -5.942  -2.995  1.00 0.00 ? 87  TYR A HB2  3  
ATOM 5170  H HB3  . TYR A 1 87  ? -1.281  -5.629  -4.229  1.00 0.00 ? 87  TYR A HB3  3  
ATOM 5171  H HD1  . TYR A 1 87  ? -0.905  -6.786  -0.698  1.00 0.00 ? 87  TYR A HD1  3  
ATOM 5172  H HD2  . TYR A 1 87  ? -3.486  -5.047  -3.634  1.00 0.00 ? 87  TYR A HD2  3  
ATOM 5173  H HE1  . TYR A 1 87  ? -2.630  -6.289  1.103   1.00 0.00 ? 87  TYR A HE1  3  
ATOM 5174  H HE2  . TYR A 1 87  ? -5.203  -4.557  -1.823  1.00 0.00 ? 87  TYR A HE2  3  
ATOM 5175  H HH   . TYR A 1 87  ? -4.643  -5.599  1.521   1.00 0.00 ? 87  TYR A HH   3  
ATOM 5176  N N    . THR A 1 88  ? -3.067  -8.723  -3.038  1.00 0.00 ? 88  THR A N    3  
ATOM 5177  C CA   . THR A 1 88  ? -4.423  -9.226  -3.172  1.00 0.00 ? 88  THR A CA   3  
ATOM 5178  C C    . THR A 1 88  ? -5.386  -8.394  -2.321  1.00 0.00 ? 88  THR A C    3  
ATOM 5179  O O    . THR A 1 88  ? -5.145  -8.181  -1.134  1.00 0.00 ? 88  THR A O    3  
ATOM 5180  C CB   . THR A 1 88  ? -4.416  -10.711 -2.804  1.00 0.00 ? 88  THR A CB   3  
ATOM 5181  O OG1  . THR A 1 88  ? -3.492  -11.291 -3.722  1.00 0.00 ? 88  THR A OG1  3  
ATOM 5182  C CG2  . THR A 1 88  ? -5.743  -11.400 -3.126  1.00 0.00 ? 88  THR A CG2  3  
ATOM 5183  H H    . THR A 1 88  ? -2.672  -8.810  -2.124  1.00 0.00 ? 88  THR A H    3  
ATOM 5184  H HA   . THR A 1 88  ? -4.733  -9.109  -4.210  1.00 0.00 ? 88  THR A HA   3  
ATOM 5185  H HB   . THR A 1 88  ? -4.148  -10.852 -1.757  1.00 0.00 ? 88  THR A HB   3  
ATOM 5186  H HG1  . THR A 1 88  ? -2.556  -11.060 -3.456  1.00 0.00 ? 88  THR A HG1  3  
ATOM 5187  H HG21 . THR A 1 88  ? -5.570  -12.210 -3.835  1.00 0.00 ? 88  THR A HG21 3  
ATOM 5188  H HG22 . THR A 1 88  ? -6.174  -11.806 -2.210  1.00 0.00 ? 88  THR A HG22 3  
ATOM 5189  H HG23 . THR A 1 88  ? -6.432  -10.677 -3.562  1.00 0.00 ? 88  THR A HG23 3  
ATOM 5190  N N    . ALA A 1 89  ? -6.456  -7.947  -2.962  1.00 0.00 ? 89  ALA A N    3  
ATOM 5191  C CA   . ALA A 1 89  ? -7.456  -7.144  -2.279  1.00 0.00 ? 89  ALA A CA   3  
ATOM 5192  C C    . ALA A 1 89  ? -8.687  -8.005  -1.993  1.00 0.00 ? 89  ALA A C    3  
ATOM 5193  O O    . ALA A 1 89  ? -9.091  -8.814  -2.827  1.00 0.00 ? 89  ALA A O    3  
ATOM 5194  C CB   . ALA A 1 89  ? -7.788  -5.914  -3.126  1.00 0.00 ? 89  ALA A CB   3  
ATOM 5195  H H    . ALA A 1 89  ? -6.644  -8.125  -3.928  1.00 0.00 ? 89  ALA A H    3  
ATOM 5196  H HA   . ALA A 1 89  ? -7.026  -6.813  -1.333  1.00 0.00 ? 89  ALA A HA   3  
ATOM 5197  H HB1  . ALA A 1 89  ? -8.336  -5.193  -2.520  1.00 0.00 ? 89  ALA A HB1  3  
ATOM 5198  H HB2  . ALA A 1 89  ? -6.865  -5.460  -3.485  1.00 0.00 ? 89  ALA A HB2  3  
ATOM 5199  H HB3  . ALA A 1 89  ? -8.401  -6.214  -3.977  1.00 0.00 ? 89  ALA A HB3  3  
ATOM 5200  N N    . THR A 1 90  ? -9.250  -7.803  -0.810  1.00 0.00 ? 90  THR A N    3  
ATOM 5201  C CA   . THR A 1 90  ? -10.427 -8.551  -0.404  1.00 0.00 ? 90  THR A CA   3  
ATOM 5202  C C    . THR A 1 90  ? -11.359 -7.668  0.429   1.00 0.00 ? 90  THR A C    3  
ATOM 5203  O O    . THR A 1 90  ? -10.905 -6.935  1.306   1.00 0.00 ? 90  THR A O    3  
ATOM 5204  C CB   . THR A 1 90  ? -9.958  -9.806  0.336   1.00 0.00 ? 90  THR A CB   3  
ATOM 5205  O OG1  . THR A 1 90  ? -8.917  -9.337  1.189   1.00 0.00 ? 90  THR A OG1  3  
ATOM 5206  C CG2  . THR A 1 90  ? -9.260  -10.804 -0.590  1.00 0.00 ? 90  THR A CG2  3  
ATOM 5207  H H    . THR A 1 90  ? -8.915  -7.144  -0.137  1.00 0.00 ? 90  THR A H    3  
ATOM 5208  H HA   . THR A 1 90  ? -10.976 -8.841  -1.299  1.00 0.00 ? 90  THR A HA   3  
ATOM 5209  H HB   . THR A 1 90  ? -10.785 -10.278 0.865   1.00 0.00 ? 90  THR A HB   3  
ATOM 5210  H HG1  . THR A 1 90  ? -8.115  -9.090  0.646   1.00 0.00 ? 90  THR A HG1  3  
ATOM 5211  H HG21 . THR A 1 90  ? -9.103  -11.743 -0.059  1.00 0.00 ? 90  THR A HG21 3  
ATOM 5212  H HG22 . THR A 1 90  ? -9.881  -10.982 -1.467  1.00 0.00 ? 90  THR A HG22 3  
ATOM 5213  H HG23 . THR A 1 90  ? -8.297  -10.399 -0.902  1.00 0.00 ? 90  THR A HG23 3  
ATOM 5214  N N    . GLY A 1 91  ? -12.644 -7.767  0.124   1.00 0.00 ? 91  GLY A N    3  
ATOM 5215  C CA   . GLY A 1 91  ? -13.644 -6.987  0.832   1.00 0.00 ? 91  GLY A CA   3  
ATOM 5216  C C    . GLY A 1 91  ? -13.929 -5.671  0.106   1.00 0.00 ? 91  GLY A C    3  
ATOM 5217  O O    . GLY A 1 91  ? -13.928 -4.605  0.720   1.00 0.00 ? 91  GLY A O    3  
ATOM 5218  H H    . GLY A 1 91  ? -13.005 -8.366  -0.592  1.00 0.00 ? 91  GLY A H    3  
ATOM 5219  H HA2  . GLY A 1 91  ? -14.564 -7.563  0.922   1.00 0.00 ? 91  GLY A HA2  3  
ATOM 5220  H HA3  . GLY A 1 91  ? -13.298 -6.779  1.845   1.00 0.00 ? 91  GLY A HA3  3  
ATOM 5221  N N    . LEU A 1 92  ? -14.166 -5.788  -1.192  1.00 0.00 ? 92  LEU A N    3  
ATOM 5222  C CA   . LEU A 1 92  ? -14.452 -4.621  -2.010  1.00 0.00 ? 92  LEU A CA   3  
ATOM 5223  C C    . LEU A 1 92  ? -15.885 -4.712  -2.537  1.00 0.00 ? 92  LEU A C    3  
ATOM 5224  O O    . LEU A 1 92  ? -16.510 -5.769  -2.467  1.00 0.00 ? 92  LEU A O    3  
ATOM 5225  C CB   . LEU A 1 92  ? -13.400 -4.467  -3.110  1.00 0.00 ? 92  LEU A CB   3  
ATOM 5226  C CG   . LEU A 1 92  ? -11.954 -4.755  -2.702  1.00 0.00 ? 92  LEU A CG   3  
ATOM 5227  C CD1  . LEU A 1 92  ? -11.107 -5.139  -3.916  1.00 0.00 ? 92  LEU A CD1  3  
ATOM 5228  C CD2  . LEU A 1 92  ? -11.356 -3.574  -1.935  1.00 0.00 ? 92  LEU A CD2  3  
ATOM 5229  H H    . LEU A 1 92  ? -14.165 -6.659  -1.685  1.00 0.00 ? 92  LEU A H    3  
ATOM 5230  H HA   . LEU A 1 92  ? -14.375 -3.745  -1.366  1.00 0.00 ? 92  LEU A HA   3  
ATOM 5231  H HB2  . LEU A 1 92  ? -13.664 -5.132  -3.933  1.00 0.00 ? 92  LEU A HB2  3  
ATOM 5232  H HB3  . LEU A 1 92  ? -13.452 -3.449  -3.495  1.00 0.00 ? 92  LEU A HB3  3  
ATOM 5233  H HG   . LEU A 1 92  ? -11.954 -5.610  -2.026  1.00 0.00 ? 92  LEU A HG   3  
ATOM 5234  H HD11 . LEU A 1 92  ? -11.339 -6.162  -4.213  1.00 0.00 ? 92  LEU A HD11 3  
ATOM 5235  H HD12 . LEU A 1 92  ? -11.329 -4.462  -4.742  1.00 0.00 ? 92  LEU A HD12 3  
ATOM 5236  H HD13 . LEU A 1 92  ? -10.050 -5.065  -3.660  1.00 0.00 ? 92  LEU A HD13 3  
ATOM 5237  H HD21 . LEU A 1 92  ? -12.124 -3.120  -1.310  1.00 0.00 ? 92  LEU A HD21 3  
ATOM 5238  H HD22 . LEU A 1 92  ? -10.537 -3.925  -1.308  1.00 0.00 ? 92  LEU A HD22 3  
ATOM 5239  H HD23 . LEU A 1 92  ? -10.979 -2.835  -2.643  1.00 0.00 ? 92  LEU A HD23 3  
ATOM 5240  N N    . LYS A 1 93  ? -16.364 -3.589  -3.052  1.00 0.00 ? 93  LYS A N    3  
ATOM 5241  C CA   . LYS A 1 93  ? -17.713 -3.528  -3.591  1.00 0.00 ? 93  LYS A CA   3  
ATOM 5242  C C    . LYS A 1 93  ? -17.671 -3.819  -5.092  1.00 0.00 ? 93  LYS A C    3  
ATOM 5243  O O    . LYS A 1 93  ? -16.913 -3.191  -5.829  1.00 0.00 ? 93  LYS A O    3  
ATOM 5244  C CB   . LYS A 1 93  ? -18.369 -2.191  -3.242  1.00 0.00 ? 93  LYS A CB   3  
ATOM 5245  C CG   . LYS A 1 93  ? -19.782 -2.106  -3.822  1.00 0.00 ? 93  LYS A CG   3  
ATOM 5246  C CD   . LYS A 1 93  ? -20.019 -0.751  -4.492  1.00 0.00 ? 93  LYS A CD   3  
ATOM 5247  C CE   . LYS A 1 93  ? -19.866 0.392   -3.487  1.00 0.00 ? 93  LYS A CE   3  
ATOM 5248  N NZ   . LYS A 1 93  ? -21.138 0.624   -2.768  1.00 0.00 ? 93  LYS A NZ   3  
ATOM 5249  H H    . LYS A 1 93  ? -15.849 -2.733  -3.105  1.00 0.00 ? 93  LYS A H    3  
ATOM 5250  H HA   . LYS A 1 93  ? -18.295 -4.310  -3.103  1.00 0.00 ? 93  LYS A HA   3  
ATOM 5251  H HB2  . LYS A 1 93  ? -18.410 -2.073  -2.159  1.00 0.00 ? 93  LYS A HB2  3  
ATOM 5252  H HB3  . LYS A 1 93  ? -17.763 -1.372  -3.629  1.00 0.00 ? 93  LYS A HB3  3  
ATOM 5253  H HG2  . LYS A 1 93  ? -19.929 -2.906  -4.548  1.00 0.00 ? 93  LYS A HG2  3  
ATOM 5254  H HG3  . LYS A 1 93  ? -20.515 -2.257  -3.029  1.00 0.00 ? 93  LYS A HG3  3  
ATOM 5255  H HD2  . LYS A 1 93  ? -19.312 -0.618  -5.311  1.00 0.00 ? 93  LYS A HD2  3  
ATOM 5256  H HD3  . LYS A 1 93  ? -21.018 -0.726  -4.927  1.00 0.00 ? 93  LYS A HD3  3  
ATOM 5257  H HE2  . LYS A 1 93  ? -19.076 0.154   -2.774  1.00 0.00 ? 93  LYS A HE2  3  
ATOM 5258  H HE3  . LYS A 1 93  ? -19.563 1.302   -4.005  1.00 0.00 ? 93  LYS A HE3  3  
ATOM 5259  H HZ1  . LYS A 1 93  ? -20.961 1.154   -1.939  1.00 0.00 ? 93  LYS A HZ1  3  
ATOM 5260  H HZ2  . LYS A 1 93  ? -21.768 1.129   -3.358  1.00 0.00 ? 93  LYS A HZ2  3  
ATOM 5261  H HZ3  . LYS A 1 93  ? -21.546 -0.255  -2.520  1.00 0.00 ? 93  LYS A HZ3  3  
ATOM 5262  N N    . PRO A 1 94  ? -18.517 -4.798  -5.511  1.00 0.00 ? 94  PRO A N    3  
ATOM 5263  C CA   . PRO A 1 94  ? -18.584 -5.180  -6.912  1.00 0.00 ? 94  PRO A CA   3  
ATOM 5264  C C    . PRO A 1 94  ? -19.336 -4.130  -7.731  1.00 0.00 ? 94  PRO A C    3  
ATOM 5265  O O    . PRO A 1 94  ? -20.140 -3.373  -7.189  1.00 0.00 ? 94  PRO A O    3  
ATOM 5266  C CB   . PRO A 1 94  ? -19.266 -6.539  -6.917  1.00 0.00 ? 94  PRO A CB   3  
ATOM 5267  C CG   . PRO A 1 94  ? -19.970 -6.656  -5.575  1.00 0.00 ? 94  PRO A CG   3  
ATOM 5268  C CD   . PRO A 1 94  ? -19.429 -5.564  -4.667  1.00 0.00 ? 94  PRO A CD   3  
ATOM 5269  H HA   . PRO A 1 94  ? -17.665 -5.225  -7.303  1.00 0.00 ? 94  PRO A HA   3  
ATOM 5270  H HB2  . PRO A 1 94  ? -19.977 -6.616  -7.739  1.00 0.00 ? 94  PRO A HB2  3  
ATOM 5271  H HB3  . PRO A 1 94  ? -18.539 -7.340  -7.048  1.00 0.00 ? 94  PRO A HB3  3  
ATOM 5272  H HG2  . PRO A 1 94  ? -21.048 -6.551  -5.699  1.00 0.00 ? 94  PRO A HG2  3  
ATOM 5273  H HG3  . PRO A 1 94  ? -19.795 -7.639  -5.136  1.00 0.00 ? 94  PRO A HG3  3  
ATOM 5274  H HD2  . PRO A 1 94  ? -20.232 -4.936  -4.280  1.00 0.00 ? 94  PRO A HD2  3  
ATOM 5275  H HD3  . PRO A 1 94  ? -18.911 -5.985  -3.805  1.00 0.00 ? 94  PRO A HD3  3  
ATOM 5276  N N    . GLU A 1 95  ? -19.050 -4.119  -9.025  1.00 0.00 ? 95  GLU A N    3  
ATOM 5277  C CA   . GLU A 1 95  ? -19.690 -3.174  -9.925  1.00 0.00 ? 95  GLU A CA   3  
ATOM 5278  C C    . GLU A 1 95  ? -19.280 -1.743  -9.571  1.00 0.00 ? 95  GLU A C    3  
ATOM 5279  O O    . GLU A 1 95  ? -20.132 -0.897  -9.306  1.00 0.00 ? 95  GLU A O    3  
ATOM 5280  C CB   . GLU A 1 95  ? -21.211 -3.332  -9.894  1.00 0.00 ? 95  GLU A CB   3  
ATOM 5281  C CG   . GLU A 1 95  ? -21.670 -4.415  -10.872 1.00 0.00 ? 95  GLU A CG   3  
ATOM 5282  C CD   . GLU A 1 95  ? -22.291 -3.794  -12.125 1.00 0.00 ? 95  GLU A CD   3  
ATOM 5283  O OE1  . GLU A 1 95  ? -23.355 -3.156  -11.975 1.00 0.00 ? 95  GLU A OE1  3  
ATOM 5284  O OE2  . GLU A 1 95  ? -21.687 -3.972  -13.205 1.00 0.00 ? 95  GLU A OE2  3  
ATOM 5285  H H    . GLU A 1 95  ? -18.395 -4.738  -9.458  1.00 0.00 ? 95  GLU A H    3  
ATOM 5286  H HA   . GLU A 1 95  ? -19.325 -3.429  -10.920 1.00 0.00 ? 95  GLU A HA   3  
ATOM 5287  H HB2  . GLU A 1 95  ? -21.534 -3.589  -8.885  1.00 0.00 ? 95  GLU A HB2  3  
ATOM 5288  H HB3  . GLU A 1 95  ? -21.684 -2.383  -10.148 1.00 0.00 ? 95  GLU A HB3  3  
ATOM 5289  H HG2  . GLU A 1 95  ? -20.822 -5.039  -11.153 1.00 0.00 ? 95  GLU A HG2  3  
ATOM 5290  H HG3  . GLU A 1 95  ? -22.398 -5.065  -10.386 1.00 0.00 ? 95  GLU A HG3  3  
ATOM 5291  N N    . SER A 1 96  ? -17.974 -1.517  -9.580  1.00 0.00 ? 96  SER A N    3  
ATOM 5292  C CA   . SER A 1 96  ? -17.441 -0.203  -9.263  1.00 0.00 ? 96  SER A CA   3  
ATOM 5293  C C    . SER A 1 96  ? -15.983 -0.107  -9.716  1.00 0.00 ? 96  SER A C    3  
ATOM 5294  O O    . SER A 1 96  ? -15.460 -1.031  -10.338 1.00 0.00 ? 96  SER A O    3  
ATOM 5295  C CB   . SER A 1 96  ? -17.552 0.091   -7.766  1.00 0.00 ? 96  SER A CB   3  
ATOM 5296  O OG   . SER A 1 96  ? -18.907 0.125   -7.327  1.00 0.00 ? 96  SER A OG   3  
ATOM 5297  H H    . SER A 1 96  ? -17.288 -2.210  -9.797  1.00 0.00 ? 96  SER A H    3  
ATOM 5298  H HA   . SER A 1 96  ? -18.061 0.502   -9.818  1.00 0.00 ? 96  SER A HA   3  
ATOM 5299  H HB2  . SER A 1 96  ? -17.009 -0.671  -7.206  1.00 0.00 ? 96  SER A HB2  3  
ATOM 5300  H HB3  . SER A 1 96  ? -17.076 1.047   -7.548  1.00 0.00 ? 96  SER A HB3  3  
ATOM 5301  H HG   . SER A 1 96  ? -19.300 -0.794  -7.359  1.00 0.00 ? 96  SER A HG   3  
ATOM 5302  N N    . VAL A 1 97  ? -15.367 1.020   -9.388  1.00 0.00 ? 97  VAL A N    3  
ATOM 5303  C CA   . VAL A 1 97  ? -13.980 1.248   -9.754  1.00 0.00 ? 97  VAL A CA   3  
ATOM 5304  C C    . VAL A 1 97  ? -13.166 1.543   -8.492  1.00 0.00 ? 97  VAL A C    3  
ATOM 5305  O O    . VAL A 1 97  ? -13.625 2.266   -7.609  1.00 0.00 ? 97  VAL A O    3  
ATOM 5306  C CB   . VAL A 1 97  ? -13.890 2.363   -10.797 1.00 0.00 ? 97  VAL A CB   3  
ATOM 5307  C CG1  . VAL A 1 97  ? -12.500 2.407   -11.435 1.00 0.00 ? 97  VAL A CG1  3  
ATOM 5308  C CG2  . VAL A 1 97  ? -14.977 2.206   -11.862 1.00 0.00 ? 97  VAL A CG2  3  
ATOM 5309  H H    . VAL A 1 97  ? -15.800 1.766   -8.883  1.00 0.00 ? 97  VAL A H    3  
ATOM 5310  H HA   . VAL A 1 97  ? -13.604 0.331   -10.207 1.00 0.00 ? 97  VAL A HA   3  
ATOM 5311  H HB   . VAL A 1 97  ? -14.055 3.313   -10.288 1.00 0.00 ? 97  VAL A HB   3  
ATOM 5312  H HG11 . VAL A 1 97  ? -12.440 3.256   -12.117 1.00 0.00 ? 97  VAL A HG11 3  
ATOM 5313  H HG12 . VAL A 1 97  ? -11.746 2.513   -10.655 1.00 0.00 ? 97  VAL A HG12 3  
ATOM 5314  H HG13 . VAL A 1 97  ? -12.325 1.484   -11.987 1.00 0.00 ? 97  VAL A HG13 3  
ATOM 5315  H HG21 . VAL A 1 97  ? -15.408 1.207   -11.797 1.00 0.00 ? 97  VAL A HG21 3  
ATOM 5316  H HG22 . VAL A 1 97  ? -15.757 2.950   -11.697 1.00 0.00 ? 97  VAL A HG22 3  
ATOM 5317  H HG23 . VAL A 1 97  ? -14.541 2.350   -12.851 1.00 0.00 ? 97  VAL A HG23 3  
ATOM 5318  N N    . TYR A 1 98  ? -11.973 0.968   -8.447  1.00 0.00 ? 98  TYR A N    3  
ATOM 5319  C CA   . TYR A 1 98  ? -11.092 1.161   -7.308  1.00 0.00 ? 98  TYR A CA   3  
ATOM 5320  C C    . TYR A 1 98  ? -9.715  1.653   -7.758  1.00 0.00 ? 98  TYR A C    3  
ATOM 5321  O O    . TYR A 1 98  ? -9.136  1.114   -8.700  1.00 0.00 ? 98  TYR A O    3  
ATOM 5322  C CB   . TYR A 1 98  ? -10.941 -0.214  -6.655  1.00 0.00 ? 98  TYR A CB   3  
ATOM 5323  C CG   . TYR A 1 98  ? -12.041 -0.548  -5.646  1.00 0.00 ? 98  TYR A CG   3  
ATOM 5324  C CD1  . TYR A 1 98  ? -13.245 -1.062  -6.082  1.00 0.00 ? 98  TYR A CD1  3  
ATOM 5325  C CD2  . TYR A 1 98  ? -11.829 -0.336  -4.298  1.00 0.00 ? 98  TYR A CD2  3  
ATOM 5326  C CE1  . TYR A 1 98  ? -14.281 -1.376  -5.132  1.00 0.00 ? 98  TYR A CE1  3  
ATOM 5327  C CE2  . TYR A 1 98  ? -12.865 -0.650  -3.348  1.00 0.00 ? 98  TYR A CE2  3  
ATOM 5328  C CZ   . TYR A 1 98  ? -14.039 -1.155  -3.812  1.00 0.00 ? 98  TYR A CZ   3  
ATOM 5329  O OH   . TYR A 1 98  ? -15.018 -1.451  -2.915  1.00 0.00 ? 98  TYR A OH   3  
ATOM 5330  H H    . TYR A 1 98  ? -11.608 0.381   -9.170  1.00 0.00 ? 98  TYR A H    3  
ATOM 5331  H HA   . TYR A 1 98  ? -11.543 1.910   -6.657  1.00 0.00 ? 98  TYR A HA   3  
ATOM 5332  H HB2  . TYR A 1 98  ? -10.933 -0.977  -7.434  1.00 0.00 ? 98  TYR A HB2  3  
ATOM 5333  H HB3  . TYR A 1 98  ? -9.975  -0.263  -6.153  1.00 0.00 ? 98  TYR A HB3  3  
ATOM 5334  H HD1  . TYR A 1 98  ? -13.413 -1.229  -7.146  1.00 0.00 ? 98  TYR A HD1  3  
ATOM 5335  H HD2  . TYR A 1 98  ? -10.878 0.069   -3.954  1.00 0.00 ? 98  TYR A HD2  3  
ATOM 5336  H HE1  . TYR A 1 98  ? -15.237 -1.782  -5.464  1.00 0.00 ? 98  TYR A HE1  3  
ATOM 5337  H HE2  . TYR A 1 98  ? -12.711 -0.488  -2.282  1.00 0.00 ? 98  TYR A HE2  3  
ATOM 5338  H HH   . TYR A 1 98  ? -14.749 -1.144  -2.002  1.00 0.00 ? 98  TYR A HH   3  
ATOM 5339  N N    . LEU A 1 99  ? -9.229  2.671   -7.062  1.00 0.00 ? 99  LEU A N    3  
ATOM 5340  C CA   . LEU A 1 99  ? -7.931  3.242   -7.378  1.00 0.00 ? 99  LEU A CA   3  
ATOM 5341  C C    . LEU A 1 99  ? -6.868  2.610   -6.476  1.00 0.00 ? 99  LEU A C    3  
ATOM 5342  O O    . LEU A 1 99  ? -6.957  2.697   -5.252  1.00 0.00 ? 99  LEU A O    3  
ATOM 5343  C CB   . LEU A 1 99  ? -7.982  4.768   -7.293  1.00 0.00 ? 99  LEU A CB   3  
ATOM 5344  C CG   . LEU A 1 99  ? -6.636  5.490   -7.384  1.00 0.00 ? 99  LEU A CG   3  
ATOM 5345  C CD1  . LEU A 1 99  ? -5.901  5.452   -6.042  1.00 0.00 ? 99  LEU A CD1  3  
ATOM 5346  C CD2  . LEU A 1 99  ? -5.784  4.921   -8.520  1.00 0.00 ? 99  LEU A CD2  3  
ATOM 5347  H H    . LEU A 1 99  ? -9.706  3.103   -6.297  1.00 0.00 ? 99  LEU A H    3  
ATOM 5348  H HA   . LEU A 1 99  ? -7.704  2.984   -8.412  1.00 0.00 ? 99  LEU A HA   3  
ATOM 5349  H HB2  . LEU A 1 99  ? -8.624  5.136   -8.093  1.00 0.00 ? 99  LEU A HB2  3  
ATOM 5350  H HB3  . LEU A 1 99  ? -8.457  5.044   -6.351  1.00 0.00 ? 99  LEU A HB3  3  
ATOM 5351  H HG   . LEU A 1 99  ? -6.826  6.538   -7.617  1.00 0.00 ? 99  LEU A HG   3  
ATOM 5352  H HD11 . LEU A 1 99  ? -5.812  6.465   -5.648  1.00 0.00 ? 99  LEU A HD11 3  
ATOM 5353  H HD12 . LEU A 1 99  ? -6.462  4.836   -5.339  1.00 0.00 ? 99  LEU A HD12 3  
ATOM 5354  H HD13 . LEU A 1 99  ? -4.907  5.029   -6.184  1.00 0.00 ? 99  LEU A HD13 3  
ATOM 5355  H HD21 . LEU A 1 99  ? -5.809  3.832   -8.482  1.00 0.00 ? 99  LEU A HD21 3  
ATOM 5356  H HD22 . LEU A 1 99  ? -6.182  5.260   -9.477  1.00 0.00 ? 99  LEU A HD22 3  
ATOM 5357  H HD23 . LEU A 1 99  ? -4.756  5.266   -8.411  1.00 0.00 ? 99  LEU A HD23 3  
ATOM 5358  N N    . PHE A 1 100 ? -5.888  1.989   -7.115  1.00 0.00 ? 100 PHE A N    3  
ATOM 5359  C CA   . PHE A 1 100 ? -4.810  1.344   -6.386  1.00 0.00 ? 100 PHE A CA   3  
ATOM 5360  C C    . PHE A 1 100 ? -3.510  2.141   -6.510  1.00 0.00 ? 100 PHE A C    3  
ATOM 5361  O O    . PHE A 1 100 ? -2.935  2.233   -7.594  1.00 0.00 ? 100 PHE A O    3  
ATOM 5362  C CB   . PHE A 1 100 ? -4.609  -0.037  -7.013  1.00 0.00 ? 100 PHE A CB   3  
ATOM 5363  C CG   . PHE A 1 100 ? -5.663  -1.067  -6.601  1.00 0.00 ? 100 PHE A CG   3  
ATOM 5364  C CD1  . PHE A 1 100 ? -6.932  -0.970  -7.080  1.00 0.00 ? 100 PHE A CD1  3  
ATOM 5365  C CD2  . PHE A 1 100 ? -5.331  -2.078  -5.755  1.00 0.00 ? 100 PHE A CD2  3  
ATOM 5366  C CE1  . PHE A 1 100 ? -7.910  -1.926  -6.697  1.00 0.00 ? 100 PHE A CE1  3  
ATOM 5367  C CE2  . PHE A 1 100 ? -6.308  -3.034  -5.372  1.00 0.00 ? 100 PHE A CE2  3  
ATOM 5368  C CZ   . PHE A 1 100 ? -7.578  -2.938  -5.851  1.00 0.00 ? 100 PHE A CZ   3  
ATOM 5369  H H    . PHE A 1 100 ? -5.824  1.923   -8.111  1.00 0.00 ? 100 PHE A H    3  
ATOM 5370  H HA   . PHE A 1 100 ? -5.108  1.300   -5.338  1.00 0.00 ? 100 PHE A HA   3  
ATOM 5371  H HB2  . PHE A 1 100 ? -4.619  0.063   -8.098  1.00 0.00 ? 100 PHE A HB2  3  
ATOM 5372  H HB3  . PHE A 1 100 ? -3.623  -0.411  -6.737  1.00 0.00 ? 100 PHE A HB3  3  
ATOM 5373  H HD1  . PHE A 1 100 ? -7.199  -0.160  -7.758  1.00 0.00 ? 100 PHE A HD1  3  
ATOM 5374  H HD2  . PHE A 1 100 ? -4.313  -2.156  -5.371  1.00 0.00 ? 100 PHE A HD2  3  
ATOM 5375  H HE1  . PHE A 1 100 ? -8.927  -1.849  -7.081  1.00 0.00 ? 100 PHE A HE1  3  
ATOM 5376  H HE2  . PHE A 1 100 ? -6.042  -3.845  -4.694  1.00 0.00 ? 100 PHE A HE2  3  
ATOM 5377  H HZ   . PHE A 1 100 ? -8.328  -3.671  -5.557  1.00 0.00 ? 100 PHE A HZ   3  
ATOM 5378  N N    . ARG A 1 101 ? -3.084  2.697   -5.385  1.00 0.00 ? 101 ARG A N    3  
ATOM 5379  C CA   . ARG A 1 101 ? -1.863  3.484   -5.355  1.00 0.00 ? 101 ARG A CA   3  
ATOM 5380  C C    . ARG A 1 101 ? -0.728  2.677   -4.721  1.00 0.00 ? 101 ARG A C    3  
ATOM 5381  O O    . ARG A 1 101 ? -0.781  2.347   -3.537  1.00 0.00 ? 101 ARG A O    3  
ATOM 5382  C CB   . ARG A 1 101 ? -2.061  4.779   -4.565  1.00 0.00 ? 101 ARG A CB   3  
ATOM 5383  C CG   . ARG A 1 101 ? -1.319  5.943   -5.225  1.00 0.00 ? 101 ARG A CG   3  
ATOM 5384  C CD   . ARG A 1 101 ? -2.067  7.260   -5.013  1.00 0.00 ? 101 ARG A CD   3  
ATOM 5385  N NE   . ARG A 1 101 ? -2.225  7.525   -3.565  1.00 0.00 ? 101 ARG A NE   3  
ATOM 5386  C CZ   . ARG A 1 101 ? -1.307  8.143   -2.810  1.00 0.00 ? 101 ARG A CZ   3  
ATOM 5387  N NH1  . ARG A 1 101 ? -0.160  8.564   -3.360  1.00 0.00 ? 101 ARG A NH1  3  
ATOM 5388  N NH2  . ARG A 1 101 ? -1.536  8.341   -1.505  1.00 0.00 ? 101 ARG A NH2  3  
ATOM 5389  H H    . ARG A 1 101 ? -3.557  2.617   -4.508  1.00 0.00 ? 101 ARG A H    3  
ATOM 5390  H HA   . ARG A 1 101 ? -1.649  3.707   -6.400  1.00 0.00 ? 101 ARG A HA   3  
ATOM 5391  H HB2  . ARG A 1 101 ? -3.124  5.010   -4.500  1.00 0.00 ? 101 ARG A HB2  3  
ATOM 5392  H HB3  . ARG A 1 101 ? -1.702  4.645   -3.545  1.00 0.00 ? 101 ARG A HB3  3  
ATOM 5393  H HG2  . ARG A 1 101 ? -0.314  6.020   -4.810  1.00 0.00 ? 101 ARG A HG2  3  
ATOM 5394  H HG3  . ARG A 1 101 ? -1.210  5.750   -6.292  1.00 0.00 ? 101 ARG A HG3  3  
ATOM 5395  H HD2  . ARG A 1 101 ? -1.521  8.078   -5.483  1.00 0.00 ? 101 ARG A HD2  3  
ATOM 5396  H HD3  . ARG A 1 101 ? -3.045  7.214   -5.492  1.00 0.00 ? 101 ARG A HD3  3  
ATOM 5397  H HE   . ARG A 1 101 ? -3.070  7.224   -3.124  1.00 0.00 ? 101 ARG A HE   3  
ATOM 5398  H HH11 . ARG A 1 101 ? 0.011   8.416   -4.334  1.00 0.00 ? 101 ARG A HH11 3  
ATOM 5399  H HH12 . ARG A 1 101 ? 0.525   9.025   -2.796  1.00 0.00 ? 101 ARG A HH12 3  
ATOM 5400  H HH21 . ARG A 1 101 ? -2.393  8.027   -1.094  1.00 0.00 ? 101 ARG A HH21 3  
ATOM 5401  H HH22 . ARG A 1 101 ? -0.851  8.802   -0.941  1.00 0.00 ? 101 ARG A HH22 3  
ATOM 5402  N N    . ILE A 1 102 ? 0.273   2.382   -5.538  1.00 0.00 ? 102 ILE A N    3  
ATOM 5403  C CA   . ILE A 1 102 ? 1.419   1.620   -5.072  1.00 0.00 ? 102 ILE A CA   3  
ATOM 5404  C C    . ILE A 1 102 ? 2.557   2.581   -4.720  1.00 0.00 ? 102 ILE A C    3  
ATOM 5405  O O    . ILE A 1 102 ? 2.789   3.559   -5.428  1.00 0.00 ? 102 ILE A O    3  
ATOM 5406  C CB   . ILE A 1 102 ? 1.809   0.556   -6.100  1.00 0.00 ? 102 ILE A CB   3  
ATOM 5407  C CG1  . ILE A 1 102 ? 0.714   -0.504  -6.235  1.00 0.00 ? 102 ILE A CG1  3  
ATOM 5408  C CG2  . ILE A 1 102 ? 3.167   -0.063  -5.761  1.00 0.00 ? 102 ILE A CG2  3  
ATOM 5409  C CD1  . ILE A 1 102 ? 0.727   -1.132  -7.630  1.00 0.00 ? 102 ILE A CD1  3  
ATOM 5410  H H    . ILE A 1 102 ? 0.309   2.654   -6.499  1.00 0.00 ? 102 ILE A H    3  
ATOM 5411  H HA   . ILE A 1 102 ? 1.117   1.096   -4.165  1.00 0.00 ? 102 ILE A HA   3  
ATOM 5412  H HB   . ILE A 1 102 ? 1.910   1.040   -7.071  1.00 0.00 ? 102 ILE A HB   3  
ATOM 5413  H HG12 . ILE A 1 102 ? 0.858   -1.279  -5.482  1.00 0.00 ? 102 ILE A HG12 3  
ATOM 5414  H HG13 . ILE A 1 102 ? -0.260  -0.052  -6.045  1.00 0.00 ? 102 ILE A HG13 3  
ATOM 5415  H HG21 . ILE A 1 102 ? 3.581   -0.540  -6.650  1.00 0.00 ? 102 ILE A HG21 3  
ATOM 5416  H HG22 . ILE A 1 102 ? 3.846   0.717   -5.418  1.00 0.00 ? 102 ILE A HG22 3  
ATOM 5417  H HG23 . ILE A 1 102 ? 3.041   -0.807  -4.975  1.00 0.00 ? 102 ILE A HG23 3  
ATOM 5418  H HD11 . ILE A 1 102 ? 0.983   -2.189  -7.551  1.00 0.00 ? 102 ILE A HD11 3  
ATOM 5419  H HD12 . ILE A 1 102 ? -0.258  -1.030  -8.084  1.00 0.00 ? 102 ILE A HD12 3  
ATOM 5420  H HD13 . ILE A 1 102 ? 1.467   -0.625  -8.250  1.00 0.00 ? 102 ILE A HD13 3  
ATOM 5421  N N    . THR A 1 103 ? 3.236   2.268   -3.626  1.00 0.00 ? 103 THR A N    3  
ATOM 5422  C CA   . THR A 1 103 ? 4.343   3.092   -3.172  1.00 0.00 ? 103 THR A CA   3  
ATOM 5423  C C    . THR A 1 103 ? 5.401   2.229   -2.482  1.00 0.00 ? 103 THR A C    3  
ATOM 5424  O O    . THR A 1 103 ? 5.114   1.113   -2.051  1.00 0.00 ? 103 THR A O    3  
ATOM 5425  C CB   . THR A 1 103 ? 3.776   4.193   -2.273  1.00 0.00 ? 103 THR A CB   3  
ATOM 5426  O OG1  . THR A 1 103 ? 2.629   4.660   -2.978  1.00 0.00 ? 103 THR A OG1  3  
ATOM 5427  C CG2  . THR A 1 103 ? 4.691   5.416   -2.197  1.00 0.00 ? 103 THR A CG2  3  
ATOM 5428  H H    . THR A 1 103 ? 3.040   1.471   -3.056  1.00 0.00 ? 103 THR A H    3  
ATOM 5429  H HA   . THR A 1 103 ? 4.817   3.542   -4.044  1.00 0.00 ? 103 THR A HA   3  
ATOM 5430  H HB   . THR A 1 103 ? 3.557   3.808   -1.277  1.00 0.00 ? 103 THR A HB   3  
ATOM 5431  H HG1  . THR A 1 103 ? 1.832   4.658   -2.374  1.00 0.00 ? 103 THR A HG1  3  
ATOM 5432  H HG21 . THR A 1 103 ? 4.655   5.956   -3.144  1.00 0.00 ? 103 THR A HG21 3  
ATOM 5433  H HG22 . THR A 1 103 ? 4.356   6.071   -1.393  1.00 0.00 ? 103 THR A HG22 3  
ATOM 5434  H HG23 . THR A 1 103 ? 5.713   5.094   -2.002  1.00 0.00 ? 103 THR A HG23 3  
ATOM 5435  N N    . ALA A 1 104 ? 6.604   2.779   -2.398  1.00 0.00 ? 104 ALA A N    3  
ATOM 5436  C CA   . ALA A 1 104 ? 7.707   2.074   -1.767  1.00 0.00 ? 104 ALA A CA   3  
ATOM 5437  C C    . ALA A 1 104 ? 8.093   2.792   -0.473  1.00 0.00 ? 104 ALA A C    3  
ATOM 5438  O O    . ALA A 1 104 ? 7.768   3.964   -0.289  1.00 0.00 ? 104 ALA A O    3  
ATOM 5439  C CB   . ALA A 1 104 ? 8.876   1.972   -2.749  1.00 0.00 ? 104 ALA A CB   3  
ATOM 5440  H H    . ALA A 1 104 ? 6.830   3.687   -2.750  1.00 0.00 ? 104 ALA A H    3  
ATOM 5441  H HA   . ALA A 1 104 ? 7.363   1.068   -1.526  1.00 0.00 ? 104 ALA A HA   3  
ATOM 5442  H HB1  . ALA A 1 104 ? 8.724   1.117   -3.407  1.00 0.00 ? 104 ALA A HB1  3  
ATOM 5443  H HB2  . ALA A 1 104 ? 8.931   2.884   -3.343  1.00 0.00 ? 104 ALA A HB2  3  
ATOM 5444  H HB3  . ALA A 1 104 ? 9.805   1.843   -2.194  1.00 0.00 ? 104 ALA A HB3  3  
ATOM 5445  N N    . GLN A 1 105 ? 8.781   2.060   0.391   1.00 0.00 ? 105 GLN A N    3  
ATOM 5446  C CA   . GLN A 1 105 ? 9.215   2.613   1.662   1.00 0.00 ? 105 GLN A CA   3  
ATOM 5447  C C    . GLN A 1 105 ? 10.730  2.469   1.815   1.00 0.00 ? 105 GLN A C    3  
ATOM 5448  O O    . GLN A 1 105 ? 11.257  1.357   1.790   1.00 0.00 ? 105 GLN A O    3  
ATOM 5449  C CB   . GLN A 1 105 ? 8.480   1.948   2.828   1.00 0.00 ? 105 GLN A CB   3  
ATOM 5450  C CG   . GLN A 1 105 ? 9.077   2.380   4.170   1.00 0.00 ? 105 GLN A CG   3  
ATOM 5451  C CD   . GLN A 1 105 ? 7.996   2.946   5.093   1.00 0.00 ? 105 GLN A CD   3  
ATOM 5452  O OE1  . GLN A 1 105 ? 7.811   4.147   5.211   1.00 0.00 ? 105 GLN A OE1  3  
ATOM 5453  N NE2  . GLN A 1 105 ? 7.296   2.019   5.739   1.00 0.00 ? 105 GLN A NE2  3  
ATOM 5454  H H    . GLN A 1 105 ? 9.041   1.107   0.233   1.00 0.00 ? 105 GLN A H    3  
ATOM 5455  H HA   . GLN A 1 105 ? 8.945   3.669   1.626   1.00 0.00 ? 105 GLN A HA   3  
ATOM 5456  H HB2  . GLN A 1 105 ? 7.423   2.211   2.795   1.00 0.00 ? 105 GLN A HB2  3  
ATOM 5457  H HB3  . GLN A 1 105 ? 8.542   0.864   2.731   1.00 0.00 ? 105 GLN A HB3  3  
ATOM 5458  H HG2  . GLN A 1 105 ? 9.559   1.528   4.648   1.00 0.00 ? 105 GLN A HG2  3  
ATOM 5459  H HG3  . GLN A 1 105 ? 9.849   3.131   4.003   1.00 0.00 ? 105 GLN A HG3  3  
ATOM 5460  H HE21 . GLN A 1 105 ? 7.499   1.050   5.597   1.00 0.00 ? 105 GLN A HE21 3  
ATOM 5461  H HE22 . GLN A 1 105 ? 6.566   2.290   6.367   1.00 0.00 ? 105 GLN A HE22 3  
ATOM 5462  N N    . THR A 1 106 ? 11.389  3.608   1.969   1.00 0.00 ? 106 THR A N    3  
ATOM 5463  C CA   . THR A 1 106 ? 12.833  3.622   2.125   1.00 0.00 ? 106 THR A CA   3  
ATOM 5464  C C    . THR A 1 106 ? 13.222  4.329   3.425   1.00 0.00 ? 106 THR A C    3  
ATOM 5465  O O    . THR A 1 106 ? 12.367  4.604   4.266   1.00 0.00 ? 106 THR A O    3  
ATOM 5466  C CB   . THR A 1 106 ? 13.437  4.270   0.878   1.00 0.00 ? 106 THR A CB   3  
ATOM 5467  O OG1  . THR A 1 106 ? 12.509  5.295   0.535   1.00 0.00 ? 106 THR A OG1  3  
ATOM 5468  C CG2  . THR A 1 106 ? 13.423  3.334   -0.333  1.00 0.00 ? 106 THR A CG2  3  
ATOM 5469  H H    . THR A 1 106 ? 10.953  4.508   1.988   1.00 0.00 ? 106 THR A H    3  
ATOM 5470  H HA   . THR A 1 106 ? 13.180  2.592   2.205   1.00 0.00 ? 106 THR A HA   3  
ATOM 5471  H HB   . THR A 1 106 ? 14.445  4.633   1.077   1.00 0.00 ? 106 THR A HB   3  
ATOM 5472  H HG1  . THR A 1 106 ? 11.651  4.888   0.220   1.00 0.00 ? 106 THR A HG1  3  
ATOM 5473  H HG21 . THR A 1 106 ? 14.128  2.518   -0.170  1.00 0.00 ? 106 THR A HG21 3  
ATOM 5474  H HG22 . THR A 1 106 ? 12.421  2.927   -0.466  1.00 0.00 ? 106 THR A HG22 3  
ATOM 5475  H HG23 . THR A 1 106 ? 13.711  3.890   -1.225  1.00 0.00 ? 106 THR A HG23 3  
ATOM 5476  N N    . ARG A 1 107 ? 14.512  4.603   3.550   1.00 0.00 ? 107 ARG A N    3  
ATOM 5477  C CA   . ARG A 1 107 ? 15.025  5.272   4.733   1.00 0.00 ? 107 ARG A CA   3  
ATOM 5478  C C    . ARG A 1 107 ? 14.736  6.773   4.660   1.00 0.00 ? 107 ARG A C    3  
ATOM 5479  O O    . ARG A 1 107 ? 15.134  7.529   5.546   1.00 0.00 ? 107 ARG A O    3  
ATOM 5480  C CB   . ARG A 1 107 ? 16.532  5.056   4.879   1.00 0.00 ? 107 ARG A CB   3  
ATOM 5481  C CG   . ARG A 1 107 ? 17.291  5.673   3.702   1.00 0.00 ? 107 ARG A CG   3  
ATOM 5482  C CD   . ARG A 1 107 ? 18.613  4.941   3.458   1.00 0.00 ? 107 ARG A CD   3  
ATOM 5483  N NE   . ARG A 1 107 ? 19.712  5.631   4.169   1.00 0.00 ? 107 ARG A NE   3  
ATOM 5484  C CZ   . ARG A 1 107 ? 20.951  5.138   4.296   1.00 0.00 ? 107 ARG A CZ   3  
ATOM 5485  N NH1  . ARG A 1 107 ? 21.256  3.948   3.760   1.00 0.00 ? 107 ARG A NH1  3  
ATOM 5486  N NH2  . ARG A 1 107 ? 21.885  5.834   4.959   1.00 0.00 ? 107 ARG A NH2  3  
ATOM 5487  H H    . ARG A 1 107 ? 15.201  4.376   2.861   1.00 0.00 ? 107 ARG A H    3  
ATOM 5488  H HA   . ARG A 1 107 ? 14.494  4.811   5.566   1.00 0.00 ? 107 ARG A HA   3  
ATOM 5489  H HB2  . ARG A 1 107 ? 16.878  5.500   5.812   1.00 0.00 ? 107 ARG A HB2  3  
ATOM 5490  H HB3  . ARG A 1 107 ? 16.746  3.989   4.935   1.00 0.00 ? 107 ARG A HB3  3  
ATOM 5491  H HG2  . ARG A 1 107 ? 16.675  5.628   2.804   1.00 0.00 ? 107 ARG A HG2  3  
ATOM 5492  H HG3  . ARG A 1 107 ? 17.486  6.726   3.903   1.00 0.00 ? 107 ARG A HG3  3  
ATOM 5493  H HD2  . ARG A 1 107 ? 18.536  3.910   3.803   1.00 0.00 ? 107 ARG A HD2  3  
ATOM 5494  H HD3  . ARG A 1 107 ? 18.826  4.905   2.390   1.00 0.00 ? 107 ARG A HD3  3  
ATOM 5495  H HE   . ARG A 1 107 ? 19.518  6.522   4.581   1.00 0.00 ? 107 ARG A HE   3  
ATOM 5496  H HH11 . ARG A 1 107 ? 20.559  3.429   3.266   1.00 0.00 ? 107 ARG A HH11 3  
ATOM 5497  H HH12 . ARG A 1 107 ? 22.181  3.580   3.855   1.00 0.00 ? 107 ARG A HH12 3  
ATOM 5498  H HH21 . ARG A 1 107 ? 21.657  6.722   5.359   1.00 0.00 ? 107 ARG A HH21 3  
ATOM 5499  H HH22 . ARG A 1 107 ? 22.810  5.465   5.053   1.00 0.00 ? 107 ARG A HH22 3  
ATOM 5500  N N    . LYS A 1 108 ? 14.048  7.160   3.597   1.00 0.00 ? 108 LYS A N    3  
ATOM 5501  C CA   . LYS A 1 108 ? 13.702  8.558   3.397   1.00 0.00 ? 108 LYS A CA   3  
ATOM 5502  C C    . LYS A 1 108 ? 12.230  8.770   3.757   1.00 0.00 ? 108 LYS A C    3  
ATOM 5503  O O    . LYS A 1 108 ? 11.891  9.721   4.460   1.00 0.00 ? 108 LYS A O    3  
ATOM 5504  C CB   . LYS A 1 108 ? 14.058  9.000   1.976   1.00 0.00 ? 108 LYS A CB   3  
ATOM 5505  C CG   . LYS A 1 108 ? 15.508  9.483   1.900   1.00 0.00 ? 108 LYS A CG   3  
ATOM 5506  C CD   . LYS A 1 108 ? 16.461  8.316   1.636   1.00 0.00 ? 108 LYS A CD   3  
ATOM 5507  C CE   . LYS A 1 108 ? 15.993  7.484   0.441   1.00 0.00 ? 108 LYS A CE   3  
ATOM 5508  N NZ   . LYS A 1 108 ? 17.137  6.785   -0.185  1.00 0.00 ? 108 LYS A NZ   3  
ATOM 5509  H H    . LYS A 1 108 ? 13.729  6.540   2.881   1.00 0.00 ? 108 LYS A H    3  
ATOM 5510  H HA   . LYS A 1 108 ? 14.313  9.146   4.081   1.00 0.00 ? 108 LYS A HA   3  
ATOM 5511  H HB2  . LYS A 1 108 ? 13.910  8.170   1.285   1.00 0.00 ? 108 LYS A HB2  3  
ATOM 5512  H HB3  . LYS A 1 108 ? 13.387  9.799   1.662   1.00 0.00 ? 108 LYS A HB3  3  
ATOM 5513  H HG2  . LYS A 1 108 ? 15.606  10.224  1.106   1.00 0.00 ? 108 LYS A HG2  3  
ATOM 5514  H HG3  . LYS A 1 108 ? 15.780  9.977   2.832   1.00 0.00 ? 108 LYS A HG3  3  
ATOM 5515  H HD2  . LYS A 1 108 ? 17.465  8.697   1.447   1.00 0.00 ? 108 LYS A HD2  3  
ATOM 5516  H HD3  . LYS A 1 108 ? 16.522  7.684   2.522   1.00 0.00 ? 108 LYS A HD3  3  
ATOM 5517  H HE2  . LYS A 1 108 ? 15.248  6.757   0.765   1.00 0.00 ? 108 LYS A HE2  3  
ATOM 5518  H HE3  . LYS A 1 108 ? 15.509  8.130   -0.292  1.00 0.00 ? 108 LYS A HE3  3  
ATOM 5519  H HZ1  . LYS A 1 108 ? 17.396  5.999   0.378   1.00 0.00 ? 108 LYS A HZ1  3  
ATOM 5520  H HZ2  . LYS A 1 108 ? 16.877  6.470   -1.098  1.00 0.00 ? 108 LYS A HZ2  3  
ATOM 5521  H HZ3  . LYS A 1 108 ? 17.913  7.412   -0.257  1.00 0.00 ? 108 LYS A HZ3  3  
ATOM 5522  N N    . GLY A 1 109 ? 11.396  7.870   3.258   1.00 0.00 ? 109 GLY A N    3  
ATOM 5523  C CA   . GLY A 1 109 ? 9.968   7.947   3.518   1.00 0.00 ? 109 GLY A CA   3  
ATOM 5524  C C    . GLY A 1 109 ? 9.176   7.171   2.464   1.00 0.00 ? 109 GLY A C    3  
ATOM 5525  O O    . GLY A 1 109 ? 9.377   5.970   2.292   1.00 0.00 ? 109 GLY A O    3  
ATOM 5526  H H    . GLY A 1 109 ? 11.680  7.100   2.688   1.00 0.00 ? 109 GLY A H    3  
ATOM 5527  H HA2  . GLY A 1 109 ? 9.753   7.546   4.509   1.00 0.00 ? 109 GLY A HA2  3  
ATOM 5528  H HA3  . GLY A 1 109 ? 9.652   8.990   3.522   1.00 0.00 ? 109 GLY A HA3  3  
ATOM 5529  N N    . TRP A 1 110 ? 8.293   7.890   1.787   1.00 0.00 ? 110 TRP A N    3  
ATOM 5530  C CA   . TRP A 1 110 ? 7.470   7.283   0.754   1.00 0.00 ? 110 TRP A CA   3  
ATOM 5531  C C    . TRP A 1 110 ? 7.595   8.135   -0.511  1.00 0.00 ? 110 TRP A C    3  
ATOM 5532  O O    . TRP A 1 110 ? 7.084   9.253   -0.564  1.00 0.00 ? 110 TRP A O    3  
ATOM 5533  C CB   . TRP A 1 110 ? 6.024   7.126   1.228   1.00 0.00 ? 110 TRP A CB   3  
ATOM 5534  C CG   . TRP A 1 110 ? 5.835   6.057   2.307   1.00 0.00 ? 110 TRP A CG   3  
ATOM 5535  C CD1  . TRP A 1 110 ? 5.859   6.214   3.637   1.00 0.00 ? 110 TRP A CD1  3  
ATOM 5536  C CD2  . TRP A 1 110 ? 5.592   4.651   2.090   1.00 0.00 ? 110 TRP A CD2  3  
ATOM 5537  N NE1  . TRP A 1 110 ? 5.649   5.018   4.292   1.00 0.00 ? 110 TRP A NE1  3  
ATOM 5538  C CE2  . TRP A 1 110 ? 5.482   4.037   3.321   1.00 0.00 ? 110 TRP A CE2  3  
ATOM 5539  C CE3  . TRP A 1 110 ? 5.469   3.922   0.894   1.00 0.00 ? 110 TRP A CE3  3  
ATOM 5540  C CZ2  . TRP A 1 110 ? 5.244   2.666   3.475   1.00 0.00 ? 110 TRP A CZ2  3  
ATOM 5541  C CZ3  . TRP A 1 110 ? 5.231   2.553   1.065   1.00 0.00 ? 110 TRP A CZ3  3  
ATOM 5542  C CH2  . TRP A 1 110 ? 5.118   1.920   2.297   1.00 0.00 ? 110 TRP A CH2  3  
ATOM 5543  H H    . TRP A 1 110 ? 8.136   8.866   1.933   1.00 0.00 ? 110 TRP A H    3  
ATOM 5544  H HA   . TRP A 1 110 ? 7.854   6.280   0.568   1.00 0.00 ? 110 TRP A HA   3  
ATOM 5545  H HB2  . TRP A 1 110 ? 5.672   8.083   1.614   1.00 0.00 ? 110 TRP A HB2  3  
ATOM 5546  H HB3  . TRP A 1 110 ? 5.396   6.878   0.372   1.00 0.00 ? 110 TRP A HB3  3  
ATOM 5547  H HD1  . TRP A 1 110 ? 6.023   7.168   4.139   1.00 0.00 ? 110 TRP A HD1  3  
ATOM 5548  H HE1  . TRP A 1 110 ? 5.620   4.869   5.371   1.00 0.00 ? 110 TRP A HE1  3  
ATOM 5549  H HE3  . TRP A 1 110 ? 5.552   4.384   -0.090  1.00 0.00 ? 110 TRP A HE3  3  
ATOM 5550  H HZ2  . TRP A 1 110 ? 5.161   2.204   4.459   1.00 0.00 ? 110 TRP A HZ2  3  
ATOM 5551  H HZ3  . TRP A 1 110 ? 5.128   1.941   0.170   1.00 0.00 ? 110 TRP A HZ3  3  
ATOM 5552  H HH2  . TRP A 1 110 ? 4.932   0.847   2.346   1.00 0.00 ? 110 TRP A HH2  3  
ATOM 5553  N N    . GLY A 1 111 ? 8.277   7.574   -1.498  1.00 0.00 ? 111 GLY A N    3  
ATOM 5554  C CA   . GLY A 1 111 ? 8.476   8.268   -2.759  1.00 0.00 ? 111 GLY A CA   3  
ATOM 5555  C C    . GLY A 1 111 ? 7.186   8.291   -3.582  1.00 0.00 ? 111 GLY A C    3  
ATOM 5556  O O    . GLY A 1 111 ? 6.104   8.042   -3.052  1.00 0.00 ? 111 GLY A O    3  
ATOM 5557  H H    . GLY A 1 111 ? 8.690   6.665   -1.447  1.00 0.00 ? 111 GLY A H    3  
ATOM 5558  H HA2  . GLY A 1 111 ? 8.808   9.289   -2.569  1.00 0.00 ? 111 GLY A HA2  3  
ATOM 5559  H HA3  . GLY A 1 111 ? 9.265   7.777   -3.328  1.00 0.00 ? 111 GLY A HA3  3  
ATOM 5560  N N    . GLU A 1 112 ? 7.343   8.593   -4.862  1.00 0.00 ? 112 GLU A N    3  
ATOM 5561  C CA   . GLU A 1 112 ? 6.204   8.652   -5.762  1.00 0.00 ? 112 GLU A CA   3  
ATOM 5562  C C    . GLU A 1 112 ? 5.319   7.417   -5.581  1.00 0.00 ? 112 GLU A C    3  
ATOM 5563  O O    . GLU A 1 112 ? 5.744   6.427   -4.988  1.00 0.00 ? 112 GLU A O    3  
ATOM 5564  C CB   . GLU A 1 112 ? 6.661   8.791   -7.216  1.00 0.00 ? 112 GLU A CB   3  
ATOM 5565  C CG   . GLU A 1 112 ? 5.947   9.954   -7.907  1.00 0.00 ? 112 GLU A CG   3  
ATOM 5566  C CD   . GLU A 1 112 ? 6.941   11.044  -8.314  1.00 0.00 ? 112 GLU A CD   3  
ATOM 5567  O OE1  . GLU A 1 112 ? 7.497   11.678  -7.392  1.00 0.00 ? 112 GLU A OE1  3  
ATOM 5568  O OE2  . GLU A 1 112 ? 7.122   11.217  -9.539  1.00 0.00 ? 112 GLU A OE2  3  
ATOM 5569  H H    . GLU A 1 112 ? 8.227   8.795   -5.284  1.00 0.00 ? 112 GLU A H    3  
ATOM 5570  H HA   . GLU A 1 112 ? 5.653   9.548   -5.474  1.00 0.00 ? 112 GLU A HA   3  
ATOM 5571  H HB2  . GLU A 1 112 ? 7.739   8.950   -7.249  1.00 0.00 ? 112 GLU A HB2  3  
ATOM 5572  H HB3  . GLU A 1 112 ? 6.459   7.865   -7.754  1.00 0.00 ? 112 GLU A HB3  3  
ATOM 5573  H HG2  . GLU A 1 112 ? 5.419   9.590   -8.788  1.00 0.00 ? 112 GLU A HG2  3  
ATOM 5574  H HG3  . GLU A 1 112 ? 5.196   10.374  -7.237  1.00 0.00 ? 112 GLU A HG3  3  
ATOM 5575  N N    . ALA A 1 113 ? 4.106   7.516   -6.103  1.00 0.00 ? 113 ALA A N    3  
ATOM 5576  C CA   . ALA A 1 113 ? 3.158   6.419   -6.006  1.00 0.00 ? 113 ALA A CA   3  
ATOM 5577  C C    . ALA A 1 113 ? 2.476   6.219   -7.361  1.00 0.00 ? 113 ALA A C    3  
ATOM 5578  O O    . ALA A 1 113 ? 2.105   7.188   -8.023  1.00 0.00 ? 113 ALA A O    3  
ATOM 5579  C CB   . ALA A 1 113 ? 2.156   6.707   -4.886  1.00 0.00 ? 113 ALA A CB   3  
ATOM 5580  H H    . ALA A 1 113 ? 3.768   8.325   -6.584  1.00 0.00 ? 113 ALA A H    3  
ATOM 5581  H HA   . ALA A 1 113 ? 3.717   5.519   -5.754  1.00 0.00 ? 113 ALA A HA   3  
ATOM 5582  H HB1  . ALA A 1 113 ? 1.414   7.424   -5.238  1.00 0.00 ? 113 ALA A HB1  3  
ATOM 5583  H HB2  . ALA A 1 113 ? 1.659   5.782   -4.596  1.00 0.00 ? 113 ALA A HB2  3  
ATOM 5584  H HB3  . ALA A 1 113 ? 2.682   7.122   -4.026  1.00 0.00 ? 113 ALA A HB3  3  
ATOM 5585  N N    . ALA A 1 114 ? 2.330   4.956   -7.734  1.00 0.00 ? 114 ALA A N    3  
ATOM 5586  C CA   . ALA A 1 114 ? 1.699   4.617   -8.998  1.00 0.00 ? 114 ALA A CA   3  
ATOM 5587  C C    . ALA A 1 114 ? 0.208   4.364   -8.767  1.00 0.00 ? 114 ALA A C    3  
ATOM 5588  O O    . ALA A 1 114 ? -0.163  3.482   -7.993  1.00 0.00 ? 114 ALA A O    3  
ATOM 5589  C CB   . ALA A 1 114 ? 2.407   3.408   -9.614  1.00 0.00 ? 114 ALA A CB   3  
ATOM 5590  H H    . ALA A 1 114 ? 2.634   4.174   -7.190  1.00 0.00 ? 114 ALA A H    3  
ATOM 5591  H HA   . ALA A 1 114 ? 1.815   5.470   -9.666  1.00 0.00 ? 114 ALA A HA   3  
ATOM 5592  H HB1  . ALA A 1 114 ? 1.892   3.113   -10.528 1.00 0.00 ? 114 ALA A HB1  3  
ATOM 5593  H HB2  . ALA A 1 114 ? 3.439   3.671   -9.846  1.00 0.00 ? 114 ALA A HB2  3  
ATOM 5594  H HB3  . ALA A 1 114 ? 2.394   2.580   -8.906  1.00 0.00 ? 114 ALA A HB3  3  
ATOM 5595  N N    . GLU A 1 115 ? -0.607  5.153   -9.451  1.00 0.00 ? 115 GLU A N    3  
ATOM 5596  C CA   . GLU A 1 115 ? -2.049  5.026   -9.330  1.00 0.00 ? 115 GLU A CA   3  
ATOM 5597  C C    . GLU A 1 115 ? -2.605  4.175   -10.474 1.00 0.00 ? 115 GLU A C    3  
ATOM 5598  O O    . GLU A 1 115 ? -2.383  4.481   -11.644 1.00 0.00 ? 115 GLU A O    3  
ATOM 5599  C CB   . GLU A 1 115 ? -2.720  6.401   -9.294  1.00 0.00 ? 115 GLU A CB   3  
ATOM 5600  C CG   . GLU A 1 115 ? -2.931  6.870   -7.853  1.00 0.00 ? 115 GLU A CG   3  
ATOM 5601  C CD   . GLU A 1 115 ? -3.946  8.014   -7.792  1.00 0.00 ? 115 GLU A CD   3  
ATOM 5602  O OE1  . GLU A 1 115 ? -3.971  8.802   -8.762  1.00 0.00 ? 115 GLU A OE1  3  
ATOM 5603  O OE2  . GLU A 1 115 ? -4.673  8.074   -6.777  1.00 0.00 ? 115 GLU A OE2  3  
ATOM 5604  H H    . GLU A 1 115 ? -0.297  5.868   -10.078 1.00 0.00 ? 115 GLU A H    3  
ATOM 5605  H HA   . GLU A 1 115 ? -2.217  4.522   -8.378  1.00 0.00 ? 115 GLU A HA   3  
ATOM 5606  H HB2  . GLU A 1 115 ? -2.105  7.124   -9.829  1.00 0.00 ? 115 GLU A HB2  3  
ATOM 5607  H HB3  . GLU A 1 115 ? -3.679  6.355   -9.810  1.00 0.00 ? 115 GLU A HB3  3  
ATOM 5608  H HG2  . GLU A 1 115 ? -3.280  6.037   -7.243  1.00 0.00 ? 115 GLU A HG2  3  
ATOM 5609  H HG3  . GLU A 1 115 ? -1.982  7.198   -7.431  1.00 0.00 ? 115 GLU A HG3  3  
ATOM 5610  N N    . ALA A 1 116 ? -3.316  3.123   -10.095 1.00 0.00 ? 116 ALA A N    3  
ATOM 5611  C CA   . ALA A 1 116 ? -3.905  2.226   -11.074 1.00 0.00 ? 116 ALA A CA   3  
ATOM 5612  C C    . ALA A 1 116 ? -5.340  1.895   -10.658 1.00 0.00 ? 116 ALA A C    3  
ATOM 5613  O O    . ALA A 1 116 ? -5.573  1.403   -9.555  1.00 0.00 ? 116 ALA A O    3  
ATOM 5614  C CB   . ALA A 1 116 ? -3.034  0.975   -11.209 1.00 0.00 ? 116 ALA A CB   3  
ATOM 5615  H H    . ALA A 1 116 ? -3.491  2.881   -9.140  1.00 0.00 ? 116 ALA A H    3  
ATOM 5616  H HA   . ALA A 1 116 ? -3.923  2.745   -12.032 1.00 0.00 ? 116 ALA A HA   3  
ATOM 5617  H HB1  . ALA A 1 116 ? -2.086  1.135   -10.695 1.00 0.00 ? 116 ALA A HB1  3  
ATOM 5618  H HB2  . ALA A 1 116 ? -3.549  0.124   -10.764 1.00 0.00 ? 116 ALA A HB2  3  
ATOM 5619  H HB3  . ALA A 1 116 ? -2.846  0.775   -12.264 1.00 0.00 ? 116 ALA A HB3  3  
ATOM 5620  N N    . LEU A 1 117 ? -6.264  2.178   -11.564 1.00 0.00 ? 117 LEU A N    3  
ATOM 5621  C CA   . LEU A 1 117 ? -7.670  1.917   -11.306 1.00 0.00 ? 117 LEU A CA   3  
ATOM 5622  C C    . LEU A 1 117 ? -8.025  0.516   -11.807 1.00 0.00 ? 117 LEU A C    3  
ATOM 5623  O O    . LEU A 1 117 ? -7.375  -0.007  -12.712 1.00 0.00 ? 117 LEU A O    3  
ATOM 5624  C CB   . LEU A 1 117 ? -8.540  3.023   -11.906 1.00 0.00 ? 117 LEU A CB   3  
ATOM 5625  C CG   . LEU A 1 117 ? -8.567  4.346   -11.138 1.00 0.00 ? 117 LEU A CG   3  
ATOM 5626  C CD1  . LEU A 1 117 ? -8.491  5.537   -12.095 1.00 0.00 ? 117 LEU A CD1  3  
ATOM 5627  C CD2  . LEU A 1 117 ? -9.790  4.423   -10.222 1.00 0.00 ? 117 LEU A CD2  3  
ATOM 5628  H H    . LEU A 1 117 ? -6.066  2.578   -12.459 1.00 0.00 ? 117 LEU A H    3  
ATOM 5629  H HA   . LEU A 1 117 ? -7.814  1.944   -10.225 1.00 0.00 ? 117 LEU A HA   3  
ATOM 5630  H HB2  . LEU A 1 117 ? -8.192  3.222   -12.920 1.00 0.00 ? 117 LEU A HB2  3  
ATOM 5631  H HB3  . LEU A 1 117 ? -9.561  2.652   -11.986 1.00 0.00 ? 117 LEU A HB3  3  
ATOM 5632  H HG   . LEU A 1 117 ? -7.684  4.389   -10.500 1.00 0.00 ? 117 LEU A HG   3  
ATOM 5633  H HD11 . LEU A 1 117 ? -7.504  5.572   -12.555 1.00 0.00 ? 117 LEU A HD11 3  
ATOM 5634  H HD12 . LEU A 1 117 ? -9.250  5.430   -12.870 1.00 0.00 ? 117 LEU A HD12 3  
ATOM 5635  H HD13 . LEU A 1 117 ? -8.666  6.460   -11.541 1.00 0.00 ? 117 LEU A HD13 3  
ATOM 5636  H HD21 . LEU A 1 117 ? -9.749  3.615   -9.492  1.00 0.00 ? 117 LEU A HD21 3  
ATOM 5637  H HD22 . LEU A 1 117 ? -9.795  5.382   -9.703  1.00 0.00 ? 117 LEU A HD22 3  
ATOM 5638  H HD23 . LEU A 1 117 ? -10.697 4.328   -10.819 1.00 0.00 ? 117 LEU A HD23 3  
ATOM 5639  N N    . VAL A 1 118 ? -9.054  -0.053  -11.198 1.00 0.00 ? 118 VAL A N    3  
ATOM 5640  C CA   . VAL A 1 118 ? -9.503  -1.384  -11.571 1.00 0.00 ? 118 VAL A CA   3  
ATOM 5641  C C    . VAL A 1 118 ? -10.971 -1.553  -11.174 1.00 0.00 ? 118 VAL A C    3  
ATOM 5642  O O    . VAL A 1 118 ? -11.332 -1.345  -10.017 1.00 0.00 ? 118 VAL A O    3  
ATOM 5643  C CB   . VAL A 1 118 ? -8.589  -2.439  -10.945 1.00 0.00 ? 118 VAL A CB   3  
ATOM 5644  C CG1  . VAL A 1 118 ? -8.476  -2.239  -9.432  1.00 0.00 ? 118 VAL A CG1  3  
ATOM 5645  C CG2  . VAL A 1 118 ? -9.075  -3.852  -11.277 1.00 0.00 ? 118 VAL A CG2  3  
ATOM 5646  H H    . VAL A 1 118 ? -9.577  0.378   -10.463 1.00 0.00 ? 118 VAL A H    3  
ATOM 5647  H HA   . VAL A 1 118 ? -9.421  -1.467  -12.655 1.00 0.00 ? 118 VAL A HA   3  
ATOM 5648  H HB   . VAL A 1 118 ? -7.595  -2.318  -11.374 1.00 0.00 ? 118 VAL A HB   3  
ATOM 5649  H HG11 . VAL A 1 118 ? -8.543  -3.205  -8.932  1.00 0.00 ? 118 VAL A HG11 3  
ATOM 5650  H HG12 . VAL A 1 118 ? -7.519  -1.774  -9.198  1.00 0.00 ? 118 VAL A HG12 3  
ATOM 5651  H HG13 . VAL A 1 118 ? -9.287  -1.596  -9.090  1.00 0.00 ? 118 VAL A HG13 3  
ATOM 5652  H HG21 . VAL A 1 118 ? -8.701  -4.144  -12.258 1.00 0.00 ? 118 VAL A HG21 3  
ATOM 5653  H HG22 . VAL A 1 118 ? -8.706  -4.549  -10.525 1.00 0.00 ? 118 VAL A HG22 3  
ATOM 5654  H HG23 . VAL A 1 118 ? -10.165 -3.869  -11.283 1.00 0.00 ? 118 VAL A HG23 3  
ATOM 5655  N N    . VAL A 1 119 ? -11.777 -1.927  -12.156 1.00 0.00 ? 119 VAL A N    3  
ATOM 5656  C CA   . VAL A 1 119 ? -13.198 -2.126  -11.924 1.00 0.00 ? 119 VAL A CA   3  
ATOM 5657  C C    . VAL A 1 119 ? -13.423 -3.517  -11.328 1.00 0.00 ? 119 VAL A C    3  
ATOM 5658  O O    . VAL A 1 119 ? -12.688 -4.454  -11.636 1.00 0.00 ? 119 VAL A O    3  
ATOM 5659  C CB   . VAL A 1 119 ? -13.978 -1.897  -13.220 1.00 0.00 ? 119 VAL A CB   3  
ATOM 5660  C CG1  . VAL A 1 119 ? -15.309 -2.650  -13.199 1.00 0.00 ? 119 VAL A CG1  3  
ATOM 5661  C CG2  . VAL A 1 119 ? -14.196 -0.404  -13.472 1.00 0.00 ? 119 VAL A CG2  3  
ATOM 5662  H H    . VAL A 1 119 ? -11.476 -2.094  -13.095 1.00 0.00 ? 119 VAL A H    3  
ATOM 5663  H HA   . VAL A 1 119 ? -13.520 -1.378  -11.199 1.00 0.00 ? 119 VAL A HA   3  
ATOM 5664  H HB   . VAL A 1 119 ? -13.382 -2.292  -14.043 1.00 0.00 ? 119 VAL A HB   3  
ATOM 5665  H HG11 . VAL A 1 119 ? -15.882 -2.399  -14.092 1.00 0.00 ? 119 VAL A HG11 3  
ATOM 5666  H HG12 . VAL A 1 119 ? -15.119 -3.723  -13.179 1.00 0.00 ? 119 VAL A HG12 3  
ATOM 5667  H HG13 . VAL A 1 119 ? -15.874 -2.364  -12.312 1.00 0.00 ? 119 VAL A HG13 3  
ATOM 5668  H HG21 . VAL A 1 119 ? -15.257 -0.214  -13.637 1.00 0.00 ? 119 VAL A HG21 3  
ATOM 5669  H HG22 . VAL A 1 119 ? -13.855 0.164   -12.606 1.00 0.00 ? 119 VAL A HG22 3  
ATOM 5670  H HG23 . VAL A 1 119 ? -13.631 -0.098  -14.353 1.00 0.00 ? 119 VAL A HG23 3  
ATOM 5671  N N    . THR A 1 120 ? -14.442 -3.608  -10.486 1.00 0.00 ? 120 THR A N    3  
ATOM 5672  C CA   . THR A 1 120 ? -14.773 -4.869  -9.845  1.00 0.00 ? 120 THR A CA   3  
ATOM 5673  C C    . THR A 1 120 ? -15.967 -5.525  -10.543 1.00 0.00 ? 120 THR A C    3  
ATOM 5674  O O    . THR A 1 120 ? -17.083 -5.012  -10.484 1.00 0.00 ? 120 THR A O    3  
ATOM 5675  C CB   . THR A 1 120 ? -15.013 -4.595  -8.359  1.00 0.00 ? 120 THR A CB   3  
ATOM 5676  O OG1  . THR A 1 120 ? -15.754 -3.379  -8.345  1.00 0.00 ? 120 THR A OG1  3  
ATOM 5677  C CG2  . THR A 1 120 ? -13.723 -4.254  -7.611  1.00 0.00 ? 120 THR A CG2  3  
ATOM 5678  H H    . THR A 1 120 ? -15.035 -2.841  -10.241 1.00 0.00 ? 120 THR A H    3  
ATOM 5679  H HA   . THR A 1 120 ? -13.926 -5.545  -9.959  1.00 0.00 ? 120 THR A HA   3  
ATOM 5680  H HB   . THR A 1 120 ? -15.527 -5.433  -7.887  1.00 0.00 ? 120 THR A HB   3  
ATOM 5681  H HG1  . THR A 1 120 ? -16.728 -3.573  -8.229  1.00 0.00 ? 120 THR A HG1  3  
ATOM 5682  H HG21 . THR A 1 120 ? -12.868 -4.642  -8.165  1.00 0.00 ? 120 THR A HG21 3  
ATOM 5683  H HG22 . THR A 1 120 ? -13.633 -3.172  -7.516  1.00 0.00 ? 120 THR A HG22 3  
ATOM 5684  H HG23 . THR A 1 120 ? -13.747 -4.706  -6.619  1.00 0.00 ? 120 THR A HG23 3  
ATOM 5685  N N    . THR A 1 121 ? -15.690 -6.649  -11.187 1.00 0.00 ? 121 THR A N    3  
ATOM 5686  C CA   . THR A 1 121 ? -16.727 -7.380  -11.895 1.00 0.00 ? 121 THR A CA   3  
ATOM 5687  C C    . THR A 1 121 ? -16.167 -8.687  -12.461 1.00 0.00 ? 121 THR A C    3  
ATOM 5688  O O    . THR A 1 121 ? -14.953 -8.882  -12.496 1.00 0.00 ? 121 THR A O    3  
ATOM 5689  C CB   . THR A 1 121 ? -17.311 -6.456  -12.965 1.00 0.00 ? 121 THR A CB   3  
ATOM 5690  O OG1  . THR A 1 121 ? -18.303 -7.251  -13.608 1.00 0.00 ? 121 THR A OG1  3  
ATOM 5691  C CG2  . THR A 1 121 ? -16.308 -6.140  -14.077 1.00 0.00 ? 121 THR A CG2  3  
ATOM 5692  H H    . THR A 1 121 ? -14.779 -7.059  -11.230 1.00 0.00 ? 121 THR A H    3  
ATOM 5693  H HA   . THR A 1 121 ? -17.507 -7.648  -11.182 1.00 0.00 ? 121 THR A HA   3  
ATOM 5694  H HB   . THR A 1 121 ? -17.699 -5.540  -12.519 1.00 0.00 ? 121 THR A HB   3  
ATOM 5695  H HG1  . THR A 1 121 ? -17.867 -7.966  -14.155 1.00 0.00 ? 121 THR A HG1  3  
ATOM 5696  H HG21 . THR A 1 121 ? -15.321 -5.984  -13.642 1.00 0.00 ? 121 THR A HG21 3  
ATOM 5697  H HG22 . THR A 1 121 ? -16.269 -6.974  -14.778 1.00 0.00 ? 121 THR A HG22 3  
ATOM 5698  H HG23 . THR A 1 121 ? -16.621 -5.238  -14.603 1.00 0.00 ? 121 THR A HG23 3  
ATOM 5699  N N    . GLU A 1 122 ? -17.079 -9.547  -12.889 1.00 0.00 ? 122 GLU A N    3  
ATOM 5700  C CA   . GLU A 1 122 ? -16.691 -10.830 -13.452 1.00 0.00 ? 122 GLU A CA   3  
ATOM 5701  C C    . GLU A 1 122 ? -16.452 -10.699 -14.957 1.00 0.00 ? 122 GLU A C    3  
ATOM 5702  O O    . GLU A 1 122 ? -15.471 -11.225 -15.481 1.00 0.00 ? 122 GLU A O    3  
ATOM 5703  C CB   . GLU A 1 122 ? -17.744 -11.899 -13.155 1.00 0.00 ? 122 GLU A CB   3  
ATOM 5704  C CG   . GLU A 1 122 ? -17.902 -12.110 -11.648 1.00 0.00 ? 122 GLU A CG   3  
ATOM 5705  C CD   . GLU A 1 122 ? -19.225 -12.809 -11.328 1.00 0.00 ? 122 GLU A CD   3  
ATOM 5706  O OE1  . GLU A 1 122 ? -20.275 -12.173 -11.565 1.00 0.00 ? 122 GLU A OE1  3  
ATOM 5707  O OE2  . GLU A 1 122 ? -19.157 -13.963 -10.852 1.00 0.00 ? 122 GLU A OE2  3  
ATOM 5708  H H    . GLU A 1 122 ? -18.064 -9.380  -12.857 1.00 0.00 ? 122 GLU A H    3  
ATOM 5709  H HA   . GLU A 1 122 ? -15.761 -11.096 -12.951 1.00 0.00 ? 122 GLU A HA   3  
ATOM 5710  H HB2  . GLU A 1 122 ? -18.700 -11.603 -13.586 1.00 0.00 ? 122 GLU A HB2  3  
ATOM 5711  H HB3  . GLU A 1 122 ? -17.458 -12.838 -13.629 1.00 0.00 ? 122 GLU A HB3  3  
ATOM 5712  H HG2  . GLU A 1 122 ? -17.071 -12.707 -11.272 1.00 0.00 ? 122 GLU A HG2  3  
ATOM 5713  H HG3  . GLU A 1 122 ? -17.861 -11.149 -11.136 1.00 0.00 ? 122 GLU A HG3  3  
ATOM 5714  N N    . LYS A 1 123 ? -17.364 -9.994  -15.610 1.00 0.00 ? 123 LYS A N    3  
ATOM 5715  C CA   . LYS A 1 123 ? -17.265 -9.788  -17.045 1.00 0.00 ? 123 LYS A CA   3  
ATOM 5716  C C    . LYS A 1 123 ? -15.939 -9.094  -17.365 1.00 0.00 ? 123 LYS A C    3  
ATOM 5717  O O    . LYS A 1 123 ? -15.422 -8.330  -16.551 1.00 0.00 ? 123 LYS A O    3  
ATOM 5718  C CB   . LYS A 1 123 ? -18.493 -9.037  -17.565 1.00 0.00 ? 123 LYS A CB   3  
ATOM 5719  C CG   . LYS A 1 123 ? -19.738 -9.925  -17.519 1.00 0.00 ? 123 LYS A CG   3  
ATOM 5720  C CD   . LYS A 1 123 ? -20.925 -9.175  -16.912 1.00 0.00 ? 123 LYS A CD   3  
ATOM 5721  C CE   . LYS A 1 123 ? -21.402 -9.853  -15.626 1.00 0.00 ? 123 LYS A CE   3  
ATOM 5722  N NZ   . LYS A 1 123 ? -22.320 -8.963  -14.880 1.00 0.00 ? 123 LYS A NZ   3  
ATOM 5723  H H    . LYS A 1 123 ? -18.159 -9.570  -15.176 1.00 0.00 ? 123 LYS A H    3  
ATOM 5724  H HA   . LYS A 1 123 ? -17.264 -10.770 -17.517 1.00 0.00 ? 123 LYS A HA   3  
ATOM 5725  H HB2  . LYS A 1 123 ? -18.658 -8.142  -16.965 1.00 0.00 ? 123 LYS A HB2  3  
ATOM 5726  H HB3  . LYS A 1 123 ? -18.315 -8.706  -18.588 1.00 0.00 ? 123 LYS A HB3  3  
ATOM 5727  H HG2  . LYS A 1 123 ? -19.990 -10.256 -18.527 1.00 0.00 ? 123 LYS A HG2  3  
ATOM 5728  H HG3  . LYS A 1 123 ? -19.530 -10.820 -16.932 1.00 0.00 ? 123 LYS A HG3  3  
ATOM 5729  H HD2  . LYS A 1 123 ? -20.638 -8.145  -16.699 1.00 0.00 ? 123 LYS A HD2  3  
ATOM 5730  H HD3  . LYS A 1 123 ? -21.742 -9.136  -17.632 1.00 0.00 ? 123 LYS A HD3  3  
ATOM 5731  H HE2  . LYS A 1 123 ? -21.909 -10.788 -15.868 1.00 0.00 ? 123 LYS A HE2  3  
ATOM 5732  H HE3  . LYS A 1 123 ? -20.546 -10.107 -15.002 1.00 0.00 ? 123 LYS A HE3  3  
ATOM 5733  H HZ1  . LYS A 1 123 ? -23.214 -9.404  -14.793 1.00 0.00 ? 123 LYS A HZ1  3  
ATOM 5734  H HZ2  . LYS A 1 123 ? -21.945 -8.785  -13.971 1.00 0.00 ? 123 LYS A HZ2  3  
ATOM 5735  H HZ3  . LYS A 1 123 ? -22.421 -8.100  -15.374 1.00 0.00 ? 123 LYS A HZ3  3  
ATOM 5736  N N    . ARG A 1 124 ? -15.427 -9.385  -18.552 1.00 0.00 ? 124 ARG A N    3  
ATOM 5737  C CA   . ARG A 1 124 ? -14.172 -8.798  -18.990 1.00 0.00 ? 124 ARG A CA   3  
ATOM 5738  C C    . ARG A 1 124 ? -14.428 -7.728  -20.052 1.00 0.00 ? 124 ARG A C    3  
ATOM 5739  O O    . ARG A 1 124 ? -15.249 -7.920  -20.947 1.00 0.00 ? 124 ARG A O    3  
ATOM 5740  C CB   . ARG A 1 124 ? -13.237 -9.864  -19.565 1.00 0.00 ? 124 ARG A CB   3  
ATOM 5741  C CG   . ARG A 1 124 ? -11.872 -9.827  -18.874 1.00 0.00 ? 124 ARG A CG   3  
ATOM 5742  C CD   . ARG A 1 124 ? -10.789 -9.321  -19.829 1.00 0.00 ? 124 ARG A CD   3  
ATOM 5743  N NE   . ARG A 1 124 ? -9.455  -9.468  -19.205 1.00 0.00 ? 124 ARG A NE   3  
ATOM 5744  C CZ   . ARG A 1 124 ? -8.298  -9.265  -19.849 1.00 0.00 ? 124 ARG A CZ   3  
ATOM 5745  N NH1  . ARG A 1 124 ? -8.303  -8.907  -21.140 1.00 0.00 ? 124 ARG A NH1  3  
ATOM 5746  N NH2  . ARG A 1 124 ? -7.135  -9.422  -19.202 1.00 0.00 ? 124 ARG A NH2  3  
ATOM 5747  H H    . ARG A 1 124 ? -15.855 -10.007 -19.208 1.00 0.00 ? 124 ARG A H    3  
ATOM 5748  H HA   . ARG A 1 124 ? -13.739 -8.362  -18.089 1.00 0.00 ? 124 ARG A HA   3  
ATOM 5749  H HB2  . ARG A 1 124 ? -13.684 -10.851 -19.440 1.00 0.00 ? 124 ARG A HB2  3  
ATOM 5750  H HB3  . ARG A 1 124 ? -13.112 -9.704  -20.635 1.00 0.00 ? 124 ARG A HB3  3  
ATOM 5751  H HG2  . ARG A 1 124 ? -11.921 -9.179  -17.999 1.00 0.00 ? 124 ARG A HG2  3  
ATOM 5752  H HG3  . ARG A 1 124 ? -11.613 -10.824 -18.519 1.00 0.00 ? 124 ARG A HG3  3  
ATOM 5753  H HD2  . ARG A 1 124 ? -10.826 -9.881  -20.764 1.00 0.00 ? 124 ARG A HD2  3  
ATOM 5754  H HD3  . ARG A 1 124 ? -10.970 -8.275  -20.077 1.00 0.00 ? 124 ARG A HD3  3  
ATOM 5755  H HE   . ARG A 1 124 ? -9.415  -9.734  -18.242 1.00 0.00 ? 124 ARG A HE   3  
ATOM 5756  H HH11 . ARG A 1 124 ? -9.171  -8.791  -21.623 1.00 0.00 ? 124 ARG A HH11 3  
ATOM 5757  H HH12 . ARG A 1 124 ? -7.439  -8.756  -21.621 1.00 0.00 ? 124 ARG A HH12 3  
ATOM 5758  H HH21 . ARG A 1 124 ? -7.131  -9.689  -18.238 1.00 0.00 ? 124 ARG A HH21 3  
ATOM 5759  H HH22 . ARG A 1 124 ? -6.271  -9.271  -19.682 1.00 0.00 ? 124 ARG A HH22 3  
ATOM 5760  N N    . SER A 1 125 ? -13.710 -6.622  -19.918 1.00 0.00 ? 125 SER A N    3  
ATOM 5761  C CA   . SER A 1 125 ? -13.849 -5.521  -20.855 1.00 0.00 ? 125 SER A CA   3  
ATOM 5762  C C    . SER A 1 125 ? -12.596 -4.644  -20.822 1.00 0.00 ? 125 SER A C    3  
ATOM 5763  O O    . SER A 1 125 ? -11.947 -4.521  -19.784 1.00 0.00 ? 125 SER A O    3  
ATOM 5764  C CB   . SER A 1 125 ? -15.091 -4.684  -20.540 1.00 0.00 ? 125 SER A CB   3  
ATOM 5765  O OG   . SER A 1 125 ? -15.937 -4.536  -21.677 1.00 0.00 ? 125 SER A OG   3  
ATOM 5766  H H    . SER A 1 125 ? -13.044 -6.474  -19.186 1.00 0.00 ? 125 SER A H    3  
ATOM 5767  H HA   . SER A 1 125 ? -13.964 -5.987  -21.833 1.00 0.00 ? 125 SER A HA   3  
ATOM 5768  H HB2  . SER A 1 125 ? -15.649 -5.154  -19.731 1.00 0.00 ? 125 SER A HB2  3  
ATOM 5769  H HB3  . SER A 1 125 ? -14.784 -3.699  -20.187 1.00 0.00 ? 125 SER A HB3  3  
ATOM 5770  H HG   . SER A 1 125 ? -15.402 -4.229  -22.464 1.00 0.00 ? 125 SER A HG   3  
ATOM 5771  N N    . GLY A 1 126 ? -12.292 -4.057  -21.970 1.00 0.00 ? 126 GLY A N    3  
ATOM 5772  C CA   . GLY A 1 126 ? -11.128 -3.195  -22.086 1.00 0.00 ? 126 GLY A CA   3  
ATOM 5773  C C    . GLY A 1 126 ? -11.392 -2.045  -23.059 1.00 0.00 ? 126 GLY A C    3  
ATOM 5774  O O    . GLY A 1 126 ? -10.863 -2.032  -24.169 1.00 0.00 ? 126 GLY A O    3  
ATOM 5775  H H    . GLY A 1 126 ? -12.825 -4.162  -22.810 1.00 0.00 ? 126 GLY A H    3  
ATOM 5776  H HA2  . GLY A 1 126 ? -10.869 -2.795  -21.106 1.00 0.00 ? 126 GLY A HA2  3  
ATOM 5777  H HA3  . GLY A 1 126 ? -10.273 -3.778  -22.429 1.00 0.00 ? 126 GLY A HA3  3  
ATOM 5778  N N    . PRO A 1 127 ? -12.232 -1.081  -22.595 1.00 0.00 ? 127 PRO A N    3  
ATOM 5779  C CA   . PRO A 1 127 ? -12.573 0.072   -23.412 1.00 0.00 ? 127 PRO A CA   3  
ATOM 5780  C C    . PRO A 1 127 ? -11.410 1.065   -23.471 1.00 0.00 ? 127 PRO A C    3  
ATOM 5781  O O    . PRO A 1 127 ? -11.488 2.151   -22.900 1.00 0.00 ? 127 PRO A O    3  
ATOM 5782  C CB   . PRO A 1 127 ? -13.820 0.655   -22.768 1.00 0.00 ? 127 PRO A CB   3  
ATOM 5783  C CG   . PRO A 1 127 ? -13.863 0.092   -21.357 1.00 0.00 ? 127 PRO A CG   3  
ATOM 5784  C CD   . PRO A 1 127 ? -12.877 -1.062  -21.285 1.00 0.00 ? 127 PRO A CD   3  
ATOM 5785  H HA   . PRO A 1 127 ? -12.740 -0.210  -24.356 1.00 0.00 ? 127 PRO A HA   3  
ATOM 5786  H HB2  . PRO A 1 127 ? -13.779 1.744   -22.753 1.00 0.00 ? 127 PRO A HB2  3  
ATOM 5787  H HB3  . PRO A 1 127 ? -14.714 0.378   -23.326 1.00 0.00 ? 127 PRO A HB3  3  
ATOM 5788  H HG2  . PRO A 1 127 ? -13.602 0.862   -20.630 1.00 0.00 ? 127 PRO A HG2  3  
ATOM 5789  H HG3  . PRO A 1 127 ? -14.869 -0.249  -21.112 1.00 0.00 ? 127 PRO A HG3  3  
ATOM 5790  H HD2  . PRO A 1 127 ? -12.149 -0.913  -20.487 1.00 0.00 ? 127 PRO A HD2  3  
ATOM 5791  H HD3  . PRO A 1 127 ? -13.385 -2.005  -21.081 1.00 0.00 ? 127 PRO A HD3  3  
ATOM 5792  N N    . SER A 1 128 ? -10.360 0.656   -24.167 1.00 0.00 ? 128 SER A N    3  
ATOM 5793  C CA   . SER A 1 128 ? -9.183  1.496   -24.309 1.00 0.00 ? 128 SER A CA   3  
ATOM 5794  C C    . SER A 1 128 ? -9.144  2.110   -25.709 1.00 0.00 ? 128 SER A C    3  
ATOM 5795  O O    . SER A 1 128 ? -9.778  1.602   -26.632 1.00 0.00 ? 128 SER A O    3  
ATOM 5796  C CB   . SER A 1 128 ? -7.903  0.700   -24.042 1.00 0.00 ? 128 SER A CB   3  
ATOM 5797  O OG   . SER A 1 128 ? -6.733  1.492   -24.229 1.00 0.00 ? 128 SER A OG   3  
ATOM 5798  H H    . SER A 1 128 ? -10.305 -0.230  -24.628 1.00 0.00 ? 128 SER A H    3  
ATOM 5799  H HA   . SER A 1 128 ? -9.290  2.273   -23.552 1.00 0.00 ? 128 SER A HA   3  
ATOM 5800  H HB2  . SER A 1 128 ? -7.921  0.315   -23.023 1.00 0.00 ? 128 SER A HB2  3  
ATOM 5801  H HB3  . SER A 1 128 ? -7.867  -0.162  -24.708 1.00 0.00 ? 128 SER A HB3  3  
ATOM 5802  H HG   . SER A 1 128 ? -6.632  1.731   -25.195 1.00 0.00 ? 128 SER A HG   3  
ATOM 5803  N N    . SER A 1 129 ? -8.393  3.196   -25.823 1.00 0.00 ? 129 SER A N    3  
ATOM 5804  C CA   . SER A 1 129 ? -8.263  3.885   -27.096 1.00 0.00 ? 129 SER A CA   3  
ATOM 5805  C C    . SER A 1 129 ? -9.644  4.285   -27.618 1.00 0.00 ? 129 SER A C    3  
ATOM 5806  O O    . SER A 1 129 ? -10.403 3.438   -28.088 1.00 0.00 ? 129 SER A O    3  
ATOM 5807  C CB   . SER A 1 129 ? -7.538  3.013   -28.123 1.00 0.00 ? 129 SER A CB   3  
ATOM 5808  O OG   . SER A 1 129 ? -6.443  3.697   -28.727 1.00 0.00 ? 129 SER A OG   3  
ATOM 5809  H H    . SER A 1 129 ? -7.880  3.603   -25.068 1.00 0.00 ? 129 SER A H    3  
ATOM 5810  H HA   . SER A 1 129 ? -7.663  4.771   -26.884 1.00 0.00 ? 129 SER A HA   3  
ATOM 5811  H HB2  . SER A 1 129 ? -7.177  2.107   -27.638 1.00 0.00 ? 129 SER A HB2  3  
ATOM 5812  H HB3  . SER A 1 129 ? -8.242  2.703   -28.896 1.00 0.00 ? 129 SER A HB3  3  
ATOM 5813  H HG   . SER A 1 129 ? -5.893  3.056   -29.262 1.00 0.00 ? 129 SER A HG   3  
ATOM 5814  N N    . GLY A 1 130 ? -9.929  5.575   -27.519 1.00 0.00 ? 130 GLY A N    3  
ATOM 5815  C CA   . GLY A 1 130 ? -11.206 6.096   -27.975 1.00 0.00 ? 130 GLY A CA   3  
ATOM 5816  C C    . GLY A 1 130 ? -12.200 6.206   -26.817 1.00 0.00 ? 130 GLY A C    3  
ATOM 5817  O O    . GLY A 1 130 ? -11.954 6.925   -25.850 1.00 0.00 ? 130 GLY A O    3  
ATOM 5818  H H    . GLY A 1 130 ? -9.307  6.257   -27.135 1.00 0.00 ? 130 GLY A H    3  
ATOM 5819  H HA2  . GLY A 1 130 ? -11.061 7.077   -28.429 1.00 0.00 ? 130 GLY A HA2  3  
ATOM 5820  H HA3  . GLY A 1 130 ? -11.614 5.445   -28.748 1.00 0.00 ? 130 GLY A HA3  3  
ATOM 5821  N N    . GLY A 1 1   ? -14.128 -13.480 10.460  1.00 0.00 ? 1   GLY A N    4  
ATOM 5822  C CA   . GLY A 1 1   ? -13.581 -14.542 9.632   1.00 0.00 ? 1   GLY A CA   4  
ATOM 5823  C C    . GLY A 1 1   ? -13.737 -14.214 8.146   1.00 0.00 ? 1   GLY A C    4  
ATOM 5824  O O    . GLY A 1 1   ? -14.332 -13.197 7.790   1.00 0.00 ? 1   GLY A O    4  
ATOM 5825  H H1   . GLY A 1 1   ? -14.257 -12.605 9.994   1.00 0.00 ? 1   GLY A H1   4  
ATOM 5826  H HA2  . GLY A 1 1   ? -12.526 -14.684 9.868   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5827  H HA3  . GLY A 1 1   ? -14.087 -15.480 9.856   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5828  N N    . SER A 1 2   ? -13.193 -15.093 7.318   1.00 0.00 ? 2   SER A N    4  
ATOM 5829  C CA   . SER A 1 2   ? -13.264 -14.910 5.878   1.00 0.00 ? 2   SER A CA   4  
ATOM 5830  C C    . SER A 1 2   ? -12.628 -16.106 5.167   1.00 0.00 ? 2   SER A C    4  
ATOM 5831  O O    . SER A 1 2   ? -11.416 -16.137 4.962   1.00 0.00 ? 2   SER A O    4  
ATOM 5832  C CB   . SER A 1 2   ? -12.576 -13.611 5.454   1.00 0.00 ? 2   SER A CB   4  
ATOM 5833  O OG   . SER A 1 2   ? -13.146 -13.069 4.265   1.00 0.00 ? 2   SER A OG   4  
ATOM 5834  H H    . SER A 1 2   ? -12.711 -15.918 7.616   1.00 0.00 ? 2   SER A H    4  
ATOM 5835  H HA   . SER A 1 2   ? -14.328 -14.849 5.648   1.00 0.00 ? 2   SER A HA   4  
ATOM 5836  H HB2  . SER A 1 2   ? -12.653 -12.880 6.259   1.00 0.00 ? 2   SER A HB2  4  
ATOM 5837  H HB3  . SER A 1 2   ? -11.514 -13.799 5.294   1.00 0.00 ? 2   SER A HB3  4  
ATOM 5838  H HG   . SER A 1 2   ? -12.539 -12.373 3.882   1.00 0.00 ? 2   SER A HG   4  
ATOM 5839  N N    . SER A 1 3   ? -13.475 -17.060 4.809   1.00 0.00 ? 3   SER A N    4  
ATOM 5840  C CA   . SER A 1 3   ? -13.010 -18.255 4.124   1.00 0.00 ? 3   SER A CA   4  
ATOM 5841  C C    . SER A 1 3   ? -13.686 -18.370 2.757   1.00 0.00 ? 3   SER A C    4  
ATOM 5842  O O    . SER A 1 3   ? -14.784 -17.851 2.557   1.00 0.00 ? 3   SER A O    4  
ATOM 5843  C CB   . SER A 1 3   ? -13.282 -19.508 4.958   1.00 0.00 ? 3   SER A CB   4  
ATOM 5844  O OG   . SER A 1 3   ? -12.091 -20.029 5.543   1.00 0.00 ? 3   SER A OG   4  
ATOM 5845  H H    . SER A 1 3   ? -14.459 -17.027 4.980   1.00 0.00 ? 3   SER A H    4  
ATOM 5846  H HA   . SER A 1 3   ? -11.934 -18.121 4.009   1.00 0.00 ? 3   SER A HA   4  
ATOM 5847  H HB2  . SER A 1 3   ? -13.998 -19.272 5.745   1.00 0.00 ? 3   SER A HB2  4  
ATOM 5848  H HB3  . SER A 1 3   ? -13.739 -20.271 4.328   1.00 0.00 ? 3   SER A HB3  4  
ATOM 5849  H HG   . SER A 1 3   ? -11.660 -20.680 4.919   1.00 0.00 ? 3   SER A HG   4  
ATOM 5850  N N    . GLY A 1 4   ? -13.003 -19.053 1.850   1.00 0.00 ? 4   GLY A N    4  
ATOM 5851  C CA   . GLY A 1 4   ? -13.524 -19.244 0.507   1.00 0.00 ? 4   GLY A CA   4  
ATOM 5852  C C    . GLY A 1 4   ? -12.476 -18.873 -0.545  1.00 0.00 ? 4   GLY A C    4  
ATOM 5853  O O    . GLY A 1 4   ? -12.242 -17.694 -0.804  1.00 0.00 ? 4   GLY A O    4  
ATOM 5854  H H    . GLY A 1 4   ? -12.111 -19.472 2.021   1.00 0.00 ? 4   GLY A H    4  
ATOM 5855  H HA2  . GLY A 1 4   ? -13.826 -20.282 0.375   1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5856  H HA3  . GLY A 1 4   ? -14.415 -18.632 0.369   1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5857  N N    . SER A 1 5   ? -11.875 -19.903 -1.122  1.00 0.00 ? 5   SER A N    4  
ATOM 5858  C CA   . SER A 1 5   ? -10.858 -19.700 -2.140  1.00 0.00 ? 5   SER A CA   4  
ATOM 5859  C C    . SER A 1 5   ? -10.564 -21.020 -2.856  1.00 0.00 ? 5   SER A C    4  
ATOM 5860  O O    . SER A 1 5   ? -10.417 -22.059 -2.214  1.00 0.00 ? 5   SER A O    4  
ATOM 5861  C CB   . SER A 1 5   ? -9.575  -19.129 -1.532  1.00 0.00 ? 5   SER A CB   4  
ATOM 5862  O OG   . SER A 1 5   ? -8.978  -20.030 -0.603  1.00 0.00 ? 5   SER A OG   4  
ATOM 5863  H H    . SER A 1 5   ? -12.071 -20.859 -0.906  1.00 0.00 ? 5   SER A H    4  
ATOM 5864  H HA   . SER A 1 5   ? -11.284 -18.976 -2.834  1.00 0.00 ? 5   SER A HA   4  
ATOM 5865  H HB2  . SER A 1 5   ? -8.865  -18.905 -2.328  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5866  H HB3  . SER A 1 5   ? -9.800  -18.188 -1.030  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5867  H HG   . SER A 1 5   ? -8.954  -19.618 0.307   1.00 0.00 ? 5   SER A HG   4  
ATOM 5868  N N    . SER A 1 6   ? -10.486 -20.936 -4.176  1.00 0.00 ? 6   SER A N    4  
ATOM 5869  C CA   . SER A 1 6   ? -10.212 -22.111 -4.986  1.00 0.00 ? 6   SER A CA   4  
ATOM 5870  C C    . SER A 1 6   ? -10.204 -21.734 -6.469  1.00 0.00 ? 6   SER A C    4  
ATOM 5871  O O    . SER A 1 6   ? -11.249 -21.735 -7.118  1.00 0.00 ? 6   SER A O    4  
ATOM 5872  C CB   . SER A 1 6   ? -11.241 -23.213 -4.724  1.00 0.00 ? 6   SER A CB   4  
ATOM 5873  O OG   . SER A 1 6   ? -10.629 -24.419 -4.276  1.00 0.00 ? 6   SER A OG   4  
ATOM 5874  H H    . SER A 1 6   ? -10.607 -20.087 -4.690  1.00 0.00 ? 6   SER A H    4  
ATOM 5875  H HA   . SER A 1 6   ? -9.226  -22.454 -4.673  1.00 0.00 ? 6   SER A HA   4  
ATOM 5876  H HB2  . SER A 1 6   ? -11.956 -22.870 -3.976  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5877  H HB3  . SER A 1 6   ? -11.804 -23.408 -5.636  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5878  H HG   . SER A 1 6   ? -9.975  -24.221 -3.546  1.00 0.00 ? 6   SER A HG   4  
ATOM 5879  N N    . GLY A 1 7   ? -9.015  -21.422 -6.961  1.00 0.00 ? 7   GLY A N    4  
ATOM 5880  C CA   . GLY A 1 7   ? -8.857  -21.044 -8.355  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5881  C C    . GLY A 1 7   ? -7.401  -21.189 -8.801  1.00 0.00 ? 7   GLY A C    4  
ATOM 5882  O O    . GLY A 1 7   ? -6.587  -21.782 -8.095  1.00 0.00 ? 7   GLY A O    4  
ATOM 5883  H H    . GLY A 1 7   ? -8.170  -21.424 -6.425  1.00 0.00 ? 7   GLY A H    4  
ATOM 5884  H HA2  . GLY A 1 7   ? -9.496  -21.668 -8.979  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5885  H HA3  . GLY A 1 7   ? -9.183  -20.013 -8.495  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5886  N N    . ARG A 1 8   ? -7.116  -20.636 -9.971  1.00 0.00 ? 8   ARG A N    4  
ATOM 5887  C CA   . ARG A 1 8   ? -5.772  -20.696 -10.520 1.00 0.00 ? 8   ARG A CA   4  
ATOM 5888  C C    . ARG A 1 8   ? -5.106  -19.321 -10.445 1.00 0.00 ? 8   ARG A C    4  
ATOM 5889  O O    . ARG A 1 8   ? -5.757  -18.299 -10.659 1.00 0.00 ? 8   ARG A O    4  
ATOM 5890  C CB   . ARG A 1 8   ? -5.792  -21.167 -11.976 1.00 0.00 ? 8   ARG A CB   4  
ATOM 5891  C CG   . ARG A 1 8   ? -5.615  -22.684 -12.064 1.00 0.00 ? 8   ARG A CG   4  
ATOM 5892  C CD   . ARG A 1 8   ? -6.821  -23.338 -12.741 1.00 0.00 ? 8   ARG A CD   4  
ATOM 5893  N NE   . ARG A 1 8   ? -6.802  -23.054 -14.193 1.00 0.00 ? 8   ARG A NE   4  
ATOM 5894  C CZ   . ARG A 1 8   ? -7.693  -23.543 -15.066 1.00 0.00 ? 8   ARG A CZ   4  
ATOM 5895  N NH1  . ARG A 1 8   ? -8.679  -24.345 -14.640 1.00 0.00 ? 8   ARG A NH1  4  
ATOM 5896  N NH2  . ARG A 1 8   ? -7.598  -23.232 -16.366 1.00 0.00 ? 8   ARG A NH2  4  
ATOM 5897  H H    . ARG A 1 8   ? -7.783  -20.155 -10.540 1.00 0.00 ? 8   ARG A H    4  
ATOM 5898  H HA   . ARG A 1 8   ? -5.248  -21.420 -9.896  1.00 0.00 ? 8   ARG A HA   4  
ATOM 5899  H HB2  . ARG A 1 8   ? -6.735  -20.879 -12.442 1.00 0.00 ? 8   ARG A HB2  4  
ATOM 5900  H HB3  . ARG A 1 8   ? -4.997  -20.671 -12.533 1.00 0.00 ? 8   ARG A HB3  4  
ATOM 5901  H HG2  . ARG A 1 8   ? -4.709  -22.916 -12.624 1.00 0.00 ? 8   ARG A HG2  4  
ATOM 5902  H HG3  . ARG A 1 8   ? -5.487  -23.098 -11.064 1.00 0.00 ? 8   ARG A HG3  4  
ATOM 5903  H HD2  . ARG A 1 8   ? -6.804  -24.415 -12.573 1.00 0.00 ? 8   ARG A HD2  4  
ATOM 5904  H HD3  . ARG A 1 8   ? -7.745  -22.962 -12.301 1.00 0.00 ? 8   ARG A HD3  4  
ATOM 5905  H HE   . ARG A 1 8   ? -6.079  -22.459 -14.545 1.00 0.00 ? 8   ARG A HE   4  
ATOM 5906  H HH11 . ARG A 1 8   ? -8.750  -24.577 -13.670 1.00 0.00 ? 8   ARG A HH11 4  
ATOM 5907  H HH12 . ARG A 1 8   ? -9.344  -24.710 -15.291 1.00 0.00 ? 8   ARG A HH12 4  
ATOM 5908  H HH21 . ARG A 1 8   ? -6.863  -22.634 -16.685 1.00 0.00 ? 8   ARG A HH21 4  
ATOM 5909  H HH22 . ARG A 1 8   ? -8.263  -23.597 -17.018 1.00 0.00 ? 8   ARG A HH22 4  
ATOM 5910  N N    . ILE A 1 9   ? -3.816  -19.339 -10.140 1.00 0.00 ? 9   ILE A N    4  
ATOM 5911  C CA   . ILE A 1 9   ? -3.055  -18.106 -10.034 1.00 0.00 ? 9   ILE A CA   4  
ATOM 5912  C C    . ILE A 1 9   ? -2.523  -17.720 -11.416 1.00 0.00 ? 9   ILE A C    4  
ATOM 5913  O O    . ILE A 1 9   ? -2.097  -18.581 -12.184 1.00 0.00 ? 9   ILE A O    4  
ATOM 5914  C CB   . ILE A 1 9   ? -1.963  -18.240 -8.970  1.00 0.00 ? 9   ILE A CB   4  
ATOM 5915  C CG1  . ILE A 1 9   ? -2.572  -18.478 -7.587  1.00 0.00 ? 9   ILE A CG1  4  
ATOM 5916  C CG2  . ILE A 1 9   ? -1.031  -17.028 -8.986  1.00 0.00 ? 9   ILE A CG2  4  
ATOM 5917  C CD1  . ILE A 1 9   ? -1.555  -19.122 -6.643  1.00 0.00 ? 9   ILE A CD1  4  
ATOM 5918  H H    . ILE A 1 9   ? -3.295  -20.174 -9.967  1.00 0.00 ? 9   ILE A H    4  
ATOM 5919  H HA   . ILE A 1 9   ? -3.739  -17.328 -9.697  1.00 0.00 ? 9   ILE A HA   4  
ATOM 5920  H HB   . ILE A 1 9   ? -1.359  -19.115 -9.210  1.00 0.00 ? 9   ILE A HB   4  
ATOM 5921  H HG12 . ILE A 1 9   ? -2.912  -17.530 -7.168  1.00 0.00 ? 9   ILE A HG12 4  
ATOM 5922  H HG13 . ILE A 1 9   ? -3.448  -19.120 -7.676  1.00 0.00 ? 9   ILE A HG13 4  
ATOM 5923  H HG21 . ILE A 1 9   ? -0.504  -16.962 -8.034  1.00 0.00 ? 9   ILE A HG21 4  
ATOM 5924  H HG22 . ILE A 1 9   ? -0.308  -17.136 -9.794  1.00 0.00 ? 9   ILE A HG22 4  
ATOM 5925  H HG23 . ILE A 1 9   ? -1.616  -16.121 -9.141  1.00 0.00 ? 9   ILE A HG23 4  
ATOM 5926  H HD11 . ILE A 1 9   ? -0.902  -18.353 -6.232  1.00 0.00 ? 9   ILE A HD11 4  
ATOM 5927  H HD12 . ILE A 1 9   ? -2.080  -19.625 -5.831  1.00 0.00 ? 9   ILE A HD12 4  
ATOM 5928  H HD13 . ILE A 1 9   ? -0.958  -19.849 -7.194  1.00 0.00 ? 9   ILE A HD13 4  
ATOM 5929  N N    . GLY A 1 10  ? -2.565  -16.424 -11.689 1.00 0.00 ? 10  GLY A N    4  
ATOM 5930  C CA   . GLY A 1 10  ? -2.093  -15.914 -12.965 1.00 0.00 ? 10  GLY A CA   4  
ATOM 5931  C C    . GLY A 1 10  ? -0.726  -15.243 -12.815 1.00 0.00 ? 10  GLY A C    4  
ATOM 5932  O O    . GLY A 1 10  ? -0.222  -15.094 -11.703 1.00 0.00 ? 10  GLY A O    4  
ATOM 5933  H H    . GLY A 1 10  ? -2.913  -15.730 -11.059 1.00 0.00 ? 10  GLY A H    4  
ATOM 5934  H HA2  . GLY A 1 10  ? -2.025  -16.729 -13.685 1.00 0.00 ? 10  GLY A HA2  4  
ATOM 5935  H HA3  . GLY A 1 10  ? -2.812  -15.197 -13.362 1.00 0.00 ? 10  GLY A HA3  4  
ATOM 5936  N N    . ASP A 1 11  ? -0.164  -14.857 -13.951 1.00 0.00 ? 11  ASP A N    4  
ATOM 5937  C CA   . ASP A 1 11  ? 1.135   -14.207 -13.960 1.00 0.00 ? 11  ASP A CA   4  
ATOM 5938  C C    . ASP A 1 11  ? 1.153   -13.127 -15.044 1.00 0.00 ? 11  ASP A C    4  
ATOM 5939  O O    . ASP A 1 11  ? 0.465   -13.248 -16.057 1.00 0.00 ? 11  ASP A O    4  
ATOM 5940  C CB   . ASP A 1 11  ? 2.250   -15.207 -14.271 1.00 0.00 ? 11  ASP A CB   4  
ATOM 5941  C CG   . ASP A 1 11  ? 2.986   -15.757 -13.047 1.00 0.00 ? 11  ASP A CG   4  
ATOM 5942  O OD1  . ASP A 1 11  ? 3.539   -14.924 -12.296 1.00 0.00 ? 11  ASP A OD1  4  
ATOM 5943  O OD2  . ASP A 1 11  ? 2.980   -16.997 -12.891 1.00 0.00 ? 11  ASP A OD2  4  
ATOM 5944  H H    . ASP A 1 11  ? -0.580  -14.983 -14.852 1.00 0.00 ? 11  ASP A H    4  
ATOM 5945  H HA   . ASP A 1 11  ? 1.256   -13.794 -12.959 1.00 0.00 ? 11  ASP A HA   4  
ATOM 5946  H HB2  . ASP A 1 11  ? 1.824   -16.043 -14.825 1.00 0.00 ? 11  ASP A HB2  4  
ATOM 5947  H HB3  . ASP A 1 11  ? 2.976   -14.727 -14.928 1.00 0.00 ? 11  ASP A HB3  4  
ATOM 5948  N N    . GLY A 1 12  ? 1.947   -12.096 -14.795 1.00 0.00 ? 12  GLY A N    4  
ATOM 5949  C CA   . GLY A 1 12  ? 2.063   -10.996 -15.737 1.00 0.00 ? 12  GLY A CA   4  
ATOM 5950  C C    . GLY A 1 12  ? 3.186   -11.253 -16.744 1.00 0.00 ? 12  GLY A C    4  
ATOM 5951  O O    . GLY A 1 12  ? 3.266   -12.332 -17.329 1.00 0.00 ? 12  GLY A O    4  
ATOM 5952  H H    . GLY A 1 12  ? 2.503   -12.006 -13.969 1.00 0.00 ? 12  GLY A H    4  
ATOM 5953  H HA2  . GLY A 1 12  ? 1.119   -10.864 -16.266 1.00 0.00 ? 12  GLY A HA2  4  
ATOM 5954  H HA3  . GLY A 1 12  ? 2.258   -10.070 -15.197 1.00 0.00 ? 12  GLY A HA3  4  
ATOM 5955  N N    . SER A 1 13  ? 4.027   -10.243 -16.915 1.00 0.00 ? 13  SER A N    4  
ATOM 5956  C CA   . SER A 1 13  ? 5.142   -10.346 -17.840 1.00 0.00 ? 13  SER A CA   4  
ATOM 5957  C C    . SER A 1 13  ? 6.465   -10.217 -17.083 1.00 0.00 ? 13  SER A C    4  
ATOM 5958  O O    . SER A 1 13  ? 6.929   -9.108  -16.822 1.00 0.00 ? 13  SER A O    4  
ATOM 5959  C CB   . SER A 1 13  ? 5.050   -9.279  -18.933 1.00 0.00 ? 13  SER A CB   4  
ATOM 5960  O OG   . SER A 1 13  ? 4.912   -9.853  -20.230 1.00 0.00 ? 13  SER A OG   4  
ATOM 5961  H H    . SER A 1 13  ? 3.955   -9.368  -16.435 1.00 0.00 ? 13  SER A H    4  
ATOM 5962  H HA   . SER A 1 13  ? 5.053   -11.334 -18.290 1.00 0.00 ? 13  SER A HA   4  
ATOM 5963  H HB2  . SER A 1 13  ? 4.200   -8.627  -18.733 1.00 0.00 ? 13  SER A HB2  4  
ATOM 5964  H HB3  . SER A 1 13  ? 5.944   -8.655  -18.907 1.00 0.00 ? 13  SER A HB3  4  
ATOM 5965  H HG   . SER A 1 13  ? 4.457   -9.208  -20.843 1.00 0.00 ? 13  SER A HG   4  
ATOM 5966  N N    . PRO A 1 14  ? 7.049   -11.397 -16.742 1.00 0.00 ? 14  PRO A N    4  
ATOM 5967  C CA   . PRO A 1 14  ? 8.309   -11.427 -16.019 1.00 0.00 ? 14  PRO A CA   4  
ATOM 5968  C C    . PRO A 1 14  ? 9.478   -11.074 -16.941 1.00 0.00 ? 14  PRO A C    4  
ATOM 5969  O O    . PRO A 1 14  ? 10.020  -11.943 -17.622 1.00 0.00 ? 14  PRO A O    4  
ATOM 5970  C CB   . PRO A 1 14  ? 8.404   -12.833 -15.451 1.00 0.00 ? 14  PRO A CB   4  
ATOM 5971  C CG   . PRO A 1 14  ? 7.428   -13.675 -16.258 1.00 0.00 ? 14  PRO A CG   4  
ATOM 5972  C CD   . PRO A 1 14  ? 6.527   -12.729 -17.034 1.00 0.00 ? 14  PRO A CD   4  
ATOM 5973  H HA   . PRO A 1 14  ? 8.312   -10.735 -15.297 1.00 0.00 ? 14  PRO A HA   4  
ATOM 5974  H HB2  . PRO A 1 14  ? 9.418   -13.222 -15.537 1.00 0.00 ? 14  PRO A HB2  4  
ATOM 5975  H HB3  . PRO A 1 14  ? 8.146   -12.845 -14.392 1.00 0.00 ? 14  PRO A HB3  4  
ATOM 5976  H HG2  . PRO A 1 14  ? 7.966   -14.335 -16.939 1.00 0.00 ? 14  PRO A HG2  4  
ATOM 5977  H HG3  . PRO A 1 14  ? 6.837   -14.311 -15.599 1.00 0.00 ? 14  PRO A HG3  4  
ATOM 5978  H HD2  . PRO A 1 14  ? 6.558   -12.940 -18.103 1.00 0.00 ? 14  PRO A HD2  4  
ATOM 5979  H HD3  . PRO A 1 14  ? 5.488   -12.825 -16.720 1.00 0.00 ? 14  PRO A HD3  4  
ATOM 5980  N N    . SER A 1 15  ? 9.833   -9.798  -16.933 1.00 0.00 ? 15  SER A N    4  
ATOM 5981  C CA   . SER A 1 15  ? 10.928  -9.320  -17.760 1.00 0.00 ? 15  SER A CA   4  
ATOM 5982  C C    . SER A 1 15  ? 11.908  -8.507  -16.911 1.00 0.00 ? 15  SER A C    4  
ATOM 5983  O O    . SER A 1 15  ? 11.498  -7.783  -16.005 1.00 0.00 ? 15  SER A O    4  
ATOM 5984  C CB   . SER A 1 15  ? 10.409  -8.476  -18.926 1.00 0.00 ? 15  SER A CB   4  
ATOM 5985  O OG   . SER A 1 15  ? 9.504   -7.464  -18.493 1.00 0.00 ? 15  SER A OG   4  
ATOM 5986  H H    . SER A 1 15  ? 9.387   -9.097  -16.376 1.00 0.00 ? 15  SER A H    4  
ATOM 5987  H HA   . SER A 1 15  ? 11.410  -10.217 -18.147 1.00 0.00 ? 15  SER A HA   4  
ATOM 5988  H HB2  . SER A 1 15  ? 11.251  -8.013  -19.441 1.00 0.00 ? 15  SER A HB2  4  
ATOM 5989  H HB3  . SER A 1 15  ? 9.911   -9.123  -19.648 1.00 0.00 ? 15  SER A HB3  4  
ATOM 5990  H HG   . SER A 1 15  ? 8.651   -7.524  -19.010 1.00 0.00 ? 15  SER A HG   4  
ATOM 5991  N N    . HIS A 1 16  ? 13.184  -8.654  -17.235 1.00 0.00 ? 16  HIS A N    4  
ATOM 5992  C CA   . HIS A 1 16  ? 14.226  -7.942  -16.514 1.00 0.00 ? 16  HIS A CA   4  
ATOM 5993  C C    . HIS A 1 16  ? 14.282  -6.491  -16.994 1.00 0.00 ? 16  HIS A C    4  
ATOM 5994  O O    . HIS A 1 16  ? 14.345  -6.232  -18.195 1.00 0.00 ? 16  HIS A O    4  
ATOM 5995  C CB   . HIS A 1 16  ? 15.569  -8.664  -16.648 1.00 0.00 ? 16  HIS A CB   4  
ATOM 5996  C CG   . HIS A 1 16  ? 16.077  -8.757  -18.067 1.00 0.00 ? 16  HIS A CG   4  
ATOM 5997  N ND1  . HIS A 1 16  ? 16.001  -9.919  -18.815 1.00 0.00 ? 16  HIS A ND1  4  
ATOM 5998  C CD2  . HIS A 1 16  ? 16.666  -7.823  -18.866 1.00 0.00 ? 16  HIS A CD2  4  
ATOM 5999  C CE1  . HIS A 1 16  ? 16.526  -9.683  -20.008 1.00 0.00 ? 16  HIS A CE1  4  
ATOM 6000  N NE2  . HIS A 1 16  ? 16.938  -8.383  -20.038 1.00 0.00 ? 16  HIS A NE2  4  
ATOM 6001  H H    . HIS A 1 16  ? 13.509  -9.245  -17.974 1.00 0.00 ? 16  HIS A H    4  
ATOM 6002  H HA   . HIS A 1 16  ? 13.944  -7.958  -15.461 1.00 0.00 ? 16  HIS A HA   4  
ATOM 6003  H HB2  . HIS A 1 16  ? 16.310  -8.144  -16.041 1.00 0.00 ? 16  HIS A HB2  4  
ATOM 6004  H HB3  . HIS A 1 16  ? 15.471  -9.670  -16.240 1.00 0.00 ? 16  HIS A HB3  4  
ATOM 6005  H HD1  . HIS A 1 16  ? 15.616  -10.789 -18.507 1.00 0.00 ? 16  HIS A HD1  4  
ATOM 6006  H HD2  . HIS A 1 16  ? 16.879  -6.790  -18.589 1.00 0.00 ? 16  HIS A HD2  4  
ATOM 6007  H HE1  . HIS A 1 16  ? 16.613  -10.402 -20.824 1.00 0.00 ? 16  HIS A HE1  4  
ATOM 6008  N N    . PRO A 1 17  ? 14.257  -5.557  -16.005 1.00 0.00 ? 17  PRO A N    4  
ATOM 6009  C CA   . PRO A 1 17  ? 14.305  -4.138  -16.314 1.00 0.00 ? 17  PRO A CA   4  
ATOM 6010  C C    . PRO A 1 17  ? 15.716  -3.714  -16.726 1.00 0.00 ? 17  PRO A C    4  
ATOM 6011  O O    . PRO A 1 17  ? 16.693  -4.375  -16.379 1.00 0.00 ? 17  PRO A O    4  
ATOM 6012  C CB   . PRO A 1 17  ? 13.821  -3.445  -15.051 1.00 0.00 ? 17  PRO A CB   4  
ATOM 6013  C CG   . PRO A 1 17  ? 13.963  -4.465  -13.934 1.00 0.00 ? 17  PRO A CG   4  
ATOM 6014  C CD   . PRO A 1 17  ? 14.183  -5.827  -14.572 1.00 0.00 ? 17  PRO A CD   4  
ATOM 6015  H HA   . PRO A 1 17  ? 13.718  -3.934  -17.097 1.00 0.00 ? 17  PRO A HA   4  
ATOM 6016  H HB2  . PRO A 1 17  ? 14.413  -2.553  -14.844 1.00 0.00 ? 17  PRO A HB2  4  
ATOM 6017  H HB3  . PRO A 1 17  ? 12.785  -3.121  -15.155 1.00 0.00 ? 17  PRO A HB3  4  
ATOM 6018  H HG2  . PRO A 1 17  ? 14.801  -4.208  -13.286 1.00 0.00 ? 17  PRO A HG2  4  
ATOM 6019  H HG3  . PRO A 1 17  ? 13.069  -4.476  -13.310 1.00 0.00 ? 17  PRO A HG3  4  
ATOM 6020  H HD2  . PRO A 1 17  ? 15.100  -6.291  -14.209 1.00 0.00 ? 17  PRO A HD2  4  
ATOM 6021  H HD3  . PRO A 1 17  ? 13.366  -6.510  -14.339 1.00 0.00 ? 17  PRO A HD3  4  
ATOM 6022  N N    . PRO A 1 18  ? 15.778  -2.584  -17.480 1.00 0.00 ? 18  PRO A N    4  
ATOM 6023  C CA   . PRO A 1 18  ? 17.053  -2.063  -17.944 1.00 0.00 ? 18  PRO A CA   4  
ATOM 6024  C C    . PRO A 1 18  ? 17.816  -1.386  -16.803 1.00 0.00 ? 18  PRO A C    4  
ATOM 6025  O O    . PRO A 1 18  ? 17.249  -1.119  -15.745 1.00 0.00 ? 18  PRO A O    4  
ATOM 6026  C CB   . PRO A 1 18  ? 16.702  -1.108  -19.073 1.00 0.00 ? 18  PRO A CB   4  
ATOM 6027  C CG   . PRO A 1 18  ? 15.229  -0.775  -18.893 1.00 0.00 ? 18  PRO A CG   4  
ATOM 6028  C CD   . PRO A 1 18  ? 14.642  -1.775  -17.911 1.00 0.00 ? 18  PRO A CD   4  
ATOM 6029  H HA   . PRO A 1 18  ? 17.639  -2.810  -18.259 1.00 0.00 ? 18  PRO A HA   4  
ATOM 6030  H HB2  . PRO A 1 18  ? 17.314  -0.208  -19.027 1.00 0.00 ? 18  PRO A HB2  4  
ATOM 6031  H HB3  . PRO A 1 18  ? 16.883  -1.568  -20.044 1.00 0.00 ? 18  PRO A HB3  4  
ATOM 6032  H HG2  . PRO A 1 18  ? 15.111  0.242   -18.520 1.00 0.00 ? 18  PRO A HG2  4  
ATOM 6033  H HG3  . PRO A 1 18  ? 14.707  -0.827  -19.849 1.00 0.00 ? 18  PRO A HG3  4  
ATOM 6034  H HD2  . PRO A 1 18  ? 14.172  -1.271  -17.066 1.00 0.00 ? 18  PRO A HD2  4  
ATOM 6035  H HD3  . PRO A 1 18  ? 13.874  -2.389  -18.382 1.00 0.00 ? 18  PRO A HD3  4  
ATOM 6036  N N    . ILE A 1 19  ? 19.090  -1.128  -17.058 1.00 0.00 ? 19  ILE A N    4  
ATOM 6037  C CA   . ILE A 1 19  ? 19.937  -0.486  -16.066 1.00 0.00 ? 19  ILE A CA   4  
ATOM 6038  C C    . ILE A 1 19  ? 19.565  0.994   -15.965 1.00 0.00 ? 19  ILE A C    4  
ATOM 6039  O O    . ILE A 1 19  ? 19.317  1.646   -16.979 1.00 0.00 ? 19  ILE A O    4  
ATOM 6040  C CB   . ILE A 1 19  ? 21.413  -0.730  -16.383 1.00 0.00 ? 19  ILE A CB   4  
ATOM 6041  C CG1  . ILE A 1 19  ? 21.723  -2.228  -16.435 1.00 0.00 ? 19  ILE A CG1  4  
ATOM 6042  C CG2  . ILE A 1 19  ? 22.316  0.008   -15.392 1.00 0.00 ? 19  ILE A CG2  4  
ATOM 6043  C CD1  . ILE A 1 19  ? 22.258  -2.629  -17.812 1.00 0.00 ? 19  ILE A CD1  4  
ATOM 6044  H H    . ILE A 1 19  ? 19.544  -1.348  -17.921 1.00 0.00 ? 19  ILE A H    4  
ATOM 6045  H HA   . ILE A 1 19  ? 19.731  -0.960  -15.106 1.00 0.00 ? 19  ILE A HA   4  
ATOM 6046  H HB   . ILE A 1 19  ? 21.622  -0.323  -17.373 1.00 0.00 ? 19  ILE A HB   4  
ATOM 6047  H HG12 . ILE A 1 19  ? 22.457  -2.478  -15.669 1.00 0.00 ? 19  ILE A HG12 4  
ATOM 6048  H HG13 . ILE A 1 19  ? 20.821  -2.797  -16.211 1.00 0.00 ? 19  ILE A HG13 4  
ATOM 6049  H HG21 . ILE A 1 19  ? 21.767  0.840   -14.951 1.00 0.00 ? 19  ILE A HG21 4  
ATOM 6050  H HG22 . ILE A 1 19  ? 22.630  -0.679  -14.606 1.00 0.00 ? 19  ILE A HG22 4  
ATOM 6051  H HG23 . ILE A 1 19  ? 23.194  0.388   -15.914 1.00 0.00 ? 19  ILE A HG23 4  
ATOM 6052  H HD11 . ILE A 1 19  ? 22.781  -3.582  -17.734 1.00 0.00 ? 19  ILE A HD11 4  
ATOM 6053  H HD12 . ILE A 1 19  ? 21.427  -2.727  -18.510 1.00 0.00 ? 19  ILE A HD12 4  
ATOM 6054  H HD13 . ILE A 1 19  ? 22.947  -1.864  -18.171 1.00 0.00 ? 19  ILE A HD13 4  
ATOM 6055  N N    . LEU A 1 20  ? 19.539  1.483   -14.734 1.00 0.00 ? 20  LEU A N    4  
ATOM 6056  C CA   . LEU A 1 20  ? 19.203  2.875   -14.488 1.00 0.00 ? 20  LEU A CA   4  
ATOM 6057  C C    . LEU A 1 20  ? 19.282  3.157   -12.986 1.00 0.00 ? 20  LEU A C    4  
ATOM 6058  O O    . LEU A 1 20  ? 18.459  2.666   -12.215 1.00 0.00 ? 20  LEU A O    4  
ATOM 6059  C CB   . LEU A 1 20  ? 17.845  3.215   -15.107 1.00 0.00 ? 20  LEU A CB   4  
ATOM 6060  C CG   . LEU A 1 20  ? 17.860  4.263   -16.222 1.00 0.00 ? 20  LEU A CG   4  
ATOM 6061  C CD1  . LEU A 1 20  ? 16.593  4.174   -17.075 1.00 0.00 ? 20  LEU A CD1  4  
ATOM 6062  C CD2  . LEU A 1 20  ? 18.069  5.667   -15.651 1.00 0.00 ? 20  LEU A CD2  4  
ATOM 6063  H H    . LEU A 1 20  ? 19.742  0.946   -13.915 1.00 0.00 ? 20  LEU A H    4  
ATOM 6064  H HA   . LEU A 1 20  ? 19.950  3.486   -14.994 1.00 0.00 ? 20  LEU A HA   4  
ATOM 6065  H HB2  . LEU A 1 20  ? 17.409  2.298   -15.504 1.00 0.00 ? 20  LEU A HB2  4  
ATOM 6066  H HB3  . LEU A 1 20  ? 17.184  3.566   -14.314 1.00 0.00 ? 20  LEU A HB3  4  
ATOM 6067  H HG   . LEU A 1 20  ? 18.705  4.053   -16.877 1.00 0.00 ? 20  LEU A HG   4  
ATOM 6068  H HD11 . LEU A 1 20  ? 15.719  4.335   -16.445 1.00 0.00 ? 20  LEU A HD11 4  
ATOM 6069  H HD12 . LEU A 1 20  ? 16.625  4.937   -17.853 1.00 0.00 ? 20  LEU A HD12 4  
ATOM 6070  H HD13 . LEU A 1 20  ? 16.534  3.188   -17.535 1.00 0.00 ? 20  LEU A HD13 4  
ATOM 6071  H HD21 . LEU A 1 20  ? 17.899  6.407   -16.433 1.00 0.00 ? 20  LEU A HD21 4  
ATOM 6072  H HD22 . LEU A 1 20  ? 17.368  5.835   -14.833 1.00 0.00 ? 20  LEU A HD22 4  
ATOM 6073  H HD23 . LEU A 1 20  ? 19.090  5.760   -15.279 1.00 0.00 ? 20  LEU A HD23 4  
ATOM 6074  N N    . GLU A 1 21  ? 20.279  3.946   -12.617 1.00 0.00 ? 21  GLU A N    4  
ATOM 6075  C CA   . GLU A 1 21  ? 20.476  4.299   -11.221 1.00 0.00 ? 21  GLU A CA   4  
ATOM 6076  C C    . GLU A 1 21  ? 21.079  5.701   -11.108 1.00 0.00 ? 21  GLU A C    4  
ATOM 6077  O O    . GLU A 1 21  ? 21.627  6.225   -12.076 1.00 0.00 ? 21  GLU A O    4  
ATOM 6078  C CB   . GLU A 1 21  ? 21.356  3.266   -10.513 1.00 0.00 ? 21  GLU A CB   4  
ATOM 6079  C CG   . GLU A 1 21  ? 20.501  2.217   -9.798  1.00 0.00 ? 21  GLU A CG   4  
ATOM 6080  C CD   . GLU A 1 21  ? 21.041  0.807   -10.048 1.00 0.00 ? 21  GLU A CD   4  
ATOM 6081  O OE1  . GLU A 1 21  ? 22.283  0.673   -10.080 1.00 0.00 ? 21  GLU A OE1  4  
ATOM 6082  O OE2  . GLU A 1 21  ? 20.199  -0.104  -10.202 1.00 0.00 ? 21  GLU A OE2  4  
ATOM 6083  H H    . GLU A 1 21  ? 20.944  4.341   -13.250 1.00 0.00 ? 21  GLU A H    4  
ATOM 6084  H HA   . GLU A 1 21  ? 19.482  4.287   -10.776 1.00 0.00 ? 21  GLU A HA   4  
ATOM 6085  H HB2  . GLU A 1 21  ? 22.005  2.778   -11.239 1.00 0.00 ? 21  GLU A HB2  4  
ATOM 6086  H HB3  . GLU A 1 21  ? 22.002  3.766   -9.792  1.00 0.00 ? 21  GLU A HB3  4  
ATOM 6087  H HG2  . GLU A 1 21  ? 20.490  2.421   -8.727  1.00 0.00 ? 21  GLU A HG2  4  
ATOM 6088  H HG3  . GLU A 1 21  ? 19.471  2.283   -10.147 1.00 0.00 ? 21  GLU A HG3  4  
ATOM 6089  N N    . ARG A 1 22  ? 20.956  6.269   -9.917  1.00 0.00 ? 22  ARG A N    4  
ATOM 6090  C CA   . ARG A 1 22  ? 21.481  7.600   -9.665  1.00 0.00 ? 22  ARG A CA   4  
ATOM 6091  C C    . ARG A 1 22  ? 22.334  7.602   -8.395  1.00 0.00 ? 22  ARG A C    4  
ATOM 6092  O O    . ARG A 1 22  ? 22.201  6.716   -7.552  1.00 0.00 ? 22  ARG A O    4  
ATOM 6093  C CB   . ARG A 1 22  ? 20.350  8.619   -9.513  1.00 0.00 ? 22  ARG A CB   4  
ATOM 6094  C CG   . ARG A 1 22  ? 19.823  9.060   -10.880 1.00 0.00 ? 22  ARG A CG   4  
ATOM 6095  C CD   . ARG A 1 22  ? 19.827  10.585  -11.004 1.00 0.00 ? 22  ARG A CD   4  
ATOM 6096  N NE   . ARG A 1 22  ? 20.924  11.016  -11.899 1.00 0.00 ? 22  ARG A NE   4  
ATOM 6097  C CZ   . ARG A 1 22  ? 21.343  12.284  -12.017 1.00 0.00 ? 22  ARG A CZ   4  
ATOM 6098  N NH1  . ARG A 1 22  ? 20.759  13.252  -11.297 1.00 0.00 ? 22  ARG A NH1  4  
ATOM 6099  N NH2  . ARG A 1 22  ? 22.345  12.583  -12.854 1.00 0.00 ? 22  ARG A NH2  4  
ATOM 6100  H H    . ARG A 1 22  ? 20.508  5.836   -9.135  1.00 0.00 ? 22  ARG A H    4  
ATOM 6101  H HA   . ARG A 1 22  ? 22.084  7.832   -10.543 1.00 0.00 ? 22  ARG A HA   4  
ATOM 6102  H HB2  . ARG A 1 22  ? 19.539  8.183   -8.930  1.00 0.00 ? 22  ARG A HB2  4  
ATOM 6103  H HB3  . ARG A 1 22  ? 20.710  9.487   -8.961  1.00 0.00 ? 22  ARG A HB3  4  
ATOM 6104  H HG2  . ARG A 1 22  ? 20.437  8.625   -11.669 1.00 0.00 ? 22  ARG A HG2  4  
ATOM 6105  H HG3  . ARG A 1 22  ? 18.809  8.683   -11.022 1.00 0.00 ? 22  ARG A HG3  4  
ATOM 6106  H HD2  . ARG A 1 22  ? 18.870  10.929  -11.395 1.00 0.00 ? 22  ARG A HD2  4  
ATOM 6107  H HD3  . ARG A 1 22  ? 19.951  11.037  -10.020 1.00 0.00 ? 22  ARG A HD3  4  
ATOM 6108  H HE   . ARG A 1 22  ? 21.381  10.319  -12.451 1.00 0.00 ? 22  ARG A HE   4  
ATOM 6109  H HH11 . ARG A 1 22  ? 20.011  13.028  -10.672 1.00 0.00 ? 22  ARG A HH11 4  
ATOM 6110  H HH12 . ARG A 1 22  ? 21.072  14.198  -11.385 1.00 0.00 ? 22  ARG A HH12 4  
ATOM 6111  H HH21 . ARG A 1 22  ? 22.781  11.861  -13.391 1.00 0.00 ? 22  ARG A HH21 4  
ATOM 6112  H HH22 . ARG A 1 22  ? 22.658  13.529  -12.942 1.00 0.00 ? 22  ARG A HH22 4  
ATOM 6113  N N    . THR A 1 23  ? 23.192  8.607   -8.298  1.00 0.00 ? 23  THR A N    4  
ATOM 6114  C CA   . THR A 1 23  ? 24.066  8.737   -7.145  1.00 0.00 ? 23  THR A CA   4  
ATOM 6115  C C    . THR A 1 23  ? 23.361  9.501   -6.023  1.00 0.00 ? 23  THR A C    4  
ATOM 6116  O O    . THR A 1 23  ? 23.581  9.226   -4.845  1.00 0.00 ? 23  THR A O    4  
ATOM 6117  C CB   . THR A 1 23  ? 25.365  9.399   -7.608  1.00 0.00 ? 23  THR A CB   4  
ATOM 6118  O OG1  . THR A 1 23  ? 26.190  8.307   -8.003  1.00 0.00 ? 23  THR A OG1  4  
ATOM 6119  C CG2  . THR A 1 23  ? 26.134  10.050  -6.456  1.00 0.00 ? 23  THR A CG2  4  
ATOM 6120  H H    . THR A 1 23  ? 23.294  9.324   -8.988  1.00 0.00 ? 23  THR A H    4  
ATOM 6121  H HA   . THR A 1 23  ? 24.283  7.738   -6.764  1.00 0.00 ? 23  THR A HA   4  
ATOM 6122  H HB   . THR A 1 23  ? 25.173  10.119  -8.403  1.00 0.00 ? 23  THR A HB   4  
ATOM 6123  H HG1  . THR A 1 23  ? 26.358  8.344   -8.988  1.00 0.00 ? 23  THR A HG1  4  
ATOM 6124  H HG21 . THR A 1 23  ? 26.928  10.678  -6.859  1.00 0.00 ? 23  THR A HG21 4  
ATOM 6125  H HG22 . THR A 1 23  ? 25.453  10.660  -5.864  1.00 0.00 ? 23  THR A HG22 4  
ATOM 6126  H HG23 . THR A 1 23  ? 26.569  9.274   -5.826  1.00 0.00 ? 23  THR A HG23 4  
ATOM 6127  N N    . LEU A 1 24  ? 22.526  10.447  -6.429  1.00 0.00 ? 24  LEU A N    4  
ATOM 6128  C CA   . LEU A 1 24  ? 21.787  11.254  -5.474  1.00 0.00 ? 24  LEU A CA   4  
ATOM 6129  C C    . LEU A 1 24  ? 20.820  10.358  -4.696  1.00 0.00 ? 24  LEU A C    4  
ATOM 6130  O O    . LEU A 1 24  ? 20.138  9.518   -5.283  1.00 0.00 ? 24  LEU A O    4  
ATOM 6131  C CB   . LEU A 1 24  ? 21.105  12.428  -6.178  1.00 0.00 ? 24  LEU A CB   4  
ATOM 6132  C CG   . LEU A 1 24  ? 21.647  13.819  -5.841  1.00 0.00 ? 24  LEU A CG   4  
ATOM 6133  C CD1  . LEU A 1 24  ? 21.278  14.220  -4.412  1.00 0.00 ? 24  LEU A CD1  4  
ATOM 6134  C CD2  . LEU A 1 24  ? 23.156  13.893  -6.086  1.00 0.00 ? 24  LEU A CD2  4  
ATOM 6135  H H    . LEU A 1 24  ? 22.353  10.665  -7.390  1.00 0.00 ? 24  LEU A H    4  
ATOM 6136  H HA   . LEU A 1 24  ? 22.508  11.673  -4.773  1.00 0.00 ? 24  LEU A HA   4  
ATOM 6137  H HB2  . LEU A 1 24  ? 21.188  12.279  -7.254  1.00 0.00 ? 24  LEU A HB2  4  
ATOM 6138  H HB3  . LEU A 1 24  ? 20.043  12.406  -5.934  1.00 0.00 ? 24  LEU A HB3  4  
ATOM 6139  H HG   . LEU A 1 24  ? 21.177  14.540  -6.510  1.00 0.00 ? 24  LEU A HG   4  
ATOM 6140  H HD11 . LEU A 1 24  ? 22.170  14.567  -3.890  1.00 0.00 ? 24  LEU A HD11 4  
ATOM 6141  H HD12 . LEU A 1 24  ? 20.538  15.020  -4.438  1.00 0.00 ? 24  LEU A HD12 4  
ATOM 6142  H HD13 . LEU A 1 24  ? 20.863  13.359  -3.888  1.00 0.00 ? 24  LEU A HD13 4  
ATOM 6143  H HD21 . LEU A 1 24  ? 23.668  13.213  -5.405  1.00 0.00 ? 24  LEU A HD21 4  
ATOM 6144  H HD22 . LEU A 1 24  ? 23.371  13.607  -7.116  1.00 0.00 ? 24  LEU A HD22 4  
ATOM 6145  H HD23 . LEU A 1 24  ? 23.503  14.911  -5.912  1.00 0.00 ? 24  LEU A HD23 4  
ATOM 6146  N N    . ASP A 1 25  ? 20.792  10.566  -3.388  1.00 0.00 ? 25  ASP A N    4  
ATOM 6147  C CA   . ASP A 1 25  ? 19.921  9.788   -2.525  1.00 0.00 ? 25  ASP A CA   4  
ATOM 6148  C C    . ASP A 1 25  ? 18.567  10.490  -2.407  1.00 0.00 ? 25  ASP A C    4  
ATOM 6149  O O    . ASP A 1 25  ? 18.492  11.716  -2.472  1.00 0.00 ? 25  ASP A O    4  
ATOM 6150  C CB   . ASP A 1 25  ? 20.510  9.659   -1.119  1.00 0.00 ? 25  ASP A CB   4  
ATOM 6151  C CG   . ASP A 1 25  ? 21.478  8.490   -0.928  1.00 0.00 ? 25  ASP A CG   4  
ATOM 6152  O OD1  . ASP A 1 25  ? 21.462  7.592   -1.797  1.00 0.00 ? 25  ASP A OD1  4  
ATOM 6153  O OD2  . ASP A 1 25  ? 22.212  8.521   0.083   1.00 0.00 ? 25  ASP A OD2  4  
ATOM 6154  H H    . ASP A 1 25  ? 21.350  11.251  -2.919  1.00 0.00 ? 25  ASP A H    4  
ATOM 6155  H HA   . ASP A 1 25  ? 19.844  8.811   -3.001  1.00 0.00 ? 25  ASP A HA   4  
ATOM 6156  H HB2  . ASP A 1 25  ? 21.030  10.586  -0.873  1.00 0.00 ? 25  ASP A HB2  4  
ATOM 6157  H HB3  . ASP A 1 25  ? 19.692  9.554   -0.406  1.00 0.00 ? 25  ASP A HB3  4  
ATOM 6158  N N    . ASP A 1 26  ? 17.530  9.683   -2.237  1.00 0.00 ? 26  ASP A N    4  
ATOM 6159  C CA   . ASP A 1 26  ? 16.183  10.212  -2.110  1.00 0.00 ? 26  ASP A CA   4  
ATOM 6160  C C    . ASP A 1 26  ? 15.173  9.091   -2.366  1.00 0.00 ? 26  ASP A C    4  
ATOM 6161  O O    . ASP A 1 26  ? 15.481  8.120   -3.055  1.00 0.00 ? 26  ASP A O    4  
ATOM 6162  C CB   . ASP A 1 26  ? 15.927  11.321  -3.132  1.00 0.00 ? 26  ASP A CB   4  
ATOM 6163  C CG   . ASP A 1 26  ? 16.488  11.053  -4.530  1.00 0.00 ? 26  ASP A CG   4  
ATOM 6164  O OD1  . ASP A 1 26  ? 16.413  9.881   -4.957  1.00 0.00 ? 26  ASP A OD1  4  
ATOM 6165  O OD2  . ASP A 1 26  ? 16.980  12.027  -5.141  1.00 0.00 ? 26  ASP A OD2  4  
ATOM 6166  H H    . ASP A 1 26  ? 17.600  8.687   -2.185  1.00 0.00 ? 26  ASP A H    4  
ATOM 6167  H HA   . ASP A 1 26  ? 16.123  10.603  -1.094  1.00 0.00 ? 26  ASP A HA   4  
ATOM 6168  H HB2  . ASP A 1 26  ? 14.852  11.480  -3.213  1.00 0.00 ? 26  ASP A HB2  4  
ATOM 6169  H HB3  . ASP A 1 26  ? 16.359  12.248  -2.755  1.00 0.00 ? 26  ASP A HB3  4  
ATOM 6170  N N    . VAL A 1 27  ? 13.989  9.263   -1.798  1.00 0.00 ? 27  VAL A N    4  
ATOM 6171  C CA   . VAL A 1 27  ? 12.932  8.278   -1.956  1.00 0.00 ? 27  VAL A CA   4  
ATOM 6172  C C    . VAL A 1 27  ? 12.931  7.766   -3.398  1.00 0.00 ? 27  VAL A C    4  
ATOM 6173  O O    . VAL A 1 27  ? 13.461  8.421   -4.294  1.00 0.00 ? 27  VAL A O    4  
ATOM 6174  C CB   . VAL A 1 27  ? 11.590  8.879   -1.534  1.00 0.00 ? 27  VAL A CB   4  
ATOM 6175  C CG1  . VAL A 1 27  ? 11.487  8.976   -0.011  1.00 0.00 ? 27  VAL A CG1  4  
ATOM 6176  C CG2  . VAL A 1 27  ? 11.370  10.245  -2.187  1.00 0.00 ? 27  VAL A CG2  4  
ATOM 6177  H H    . VAL A 1 27  ? 13.747  10.056  -1.239  1.00 0.00 ? 27  VAL A H    4  
ATOM 6178  H HA   . VAL A 1 27  ? 13.155  7.447   -1.288  1.00 0.00 ? 27  VAL A HA   4  
ATOM 6179  H HB   . VAL A 1 27  ? 10.801  8.211   -1.881  1.00 0.00 ? 27  VAL A HB   4  
ATOM 6180  H HG11 . VAL A 1 27  ? 11.845  8.050   0.437   1.00 0.00 ? 27  VAL A HG11 4  
ATOM 6181  H HG12 . VAL A 1 27  ? 12.096  9.809   0.342   1.00 0.00 ? 27  VAL A HG12 4  
ATOM 6182  H HG13 . VAL A 1 27  ? 10.448  9.140   0.274   1.00 0.00 ? 27  VAL A HG13 4  
ATOM 6183  H HG21 . VAL A 1 27  ? 12.335  10.706  -2.397  1.00 0.00 ? 27  VAL A HG21 4  
ATOM 6184  H HG22 . VAL A 1 27  ? 10.819  10.118  -3.119  1.00 0.00 ? 27  VAL A HG22 4  
ATOM 6185  H HG23 . VAL A 1 27  ? 10.801  10.883  -1.512  1.00 0.00 ? 27  VAL A HG23 4  
ATOM 6186  N N    . PRO A 1 28  ? 12.314  6.567   -3.581  1.00 0.00 ? 28  PRO A N    4  
ATOM 6187  C CA   . PRO A 1 28  ? 12.237  5.959   -4.898  1.00 0.00 ? 28  PRO A CA   4  
ATOM 6188  C C    . PRO A 1 28  ? 11.197  6.667   -5.769  1.00 0.00 ? 28  PRO A C    4  
ATOM 6189  O O    . PRO A 1 28  ? 10.498  7.564   -5.302  1.00 0.00 ? 28  PRO A O    4  
ATOM 6190  C CB   . PRO A 1 28  ? 11.901  4.500   -4.638  1.00 0.00 ? 28  PRO A CB   4  
ATOM 6191  C CG   . PRO A 1 28  ? 11.346  4.445   -3.224  1.00 0.00 ? 28  PRO A CG   4  
ATOM 6192  C CD   . PRO A 1 28  ? 11.676  5.763   -2.543  1.00 0.00 ? 28  PRO A CD   4  
ATOM 6193  H HA   . PRO A 1 28  ? 13.109  6.058   -5.378  1.00 0.00 ? 28  PRO A HA   4  
ATOM 6194  H HB2  . PRO A 1 28  ? 11.170  4.133   -5.359  1.00 0.00 ? 28  PRO A HB2  4  
ATOM 6195  H HB3  . PRO A 1 28  ? 12.786  3.871   -4.735  1.00 0.00 ? 28  PRO A HB3  4  
ATOM 6196  H HG2  . PRO A 1 28  ? 10.268  4.285   -3.243  1.00 0.00 ? 28  PRO A HG2  4  
ATOM 6197  H HG3  . PRO A 1 28  ? 11.783  3.611   -2.675  1.00 0.00 ? 28  PRO A HG3  4  
ATOM 6198  H HD2  . PRO A 1 28  ? 10.778  6.248   -2.162  1.00 0.00 ? 28  PRO A HD2  4  
ATOM 6199  H HD3  . PRO A 1 28  ? 12.342  5.613   -1.693  1.00 0.00 ? 28  PRO A HD3  4  
ATOM 6200  N N    . GLY A 1 29  ? 11.128  6.235   -7.020  1.00 0.00 ? 29  GLY A N    4  
ATOM 6201  C CA   . GLY A 1 29  ? 10.185  6.816   -7.960  1.00 0.00 ? 29  GLY A CA   4  
ATOM 6202  C C    . GLY A 1 29  ? 8.867   6.040   -7.966  1.00 0.00 ? 29  GLY A C    4  
ATOM 6203  O O    . GLY A 1 29  ? 8.627   5.210   -7.090  1.00 0.00 ? 29  GLY A O    4  
ATOM 6204  H H    . GLY A 1 29  ? 11.700  5.505   -7.392  1.00 0.00 ? 29  GLY A H    4  
ATOM 6205  H HA2  . GLY A 1 29  ? 9.997   7.857   -7.696  1.00 0.00 ? 29  GLY A HA2  4  
ATOM 6206  H HA3  . GLY A 1 29  ? 10.616  6.815   -8.961  1.00 0.00 ? 29  GLY A HA3  4  
ATOM 6207  N N    . PRO A 1 30  ? 8.024   6.345   -8.989  1.00 0.00 ? 30  PRO A N    4  
ATOM 6208  C CA   . PRO A 1 30  ? 6.736   5.685   -9.119  1.00 0.00 ? 30  PRO A CA   4  
ATOM 6209  C C    . PRO A 1 30  ? 6.903   4.255   -9.637  1.00 0.00 ? 30  PRO A C    4  
ATOM 6210  O O    . PRO A 1 30  ? 7.676   4.012   -10.563 1.00 0.00 ? 30  PRO A O    4  
ATOM 6211  C CB   . PRO A 1 30  ? 5.935   6.568   -10.062 1.00 0.00 ? 30  PRO A CB   4  
ATOM 6212  C CG   . PRO A 1 30  ? 6.953   7.434   -10.787 1.00 0.00 ? 30  PRO A CG   4  
ATOM 6213  C CD   . PRO A 1 30  ? 8.274   7.322   -10.044 1.00 0.00 ? 30  PRO A CD   4  
ATOM 6214  H HA   . PRO A 1 30  ? 6.296   5.602   -8.225  1.00 0.00 ? 30  PRO A HA   4  
ATOM 6215  H HB2  . PRO A 1 30  ? 5.361   5.968   -10.767 1.00 0.00 ? 30  PRO A HB2  4  
ATOM 6216  H HB3  . PRO A 1 30  ? 5.222   7.182   -9.511  1.00 0.00 ? 30  PRO A HB3  4  
ATOM 6217  H HG2  . PRO A 1 30  ? 7.067   7.106   -11.820 1.00 0.00 ? 30  PRO A HG2  4  
ATOM 6218  H HG3  . PRO A 1 30  ? 6.619   8.471   -10.818 1.00 0.00 ? 30  PRO A HG3  4  
ATOM 6219  H HD2  . PRO A 1 30  ? 9.075   6.994   -10.706 1.00 0.00 ? 30  PRO A HD2  4  
ATOM 6220  H HD3  . PRO A 1 30  ? 8.578   8.284   -9.629  1.00 0.00 ? 30  PRO A HD3  4  
ATOM 6221  N N    . PRO A 1 31  ? 6.146   3.321   -9.001  1.00 0.00 ? 31  PRO A N    4  
ATOM 6222  C CA   . PRO A 1 31  ? 6.202   1.922   -9.388  1.00 0.00 ? 31  PRO A CA   4  
ATOM 6223  C C    . PRO A 1 31  ? 5.453   1.685   -10.701 1.00 0.00 ? 31  PRO A C    4  
ATOM 6224  O O    . PRO A 1 31  ? 4.224   1.722   -10.734 1.00 0.00 ? 31  PRO A O    4  
ATOM 6225  C CB   . PRO A 1 31  ? 5.600   1.165   -8.216  1.00 0.00 ? 31  PRO A CB   4  
ATOM 6226  C CG   . PRO A 1 31  ? 4.808   2.190   -7.420  1.00 0.00 ? 31  PRO A CG   4  
ATOM 6227  C CD   . PRO A 1 31  ? 5.219   3.572   -7.901  1.00 0.00 ? 31  PRO A CD   4  
ATOM 6228  H HA   . PRO A 1 31  ? 7.148   1.647   -9.560  1.00 0.00 ? 31  PRO A HA   4  
ATOM 6229  H HB2  . PRO A 1 31  ? 4.956   0.357   -8.562  1.00 0.00 ? 31  PRO A HB2  4  
ATOM 6230  H HB3  . PRO A 1 31  ? 6.378   0.711   -7.602  1.00 0.00 ? 31  PRO A HB3  4  
ATOM 6231  H HG2  . PRO A 1 31  ? 3.737   2.040   -7.563  1.00 0.00 ? 31  PRO A HG2  4  
ATOM 6232  H HG3  . PRO A 1 31  ? 5.006   2.082   -6.354  1.00 0.00 ? 31  PRO A HG3  4  
ATOM 6233  H HD2  . PRO A 1 31  ? 4.357   4.149   -8.234  1.00 0.00 ? 31  PRO A HD2  4  
ATOM 6234  H HD3  . PRO A 1 31  ? 5.696   4.143   -7.104  1.00 0.00 ? 31  PRO A HD3  4  
ATOM 6235  N N    . MET A 1 32  ? 6.225   1.447   -11.751 1.00 0.00 ? 32  MET A N    4  
ATOM 6236  C CA   . MET A 1 32  ? 5.650   1.204   -13.063 1.00 0.00 ? 32  MET A CA   4  
ATOM 6237  C C    . MET A 1 32  ? 5.378   -0.286  -13.275 1.00 0.00 ? 32  MET A C    4  
ATOM 6238  O O    . MET A 1 32  ? 5.910   -1.127  -12.552 1.00 0.00 ? 32  MET A O    4  
ATOM 6239  C CB   . MET A 1 32  ? 6.610   1.707   -14.143 1.00 0.00 ? 32  MET A CB   4  
ATOM 6240  C CG   . MET A 1 32  ? 7.987   1.056   -13.999 1.00 0.00 ? 32  MET A CG   4  
ATOM 6241  S SD   . MET A 1 32  ? 8.869   1.144   -15.548 1.00 0.00 ? 32  MET A SD   4  
ATOM 6242  C CE   . MET A 1 32  ? 10.524  0.782   -14.983 1.00 0.00 ? 32  MET A CE   4  
ATOM 6243  H H    . MET A 1 32  ? 7.224   1.419   -11.716 1.00 0.00 ? 32  MET A H    4  
ATOM 6244  H HA   . MET A 1 32  ? 4.711   1.758   -13.078 1.00 0.00 ? 32  MET A HA   4  
ATOM 6245  H HB2  . MET A 1 32  ? 6.201   1.488   -15.129 1.00 0.00 ? 32  MET A HB2  4  
ATOM 6246  H HB3  . MET A 1 32  ? 6.707   2.791   -14.072 1.00 0.00 ? 32  MET A HB3  4  
ATOM 6247  H HG2  . MET A 1 32  ? 8.556   1.559   -13.217 1.00 0.00 ? 32  MET A HG2  4  
ATOM 6248  H HG3  . MET A 1 32  ? 7.876   0.016   -13.692 1.00 0.00 ? 32  MET A HG3  4  
ATOM 6249  H HE1  . MET A 1 32  ? 11.231  0.961   -15.793 1.00 0.00 ? 32  MET A HE1  4  
ATOM 6250  H HE2  . MET A 1 32  ? 10.768  1.427   -14.138 1.00 0.00 ? 32  MET A HE2  4  
ATOM 6251  H HE3  . MET A 1 32  ? 10.582  -0.261  -14.673 1.00 0.00 ? 32  MET A HE3  4  
ATOM 6252  N N    . GLY A 1 33  ? 4.550   -0.568  -14.271 1.00 0.00 ? 33  GLY A N    4  
ATOM 6253  C CA   . GLY A 1 33  ? 4.202   -1.943  -14.588 1.00 0.00 ? 33  GLY A CA   4  
ATOM 6254  C C    . GLY A 1 33  ? 2.999   -2.407  -13.764 1.00 0.00 ? 33  GLY A C    4  
ATOM 6255  O O    . GLY A 1 33  ? 3.005   -3.508  -13.216 1.00 0.00 ? 33  GLY A O    4  
ATOM 6256  H H    . GLY A 1 33  ? 4.122   0.122   -14.855 1.00 0.00 ? 33  GLY A H    4  
ATOM 6257  H HA2  . GLY A 1 33  ? 3.974   -2.028  -15.650 1.00 0.00 ? 33  GLY A HA2  4  
ATOM 6258  H HA3  . GLY A 1 33  ? 5.054   -2.593  -14.391 1.00 0.00 ? 33  GLY A HA3  4  
ATOM 6259  N N    . ILE A 1 34  ? 1.996   -1.544  -13.702 1.00 0.00 ? 34  ILE A N    4  
ATOM 6260  C CA   . ILE A 1 34  ? 0.788   -1.851  -12.955 1.00 0.00 ? 34  ILE A CA   4  
ATOM 6261  C C    . ILE A 1 34  ? -0.236  -2.496  -13.891 1.00 0.00 ? 34  ILE A C    4  
ATOM 6262  O O    . ILE A 1 34  ? -0.687  -1.870  -14.848 1.00 0.00 ? 34  ILE A O    4  
ATOM 6263  C CB   . ILE A 1 34  ? 0.268   -0.603  -12.240 1.00 0.00 ? 34  ILE A CB   4  
ATOM 6264  C CG1  . ILE A 1 34  ? 1.423   0.233   -11.685 1.00 0.00 ? 34  ILE A CG1  4  
ATOM 6265  C CG2  . ILE A 1 34  ? -0.744  -0.974  -11.154 1.00 0.00 ? 34  ILE A CG2  4  
ATOM 6266  C CD1  . ILE A 1 34  ? 2.324   -0.609  -10.780 1.00 0.00 ? 34  ILE A CD1  4  
ATOM 6267  H H    . ILE A 1 34  ? 1.999   -0.650  -14.151 1.00 0.00 ? 34  ILE A H    4  
ATOM 6268  H HA   . ILE A 1 34  ? 1.056   -2.575  -12.185 1.00 0.00 ? 34  ILE A HA   4  
ATOM 6269  H HB   . ILE A 1 34  ? -0.256  0.015   -12.970 1.00 0.00 ? 34  ILE A HB   4  
ATOM 6270  H HG12 . ILE A 1 34  ? 2.009   0.642   -12.509 1.00 0.00 ? 34  ILE A HG12 4  
ATOM 6271  H HG13 . ILE A 1 34  ? 1.027   1.080   -11.125 1.00 0.00 ? 34  ILE A HG13 4  
ATOM 6272  H HG21 . ILE A 1 34  ? -0.699  -0.240  -10.349 1.00 0.00 ? 34  ILE A HG21 4  
ATOM 6273  H HG22 . ILE A 1 34  ? -1.747  -0.985  -11.580 1.00 0.00 ? 34  ILE A HG22 4  
ATOM 6274  H HG23 . ILE A 1 34  ? -0.506  -1.962  -10.759 1.00 0.00 ? 34  ILE A HG23 4  
ATOM 6275  H HD11 . ILE A 1 34  ? 1.884   -1.598  -10.648 1.00 0.00 ? 34  ILE A HD11 4  
ATOM 6276  H HD12 . ILE A 1 34  ? 3.309   -0.707  -11.237 1.00 0.00 ? 34  ILE A HD12 4  
ATOM 6277  H HD13 . ILE A 1 34  ? 2.420   -0.122  -9.809  1.00 0.00 ? 34  ILE A HD13 4  
ATOM 6278  N N    . LEU A 1 35  ? -0.573  -3.739  -13.582 1.00 0.00 ? 35  LEU A N    4  
ATOM 6279  C CA   . LEU A 1 35  ? -1.535  -4.476  -14.383 1.00 0.00 ? 35  LEU A CA   4  
ATOM 6280  C C    . LEU A 1 35  ? -2.410  -5.331  -13.465 1.00 0.00 ? 35  LEU A C    4  
ATOM 6281  O O    . LEU A 1 35  ? -1.996  -5.687  -12.363 1.00 0.00 ? 35  LEU A O    4  
ATOM 6282  C CB   . LEU A 1 35  ? -0.822  -5.277  -15.474 1.00 0.00 ? 35  LEU A CB   4  
ATOM 6283  C CG   . LEU A 1 35  ? -0.127  -4.457  -16.564 1.00 0.00 ? 35  LEU A CG   4  
ATOM 6284  C CD1  . LEU A 1 35  ? 0.639   -5.364  -17.528 1.00 0.00 ? 35  LEU A CD1  4  
ATOM 6285  C CD2  . LEU A 1 35  ? -1.127  -3.558  -17.294 1.00 0.00 ? 35  LEU A CD2  4  
ATOM 6286  H H    . LEU A 1 35  ? -0.201  -4.242  -12.801 1.00 0.00 ? 35  LEU A H    4  
ATOM 6287  H HA   . LEU A 1 35  ? -2.170  -3.745  -14.884 1.00 0.00 ? 35  LEU A HA   4  
ATOM 6288  H HB2  . LEU A 1 35  ? -0.079  -5.918  -15.000 1.00 0.00 ? 35  LEU A HB2  4  
ATOM 6289  H HB3  . LEU A 1 35  ? -1.551  -5.933  -15.950 1.00 0.00 ? 35  LEU A HB3  4  
ATOM 6290  H HG   . LEU A 1 35  ? 0.603   -3.804  -16.086 1.00 0.00 ? 35  LEU A HG   4  
ATOM 6291  H HD11 . LEU A 1 35  ? 1.671   -5.462  -17.192 1.00 0.00 ? 35  LEU A HD11 4  
ATOM 6292  H HD12 . LEU A 1 35  ? 0.170   -6.348  -17.552 1.00 0.00 ? 35  LEU A HD12 4  
ATOM 6293  H HD13 . LEU A 1 35  ? 0.622   -4.929  -18.527 1.00 0.00 ? 35  LEU A HD13 4  
ATOM 6294  H HD21 . LEU A 1 35  ? -1.585  -2.871  -16.583 1.00 0.00 ? 35  LEU A HD21 4  
ATOM 6295  H HD22 . LEU A 1 35  ? -0.608  -2.990  -18.066 1.00 0.00 ? 35  LEU A HD22 4  
ATOM 6296  H HD23 . LEU A 1 35  ? -1.900  -4.173  -17.754 1.00 0.00 ? 35  LEU A HD23 4  
ATOM 6297  N N    . PHE A 1 36  ? -3.604  -5.635  -13.952 1.00 0.00 ? 36  PHE A N    4  
ATOM 6298  C CA   . PHE A 1 36  ? -4.540  -6.442  -13.188 1.00 0.00 ? 36  PHE A CA   4  
ATOM 6299  C C    . PHE A 1 36  ? -4.863  -7.747  -13.919 1.00 0.00 ? 36  PHE A C    4  
ATOM 6300  O O    . PHE A 1 36  ? -5.764  -7.787  -14.755 1.00 0.00 ? 36  PHE A O    4  
ATOM 6301  C CB   . PHE A 1 36  ? -5.823  -5.621  -13.044 1.00 0.00 ? 36  PHE A CB   4  
ATOM 6302  C CG   . PHE A 1 36  ? -5.692  -4.421  -12.104 1.00 0.00 ? 36  PHE A CG   4  
ATOM 6303  C CD1  . PHE A 1 36  ? -5.300  -3.214  -12.592 1.00 0.00 ? 36  PHE A CD1  4  
ATOM 6304  C CD2  . PHE A 1 36  ? -5.968  -4.562  -10.779 1.00 0.00 ? 36  PHE A CD2  4  
ATOM 6305  C CE1  . PHE A 1 36  ? -5.178  -2.100  -11.720 1.00 0.00 ? 36  PHE A CE1  4  
ATOM 6306  C CE2  . PHE A 1 36  ? -5.846  -3.448  -9.907  1.00 0.00 ? 36  PHE A CE2  4  
ATOM 6307  C CZ   . PHE A 1 36  ? -5.454  -2.241  -10.395 1.00 0.00 ? 36  PHE A CZ   4  
ATOM 6308  H H    . PHE A 1 36  ? -3.933  -5.341  -14.849 1.00 0.00 ? 36  PHE A H    4  
ATOM 6309  H HA   . PHE A 1 36  ? -4.067  -6.670  -12.233 1.00 0.00 ? 36  PHE A HA   4  
ATOM 6310  H HB2  . PHE A 1 36  ? -6.128  -5.266  -14.029 1.00 0.00 ? 36  PHE A HB2  4  
ATOM 6311  H HB3  . PHE A 1 36  ? -6.619  -6.270  -12.679 1.00 0.00 ? 36  PHE A HB3  4  
ATOM 6312  H HD1  . PHE A 1 36  ? -5.080  -3.101  -13.654 1.00 0.00 ? 36  PHE A HD1  4  
ATOM 6313  H HD2  . PHE A 1 36  ? -6.282  -5.529  -10.388 1.00 0.00 ? 36  PHE A HD2  4  
ATOM 6314  H HE1  . PHE A 1 36  ? -4.864  -1.133  -12.111 1.00 0.00 ? 36  PHE A HE1  4  
ATOM 6315  H HE2  . PHE A 1 36  ? -6.066  -3.561  -8.845  1.00 0.00 ? 36  PHE A HE2  4  
ATOM 6316  H HZ   . PHE A 1 36  ? -5.360  -1.386  -9.725  1.00 0.00 ? 36  PHE A HZ   4  
ATOM 6317  N N    . PRO A 1 37  ? -4.090  -8.808  -13.568 1.00 0.00 ? 37  PRO A N    4  
ATOM 6318  C CA   . PRO A 1 37  ? -4.284  -10.111 -14.181 1.00 0.00 ? 37  PRO A CA   4  
ATOM 6319  C C    . PRO A 1 37  ? -5.536  -10.796 -13.628 1.00 0.00 ? 37  PRO A C    4  
ATOM 6320  O O    . PRO A 1 37  ? -6.365  -11.291 -14.390 1.00 0.00 ? 37  PRO A O    4  
ATOM 6321  C CB   . PRO A 1 37  ? -3.007  -10.880 -13.885 1.00 0.00 ? 37  PRO A CB   4  
ATOM 6322  C CG   . PRO A 1 37  ? -2.341  -10.152 -12.729 1.00 0.00 ? 37  PRO A CG   4  
ATOM 6323  C CD   . PRO A 1 37  ? -3.013  -8.797  -12.582 1.00 0.00 ? 37  PRO A CD   4  
ATOM 6324  H HA   . PRO A 1 37  ? -4.438  -10.013 -15.164 1.00 0.00 ? 37  PRO A HA   4  
ATOM 6325  H HB2  . PRO A 1 37  ? -3.226  -11.915 -13.621 1.00 0.00 ? 37  PRO A HB2  4  
ATOM 6326  H HB3  . PRO A 1 37  ? -2.355  -10.905 -14.758 1.00 0.00 ? 37  PRO A HB3  4  
ATOM 6327  H HG2  . PRO A 1 37  ? -2.437  -10.728 -11.809 1.00 0.00 ? 37  PRO A HG2  4  
ATOM 6328  H HG3  . PRO A 1 37  ? -1.274  -10.031 -12.918 1.00 0.00 ? 37  PRO A HG3  4  
ATOM 6329  H HD2  . PRO A 1 37  ? -3.402  -8.655  -11.573 1.00 0.00 ? 37  PRO A HD2  4  
ATOM 6330  H HD3  . PRO A 1 37  ? -2.312  -7.984  -12.770 1.00 0.00 ? 37  PRO A HD3  4  
ATOM 6331  N N    . GLU A 1 38  ? -5.633  -10.803 -12.307 1.00 0.00 ? 38  GLU A N    4  
ATOM 6332  C CA   . GLU A 1 38  ? -6.769  -11.419 -11.643 1.00 0.00 ? 38  GLU A CA   4  
ATOM 6333  C C    . GLU A 1 38  ? -7.520  -10.382 -10.805 1.00 0.00 ? 38  GLU A C    4  
ATOM 6334  O O    . GLU A 1 38  ? -7.018  -9.927  -9.779  1.00 0.00 ? 38  GLU A O    4  
ATOM 6335  C CB   . GLU A 1 38  ? -6.326  -12.603 -10.782 1.00 0.00 ? 38  GLU A CB   4  
ATOM 6336  C CG   . GLU A 1 38  ? -7.516  -13.222 -10.046 1.00 0.00 ? 38  GLU A CG   4  
ATOM 6337  C CD   . GLU A 1 38  ? -7.052  -14.297 -9.061  1.00 0.00 ? 38  GLU A CD   4  
ATOM 6338  O OE1  . GLU A 1 38  ? -6.105  -15.028 -9.424  1.00 0.00 ? 38  GLU A OE1  4  
ATOM 6339  O OE2  . GLU A 1 38  ? -7.656  -14.365 -7.969  1.00 0.00 ? 38  GLU A OE2  4  
ATOM 6340  H H    . GLU A 1 38  ? -4.954  -10.398 -11.694 1.00 0.00 ? 38  GLU A H    4  
ATOM 6341  H HA   . GLU A 1 38  ? -7.412  -11.781 -12.446 1.00 0.00 ? 38  GLU A HA   4  
ATOM 6342  H HB2  . GLU A 1 38  ? -5.851  -13.356 -11.411 1.00 0.00 ? 38  GLU A HB2  4  
ATOM 6343  H HB3  . GLU A 1 38  ? -5.579  -12.273 -10.061 1.00 0.00 ? 38  GLU A HB3  4  
ATOM 6344  H HG2  . GLU A 1 38  ? -8.061  -12.444 -9.511  1.00 0.00 ? 38  GLU A HG2  4  
ATOM 6345  H HG3  . GLU A 1 38  ? -8.207  -13.657 -10.767 1.00 0.00 ? 38  GLU A HG3  4  
ATOM 6346  N N    . VAL A 1 39  ? -8.711  -10.039 -11.273 1.00 0.00 ? 39  VAL A N    4  
ATOM 6347  C CA   . VAL A 1 39  ? -9.536  -9.065  -10.580 1.00 0.00 ? 39  VAL A CA   4  
ATOM 6348  C C    . VAL A 1 39  ? -10.992 -9.535  -10.591 1.00 0.00 ? 39  VAL A C    4  
ATOM 6349  O O    . VAL A 1 39  ? -11.617 -9.605  -11.648 1.00 0.00 ? 39  VAL A O    4  
ATOM 6350  C CB   . VAL A 1 39  ? -9.350  -7.681  -11.206 1.00 0.00 ? 39  VAL A CB   4  
ATOM 6351  C CG1  . VAL A 1 39  ? -8.891  -7.795  -12.661 1.00 0.00 ? 39  VAL A CG1  4  
ATOM 6352  C CG2  . VAL A 1 39  ? -10.633 -6.854  -11.099 1.00 0.00 ? 39  VAL A CG2  4  
ATOM 6353  H H    . VAL A 1 39  ? -9.112  -10.414 -12.109 1.00 0.00 ? 39  VAL A H    4  
ATOM 6354  H HA   . VAL A 1 39  ? -9.191  -9.017  -9.547  1.00 0.00 ? 39  VAL A HA   4  
ATOM 6355  H HB   . VAL A 1 39  ? -8.570  -7.163  -10.648 1.00 0.00 ? 39  VAL A HB   4  
ATOM 6356  H HG11 . VAL A 1 39  ? -7.853  -8.127  -12.689 1.00 0.00 ? 39  VAL A HG11 4  
ATOM 6357  H HG12 . VAL A 1 39  ? -9.517  -8.518  -13.184 1.00 0.00 ? 39  VAL A HG12 4  
ATOM 6358  H HG13 . VAL A 1 39  ? -8.975  -6.823  -13.146 1.00 0.00 ? 39  VAL A HG13 4  
ATOM 6359  H HG21 . VAL A 1 39  ? -10.443 -5.842  -11.457 1.00 0.00 ? 39  VAL A HG21 4  
ATOM 6360  H HG22 . VAL A 1 39  ? -11.413 -7.314  -11.705 1.00 0.00 ? 39  VAL A HG22 4  
ATOM 6361  H HG23 . VAL A 1 39  ? -10.955 -6.817  -10.058 1.00 0.00 ? 39  VAL A HG23 4  
ATOM 6362  N N    . ARG A 1 40  ? -11.489 -9.846  -9.403  1.00 0.00 ? 40  ARG A N    4  
ATOM 6363  C CA   . ARG A 1 40  ? -12.860 -10.307 -9.263  1.00 0.00 ? 40  ARG A CA   4  
ATOM 6364  C C    . ARG A 1 40  ? -13.747 -9.182  -8.726  1.00 0.00 ? 40  ARG A C    4  
ATOM 6365  O O    . ARG A 1 40  ? -13.373 -8.012  -8.782  1.00 0.00 ? 40  ARG A O    4  
ATOM 6366  C CB   . ARG A 1 40  ? -12.943 -11.508 -8.317  1.00 0.00 ? 40  ARG A CB   4  
ATOM 6367  C CG   . ARG A 1 40  ? -11.699 -12.390 -8.441  1.00 0.00 ? 40  ARG A CG   4  
ATOM 6368  C CD   . ARG A 1 40  ? -11.894 -13.719 -7.709  1.00 0.00 ? 40  ARG A CD   4  
ATOM 6369  N NE   . ARG A 1 40  ? -12.721 -14.632 -8.530  1.00 0.00 ? 40  ARG A NE   4  
ATOM 6370  C CZ   . ARG A 1 40  ? -12.238 -15.396 -9.520  1.00 0.00 ? 40  ARG A CZ   4  
ATOM 6371  N NH1  . ARG A 1 40  ? -10.932 -15.361 -9.818  1.00 0.00 ? 40  ARG A NH1  4  
ATOM 6372  N NH2  . ARG A 1 40  ? -13.062 -16.194 -10.213 1.00 0.00 ? 40  ARG A NH2  4  
ATOM 6373  H H    . ARG A 1 40  ? -10.974 -9.786  -8.548  1.00 0.00 ? 40  ARG A H    4  
ATOM 6374  H HA   . ARG A 1 40  ? -13.160 -10.598 -10.269 1.00 0.00 ? 40  ARG A HA   4  
ATOM 6375  H HB2  . ARG A 1 40  ? -13.045 -11.159 -7.290  1.00 0.00 ? 40  ARG A HB2  4  
ATOM 6376  H HB3  . ARG A 1 40  ? -13.833 -12.094 -8.545  1.00 0.00 ? 40  ARG A HB3  4  
ATOM 6377  H HG2  . ARG A 1 40  ? -11.485 -12.577 -9.493  1.00 0.00 ? 40  ARG A HG2  4  
ATOM 6378  H HG3  . ARG A 1 40  ? -10.836 -11.867 -8.028  1.00 0.00 ? 40  ARG A HG3  4  
ATOM 6379  H HD2  . ARG A 1 40  ? -10.927 -14.177 -7.504  1.00 0.00 ? 40  ARG A HD2  4  
ATOM 6380  H HD3  . ARG A 1 40  ? -12.376 -13.547 -6.747  1.00 0.00 ? 40  ARG A HD3  4  
ATOM 6381  H HE   . ARG A 1 40  ? -13.700 -14.682 -8.335  1.00 0.00 ? 40  ARG A HE   4  
ATOM 6382  H HH11 . ARG A 1 40  ? -10.318 -14.765 -9.301  1.00 0.00 ? 40  ARG A HH11 4  
ATOM 6383  H HH12 . ARG A 1 40  ? -10.573 -15.931 -10.557 1.00 0.00 ? 40  ARG A HH12 4  
ATOM 6384  H HH21 . ARG A 1 40  ? -14.037 -16.220 -9.991  1.00 0.00 ? 40  ARG A HH21 4  
ATOM 6385  H HH22 . ARG A 1 40  ? -12.703 -16.764 -10.951 1.00 0.00 ? 40  ARG A HH22 4  
ATOM 6386  N N    . THR A 1 41  ? -14.905 -9.576  -8.218  1.00 0.00 ? 41  THR A N    4  
ATOM 6387  C CA   . THR A 1 41  ? -15.848 -8.615  -7.672  1.00 0.00 ? 41  THR A CA   4  
ATOM 6388  C C    . THR A 1 41  ? -15.328 -8.049  -6.349  1.00 0.00 ? 41  THR A C    4  
ATOM 6389  O O    . THR A 1 41  ? -14.685 -7.000  -6.329  1.00 0.00 ? 41  THR A O    4  
ATOM 6390  C CB   . THR A 1 41  ? -17.207 -9.307  -7.543  1.00 0.00 ? 41  THR A CB   4  
ATOM 6391  O OG1  . THR A 1 41  ? -16.880 -10.670 -7.289  1.00 0.00 ? 41  THR A OG1  4  
ATOM 6392  C CG2  . THR A 1 41  ? -17.971 -9.348  -8.869  1.00 0.00 ? 41  THR A CG2  4  
ATOM 6393  H H    . THR A 1 41  ? -15.202 -10.530 -8.176  1.00 0.00 ? 41  THR A H    4  
ATOM 6394  H HA   . THR A 1 41  ? -15.930 -7.780  -8.367  1.00 0.00 ? 41  THR A HA   4  
ATOM 6395  H HB   . THR A 1 41  ? -17.808 -8.843  -6.762  1.00 0.00 ? 41  THR A HB   4  
ATOM 6396  H HG1  . THR A 1 41  ? -17.690 -11.163 -6.973  1.00 0.00 ? 41  THR A HG1  4  
ATOM 6397  H HG21 . THR A 1 41  ? -19.039 -9.245  -8.676  1.00 0.00 ? 41  THR A HG21 4  
ATOM 6398  H HG22 . THR A 1 41  ? -17.636 -8.529  -9.506  1.00 0.00 ? 41  THR A HG22 4  
ATOM 6399  H HG23 . THR A 1 41  ? -17.782 -10.298 -9.368  1.00 0.00 ? 41  THR A HG23 4  
ATOM 6400  N N    . THR A 1 42  ? -15.624 -8.769  -5.277  1.00 0.00 ? 42  THR A N    4  
ATOM 6401  C CA   . THR A 1 42  ? -15.193 -8.352  -3.953  1.00 0.00 ? 42  THR A CA   4  
ATOM 6402  C C    . THR A 1 42  ? -13.792 -8.888  -3.654  1.00 0.00 ? 42  THR A C    4  
ATOM 6403  O O    . THR A 1 42  ? -13.423 -9.057  -2.493  1.00 0.00 ? 42  THR A O    4  
ATOM 6404  C CB   . THR A 1 42  ? -16.249 -8.812  -2.946  1.00 0.00 ? 42  THR A CB   4  
ATOM 6405  O OG1  . THR A 1 42  ? -16.232 -10.233 -3.051  1.00 0.00 ? 42  THR A OG1  4  
ATOM 6406  C CG2  . THR A 1 42  ? -17.668 -8.425  -3.366  1.00 0.00 ? 42  THR A CG2  4  
ATOM 6407  H H    . THR A 1 42  ? -16.147 -9.621  -5.302  1.00 0.00 ? 42  THR A H    4  
ATOM 6408  H HA   . THR A 1 42  ? -15.129 -7.264  -3.940  1.00 0.00 ? 42  THR A HA   4  
ATOM 6409  H HB   . THR A 1 42  ? -16.022 -8.439  -1.947  1.00 0.00 ? 42  THR A HB   4  
ATOM 6410  H HG1  . THR A 1 42  ? -15.331 -10.585 -2.794  1.00 0.00 ? 42  THR A HG1  4  
ATOM 6411  H HG21 . THR A 1 42  ? -18.292 -9.318  -3.407  1.00 0.00 ? 42  THR A HG21 4  
ATOM 6412  H HG22 . THR A 1 42  ? -18.083 -7.725  -2.640  1.00 0.00 ? 42  THR A HG22 4  
ATOM 6413  H HG23 . THR A 1 42  ? -17.640 -7.955  -4.349  1.00 0.00 ? 42  THR A HG23 4  
ATOM 6414  N N    . SER A 1 43  ? -13.050 -9.143  -4.722  1.00 0.00 ? 43  SER A N    4  
ATOM 6415  C CA   . SER A 1 43  ? -11.698 -9.657  -4.588  1.00 0.00 ? 43  SER A CA   4  
ATOM 6416  C C    . SER A 1 43  ? -10.929 -9.452  -5.895  1.00 0.00 ? 43  SER A C    4  
ATOM 6417  O O    . SER A 1 43  ? -11.272 -10.038 -6.920  1.00 0.00 ? 43  SER A O    4  
ATOM 6418  C CB   . SER A 1 43  ? -11.707 -11.138 -4.205  1.00 0.00 ? 43  SER A CB   4  
ATOM 6419  O OG   . SER A 1 43  ? -11.665 -11.986 -5.349  1.00 0.00 ? 43  SER A OG   4  
ATOM 6420  H H    . SER A 1 43  ? -13.358 -9.003  -5.663  1.00 0.00 ? 43  SER A H    4  
ATOM 6421  H HA   . SER A 1 43  ? -11.247 -9.077  -3.784  1.00 0.00 ? 43  SER A HA   4  
ATOM 6422  H HB2  . SER A 1 43  ? -10.853 -11.352 -3.563  1.00 0.00 ? 43  SER A HB2  4  
ATOM 6423  H HB3  . SER A 1 43  ? -12.604 -11.357 -3.625  1.00 0.00 ? 43  SER A HB3  4  
ATOM 6424  H HG   . SER A 1 43  ? -10.737 -12.010 -5.722  1.00 0.00 ? 43  SER A HG   4  
ATOM 6425  N N    . VAL A 1 44  ? -9.902  -8.618  -5.815  1.00 0.00 ? 44  VAL A N    4  
ATOM 6426  C CA   . VAL A 1 44  ? -9.081  -8.329  -6.979  1.00 0.00 ? 44  VAL A CA   4  
ATOM 6427  C C    . VAL A 1 44  ? -7.614  -8.599  -6.642  1.00 0.00 ? 44  VAL A C    4  
ATOM 6428  O O    . VAL A 1 44  ? -7.252  -8.710  -5.472  1.00 0.00 ? 44  VAL A O    4  
ATOM 6429  C CB   . VAL A 1 44  ? -9.332  -6.896  -7.453  1.00 0.00 ? 44  VAL A CB   4  
ATOM 6430  C CG1  . VAL A 1 44  ? -10.825 -6.561  -7.423  1.00 0.00 ? 44  VAL A CG1  4  
ATOM 6431  C CG2  . VAL A 1 44  ? -8.529  -5.894  -6.620  1.00 0.00 ? 44  VAL A CG2  4  
ATOM 6432  H H    . VAL A 1 44  ? -9.629  -8.145  -4.977  1.00 0.00 ? 44  VAL A H    4  
ATOM 6433  H HA   . VAL A 1 44  ? -9.389  -9.006  -7.775  1.00 0.00 ? 44  VAL A HA   4  
ATOM 6434  H HB   . VAL A 1 44  ? -8.993  -6.820  -8.486  1.00 0.00 ? 44  VAL A HB   4  
ATOM 6435  H HG11 . VAL A 1 44  ? -11.197 -6.652  -6.402  1.00 0.00 ? 44  VAL A HG11 4  
ATOM 6436  H HG12 . VAL A 1 44  ? -10.976 -5.541  -7.775  1.00 0.00 ? 44  VAL A HG12 4  
ATOM 6437  H HG13 . VAL A 1 44  ? -11.365 -7.253  -8.069  1.00 0.00 ? 44  VAL A HG13 4  
ATOM 6438  H HG21 . VAL A 1 44  ? -7.787  -5.407  -7.253  1.00 0.00 ? 44  VAL A HG21 4  
ATOM 6439  H HG22 . VAL A 1 44  ? -9.202  -5.144  -6.206  1.00 0.00 ? 44  VAL A HG22 4  
ATOM 6440  H HG23 . VAL A 1 44  ? -8.026  -6.419  -5.807  1.00 0.00 ? 44  VAL A HG23 4  
ATOM 6441  N N    . ARG A 1 45  ? -6.808  -8.697  -7.689  1.00 0.00 ? 45  ARG A N    4  
ATOM 6442  C CA   . ARG A 1 45  ? -5.387  -8.952  -7.519  1.00 0.00 ? 45  ARG A CA   4  
ATOM 6443  C C    . ARG A 1 45  ? -4.593  -8.308  -8.657  1.00 0.00 ? 45  ARG A C    4  
ATOM 6444  O O    . ARG A 1 45  ? -4.712  -8.716  -9.811  1.00 0.00 ? 45  ARG A O    4  
ATOM 6445  C CB   . ARG A 1 45  ? -5.097  -10.454 -7.490  1.00 0.00 ? 45  ARG A CB   4  
ATOM 6446  C CG   . ARG A 1 45  ? -3.613  -10.720 -7.233  1.00 0.00 ? 45  ARG A CG   4  
ATOM 6447  C CD   . ARG A 1 45  ? -3.162  -12.015 -7.913  1.00 0.00 ? 45  ARG A CD   4  
ATOM 6448  N NE   . ARG A 1 45  ? -3.280  -13.149 -6.970  1.00 0.00 ? 45  ARG A NE   4  
ATOM 6449  C CZ   . ARG A 1 45  ? -2.449  -13.360 -5.940  1.00 0.00 ? 45  ARG A CZ   4  
ATOM 6450  N NH1  . ARG A 1 45  ? -1.433  -12.515 -5.715  1.00 0.00 ? 45  ARG A NH1  4  
ATOM 6451  N NH2  . ARG A 1 45  ? -2.632  -14.416 -5.136  1.00 0.00 ? 45  ARG A NH2  4  
ATOM 6452  H H    . ARG A 1 45  ? -7.110  -8.605  -8.638  1.00 0.00 ? 45  ARG A H    4  
ATOM 6453  H HA   . ARG A 1 45  ? -5.136  -8.499  -6.560  1.00 0.00 ? 45  ARG A HA   4  
ATOM 6454  H HB2  . ARG A 1 45  ? -5.696  -10.928 -6.713  1.00 0.00 ? 45  ARG A HB2  4  
ATOM 6455  H HB3  . ARG A 1 45  ? -5.392  -10.903 -8.439  1.00 0.00 ? 45  ARG A HB3  4  
ATOM 6456  H HG2  . ARG A 1 45  ? -3.020  -9.885  -7.604  1.00 0.00 ? 45  ARG A HG2  4  
ATOM 6457  H HG3  . ARG A 1 45  ? -3.433  -10.787 -6.160  1.00 0.00 ? 45  ARG A HG3  4  
ATOM 6458  H HD2  . ARG A 1 45  ? -3.771  -12.202 -8.797  1.00 0.00 ? 45  ARG A HD2  4  
ATOM 6459  H HD3  . ARG A 1 45  ? -2.131  -11.918 -8.250  1.00 0.00 ? 45  ARG A HD3  4  
ATOM 6460  H HE   . ARG A 1 45  ? -4.027  -13.799 -7.109  1.00 0.00 ? 45  ARG A HE   4  
ATOM 6461  H HH11 . ARG A 1 45  ? -1.296  -11.727 -6.315  1.00 0.00 ? 45  ARG A HH11 4  
ATOM 6462  H HH12 . ARG A 1 45  ? -0.813  -12.673 -4.947  1.00 0.00 ? 45  ARG A HH12 4  
ATOM 6463  H HH21 . ARG A 1 45  ? -3.389  -15.047 -5.304  1.00 0.00 ? 45  ARG A HH21 4  
ATOM 6464  H HH22 . ARG A 1 45  ? -2.011  -14.574 -4.368  1.00 0.00 ? 45  ARG A HH22 4  
ATOM 6465  N N    . LEU A 1 46  ? -3.799  -7.312  -8.292  1.00 0.00 ? 46  LEU A N    4  
ATOM 6466  C CA   . LEU A 1 46  ? -2.985  -6.607  -9.267  1.00 0.00 ? 46  LEU A CA   4  
ATOM 6467  C C    . LEU A 1 46  ? -1.506  -6.874  -8.979  1.00 0.00 ? 46  LEU A C    4  
ATOM 6468  O O    . LEU A 1 46  ? -1.164  -7.433  -7.938  1.00 0.00 ? 46  LEU A O    4  
ATOM 6469  C CB   . LEU A 1 46  ? -3.347  -5.121  -9.294  1.00 0.00 ? 46  LEU A CB   4  
ATOM 6470  C CG   . LEU A 1 46  ? -2.468  -4.200  -8.445  1.00 0.00 ? 46  LEU A CG   4  
ATOM 6471  C CD1  . LEU A 1 46  ? -2.487  -2.770  -8.988  1.00 0.00 ? 46  LEU A CD1  4  
ATOM 6472  C CD2  . LEU A 1 46  ? -2.874  -4.260  -6.972  1.00 0.00 ? 46  LEU A CD2  4  
ATOM 6473  H H    . LEU A 1 46  ? -3.708  -6.986  -7.351  1.00 0.00 ? 46  LEU A H    4  
ATOM 6474  H HA   . LEU A 1 46  ? -3.225  -7.015  -10.249 1.00 0.00 ? 46  LEU A HA   4  
ATOM 6475  H HB2  . LEU A 1 46  ? -3.308  -4.776  -10.328 1.00 0.00 ? 46  LEU A HB2  4  
ATOM 6476  H HB3  . LEU A 1 46  ? -4.379  -5.013  -8.962  1.00 0.00 ? 46  LEU A HB3  4  
ATOM 6477  H HG   . LEU A 1 46  ? -1.439  -4.555  -8.510  1.00 0.00 ? 46  LEU A HG   4  
ATOM 6478  H HD11 . LEU A 1 46  ? -3.246  -2.192  -8.460  1.00 0.00 ? 46  LEU A HD11 4  
ATOM 6479  H HD12 . LEU A 1 46  ? -1.510  -2.311  -8.837  1.00 0.00 ? 46  LEU A HD12 4  
ATOM 6480  H HD13 . LEU A 1 46  ? -2.720  -2.788  -10.053 1.00 0.00 ? 46  LEU A HD13 4  
ATOM 6481  H HD21 . LEU A 1 46  ? -3.811  -4.808  -6.875  1.00 0.00 ? 46  LEU A HD21 4  
ATOM 6482  H HD22 . LEU A 1 46  ? -2.096  -4.767  -6.401  1.00 0.00 ? 46  LEU A HD22 4  
ATOM 6483  H HD23 . LEU A 1 46  ? -3.004  -3.248  -6.589  1.00 0.00 ? 46  LEU A HD23 4  
ATOM 6484  N N    . ILE A 1 47  ? -0.669  -6.463  -9.920  1.00 0.00 ? 47  ILE A N    4  
ATOM 6485  C CA   . ILE A 1 47  ? 0.765   -6.651  -9.781  1.00 0.00 ? 47  ILE A CA   4  
ATOM 6486  C C    . ILE A 1 47  ? 1.486   -5.369  -10.201 1.00 0.00 ? 47  ILE A C    4  
ATOM 6487  O O    . ILE A 1 47  ? 0.921   -4.537  -10.909 1.00 0.00 ? 47  ILE A O    4  
ATOM 6488  C CB   . ILE A 1 47  ? 1.220   -7.892  -10.550 1.00 0.00 ? 47  ILE A CB   4  
ATOM 6489  C CG1  . ILE A 1 47  ? 1.391   -7.583  -12.038 1.00 0.00 ? 47  ILE A CG1  4  
ATOM 6490  C CG2  . ILE A 1 47  ? 0.265   -9.064  -10.313 1.00 0.00 ? 47  ILE A CG2  4  
ATOM 6491  C CD1  . ILE A 1 47  ? 0.041   -7.290  -12.696 1.00 0.00 ? 47  ILE A CD1  4  
ATOM 6492  H H    . ILE A 1 47  ? -0.955  -6.009  -10.764 1.00 0.00 ? 47  ILE A H    4  
ATOM 6493  H HA   . ILE A 1 47  ? 0.970   -6.832  -8.725  1.00 0.00 ? 47  ILE A HA   4  
ATOM 6494  H HB   . ILE A 1 47  ? 2.197   -8.191  -10.169 1.00 0.00 ? 47  ILE A HB   4  
ATOM 6495  H HG12 . ILE A 1 47  ? 2.053   -6.727  -12.162 1.00 0.00 ? 47  ILE A HG12 4  
ATOM 6496  H HG13 . ILE A 1 47  ? 1.866   -8.428  -12.537 1.00 0.00 ? 47  ILE A HG13 4  
ATOM 6497  H HG21 . ILE A 1 47  ? 0.426   -9.824  -11.078 1.00 0.00 ? 47  ILE A HG21 4  
ATOM 6498  H HG22 . ILE A 1 47  ? 0.454   -9.494  -9.330  1.00 0.00 ? 47  ILE A HG22 4  
ATOM 6499  H HG23 . ILE A 1 47  ? -0.764  -8.710  -10.364 1.00 0.00 ? 47  ILE A HG23 4  
ATOM 6500  H HD11 . ILE A 1 47  ? -0.097  -7.949  -13.553 1.00 0.00 ? 47  ILE A HD11 4  
ATOM 6501  H HD12 . ILE A 1 47  ? -0.759  -7.460  -11.975 1.00 0.00 ? 47  ILE A HD12 4  
ATOM 6502  H HD13 . ILE A 1 47  ? 0.016   -6.252  -13.028 1.00 0.00 ? 47  ILE A HD13 4  
ATOM 6503  N N    . TRP A 1 48  ? 2.725   -5.248  -9.746  1.00 0.00 ? 48  TRP A N    4  
ATOM 6504  C CA   . TRP A 1 48  ? 3.530   -4.081  -10.066 1.00 0.00 ? 48  TRP A CA   4  
ATOM 6505  C C    . TRP A 1 48  ? 4.997   -4.514  -10.102 1.00 0.00 ? 48  TRP A C    4  
ATOM 6506  O O    . TRP A 1 48  ? 5.311   -5.678  -9.856  1.00 0.00 ? 48  TRP A O    4  
ATOM 6507  C CB   . TRP A 1 48  ? 3.266   -2.945  -9.076  1.00 0.00 ? 48  TRP A CB   4  
ATOM 6508  C CG   . TRP A 1 48  ? 3.771   -3.225  -7.659  1.00 0.00 ? 48  TRP A CG   4  
ATOM 6509  C CD1  . TRP A 1 48  ? 4.940   -2.862  -7.113  1.00 0.00 ? 48  TRP A CD1  4  
ATOM 6510  C CD2  . TRP A 1 48  ? 3.071   -3.946  -6.623  1.00 0.00 ? 48  TRP A CD2  4  
ATOM 6511  N NE1  . TRP A 1 48  ? 5.044   -3.294  -5.807  1.00 0.00 ? 48  TRP A NE1  4  
ATOM 6512  C CE2  . TRP A 1 48  ? 3.871   -3.974  -5.499  1.00 0.00 ? 48  TRP A CE2  4  
ATOM 6513  C CE3  . TRP A 1 48  ? 1.803   -4.554  -6.635  1.00 0.00 ? 48  TRP A CE3  4  
ATOM 6514  C CZ2  . TRP A 1 48  ? 3.493   -4.598  -4.304  1.00 0.00 ? 48  TRP A CZ2  4  
ATOM 6515  C CZ3  . TRP A 1 48  ? 1.440   -5.173  -5.433  1.00 0.00 ? 48  TRP A CZ3  4  
ATOM 6516  C CH2  . TRP A 1 48  ? 2.234   -5.211  -4.293  1.00 0.00 ? 48  TRP A CH2  4  
ATOM 6517  H H    . TRP A 1 48  ? 3.178   -5.929  -9.170  1.00 0.00 ? 48  TRP A H    4  
ATOM 6518  H HA   . TRP A 1 48  ? 3.222   -3.724  -11.048 1.00 0.00 ? 48  TRP A HA   4  
ATOM 6519  H HB2  . TRP A 1 48  ? 3.740   -2.036  -9.447  1.00 0.00 ? 48  TRP A HB2  4  
ATOM 6520  H HB3  . TRP A 1 48  ? 2.194   -2.753  -9.037  1.00 0.00 ? 48  TRP A HB3  4  
ATOM 6521  H HD1  . TRP A 1 48  ? 5.711   -2.296  -7.635  1.00 0.00 ? 48  TRP A HD1  4  
ATOM 6522  H HE1  . TRP A 1 48  ? 5.890   -3.132  -5.139  1.00 0.00 ? 48  TRP A HE1  4  
ATOM 6523  H HE3  . TRP A 1 48  ? 1.153   -4.545  -7.509  1.00 0.00 ? 48  TRP A HE3  4  
ATOM 6524  H HZ2  . TRP A 1 48  ? 4.144   -4.607  -3.430  1.00 0.00 ? 48  TRP A HZ2  4  
ATOM 6525  H HZ3  . TRP A 1 48  ? 0.466   -5.660  -5.388  1.00 0.00 ? 48  TRP A HZ3  4  
ATOM 6526  H HH2  . TRP A 1 48  ? 1.879   -5.715  -3.394  1.00 0.00 ? 48  TRP A HH2  4  
ATOM 6527  N N    . GLN A 1 49  ? 5.856   -3.554  -10.410 1.00 0.00 ? 49  GLN A N    4  
ATOM 6528  C CA   . GLN A 1 49  ? 7.283   -3.822  -10.482 1.00 0.00 ? 49  GLN A CA   4  
ATOM 6529  C C    . GLN A 1 49  ? 8.065   -2.726  -9.756  1.00 0.00 ? 49  GLN A C    4  
ATOM 6530  O O    . GLN A 1 49  ? 7.537   -1.644  -9.502  1.00 0.00 ? 49  GLN A O    4  
ATOM 6531  C CB   . GLN A 1 49  ? 7.744   -3.953  -11.935 1.00 0.00 ? 49  GLN A CB   4  
ATOM 6532  C CG   . GLN A 1 49  ? 7.516   -5.374  -12.456 1.00 0.00 ? 49  GLN A CG   4  
ATOM 6533  C CD   . GLN A 1 49  ? 8.416   -5.668  -13.657 1.00 0.00 ? 49  GLN A CD   4  
ATOM 6534  O OE1  . GLN A 1 49  ? 9.633   -5.631  -13.578 1.00 0.00 ? 49  GLN A OE1  4  
ATOM 6535  N NE2  . GLN A 1 49  ? 7.752   -5.962  -14.772 1.00 0.00 ? 49  GLN A NE2  4  
ATOM 6536  H H    . GLN A 1 49  ? 5.593   -2.610  -10.609 1.00 0.00 ? 49  GLN A H    4  
ATOM 6537  H HA   . GLN A 1 49  ? 7.424   -4.776  -9.974  1.00 0.00 ? 49  GLN A HA   4  
ATOM 6538  H HB2  . GLN A 1 49  ? 7.201   -3.242  -12.558 1.00 0.00 ? 49  GLN A HB2  4  
ATOM 6539  H HB3  . GLN A 1 49  ? 8.801   -3.700  -12.009 1.00 0.00 ? 49  GLN A HB3  4  
ATOM 6540  H HG2  . GLN A 1 49  ? 7.717   -6.093  -11.661 1.00 0.00 ? 49  GLN A HG2  4  
ATOM 6541  H HG3  . GLN A 1 49  ? 6.471   -5.497  -12.741 1.00 0.00 ? 49  GLN A HG3  4  
ATOM 6542  H HE21 . GLN A 1 49  ? 6.752   -5.975  -14.769 1.00 0.00 ? 49  GLN A HE21 4  
ATOM 6543  H HE22 . GLN A 1 49  ? 8.253   -6.169  -15.612 1.00 0.00 ? 49  GLN A HE22 4  
ATOM 6544  N N    . PRO A 1 50  ? 9.346   -3.052  -9.433  1.00 0.00 ? 50  PRO A N    4  
ATOM 6545  C CA   . PRO A 1 50  ? 10.206  -2.107  -8.740  1.00 0.00 ? 50  PRO A CA   4  
ATOM 6546  C C    . PRO A 1 50  ? 10.689  -1.008  -9.689  1.00 0.00 ? 50  PRO A C    4  
ATOM 6547  O O    . PRO A 1 50  ? 10.824  -1.235  -10.890 1.00 0.00 ? 50  PRO A O    4  
ATOM 6548  C CB   . PRO A 1 50  ? 11.341  -2.948  -8.179  1.00 0.00 ? 50  PRO A CB   4  
ATOM 6549  C CG   . PRO A 1 50  ? 11.324  -4.249  -8.965  1.00 0.00 ? 50  PRO A CG   4  
ATOM 6550  C CD   . PRO A 1 50  ? 10.005  -4.323  -9.716  1.00 0.00 ? 50  PRO A CD   4  
ATOM 6551  H HA   . PRO A 1 50  ? 9.698   -1.640  -8.017  1.00 0.00 ? 50  PRO A HA   4  
ATOM 6552  H HB2  . PRO A 1 50  ? 12.298  -2.437  -8.290  1.00 0.00 ? 50  PRO A HB2  4  
ATOM 6553  H HB3  . PRO A 1 50  ? 11.201  -3.133  -7.114  1.00 0.00 ? 50  PRO A HB3  4  
ATOM 6554  H HG2  . PRO A 1 50  ? 12.163  -4.286  -9.661  1.00 0.00 ? 50  PRO A HG2  4  
ATOM 6555  H HG3  . PRO A 1 50  ? 11.430  -5.102  -8.294  1.00 0.00 ? 50  PRO A HG3  4  
ATOM 6556  H HD2  . PRO A 1 50  ? 10.166  -4.455  -10.786 1.00 0.00 ? 50  PRO A HD2  4  
ATOM 6557  H HD3  . PRO A 1 50  ? 9.403   -5.166  -9.378  1.00 0.00 ? 50  PRO A HD3  4  
ATOM 6558  N N    . PRO A 1 51  ? 10.942  0.191   -9.098  1.00 0.00 ? 51  PRO A N    4  
ATOM 6559  C CA   . PRO A 1 51  ? 11.406  1.326   -9.877  1.00 0.00 ? 51  PRO A CA   4  
ATOM 6560  C C    . PRO A 1 51  ? 12.879  1.163   -10.258 1.00 0.00 ? 51  PRO A C    4  
ATOM 6561  O O    . PRO A 1 51  ? 13.739  1.038   -9.387  1.00 0.00 ? 51  PRO A O    4  
ATOM 6562  C CB   . PRO A 1 51  ? 11.150  2.538   -8.997  1.00 0.00 ? 51  PRO A CB   4  
ATOM 6563  C CG   . PRO A 1 51  ? 10.985  2.001   -7.585  1.00 0.00 ? 51  PRO A CG   4  
ATOM 6564  C CD   . PRO A 1 51  ? 10.792  0.496   -7.678  1.00 0.00 ? 51  PRO A CD   4  
ATOM 6565  H HA   . PRO A 1 51  ? 10.905  1.382   -10.741 1.00 0.00 ? 51  PRO A HA   4  
ATOM 6566  H HB2  . PRO A 1 51  ? 11.980  3.243   -9.053  1.00 0.00 ? 51  PRO A HB2  4  
ATOM 6567  H HB3  . PRO A 1 51  ? 10.256  3.072   -9.319  1.00 0.00 ? 51  PRO A HB3  4  
ATOM 6568  H HG2  . PRO A 1 51  ? 11.862  2.236   -6.982  1.00 0.00 ? 51  PRO A HG2  4  
ATOM 6569  H HG3  . PRO A 1 51  ? 10.129  2.466   -7.097  1.00 0.00 ? 51  PRO A HG3  4  
ATOM 6570  H HD2  . PRO A 1 51  ? 11.531  -0.036  -7.079  1.00 0.00 ? 51  PRO A HD2  4  
ATOM 6571  H HD3  . PRO A 1 51  ? 9.810   0.199   -7.311  1.00 0.00 ? 51  PRO A HD3  4  
ATOM 6572  N N    . ALA A 1 52  ? 13.125  1.171   -11.560 1.00 0.00 ? 52  ALA A N    4  
ATOM 6573  C CA   . ALA A 1 52  ? 14.479  1.026   -12.066 1.00 0.00 ? 52  ALA A CA   4  
ATOM 6574  C C    . ALA A 1 52  ? 15.422  1.911   -11.248 1.00 0.00 ? 52  ALA A C    4  
ATOM 6575  O O    . ALA A 1 52  ? 16.604  1.601   -11.107 1.00 0.00 ? 52  ALA A O    4  
ATOM 6576  C CB   . ALA A 1 52  ? 14.506  1.368   -13.557 1.00 0.00 ? 52  ALA A CB   4  
ATOM 6577  H H    . ALA A 1 52  ? 12.420  1.274   -12.261 1.00 0.00 ? 52  ALA A H    4  
ATOM 6578  H HA   . ALA A 1 52  ? 14.772  -0.016  -11.939 1.00 0.00 ? 52  ALA A HA   4  
ATOM 6579  H HB1  . ALA A 1 52  ? 13.489  1.540   -13.909 1.00 0.00 ? 52  ALA A HB1  4  
ATOM 6580  H HB2  . ALA A 1 52  ? 15.101  2.267   -13.713 1.00 0.00 ? 52  ALA A HB2  4  
ATOM 6581  H HB3  . ALA A 1 52  ? 14.947  0.540   -14.112 1.00 0.00 ? 52  ALA A HB3  4  
ATOM 6582  N N    . ALA A 1 53  ? 14.865  2.996   -10.731 1.00 0.00 ? 53  ALA A N    4  
ATOM 6583  C CA   . ALA A 1 53  ? 15.641  3.928   -9.931  1.00 0.00 ? 53  ALA A CA   4  
ATOM 6584  C C    . ALA A 1 53  ? 15.077  3.966   -8.510  1.00 0.00 ? 53  ALA A C    4  
ATOM 6585  O O    . ALA A 1 53  ? 14.253  4.821   -8.188  1.00 0.00 ? 53  ALA A O    4  
ATOM 6586  C CB   . ALA A 1 53  ? 15.632  5.305   -10.599 1.00 0.00 ? 53  ALA A CB   4  
ATOM 6587  H H    . ALA A 1 53  ? 13.902  3.241   -10.851 1.00 0.00 ? 53  ALA A H    4  
ATOM 6588  H HA   . ALA A 1 53  ? 16.667  3.561   -9.897  1.00 0.00 ? 53  ALA A HA   4  
ATOM 6589  H HB1  . ALA A 1 53  ? 15.546  5.184   -11.679 1.00 0.00 ? 53  ALA A HB1  4  
ATOM 6590  H HB2  . ALA A 1 53  ? 14.786  5.883   -10.229 1.00 0.00 ? 53  ALA A HB2  4  
ATOM 6591  H HB3  . ALA A 1 53  ? 16.560  5.828   -10.365 1.00 0.00 ? 53  ALA A HB3  4  
ATOM 6592  N N    . PRO A 1 54  ? 15.555  3.005   -7.675  1.00 0.00 ? 54  PRO A N    4  
ATOM 6593  C CA   . PRO A 1 54  ? 15.107  2.921   -6.296  1.00 0.00 ? 54  PRO A CA   4  
ATOM 6594  C C    . PRO A 1 54  ? 15.742  4.023   -5.445  1.00 0.00 ? 54  PRO A C    4  
ATOM 6595  O O    . PRO A 1 54  ? 15.100  4.567   -4.548  1.00 0.00 ? 54  PRO A O    4  
ATOM 6596  C CB   . PRO A 1 54  ? 15.495  1.523   -5.841  1.00 0.00 ? 54  PRO A CB   4  
ATOM 6597  C CG   . PRO A 1 54  ? 16.552  1.043   -6.822  1.00 0.00 ? 54  PRO A CG   4  
ATOM 6598  C CD   . PRO A 1 54  ? 16.532  1.976   -8.022  1.00 0.00 ? 54  PRO A CD   4  
ATOM 6599  H HA   . PRO A 1 54  ? 14.120  3.068   -6.242  1.00 0.00 ? 54  PRO A HA   4  
ATOM 6600  H HB2  . PRO A 1 54  ? 15.884  1.537   -4.823  1.00 0.00 ? 54  PRO A HB2  4  
ATOM 6601  H HB3  . PRO A 1 54  ? 14.630  0.859   -5.842  1.00 0.00 ? 54  PRO A HB3  4  
ATOM 6602  H HG2  . PRO A 1 54  ? 17.536  1.044   -6.354  1.00 0.00 ? 54  PRO A HG2  4  
ATOM 6603  H HG3  . PRO A 1 54  ? 16.348  0.018   -7.132  1.00 0.00 ? 54  PRO A HG3  4  
ATOM 6604  H HD2  . PRO A 1 54  ? 17.515  2.409   -8.204  1.00 0.00 ? 54  PRO A HD2  4  
ATOM 6605  H HD3  . PRO A 1 54  ? 16.244  1.447   -8.930  1.00 0.00 ? 54  PRO A HD3  4  
ATOM 6606  N N    . ASN A 1 55  ? 16.995  4.321   -5.758  1.00 0.00 ? 55  ASN A N    4  
ATOM 6607  C CA   . ASN A 1 55  ? 17.723  5.348   -5.034  1.00 0.00 ? 55  ASN A CA   4  
ATOM 6608  C C    . ASN A 1 55  ? 17.451  5.200   -3.535  1.00 0.00 ? 55  ASN A C    4  
ATOM 6609  O O    . ASN A 1 55  ? 17.175  6.184   -2.850  1.00 0.00 ? 55  ASN A O    4  
ATOM 6610  C CB   . ASN A 1 55  ? 17.272  6.747   -5.460  1.00 0.00 ? 55  ASN A CB   4  
ATOM 6611  C CG   . ASN A 1 55  ? 17.172  6.850   -6.983  1.00 0.00 ? 55  ASN A CG   4  
ATOM 6612  O OD1  . ASN A 1 55  ? 18.127  6.631   -7.710  1.00 0.00 ? 55  ASN A OD1  4  
ATOM 6613  N ND2  . ASN A 1 55  ? 15.966  7.196   -7.423  1.00 0.00 ? 55  ASN A ND2  4  
ATOM 6614  H H    . ASN A 1 55  ? 17.510  3.874   -6.489  1.00 0.00 ? 55  ASN A H    4  
ATOM 6615  H HA   . ASN A 1 55  ? 18.771  5.188   -5.285  1.00 0.00 ? 55  ASN A HA   4  
ATOM 6616  H HB2  . ASN A 1 55  ? 16.304  6.973   -5.012  1.00 0.00 ? 55  ASN A HB2  4  
ATOM 6617  H HB3  . ASN A 1 55  ? 17.977  7.490   -5.087  1.00 0.00 ? 55  ASN A HB3  4  
ATOM 6618  H HD21 . ASN A 1 55  ? 15.224  7.362   -6.773  1.00 0.00 ? 55  ASN A HD21 4  
ATOM 6619  H HD22 . ASN A 1 55  ? 15.800  7.290   -8.405  1.00 0.00 ? 55  ASN A HD22 4  
ATOM 6620  N N    . GLY A 1 56  ? 17.538  3.963   -3.070  1.00 0.00 ? 56  GLY A N    4  
ATOM 6621  C CA   . GLY A 1 56  ? 17.305  3.673   -1.665  1.00 0.00 ? 56  GLY A CA   4  
ATOM 6622  C C    . GLY A 1 56  ? 16.796  2.242   -1.478  1.00 0.00 ? 56  GLY A C    4  
ATOM 6623  O O    . GLY A 1 56  ? 15.845  1.827   -2.137  1.00 0.00 ? 56  GLY A O    4  
ATOM 6624  H H    . GLY A 1 56  ? 17.764  3.168   -3.634  1.00 0.00 ? 56  GLY A H    4  
ATOM 6625  H HA2  . GLY A 1 56  ? 18.229  3.811   -1.104  1.00 0.00 ? 56  GLY A HA2  4  
ATOM 6626  H HA3  . GLY A 1 56  ? 16.578  4.377   -1.261  1.00 0.00 ? 56  GLY A HA3  4  
ATOM 6627  N N    . ILE A 1 57  ? 17.453  1.528   -0.575  1.00 0.00 ? 57  ILE A N    4  
ATOM 6628  C CA   . ILE A 1 57  ? 17.079  0.153   -0.293  1.00 0.00 ? 57  ILE A CA   4  
ATOM 6629  C C    . ILE A 1 57  ? 15.618  0.109   0.159   1.00 0.00 ? 57  ILE A C    4  
ATOM 6630  O O    . ILE A 1 57  ? 15.277  0.627   1.221   1.00 0.00 ? 57  ILE A O    4  
ATOM 6631  C CB   . ILE A 1 57  ? 18.051  -0.472  0.710   1.00 0.00 ? 57  ILE A CB   4  
ATOM 6632  C CG1  . ILE A 1 57  ? 19.314  -0.976  0.008   1.00 0.00 ? 57  ILE A CG1  4  
ATOM 6633  C CG2  . ILE A 1 57  ? 17.369  -1.573  1.523   1.00 0.00 ? 57  ILE A CG2  4  
ATOM 6634  C CD1  . ILE A 1 57  ? 19.777  0.012   -1.064  1.00 0.00 ? 57  ILE A CD1  4  
ATOM 6635  H H    . ILE A 1 57  ? 18.226  1.874   -0.044  1.00 0.00 ? 57  ILE A H    4  
ATOM 6636  H HA   . ILE A 1 57  ? 17.170  -0.408  -1.223  1.00 0.00 ? 57  ILE A HA   4  
ATOM 6637  H HB   . ILE A 1 57  ? 18.361  0.302   1.413   1.00 0.00 ? 57  ILE A HB   4  
ATOM 6638  H HG12 . ILE A 1 57  ? 20.108  -1.122  0.740   1.00 0.00 ? 57  ILE A HG12 4  
ATOM 6639  H HG13 . ILE A 1 57  ? 19.118  -1.947  -0.447  1.00 0.00 ? 57  ILE A HG13 4  
ATOM 6640  H HG21 . ILE A 1 57  ? 16.700  -2.141  0.876   1.00 0.00 ? 57  ILE A HG21 4  
ATOM 6641  H HG22 . ILE A 1 57  ? 18.124  -2.240  1.938   1.00 0.00 ? 57  ILE A HG22 4  
ATOM 6642  H HG23 . ILE A 1 57  ? 16.795  -1.124  2.334   1.00 0.00 ? 57  ILE A HG23 4  
ATOM 6643  H HD11 . ILE A 1 57  ? 19.951  0.987   -0.609  1.00 0.00 ? 57  ILE A HD11 4  
ATOM 6644  H HD12 . ILE A 1 57  ? 20.702  -0.348  -1.515  1.00 0.00 ? 57  ILE A HD12 4  
ATOM 6645  H HD13 . ILE A 1 57  ? 19.009  0.102   -1.832  1.00 0.00 ? 57  ILE A HD13 4  
ATOM 6646  N N    . ILE A 1 58  ? 14.794  -0.515  -0.671  1.00 0.00 ? 58  ILE A N    4  
ATOM 6647  C CA   . ILE A 1 58  ? 13.377  -0.633  -0.370  1.00 0.00 ? 58  ILE A CA   4  
ATOM 6648  C C    . ILE A 1 58  ? 13.203  -1.362  0.963   1.00 0.00 ? 58  ILE A C    4  
ATOM 6649  O O    . ILE A 1 58  ? 13.840  -2.387  1.203   1.00 0.00 ? 58  ILE A O    4  
ATOM 6650  C CB   . ILE A 1 58  ? 12.636  -1.294  -1.534  1.00 0.00 ? 58  ILE A CB   4  
ATOM 6651  C CG1  . ILE A 1 58  ? 12.892  -0.544  -2.843  1.00 0.00 ? 58  ILE A CG1  4  
ATOM 6652  C CG2  . ILE A 1 58  ? 11.142  -1.424  -1.230  1.00 0.00 ? 58  ILE A CG2  4  
ATOM 6653  C CD1  . ILE A 1 58  ? 12.397  0.901   -2.753  1.00 0.00 ? 58  ILE A CD1  4  
ATOM 6654  H H    . ILE A 1 58  ? 15.079  -0.933  -1.533  1.00 0.00 ? 58  ILE A H    4  
ATOM 6655  H HA   . ILE A 1 58  ? 12.980  0.377   -0.267  1.00 0.00 ? 58  ILE A HA   4  
ATOM 6656  H HB   . ILE A 1 58  ? 13.028  -2.303  -1.659  1.00 0.00 ? 58  ILE A HB   4  
ATOM 6657  H HG12 . ILE A 1 58  ? 13.958  -0.554  -3.070  1.00 0.00 ? 58  ILE A HG12 4  
ATOM 6658  H HG13 . ILE A 1 58  ? 12.387  -1.055  -3.663  1.00 0.00 ? 58  ILE A HG13 4  
ATOM 6659  H HG21 . ILE A 1 58  ? 10.878  -2.478  -1.150  1.00 0.00 ? 58  ILE A HG21 4  
ATOM 6660  H HG22 . ILE A 1 58  ? 10.918  -0.920  -0.289  1.00 0.00 ? 58  ILE A HG22 4  
ATOM 6661  H HG23 . ILE A 1 58  ? 10.567  -0.965  -2.034  1.00 0.00 ? 58  ILE A HG23 4  
ATOM 6662  H HD11 . ILE A 1 58  ? 11.949  1.191   -3.703  1.00 0.00 ? 58  ILE A HD11 4  
ATOM 6663  H HD12 . ILE A 1 58  ? 11.653  0.981   -1.961  1.00 0.00 ? 58  ILE A HD12 4  
ATOM 6664  H HD13 . ILE A 1 58  ? 13.237  1.559   -2.531  1.00 0.00 ? 58  ILE A HD13 4  
ATOM 6665  N N    . LEU A 1 59  ? 12.336  -0.805  1.797   1.00 0.00 ? 59  LEU A N    4  
ATOM 6666  C CA   . LEU A 1 59  ? 12.069  -1.390  3.100   1.00 0.00 ? 59  LEU A CA   4  
ATOM 6667  C C    . LEU A 1 59  ? 10.675  -2.021  3.096   1.00 0.00 ? 59  LEU A C    4  
ATOM 6668  O O    . LEU A 1 59  ? 10.392  -2.914  3.893   1.00 0.00 ? 59  LEU A O    4  
ATOM 6669  C CB   . LEU A 1 59  ? 12.270  -0.350  4.205   1.00 0.00 ? 59  LEU A CB   4  
ATOM 6670  C CG   . LEU A 1 59  ? 13.568  0.458   4.136   1.00 0.00 ? 59  LEU A CG   4  
ATOM 6671  C CD1  . LEU A 1 59  ? 13.619  1.507   5.249   1.00 0.00 ? 59  LEU A CD1  4  
ATOM 6672  C CD2  . LEU A 1 59  ? 14.789  -0.463  4.160   1.00 0.00 ? 59  LEU A CD2  4  
ATOM 6673  H H    . LEU A 1 59  ? 11.821  0.028   1.594   1.00 0.00 ? 59  LEU A H    4  
ATOM 6674  H HA   . LEU A 1 59  ? 12.805  -2.178  3.261   1.00 0.00 ? 59  LEU A HA   4  
ATOM 6675  H HB2  . LEU A 1 59  ? 11.431  0.344   4.180   1.00 0.00 ? 59  LEU A HB2  4  
ATOM 6676  H HB3  . LEU A 1 59  ? 12.234  -0.861  5.167   1.00 0.00 ? 59  LEU A HB3  4  
ATOM 6677  H HG   . LEU A 1 59  ? 13.587  0.994   3.187   1.00 0.00 ? 59  LEU A HG   4  
ATOM 6678  H HD11 . LEU A 1 59  ? 14.363  2.264   5.001   1.00 0.00 ? 59  LEU A HD11 4  
ATOM 6679  H HD12 . LEU A 1 59  ? 12.641  1.978   5.350   1.00 0.00 ? 59  LEU A HD12 4  
ATOM 6680  H HD13 . LEU A 1 59  ? 13.889  1.026   6.189   1.00 0.00 ? 59  LEU A HD13 4  
ATOM 6681  H HD21 . LEU A 1 59  ? 15.675  0.115   4.424   1.00 0.00 ? 59  LEU A HD21 4  
ATOM 6682  H HD22 . LEU A 1 59  ? 14.637  -1.251  4.898   1.00 0.00 ? 59  LEU A HD22 4  
ATOM 6683  H HD23 . LEU A 1 59  ? 14.927  -0.909  3.175   1.00 0.00 ? 59  LEU A HD23 4  
ATOM 6684  N N    . ALA A 1 60  ? 9.842   -1.531  2.189   1.00 0.00 ? 60  ALA A N    4  
ATOM 6685  C CA   . ALA A 1 60  ? 8.485   -2.036  2.071   1.00 0.00 ? 60  ALA A CA   4  
ATOM 6686  C C    . ALA A 1 60  ? 7.722   -1.200  1.041   1.00 0.00 ? 60  ALA A C    4  
ATOM 6687  O O    . ALA A 1 60  ? 8.312   -0.370  0.350   1.00 0.00 ? 60  ALA A O    4  
ATOM 6688  C CB   . ALA A 1 60  ? 7.813   -2.022  3.445   1.00 0.00 ? 60  ALA A CB   4  
ATOM 6689  H H    . ALA A 1 60  ? 10.080  -0.805  1.545   1.00 0.00 ? 60  ALA A H    4  
ATOM 6690  H HA   . ALA A 1 60  ? 8.543   -3.066  1.719   1.00 0.00 ? 60  ALA A HA   4  
ATOM 6691  H HB1  . ALA A 1 60  ? 6.838   -1.539  3.369   1.00 0.00 ? 60  ALA A HB1  4  
ATOM 6692  H HB2  . ALA A 1 60  ? 7.684   -3.045  3.797   1.00 0.00 ? 60  ALA A HB2  4  
ATOM 6693  H HB3  . ALA A 1 60  ? 8.437   -1.471  4.149   1.00 0.00 ? 60  ALA A HB3  4  
ATOM 6694  N N    . TYR A 1 61  ? 6.423   -1.448  0.969   1.00 0.00 ? 61  TYR A N    4  
ATOM 6695  C CA   . TYR A 1 61  ? 5.574   -0.729  0.035   1.00 0.00 ? 61  TYR A CA   4  
ATOM 6696  C C    . TYR A 1 61  ? 4.206   -0.431  0.653   1.00 0.00 ? 61  TYR A C    4  
ATOM 6697  O O    . TYR A 1 61  ? 3.909   -0.885  1.757   1.00 0.00 ? 61  TYR A O    4  
ATOM 6698  C CB   . TYR A 1 61  ? 5.386   -1.658  -1.166  1.00 0.00 ? 61  TYR A CB   4  
ATOM 6699  C CG   . TYR A 1 61  ? 6.517   -1.585  -2.193  1.00 0.00 ? 61  TYR A CG   4  
ATOM 6700  C CD1  . TYR A 1 61  ? 7.705   -2.250  -1.960  1.00 0.00 ? 61  TYR A CD1  4  
ATOM 6701  C CD2  . TYR A 1 61  ? 6.351   -0.855  -3.352  1.00 0.00 ? 61  TYR A CD2  4  
ATOM 6702  C CE1  . TYR A 1 61  ? 8.770   -2.181  -2.926  1.00 0.00 ? 61  TYR A CE1  4  
ATOM 6703  C CE2  . TYR A 1 61  ? 7.416   -0.786  -4.319  1.00 0.00 ? 61  TYR A CE2  4  
ATOM 6704  C CZ   . TYR A 1 61  ? 8.573   -1.453  -4.058  1.00 0.00 ? 61  TYR A CZ   4  
ATOM 6705  O OH   . TYR A 1 61  ? 9.579   -1.388  -4.971  1.00 0.00 ? 61  TYR A OH   4  
ATOM 6706  H H    . TYR A 1 61  ? 5.951   -2.125  1.534   1.00 0.00 ? 61  TYR A H    4  
ATOM 6707  H HA   . TYR A 1 61  ? 6.066   0.212   -0.211  1.00 0.00 ? 61  TYR A HA   4  
ATOM 6708  H HB2  . TYR A 1 61  ? 5.299   -2.684  -0.808  1.00 0.00 ? 61  TYR A HB2  4  
ATOM 6709  H HB3  . TYR A 1 61  ? 4.445   -1.413  -1.659  1.00 0.00 ? 61  TYR A HB3  4  
ATOM 6710  H HD1  . TYR A 1 61  ? 7.836   -2.827  -1.044  1.00 0.00 ? 61  TYR A HD1  4  
ATOM 6711  H HD2  . TYR A 1 61  ? 5.414   -0.330  -3.536  1.00 0.00 ? 61  TYR A HD2  4  
ATOM 6712  H HE1  . TYR A 1 61  ? 9.712   -2.701  -2.755  1.00 0.00 ? 61  TYR A HE1  4  
ATOM 6713  H HE2  . TYR A 1 61  ? 7.299   -0.213  -5.238  1.00 0.00 ? 61  TYR A HE2  4  
ATOM 6714  H HH   . TYR A 1 61  ? 10.199  -2.164  -4.853  1.00 0.00 ? 61  TYR A HH   4  
ATOM 6715  N N    . GLN A 1 62  ? 3.411   0.329   -0.085  1.00 0.00 ? 62  GLN A N    4  
ATOM 6716  C CA   . GLN A 1 62  ? 2.083   0.693   0.378   1.00 0.00 ? 62  GLN A CA   4  
ATOM 6717  C C    . GLN A 1 62  ? 1.078   0.605   -0.773  1.00 0.00 ? 62  GLN A C    4  
ATOM 6718  O O    . GLN A 1 62  ? 1.343   1.089   -1.872  1.00 0.00 ? 62  GLN A O    4  
ATOM 6719  C CB   . GLN A 1 62  ? 2.082   2.090   1.001   1.00 0.00 ? 62  GLN A CB   4  
ATOM 6720  C CG   . GLN A 1 62  ? 0.723   2.412   1.625   1.00 0.00 ? 62  GLN A CG   4  
ATOM 6721  C CD   . GLN A 1 62  ? 0.827   3.601   2.582   1.00 0.00 ? 62  GLN A CD   4  
ATOM 6722  O OE1  . GLN A 1 62  ? 1.164   3.466   3.747   1.00 0.00 ? 62  GLN A OE1  4  
ATOM 6723  N NE2  . GLN A 1 62  ? 0.518   4.770   2.028   1.00 0.00 ? 62  GLN A NE2  4  
ATOM 6724  H H    . GLN A 1 62  ? 3.661   0.695   -0.981  1.00 0.00 ? 62  GLN A H    4  
ATOM 6725  H HA   . GLN A 1 62  ? 1.832   -0.040  1.145   1.00 0.00 ? 62  GLN A HA   4  
ATOM 6726  H HB2  . GLN A 1 62  ? 2.860   2.154   1.762   1.00 0.00 ? 62  GLN A HB2  4  
ATOM 6727  H HB3  . GLN A 1 62  ? 2.321   2.832   0.238   1.00 0.00 ? 62  GLN A HB3  4  
ATOM 6728  H HG2  . GLN A 1 62  ? 0.001   2.635   0.839   1.00 0.00 ? 62  GLN A HG2  4  
ATOM 6729  H HG3  . GLN A 1 62  ? 0.350   1.540   2.162   1.00 0.00 ? 62  GLN A HG3  4  
ATOM 6730  H HE21 . GLN A 1 62  ? 0.249   4.812   1.066   1.00 0.00 ? 62  GLN A HE21 4  
ATOM 6731  H HE22 . GLN A 1 62  ? 0.556   5.607   2.573   1.00 0.00 ? 62  GLN A HE22 4  
ATOM 6732  N N    . ILE A 1 63  ? -0.055  -0.017  -0.480  1.00 0.00 ? 63  ILE A N    4  
ATOM 6733  C CA   . ILE A 1 63  ? -1.101  -0.174  -1.477  1.00 0.00 ? 63  ILE A CA   4  
ATOM 6734  C C    . ILE A 1 63  ? -2.405  0.419   -0.939  1.00 0.00 ? 63  ILE A C    4  
ATOM 6735  O O    . ILE A 1 63  ? -3.043  -0.166  -0.065  1.00 0.00 ? 63  ILE A O    4  
ATOM 6736  C CB   . ILE A 1 63  ? -1.220  -1.639  -1.901  1.00 0.00 ? 63  ILE A CB   4  
ATOM 6737  C CG1  . ILE A 1 63  ? -0.695  -1.843  -3.323  1.00 0.00 ? 63  ILE A CG1  4  
ATOM 6738  C CG2  . ILE A 1 63  ? -2.657  -2.140  -1.743  1.00 0.00 ? 63  ILE A CG2  4  
ATOM 6739  C CD1  . ILE A 1 63  ? 0.149   -3.115  -3.419  1.00 0.00 ? 63  ILE A CD1  4  
ATOM 6740  H H    . ILE A 1 63  ? -0.263  -0.408  0.416   1.00 0.00 ? 63  ILE A H    4  
ATOM 6741  H HA   . ILE A 1 63  ? -0.801  0.393   -2.358  1.00 0.00 ? 63  ILE A HA   4  
ATOM 6742  H HB   . ILE A 1 63  ? -0.596  -2.239  -1.238  1.00 0.00 ? 63  ILE A HB   4  
ATOM 6743  H HG12 . ILE A 1 63  ? -1.532  -1.904  -4.019  1.00 0.00 ? 63  ILE A HG12 4  
ATOM 6744  H HG13 . ILE A 1 63  ? -0.096  -0.982  -3.620  1.00 0.00 ? 63  ILE A HG13 4  
ATOM 6745  H HG21 . ILE A 1 63  ? -3.346  -1.407  -2.163  1.00 0.00 ? 63  ILE A HG21 4  
ATOM 6746  H HG22 . ILE A 1 63  ? -2.771  -3.088  -2.269  1.00 0.00 ? 63  ILE A HG22 4  
ATOM 6747  H HG23 . ILE A 1 63  ? -2.879  -2.283  -0.686  1.00 0.00 ? 63  ILE A HG23 4  
ATOM 6748  H HD11 . ILE A 1 63  ? 0.260   -3.400  -4.466  1.00 0.00 ? 63  ILE A HD11 4  
ATOM 6749  H HD12 . ILE A 1 63  ? 1.133   -2.932  -2.986  1.00 0.00 ? 63  ILE A HD12 4  
ATOM 6750  H HD13 . ILE A 1 63  ? -0.344  -3.920  -2.874  1.00 0.00 ? 63  ILE A HD13 4  
ATOM 6751  N N    . THR A 1 64  ? -2.762  1.572   -1.484  1.00 0.00 ? 64  THR A N    4  
ATOM 6752  C CA   . THR A 1 64  ? -3.978  2.251   -1.070  1.00 0.00 ? 64  THR A CA   4  
ATOM 6753  C C    . THR A 1 64  ? -5.087  2.033   -2.101  1.00 0.00 ? 64  THR A C    4  
ATOM 6754  O O    . THR A 1 64  ? -4.935  2.394   -3.267  1.00 0.00 ? 64  THR A O    4  
ATOM 6755  C CB   . THR A 1 64  ? -3.642  3.726   -0.841  1.00 0.00 ? 64  THR A CB   4  
ATOM 6756  O OG1  . THR A 1 64  ? -3.600  4.280   -2.153  1.00 0.00 ? 64  THR A OG1  4  
ATOM 6757  C CG2  . THR A 1 64  ? -2.223  3.927   -0.306  1.00 0.00 ? 64  THR A CG2  4  
ATOM 6758  H H    . THR A 1 64  ? -2.237  2.042   -2.194  1.00 0.00 ? 64  THR A H    4  
ATOM 6759  H HA   . THR A 1 64  ? -4.319  1.806   -0.135  1.00 0.00 ? 64  THR A HA   4  
ATOM 6760  H HB   . THR A 1 64  ? -4.376  4.195   -0.185  1.00 0.00 ? 64  THR A HB   4  
ATOM 6761  H HG1  . THR A 1 64  ? -4.147  5.117   -2.188  1.00 0.00 ? 64  THR A HG1  4  
ATOM 6762  H HG21 . THR A 1 64  ? -2.040  4.990   -0.151  1.00 0.00 ? 64  THR A HG21 4  
ATOM 6763  H HG22 . THR A 1 64  ? -2.114  3.398   0.641   1.00 0.00 ? 64  THR A HG22 4  
ATOM 6764  H HG23 . THR A 1 64  ? -1.505  3.535   -1.026  1.00 0.00 ? 64  THR A HG23 4  
ATOM 6765  N N    . HIS A 1 65  ? -6.179  1.445   -1.634  1.00 0.00 ? 65  HIS A N    4  
ATOM 6766  C CA   . HIS A 1 65  ? -7.313  1.175   -2.501  1.00 0.00 ? 65  HIS A CA   4  
ATOM 6767  C C    . HIS A 1 65  ? -8.567  1.838   -1.927  1.00 0.00 ? 65  HIS A C    4  
ATOM 6768  O O    . HIS A 1 65  ? -8.811  1.776   -0.723  1.00 0.00 ? 65  HIS A O    4  
ATOM 6769  C CB   . HIS A 1 65  ? -7.485  -0.330  -2.718  1.00 0.00 ? 65  HIS A CB   4  
ATOM 6770  C CG   . HIS A 1 65  ? -8.068  -1.059  -1.531  1.00 0.00 ? 65  HIS A CG   4  
ATOM 6771  N ND1  . HIS A 1 65  ? -8.712  -2.278  -1.643  1.00 0.00 ? 65  HIS A ND1  4  
ATOM 6772  C CD2  . HIS A 1 65  ? -8.096  -0.728  -0.208  1.00 0.00 ? 65  HIS A CD2  4  
ATOM 6773  C CE1  . HIS A 1 65  ? -9.107  -2.655  -0.436  1.00 0.00 ? 65  HIS A CE1  4  
ATOM 6774  N NE2  . HIS A 1 65  ? -8.724  -1.693  0.452   1.00 0.00 ? 65  HIS A NE2  4  
ATOM 6775  H H    . HIS A 1 65  ? -6.294  1.155   -0.684  1.00 0.00 ? 65  HIS A H    4  
ATOM 6776  H HA   . HIS A 1 65  ? -7.083  1.626   -3.466  1.00 0.00 ? 65  HIS A HA   4  
ATOM 6777  H HB2  . HIS A 1 65  ? -8.129  -0.490  -3.582  1.00 0.00 ? 65  HIS A HB2  4  
ATOM 6778  H HB3  . HIS A 1 65  ? -6.515  -0.765  -2.959  1.00 0.00 ? 65  HIS A HB3  4  
ATOM 6779  H HD1  . HIS A 1 65  ? -8.856  -2.789  -2.491  1.00 0.00 ? 65  HIS A HD1  4  
ATOM 6780  H HD2  . HIS A 1 65  ? -7.673  0.175   0.232   1.00 0.00 ? 65  HIS A HD2  4  
ATOM 6781  H HE1  . HIS A 1 65  ? -9.643  -3.573  -0.195  1.00 0.00 ? 65  HIS A HE1  4  
ATOM 6782  N N    . ARG A 1 66  ? -9.328  2.459   -2.816  1.00 0.00 ? 66  ARG A N    4  
ATOM 6783  C CA   . ARG A 1 66  ? -10.551 3.133   -2.413  1.00 0.00 ? 66  ARG A CA   4  
ATOM 6784  C C    . ARG A 1 66  ? -11.451 3.370   -3.628  1.00 0.00 ? 66  ARG A C    4  
ATOM 6785  O O    . ARG A 1 66  ? -10.963 3.639   -4.724  1.00 0.00 ? 66  ARG A O    4  
ATOM 6786  C CB   . ARG A 1 66  ? -10.245 4.475   -1.745  1.00 0.00 ? 66  ARG A CB   4  
ATOM 6787  C CG   . ARG A 1 66  ? -9.560  5.432   -2.724  1.00 0.00 ? 66  ARG A CG   4  
ATOM 6788  C CD   . ARG A 1 66  ? -8.582  6.355   -1.994  1.00 0.00 ? 66  ARG A CD   4  
ATOM 6789  N NE   . ARG A 1 66  ? -7.661  6.986   -2.966  1.00 0.00 ? 66  ARG A NE   4  
ATOM 6790  C CZ   . ARG A 1 66  ? -6.741  7.905   -2.642  1.00 0.00 ? 66  ARG A CZ   4  
ATOM 6791  N NH1  . ARG A 1 66  ? -6.614  8.306   -1.370  1.00 0.00 ? 66  ARG A NH1  4  
ATOM 6792  N NH2  . ARG A 1 66  ? -5.948  8.422   -3.590  1.00 0.00 ? 66  ARG A NH2  4  
ATOM 6793  H H    . ARG A 1 66  ? -9.122  2.506   -3.794  1.00 0.00 ? 66  ARG A H    4  
ATOM 6794  H HA   . ARG A 1 66  ? -11.022 2.455   -1.702  1.00 0.00 ? 66  ARG A HA   4  
ATOM 6795  H HB2  . ARG A 1 66  ? -11.169 4.923   -1.380  1.00 0.00 ? 66  ARG A HB2  4  
ATOM 6796  H HB3  . ARG A 1 66  ? -9.604  4.316   -0.878  1.00 0.00 ? 66  ARG A HB3  4  
ATOM 6797  H HG2  . ARG A 1 66  ? -9.028  4.860   -3.484  1.00 0.00 ? 66  ARG A HG2  4  
ATOM 6798  H HG3  . ARG A 1 66  ? -10.312 6.028   -3.241  1.00 0.00 ? 66  ARG A HG3  4  
ATOM 6799  H HD2  . ARG A 1 66  ? -9.132  7.123   -1.450  1.00 0.00 ? 66  ARG A HD2  4  
ATOM 6800  H HD3  . ARG A 1 66  ? -8.014  5.788   -1.258  1.00 0.00 ? 66  ARG A HD3  4  
ATOM 6801  H HE   . ARG A 1 66  ? -7.730  6.709   -3.925  1.00 0.00 ? 66  ARG A HE   4  
ATOM 6802  H HH11 . ARG A 1 66  ? -7.206  7.919   -0.662  1.00 0.00 ? 66  ARG A HH11 4  
ATOM 6803  H HH12 . ARG A 1 66  ? -5.928  8.992   -1.128  1.00 0.00 ? 66  ARG A HH12 4  
ATOM 6804  H HH21 . ARG A 1 66  ? -6.043  8.123   -4.540  1.00 0.00 ? 66  ARG A HH21 4  
ATOM 6805  H HH22 . ARG A 1 66  ? -5.262  9.108   -3.348  1.00 0.00 ? 66  ARG A HH22 4  
ATOM 6806  N N    . LEU A 1 67  ? -12.750 3.260   -3.391  1.00 0.00 ? 67  LEU A N    4  
ATOM 6807  C CA   . LEU A 1 67  ? -13.724 3.458   -4.451  1.00 0.00 ? 67  LEU A CA   4  
ATOM 6808  C C    . LEU A 1 67  ? -13.568 4.868   -5.024  1.00 0.00 ? 67  LEU A C    4  
ATOM 6809  O O    . LEU A 1 67  ? -13.820 5.854   -4.333  1.00 0.00 ? 67  LEU A O    4  
ATOM 6810  C CB   . LEU A 1 67  ? -15.135 3.152   -3.947  1.00 0.00 ? 67  LEU A CB   4  
ATOM 6811  C CG   . LEU A 1 67  ? -15.568 1.686   -4.015  1.00 0.00 ? 67  LEU A CG   4  
ATOM 6812  C CD1  . LEU A 1 67  ? -17.064 1.542   -3.725  1.00 0.00 ? 67  LEU A CD1  4  
ATOM 6813  C CD2  . LEU A 1 67  ? -15.182 1.061   -5.357  1.00 0.00 ? 67  LEU A CD2  4  
ATOM 6814  H H    . LEU A 1 67  ? -13.139 3.041   -2.496  1.00 0.00 ? 67  LEU A H    4  
ATOM 6815  H HA   . LEU A 1 67  ? -13.500 2.739   -5.239  1.00 0.00 ? 67  LEU A HA   4  
ATOM 6816  H HB2  . LEU A 1 67  ? -15.210 3.485   -2.912  1.00 0.00 ? 67  LEU A HB2  4  
ATOM 6817  H HB3  . LEU A 1 67  ? -15.843 3.746   -4.525  1.00 0.00 ? 67  LEU A HB3  4  
ATOM 6818  H HG   . LEU A 1 67  ? -15.036 1.137   -3.238  1.00 0.00 ? 67  LEU A HG   4  
ATOM 6819  H HD11 . LEU A 1 67  ? -17.631 2.147   -4.433  1.00 0.00 ? 67  LEU A HD11 4  
ATOM 6820  H HD12 . LEU A 1 67  ? -17.354 0.497   -3.825  1.00 0.00 ? 67  LEU A HD12 4  
ATOM 6821  H HD13 . LEU A 1 67  ? -17.272 1.881   -2.710  1.00 0.00 ? 67  LEU A HD13 4  
ATOM 6822  H HD21 . LEU A 1 67  ? -15.340 1.787   -6.154  1.00 0.00 ? 67  LEU A HD21 4  
ATOM 6823  H HD22 . LEU A 1 67  ? -14.131 0.771   -5.333  1.00 0.00 ? 67  LEU A HD22 4  
ATOM 6824  H HD23 . LEU A 1 67  ? -15.798 0.181   -5.539  1.00 0.00 ? 67  LEU A HD23 4  
ATOM 6825  N N    . ASN A 1 68  ? -13.153 4.920   -6.281  1.00 0.00 ? 68  ASN A N    4  
ATOM 6826  C CA   . ASN A 1 68  ? -12.960 6.193   -6.954  1.00 0.00 ? 68  ASN A CA   4  
ATOM 6827  C C    . ASN A 1 68  ? -14.079 7.154   -6.549  1.00 0.00 ? 68  ASN A C    4  
ATOM 6828  O O    . ASN A 1 68  ? -13.874 8.366   -6.499  1.00 0.00 ? 68  ASN A O    4  
ATOM 6829  C CB   . ASN A 1 68  ? -13.009 6.025   -8.474  1.00 0.00 ? 68  ASN A CB   4  
ATOM 6830  C CG   . ASN A 1 68  ? -12.494 7.280   -9.181  1.00 0.00 ? 68  ASN A CG   4  
ATOM 6831  O OD1  . ASN A 1 68  ? -12.396 8.352   -8.607  1.00 0.00 ? 68  ASN A OD1  4  
ATOM 6832  N ND2  . ASN A 1 68  ? -12.172 7.089   -10.457 1.00 0.00 ? 68  ASN A ND2  4  
ATOM 6833  H H    . ASN A 1 68  ? -12.950 4.113   -6.836  1.00 0.00 ? 68  ASN A H    4  
ATOM 6834  H HA   . ASN A 1 68  ? -11.977 6.539   -6.636  1.00 0.00 ? 68  ASN A HA   4  
ATOM 6835  H HB2  . ASN A 1 68  ? -12.408 5.165   -8.769  1.00 0.00 ? 68  ASN A HB2  4  
ATOM 6836  H HB3  . ASN A 1 68  ? -14.033 5.820   -8.788  1.00 0.00 ? 68  ASN A HB3  4  
ATOM 6837  H HD21 . ASN A 1 68  ? -12.276 6.183   -10.869 1.00 0.00 ? 68  ASN A HD21 4  
ATOM 6838  H HD22 . ASN A 1 68  ? -11.825 7.850   -11.005 1.00 0.00 ? 68  ASN A HD22 4  
ATOM 6839  N N    . THR A 1 69  ? -15.239 6.577   -6.268  1.00 0.00 ? 69  THR A N    4  
ATOM 6840  C CA   . THR A 1 69  ? -16.390 7.367   -5.868  1.00 0.00 ? 69  THR A CA   4  
ATOM 6841  C C    . THR A 1 69  ? -17.077 6.734   -4.657  1.00 0.00 ? 69  THR A C    4  
ATOM 6842  O O    . THR A 1 69  ? -17.710 5.686   -4.775  1.00 0.00 ? 69  THR A O    4  
ATOM 6843  C CB   . THR A 1 69  ? -17.311 7.510   -7.082  1.00 0.00 ? 69  THR A CB   4  
ATOM 6844  O OG1  . THR A 1 69  ? -17.895 6.219   -7.228  1.00 0.00 ? 69  THR A OG1  4  
ATOM 6845  C CG2  . THR A 1 69  ? -16.534 7.717   -8.384  1.00 0.00 ? 69  THR A CG2  4  
ATOM 6846  H H    . THR A 1 69  ? -15.397 5.591   -6.311  1.00 0.00 ? 69  THR A H    4  
ATOM 6847  H HA   . THR A 1 69  ? -16.041 8.352   -5.559  1.00 0.00 ? 69  THR A HA   4  
ATOM 6848  H HB   . THR A 1 69  ? -18.035 8.310   -6.930  1.00 0.00 ? 69  THR A HB   4  
ATOM 6849  H HG1  . THR A 1 69  ? -18.598 6.240   -7.940  1.00 0.00 ? 69  THR A HG1  4  
ATOM 6850  H HG21 . THR A 1 69  ? -15.727 6.987   -8.446  1.00 0.00 ? 69  THR A HG21 4  
ATOM 6851  H HG22 . THR A 1 69  ? -17.207 7.587   -9.233  1.00 0.00 ? 69  THR A HG22 4  
ATOM 6852  H HG23 . THR A 1 69  ? -16.116 8.723   -8.402  1.00 0.00 ? 69  THR A HG23 4  
ATOM 6853  N N    . THR A 1 70  ? -16.928 7.397   -3.519  1.00 0.00 ? 70  THR A N    4  
ATOM 6854  C CA   . THR A 1 70  ? -17.526 6.912   -2.287  1.00 0.00 ? 70  THR A CA   4  
ATOM 6855  C C    . THR A 1 70  ? -17.517 8.010   -1.222  1.00 0.00 ? 70  THR A C    4  
ATOM 6856  O O    . THR A 1 70  ? -17.189 9.160   -1.512  1.00 0.00 ? 70  THR A O    4  
ATOM 6857  C CB   . THR A 1 70  ? -16.775 5.648   -1.862  1.00 0.00 ? 70  THR A CB   4  
ATOM 6858  O OG1  . THR A 1 70  ? -15.627 5.627   -2.706  1.00 0.00 ? 70  THR A OG1  4  
ATOM 6859  C CG2  . THR A 1 70  ? -17.530 4.368   -2.228  1.00 0.00 ? 70  THR A CG2  4  
ATOM 6860  H H    . THR A 1 70  ? -16.411 8.249   -3.432  1.00 0.00 ? 70  THR A H    4  
ATOM 6861  H HA   . THR A 1 70  ? -18.569 6.666   -2.484  1.00 0.00 ? 70  THR A HA   4  
ATOM 6862  H HB   . THR A 1 70  ? -16.542 5.673   -0.798  1.00 0.00 ? 70  THR A HB   4  
ATOM 6863  H HG1  . THR A 1 70  ? -14.853 6.058   -2.241  1.00 0.00 ? 70  THR A HG1  4  
ATOM 6864  H HG21 . THR A 1 70  ? -17.346 4.124   -3.274  1.00 0.00 ? 70  THR A HG21 4  
ATOM 6865  H HG22 . THR A 1 70  ? -17.183 3.550   -1.597  1.00 0.00 ? 70  THR A HG22 4  
ATOM 6866  H HG23 . THR A 1 70  ? -18.598 4.519   -2.072  1.00 0.00 ? 70  THR A HG23 4  
ATOM 6867  N N    . THR A 1 71  ? -17.882 7.618   -0.010  1.00 0.00 ? 71  THR A N    4  
ATOM 6868  C CA   . THR A 1 71  ? -17.921 8.555   1.100   1.00 0.00 ? 71  THR A CA   4  
ATOM 6869  C C    . THR A 1 71  ? -17.577 7.844   2.410   1.00 0.00 ? 71  THR A C    4  
ATOM 6870  O O    . THR A 1 71  ? -18.424 7.170   2.996   1.00 0.00 ? 71  THR A O    4  
ATOM 6871  C CB   . THR A 1 71  ? -19.300 9.217   1.112   1.00 0.00 ? 71  THR A CB   4  
ATOM 6872  O OG1  . THR A 1 71  ? -20.211 8.123   1.063   1.00 0.00 ? 71  THR A OG1  4  
ATOM 6873  C CG2  . THR A 1 71  ? -19.585 9.998   -0.173  1.00 0.00 ? 71  THR A CG2  4  
ATOM 6874  H H    . THR A 1 71  ? -18.148 6.681   0.218   1.00 0.00 ? 71  THR A H    4  
ATOM 6875  H HA   . THR A 1 71  ? -17.154 9.312   0.937   1.00 0.00 ? 71  THR A HA   4  
ATOM 6876  H HB   . THR A 1 71  ? -19.418 9.854   1.989   1.00 0.00 ? 71  THR A HB   4  
ATOM 6877  H HG1  . THR A 1 71  ? -20.049 7.508   1.834   1.00 0.00 ? 71  THR A HG1  4  
ATOM 6878  H HG21 . THR A 1 71  ? -19.504 9.330   -1.030  1.00 0.00 ? 71  THR A HG21 4  
ATOM 6879  H HG22 . THR A 1 71  ? -20.592 10.413  -0.129  1.00 0.00 ? 71  THR A HG22 4  
ATOM 6880  H HG23 . THR A 1 71  ? -18.863 10.808  -0.274  1.00 0.00 ? 71  THR A HG23 4  
ATOM 6881  N N    . ALA A 1 72  ? -16.333 8.017   2.832   1.00 0.00 ? 72  ALA A N    4  
ATOM 6882  C CA   . ALA A 1 72  ? -15.867 7.401   4.062   1.00 0.00 ? 72  ALA A CA   4  
ATOM 6883  C C    . ALA A 1 72  ? -14.898 8.351   4.769   1.00 0.00 ? 72  ALA A C    4  
ATOM 6884  O O    . ALA A 1 72  ? -14.702 9.483   4.330   1.00 0.00 ? 72  ALA A O    4  
ATOM 6885  C CB   . ALA A 1 72  ? -15.228 6.047   3.745   1.00 0.00 ? 72  ALA A CB   4  
ATOM 6886  H H    . ALA A 1 72  ? -15.651 8.566   2.350   1.00 0.00 ? 72  ALA A H    4  
ATOM 6887  H HA   . ALA A 1 72  ? -16.735 7.238   4.702   1.00 0.00 ? 72  ALA A HA   4  
ATOM 6888  H HB1  . ALA A 1 72  ? -15.749 5.262   4.293   1.00 0.00 ? 72  ALA A HB1  4  
ATOM 6889  H HB2  . ALA A 1 72  ? -15.301 5.853   2.675   1.00 0.00 ? 72  ALA A HB2  4  
ATOM 6890  H HB3  . ALA A 1 72  ? -14.179 6.062   4.041   1.00 0.00 ? 72  ALA A HB3  4  
ATOM 6891  N N    . ASN A 1 73  ? -14.318 7.856   5.853   1.00 0.00 ? 73  ASN A N    4  
ATOM 6892  C CA   . ASN A 1 73  ? -13.375 8.647   6.625   1.00 0.00 ? 73  ASN A CA   4  
ATOM 6893  C C    . ASN A 1 73  ? -12.025 8.667   5.905   1.00 0.00 ? 73  ASN A C    4  
ATOM 6894  O O    . ASN A 1 73  ? -11.400 9.720   5.780   1.00 0.00 ? 73  ASN A O    4  
ATOM 6895  C CB   . ASN A 1 73  ? -13.161 8.046   8.015   1.00 0.00 ? 73  ASN A CB   4  
ATOM 6896  C CG   . ASN A 1 73  ? -13.016 9.144   9.071   1.00 0.00 ? 73  ASN A CG   4  
ATOM 6897  O OD1  . ASN A 1 73  ? -13.985 9.692   9.571   1.00 0.00 ? 73  ASN A OD1  4  
ATOM 6898  N ND2  . ASN A 1 73  ? -11.756 9.434   9.380   1.00 0.00 ? 73  ASN A ND2  4  
ATOM 6899  H H    . ASN A 1 73  ? -14.484 6.934   6.203   1.00 0.00 ? 73  ASN A H    4  
ATOM 6900  H HA   . ASN A 1 73  ? -13.824 9.637   6.697   1.00 0.00 ? 73  ASN A HA   4  
ATOM 6901  H HB2  . ASN A 1 73  ? -14.001 7.400   8.270   1.00 0.00 ? 73  ASN A HB2  4  
ATOM 6902  H HB3  . ASN A 1 73  ? -12.268 7.420   8.011   1.00 0.00 ? 73  ASN A HB3  4  
ATOM 6903  H HD21 . ASN A 1 73  ? -11.006 8.946   8.932   1.00 0.00 ? 73  ASN A HD21 4  
ATOM 6904  H HD22 . ASN A 1 73  ? -11.557 10.139  10.061  1.00 0.00 ? 73  ASN A HD22 4  
ATOM 6905  N N    . THR A 1 74  ? -11.614 7.492   5.451   1.00 0.00 ? 74  THR A N    4  
ATOM 6906  C CA   . THR A 1 74  ? -10.350 7.363   4.747   1.00 0.00 ? 74  THR A CA   4  
ATOM 6907  C C    . THR A 1 74  ? -10.268 6.007   4.042   1.00 0.00 ? 74  THR A C    4  
ATOM 6908  O O    . THR A 1 74  ? -11.100 5.131   4.276   1.00 0.00 ? 74  THR A O    4  
ATOM 6909  C CB   . THR A 1 74  ? -9.222  7.592   5.756   1.00 0.00 ? 74  THR A CB   4  
ATOM 6910  O OG1  . THR A 1 74  ? -8.563  8.762   5.280   1.00 0.00 ? 74  THR A OG1  4  
ATOM 6911  C CG2  . THR A 1 74  ? -8.147  6.505   5.689   1.00 0.00 ? 74  THR A CG2  4  
ATOM 6912  H H    . THR A 1 74  ? -12.128 6.641   5.557   1.00 0.00 ? 74  THR A H    4  
ATOM 6913  H HA   . THR A 1 74  ? -10.307 8.129   3.973   1.00 0.00 ? 74  THR A HA   4  
ATOM 6914  H HB   . THR A 1 74  ? -9.617  7.686   6.767   1.00 0.00 ? 74  THR A HB   4  
ATOM 6915  H HG1  . THR A 1 74  ? -9.225  9.500   5.155   1.00 0.00 ? 74  THR A HG1  4  
ATOM 6916  H HG21 . THR A 1 74  ? -7.446  6.636   6.513   1.00 0.00 ? 74  THR A HG21 4  
ATOM 6917  H HG22 . THR A 1 74  ? -8.616  5.524   5.764   1.00 0.00 ? 74  THR A HG22 4  
ATOM 6918  H HG23 . THR A 1 74  ? -7.613  6.581   4.741   1.00 0.00 ? 74  THR A HG23 4  
ATOM 6919  N N    . ALA A 1 75  ? -9.259  5.877   3.194   1.00 0.00 ? 75  ALA A N    4  
ATOM 6920  C CA   . ALA A 1 75  ? -9.058  4.643   2.454   1.00 0.00 ? 75  ALA A CA   4  
ATOM 6921  C C    . ALA A 1 75  ? -8.235  3.672   3.302   1.00 0.00 ? 75  ALA A C    4  
ATOM 6922  O O    . ALA A 1 75  ? -7.494  4.092   4.189   1.00 0.00 ? 75  ALA A O    4  
ATOM 6923  C CB   . ALA A 1 75  ? -8.391  4.955   1.113   1.00 0.00 ? 75  ALA A CB   4  
ATOM 6924  H H    . ALA A 1 75  ? -8.587  6.594   3.010   1.00 0.00 ? 75  ALA A H    4  
ATOM 6925  H HA   . ALA A 1 75  ? -10.039 4.206   2.264   1.00 0.00 ? 75  ALA A HA   4  
ATOM 6926  H HB1  . ALA A 1 75  ? -9.035  5.614   0.531   1.00 0.00 ? 75  ALA A HB1  4  
ATOM 6927  H HB2  . ALA A 1 75  ? -7.434  5.446   1.289   1.00 0.00 ? 75  ALA A HB2  4  
ATOM 6928  H HB3  . ALA A 1 75  ? -8.228  4.028   0.563   1.00 0.00 ? 75  ALA A HB3  4  
ATOM 6929  N N    . THR A 1 76  ? -8.394  2.392   3.001   1.00 0.00 ? 76  THR A N    4  
ATOM 6930  C CA   . THR A 1 76  ? -7.675  1.357   3.725   1.00 0.00 ? 76  THR A CA   4  
ATOM 6931  C C    . THR A 1 76  ? -6.255  1.209   3.174   1.00 0.00 ? 76  THR A C    4  
ATOM 6932  O O    . THR A 1 76  ? -6.041  0.519   2.178   1.00 0.00 ? 76  THR A O    4  
ATOM 6933  C CB   . THR A 1 76  ? -8.495  0.068   3.647   1.00 0.00 ? 76  THR A CB   4  
ATOM 6934  O OG1  . THR A 1 76  ? -9.599  0.306   4.516   1.00 0.00 ? 76  THR A OG1  4  
ATOM 6935  C CG2  . THR A 1 76  ? -7.773  -1.124  4.279   1.00 0.00 ? 76  THR A CG2  4  
ATOM 6936  H H    . THR A 1 76  ? -8.999  2.058   2.278   1.00 0.00 ? 76  THR A H    4  
ATOM 6937  H HA   . THR A 1 76  ? -7.583  1.668   4.766   1.00 0.00 ? 76  THR A HA   4  
ATOM 6938  H HB   . THR A 1 76  ? -8.780  -0.150  2.618   1.00 0.00 ? 76  THR A HB   4  
ATOM 6939  H HG1  . THR A 1 76  ? -10.353 -0.310  4.287   1.00 0.00 ? 76  THR A HG1  4  
ATOM 6940  H HG21 . THR A 1 76  ? -8.003  -1.166  5.343   1.00 0.00 ? 76  THR A HG21 4  
ATOM 6941  H HG22 . THR A 1 76  ? -8.105  -2.045  3.799   1.00 0.00 ? 76  THR A HG22 4  
ATOM 6942  H HG23 . THR A 1 76  ? -6.698  -1.011  4.144   1.00 0.00 ? 76  THR A HG23 4  
ATOM 6943  N N    . VAL A 1 77  ? -5.322  1.868   3.845   1.00 0.00 ? 77  VAL A N    4  
ATOM 6944  C CA   . VAL A 1 77  ? -3.929  1.818   3.435   1.00 0.00 ? 77  VAL A CA   4  
ATOM 6945  C C    . VAL A 1 77  ? -3.259  0.596   4.068   1.00 0.00 ? 77  VAL A C    4  
ATOM 6946  O O    . VAL A 1 77  ? -3.410  0.351   5.264   1.00 0.00 ? 77  VAL A O    4  
ATOM 6947  C CB   . VAL A 1 77  ? -3.232  3.133   3.790   1.00 0.00 ? 77  VAL A CB   4  
ATOM 6948  C CG1  . VAL A 1 77  ? -1.719  3.023   3.588   1.00 0.00 ? 77  VAL A CG1  4  
ATOM 6949  C CG2  . VAL A 1 77  ? -3.810  4.295   2.980   1.00 0.00 ? 77  VAL A CG2  4  
ATOM 6950  H H    . VAL A 1 77  ? -5.505  2.426   4.654   1.00 0.00 ? 77  VAL A H    4  
ATOM 6951  H HA   . VAL A 1 77  ? -3.909  1.707   2.351   1.00 0.00 ? 77  VAL A HA   4  
ATOM 6952  H HB   . VAL A 1 77  ? -3.415  3.335   4.845   1.00 0.00 ? 77  VAL A HB   4  
ATOM 6953  H HG11 . VAL A 1 77  ? -1.317  2.269   4.265   1.00 0.00 ? 77  VAL A HG11 4  
ATOM 6954  H HG12 . VAL A 1 77  ? -1.510  2.734   2.558   1.00 0.00 ? 77  VAL A HG12 4  
ATOM 6955  H HG13 . VAL A 1 77  ? -1.254  3.986   3.798   1.00 0.00 ? 77  VAL A HG13 4  
ATOM 6956  H HG21 . VAL A 1 77  ? -3.346  4.318   1.995   1.00 0.00 ? 77  VAL A HG21 4  
ATOM 6957  H HG22 . VAL A 1 77  ? -4.886  4.163   2.872   1.00 0.00 ? 77  VAL A HG22 4  
ATOM 6958  H HG23 . VAL A 1 77  ? -3.609  5.233   3.498   1.00 0.00 ? 77  VAL A HG23 4  
ATOM 6959  N N    . GLU A 1 78  ? -2.534  -0.137  3.237   1.00 0.00 ? 78  GLU A N    4  
ATOM 6960  C CA   . GLU A 1 78  ? -1.840  -1.327  3.699   1.00 0.00 ? 78  GLU A CA   4  
ATOM 6961  C C    . GLU A 1 78  ? -0.364  -1.269  3.303   1.00 0.00 ? 78  GLU A C    4  
ATOM 6962  O O    . GLU A 1 78  ? -0.034  -0.911  2.173   1.00 0.00 ? 78  GLU A O    4  
ATOM 6963  C CB   . GLU A 1 78  ? -2.504  -2.595  3.157   1.00 0.00 ? 78  GLU A CB   4  
ATOM 6964  C CG   . GLU A 1 78  ? -1.592  -3.811  3.336   1.00 0.00 ? 78  GLU A CG   4  
ATOM 6965  C CD   . GLU A 1 78  ? -2.352  -4.977  3.972   1.00 0.00 ? 78  GLU A CD   4  
ATOM 6966  O OE1  . GLU A 1 78  ? -2.900  -4.763  5.075   1.00 0.00 ? 78  GLU A OE1  4  
ATOM 6967  O OE2  . GLU A 1 78  ? -2.368  -6.055  3.340   1.00 0.00 ? 78  GLU A OE2  4  
ATOM 6968  H H    . GLU A 1 78  ? -2.416  0.069   2.265   1.00 0.00 ? 78  GLU A H    4  
ATOM 6969  H HA   . GLU A 1 78  ? -1.933  -1.313  4.785   1.00 0.00 ? 78  GLU A HA   4  
ATOM 6970  H HB2  . GLU A 1 78  ? -3.448  -2.765  3.674   1.00 0.00 ? 78  GLU A HB2  4  
ATOM 6971  H HB3  . GLU A 1 78  ? -2.738  -2.464  2.101   1.00 0.00 ? 78  GLU A HB3  4  
ATOM 6972  H HG2  . GLU A 1 78  ? -1.194  -4.116  2.368   1.00 0.00 ? 78  GLU A HG2  4  
ATOM 6973  H HG3  . GLU A 1 78  ? -0.741  -3.542  3.961   1.00 0.00 ? 78  GLU A HG3  4  
ATOM 6974  N N    . VAL A 1 79  ? 0.486   -1.626  4.255   1.00 0.00 ? 79  VAL A N    4  
ATOM 6975  C CA   . VAL A 1 79  ? 1.920   -1.619  4.019   1.00 0.00 ? 79  VAL A CA   4  
ATOM 6976  C C    . VAL A 1 79  ? 2.377   -3.030  3.642   1.00 0.00 ? 79  VAL A C    4  
ATOM 6977  O O    . VAL A 1 79  ? 2.084   -3.992  4.350   1.00 0.00 ? 79  VAL A O    4  
ATOM 6978  C CB   . VAL A 1 79  ? 2.649   -1.062  5.244   1.00 0.00 ? 79  VAL A CB   4  
ATOM 6979  C CG1  . VAL A 1 79  ? 4.021   -1.717  5.410   1.00 0.00 ? 79  VAL A CG1  4  
ATOM 6980  C CG2  . VAL A 1 79  ? 2.774   0.460   5.161   1.00 0.00 ? 79  VAL A CG2  4  
ATOM 6981  H H    . VAL A 1 79  ? 0.210   -1.916  5.171   1.00 0.00 ? 79  VAL A H    4  
ATOM 6982  H HA   . VAL A 1 79  ? 2.112   -0.951  3.179   1.00 0.00 ? 79  VAL A HA   4  
ATOM 6983  H HB   . VAL A 1 79  ? 2.054   -1.302  6.125   1.00 0.00 ? 79  VAL A HB   4  
ATOM 6984  H HG11 . VAL A 1 79  ? 4.609   -1.152  6.133   1.00 0.00 ? 79  VAL A HG11 4  
ATOM 6985  H HG12 . VAL A 1 79  ? 3.895   -2.740  5.765   1.00 0.00 ? 79  VAL A HG12 4  
ATOM 6986  H HG13 . VAL A 1 79  ? 4.538   -1.727  4.450   1.00 0.00 ? 79  VAL A HG13 4  
ATOM 6987  H HG21 . VAL A 1 79  ? 1.780   0.905   5.111   1.00 0.00 ? 79  VAL A HG21 4  
ATOM 6988  H HG22 . VAL A 1 79  ? 3.293   0.831   6.046   1.00 0.00 ? 79  VAL A HG22 4  
ATOM 6989  H HG23 . VAL A 1 79  ? 3.338   0.731   4.269   1.00 0.00 ? 79  VAL A HG23 4  
ATOM 6990  N N    . LEU A 1 80  ? 3.088   -3.108  2.526   1.00 0.00 ? 80  LEU A N    4  
ATOM 6991  C CA   . LEU A 1 80  ? 3.589   -4.384  2.046   1.00 0.00 ? 80  LEU A CA   4  
ATOM 6992  C C    . LEU A 1 80  ? 5.096   -4.464  2.299   1.00 0.00 ? 80  LEU A C    4  
ATOM 6993  O O    . LEU A 1 80  ? 5.718   -3.474  2.682   1.00 0.00 ? 80  LEU A O    4  
ATOM 6994  C CB   . LEU A 1 80  ? 3.199   -4.596  0.582   1.00 0.00 ? 80  LEU A CB   4  
ATOM 6995  C CG   . LEU A 1 80  ? 1.721   -4.889  0.316   1.00 0.00 ? 80  LEU A CG   4  
ATOM 6996  C CD1  . LEU A 1 80  ? 1.219   -4.113  -0.903  1.00 0.00 ? 80  LEU A CD1  4  
ATOM 6997  C CD2  . LEU A 1 80  ? 1.476   -6.393  0.180   1.00 0.00 ? 80  LEU A CD2  4  
ATOM 6998  H H    . LEU A 1 80  ? 3.322   -2.321  1.956   1.00 0.00 ? 80  LEU A H    4  
ATOM 6999  H HA   . LEU A 1 80  ? 3.099   -5.167  2.626   1.00 0.00 ? 80  LEU A HA   4  
ATOM 7000  H HB2  . LEU A 1 80  ? 3.480   -3.706  0.019   1.00 0.00 ? 80  LEU A HB2  4  
ATOM 7001  H HB3  . LEU A 1 80  ? 3.790   -5.422  0.185   1.00 0.00 ? 80  LEU A HB3  4  
ATOM 7002  H HG   . LEU A 1 80  ? 1.145   -4.545  1.176   1.00 0.00 ? 80  LEU A HG   4  
ATOM 7003  H HD11 . LEU A 1 80  ? 0.132   -4.176  -0.951  1.00 0.00 ? 80  LEU A HD11 4  
ATOM 7004  H HD12 . LEU A 1 80  ? 1.519   -3.069  -0.818  1.00 0.00 ? 80  LEU A HD12 4  
ATOM 7005  H HD13 . LEU A 1 80  ? 1.648   -4.542  -1.808  1.00 0.00 ? 80  LEU A HD13 4  
ATOM 7006  H HD21 . LEU A 1 80  ? 1.221   -6.627  -0.853  1.00 0.00 ? 80  LEU A HD21 4  
ATOM 7007  H HD22 . LEU A 1 80  ? 2.377   -6.935  0.464   1.00 0.00 ? 80  LEU A HD22 4  
ATOM 7008  H HD23 . LEU A 1 80  ? 0.654   -6.687  0.833   1.00 0.00 ? 80  LEU A HD23 4  
ATOM 7009  N N    . ALA A 1 81  ? 5.639   -5.652  2.075   1.00 0.00 ? 81  ALA A N    4  
ATOM 7010  C CA   . ALA A 1 81  ? 7.061   -5.873  2.274   1.00 0.00 ? 81  ALA A CA   4  
ATOM 7011  C C    . ALA A 1 81  ? 7.836   -5.277  1.097   1.00 0.00 ? 81  ALA A C    4  
ATOM 7012  O O    . ALA A 1 81  ? 7.244   -4.906  0.084   1.00 0.00 ? 81  ALA A O    4  
ATOM 7013  C CB   . ALA A 1 81  ? 7.325   -7.371  2.447   1.00 0.00 ? 81  ALA A CB   4  
ATOM 7014  H H    . ALA A 1 81  ? 5.126   -6.452  1.764   1.00 0.00 ? 81  ALA A H    4  
ATOM 7015  H HA   . ALA A 1 81  ? 7.353   -5.358  3.189   1.00 0.00 ? 81  ALA A HA   4  
ATOM 7016  H HB1  . ALA A 1 81  ? 6.391   -7.879  2.685   1.00 0.00 ? 81  ALA A HB1  4  
ATOM 7017  H HB2  . ALA A 1 81  ? 7.735   -7.776  1.522   1.00 0.00 ? 81  ALA A HB2  4  
ATOM 7018  H HB3  . ALA A 1 81  ? 8.038   -7.522  3.257   1.00 0.00 ? 81  ALA A HB3  4  
ATOM 7019  N N    . PRO A 1 82  ? 9.182   -5.201  1.274   1.00 0.00 ? 82  PRO A N    4  
ATOM 7020  C CA   . PRO A 1 82  ? 10.044  -4.656  0.239   1.00 0.00 ? 82  PRO A CA   4  
ATOM 7021  C C    . PRO A 1 82  ? 10.216  -5.650  -0.911  1.00 0.00 ? 82  PRO A C    4  
ATOM 7022  O O    . PRO A 1 82  ? 10.771  -5.308  -1.954  1.00 0.00 ? 82  PRO A O    4  
ATOM 7023  C CB   . PRO A 1 82  ? 11.350  -4.331  0.945   1.00 0.00 ? 82  PRO A CB   4  
ATOM 7024  C CG   . PRO A 1 82  ? 11.335  -5.131  2.237   1.00 0.00 ? 82  PRO A CG   4  
ATOM 7025  C CD   . PRO A 1 82  ? 9.917   -5.630  2.460   1.00 0.00 ? 82  PRO A CD   4  
ATOM 7026  H HA   . PRO A 1 82  ? 9.628   -3.841  -0.165  1.00 0.00 ? 82  PRO A HA   4  
ATOM 7027  H HB2  . PRO A 1 82  ? 12.206  -4.603  0.327   1.00 0.00 ? 82  PRO A HB2  4  
ATOM 7028  H HB3  . PRO A 1 82  ? 11.430  -3.263  1.148   1.00 0.00 ? 82  PRO A HB3  4  
ATOM 7029  H HG2  . PRO A 1 82  ? 12.030  -5.969  2.176   1.00 0.00 ? 82  PRO A HG2  4  
ATOM 7030  H HG3  . PRO A 1 82  ? 11.657  -4.511  3.074   1.00 0.00 ? 82  PRO A HG3  4  
ATOM 7031  H HD2  . PRO A 1 82  ? 9.892   -6.714  2.571   1.00 0.00 ? 82  PRO A HD2  4  
ATOM 7032  H HD3  . PRO A 1 82  ? 9.486   -5.207  3.368   1.00 0.00 ? 82  PRO A HD3  4  
ATOM 7033  N N    . SER A 1 83  ? 9.731   -6.861  -0.681  1.00 0.00 ? 83  SER A N    4  
ATOM 7034  C CA   . SER A 1 83  ? 9.825   -7.908  -1.684  1.00 0.00 ? 83  SER A CA   4  
ATOM 7035  C C    . SER A 1 83  ? 8.430   -8.260  -2.205  1.00 0.00 ? 83  SER A C    4  
ATOM 7036  O O    . SER A 1 83  ? 8.158   -9.415  -2.531  1.00 0.00 ? 83  SER A O    4  
ATOM 7037  C CB   . SER A 1 83  ? 10.510  -9.154  -1.119  1.00 0.00 ? 83  SER A CB   4  
ATOM 7038  O OG   . SER A 1 83  ? 9.614   -9.956  -0.356  1.00 0.00 ? 83  SER A OG   4  
ATOM 7039  H H    . SER A 1 83  ? 9.282   -7.131  0.171   1.00 0.00 ? 83  SER A H    4  
ATOM 7040  H HA   . SER A 1 83  ? 10.437  -7.488  -2.483  1.00 0.00 ? 83  SER A HA   4  
ATOM 7041  H HB2  . SER A 1 83  ? 10.920  -9.745  -1.938  1.00 0.00 ? 83  SER A HB2  4  
ATOM 7042  H HB3  . SER A 1 83  ? 11.350  -8.853  -0.493  1.00 0.00 ? 83  SER A HB3  4  
ATOM 7043  H HG   . SER A 1 83  ? 10.120  -10.672 0.125   1.00 0.00 ? 83  SER A HG   4  
ATOM 7044  N N    . ALA A 1 84  ? 7.582   -7.244  -2.267  1.00 0.00 ? 84  ALA A N    4  
ATOM 7045  C CA   . ALA A 1 84  ? 6.222   -7.431  -2.743  1.00 0.00 ? 84  ALA A CA   4  
ATOM 7046  C C    . ALA A 1 84  ? 6.160   -7.107  -4.236  1.00 0.00 ? 84  ALA A C    4  
ATOM 7047  O O    . ALA A 1 84  ? 6.624   -6.052  -4.666  1.00 0.00 ? 84  ALA A O    4  
ATOM 7048  C CB   . ALA A 1 84  ? 5.268   -6.565  -1.917  1.00 0.00 ? 84  ALA A CB   4  
ATOM 7049  H H    . ALA A 1 84  ? 7.811   -6.308  -2.000  1.00 0.00 ? 84  ALA A H    4  
ATOM 7050  H HA   . ALA A 1 84  ? 5.961   -8.479  -2.596  1.00 0.00 ? 84  ALA A HA   4  
ATOM 7051  H HB1  . ALA A 1 84  ? 5.390   -6.798  -0.859  1.00 0.00 ? 84  ALA A HB1  4  
ATOM 7052  H HB2  . ALA A 1 84  ? 5.495   -5.513  -2.086  1.00 0.00 ? 84  ALA A HB2  4  
ATOM 7053  H HB3  . ALA A 1 84  ? 4.241   -6.769  -2.218  1.00 0.00 ? 84  ALA A HB3  4  
ATOM 7054  N N    . ARG A 1 85  ? 5.582   -8.033  -4.987  1.00 0.00 ? 85  ARG A N    4  
ATOM 7055  C CA   . ARG A 1 85  ? 5.452   -7.859  -6.424  1.00 0.00 ? 85  ARG A CA   4  
ATOM 7056  C C    . ARG A 1 85  ? 3.981   -7.691  -6.808  1.00 0.00 ? 85  ARG A C    4  
ATOM 7057  O O    . ARG A 1 85  ? 3.669   -7.119  -7.851  1.00 0.00 ? 85  ARG A O    4  
ATOM 7058  C CB   . ARG A 1 85  ? 6.036   -9.054  -7.179  1.00 0.00 ? 85  ARG A CB   4  
ATOM 7059  C CG   . ARG A 1 85  ? 6.394   -8.674  -8.617  1.00 0.00 ? 85  ARG A CG   4  
ATOM 7060  C CD   . ARG A 1 85  ? 7.823   -8.135  -8.702  1.00 0.00 ? 85  ARG A CD   4  
ATOM 7061  N NE   . ARG A 1 85  ? 8.377   -8.379  -10.052 1.00 0.00 ? 85  ARG A NE   4  
ATOM 7062  C CZ   . ARG A 1 85  ? 8.765   -9.582  -10.499 1.00 0.00 ? 85  ARG A CZ   4  
ATOM 7063  N NH1  . ARG A 1 85  ? 8.662   -10.656 -9.706  1.00 0.00 ? 85  ARG A NH1  4  
ATOM 7064  N NH2  . ARG A 1 85  ? 9.255   -9.709  -11.740 1.00 0.00 ? 85  ARG A NH2  4  
ATOM 7065  H H    . ARG A 1 85  ? 5.207   -8.888  -4.630  1.00 0.00 ? 85  ARG A H    4  
ATOM 7066  H HA   . ARG A 1 85  ? 6.022   -6.956  -6.647  1.00 0.00 ? 85  ARG A HA   4  
ATOM 7067  H HB2  . ARG A 1 85  ? 6.925   -9.416  -6.662  1.00 0.00 ? 85  ARG A HB2  4  
ATOM 7068  H HB3  . ARG A 1 85  ? 5.316   -9.873  -7.184  1.00 0.00 ? 85  ARG A HB3  4  
ATOM 7069  H HG2  . ARG A 1 85  ? 6.291   -9.545  -9.264  1.00 0.00 ? 85  ARG A HG2  4  
ATOM 7070  H HG3  . ARG A 1 85  ? 5.696   -7.921  -8.982  1.00 0.00 ? 85  ARG A HG3  4  
ATOM 7071  H HD2  . ARG A 1 85  ? 7.832   -7.067  -8.484  1.00 0.00 ? 85  ARG A HD2  4  
ATOM 7072  H HD3  . ARG A 1 85  ? 8.448   -8.619  -7.951  1.00 0.00 ? 85  ARG A HD3  4  
ATOM 7073  H HE   . ARG A 1 85  ? 8.467   -7.598  -10.670 1.00 0.00 ? 85  ARG A HE   4  
ATOM 7074  H HH11 . ARG A 1 85  ? 8.296   -10.561 -8.780  1.00 0.00 ? 85  ARG A HH11 4  
ATOM 7075  H HH12 . ARG A 1 85  ? 8.951   -11.554 -10.039 1.00 0.00 ? 85  ARG A HH12 4  
ATOM 7076  H HH21 . ARG A 1 85  ? 9.332   -8.907  -12.332 1.00 0.00 ? 85  ARG A HH21 4  
ATOM 7077  H HH22 . ARG A 1 85  ? 9.545   -10.606 -12.073 1.00 0.00 ? 85  ARG A HH22 4  
ATOM 7078  N N    . GLN A 1 86  ? 3.115   -8.199  -5.943  1.00 0.00 ? 86  GLN A N    4  
ATOM 7079  C CA   . GLN A 1 86  ? 1.684   -8.112  -6.178  1.00 0.00 ? 86  GLN A CA   4  
ATOM 7080  C C    . GLN A 1 86  ? 0.930   -8.047  -4.849  1.00 0.00 ? 86  GLN A C    4  
ATOM 7081  O O    . GLN A 1 86  ? 1.512   -8.275  -3.789  1.00 0.00 ? 86  GLN A O    4  
ATOM 7082  C CB   . GLN A 1 86  ? 1.196   -9.287  -7.028  1.00 0.00 ? 86  GLN A CB   4  
ATOM 7083  C CG   . GLN A 1 86  ? 1.230   -10.592 -6.230  1.00 0.00 ? 86  GLN A CG   4  
ATOM 7084  C CD   . GLN A 1 86  ? 1.519   -11.786 -7.142  1.00 0.00 ? 86  GLN A CD   4  
ATOM 7085  O OE1  . GLN A 1 86  ? 2.529   -12.460 -7.024  1.00 0.00 ? 86  GLN A OE1  4  
ATOM 7086  N NE2  . GLN A 1 86  ? 0.579   -12.008 -8.057  1.00 0.00 ? 86  GLN A NE2  4  
ATOM 7087  H H    . GLN A 1 86  ? 3.377   -8.662  -5.096  1.00 0.00 ? 86  GLN A H    4  
ATOM 7088  H HA   . GLN A 1 86  ? 1.537   -7.185  -6.733  1.00 0.00 ? 86  GLN A HA   4  
ATOM 7089  H HB2  . GLN A 1 86  ? 0.180   -9.094  -7.373  1.00 0.00 ? 86  GLN A HB2  4  
ATOM 7090  H HB3  . GLN A 1 86  ? 1.821   -9.384  -7.916  1.00 0.00 ? 86  GLN A HB3  4  
ATOM 7091  H HG2  . GLN A 1 86  ? 1.994   -10.529 -5.455  1.00 0.00 ? 86  GLN A HG2  4  
ATOM 7092  H HG3  . GLN A 1 86  ? 0.275   -10.739 -5.725  1.00 0.00 ? 86  GLN A HG3  4  
ATOM 7093  H HE21 . GLN A 1 86  ? -0.226  -11.417 -8.100  1.00 0.00 ? 86  GLN A HE21 4  
ATOM 7094  H HE22 . GLN A 1 86  ? 0.678   -12.767 -8.701  1.00 0.00 ? 86  GLN A HE22 4  
ATOM 7095  N N    . TYR A 1 87  ? -0.354  -7.734  -4.947  1.00 0.00 ? 87  TYR A N    4  
ATOM 7096  C CA   . TYR A 1 87  ? -1.193  -7.636  -3.765  1.00 0.00 ? 87  TYR A CA   4  
ATOM 7097  C C    . TYR A 1 87  ? -2.648  -7.973  -4.097  1.00 0.00 ? 87  TYR A C    4  
ATOM 7098  O O    . TYR A 1 87  ? -3.172  -7.539  -5.121  1.00 0.00 ? 87  TYR A O    4  
ATOM 7099  C CB   . TYR A 1 87  ? -1.111  -6.177  -3.310  1.00 0.00 ? 87  TYR A CB   4  
ATOM 7100  C CG   . TYR A 1 87  ? -2.179  -5.784  -2.288  1.00 0.00 ? 87  TYR A CG   4  
ATOM 7101  C CD1  . TYR A 1 87  ? -3.407  -5.320  -2.716  1.00 0.00 ? 87  TYR A CD1  4  
ATOM 7102  C CD2  . TYR A 1 87  ? -1.915  -5.892  -0.938  1.00 0.00 ? 87  TYR A CD2  4  
ATOM 7103  C CE1  . TYR A 1 87  ? -4.412  -4.950  -1.754  1.00 0.00 ? 87  TYR A CE1  4  
ATOM 7104  C CE2  . TYR A 1 87  ? -2.921  -5.521  0.024   1.00 0.00 ? 87  TYR A CE2  4  
ATOM 7105  C CZ   . TYR A 1 87  ? -4.119  -5.069  -0.431  1.00 0.00 ? 87  TYR A CZ   4  
ATOM 7106  O OH   . TYR A 1 87  ? -5.069  -4.719  0.477   1.00 0.00 ? 87  TYR A OH   4  
ATOM 7107  H H    . TYR A 1 87  ? -0.819  -7.550  -5.813  1.00 0.00 ? 87  TYR A H    4  
ATOM 7108  H HA   . TYR A 1 87  ? -0.821  -8.348  -3.029  1.00 0.00 ? 87  TYR A HA   4  
ATOM 7109  H HB2  . TYR A 1 87  ? -0.126  -5.997  -2.879  1.00 0.00 ? 87  TYR A HB2  4  
ATOM 7110  H HB3  . TYR A 1 87  ? -1.201  -5.530  -4.182  1.00 0.00 ? 87  TYR A HB3  4  
ATOM 7111  H HD1  . TYR A 1 87  ? -3.615  -5.235  -3.783  1.00 0.00 ? 87  TYR A HD1  4  
ATOM 7112  H HD2  . TYR A 1 87  ? -0.946  -6.258  -0.599  1.00 0.00 ? 87  TYR A HD2  4  
ATOM 7113  H HE1  . TYR A 1 87  ? -5.385  -4.582  -2.079  1.00 0.00 ? 87  TYR A HE1  4  
ATOM 7114  H HE2  . TYR A 1 87  ? -2.726  -5.602  1.094   1.00 0.00 ? 87  TYR A HE2  4  
ATOM 7115  H HH   . TYR A 1 87  ? -4.983  -5.285  1.297   1.00 0.00 ? 87  TYR A HH   4  
ATOM 7116  N N    . THR A 1 88  ? -3.259  -8.745  -3.210  1.00 0.00 ? 88  THR A N    4  
ATOM 7117  C CA   . THR A 1 88  ? -4.644  -9.146  -3.395  1.00 0.00 ? 88  THR A CA   4  
ATOM 7118  C C    . THR A 1 88  ? -5.565  -8.306  -2.509  1.00 0.00 ? 88  THR A C    4  
ATOM 7119  O O    . THR A 1 88  ? -5.373  -8.238  -1.296  1.00 0.00 ? 88  THR A O    4  
ATOM 7120  C CB   . THR A 1 88  ? -4.741  -10.649 -3.123  1.00 0.00 ? 88  THR A CB   4  
ATOM 7121  O OG1  . THR A 1 88  ? -3.777  -11.224 -4.000  1.00 0.00 ? 88  THR A OG1  4  
ATOM 7122  C CG2  . THR A 1 88  ? -6.072  -11.243 -3.589  1.00 0.00 ? 88  THR A CG2  4  
ATOM 7123  H H    . THR A 1 88  ? -2.826  -9.095  -2.379  1.00 0.00 ? 88  THR A H    4  
ATOM 7124  H HA   . THR A 1 88  ? -4.924  -8.945  -4.429  1.00 0.00 ? 88  THR A HA   4  
ATOM 7125  H HB   . THR A 1 88  ? -4.566  -10.865 -2.069  1.00 0.00 ? 88  THR A HB   4  
ATOM 7126  H HG1  . THR A 1 88  ? -2.906  -10.741 -3.916  1.00 0.00 ? 88  THR A HG1  4  
ATOM 7127  H HG21 . THR A 1 88  ? -6.555  -10.554 -4.281  1.00 0.00 ? 88  THR A HG21 4  
ATOM 7128  H HG22 . THR A 1 88  ? -5.889  -12.193 -4.091  1.00 0.00 ? 88  THR A HG22 4  
ATOM 7129  H HG23 . THR A 1 88  ? -6.719  -11.406 -2.727  1.00 0.00 ? 88  THR A HG23 4  
ATOM 7130  N N    . ALA A 1 89  ? -6.547  -7.688  -3.149  1.00 0.00 ? 89  ALA A N    4  
ATOM 7131  C CA   . ALA A 1 89  ? -7.499  -6.855  -2.433  1.00 0.00 ? 89  ALA A CA   4  
ATOM 7132  C C    . ALA A 1 89  ? -8.798  -7.637  -2.226  1.00 0.00 ? 89  ALA A C    4  
ATOM 7133  O O    . ALA A 1 89  ? -9.402  -8.111  -3.187  1.00 0.00 ? 89  ALA A O    4  
ATOM 7134  C CB   . ALA A 1 89  ? -7.719  -5.553  -3.205  1.00 0.00 ? 89  ALA A CB   4  
ATOM 7135  H H    . ALA A 1 89  ? -6.696  -7.749  -4.136  1.00 0.00 ? 89  ALA A H    4  
ATOM 7136  H HA   . ALA A 1 89  ? -7.068  -6.619  -1.461  1.00 0.00 ? 89  ALA A HA   4  
ATOM 7137  H HB1  . ALA A 1 89  ? -8.098  -4.788  -2.527  1.00 0.00 ? 89  ALA A HB1  4  
ATOM 7138  H HB2  . ALA A 1 89  ? -6.773  -5.220  -3.634  1.00 0.00 ? 89  ALA A HB2  4  
ATOM 7139  H HB3  . ALA A 1 89  ? -8.441  -5.721  -4.004  1.00 0.00 ? 89  ALA A HB3  4  
ATOM 7140  N N    . THR A 1 90  ? -9.190  -7.747  -0.965  1.00 0.00 ? 90  THR A N    4  
ATOM 7141  C CA   . THR A 1 90  ? -10.406 -8.462  -0.620  1.00 0.00 ? 90  THR A CA   4  
ATOM 7142  C C    . THR A 1 90  ? -11.362 -7.549  0.151   1.00 0.00 ? 90  THR A C    4  
ATOM 7143  O O    . THR A 1 90  ? -10.934 -6.572  0.764   1.00 0.00 ? 90  THR A O    4  
ATOM 7144  C CB   . THR A 1 90  ? -10.011 -9.720  0.156   1.00 0.00 ? 90  THR A CB   4  
ATOM 7145  O OG1  . THR A 1 90  ? -9.125  -9.242  1.165   1.00 0.00 ? 90  THR A OG1  4  
ATOM 7146  C CG2  . THR A 1 90  ? -9.149  -10.673 -0.674  1.00 0.00 ? 90  THR A CG2  4  
ATOM 7147  H H    . THR A 1 90  ? -8.693  -7.358  -0.189  1.00 0.00 ? 90  THR A H    4  
ATOM 7148  H HA   . THR A 1 90  ? -10.911 -8.747  -1.542  1.00 0.00 ? 90  THR A HA   4  
ATOM 7149  H HB   . THR A 1 90  ? -10.892 -10.230 0.545   1.00 0.00 ? 90  THR A HB   4  
ATOM 7150  H HG1  . THR A 1 90  ? -8.789  -10.006 1.715   1.00 0.00 ? 90  THR A HG1  4  
ATOM 7151  H HG21 . THR A 1 90  ? -8.173  -10.221 -0.851  1.00 0.00 ? 90  THR A HG21 4  
ATOM 7152  H HG22 . THR A 1 90  ? -9.022  -11.612 -0.135  1.00 0.00 ? 90  THR A HG22 4  
ATOM 7153  H HG23 . THR A 1 90  ? -9.638  -10.866 -1.629  1.00 0.00 ? 90  THR A HG23 4  
ATOM 7154  N N    . GLY A 1 91  ? -12.639 -7.898  0.094   1.00 0.00 ? 91  GLY A N    4  
ATOM 7155  C CA   . GLY A 1 91  ? -13.658 -7.122  0.779   1.00 0.00 ? 91  GLY A CA   4  
ATOM 7156  C C    . GLY A 1 91  ? -13.919 -5.800  0.054   1.00 0.00 ? 91  GLY A C    4  
ATOM 7157  O O    . GLY A 1 91  ? -13.687 -4.727  0.610   1.00 0.00 ? 91  GLY A O    4  
ATOM 7158  H H    . GLY A 1 91  ? -12.979 -8.694  -0.407  1.00 0.00 ? 91  GLY A H    4  
ATOM 7159  H HA2  . GLY A 1 91  ? -14.582 -7.698  0.836   1.00 0.00 ? 91  GLY A HA2  4  
ATOM 7160  H HA3  . GLY A 1 91  ? -13.343 -6.924  1.803   1.00 0.00 ? 91  GLY A HA3  4  
ATOM 7161  N N    . LEU A 1 92  ? -14.399 -5.920  -1.175  1.00 0.00 ? 92  LEU A N    4  
ATOM 7162  C CA   . LEU A 1 92  ? -14.694 -4.747  -1.981  1.00 0.00 ? 92  LEU A CA   4  
ATOM 7163  C C    . LEU A 1 92  ? -16.124 -4.849  -2.517  1.00 0.00 ? 92  LEU A C    4  
ATOM 7164  O O    . LEU A 1 92  ? -16.770 -5.886  -2.378  1.00 0.00 ? 92  LEU A O    4  
ATOM 7165  C CB   . LEU A 1 92  ? -13.638 -4.568  -3.073  1.00 0.00 ? 92  LEU A CB   4  
ATOM 7166  C CG   . LEU A 1 92  ? -12.210 -4.967  -2.697  1.00 0.00 ? 92  LEU A CG   4  
ATOM 7167  C CD1  . LEU A 1 92  ? -11.434 -5.450  -3.924  1.00 0.00 ? 92  LEU A CD1  4  
ATOM 7168  C CD2  . LEU A 1 92  ? -11.492 -3.821  -1.980  1.00 0.00 ? 92  LEU A CD2  4  
ATOM 7169  H H    . LEU A 1 92  ? -14.586 -6.796  -1.619  1.00 0.00 ? 92  LEU A H    4  
ATOM 7170  H HA   . LEU A 1 92  ? -14.632 -3.877  -1.327  1.00 0.00 ? 92  LEU A HA   4  
ATOM 7171  H HB2  . LEU A 1 92  ? -13.941 -5.153  -3.942  1.00 0.00 ? 92  LEU A HB2  4  
ATOM 7172  H HB3  . LEU A 1 92  ? -13.634 -3.522  -3.379  1.00 0.00 ? 92  LEU A HB3  4  
ATOM 7173  H HG   . LEU A 1 92  ? -12.261 -5.802  -1.999  1.00 0.00 ? 92  LEU A HG   4  
ATOM 7174  H HD11 . LEU A 1 92  ? -10.365 -5.331  -3.748  1.00 0.00 ? 92  LEU A HD11 4  
ATOM 7175  H HD12 . LEU A 1 92  ? -11.658 -6.502  -4.104  1.00 0.00 ? 92  LEU A HD12 4  
ATOM 7176  H HD13 . LEU A 1 92  ? -11.728 -4.863  -4.794  1.00 0.00 ? 92  LEU A HD13 4  
ATOM 7177  H HD21 . LEU A 1 92  ? -10.423 -3.877  -2.185  1.00 0.00 ? 92  LEU A HD21 4  
ATOM 7178  H HD22 . LEU A 1 92  ? -11.881 -2.868  -2.338  1.00 0.00 ? 92  LEU A HD22 4  
ATOM 7179  H HD23 . LEU A 1 92  ? -11.661 -3.903  -0.906  1.00 0.00 ? 92  LEU A HD23 4  
ATOM 7180  N N    . LYS A 1 93  ? -16.575 -3.759  -3.119  1.00 0.00 ? 93  LYS A N    4  
ATOM 7181  C CA   . LYS A 1 93  ? -17.915 -3.712  -3.678  1.00 0.00 ? 93  LYS A CA   4  
ATOM 7182  C C    . LYS A 1 93  ? -17.836 -3.869  -5.198  1.00 0.00 ? 93  LYS A C    4  
ATOM 7183  O O    . LYS A 1 93  ? -17.062 -3.177  -5.857  1.00 0.00 ? 93  LYS A O    4  
ATOM 7184  C CB   . LYS A 1 93  ? -18.640 -2.442  -3.227  1.00 0.00 ? 93  LYS A CB   4  
ATOM 7185  C CG   . LYS A 1 93  ? -19.975 -2.284  -3.958  1.00 0.00 ? 93  LYS A CG   4  
ATOM 7186  C CD   . LYS A 1 93  ? -20.204 -0.829  -4.372  1.00 0.00 ? 93  LYS A CD   4  
ATOM 7187  C CE   . LYS A 1 93  ? -20.116 0.105   -3.164  1.00 0.00 ? 93  LYS A CE   4  
ATOM 7188  N NZ   . LYS A 1 93  ? -20.653 1.442   -3.502  1.00 0.00 ? 93  LYS A NZ   4  
ATOM 7189  H H    . LYS A 1 93  ? -16.042 -2.919  -3.228  1.00 0.00 ? 93  LYS A H    4  
ATOM 7190  H HA   . LYS A 1 93  ? -18.468 -4.560  -3.272  1.00 0.00 ? 93  LYS A HA   4  
ATOM 7191  H HB2  . LYS A 1 93  ? -18.812 -2.479  -2.152  1.00 0.00 ? 93  LYS A HB2  4  
ATOM 7192  H HB3  . LYS A 1 93  ? -18.011 -1.573  -3.419  1.00 0.00 ? 93  LYS A HB3  4  
ATOM 7193  H HG2  . LYS A 1 93  ? -19.988 -2.923  -4.841  1.00 0.00 ? 93  LYS A HG2  4  
ATOM 7194  H HG3  . LYS A 1 93  ? -20.788 -2.615  -3.312  1.00 0.00 ? 93  LYS A HG3  4  
ATOM 7195  H HD2  . LYS A 1 93  ? -19.463 -0.538  -5.116  1.00 0.00 ? 93  LYS A HD2  4  
ATOM 7196  H HD3  . LYS A 1 93  ? -21.183 -0.731  -4.842  1.00 0.00 ? 93  LYS A HD3  4  
ATOM 7197  H HE2  . LYS A 1 93  ? -20.674 -0.317  -2.329  1.00 0.00 ? 93  LYS A HE2  4  
ATOM 7198  H HE3  . LYS A 1 93  ? -19.079 0.195   -2.841  1.00 0.00 ? 93  LYS A HE3  4  
ATOM 7199  H HZ1  . LYS A 1 93  ? -20.634 1.568   -4.494  1.00 0.00 ? 93  LYS A HZ1  4  
ATOM 7200  H HZ2  . LYS A 1 93  ? -21.596 1.515   -3.175  1.00 0.00 ? 93  LYS A HZ2  4  
ATOM 7201  H HZ3  . LYS A 1 93  ? -20.094 2.147   -3.066  1.00 0.00 ? 93  LYS A HZ3  4  
ATOM 7202  N N    . PRO A 1 94  ? -18.669 -4.806  -5.723  1.00 0.00 ? 94  PRO A N    4  
ATOM 7203  C CA   . PRO A 1 94  ? -18.700 -5.062  -7.153  1.00 0.00 ? 94  PRO A CA   4  
ATOM 7204  C C    . PRO A 1 94  ? -19.435 -3.944  -7.895  1.00 0.00 ? 94  PRO A C    4  
ATOM 7205  O O    . PRO A 1 94  ? -20.199 -3.191  -7.291  1.00 0.00 ? 94  PRO A O    4  
ATOM 7206  C CB   . PRO A 1 94  ? -19.379 -6.415  -7.296  1.00 0.00 ? 94  PRO A CB   4  
ATOM 7207  C CG   . PRO A 1 94  ? -20.116 -6.652  -5.988  1.00 0.00 ? 94  PRO A CG   4  
ATOM 7208  C CD   . PRO A 1 94  ? -19.600 -5.645  -4.973  1.00 0.00 ? 94  PRO A CD   4  
ATOM 7209  H HA   . PRO A 1 94  ? -17.772 -5.072  -7.524  1.00 0.00 ? 94  PRO A HA   4  
ATOM 7210  H HB2  . PRO A 1 94  ? -20.069 -6.419  -8.139  1.00 0.00 ? 94  PRO A HB2  4  
ATOM 7211  H HB3  . PRO A 1 94  ? -18.647 -7.202  -7.480  1.00 0.00 ? 94  PRO A HB3  4  
ATOM 7212  H HG2  . PRO A 1 94  ? -21.191 -6.536  -6.128  1.00 0.00 ? 94  PRO A HG2  4  
ATOM 7213  H HG3  . PRO A 1 94  ? -19.949 -7.669  -5.634  1.00 0.00 ? 94  PRO A HG3  4  
ATOM 7214  H HD2  . PRO A 1 94  ? -20.414 -5.054  -4.552  1.00 0.00 ? 94  PRO A HD2  4  
ATOM 7215  H HD3  . PRO A 1 94  ? -19.103 -6.141  -4.140  1.00 0.00 ? 94  PRO A HD3  4  
ATOM 7216  N N    . GLU A 1 95  ? -19.179 -3.870  -9.192  1.00 0.00 ? 95  GLU A N    4  
ATOM 7217  C CA   . GLU A 1 95  ? -19.807 -2.856  -10.023 1.00 0.00 ? 95  GLU A CA   4  
ATOM 7218  C C    . GLU A 1 95  ? -19.332 -1.462  -9.608  1.00 0.00 ? 95  GLU A C    4  
ATOM 7219  O O    . GLU A 1 95  ? -20.131 -0.532  -9.514  1.00 0.00 ? 95  GLU A O    4  
ATOM 7220  C CB   . GLU A 1 95  ? -21.332 -2.958  -9.954  1.00 0.00 ? 95  GLU A CB   4  
ATOM 7221  C CG   . GLU A 1 95  ? -21.821 -4.276  -10.559 1.00 0.00 ? 95  GLU A CG   4  
ATOM 7222  C CD   . GLU A 1 95  ? -22.424 -4.051  -11.947 1.00 0.00 ? 95  GLU A CD   4  
ATOM 7223  O OE1  . GLU A 1 95  ? -21.673 -3.564  -12.820 1.00 0.00 ? 95  GLU A OE1  4  
ATOM 7224  O OE2  . GLU A 1 95  ? -23.622 -4.371  -12.105 1.00 0.00 ? 95  GLU A OE2  4  
ATOM 7225  H H    . GLU A 1 95  ? -18.557 -4.486  -9.676  1.00 0.00 ? 95  GLU A H    4  
ATOM 7226  H HA   . GLU A 1 95  ? -19.480 -3.071  -11.040 1.00 0.00 ? 95  GLU A HA   4  
ATOM 7227  H HB2  . GLU A 1 95  ? -21.659 -2.887  -8.916  1.00 0.00 ? 95  GLU A HB2  4  
ATOM 7228  H HB3  . GLU A 1 95  ? -21.781 -2.120  -10.487 1.00 0.00 ? 95  GLU A HB3  4  
ATOM 7229  H HG2  . GLU A 1 95  ? -20.991 -4.978  -10.628 1.00 0.00 ? 95  GLU A HG2  4  
ATOM 7230  H HG3  . GLU A 1 95  ? -22.567 -4.726  -9.904  1.00 0.00 ? 95  GLU A HG3  4  
ATOM 7231  N N    . SER A 1 96  ? -18.032 -1.361  -9.372  1.00 0.00 ? 96  SER A N    4  
ATOM 7232  C CA   . SER A 1 96  ? -17.441 -0.096  -8.970  1.00 0.00 ? 96  SER A CA   4  
ATOM 7233  C C    . SER A 1 96  ? -15.998 -0.010  -9.471  1.00 0.00 ? 96  SER A C    4  
ATOM 7234  O O    . SER A 1 96  ? -15.521 -0.912  -10.158 1.00 0.00 ? 96  SER A O    4  
ATOM 7235  C CB   . SER A 1 96  ? -17.485 0.074   -7.450  1.00 0.00 ? 96  SER A CB   4  
ATOM 7236  O OG   . SER A 1 96  ? -18.793 0.403   -6.988  1.00 0.00 ? 96  SER A OG   4  
ATOM 7237  H H    . SER A 1 96  ? -17.388 -2.122  -9.451  1.00 0.00 ? 96  SER A H    4  
ATOM 7238  H HA   . SER A 1 96  ? -18.055 0.672   -9.439  1.00 0.00 ? 96  SER A HA   4  
ATOM 7239  H HB2  . SER A 1 96  ? -17.153 -0.847  -6.972  1.00 0.00 ? 96  SER A HB2  4  
ATOM 7240  H HB3  . SER A 1 96  ? -16.788 0.857   -7.152  1.00 0.00 ? 96  SER A HB3  4  
ATOM 7241  H HG   . SER A 1 96  ? -19.423 -0.349  -7.181  1.00 0.00 ? 96  SER A HG   4  
ATOM 7242  N N    . VAL A 1 97  ? -15.343 1.083   -9.109  1.00 0.00 ? 97  VAL A N    4  
ATOM 7243  C CA   . VAL A 1 97  ? -13.964 1.298   -9.513  1.00 0.00 ? 97  VAL A CA   4  
ATOM 7244  C C    . VAL A 1 97  ? -13.112 1.580   -8.274  1.00 0.00 ? 97  VAL A C    4  
ATOM 7245  O O    . VAL A 1 97  ? -13.531 2.317   -7.382  1.00 0.00 ? 97  VAL A O    4  
ATOM 7246  C CB   . VAL A 1 97  ? -13.893 2.417   -10.555 1.00 0.00 ? 97  VAL A CB   4  
ATOM 7247  C CG1  . VAL A 1 97  ? -12.518 2.456   -11.225 1.00 0.00 ? 97  VAL A CG1  4  
ATOM 7248  C CG2  . VAL A 1 97  ? -15.006 2.270   -11.594 1.00 0.00 ? 97  VAL A CG2  4  
ATOM 7249  H H    . VAL A 1 97  ? -15.738 1.812   -8.550  1.00 0.00 ? 97  VAL A H    4  
ATOM 7250  H HA   . VAL A 1 97  ? -13.611 0.379   -9.981  1.00 0.00 ? 97  VAL A HA   4  
ATOM 7251  H HB   . VAL A 1 97  ? -14.041 3.366   -10.038 1.00 0.00 ? 97  VAL A HB   4  
ATOM 7252  H HG11 . VAL A 1 97  ? -11.742 2.355   -10.466 1.00 0.00 ? 97  VAL A HG11 4  
ATOM 7253  H HG12 . VAL A 1 97  ? -12.438 1.636   -11.938 1.00 0.00 ? 97  VAL A HG12 4  
ATOM 7254  H HG13 . VAL A 1 97  ? -12.395 3.405   -11.746 1.00 0.00 ? 97  VAL A HG13 4  
ATOM 7255  H HG21 . VAL A 1 97  ? -15.702 3.103   -11.502 1.00 0.00 ? 97  VAL A HG21 4  
ATOM 7256  H HG22 . VAL A 1 97  ? -14.571 2.269   -12.594 1.00 0.00 ? 97  VAL A HG22 4  
ATOM 7257  H HG23 . VAL A 1 97  ? -15.537 1.332   -11.428 1.00 0.00 ? 97  VAL A HG23 4  
ATOM 7258  N N    . TYR A 1 98  ? -11.931 0.979   -8.259  1.00 0.00 ? 98  TYR A N    4  
ATOM 7259  C CA   . TYR A 1 98  ? -11.016 1.156   -7.144  1.00 0.00 ? 98  TYR A CA   4  
ATOM 7260  C C    . TYR A 1 98  ? -9.641  1.618   -7.631  1.00 0.00 ? 98  TYR A C    4  
ATOM 7261  O O    . TYR A 1 98  ? -9.057  1.007   -8.524  1.00 0.00 ? 98  TYR A O    4  
ATOM 7262  C CB   . TYR A 1 98  ? -10.876 -0.220  -6.491  1.00 0.00 ? 98  TYR A CB   4  
ATOM 7263  C CG   . TYR A 1 98  ? -12.013 -0.572  -5.530  1.00 0.00 ? 98  TYR A CG   4  
ATOM 7264  C CD1  . TYR A 1 98  ? -11.939 -0.194  -4.205  1.00 0.00 ? 98  TYR A CD1  4  
ATOM 7265  C CD2  . TYR A 1 98  ? -13.114 -1.267  -5.989  1.00 0.00 ? 98  TYR A CD2  4  
ATOM 7266  C CE1  . TYR A 1 98  ? -13.010 -0.525  -3.300  1.00 0.00 ? 98  TYR A CE1  4  
ATOM 7267  C CE2  . TYR A 1 98  ? -14.184 -1.598  -5.084  1.00 0.00 ? 98  TYR A CE2  4  
ATOM 7268  C CZ   . TYR A 1 98  ? -14.080 -1.211  -3.785  1.00 0.00 ? 98  TYR A CZ   4  
ATOM 7269  O OH   . TYR A 1 98  ? -15.091 -1.524  -2.931  1.00 0.00 ? 98  TYR A OH   4  
ATOM 7270  H H    . TYR A 1 98  ? -11.598 0.382   -8.988  1.00 0.00 ? 98  TYR A H    4  
ATOM 7271  H HA   . TYR A 1 98  ? -11.434 1.916   -6.483  1.00 0.00 ? 98  TYR A HA   4  
ATOM 7272  H HB2  . TYR A 1 98  ? -10.827 -0.979  -7.272  1.00 0.00 ? 98  TYR A HB2  4  
ATOM 7273  H HB3  . TYR A 1 98  ? -9.931  -0.260  -5.949  1.00 0.00 ? 98  TYR A HB3  4  
ATOM 7274  H HD1  . TYR A 1 98  ? -11.070 0.355   -3.843  1.00 0.00 ? 98  TYR A HD1  4  
ATOM 7275  H HD2  . TYR A 1 98  ? -13.173 -1.566  -7.035  1.00 0.00 ? 98  TYR A HD2  4  
ATOM 7276  H HE1  . TYR A 1 98  ? -12.964 -0.233  -2.251  1.00 0.00 ? 98  TYR A HE1  4  
ATOM 7277  H HE2  . TYR A 1 98  ? -15.059 -2.147  -5.433  1.00 0.00 ? 98  TYR A HE2  4  
ATOM 7278  H HH   . TYR A 1 98  ? -15.548 -0.689  -2.622  1.00 0.00 ? 98  TYR A HH   4  
ATOM 7279  N N    . LEU A 1 99  ? -9.165  2.695   -7.023  1.00 0.00 ? 99  LEU A N    4  
ATOM 7280  C CA   . LEU A 1 99  ? -7.870  3.247   -7.383  1.00 0.00 ? 99  LEU A CA   4  
ATOM 7281  C C    . LEU A 1 99  ? -6.793  2.641   -6.481  1.00 0.00 ? 99  LEU A C    4  
ATOM 7282  O O    . LEU A 1 99  ? -6.809  2.844   -5.268  1.00 0.00 ? 99  LEU A O    4  
ATOM 7283  C CB   . LEU A 1 99  ? -7.911  4.776   -7.351  1.00 0.00 ? 99  LEU A CB   4  
ATOM 7284  C CG   . LEU A 1 99  ? -6.556  5.484   -7.394  1.00 0.00 ? 99  LEU A CG   4  
ATOM 7285  C CD1  . LEU A 1 99  ? -5.862  5.425   -6.032  1.00 0.00 ? 99  LEU A CD1  4  
ATOM 7286  C CD2  . LEU A 1 99  ? -5.676  4.917   -8.510  1.00 0.00 ? 99  LEU A CD2  4  
ATOM 7287  H H    . LEU A 1 99  ? -9.647  3.187   -6.298  1.00 0.00 ? 99  LEU A H    4  
ATOM 7288  H HA   . LEU A 1 99  ? -7.664  2.952   -8.412  1.00 0.00 ? 99  LEU A HA   4  
ATOM 7289  H HB2  . LEU A 1 99  ? -8.507  5.122   -8.195  1.00 0.00 ? 99  LEU A HB2  4  
ATOM 7290  H HB3  . LEU A 1 99  ? -8.432  5.086   -6.445  1.00 0.00 ? 99  LEU A HB3  4  
ATOM 7291  H HG   . LEU A 1 99  ? -6.727  6.536   -7.623  1.00 0.00 ? 99  LEU A HG   4  
ATOM 7292  H HD11 . LEU A 1 99  ? -5.304  4.493   -5.949  1.00 0.00 ? 99  LEU A HD11 4  
ATOM 7293  H HD12 . LEU A 1 99  ? -5.178  6.268   -5.936  1.00 0.00 ? 99  LEU A HD12 4  
ATOM 7294  H HD13 . LEU A 1 99  ? -6.610  5.472   -5.241  1.00 0.00 ? 99  LEU A HD13 4  
ATOM 7295  H HD21 . LEU A 1 99  ? -5.909  3.862   -8.656  1.00 0.00 ? 99  LEU A HD21 4  
ATOM 7296  H HD22 . LEU A 1 99  ? -5.866  5.462   -9.435  1.00 0.00 ? 99  LEU A HD22 4  
ATOM 7297  H HD23 . LEU A 1 99  ? -4.627  5.022   -8.235  1.00 0.00 ? 99  LEU A HD23 4  
ATOM 7298  N N    . PHE A 1 100 ? -5.884  1.909   -7.108  1.00 0.00 ? 100 PHE A N    4  
ATOM 7299  C CA   . PHE A 1 100 ? -4.802  1.272   -6.377  1.00 0.00 ? 100 PHE A CA   4  
ATOM 7300  C C    . PHE A 1 100 ? -3.519  2.102   -6.463  1.00 0.00 ? 100 PHE A C    4  
ATOM 7301  O O    . PHE A 1 100 ? -2.939  2.245   -7.539  1.00 0.00 ? 100 PHE A O    4  
ATOM 7302  C CB   . PHE A 1 100 ? -4.560  -0.089  -7.031  1.00 0.00 ? 100 PHE A CB   4  
ATOM 7303  C CG   . PHE A 1 100 ? -5.497  -1.193  -6.537  1.00 0.00 ? 100 PHE A CG   4  
ATOM 7304  C CD1  . PHE A 1 100 ? -6.778  -1.251  -6.991  1.00 0.00 ? 100 PHE A CD1  4  
ATOM 7305  C CD2  . PHE A 1 100 ? -5.049  -2.116  -5.644  1.00 0.00 ? 100 PHE A CD2  4  
ATOM 7306  C CE1  . PHE A 1 100 ? -7.647  -2.276  -6.532  1.00 0.00 ? 100 PHE A CE1  4  
ATOM 7307  C CE2  . PHE A 1 100 ? -5.919  -3.140  -5.185  1.00 0.00 ? 100 PHE A CE2  4  
ATOM 7308  C CZ   . PHE A 1 100 ? -7.200  -3.198  -5.639  1.00 0.00 ? 100 PHE A CZ   4  
ATOM 7309  H H    . PHE A 1 100 ? -5.879  1.749   -8.095  1.00 0.00 ? 100 PHE A H    4  
ATOM 7310  H HA   . PHE A 1 100 ? -5.115  1.198   -5.335  1.00 0.00 ? 100 PHE A HA   4  
ATOM 7311  H HB2  . PHE A 1 100 ? -4.673  0.013   -8.111  1.00 0.00 ? 100 PHE A HB2  4  
ATOM 7312  H HB3  . PHE A 1 100 ? -3.529  -0.392  -6.846  1.00 0.00 ? 100 PHE A HB3  4  
ATOM 7313  H HD1  . PHE A 1 100 ? -7.136  -0.512  -7.707  1.00 0.00 ? 100 PHE A HD1  4  
ATOM 7314  H HD2  . PHE A 1 100 ? -4.023  -2.069  -5.280  1.00 0.00 ? 100 PHE A HD2  4  
ATOM 7315  H HE1  . PHE A 1 100 ? -8.674  -2.322  -6.896  1.00 0.00 ? 100 PHE A HE1  4  
ATOM 7316  H HE2  . PHE A 1 100 ? -5.560  -3.880  -4.470  1.00 0.00 ? 100 PHE A HE2  4  
ATOM 7317  H HZ   . PHE A 1 100 ? -7.868  -3.985  -5.287  1.00 0.00 ? 100 PHE A HZ   4  
ATOM 7318  N N    . ARG A 1 101 ? -3.113  2.627   -5.316  1.00 0.00 ? 101 ARG A N    4  
ATOM 7319  C CA   . ARG A 1 101 ? -1.910  3.438   -5.249  1.00 0.00 ? 101 ARG A CA   4  
ATOM 7320  C C    . ARG A 1 101 ? -0.761  2.634   -4.639  1.00 0.00 ? 101 ARG A C    4  
ATOM 7321  O O    . ARG A 1 101 ? -0.792  2.300   -3.455  1.00 0.00 ? 101 ARG A O    4  
ATOM 7322  C CB   . ARG A 1 101 ? -2.142  4.698   -4.413  1.00 0.00 ? 101 ARG A CB   4  
ATOM 7323  C CG   . ARG A 1 101 ? -1.388  5.893   -5.001  1.00 0.00 ? 101 ARG A CG   4  
ATOM 7324  C CD   . ARG A 1 101 ? -2.167  7.192   -4.787  1.00 0.00 ? 101 ARG A CD   4  
ATOM 7325  N NE   . ARG A 1 101 ? -1.306  8.355   -5.099  1.00 0.00 ? 101 ARG A NE   4  
ATOM 7326  C CZ   . ARG A 1 101 ? -1.657  9.630   -4.879  1.00 0.00 ? 101 ARG A CZ   4  
ATOM 7327  N NH1  . ARG A 1 101 ? -2.853  9.913   -4.344  1.00 0.00 ? 101 ARG A NH1  4  
ATOM 7328  N NH2  . ARG A 1 101 ? -0.812  10.621  -5.193  1.00 0.00 ? 101 ARG A NH2  4  
ATOM 7329  H H    . ARG A 1 101 ? -3.591  2.506   -4.446  1.00 0.00 ? 101 ARG A H    4  
ATOM 7330  H HA   . ARG A 1 101 ? -1.696  3.705   -6.284  1.00 0.00 ? 101 ARG A HA   4  
ATOM 7331  H HB2  . ARG A 1 101 ? -3.208  4.921   -4.372  1.00 0.00 ? 101 ARG A HB2  4  
ATOM 7332  H HB3  . ARG A 1 101 ? -1.813  4.525   -3.388  1.00 0.00 ? 101 ARG A HB3  4  
ATOM 7333  H HG2  . ARG A 1 101 ? -0.405  5.973   -4.535  1.00 0.00 ? 101 ARG A HG2  4  
ATOM 7334  H HG3  . ARG A 1 101 ? -1.223  5.735   -6.067  1.00 0.00 ? 101 ARG A HG3  4  
ATOM 7335  H HD2  . ARG A 1 101 ? -3.052  7.204   -5.422  1.00 0.00 ? 101 ARG A HD2  4  
ATOM 7336  H HD3  . ARG A 1 101 ? -2.513  7.252   -3.755  1.00 0.00 ? 101 ARG A HD3  4  
ATOM 7337  H HE   . ARG A 1 101 ? -0.407  8.179   -5.499  1.00 0.00 ? 101 ARG A HE   4  
ATOM 7338  H HH11 . ARG A 1 101 ? -3.484  9.173   -4.110  1.00 0.00 ? 101 ARG A HH11 4  
ATOM 7339  H HH12 . ARG A 1 101 ? -3.115  10.864  -4.180  1.00 0.00 ? 101 ARG A HH12 4  
ATOM 7340  H HH21 . ARG A 1 101 ? 0.080   10.410  -5.592  1.00 0.00 ? 101 ARG A HH21 4  
ATOM 7341  H HH22 . ARG A 1 101 ? -1.074  11.572  -5.029  1.00 0.00 ? 101 ARG A HH22 4  
ATOM 7342  N N    . ILE A 1 102 ? 0.226   2.345   -5.474  1.00 0.00 ? 102 ILE A N    4  
ATOM 7343  C CA   . ILE A 1 102 ? 1.384   1.586   -5.031  1.00 0.00 ? 102 ILE A CA   4  
ATOM 7344  C C    . ILE A 1 102 ? 2.525   2.550   -4.702  1.00 0.00 ? 102 ILE A C    4  
ATOM 7345  O O    . ILE A 1 102 ? 2.758   3.514   -5.430  1.00 0.00 ? 102 ILE A O    4  
ATOM 7346  C CB   . ILE A 1 102 ? 1.756   0.524   -6.068  1.00 0.00 ? 102 ILE A CB   4  
ATOM 7347  C CG1  . ILE A 1 102 ? 0.674   -0.555  -6.160  1.00 0.00 ? 102 ILE A CG1  4  
ATOM 7348  C CG2  . ILE A 1 102 ? 3.134   -0.071  -5.773  1.00 0.00 ? 102 ILE A CG2  4  
ATOM 7349  C CD1  . ILE A 1 102 ? 0.659   -1.199  -7.548  1.00 0.00 ? 102 ILE A CD1  4  
ATOM 7350  H H    . ILE A 1 102 ? 0.244   2.620   -6.435  1.00 0.00 ? 102 ILE A H    4  
ATOM 7351  H HA   . ILE A 1 102 ? 1.101   1.061   -4.119  1.00 0.00 ? 102 ILE A HA   4  
ATOM 7352  H HB   . ILE A 1 102 ? 1.815   1.005   -7.044  1.00 0.00 ? 102 ILE A HB   4  
ATOM 7353  H HG12 . ILE A 1 102 ? 0.851   -1.318  -5.403  1.00 0.00 ? 102 ILE A HG12 4  
ATOM 7354  H HG13 . ILE A 1 102 ? -0.301  -0.116  -5.948  1.00 0.00 ? 102 ILE A HG13 4  
ATOM 7355  H HG21 . ILE A 1 102 ? 3.502   -0.592  -6.657  1.00 0.00 ? 102 ILE A HG21 4  
ATOM 7356  H HG22 . ILE A 1 102 ? 3.826   0.728   -5.508  1.00 0.00 ? 102 ILE A HG22 4  
ATOM 7357  H HG23 . ILE A 1 102 ? 3.056   -0.774  -4.943  1.00 0.00 ? 102 ILE A HG23 4  
ATOM 7358  H HD11 . ILE A 1 102 ? -0.053  -0.673  -8.185  1.00 0.00 ? 102 ILE A HD11 4  
ATOM 7359  H HD12 . ILE A 1 102 ? 1.654   -1.137  -7.988  1.00 0.00 ? 102 ILE A HD12 4  
ATOM 7360  H HD13 . ILE A 1 102 ? 0.364   -2.244  -7.460  1.00 0.00 ? 102 ILE A HD13 4  
ATOM 7361  N N    . THR A 1 103 ? 3.207   2.256   -3.605  1.00 0.00 ? 103 THR A N    4  
ATOM 7362  C CA   . THR A 1 103 ? 4.318   3.085   -3.170  1.00 0.00 ? 103 THR A CA   4  
ATOM 7363  C C    . THR A 1 103 ? 5.369   2.235   -2.453  1.00 0.00 ? 103 THR A C    4  
ATOM 7364  O O    . THR A 1 103 ? 5.061   1.155   -1.951  1.00 0.00 ? 103 THR A O    4  
ATOM 7365  C CB   . THR A 1 103 ? 3.756   4.214   -2.304  1.00 0.00 ? 103 THR A CB   4  
ATOM 7366  O OG1  . THR A 1 103 ? 2.649   4.707   -3.054  1.00 0.00 ? 103 THR A OG1  4  
ATOM 7367  C CG2  . THR A 1 103 ? 4.706   5.410   -2.213  1.00 0.00 ? 103 THR A CG2  4  
ATOM 7368  H H    . THR A 1 103 ? 3.011   1.471   -3.018  1.00 0.00 ? 103 THR A H    4  
ATOM 7369  H HA   . THR A 1 103 ? 4.798   3.508   -4.053  1.00 0.00 ? 103 THR A HA   4  
ATOM 7370  H HB   . THR A 1 103 ? 3.492   3.850   -1.312  1.00 0.00 ? 103 THR A HB   4  
ATOM 7371  H HG1  . THR A 1 103 ? 2.026   5.209   -2.453  1.00 0.00 ? 103 THR A HG1  4  
ATOM 7372  H HG21 . THR A 1 103 ? 5.722   5.055   -2.043  1.00 0.00 ? 103 THR A HG21 4  
ATOM 7373  H HG22 . THR A 1 103 ? 4.669   5.976   -3.144  1.00 0.00 ? 103 THR A HG22 4  
ATOM 7374  H HG23 . THR A 1 103 ? 4.403   6.052   -1.386  1.00 0.00 ? 103 THR A HG23 4  
ATOM 7375  N N    . ALA A 1 104 ? 6.587   2.755   -2.426  1.00 0.00 ? 104 ALA A N    4  
ATOM 7376  C CA   . ALA A 1 104 ? 7.685   2.057   -1.778  1.00 0.00 ? 104 ALA A CA   4  
ATOM 7377  C C    . ALA A 1 104 ? 8.117   2.838   -0.535  1.00 0.00 ? 104 ALA A C    4  
ATOM 7378  O O    . ALA A 1 104 ? 7.858   4.036   -0.429  1.00 0.00 ? 104 ALA A O    4  
ATOM 7379  C CB   . ALA A 1 104 ? 8.830   1.869   -2.775  1.00 0.00 ? 104 ALA A CB   4  
ATOM 7380  H H    . ALA A 1 104 ? 6.829   3.634   -2.836  1.00 0.00 ? 104 ALA A H    4  
ATOM 7381  H HA   . ALA A 1 104 ? 7.320   1.076   -1.473  1.00 0.00 ? 104 ALA A HA   4  
ATOM 7382  H HB1  . ALA A 1 104 ? 9.748   1.641   -2.235  1.00 0.00 ? 104 ALA A HB1  4  
ATOM 7383  H HB2  . ALA A 1 104 ? 8.592   1.047   -3.451  1.00 0.00 ? 104 ALA A HB2  4  
ATOM 7384  H HB3  . ALA A 1 104 ? 8.964   2.785   -3.351  1.00 0.00 ? 104 ALA A HB3  4  
ATOM 7385  N N    . GLN A 1 105 ? 8.767   2.127   0.374   1.00 0.00 ? 105 GLN A N    4  
ATOM 7386  C CA   . GLN A 1 105 ? 9.237   2.738   1.606   1.00 0.00 ? 105 GLN A CA   4  
ATOM 7387  C C    . GLN A 1 105 ? 10.751  2.559   1.743   1.00 0.00 ? 105 GLN A C    4  
ATOM 7388  O O    . GLN A 1 105 ? 11.250  1.435   1.728   1.00 0.00 ? 105 GLN A O    4  
ATOM 7389  C CB   . GLN A 1 105 ? 8.505   2.161   2.819   1.00 0.00 ? 105 GLN A CB   4  
ATOM 7390  C CG   . GLN A 1 105 ? 9.030   2.773   4.119   1.00 0.00 ? 105 GLN A CG   4  
ATOM 7391  C CD   . GLN A 1 105 ? 8.687   1.889   5.319   1.00 0.00 ? 105 GLN A CD   4  
ATOM 7392  O OE1  . GLN A 1 105 ? 8.818   0.676   5.287   1.00 0.00 ? 105 GLN A OE1  4  
ATOM 7393  N NE2  . GLN A 1 105 ? 8.242   2.561   6.377   1.00 0.00 ? 105 GLN A NE2  4  
ATOM 7394  H H    . GLN A 1 105 ? 8.973   1.153   0.280   1.00 0.00 ? 105 GLN A H    4  
ATOM 7395  H HA   . GLN A 1 105 ? 8.997   3.797   1.514   1.00 0.00 ? 105 GLN A HA   4  
ATOM 7396  H HB2  . GLN A 1 105 ? 7.436   2.354   2.728   1.00 0.00 ? 105 GLN A HB2  4  
ATOM 7397  H HB3  . GLN A 1 105 ? 8.632   1.079   2.844   1.00 0.00 ? 105 GLN A HB3  4  
ATOM 7398  H HG2  . GLN A 1 105 ? 10.111  2.902   4.054   1.00 0.00 ? 105 GLN A HG2  4  
ATOM 7399  H HG3  . GLN A 1 105 ? 8.599   3.765   4.258   1.00 0.00 ? 105 GLN A HG3  4  
ATOM 7400  H HE21 . GLN A 1 105 ? 8.159   3.557   6.338   1.00 0.00 ? 105 GLN A HE21 4  
ATOM 7401  H HE22 . GLN A 1 105 ? 7.992   2.070   7.212   1.00 0.00 ? 105 GLN A HE22 4  
ATOM 7402  N N    . THR A 1 106 ? 11.438  3.684   1.874   1.00 0.00 ? 106 THR A N    4  
ATOM 7403  C CA   . THR A 1 106 ? 12.884  3.666   2.014   1.00 0.00 ? 106 THR A CA   4  
ATOM 7404  C C    . THR A 1 106 ? 13.305  4.384   3.297   1.00 0.00 ? 106 THR A C    4  
ATOM 7405  O O    . THR A 1 106 ? 12.469  4.682   4.149   1.00 0.00 ? 106 THR A O    4  
ATOM 7406  C CB   . THR A 1 106 ? 13.489  4.277   0.749   1.00 0.00 ? 106 THR A CB   4  
ATOM 7407  O OG1  . THR A 1 106 ? 12.653  5.396   0.469   1.00 0.00 ? 106 THR A OG1  4  
ATOM 7408  C CG2  . THR A 1 106 ? 13.324  3.374   -0.475  1.00 0.00 ? 106 THR A CG2  4  
ATOM 7409  H H    . THR A 1 106 ? 11.024  4.594   1.885   1.00 0.00 ? 106 THR A H    4  
ATOM 7410  H HA   . THR A 1 106 ? 13.207  2.629   2.107   1.00 0.00 ? 106 THR A HA   4  
ATOM 7411  H HB   . THR A 1 106 ? 14.537  4.535   0.904   1.00 0.00 ? 106 THR A HB   4  
ATOM 7412  H HG1  . THR A 1 106 ? 11.761  5.084   0.142   1.00 0.00 ? 106 THR A HG1  4  
ATOM 7413  H HG21 . THR A 1 106 ? 12.291  3.032   -0.538  1.00 0.00 ? 106 THR A HG21 4  
ATOM 7414  H HG22 . THR A 1 106 ? 13.577  3.933   -1.376  1.00 0.00 ? 106 THR A HG22 4  
ATOM 7415  H HG23 . THR A 1 106 ? 13.987  2.513   -0.384  1.00 0.00 ? 106 THR A HG23 4  
ATOM 7416  N N    . ARG A 1 107 ? 14.601  4.642   3.395   1.00 0.00 ? 107 ARG A N    4  
ATOM 7417  C CA   . ARG A 1 107 ? 15.143  5.320   4.561   1.00 0.00 ? 107 ARG A CA   4  
ATOM 7418  C C    . ARG A 1 107 ? 14.756  6.800   4.541   1.00 0.00 ? 107 ARG A C    4  
ATOM 7419  O O    . ARG A 1 107 ? 14.827  7.477   5.566   1.00 0.00 ? 107 ARG A O    4  
ATOM 7420  C CB   . ARG A 1 107 ? 16.668  5.199   4.609   1.00 0.00 ? 107 ARG A CB   4  
ATOM 7421  C CG   . ARG A 1 107 ? 17.313  5.934   3.433   1.00 0.00 ? 107 ARG A CG   4  
ATOM 7422  C CD   . ARG A 1 107 ? 18.835  5.777   3.457   1.00 0.00 ? 107 ARG A CD   4  
ATOM 7423  N NE   . ARG A 1 107 ? 19.451  6.921   4.167   1.00 0.00 ? 107 ARG A NE   4  
ATOM 7424  C CZ   . ARG A 1 107 ? 20.758  7.211   4.132   1.00 0.00 ? 107 ARG A CZ   4  
ATOM 7425  N NH1  . ARG A 1 107 ? 21.596  6.443   3.423   1.00 0.00 ? 107 ARG A NH1  4  
ATOM 7426  N NH2  . ARG A 1 107 ? 21.228  8.269   4.807   1.00 0.00 ? 107 ARG A NH2  4  
ATOM 7427  H H    . ARG A 1 107 ? 15.274  4.396   2.698   1.00 0.00 ? 107 ARG A H    4  
ATOM 7428  H HA   . ARG A 1 107 ? 14.696  4.809   5.413   1.00 0.00 ? 107 ARG A HA   4  
ATOM 7429  H HB2  . ARG A 1 107 ? 17.039  5.610   5.548   1.00 0.00 ? 107 ARG A HB2  4  
ATOM 7430  H HB3  . ARG A 1 107 ? 16.953  4.147   4.586   1.00 0.00 ? 107 ARG A HB3  4  
ATOM 7431  H HG2  . ARG A 1 107 ? 16.919  5.544   2.494   1.00 0.00 ? 107 ARG A HG2  4  
ATOM 7432  H HG3  . ARG A 1 107 ? 17.053  6.991   3.473   1.00 0.00 ? 107 ARG A HG3  4  
ATOM 7433  H HD2  . ARG A 1 107 ? 19.105  4.844   3.951   1.00 0.00 ? 107 ARG A HD2  4  
ATOM 7434  H HD3  . ARG A 1 107 ? 19.220  5.721   2.439   1.00 0.00 ? 107 ARG A HD3  4  
ATOM 7435  H HE   . ARG A 1 107 ? 18.853  7.514   4.706   1.00 0.00 ? 107 ARG A HE   4  
ATOM 7436  H HH11 . ARG A 1 107 ? 21.246  5.653   2.919   1.00 0.00 ? 107 ARG A HH11 4  
ATOM 7437  H HH12 . ARG A 1 107 ? 22.572  6.659   3.397   1.00 0.00 ? 107 ARG A HH12 4  
ATOM 7438  H HH21 . ARG A 1 107 ? 20.603  8.842   5.337   1.00 0.00 ? 107 ARG A HH21 4  
ATOM 7439  H HH22 . ARG A 1 107 ? 22.204  8.485   4.782   1.00 0.00 ? 107 ARG A HH22 4  
ATOM 7440  N N    . LYS A 1 108 ? 14.356  7.259   3.364   1.00 0.00 ? 108 LYS A N    4  
ATOM 7441  C CA   . LYS A 1 108 ? 13.958  8.646   3.198   1.00 0.00 ? 108 LYS A CA   4  
ATOM 7442  C C    . LYS A 1 108 ? 12.472  8.790   3.534   1.00 0.00 ? 108 LYS A C    4  
ATOM 7443  O O    . LYS A 1 108 ? 12.074  9.736   4.211   1.00 0.00 ? 108 LYS A O    4  
ATOM 7444  C CB   . LYS A 1 108 ? 14.323  9.145   1.798   1.00 0.00 ? 108 LYS A CB   4  
ATOM 7445  C CG   . LYS A 1 108 ? 15.749  8.733   1.425   1.00 0.00 ? 108 LYS A CG   4  
ATOM 7446  C CD   . LYS A 1 108 ? 16.755  9.239   2.461   1.00 0.00 ? 108 LYS A CD   4  
ATOM 7447  C CE   . LYS A 1 108 ? 16.853  10.765  2.431   1.00 0.00 ? 108 LYS A CE   4  
ATOM 7448  N NZ   . LYS A 1 108 ? 17.600  11.213  1.235   1.00 0.00 ? 108 LYS A NZ   4  
ATOM 7449  H H    . LYS A 1 108 ? 14.301  6.701   2.536   1.00 0.00 ? 108 LYS A H    4  
ATOM 7450  H HA   . LYS A 1 108 ? 14.532  9.239   3.911   1.00 0.00 ? 108 LYS A HA   4  
ATOM 7451  H HB2  . LYS A 1 108 ? 13.621  8.740   1.069   1.00 0.00 ? 108 LYS A HB2  4  
ATOM 7452  H HB3  . LYS A 1 108 ? 14.232  10.230  1.760   1.00 0.00 ? 108 LYS A HB3  4  
ATOM 7453  H HG2  . LYS A 1 108 ? 15.811  7.648   1.352   1.00 0.00 ? 108 LYS A HG2  4  
ATOM 7454  H HG3  . LYS A 1 108 ? 16.001  9.134   0.443   1.00 0.00 ? 108 LYS A HG3  4  
ATOM 7455  H HD2  . LYS A 1 108 ? 16.454  8.909   3.456   1.00 0.00 ? 108 LYS A HD2  4  
ATOM 7456  H HD3  . LYS A 1 108 ? 17.734  8.804   2.264   1.00 0.00 ? 108 LYS A HD3  4  
ATOM 7457  H HE2  . LYS A 1 108 ? 15.853  11.200  2.426   1.00 0.00 ? 108 LYS A HE2  4  
ATOM 7458  H HE3  . LYS A 1 108 ? 17.351  11.121  3.333   1.00 0.00 ? 108 LYS A HE3  4  
ATOM 7459  H HZ1  . LYS A 1 108 ? 18.289  11.886  1.505   1.00 0.00 ? 108 LYS A HZ1  4  
ATOM 7460  H HZ2  . LYS A 1 108 ? 18.049  10.428  0.809   1.00 0.00 ? 108 LYS A HZ2  4  
ATOM 7461  H HZ3  . LYS A 1 108 ? 16.966  11.629  0.582   1.00 0.00 ? 108 LYS A HZ3  4  
ATOM 7462  N N    . GLY A 1 109 ? 11.693  7.837   3.045   1.00 0.00 ? 109 GLY A N    4  
ATOM 7463  C CA   . GLY A 1 109 ? 10.260  7.845   3.284   1.00 0.00 ? 109 GLY A CA   4  
ATOM 7464  C C    . GLY A 1 109 ? 9.511   7.132   2.157   1.00 0.00 ? 109 GLY A C    4  
ATOM 7465  O O    . GLY A 1 109 ? 9.917   6.055   1.721   1.00 0.00 ? 109 GLY A O    4  
ATOM 7466  H H    . GLY A 1 109 ? 12.025  7.070   2.495   1.00 0.00 ? 109 GLY A H    4  
ATOM 7467  H HA2  . GLY A 1 109 ? 10.044  7.357   4.235   1.00 0.00 ? 109 GLY A HA2  4  
ATOM 7468  H HA3  . GLY A 1 109 ? 9.907   8.873   3.366   1.00 0.00 ? 109 GLY A HA3  4  
ATOM 7469  N N    . TRP A 1 110 ? 8.432   7.761   1.716   1.00 0.00 ? 110 TRP A N    4  
ATOM 7470  C CA   . TRP A 1 110 ? 7.623   7.200   0.647   1.00 0.00 ? 110 TRP A CA   4  
ATOM 7471  C C    . TRP A 1 110 ? 7.775   8.097   -0.583  1.00 0.00 ? 110 TRP A C    4  
ATOM 7472  O O    . TRP A 1 110 ? 7.400   9.268   -0.552  1.00 0.00 ? 110 TRP A O    4  
ATOM 7473  C CB   . TRP A 1 110 ? 6.167   7.035   1.090   1.00 0.00 ? 110 TRP A CB   4  
ATOM 7474  C CG   . TRP A 1 110 ? 5.976   6.053   2.248   1.00 0.00 ? 110 TRP A CG   4  
ATOM 7475  C CD1  . TRP A 1 110 ? 6.044   6.305   3.562   1.00 0.00 ? 110 TRP A CD1  4  
ATOM 7476  C CD2  . TRP A 1 110 ? 5.682   4.645   2.141   1.00 0.00 ? 110 TRP A CD2  4  
ATOM 7477  N NE1  . TRP A 1 110 ? 5.816   5.167   4.308   1.00 0.00 ? 110 TRP A NE1  4  
ATOM 7478  C CE2  . TRP A 1 110 ? 5.588   4.125   3.416   1.00 0.00 ? 110 TRP A CE2  4  
ATOM 7479  C CE3  . TRP A 1 110 ? 5.500   3.836   1.005   1.00 0.00 ? 110 TRP A CE3  4  
ATOM 7480  C CZ2  . TRP A 1 110 ? 5.311   2.777   3.676   1.00 0.00 ? 110 TRP A CZ2  4  
ATOM 7481  C CZ3  . TRP A 1 110 ? 5.224   2.492   1.282   1.00 0.00 ? 110 TRP A CZ3  4  
ATOM 7482  C CH2  . TRP A 1 110 ? 5.126   1.953   2.560   1.00 0.00 ? 110 TRP A CH2  4  
ATOM 7483  H H    . TRP A 1 110 ? 8.109   8.636   2.075   1.00 0.00 ? 110 TRP A H    4  
ATOM 7484  H HA   . TRP A 1 110 ? 8.003   6.202   0.430   1.00 0.00 ? 110 TRP A HA   4  
ATOM 7485  H HB2  . TRP A 1 110 ? 5.775   8.008   1.384   1.00 0.00 ? 110 TRP A HB2  4  
ATOM 7486  H HB3  . TRP A 1 110 ? 5.576   6.697   0.239   1.00 0.00 ? 110 TRP A HB3  4  
ATOM 7487  H HD1  . TRP A 1 110 ? 6.253   7.286   3.989   1.00 0.00 ? 110 TRP A HD1  4  
ATOM 7488  H HE1  . TRP A 1 110 ? 5.813   5.097   5.396   1.00 0.00 ? 110 TRP A HE1  4  
ATOM 7489  H HE3  . TRP A 1 110 ? 5.569   4.223   -0.011  1.00 0.00 ? 110 TRP A HE3  4  
ATOM 7490  H HZ2  . TRP A 1 110 ? 5.242   2.391   4.693   1.00 0.00 ? 110 TRP A HZ2  4  
ATOM 7491  H HZ3  . TRP A 1 110 ? 5.074   1.821   0.436   1.00 0.00 ? 110 TRP A HZ3  4  
ATOM 7492  H HH2  . TRP A 1 110 ? 4.907   0.894   2.692   1.00 0.00 ? 110 TRP A HH2  4  
ATOM 7493  N N    . GLY A 1 111 ? 8.327   7.514   -1.636  1.00 0.00 ? 111 GLY A N    4  
ATOM 7494  C CA   . GLY A 1 111 ? 8.535   8.246   -2.874  1.00 0.00 ? 111 GLY A CA   4  
ATOM 7495  C C    . GLY A 1 111 ? 7.242   8.320   -3.690  1.00 0.00 ? 111 GLY A C    4  
ATOM 7496  O O    . GLY A 1 111 ? 6.148   8.286   -3.131  1.00 0.00 ? 111 GLY A O    4  
ATOM 7497  H H    . GLY A 1 111 ? 8.630   6.561   -1.653  1.00 0.00 ? 111 GLY A H    4  
ATOM 7498  H HA2  . GLY A 1 111 ? 8.886   9.253   -2.651  1.00 0.00 ? 111 GLY A HA2  4  
ATOM 7499  H HA3  . GLY A 1 111 ? 9.313   7.760   -3.462  1.00 0.00 ? 111 GLY A HA3  4  
ATOM 7500  N N    . GLU A 1 112 ? 7.413   8.419   -5.001  1.00 0.00 ? 112 GLU A N    4  
ATOM 7501  C CA   . GLU A 1 112 ? 6.274   8.498   -5.899  1.00 0.00 ? 112 GLU A CA   4  
ATOM 7502  C C    . GLU A 1 112 ? 5.334   7.312   -5.671  1.00 0.00 ? 112 GLU A C    4  
ATOM 7503  O O    . GLU A 1 112 ? 5.720   6.319   -5.055  1.00 0.00 ? 112 GLU A O    4  
ATOM 7504  C CB   . GLU A 1 112 ? 6.730   8.563   -7.358  1.00 0.00 ? 112 GLU A CB   4  
ATOM 7505  C CG   . GLU A 1 112 ? 6.263   9.861   -8.021  1.00 0.00 ? 112 GLU A CG   4  
ATOM 7506  C CD   . GLU A 1 112 ? 7.417   10.859  -8.144  1.00 0.00 ? 112 GLU A CD   4  
ATOM 7507  O OE1  . GLU A 1 112 ? 8.538   10.397  -8.445  1.00 0.00 ? 112 GLU A OE1  4  
ATOM 7508  O OE2  . GLU A 1 112 ? 7.151   12.062  -7.933  1.00 0.00 ? 112 GLU A OE2  4  
ATOM 7509  H H    . GLU A 1 112 ? 8.307   8.446   -5.448  1.00 0.00 ? 112 GLU A H    4  
ATOM 7510  H HA   . GLU A 1 112 ? 5.765   9.427   -5.642  1.00 0.00 ? 112 GLU A HA   4  
ATOM 7511  H HB2  . GLU A 1 112 ? 7.817   8.497   -7.406  1.00 0.00 ? 112 GLU A HB2  4  
ATOM 7512  H HB3  . GLU A 1 112 ? 6.334   7.708   -7.906  1.00 0.00 ? 112 GLU A HB3  4  
ATOM 7513  H HG2  . GLU A 1 112 ? 5.859   9.644   -9.009  1.00 0.00 ? 112 GLU A HG2  4  
ATOM 7514  H HG3  . GLU A 1 112 ? 5.456   10.303  -7.436  1.00 0.00 ? 112 GLU A HG3  4  
ATOM 7515  N N    . ALA A 1 113 ? 4.119   7.454   -6.180  1.00 0.00 ? 113 ALA A N    4  
ATOM 7516  C CA   . ALA A 1 113 ? 3.122   6.407   -6.040  1.00 0.00 ? 113 ALA A CA   4  
ATOM 7517  C C    . ALA A 1 113 ? 2.422   6.192   -7.383  1.00 0.00 ? 113 ALA A C    4  
ATOM 7518  O O    . ALA A 1 113 ? 2.058   7.153   -8.058  1.00 0.00 ? 113 ALA A O    4  
ATOM 7519  C CB   . ALA A 1 113 ? 2.143   6.780   -4.925  1.00 0.00 ? 113 ALA A CB   4  
ATOM 7520  H H    . ALA A 1 113 ? 3.814   8.264   -6.680  1.00 0.00 ? 113 ALA A H    4  
ATOM 7521  H HA   . ALA A 1 113 ? 3.641   5.490   -5.759  1.00 0.00 ? 113 ALA A HA   4  
ATOM 7522  H HB1  . ALA A 1 113 ? 2.695   7.189   -4.078  1.00 0.00 ? 113 ALA A HB1  4  
ATOM 7523  H HB2  . ALA A 1 113 ? 1.439   7.526   -5.294  1.00 0.00 ? 113 ALA A HB2  4  
ATOM 7524  H HB3  . ALA A 1 113 ? 1.598   5.891   -4.608  1.00 0.00 ? 113 ALA A HB3  4  
ATOM 7525  N N    . ALA A 1 114 ? 2.254   4.924   -7.730  1.00 0.00 ? 114 ALA A N    4  
ATOM 7526  C CA   . ALA A 1 114 ? 1.603   4.571   -8.981  1.00 0.00 ? 114 ALA A CA   4  
ATOM 7527  C C    . ALA A 1 114 ? 0.117   4.315   -8.723  1.00 0.00 ? 114 ALA A C    4  
ATOM 7528  O O    . ALA A 1 114 ? -0.238  3.456   -7.917  1.00 0.00 ? 114 ALA A O    4  
ATOM 7529  C CB   . ALA A 1 114 ? 2.306   3.359   -9.597  1.00 0.00 ? 114 ALA A CB   4  
ATOM 7530  H H    . ALA A 1 114 ? 2.552   4.148   -7.175  1.00 0.00 ? 114 ALA A H    4  
ATOM 7531  H HA   . ALA A 1 114 ? 1.705   5.418   -9.659  1.00 0.00 ? 114 ALA A HA   4  
ATOM 7532  H HB1  . ALA A 1 114 ? 3.327   3.629   -9.865  1.00 0.00 ? 114 ALA A HB1  4  
ATOM 7533  H HB2  . ALA A 1 114 ? 2.322   2.543   -8.875  1.00 0.00 ? 114 ALA A HB2  4  
ATOM 7534  H HB3  . ALA A 1 114 ? 1.767   3.043   -10.490 1.00 0.00 ? 114 ALA A HB3  4  
ATOM 7535  N N    . GLU A 1 115 ? -0.712  5.076   -9.422  1.00 0.00 ? 115 GLU A N    4  
ATOM 7536  C CA   . GLU A 1 115 ? -2.152  4.942   -9.279  1.00 0.00 ? 115 GLU A CA   4  
ATOM 7537  C C    . GLU A 1 115 ? -2.723  4.103   -10.423 1.00 0.00 ? 115 GLU A C    4  
ATOM 7538  O O    . GLU A 1 115 ? -2.521  4.423   -11.594 1.00 0.00 ? 115 GLU A O    4  
ATOM 7539  C CB   . GLU A 1 115 ? -2.826  6.314   -9.216  1.00 0.00 ? 115 GLU A CB   4  
ATOM 7540  C CG   . GLU A 1 115 ? -2.889  6.829   -7.776  1.00 0.00 ? 115 GLU A CG   4  
ATOM 7541  C CD   . GLU A 1 115 ? -3.757  8.085   -7.680  1.00 0.00 ? 115 GLU A CD   4  
ATOM 7542  O OE1  . GLU A 1 115 ? -4.696  8.189   -8.499  1.00 0.00 ? 115 GLU A OE1  4  
ATOM 7543  O OE2  . GLU A 1 115 ? -3.463  8.911   -6.790  1.00 0.00 ? 115 GLU A OE2  4  
ATOM 7544  H H    . GLU A 1 115 ? -0.415  5.773   -10.075 1.00 0.00 ? 115 GLU A H    4  
ATOM 7545  H HA   . GLU A 1 115 ? -2.302  4.426   -8.331  1.00 0.00 ? 115 GLU A HA   4  
ATOM 7546  H HB2  . GLU A 1 115 ? -2.276  7.023   -9.835  1.00 0.00 ? 115 GLU A HB2  4  
ATOM 7547  H HB3  . GLU A 1 115 ? -3.834  6.247   -9.626  1.00 0.00 ? 115 GLU A HB3  4  
ATOM 7548  H HG2  . GLU A 1 115 ? -3.293  6.052   -7.126  1.00 0.00 ? 115 GLU A HG2  4  
ATOM 7549  H HG3  . GLU A 1 115 ? -1.882  7.050   -7.421  1.00 0.00 ? 115 GLU A HG3  4  
ATOM 7550  N N    . ALA A 1 116 ? -3.424  3.044   -10.045 1.00 0.00 ? 116 ALA A N    4  
ATOM 7551  C CA   . ALA A 1 116 ? -4.026  2.156   -11.025 1.00 0.00 ? 116 ALA A CA   4  
ATOM 7552  C C    . ALA A 1 116 ? -5.466  1.847   -10.610 1.00 0.00 ? 116 ALA A C    4  
ATOM 7553  O O    . ALA A 1 116 ? -5.705  1.335   -9.518  1.00 0.00 ? 116 ALA A O    4  
ATOM 7554  C CB   . ALA A 1 116 ? -3.174  0.892   -11.160 1.00 0.00 ? 116 ALA A CB   4  
ATOM 7555  H H    . ALA A 1 116 ? -3.583  2.791   -9.091  1.00 0.00 ? 116 ALA A H    4  
ATOM 7556  H HA   . ALA A 1 116 ? -4.036  2.677   -11.983 1.00 0.00 ? 116 ALA A HA   4  
ATOM 7557  H HB1  . ALA A 1 116 ? -2.994  0.687   -12.216 1.00 0.00 ? 116 ALA A HB1  4  
ATOM 7558  H HB2  . ALA A 1 116 ? -2.222  1.040   -10.651 1.00 0.00 ? 116 ALA A HB2  4  
ATOM 7559  H HB3  . ALA A 1 116 ? -3.700  0.050   -10.711 1.00 0.00 ? 116 ALA A HB3  4  
ATOM 7560  N N    . LEU A 1 117 ? -6.388  2.171   -11.505 1.00 0.00 ? 117 LEU A N    4  
ATOM 7561  C CA   . LEU A 1 117 ? -7.798  1.934   -11.246 1.00 0.00 ? 117 LEU A CA   4  
ATOM 7562  C C    . LEU A 1 117 ? -8.184  0.551   -11.774 1.00 0.00 ? 117 LEU A C    4  
ATOM 7563  O O    . LEU A 1 117 ? -7.668  0.108   -12.798 1.00 0.00 ? 117 LEU A O    4  
ATOM 7564  C CB   . LEU A 1 117 ? -8.647  3.071   -11.819 1.00 0.00 ? 117 LEU A CB   4  
ATOM 7565  C CG   . LEU A 1 117 ? -8.660  4.371   -11.013 1.00 0.00 ? 117 LEU A CG   4  
ATOM 7566  C CD1  . LEU A 1 117 ? -8.604  5.589   -11.937 1.00 0.00 ? 117 LEU A CD1  4  
ATOM 7567  C CD2  . LEU A 1 117 ? -9.864  4.420   -10.071 1.00 0.00 ? 117 LEU A CD2  4  
ATOM 7568  H H    . LEU A 1 117 ? -6.186  2.587   -12.391 1.00 0.00 ? 117 LEU A H    4  
ATOM 7569  H HA   . LEU A 1 117 ? -7.937  1.942   -10.165 1.00 0.00 ? 117 LEU A HA   4  
ATOM 7570  H HB2  . LEU A 1 117 ? -8.288  3.293   -12.825 1.00 0.00 ? 117 LEU A HB2  4  
ATOM 7571  H HB3  . LEU A 1 117 ? -9.673  2.717   -11.918 1.00 0.00 ? 117 LEU A HB3  4  
ATOM 7572  H HG   . LEU A 1 117 ? -7.764  4.397   -10.392 1.00 0.00 ? 117 LEU A HG   4  
ATOM 7573  H HD11 . LEU A 1 117 ? -8.778  6.495   -11.355 1.00 0.00 ? 117 LEU A HD11 4  
ATOM 7574  H HD12 . LEU A 1 117 ? -7.623  5.643   -12.409 1.00 0.00 ? 117 LEU A HD12 4  
ATOM 7575  H HD13 . LEU A 1 117 ? -9.372  5.498   -12.705 1.00 0.00 ? 117 LEU A HD13 4  
ATOM 7576  H HD21 . LEU A 1 117 ? -10.767 4.152   -10.621 1.00 0.00 ? 117 LEU A HD21 4  
ATOM 7577  H HD22 . LEU A 1 117 ? -9.715  3.715   -9.253  1.00 0.00 ? 117 LEU A HD22 4  
ATOM 7578  H HD23 . LEU A 1 117 ? -9.970  5.427   -9.669  1.00 0.00 ? 117 LEU A HD23 4  
ATOM 7579  N N    . VAL A 1 118 ? -9.089  -0.092  -11.051 1.00 0.00 ? 118 VAL A N    4  
ATOM 7580  C CA   . VAL A 1 118 ? -9.551  -1.415  -11.434 1.00 0.00 ? 118 VAL A CA   4  
ATOM 7581  C C    . VAL A 1 118 ? -11.006 -1.590  -10.995 1.00 0.00 ? 118 VAL A C    4  
ATOM 7582  O O    . VAL A 1 118 ? -11.333 -1.393  -9.826  1.00 0.00 ? 118 VAL A O    4  
ATOM 7583  C CB   . VAL A 1 118 ? -8.619  -2.482  -10.855 1.00 0.00 ? 118 VAL A CB   4  
ATOM 7584  C CG1  . VAL A 1 118 ? -8.558  -2.386  -9.329  1.00 0.00 ? 118 VAL A CG1  4  
ATOM 7585  C CG2  . VAL A 1 118 ? -9.046  -3.882  -11.300 1.00 0.00 ? 118 VAL A CG2  4  
ATOM 7586  H H    . VAL A 1 118 ? -9.505  0.276   -10.219 1.00 0.00 ? 118 VAL A H    4  
ATOM 7587  H HA   . VAL A 1 118 ? -9.502  -1.479  -12.521 1.00 0.00 ? 118 VAL A HA   4  
ATOM 7588  H HB   . VAL A 1 118 ? -7.617  -2.298  -11.243 1.00 0.00 ? 118 VAL A HB   4  
ATOM 7589  H HG11 . VAL A 1 118 ? -7.548  -2.111  -9.023  1.00 0.00 ? 118 VAL A HG11 4  
ATOM 7590  H HG12 . VAL A 1 118 ? -9.262  -1.629  -8.984  1.00 0.00 ? 118 VAL A HG12 4  
ATOM 7591  H HG13 . VAL A 1 118 ? -8.818  -3.351  -8.894  1.00 0.00 ? 118 VAL A HG13 4  
ATOM 7592  H HG21 . VAL A 1 118 ? -8.842  -4.595  -10.501 1.00 0.00 ? 118 VAL A HG21 4  
ATOM 7593  H HG22 . VAL A 1 118 ? -10.113 -3.883  -11.524 1.00 0.00 ? 118 VAL A HG22 4  
ATOM 7594  H HG23 . VAL A 1 118 ? -8.487  -4.166  -12.192 1.00 0.00 ? 118 VAL A HG23 4  
ATOM 7595  N N    . VAL A 1 119 ? -11.840 -1.959  -11.956 1.00 0.00 ? 119 VAL A N    4  
ATOM 7596  C CA   . VAL A 1 119 ? -13.253 -2.163  -11.684 1.00 0.00 ? 119 VAL A CA   4  
ATOM 7597  C C    . VAL A 1 119 ? -13.470 -3.592  -11.183 1.00 0.00 ? 119 VAL A C    4  
ATOM 7598  O O    . VAL A 1 119 ? -12.732 -4.503  -11.555 1.00 0.00 ? 119 VAL A O    4  
ATOM 7599  C CB   . VAL A 1 119 ? -14.079 -1.833  -12.928 1.00 0.00 ? 119 VAL A CB   4  
ATOM 7600  C CG1  . VAL A 1 119 ? -15.427 -2.556  -12.899 1.00 0.00 ? 119 VAL A CG1  4  
ATOM 7601  C CG2  . VAL A 1 119 ? -14.270 -0.322  -13.076 1.00 0.00 ? 119 VAL A CG2  4  
ATOM 7602  H H    . VAL A 1 119 ? -11.566 -2.117  -12.905 1.00 0.00 ? 119 VAL A H    4  
ATOM 7603  H HA   . VAL A 1 119 ? -13.539 -1.467  -10.895 1.00 0.00 ? 119 VAL A HA   4  
ATOM 7604  H HB   . VAL A 1 119 ? -13.528 -2.187  -13.800 1.00 0.00 ? 119 VAL A HB   4  
ATOM 7605  H HG11 . VAL A 1 119 ? -16.028 -2.239  -13.751 1.00 0.00 ? 119 VAL A HG11 4  
ATOM 7606  H HG12 . VAL A 1 119 ? -15.263 -3.633  -12.951 1.00 0.00 ? 119 VAL A HG12 4  
ATOM 7607  H HG13 . VAL A 1 119 ? -15.950 -2.312  -11.974 1.00 0.00 ? 119 VAL A HG13 4  
ATOM 7608  H HG21 . VAL A 1 119 ? -15.316 -0.108  -13.298 1.00 0.00 ? 119 VAL A HG21 4  
ATOM 7609  H HG22 . VAL A 1 119 ? -13.988 0.172   -12.146 1.00 0.00 ? 119 VAL A HG22 4  
ATOM 7610  H HG23 . VAL A 1 119 ? -13.643 0.046   -13.888 1.00 0.00 ? 119 VAL A HG23 4  
ATOM 7611  N N    . THR A 1 120 ? -14.486 -3.744  -10.346 1.00 0.00 ? 120 THR A N    4  
ATOM 7612  C CA   . THR A 1 120 ? -14.810 -5.047  -9.791  1.00 0.00 ? 120 THR A CA   4  
ATOM 7613  C C    . THR A 1 120 ? -15.971 -5.681  -10.560 1.00 0.00 ? 120 THR A C    4  
ATOM 7614  O O    . THR A 1 120 ? -17.099 -5.196  -10.500 1.00 0.00 ? 120 THR A O    4  
ATOM 7615  C CB   . THR A 1 120 ? -15.096 -4.867  -8.299  1.00 0.00 ? 120 THR A CB   4  
ATOM 7616  O OG1  . THR A 1 120 ? -15.881 -3.679  -8.237  1.00 0.00 ? 120 THR A OG1  4  
ATOM 7617  C CG2  . THR A 1 120 ? -13.838 -4.524  -7.498  1.00 0.00 ? 120 THR A CG2  4  
ATOM 7618  H H    . THR A 1 120 ? -15.082 -2.998  -10.049 1.00 0.00 ? 120 THR A H    4  
ATOM 7619  H HA   . THR A 1 120 ? -13.947 -5.700  -9.920  1.00 0.00 ? 120 THR A HA   4  
ATOM 7620  H HB   . THR A 1 120 ? -15.591 -5.747  -7.889  1.00 0.00 ? 120 THR A HB   4  
ATOM 7621  H HG1  . THR A 1 120 ? -16.738 -3.809  -8.736  1.00 0.00 ? 120 THR A HG1  4  
ATOM 7622  H HG21 . THR A 1 120 ? -13.914 -4.956  -6.500  1.00 0.00 ? 120 THR A HG21 4  
ATOM 7623  H HG22 . THR A 1 120 ? -12.963 -4.932  -8.005  1.00 0.00 ? 120 THR A HG22 4  
ATOM 7624  H HG23 . THR A 1 120 ? -13.741 -3.442  -7.420  1.00 0.00 ? 120 THR A HG23 4  
ATOM 7625  N N    . THR A 1 121 ? -15.653 -6.757  -11.266 1.00 0.00 ? 121 THR A N    4  
ATOM 7626  C CA   . THR A 1 121 ? -16.656 -7.463  -12.046 1.00 0.00 ? 121 THR A CA   4  
ATOM 7627  C C    . THR A 1 121 ? -16.044 -8.701  -12.704 1.00 0.00 ? 121 THR A C    4  
ATOM 7628  O O    . THR A 1 121 ? -14.830 -8.892  -12.668 1.00 0.00 ? 121 THR A O    4  
ATOM 7629  C CB   . THR A 1 121 ? -17.256 -6.475  -13.049 1.00 0.00 ? 121 THR A CB   4  
ATOM 7630  O OG1  . THR A 1 121 ? -18.084 -7.285  -13.879 1.00 0.00 ? 121 THR A OG1  4  
ATOM 7631  C CG2  . THR A 1 121 ? -16.208 -5.906  -14.008 1.00 0.00 ? 121 THR A CG2  4  
ATOM 7632  H H    . THR A 1 121 ? -14.733 -7.145  -11.309 1.00 0.00 ? 121 THR A H    4  
ATOM 7633  H HA   . THR A 1 121 ? -17.435 -7.812  -11.368 1.00 0.00 ? 121 THR A HA   4  
ATOM 7634  H HB   . THR A 1 121 ? -17.789 -5.675  -12.536 1.00 0.00 ? 121 THR A HB   4  
ATOM 7635  H HG1  . THR A 1 121 ? -19.004 -6.896  -13.927 1.00 0.00 ? 121 THR A HG1  4  
ATOM 7636  H HG21 . THR A 1 121 ? -16.453 -4.870  -14.240 1.00 0.00 ? 121 THR A HG21 4  
ATOM 7637  H HG22 . THR A 1 121 ? -15.225 -5.951  -13.540 1.00 0.00 ? 121 THR A HG22 4  
ATOM 7638  H HG23 . THR A 1 121 ? -16.201 -6.492  -14.927 1.00 0.00 ? 121 THR A HG23 4  
ATOM 7639  N N    . GLU A 1 122 ? -16.914 -9.511  -13.289 1.00 0.00 ? 122 GLU A N    4  
ATOM 7640  C CA   . GLU A 1 122 ? -16.476 -10.726 -13.954 1.00 0.00 ? 122 GLU A CA   4  
ATOM 7641  C C    . GLU A 1 122 ? -16.322 -10.483 -15.457 1.00 0.00 ? 122 GLU A C    4  
ATOM 7642  O O    . GLU A 1 122 ? -15.621 -11.226 -16.141 1.00 0.00 ? 122 GLU A O    4  
ATOM 7643  C CB   . GLU A 1 122 ? -17.442 -11.880 -13.681 1.00 0.00 ? 122 GLU A CB   4  
ATOM 7644  C CG   . GLU A 1 122 ? -17.610 -12.111 -12.178 1.00 0.00 ? 122 GLU A CG   4  
ATOM 7645  C CD   . GLU A 1 122 ? -18.894 -12.889 -11.883 1.00 0.00 ? 122 GLU A CD   4  
ATOM 7646  O OE1  . GLU A 1 122 ? -18.905 -14.102 -12.186 1.00 0.00 ? 122 GLU A OE1  4  
ATOM 7647  O OE2  . GLU A 1 122 ? -19.835 -12.253 -11.361 1.00 0.00 ? 122 GLU A OE2  4  
ATOM 7648  H H    . GLU A 1 122 ? -17.901 -9.348  -13.314 1.00 0.00 ? 122 GLU A H    4  
ATOM 7649  H HA   . GLU A 1 122 ? -15.505 -10.962 -13.517 1.00 0.00 ? 122 GLU A HA   4  
ATOM 7650  H HB2  . GLU A 1 122 ? -18.411 -11.662 -14.130 1.00 0.00 ? 122 GLU A HB2  4  
ATOM 7651  H HB3  . GLU A 1 122 ? -17.070 -12.790 -14.153 1.00 0.00 ? 122 GLU A HB3  4  
ATOM 7652  H HG2  . GLU A 1 122 ? -16.751 -12.660 -11.793 1.00 0.00 ? 122 GLU A HG2  4  
ATOM 7653  H HG3  . GLU A 1 122 ? -17.634 -11.152 -11.660 1.00 0.00 ? 122 GLU A HG3  4  
ATOM 7654  N N    . LYS A 1 123 ? -16.990 -9.439  -15.926 1.00 0.00 ? 123 LYS A N    4  
ATOM 7655  C CA   . LYS A 1 123 ? -16.937 -9.089  -17.336 1.00 0.00 ? 123 LYS A CA   4  
ATOM 7656  C C    . LYS A 1 123 ? -15.674 -8.269  -17.606 1.00 0.00 ? 123 LYS A C    4  
ATOM 7657  O O    . LYS A 1 123 ? -15.450 -7.240  -16.970 1.00 0.00 ? 123 LYS A O    4  
ATOM 7658  C CB   . LYS A 1 123 ? -18.228 -8.388  -17.762 1.00 0.00 ? 123 LYS A CB   4  
ATOM 7659  C CG   . LYS A 1 123 ? -19.410 -9.360  -17.751 1.00 0.00 ? 123 LYS A CG   4  
ATOM 7660  C CD   . LYS A 1 123 ? -20.636 -8.740  -18.424 1.00 0.00 ? 123 LYS A CD   4  
ATOM 7661  C CE   . LYS A 1 123 ? -20.456 -8.678  -19.942 1.00 0.00 ? 123 LYS A CE   4  
ATOM 7662  N NZ   . LYS A 1 123 ? -20.673 -7.299  -20.434 1.00 0.00 ? 123 LYS A NZ   4  
ATOM 7663  H H    . LYS A 1 123 ? -17.558 -8.840  -15.363 1.00 0.00 ? 123 LYS A H    4  
ATOM 7664  H HA   . LYS A 1 123 ? -16.873 -10.019 -17.901 1.00 0.00 ? 123 LYS A HA   4  
ATOM 7665  H HB2  . LYS A 1 123 ? -18.433 -7.553  -17.091 1.00 0.00 ? 123 LYS A HB2  4  
ATOM 7666  H HB3  . LYS A 1 123 ? -18.106 -7.970  -18.762 1.00 0.00 ? 123 LYS A HB3  4  
ATOM 7667  H HG2  . LYS A 1 123 ? -19.134 -10.279 -18.266 1.00 0.00 ? 123 LYS A HG2  4  
ATOM 7668  H HG3  . LYS A 1 123 ? -19.652 -9.631  -16.723 1.00 0.00 ? 123 LYS A HG3  4  
ATOM 7669  H HD2  . LYS A 1 123 ? -21.523 -9.326  -18.182 1.00 0.00 ? 123 LYS A HD2  4  
ATOM 7670  H HD3  . LYS A 1 123 ? -20.802 -7.736  -18.032 1.00 0.00 ? 123 LYS A HD3  4  
ATOM 7671  H HE2  . LYS A 1 123 ? -19.454 -9.012  -20.209 1.00 0.00 ? 123 LYS A HE2  4  
ATOM 7672  H HE3  . LYS A 1 123 ? -21.158 -9.358  -20.425 1.00 0.00 ? 123 LYS A HE3  4  
ATOM 7673  H HZ1  . LYS A 1 123 ? -21.645 -7.071  -20.368 1.00 0.00 ? 123 LYS A HZ1  4  
ATOM 7674  H HZ2  . LYS A 1 123 ? -20.142 -6.660  -19.878 1.00 0.00 ? 123 LYS A HZ2  4  
ATOM 7675  H HZ3  . LYS A 1 123 ? -20.380 -7.236  -21.388 1.00 0.00 ? 123 LYS A HZ3  4  
ATOM 7676  N N    . ARG A 1 124 ? -14.882 -8.756  -18.549 1.00 0.00 ? 124 ARG A N    4  
ATOM 7677  C CA   . ARG A 1 124 ? -13.647 -8.081  -18.911 1.00 0.00 ? 124 ARG A CA   4  
ATOM 7678  C C    . ARG A 1 124 ? -13.437 -8.135  -20.426 1.00 0.00 ? 124 ARG A C    4  
ATOM 7679  O O    . ARG A 1 124 ? -13.669 -9.168  -21.052 1.00 0.00 ? 124 ARG A O    4  
ATOM 7680  C CB   . ARG A 1 124 ? -12.445 -8.721  -18.214 1.00 0.00 ? 124 ARG A CB   4  
ATOM 7681  C CG   . ARG A 1 124 ? -11.451 -7.656  -17.747 1.00 0.00 ? 124 ARG A CG   4  
ATOM 7682  C CD   . ARG A 1 124 ? -10.544 -8.199  -16.641 1.00 0.00 ? 124 ARG A CD   4  
ATOM 7683  N NE   . ARG A 1 124 ? -9.264  -7.457  -16.626 1.00 0.00 ? 124 ARG A NE   4  
ATOM 7684  C CZ   . ARG A 1 124 ? -9.116  -6.224  -16.124 1.00 0.00 ? 124 ARG A CZ   4  
ATOM 7685  N NH1  . ARG A 1 124 ? -10.168 -5.586  -15.593 1.00 0.00 ? 124 ARG A NH1  4  
ATOM 7686  N NH2  . ARG A 1 124 ? -7.916  -5.628  -16.153 1.00 0.00 ? 124 ARG A NH2  4  
ATOM 7687  H H    . ARG A 1 124 ? -15.071 -9.594  -19.062 1.00 0.00 ? 124 ARG A H    4  
ATOM 7688  H HA   . ARG A 1 124 ? -13.780 -7.055  -18.570 1.00 0.00 ? 124 ARG A HA   4  
ATOM 7689  H HB2  . ARG A 1 124 ? -12.784 -9.306  -17.360 1.00 0.00 ? 124 ARG A HB2  4  
ATOM 7690  H HB3  . ARG A 1 124 ? -11.949 -9.412  -18.896 1.00 0.00 ? 124 ARG A HB3  4  
ATOM 7691  H HG2  . ARG A 1 124 ? -10.844 -7.325  -18.590 1.00 0.00 ? 124 ARG A HG2  4  
ATOM 7692  H HG3  . ARG A 1 124 ? -11.992 -6.783  -17.382 1.00 0.00 ? 124 ARG A HG3  4  
ATOM 7693  H HD2  . ARG A 1 124 ? -11.039 -8.106  -15.674 1.00 0.00 ? 124 ARG A HD2  4  
ATOM 7694  H HD3  . ARG A 1 124 ? -10.357 -9.261  -16.802 1.00 0.00 ? 124 ARG A HD3  4  
ATOM 7695  H HE   . ARG A 1 124 ? -8.458  -7.905  -17.015 1.00 0.00 ? 124 ARG A HE   4  
ATOM 7696  H HH11 . ARG A 1 124 ? -11.064 -6.031  -15.572 1.00 0.00 ? 124 ARG A HH11 4  
ATOM 7697  H HH12 . ARG A 1 124 ? -10.058 -4.665  -15.219 1.00 0.00 ? 124 ARG A HH12 4  
ATOM 7698  H HH21 . ARG A 1 124 ? -7.131  -6.103  -16.549 1.00 0.00 ? 124 ARG A HH21 4  
ATOM 7699  H HH22 . ARG A 1 124 ? -7.806  -4.707  -15.779 1.00 0.00 ? 124 ARG A HH22 4  
ATOM 7700  N N    . SER A 1 125 ? -13.001 -7.009  -20.971 1.00 0.00 ? 125 SER A N    4  
ATOM 7701  C CA   . SER A 1 125 ? -12.757 -6.914  -22.400 1.00 0.00 ? 125 SER A CA   4  
ATOM 7702  C C    . SER A 1 125 ? -11.270 -6.670  -22.663 1.00 0.00 ? 125 SER A C    4  
ATOM 7703  O O    . SER A 1 125 ? -10.657 -7.362  -23.475 1.00 0.00 ? 125 SER A O    4  
ATOM 7704  C CB   . SER A 1 125 ? -13.597 -5.801  -23.030 1.00 0.00 ? 125 SER A CB   4  
ATOM 7705  O OG   . SER A 1 125 ? -14.988 -6.111  -23.020 1.00 0.00 ? 125 SER A OG   4  
ATOM 7706  H H    . SER A 1 125 ? -12.815 -6.173  -20.455 1.00 0.00 ? 125 SER A H    4  
ATOM 7707  H HA   . SER A 1 125 ? -13.065 -7.877  -22.810 1.00 0.00 ? 125 SER A HA   4  
ATOM 7708  H HB2  . SER A 1 125 ? -13.429 -4.870  -22.489 1.00 0.00 ? 125 SER A HB2  4  
ATOM 7709  H HB3  . SER A 1 125 ? -13.269 -5.636  -24.056 1.00 0.00 ? 125 SER A HB3  4  
ATOM 7710  H HG   . SER A 1 125 ? -15.118 -7.101  -23.073 1.00 0.00 ? 125 SER A HG   4  
ATOM 7711  N N    . GLY A 1 126 ? -10.731 -5.685  -21.960 1.00 0.00 ? 126 GLY A N    4  
ATOM 7712  C CA   . GLY A 1 126 ? -9.327  -5.341  -22.106 1.00 0.00 ? 126 GLY A CA   4  
ATOM 7713  C C    . GLY A 1 126 ? -9.164  -3.984  -22.793 1.00 0.00 ? 126 GLY A C    4  
ATOM 7714  O O    . GLY A 1 126 ? -9.521  -3.828  -23.960 1.00 0.00 ? 126 GLY A O    4  
ATOM 7715  H H    . GLY A 1 126 ? -11.236 -5.127  -21.301 1.00 0.00 ? 126 GLY A H    4  
ATOM 7716  H HA2  . GLY A 1 126 ? -8.851  -5.316  -21.126 1.00 0.00 ? 126 GLY A HA2  4  
ATOM 7717  H HA3  . GLY A 1 126 ? -8.820  -6.110  -22.688 1.00 0.00 ? 126 GLY A HA3  4  
ATOM 7718  N N    . PRO A 1 127 ? -8.610  -3.011  -22.021 1.00 0.00 ? 127 PRO A N    4  
ATOM 7719  C CA   . PRO A 1 127 ? -8.395  -1.672  -22.543 1.00 0.00 ? 127 PRO A CA   4  
ATOM 7720  C C    . PRO A 1 127 ? -7.201  -1.641  -23.498 1.00 0.00 ? 127 PRO A C    4  
ATOM 7721  O O    . PRO A 1 127 ? -6.493  -2.637  -23.646 1.00 0.00 ? 127 PRO A O    4  
ATOM 7722  C CB   . PRO A 1 127 ? -8.196  -0.799  -21.315 1.00 0.00 ? 127 PRO A CB   4  
ATOM 7723  C CG   . PRO A 1 127 ? -7.845  -1.747  -20.181 1.00 0.00 ? 127 PRO A CG   4  
ATOM 7724  C CD   . PRO A 1 127 ? -8.175  -3.160  -20.635 1.00 0.00 ? 127 PRO A CD   4  
ATOM 7725  H HA   . PRO A 1 127 ? -9.185  -1.379  -23.082 1.00 0.00 ? 127 PRO A HA   4  
ATOM 7726  H HB2  . PRO A 1 127 ? -7.400  -0.072  -21.477 1.00 0.00 ? 127 PRO A HB2  4  
ATOM 7727  H HB3  . PRO A 1 127 ? -9.101  -0.235  -21.086 1.00 0.00 ? 127 PRO A HB3  4  
ATOM 7728  H HG2  . PRO A 1 127 ? -6.787  -1.665  -19.928 1.00 0.00 ? 127 PRO A HG2  4  
ATOM 7729  H HG3  . PRO A 1 127 ? -8.407  -1.494  -19.282 1.00 0.00 ? 127 PRO A HG3  4  
ATOM 7730  H HD2  . PRO A 1 127 ? -7.306  -3.814  -20.561 1.00 0.00 ? 127 PRO A HD2  4  
ATOM 7731  H HD3  . PRO A 1 127 ? -8.959  -3.600  -20.019 1.00 0.00 ? 127 PRO A HD3  4  
ATOM 7732  N N    . SER A 1 128 ? -7.013  -0.488  -24.123 1.00 0.00 ? 128 SER A N    4  
ATOM 7733  C CA   . SER A 1 128 ? -5.916  -0.315  -25.060 1.00 0.00 ? 128 SER A CA   4  
ATOM 7734  C C    . SER A 1 128 ? -4.746  0.391   -24.372 1.00 0.00 ? 128 SER A C    4  
ATOM 7735  O O    . SER A 1 128 ? -3.660  -0.174  -24.252 1.00 0.00 ? 128 SER A O    4  
ATOM 7736  C CB   . SER A 1 128 ? -6.363  0.477   -26.290 1.00 0.00 ? 128 SER A CB   4  
ATOM 7737  O OG   . SER A 1 128 ? -7.161  -0.310  -27.171 1.00 0.00 ? 128 SER A OG   4  
ATOM 7738  H H    . SER A 1 128 ? -7.593  0.317   -23.997 1.00 0.00 ? 128 SER A H    4  
ATOM 7739  H HA   . SER A 1 128 ? -5.632  -1.323  -25.361 1.00 0.00 ? 128 SER A HA   4  
ATOM 7740  H HB2  . SER A 1 128 ? -6.931  1.352   -25.972 1.00 0.00 ? 128 SER A HB2  4  
ATOM 7741  H HB3  . SER A 1 128 ? -5.487  0.843   -26.824 1.00 0.00 ? 128 SER A HB3  4  
ATOM 7742  H HG   . SER A 1 128 ? -8.019  -0.561  -26.724 1.00 0.00 ? 128 SER A HG   4  
ATOM 7743  N N    . SER A 1 129 ? -5.007  1.614   -23.936 1.00 0.00 ? 129 SER A N    4  
ATOM 7744  C CA   . SER A 1 129 ? -3.989  2.402   -23.263 1.00 0.00 ? 129 SER A CA   4  
ATOM 7745  C C    . SER A 1 129 ? -4.609  3.166   -22.090 1.00 0.00 ? 129 SER A C    4  
ATOM 7746  O O    . SER A 1 129 ? -5.794  3.493   -22.115 1.00 0.00 ? 129 SER A O    4  
ATOM 7747  C CB   . SER A 1 129 ? -3.315  3.375   -24.232 1.00 0.00 ? 129 SER A CB   4  
ATOM 7748  O OG   . SER A 1 129 ? -2.010  3.745   -23.795 1.00 0.00 ? 129 SER A OG   4  
ATOM 7749  H H    . SER A 1 129 ? -5.894  2.066   -24.037 1.00 0.00 ? 129 SER A H    4  
ATOM 7750  H HA   . SER A 1 129 ? -3.256  1.680   -22.904 1.00 0.00 ? 129 SER A HA   4  
ATOM 7751  H HB2  . SER A 1 129 ? -3.250  2.916   -25.219 1.00 0.00 ? 129 SER A HB2  4  
ATOM 7752  H HB3  . SER A 1 129 ? -3.930  4.269   -24.336 1.00 0.00 ? 129 SER A HB3  4  
ATOM 7753  H HG   . SER A 1 129 ? -1.957  3.698   -22.798 1.00 0.00 ? 129 SER A HG   4  
ATOM 7754  N N    . GLY A 1 130 ? -3.779  3.428   -21.092 1.00 0.00 ? 130 GLY A N    4  
ATOM 7755  C CA   . GLY A 1 130 ? -4.230  4.147   -19.912 1.00 0.00 ? 130 GLY A CA   4  
ATOM 7756  C C    . GLY A 1 130 ? -3.045  4.709   -19.125 1.00 0.00 ? 130 GLY A C    4  
ATOM 7757  O O    . GLY A 1 130 ? -2.233  5.456   -19.669 1.00 0.00 ? 130 GLY A O    4  
ATOM 7758  H H    . GLY A 1 130 ? -2.816  3.158   -21.079 1.00 0.00 ? 130 GLY A H    4  
ATOM 7759  H HA2  . GLY A 1 130 ? -4.893  4.960   -20.209 1.00 0.00 ? 130 GLY A HA2  4  
ATOM 7760  H HA3  . GLY A 1 130 ? -4.811  3.479   -19.275 1.00 0.00 ? 130 GLY A HA3  4  
ATOM 7761  N N    . GLY A 1 1   ? -6.165  30.565  -4.126  1.00 0.00 ? 1   GLY A N    5  
ATOM 7762  C CA   . GLY A 1 1   ? -5.567  29.470  -4.871  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7763  C C    . GLY A 1 1   ? -6.508  28.266  -4.928  1.00 0.00 ? 1   GLY A C    5  
ATOM 7764  O O    . GLY A 1 1   ? -7.722  28.427  -5.039  1.00 0.00 ? 1   GLY A O    5  
ATOM 7765  H H1   . GLY A 1 1   ? -7.046  30.883  -4.477  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7766  H HA2  . GLY A 1 1   ? -5.331  29.801  -5.883  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7767  H HA3  . GLY A 1 1   ? -4.626  29.179  -4.403  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7768  N N    . SER A 1 2   ? -5.912  27.085  -4.849  1.00 0.00 ? 2   SER A N    5  
ATOM 7769  C CA   . SER A 1 2   ? -6.682  25.854  -4.890  1.00 0.00 ? 2   SER A CA   5  
ATOM 7770  C C    . SER A 1 2   ? -6.606  25.143  -3.537  1.00 0.00 ? 2   SER A C    5  
ATOM 7771  O O    . SER A 1 2   ? -5.571  24.578  -3.186  1.00 0.00 ? 2   SER A O    5  
ATOM 7772  C CB   . SER A 1 2   ? -6.185  24.930  -6.003  1.00 0.00 ? 2   SER A CB   5  
ATOM 7773  O OG   . SER A 1 2   ? -4.805  24.609  -5.854  1.00 0.00 ? 2   SER A OG   5  
ATOM 7774  H H    . SER A 1 2   ? -4.924  26.963  -4.759  1.00 0.00 ? 2   SER A H    5  
ATOM 7775  H HA   . SER A 1 2   ? -7.706  26.161  -5.104  1.00 0.00 ? 2   SER A HA   5  
ATOM 7776  H HB2  . SER A 1 2   ? -6.773  24.012  -6.002  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7777  H HB3  . SER A 1 2   ? -6.343  25.408  -6.970  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7778  H HG   . SER A 1 2   ? -4.555  24.615  -4.886  1.00 0.00 ? 2   SER A HG   5  
ATOM 7779  N N    . SER A 1 3   ? -7.715  25.195  -2.814  1.00 0.00 ? 3   SER A N    5  
ATOM 7780  C CA   . SER A 1 3   ? -7.787  24.564  -1.507  1.00 0.00 ? 3   SER A CA   5  
ATOM 7781  C C    . SER A 1 3   ? -7.951  23.051  -1.666  1.00 0.00 ? 3   SER A C    5  
ATOM 7782  O O    . SER A 1 3   ? -9.003  22.578  -2.093  1.00 0.00 ? 3   SER A O    5  
ATOM 7783  C CB   . SER A 1 3   ? -8.938  25.139  -0.680  1.00 0.00 ? 3   SER A CB   5  
ATOM 7784  O OG   . SER A 1 3   ? -10.207 24.686  -1.144  1.00 0.00 ? 3   SER A OG   5  
ATOM 7785  H H    . SER A 1 3   ? -8.553  25.657  -3.107  1.00 0.00 ? 3   SER A H    5  
ATOM 7786  H HA   . SER A 1 3   ? -6.839  24.797  -1.022  1.00 0.00 ? 3   SER A HA   5  
ATOM 7787  H HB2  . SER A 1 3   ? -8.811  24.854  0.365   1.00 0.00 ? 3   SER A HB2  5  
ATOM 7788  H HB3  . SER A 1 3   ? -8.905  26.227  -0.720  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7789  H HG   . SER A 1 3   ? -10.259 24.772  -2.139  1.00 0.00 ? 3   SER A HG   5  
ATOM 7790  N N    . GLY A 1 4   ? -6.895  22.333  -1.313  1.00 0.00 ? 4   GLY A N    5  
ATOM 7791  C CA   . GLY A 1 4   ? -6.909  20.883  -1.410  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7792  C C    . GLY A 1 4   ? -6.431  20.422  -2.789  1.00 0.00 ? 4   GLY A C    5  
ATOM 7793  O O    . GLY A 1 4   ? -5.249  20.537  -3.111  1.00 0.00 ? 4   GLY A O    5  
ATOM 7794  H H    . GLY A 1 4   ? -6.043  22.725  -0.966  1.00 0.00 ? 4   GLY A H    5  
ATOM 7795  H HA2  . GLY A 1 4   ? -6.269  20.457  -0.638  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7796  H HA3  . GLY A 1 4   ? -7.918  20.513  -1.228  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7797  N N    . SER A 1 5   ? -7.374  19.909  -3.566  1.00 0.00 ? 5   SER A N    5  
ATOM 7798  C CA   . SER A 1 5   ? -7.064  19.430  -4.902  1.00 0.00 ? 5   SER A CA   5  
ATOM 7799  C C    . SER A 1 5   ? -5.723  18.693  -4.896  1.00 0.00 ? 5   SER A C    5  
ATOM 7800  O O    . SER A 1 5   ? -4.678  19.296  -5.135  1.00 0.00 ? 5   SER A O    5  
ATOM 7801  C CB   . SER A 1 5   ? -7.031  20.583  -5.907  1.00 0.00 ? 5   SER A CB   5  
ATOM 7802  O OG   . SER A 1 5   ? -8.337  21.071  -6.202  1.00 0.00 ? 5   SER A OG   5  
ATOM 7803  H H    . SER A 1 5   ? -8.333  19.819  -3.296  1.00 0.00 ? 5   SER A H    5  
ATOM 7804  H HA   . SER A 1 5   ? -7.874  18.748  -5.159  1.00 0.00 ? 5   SER A HA   5  
ATOM 7805  H HB2  . SER A 1 5   ? -6.422  21.394  -5.508  1.00 0.00 ? 5   SER A HB2  5  
ATOM 7806  H HB3  . SER A 1 5   ? -6.553  20.248  -6.827  1.00 0.00 ? 5   SER A HB3  5  
ATOM 7807  H HG   . SER A 1 5   ? -8.275  21.952  -6.672  1.00 0.00 ? 5   SER A HG   5  
ATOM 7808  N N    . SER A 1 6   ? -5.797  17.399  -4.620  1.00 0.00 ? 6   SER A N    5  
ATOM 7809  C CA   . SER A 1 6   ? -4.601  16.574  -4.579  1.00 0.00 ? 6   SER A CA   5  
ATOM 7810  C C    . SER A 1 6   ? -4.078  16.341  -5.998  1.00 0.00 ? 6   SER A C    5  
ATOM 7811  O O    . SER A 1 6   ? -2.941  16.691  -6.309  1.00 0.00 ? 6   SER A O    5  
ATOM 7812  C CB   . SER A 1 6   ? -4.879  15.236  -3.890  1.00 0.00 ? 6   SER A CB   5  
ATOM 7813  O OG   . SER A 1 6   ? -4.419  15.226  -2.541  1.00 0.00 ? 6   SER A OG   5  
ATOM 7814  H H    . SER A 1 6   ? -6.651  16.916  -4.427  1.00 0.00 ? 6   SER A H    5  
ATOM 7815  H HA   . SER A 1 6   ? -3.879  17.141  -3.993  1.00 0.00 ? 6   SER A HA   5  
ATOM 7816  H HB2  . SER A 1 6   ? -5.950  15.034  -3.909  1.00 0.00 ? 6   SER A HB2  5  
ATOM 7817  H HB3  . SER A 1 6   ? -4.393  14.434  -4.445  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7818  H HG   . SER A 1 6   ? -4.855  15.963  -2.025  1.00 0.00 ? 6   SER A HG   5  
ATOM 7819  N N    . GLY A 1 7   ? -4.933  15.751  -6.820  1.00 0.00 ? 7   GLY A N    5  
ATOM 7820  C CA   . GLY A 1 7   ? -4.571  15.467  -8.199  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7821  C C    . GLY A 1 7   ? -3.304  14.612  -8.268  1.00 0.00 ? 7   GLY A C    5  
ATOM 7822  O O    . GLY A 1 7   ? -3.215  13.575  -7.612  1.00 0.00 ? 7   GLY A O    5  
ATOM 7823  H H    . GLY A 1 7   ? -5.856  15.469  -6.560  1.00 0.00 ? 7   GLY A H    5  
ATOM 7824  H HA2  . GLY A 1 7   ? -5.392  14.949  -8.695  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7825  H HA3  . GLY A 1 7   ? -4.413  16.402  -8.737  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7826  N N    . ARG A 1 8   ? -2.357  15.078  -9.068  1.00 0.00 ? 8   ARG A N    5  
ATOM 7827  C CA   . ARG A 1 8   ? -1.099  14.369  -9.231  1.00 0.00 ? 8   ARG A CA   5  
ATOM 7828  C C    . ARG A 1 8   ? -1.358  12.911  -9.616  1.00 0.00 ? 8   ARG A C    5  
ATOM 7829  O O    . ARG A 1 8   ? -1.548  12.061  -8.748  1.00 0.00 ? 8   ARG A O    5  
ATOM 7830  C CB   . ARG A 1 8   ? -0.272  14.411  -7.945  1.00 0.00 ? 8   ARG A CB   5  
ATOM 7831  C CG   . ARG A 1 8   ? 0.928   15.348  -8.095  1.00 0.00 ? 8   ARG A CG   5  
ATOM 7832  C CD   . ARG A 1 8   ? 2.244   14.577  -7.978  1.00 0.00 ? 8   ARG A CD   5  
ATOM 7833  N NE   . ARG A 1 8   ? 3.388   15.509  -8.091  1.00 0.00 ? 8   ARG A NE   5  
ATOM 7834  C CZ   . ARG A 1 8   ? 4.638   15.213  -7.709  1.00 0.00 ? 8   ARG A CZ   5  
ATOM 7835  N NH1  . ARG A 1 8   ? 4.913   14.009  -7.189  1.00 0.00 ? 8   ARG A NH1  5  
ATOM 7836  N NH2  . ARG A 1 8   ? 5.614   16.121  -7.848  1.00 0.00 ? 8   ARG A NH2  5  
ATOM 7837  H H    . ARG A 1 8   ? -2.438  15.923  -9.598  1.00 0.00 ? 8   ARG A H    5  
ATOM 7838  H HA   . ARG A 1 8   ? -0.582  14.900  -10.031 1.00 0.00 ? 8   ARG A HA   5  
ATOM 7839  H HB2  . ARG A 1 8   ? -0.898  14.744  -7.117  1.00 0.00 ? 8   ARG A HB2  5  
ATOM 7840  H HB3  . ARG A 1 8   ? 0.074   13.407  -7.698  1.00 0.00 ? 8   ARG A HB3  5  
ATOM 7841  H HG2  . ARG A 1 8   ? 0.882   15.853  -9.060  1.00 0.00 ? 8   ARG A HG2  5  
ATOM 7842  H HG3  . ARG A 1 8   ? 0.887   16.122  -7.328  1.00 0.00 ? 8   ARG A HG3  5  
ATOM 7843  H HD2  . ARG A 1 8   ? 2.284   14.052  -7.024  1.00 0.00 ? 8   ARG A HD2  5  
ATOM 7844  H HD3  . ARG A 1 8   ? 2.302   13.821  -8.761  1.00 0.00 ? 8   ARG A HD3  5  
ATOM 7845  H HE   . ARG A 1 8   ? 3.218   16.416  -8.475  1.00 0.00 ? 8   ARG A HE   5  
ATOM 7846  H HH11 . ARG A 1 8   ? 4.185   13.331  -7.085  1.00 0.00 ? 8   ARG A HH11 5  
ATOM 7847  H HH12 . ARG A 1 8   ? 5.846   13.788  -6.904  1.00 0.00 ? 8   ARG A HH12 5  
ATOM 7848  H HH21 . ARG A 1 8   ? 5.409   17.019  -8.237  1.00 0.00 ? 8   ARG A HH21 5  
ATOM 7849  H HH22 . ARG A 1 8   ? 6.547   15.900  -7.564  1.00 0.00 ? 8   ARG A HH22 5  
ATOM 7850  N N    . ILE A 1 9   ? -1.358  12.667  -10.918 1.00 0.00 ? 9   ILE A N    5  
ATOM 7851  C CA   . ILE A 1 9   ? -1.590  11.327  -11.429 1.00 0.00 ? 9   ILE A CA   5  
ATOM 7852  C C    . ILE A 1 9   ? -0.259  10.715  -11.869 1.00 0.00 ? 9   ILE A C    5  
ATOM 7853  O O    . ILE A 1 9   ? 0.584   11.403  -12.443 1.00 0.00 ? 9   ILE A O    5  
ATOM 7854  C CB   . ILE A 1 9   ? -2.651  11.349  -12.531 1.00 0.00 ? 9   ILE A CB   5  
ATOM 7855  C CG1  . ILE A 1 9   ? -3.958  11.963  -12.022 1.00 0.00 ? 9   ILE A CG1  5  
ATOM 7856  C CG2  . ILE A 1 9   ? -2.864  9.952   -13.116 1.00 0.00 ? 9   ILE A CG2  5  
ATOM 7857  C CD1  . ILE A 1 9   ? -4.714  10.978  -11.128 1.00 0.00 ? 9   ILE A CD1  5  
ATOM 7858  H H    . ILE A 1 9   ? -1.203  13.365  -11.618 1.00 0.00 ? 9   ILE A H    5  
ATOM 7859  H HA   . ILE A 1 9   ? -1.990  10.730  -10.609 1.00 0.00 ? 9   ILE A HA   5  
ATOM 7860  H HB   . ILE A 1 9   ? -2.290  11.985  -13.339 1.00 0.00 ? 9   ILE A HB   5  
ATOM 7861  H HG12 . ILE A 1 9   ? -3.742  12.874  -11.464 1.00 0.00 ? 9   ILE A HG12 5  
ATOM 7862  H HG13 . ILE A 1 9   ? -4.584  12.247  -12.868 1.00 0.00 ? 9   ILE A HG13 5  
ATOM 7863  H HG21 . ILE A 1 9   ? -3.821  9.918   -13.636 1.00 0.00 ? 9   ILE A HG21 5  
ATOM 7864  H HG22 . ILE A 1 9   ? -2.061  9.726   -13.817 1.00 0.00 ? 9   ILE A HG22 5  
ATOM 7865  H HG23 . ILE A 1 9   ? -2.862  9.217   -12.311 1.00 0.00 ? 9   ILE A HG23 5  
ATOM 7866  H HD11 . ILE A 1 9   ? -4.177  10.854  -10.188 1.00 0.00 ? 9   ILE A HD11 5  
ATOM 7867  H HD12 . ILE A 1 9   ? -5.714  11.364  -10.927 1.00 0.00 ? 9   ILE A HD12 5  
ATOM 7868  H HD13 . ILE A 1 9   ? -4.791  10.015  -11.633 1.00 0.00 ? 9   ILE A HD13 5  
ATOM 7869  N N    . GLY A 1 10  ? -0.111  9.430   -11.584 1.00 0.00 ? 10  GLY A N    5  
ATOM 7870  C CA   . GLY A 1 10  ? 1.103   8.718   -11.943 1.00 0.00 ? 10  GLY A CA   5  
ATOM 7871  C C    . GLY A 1 10  ? 1.086   8.316   -13.419 1.00 0.00 ? 10  GLY A C    5  
ATOM 7872  O O    . GLY A 1 10  ? 0.062   8.441   -14.089 1.00 0.00 ? 10  GLY A O    5  
ATOM 7873  H H    . GLY A 1 10  ? -0.802  8.878   -11.116 1.00 0.00 ? 10  GLY A H    5  
ATOM 7874  H HA2  . GLY A 1 10  ? 1.970   9.347   -11.744 1.00 0.00 ? 10  GLY A HA2  5  
ATOM 7875  H HA3  . GLY A 1 10  ? 1.205   7.829   -11.322 1.00 0.00 ? 10  GLY A HA3  5  
ATOM 7876  N N    . ASP A 1 11  ? 2.233   7.842   -13.884 1.00 0.00 ? 11  ASP A N    5  
ATOM 7877  C CA   . ASP A 1 11  ? 2.363   7.421   -15.268 1.00 0.00 ? 11  ASP A CA   5  
ATOM 7878  C C    . ASP A 1 11  ? 3.493   6.395   -15.381 1.00 0.00 ? 11  ASP A C    5  
ATOM 7879  O O    . ASP A 1 11  ? 4.547   6.557   -14.769 1.00 0.00 ? 11  ASP A O    5  
ATOM 7880  C CB   . ASP A 1 11  ? 2.708   8.605   -16.174 1.00 0.00 ? 11  ASP A CB   5  
ATOM 7881  C CG   . ASP A 1 11  ? 1.506   9.404   -16.679 1.00 0.00 ? 11  ASP A CG   5  
ATOM 7882  O OD1  . ASP A 1 11  ? 0.982   9.026   -17.749 1.00 0.00 ? 11  ASP A OD1  5  
ATOM 7883  O OD2  . ASP A 1 11  ? 1.137   10.375  -15.984 1.00 0.00 ? 11  ASP A OD2  5  
ATOM 7884  H H    . ASP A 1 11  ? 3.062   7.744   -13.333 1.00 0.00 ? 11  ASP A H    5  
ATOM 7885  H HA   . ASP A 1 11  ? 1.392   7.003   -15.533 1.00 0.00 ? 11  ASP A HA   5  
ATOM 7886  H HB2  . ASP A 1 11  ? 3.371   9.278   -15.630 1.00 0.00 ? 11  ASP A HB2  5  
ATOM 7887  H HB3  . ASP A 1 11  ? 3.267   8.234   -17.034 1.00 0.00 ? 11  ASP A HB3  5  
ATOM 7888  N N    . GLY A 1 12  ? 3.233   5.360   -16.167 1.00 0.00 ? 12  GLY A N    5  
ATOM 7889  C CA   . GLY A 1 12  ? 4.214   4.308   -16.368 1.00 0.00 ? 12  GLY A CA   5  
ATOM 7890  C C    . GLY A 1 12  ? 4.812   4.376   -17.775 1.00 0.00 ? 12  GLY A C    5  
ATOM 7891  O O    . GLY A 1 12  ? 4.131   4.760   -18.724 1.00 0.00 ? 12  GLY A O    5  
ATOM 7892  H H    . GLY A 1 12  ? 2.373   5.236   -16.661 1.00 0.00 ? 12  GLY A H    5  
ATOM 7893  H HA2  . GLY A 1 12  ? 5.008   4.400   -15.627 1.00 0.00 ? 12  GLY A HA2  5  
ATOM 7894  H HA3  . GLY A 1 12  ? 3.747   3.335   -16.215 1.00 0.00 ? 12  GLY A HA3  5  
ATOM 7895  N N    . SER A 1 13  ? 6.079   3.998   -17.864 1.00 0.00 ? 13  SER A N    5  
ATOM 7896  C CA   . SER A 1 13  ? 6.776   4.011   -19.139 1.00 0.00 ? 13  SER A CA   5  
ATOM 7897  C C    . SER A 1 13  ? 7.294   2.610   -19.467 1.00 0.00 ? 13  SER A C    5  
ATOM 7898  O O    . SER A 1 13  ? 7.962   1.983   -18.645 1.00 0.00 ? 13  SER A O    5  
ATOM 7899  C CB   . SER A 1 13  ? 7.930   5.015   -19.125 1.00 0.00 ? 13  SER A CB   5  
ATOM 7900  O OG   . SER A 1 13  ? 8.848   4.758   -18.065 1.00 0.00 ? 13  SER A OG   5  
ATOM 7901  H H    . SER A 1 13  ? 6.625   3.687   -17.087 1.00 0.00 ? 13  SER A H    5  
ATOM 7902  H HA   . SER A 1 13  ? 6.032   4.325   -19.871 1.00 0.00 ? 13  SER A HA   5  
ATOM 7903  H HB2  . SER A 1 13  ? 8.457   4.975   -20.078 1.00 0.00 ? 13  SER A HB2  5  
ATOM 7904  H HB3  . SER A 1 13  ? 7.532   6.024   -19.022 1.00 0.00 ? 13  SER A HB3  5  
ATOM 7905  H HG   . SER A 1 13  ? 8.776   5.472   -17.369 1.00 0.00 ? 13  SER A HG   5  
ATOM 7906  N N    . PRO A 1 14  ? 6.959   2.147   -20.701 1.00 0.00 ? 14  PRO A N    5  
ATOM 7907  C CA   . PRO A 1 14  ? 7.383   0.831   -21.147 1.00 0.00 ? 14  PRO A CA   5  
ATOM 7908  C C    . PRO A 1 14  ? 8.869   0.829   -21.512 1.00 0.00 ? 14  PRO A C    5  
ATOM 7909  O O    . PRO A 1 14  ? 9.236   0.487   -22.635 1.00 0.00 ? 14  PRO A O    5  
ATOM 7910  C CB   . PRO A 1 14  ? 6.482   0.506   -22.327 1.00 0.00 ? 14  PRO A CB   5  
ATOM 7911  C CG   . PRO A 1 14  ? 5.904   1.834   -22.788 1.00 0.00 ? 14  PRO A CG   5  
ATOM 7912  C CD   . PRO A 1 14  ? 6.169   2.861   -21.700 1.00 0.00 ? 14  PRO A CD   5  
ATOM 7913  H HA   . PRO A 1 14  ? 7.283   0.165   -20.408 1.00 0.00 ? 14  PRO A HA   5  
ATOM 7914  H HB2  . PRO A 1 14  ? 7.044   0.025   -23.127 1.00 0.00 ? 14  PRO A HB2  5  
ATOM 7915  H HB3  . PRO A 1 14  ? 5.690   -0.184  -22.034 1.00 0.00 ? 14  PRO A HB3  5  
ATOM 7916  H HG2  . PRO A 1 14  ? 6.363   2.144   -23.727 1.00 0.00 ? 14  PRO A HG2  5  
ATOM 7917  H HG3  . PRO A 1 14  ? 4.833   1.741   -22.972 1.00 0.00 ? 14  PRO A HG3  5  
ATOM 7918  H HD2  . PRO A 1 14  ? 6.712   3.722   -22.092 1.00 0.00 ? 14  PRO A HD2  5  
ATOM 7919  H HD3  . PRO A 1 14  ? 5.239   3.237   -21.274 1.00 0.00 ? 14  PRO A HD3  5  
ATOM 7920  N N    . SER A 1 15  ? 9.685   1.215   -20.542 1.00 0.00 ? 15  SER A N    5  
ATOM 7921  C CA   . SER A 1 15  ? 11.122  1.262   -20.747 1.00 0.00 ? 15  SER A CA   5  
ATOM 7922  C C    . SER A 1 15  ? 11.823  1.667   -19.449 1.00 0.00 ? 15  SER A C    5  
ATOM 7923  O O    . SER A 1 15  ? 11.257  2.394   -18.634 1.00 0.00 ? 15  SER A O    5  
ATOM 7924  C CB   . SER A 1 15  ? 11.487  2.232   -21.872 1.00 0.00 ? 15  SER A CB   5  
ATOM 7925  O OG   . SER A 1 15  ? 11.557  3.580   -21.414 1.00 0.00 ? 15  SER A OG   5  
ATOM 7926  H H    . SER A 1 15  ? 9.379   1.492   -19.631 1.00 0.00 ? 15  SER A H    5  
ATOM 7927  H HA   . SER A 1 15  ? 11.406  0.250   -21.035 1.00 0.00 ? 15  SER A HA   5  
ATOM 7928  H HB2  . SER A 1 15  ? 12.447  1.945   -22.302 1.00 0.00 ? 15  SER A HB2  5  
ATOM 7929  H HB3  . SER A 1 15  ? 10.746  2.159   -22.669 1.00 0.00 ? 15  SER A HB3  5  
ATOM 7930  H HG   . SER A 1 15  ? 10.675  3.859   -21.036 1.00 0.00 ? 15  SER A HG   5  
ATOM 7931  N N    . HIS A 1 16  ? 13.046  1.179   -19.297 1.00 0.00 ? 16  HIS A N    5  
ATOM 7932  C CA   . HIS A 1 16  ? 13.830  1.482   -18.111 1.00 0.00 ? 16  HIS A CA   5  
ATOM 7933  C C    . HIS A 1 16  ? 14.836  2.589   -18.430 1.00 0.00 ? 16  HIS A C    5  
ATOM 7934  O O    . HIS A 1 16  ? 15.421  2.609   -19.512 1.00 0.00 ? 16  HIS A O    5  
ATOM 7935  C CB   . HIS A 1 16  ? 14.494  0.218   -17.562 1.00 0.00 ? 16  HIS A CB   5  
ATOM 7936  C CG   . HIS A 1 16  ? 13.554  -0.954  -17.410 1.00 0.00 ? 16  HIS A CG   5  
ATOM 7937  N ND1  . HIS A 1 16  ? 12.990  -1.608  -18.492 1.00 0.00 ? 16  HIS A ND1  5  
ATOM 7938  C CD2  . HIS A 1 16  ? 13.085  -1.582  -16.294 1.00 0.00 ? 16  HIS A CD2  5  
ATOM 7939  C CE1  . HIS A 1 16  ? 12.218  -2.583  -18.035 1.00 0.00 ? 16  HIS A CE1  5  
ATOM 7940  N NE2  . HIS A 1 16  ? 12.278  -2.565  -16.673 1.00 0.00 ? 16  HIS A NE2  5  
ATOM 7941  H H    . HIS A 1 16  ? 13.499  0.589   -19.964 1.00 0.00 ? 16  HIS A H    5  
ATOM 7942  H HA   . HIS A 1 16  ? 13.131  1.844   -17.358 1.00 0.00 ? 16  HIS A HA   5  
ATOM 7943  H HB2  . HIS A 1 16  ? 15.311  -0.069  -18.225 1.00 0.00 ? 16  HIS A HB2  5  
ATOM 7944  H HB3  . HIS A 1 16  ? 14.936  0.444   -16.592 1.00 0.00 ? 16  HIS A HB3  5  
ATOM 7945  H HD1  . HIS A 1 16  ? 13.140  -1.383  -19.455 1.00 0.00 ? 16  HIS A HD1  5  
ATOM 7946  H HD2  . HIS A 1 16  ? 13.331  -1.320  -15.265 1.00 0.00 ? 16  HIS A HD2  5  
ATOM 7947  H HE1  . HIS A 1 16  ? 11.638  -3.278  -18.642 1.00 0.00 ? 16  HIS A HE1  5  
ATOM 7948  N N    . PRO A 1 17  ? 15.011  3.509   -17.443 1.00 0.00 ? 17  PRO A N    5  
ATOM 7949  C CA   . PRO A 1 17  ? 15.936  4.617   -17.608 1.00 0.00 ? 17  PRO A CA   5  
ATOM 7950  C C    . PRO A 1 17  ? 17.385  4.146   -17.474 1.00 0.00 ? 17  PRO A C    5  
ATOM 7951  O O    . PRO A 1 17  ? 17.638  2.994   -17.125 1.00 0.00 ? 17  PRO A O    5  
ATOM 7952  C CB   . PRO A 1 17  ? 15.537  5.624   -16.542 1.00 0.00 ? 17  PRO A CB   5  
ATOM 7953  C CG   . PRO A 1 17  ? 14.713  4.850   -15.525 1.00 0.00 ? 17  PRO A CG   5  
ATOM 7954  C CD   . PRO A 1 17  ? 14.335  3.517   -16.149 1.00 0.00 ? 17  PRO A CD   5  
ATOM 7955  H HA   . PRO A 1 17  ? 15.858  5.000   -18.528 1.00 0.00 ? 17  PRO A HA   5  
ATOM 7956  H HB2  . PRO A 1 17  ? 16.417  6.068   -16.076 1.00 0.00 ? 17  PRO A HB2  5  
ATOM 7957  H HB3  . PRO A 1 17  ? 14.959  6.441   -16.973 1.00 0.00 ? 17  PRO A HB3  5  
ATOM 7958  H HG2  . PRO A 1 17  ? 15.284  4.695   -14.610 1.00 0.00 ? 17  PRO A HG2  5  
ATOM 7959  H HG3  . PRO A 1 17  ? 13.820  5.411   -15.252 1.00 0.00 ? 17  PRO A HG3  5  
ATOM 7960  H HD2  . PRO A 1 17  ? 14.659  2.683   -15.528 1.00 0.00 ? 17  PRO A HD2  5  
ATOM 7961  H HD3  . PRO A 1 17  ? 13.255  3.427   -16.266 1.00 0.00 ? 17  PRO A HD3  5  
ATOM 7962  N N    . PRO A 1 18  ? 18.324  5.085   -17.765 1.00 0.00 ? 18  PRO A N    5  
ATOM 7963  C CA   . PRO A 1 18  ? 19.742  4.778   -17.681 1.00 0.00 ? 18  PRO A CA   5  
ATOM 7964  C C    . PRO A 1 18  ? 20.204  4.719   -16.223 1.00 0.00 ? 18  PRO A C    5  
ATOM 7965  O O    . PRO A 1 18  ? 19.489  5.157   -15.323 1.00 0.00 ? 18  PRO A O    5  
ATOM 7966  C CB   . PRO A 1 18  ? 20.431  5.874   -18.478 1.00 0.00 ? 18  PRO A CB   5  
ATOM 7967  C CG   . PRO A 1 18  ? 19.422  7.005   -18.588 1.00 0.00 ? 18  PRO A CG   5  
ATOM 7968  C CD   . PRO A 1 18  ? 18.063  6.460   -18.182 1.00 0.00 ? 18  PRO A CD   5  
ATOM 7969  H HA   . PRO A 1 18  ? 19.924  3.872   -18.062 1.00 0.00 ? 18  PRO A HA   5  
ATOM 7970  H HB2  . PRO A 1 18  ? 21.340  6.208   -17.978 1.00 0.00 ? 18  PRO A HB2  5  
ATOM 7971  H HB3  . PRO A 1 18  ? 20.723  5.514   -19.464 1.00 0.00 ? 18  PRO A HB3  5  
ATOM 7972  H HG2  . PRO A 1 18  ? 19.708  7.836   -17.942 1.00 0.00 ? 18  PRO A HG2  5  
ATOM 7973  H HG3  . PRO A 1 18  ? 19.390  7.391   -19.607 1.00 0.00 ? 18  PRO A HG3  5  
ATOM 7974  H HD2  . PRO A 1 18  ? 17.627  7.043   -17.371 1.00 0.00 ? 18  PRO A HD2  5  
ATOM 7975  H HD3  . PRO A 1 18  ? 17.358  6.494   -19.013 1.00 0.00 ? 18  PRO A HD3  5  
ATOM 7976  N N    . ILE A 1 19  ? 21.397  4.173   -16.035 1.00 0.00 ? 19  ILE A N    5  
ATOM 7977  C CA   . ILE A 1 19  ? 21.962  4.051   -14.703 1.00 0.00 ? 19  ILE A CA   5  
ATOM 7978  C C    . ILE A 1 19  ? 21.055  3.164   -13.847 1.00 0.00 ? 19  ILE A C    5  
ATOM 7979  O O    . ILE A 1 19  ? 19.833  3.204   -13.986 1.00 0.00 ? 19  ILE A O    5  
ATOM 7980  C CB   . ILE A 1 19  ? 22.216  5.434   -14.100 1.00 0.00 ? 19  ILE A CB   5  
ATOM 7981  C CG1  . ILE A 1 19  ? 23.483  6.063   -14.684 1.00 0.00 ? 19  ILE A CG1  5  
ATOM 7982  C CG2  . ILE A 1 19  ? 22.262  5.366   -12.572 1.00 0.00 ? 19  ILE A CG2  5  
ATOM 7983  C CD1  . ILE A 1 19  ? 23.534  7.564   -14.393 1.00 0.00 ? 19  ILE A CD1  5  
ATOM 7984  H H    . ILE A 1 19  ? 21.972  3.819   -16.773 1.00 0.00 ? 19  ILE A H    5  
ATOM 7985  H HA   . ILE A 1 19  ? 22.931  3.560   -14.802 1.00 0.00 ? 19  ILE A HA   5  
ATOM 7986  H HB   . ILE A 1 19  ? 21.382  6.082   -14.368 1.00 0.00 ? 19  ILE A HB   5  
ATOM 7987  H HG12 . ILE A 1 19  ? 24.362  5.577   -14.261 1.00 0.00 ? 19  ILE A HG12 5  
ATOM 7988  H HG13 . ILE A 1 19  ? 23.513  5.896   -15.760 1.00 0.00 ? 19  ILE A HG13 5  
ATOM 7989  H HG21 . ILE A 1 19  ? 22.964  6.110   -12.196 1.00 0.00 ? 19  ILE A HG21 5  
ATOM 7990  H HG22 . ILE A 1 19  ? 21.269  5.566   -12.169 1.00 0.00 ? 19  ILE A HG22 5  
ATOM 7991  H HG23 . ILE A 1 19  ? 22.586  4.372   -12.262 1.00 0.00 ? 19  ILE A HG23 5  
ATOM 7992  H HD11 . ILE A 1 19  ? 24.556  7.923   -14.512 1.00 0.00 ? 19  ILE A HD11 5  
ATOM 7993  H HD12 . ILE A 1 19  ? 22.881  8.091   -15.089 1.00 0.00 ? 19  ILE A HD12 5  
ATOM 7994  H HD13 . ILE A 1 19  ? 23.201  7.748   -13.372 1.00 0.00 ? 19  ILE A HD13 5  
ATOM 7995  N N    . LEU A 1 20  ? 21.688  2.385   -12.982 1.00 0.00 ? 20  LEU A N    5  
ATOM 7996  C CA   . LEU A 1 20  ? 20.953  1.490   -12.105 1.00 0.00 ? 20  LEU A CA   5  
ATOM 7997  C C    . LEU A 1 20  ? 21.699  1.359   -10.776 1.00 0.00 ? 20  LEU A C    5  
ATOM 7998  O O    . LEU A 1 20  ? 22.338  0.340   -10.516 1.00 0.00 ? 20  LEU A O    5  
ATOM 7999  C CB   . LEU A 1 20  ? 20.694  0.151   -12.799 1.00 0.00 ? 20  LEU A CB   5  
ATOM 8000  C CG   . LEU A 1 20  ? 19.411  -0.578  -12.395 1.00 0.00 ? 20  LEU A CG   5  
ATOM 8001  C CD1  . LEU A 1 20  ? 18.537  -0.869  -13.616 1.00 0.00 ? 20  LEU A CD1  5  
ATOM 8002  C CD2  . LEU A 1 20  ? 19.729  -1.847  -11.602 1.00 0.00 ? 20  LEU A CD2  5  
ATOM 8003  H H    . LEU A 1 20  ? 22.682  2.359   -12.876 1.00 0.00 ? 20  LEU A H    5  
ATOM 8004  H HA   . LEU A 1 20  ? 19.982  1.946   -11.912 1.00 0.00 ? 20  LEU A HA   5  
ATOM 8005  H HB2  . LEU A 1 20  ? 20.667  0.322   -13.876 1.00 0.00 ? 20  LEU A HB2  5  
ATOM 8006  H HB3  . LEU A 1 20  ? 21.540  -0.507  -12.602 1.00 0.00 ? 20  LEU A HB3  5  
ATOM 8007  H HG   . LEU A 1 20  ? 18.839  0.077   -11.738 1.00 0.00 ? 20  LEU A HG   5  
ATOM 8008  H HD11 . LEU A 1 20  ? 17.861  -1.693  -13.391 1.00 0.00 ? 20  LEU A HD11 5  
ATOM 8009  H HD12 . LEU A 1 20  ? 17.957  0.019   -13.867 1.00 0.00 ? 20  LEU A HD12 5  
ATOM 8010  H HD13 . LEU A 1 20  ? 19.171  -1.139  -14.461 1.00 0.00 ? 20  LEU A HD13 5  
ATOM 8011  H HD21 . LEU A 1 20  ? 20.736  -2.185  -11.845 1.00 0.00 ? 20  LEU A HD21 5  
ATOM 8012  H HD22 . LEU A 1 20  ? 19.665  -1.634  -10.534 1.00 0.00 ? 20  LEU A HD22 5  
ATOM 8013  H HD23 . LEU A 1 20  ? 19.012  -2.626  -11.860 1.00 0.00 ? 20  LEU A HD23 5  
ATOM 8014  N N    . GLU A 1 21  ? 21.594  2.405   -9.969  1.00 0.00 ? 21  GLU A N    5  
ATOM 8015  C CA   . GLU A 1 21  ? 22.251  2.419   -8.673  1.00 0.00 ? 21  GLU A CA   5  
ATOM 8016  C C    . GLU A 1 21  ? 21.828  3.656   -7.878  1.00 0.00 ? 21  GLU A C    5  
ATOM 8017  O O    . GLU A 1 21  ? 21.324  4.622   -8.447  1.00 0.00 ? 21  GLU A O    5  
ATOM 8018  C CB   . GLU A 1 21  ? 23.772  2.361   -8.829  1.00 0.00 ? 21  GLU A CB   5  
ATOM 8019  C CG   . GLU A 1 21  ? 24.327  1.038   -8.298  1.00 0.00 ? 21  GLU A CG   5  
ATOM 8020  C CD   . GLU A 1 21  ? 25.046  1.241   -6.963  1.00 0.00 ? 21  GLU A CD   5  
ATOM 8021  O OE1  . GLU A 1 21  ? 24.470  1.951   -6.110  1.00 0.00 ? 21  GLU A OE1  5  
ATOM 8022  O OE2  . GLU A 1 21  ? 26.156  0.683   -6.826  1.00 0.00 ? 21  GLU A OE2  5  
ATOM 8023  H H    . GLU A 1 21  ? 21.072  3.229   -10.188 1.00 0.00 ? 21  GLU A H    5  
ATOM 8024  H HA   . GLU A 1 21  ? 21.909  1.518   -8.165  1.00 0.00 ? 21  GLU A HA   5  
ATOM 8025  H HB2  . GLU A 1 21  ? 24.038  2.476   -9.880  1.00 0.00 ? 21  GLU A HB2  5  
ATOM 8026  H HB3  . GLU A 1 21  ? 24.228  3.193   -8.292  1.00 0.00 ? 21  GLU A HB3  5  
ATOM 8027  H HG2  . GLU A 1 21  ? 23.514  0.323   -8.172  1.00 0.00 ? 21  GLU A HG2  5  
ATOM 8028  H HG3  . GLU A 1 21  ? 25.017  0.611   -9.026  1.00 0.00 ? 21  GLU A HG3  5  
ATOM 8029  N N    . ARG A 1 22  ? 22.050  3.585   -6.573  1.00 0.00 ? 22  ARG A N    5  
ATOM 8030  C CA   . ARG A 1 22  ? 21.698  4.687   -5.694  1.00 0.00 ? 22  ARG A CA   5  
ATOM 8031  C C    . ARG A 1 22  ? 22.711  5.825   -5.838  1.00 0.00 ? 22  ARG A C    5  
ATOM 8032  O O    . ARG A 1 22  ? 23.573  6.006   -4.979  1.00 0.00 ? 22  ARG A O    5  
ATOM 8033  C CB   . ARG A 1 22  ? 21.655  4.234   -4.233  1.00 0.00 ? 22  ARG A CB   5  
ATOM 8034  C CG   . ARG A 1 22  ? 21.157  5.360   -3.324  1.00 0.00 ? 22  ARG A CG   5  
ATOM 8035  C CD   . ARG A 1 22  ? 21.609  5.138   -1.879  1.00 0.00 ? 22  ARG A CD   5  
ATOM 8036  N NE   . ARG A 1 22  ? 22.346  6.326   -1.392  1.00 0.00 ? 22  ARG A NE   5  
ATOM 8037  C CZ   . ARG A 1 22  ? 22.763  6.484   -0.129  1.00 0.00 ? 22  ARG A CZ   5  
ATOM 8038  N NH1  . ARG A 1 22  ? 22.519  5.532   0.782   1.00 0.00 ? 22  ARG A NH1  5  
ATOM 8039  N NH2  . ARG A 1 22  ? 23.425  7.595   0.224   1.00 0.00 ? 22  ARG A NH2  5  
ATOM 8040  H H    . ARG A 1 22  ? 22.461  2.796   -6.118  1.00 0.00 ? 22  ARG A H    5  
ATOM 8041  H HA   . ARG A 1 22  ? 20.707  5.001   -6.022  1.00 0.00 ? 22  ARG A HA   5  
ATOM 8042  H HB2  . ARG A 1 22  ? 21.000  3.368   -4.137  1.00 0.00 ? 22  ARG A HB2  5  
ATOM 8043  H HB3  . ARG A 1 22  ? 22.649  3.919   -3.917  1.00 0.00 ? 22  ARG A HB3  5  
ATOM 8044  H HG2  . ARG A 1 22  ? 21.534  6.317   -3.685  1.00 0.00 ? 22  ARG A HG2  5  
ATOM 8045  H HG3  . ARG A 1 22  ? 20.069  5.410   -3.365  1.00 0.00 ? 22  ARG A HG3  5  
ATOM 8046  H HD2  . ARG A 1 22  ? 20.744  4.950   -1.244  1.00 0.00 ? 22  ARG A HD2  5  
ATOM 8047  H HD3  . ARG A 1 22  ? 22.246  4.255   -1.820  1.00 0.00 ? 22  ARG A HD3  5  
ATOM 8048  H HE   . ARG A 1 22  ? 22.544  7.055   -2.046  1.00 0.00 ? 22  ARG A HE   5  
ATOM 8049  H HH11 . ARG A 1 22  ? 22.025  4.703   0.519   1.00 0.00 ? 22  ARG A HH11 5  
ATOM 8050  H HH12 . ARG A 1 22  ? 22.831  5.650   1.725   1.00 0.00 ? 22  ARG A HH12 5  
ATOM 8051  H HH21 . ARG A 1 22  ? 23.607  8.306   -0.456  1.00 0.00 ? 22  ARG A HH21 5  
ATOM 8052  H HH22 . ARG A 1 22  ? 23.736  7.713   1.167   1.00 0.00 ? 22  ARG A HH22 5  
ATOM 8053  N N    . THR A 1 23  ? 22.574  6.562   -6.930  1.00 0.00 ? 23  THR A N    5  
ATOM 8054  C CA   . THR A 1 23  ? 23.466  7.678   -7.197  1.00 0.00 ? 23  THR A CA   5  
ATOM 8055  C C    . THR A 1 23  ? 23.224  8.807   -6.194  1.00 0.00 ? 23  THR A C    5  
ATOM 8056  O O    . THR A 1 23  ? 24.167  9.327   -5.600  1.00 0.00 ? 23  THR A O    5  
ATOM 8057  C CB   . THR A 1 23  ? 23.266  8.105   -8.652  1.00 0.00 ? 23  THR A CB   5  
ATOM 8058  O OG1  . THR A 1 23  ? 24.108  7.224   -9.392  1.00 0.00 ? 23  THR A OG1  5  
ATOM 8059  C CG2  . THR A 1 23  ? 23.838  9.495   -8.939  1.00 0.00 ? 23  THR A CG2  5  
ATOM 8060  H H    . THR A 1 23  ? 21.870  6.409   -7.624  1.00 0.00 ? 23  THR A H    5  
ATOM 8061  H HA   . THR A 1 23  ? 24.492  7.338   -7.055  1.00 0.00 ? 23  THR A HA   5  
ATOM 8062  H HB   . THR A 1 23  ? 22.214  8.051   -8.933  1.00 0.00 ? 23  THR A HB   5  
ATOM 8063  H HG1  . THR A 1 23  ? 23.553  6.550   -9.880  1.00 0.00 ? 23  THR A HG1  5  
ATOM 8064  H HG21 . THR A 1 23  ? 23.022  10.197  -9.106  1.00 0.00 ? 23  THR A HG21 5  
ATOM 8065  H HG22 . THR A 1 23  ? 24.433  9.825   -8.087  1.00 0.00 ? 23  THR A HG22 5  
ATOM 8066  H HG23 . THR A 1 23  ? 24.468  9.452   -9.827  1.00 0.00 ? 23  THR A HG23 5  
ATOM 8067  N N    . LEU A 1 24  ? 21.954  9.152   -6.035  1.00 0.00 ? 24  LEU A N    5  
ATOM 8068  C CA   . LEU A 1 24  ? 21.576  10.210  -5.114  1.00 0.00 ? 24  LEU A CA   5  
ATOM 8069  C C    . LEU A 1 24  ? 20.649  9.638   -4.040  1.00 0.00 ? 24  LEU A C    5  
ATOM 8070  O O    . LEU A 1 24  ? 19.933  8.669   -4.286  1.00 0.00 ? 24  LEU A O    5  
ATOM 8071  C CB   . LEU A 1 24  ? 20.978  11.395  -5.875  1.00 0.00 ? 24  LEU A CB   5  
ATOM 8072  C CG   . LEU A 1 24  ? 21.752  12.711  -5.784  1.00 0.00 ? 24  LEU A CG   5  
ATOM 8073  C CD1  . LEU A 1 24  ? 21.818  13.209  -4.339  1.00 0.00 ? 24  LEU A CD1  5  
ATOM 8074  C CD2  . LEU A 1 24  ? 23.143  12.574  -6.407  1.00 0.00 ? 24  LEU A CD2  5  
ATOM 8075  H H    . LEU A 1 24  ? 21.193  8.724   -6.522  1.00 0.00 ? 24  LEU A H    5  
ATOM 8076  H HA   . LEU A 1 24  ? 22.487  10.564  -4.631  1.00 0.00 ? 24  LEU A HA   5  
ATOM 8077  H HB2  . LEU A 1 24  ? 20.891  11.120  -6.927  1.00 0.00 ? 24  LEU A HB2  5  
ATOM 8078  H HB3  . LEU A 1 24  ? 19.966  11.565  -5.506  1.00 0.00 ? 24  LEU A HB3  5  
ATOM 8079  H HG   . LEU A 1 24  ? 21.215  13.465  -6.360  1.00 0.00 ? 24  LEU A HG   5  
ATOM 8080  H HD11 . LEU A 1 24  ? 20.822  13.178  -3.898  1.00 0.00 ? 24  LEU A HD11 5  
ATOM 8081  H HD12 . LEU A 1 24  ? 22.490  12.571  -3.765  1.00 0.00 ? 24  LEU A HD12 5  
ATOM 8082  H HD13 . LEU A 1 24  ? 22.190  14.234  -4.324  1.00 0.00 ? 24  LEU A HD13 5  
ATOM 8083  H HD21 . LEU A 1 24  ? 23.163  11.703  -7.063  1.00 0.00 ? 24  LEU A HD21 5  
ATOM 8084  H HD22 . LEU A 1 24  ? 23.372  13.469  -6.984  1.00 0.00 ? 24  LEU A HD22 5  
ATOM 8085  H HD23 . LEU A 1 24  ? 23.884  12.451  -5.617  1.00 0.00 ? 24  LEU A HD23 5  
ATOM 8086  N N    . ASP A 1 25  ? 20.692  10.262  -2.872  1.00 0.00 ? 25  ASP A N    5  
ATOM 8087  C CA   . ASP A 1 25  ? 19.865  9.827   -1.760  1.00 0.00 ? 25  ASP A CA   5  
ATOM 8088  C C    . ASP A 1 25  ? 18.521  10.556  -1.814  1.00 0.00 ? 25  ASP A C    5  
ATOM 8089  O O    . ASP A 1 25  ? 18.478  11.785  -1.832  1.00 0.00 ? 25  ASP A O    5  
ATOM 8090  C CB   . ASP A 1 25  ? 20.527  10.155  -0.420  1.00 0.00 ? 25  ASP A CB   5  
ATOM 8091  C CG   . ASP A 1 25  ? 20.830  11.637  -0.194  1.00 0.00 ? 25  ASP A CG   5  
ATOM 8092  O OD1  . ASP A 1 25  ? 21.920  12.067  -0.628  1.00 0.00 ? 25  ASP A OD1  5  
ATOM 8093  O OD2  . ASP A 1 25  ? 19.963  12.308  0.409   1.00 0.00 ? 25  ASP A OD2  5  
ATOM 8094  H H    . ASP A 1 25  ? 21.278  11.050  -2.681  1.00 0.00 ? 25  ASP A H    5  
ATOM 8095  H HA   . ASP A 1 25  ? 19.760  8.750   -1.885  1.00 0.00 ? 25  ASP A HA   5  
ATOM 8096  H HB2  . ASP A 1 25  ? 19.879  9.805   0.383   1.00 0.00 ? 25  ASP A HB2  5  
ATOM 8097  H HB3  . ASP A 1 25  ? 21.458  9.594   -0.345  1.00 0.00 ? 25  ASP A HB3  5  
ATOM 8098  N N    . ASP A 1 26  ? 17.457  9.767   -1.839  1.00 0.00 ? 26  ASP A N    5  
ATOM 8099  C CA   . ASP A 1 26  ? 16.115  10.322  -1.890  1.00 0.00 ? 26  ASP A CA   5  
ATOM 8100  C C    . ASP A 1 26  ? 15.112  9.198   -2.156  1.00 0.00 ? 26  ASP A C    5  
ATOM 8101  O O    . ASP A 1 26  ? 15.450  8.196   -2.785  1.00 0.00 ? 26  ASP A O    5  
ATOM 8102  C CB   . ASP A 1 26  ? 15.986  11.347  -3.019  1.00 0.00 ? 26  ASP A CB   5  
ATOM 8103  C CG   . ASP A 1 26  ? 17.014  11.204  -4.143  1.00 0.00 ? 26  ASP A CG   5  
ATOM 8104  O OD1  . ASP A 1 26  ? 17.365  10.044  -4.447  1.00 0.00 ? 26  ASP A OD1  5  
ATOM 8105  O OD2  . ASP A 1 26  ? 17.425  12.259  -4.673  1.00 0.00 ? 26  ASP A OD2  5  
ATOM 8106  H H    . ASP A 1 26  ? 17.501  8.768   -1.824  1.00 0.00 ? 26  ASP A H    5  
ATOM 8107  H HA   . ASP A 1 26  ? 15.963  10.796  -0.920  1.00 0.00 ? 26  ASP A HA   5  
ATOM 8108  H HB2  . ASP A 1 26  ? 14.987  11.269  -3.448  1.00 0.00 ? 26  ASP A HB2  5  
ATOM 8109  H HB3  . ASP A 1 26  ? 16.072  12.347  -2.593  1.00 0.00 ? 26  ASP A HB3  5  
ATOM 8110  N N    . VAL A 1 27  ? 13.899  9.401   -1.664  1.00 0.00 ? 27  VAL A N    5  
ATOM 8111  C CA   . VAL A 1 27  ? 12.845  8.416   -1.840  1.00 0.00 ? 27  VAL A CA   5  
ATOM 8112  C C    . VAL A 1 27  ? 12.895  7.873   -3.270  1.00 0.00 ? 27  VAL A C    5  
ATOM 8113  O O    . VAL A 1 27  ? 13.451  8.512   -4.162  1.00 0.00 ? 27  VAL A O    5  
ATOM 8114  C CB   . VAL A 1 27  ? 11.490  9.030   -1.481  1.00 0.00 ? 27  VAL A CB   5  
ATOM 8115  C CG1  . VAL A 1 27  ? 11.360  9.225   0.031   1.00 0.00 ? 27  VAL A CG1  5  
ATOM 8116  C CG2  . VAL A 1 27  ? 11.271  10.349  -2.225  1.00 0.00 ? 27  VAL A CG2  5  
ATOM 8117  H H    . VAL A 1 27  ? 13.633  10.218  -1.153  1.00 0.00 ? 27  VAL A H    5  
ATOM 8118  H HA   . VAL A 1 27  ? 13.040  7.598   -1.147  1.00 0.00 ? 27  VAL A HA   5  
ATOM 8119  H HB   . VAL A 1 27  ? 10.713  8.334   -1.797  1.00 0.00 ? 27  VAL A HB   5  
ATOM 8120  H HG11 . VAL A 1 27  ? 11.568  8.282   0.538   1.00 0.00 ? 27  VAL A HG11 5  
ATOM 8121  H HG12 . VAL A 1 27  ? 12.073  9.980   0.362   1.00 0.00 ? 27  VAL A HG12 5  
ATOM 8122  H HG13 . VAL A 1 27  ? 10.348  9.550   0.270   1.00 0.00 ? 27  VAL A HG13 5  
ATOM 8123  H HG21 . VAL A 1 27  ? 10.948  10.141  -3.245  1.00 0.00 ? 27  VAL A HG21 5  
ATOM 8124  H HG22 . VAL A 1 27  ? 10.506  10.932  -1.713  1.00 0.00 ? 27  VAL A HG22 5  
ATOM 8125  H HG23 . VAL A 1 27  ? 12.204  10.913  -2.246  1.00 0.00 ? 27  VAL A HG23 5  
ATOM 8126  N N    . PRO A 1 28  ? 12.292  6.667   -3.447  1.00 0.00 ? 28  PRO A N    5  
ATOM 8127  C CA   . PRO A 1 28  ? 12.262  6.030   -4.753  1.00 0.00 ? 28  PRO A CA   5  
ATOM 8128  C C    . PRO A 1 28  ? 11.248  6.713   -5.673  1.00 0.00 ? 28  PRO A C    5  
ATOM 8129  O O    . PRO A 1 28  ? 10.583  7.667   -5.271  1.00 0.00 ? 28  PRO A O    5  
ATOM 8130  C CB   . PRO A 1 28  ? 11.925  4.575   -4.473  1.00 0.00 ? 28  PRO A CB   5  
ATOM 8131  C CG   . PRO A 1 28  ? 11.323  4.547   -3.078  1.00 0.00 ? 28  PRO A CG   5  
ATOM 8132  C CD   . PRO A 1 28  ? 11.624  5.881   -2.414  1.00 0.00 ? 28  PRO A CD   5  
ATOM 8133  H HA   . PRO A 1 28  ? 13.149  6.125   -5.206  1.00 0.00 ? 28  PRO A HA   5  
ATOM 8134  H HB2  . PRO A 1 28  ? 11.220  4.188   -5.210  1.00 0.00 ? 28  PRO A HB2  5  
ATOM 8135  H HB3  . PRO A 1 28  ? 12.816  3.950   -4.527  1.00 0.00 ? 28  PRO A HB3  5  
ATOM 8136  H HG2  . PRO A 1 28  ? 10.247  4.380   -3.129  1.00 0.00 ? 28  PRO A HG2  5  
ATOM 8137  H HG3  . PRO A 1 28  ? 11.746  3.728   -2.496  1.00 0.00 ? 28  PRO A HG3  5  
ATOM 8138  H HD2  . PRO A 1 28  ? 10.710  6.369   -2.074  1.00 0.00 ? 28  PRO A HD2  5  
ATOM 8139  H HD3  . PRO A 1 28  ? 12.261  5.754   -1.539  1.00 0.00 ? 28  PRO A HD3  5  
ATOM 8140  N N    . GLY A 1 29  ? 11.161  6.197   -6.891  1.00 0.00 ? 29  GLY A N    5  
ATOM 8141  C CA   . GLY A 1 29  ? 10.239  6.745   -7.871  1.00 0.00 ? 29  GLY A CA   5  
ATOM 8142  C C    . GLY A 1 29  ? 8.934   5.946   -7.903  1.00 0.00 ? 29  GLY A C    5  
ATOM 8143  O O    . GLY A 1 29  ? 8.711   5.081   -7.058  1.00 0.00 ? 29  GLY A O    5  
ATOM 8144  H H    . GLY A 1 29  ? 11.705  5.421   -7.210  1.00 0.00 ? 29  GLY A H    5  
ATOM 8145  H HA2  . GLY A 1 29  ? 10.025  7.787   -7.633  1.00 0.00 ? 29  GLY A HA2  5  
ATOM 8146  H HA3  . GLY A 1 29  ? 10.702  6.732   -8.858  1.00 0.00 ? 29  GLY A HA3  5  
ATOM 8147  N N    . PRO A 1 30  ? 8.085   6.273   -8.914  1.00 0.00 ? 30  PRO A N    5  
ATOM 8148  C CA   . PRO A 1 30  ? 6.809   5.595   -9.068  1.00 0.00 ? 30  PRO A CA   5  
ATOM 8149  C C    . PRO A 1 30  ? 7.000   4.188   -9.637  1.00 0.00 ? 30  PRO A C    5  
ATOM 8150  O O    . PRO A 1 30  ? 7.790   3.989   -10.558 1.00 0.00 ? 30  PRO A O    5  
ATOM 8151  C CB   . PRO A 1 30  ? 5.992   6.498   -9.978  1.00 0.00 ? 30  PRO A CB   5  
ATOM 8152  C CG   . PRO A 1 30  ? 6.993   7.407   -10.672 1.00 0.00 ? 30  PRO A CG   5  
ATOM 8153  C CD   . PRO A 1 30  ? 8.317   7.292   -9.934  1.00 0.00 ? 30  PRO A CD   5  
ATOM 8154  H HA   . PRO A 1 30  ? 6.371   5.473   -8.177  1.00 0.00 ? 30  PRO A HA   5  
ATOM 8155  H HB2  . PRO A 1 30  ? 5.427   5.913   -10.703 1.00 0.00 ? 30  PRO A HB2  5  
ATOM 8156  H HB3  . PRO A 1 30  ? 5.269   7.079   -9.405  1.00 0.00 ? 30  PRO A HB3  5  
ATOM 8157  H HG2  . PRO A 1 30  ? 7.111   7.117   -11.716 1.00 0.00 ? 30  PRO A HG2  5  
ATOM 8158  H HG3  . PRO A 1 30  ? 6.641   8.438   -10.665 1.00 0.00 ? 30  PRO A HG3  5  
ATOM 8159  H HD2  . PRO A 1 30  ? 9.122   7.001   -10.608 1.00 0.00 ? 30  PRO A HD2  5  
ATOM 8160  H HD3  . PRO A 1 30  ? 8.604   8.242   -9.485  1.00 0.00 ? 30  PRO A HD3  5  
ATOM 8161  N N    . PRO A 1 31  ? 6.243   3.223   -9.049  1.00 0.00 ? 31  PRO A N    5  
ATOM 8162  C CA   . PRO A 1 31  ? 6.322   1.840   -9.487  1.00 0.00 ? 31  PRO A CA   5  
ATOM 8163  C C    . PRO A 1 31  ? 5.596   1.645   -10.820 1.00 0.00 ? 31  PRO A C    5  
ATOM 8164  O O    . PRO A 1 31  ? 4.370   1.728   -10.882 1.00 0.00 ? 31  PRO A O    5  
ATOM 8165  C CB   . PRO A 1 31  ? 5.709   1.033   -8.354  1.00 0.00 ? 31  PRO A CB   5  
ATOM 8166  C CG   . PRO A 1 31  ? 4.893   2.018   -7.534  1.00 0.00 ? 31  PRO A CG   5  
ATOM 8167  C CD   . PRO A 1 31  ? 5.297   3.422   -7.955  1.00 0.00 ? 31  PRO A CD   5  
ATOM 8168  H HA   . PRO A 1 31  ? 7.273   1.582   -9.654  1.00 0.00 ? 31  PRO A HA   5  
ATOM 8169  H HB2  . PRO A 1 31  ? 5.080   0.231   -8.741  1.00 0.00 ? 31  PRO A HB2  5  
ATOM 8170  H HB3  . PRO A 1 31  ? 6.483   0.564   -7.746  1.00 0.00 ? 31  PRO A HB3  5  
ATOM 8171  H HG2  . PRO A 1 31  ? 3.827   1.862   -7.699  1.00 0.00 ? 31  PRO A HG2  5  
ATOM 8172  H HG3  . PRO A 1 31  ? 5.076   1.872   -6.469  1.00 0.00 ? 31  PRO A HG3  5  
ATOM 8173  H HD2  . PRO A 1 31  ? 4.433   4.002   -8.280  1.00 0.00 ? 31  PRO A HD2  5  
ATOM 8174  H HD3  . PRO A 1 31  ? 5.755   3.967   -7.130  1.00 0.00 ? 31  PRO A HD3  5  
ATOM 8175  N N    . MET A 1 32  ? 6.384   1.390   -11.854 1.00 0.00 ? 32  MET A N    5  
ATOM 8176  C CA   . MET A 1 32  ? 5.831   1.183   -13.182 1.00 0.00 ? 32  MET A CA   5  
ATOM 8177  C C    . MET A 1 32  ? 5.530   -0.297  -13.426 1.00 0.00 ? 32  MET A C    5  
ATOM 8178  O O    . MET A 1 32  ? 6.058   -1.164  -12.732 1.00 0.00 ? 32  MET A O    5  
ATOM 8179  C CB   . MET A 1 32  ? 6.827   1.681   -14.233 1.00 0.00 ? 32  MET A CB   5  
ATOM 8180  C CG   . MET A 1 32  ? 8.179   0.982   -14.081 1.00 0.00 ? 32  MET A CG   5  
ATOM 8181  S SD   . MET A 1 32  ? 9.145   1.194   -15.567 1.00 0.00 ? 32  MET A SD   5  
ATOM 8182  C CE   . MET A 1 32  ? 10.763  0.760   -14.949 1.00 0.00 ? 32  MET A CE   5  
ATOM 8183  H H    . MET A 1 32  ? 7.380   1.324   -11.796 1.00 0.00 ? 32  MET A H    5  
ATOM 8184  H HA   . MET A 1 32  ? 4.906   1.759   -13.208 1.00 0.00 ? 32  MET A HA   5  
ATOM 8185  H HB2  . MET A 1 32  ? 6.429   1.499   -15.231 1.00 0.00 ? 32  MET A HB2  5  
ATOM 8186  H HB3  . MET A 1 32  ? 6.957   2.759   -14.133 1.00 0.00 ? 32  MET A HB3  5  
ATOM 8187  H HG2  . MET A 1 32  ? 8.716   1.393   -13.226 1.00 0.00 ? 32  MET A HG2  5  
ATOM 8188  H HG3  . MET A 1 32  ? 8.029   -0.079  -13.883 1.00 0.00 ? 32  MET A HG3  5  
ATOM 8189  H HE1  . MET A 1 32  ? 11.148  -0.094  -15.507 1.00 0.00 ? 32  MET A HE1  5  
ATOM 8190  H HE2  . MET A 1 32  ? 11.438  1.607   -15.071 1.00 0.00 ? 32  MET A HE2  5  
ATOM 8191  H HE3  . MET A 1 32  ? 10.691  0.501   -13.893 1.00 0.00 ? 32  MET A HE3  5  
ATOM 8192  N N    . GLY A 1 33  ? 4.682   -0.540  -14.414 1.00 0.00 ? 33  GLY A N    5  
ATOM 8193  C CA   . GLY A 1 33  ? 4.303   -1.900  -14.758 1.00 0.00 ? 33  GLY A CA   5  
ATOM 8194  C C    . GLY A 1 33  ? 3.105   -2.363  -13.927 1.00 0.00 ? 33  GLY A C    5  
ATOM 8195  O O    . GLY A 1 33  ? 3.142   -3.433  -13.321 1.00 0.00 ? 33  GLY A O    5  
ATOM 8196  H H    . GLY A 1 33  ? 4.256   0.171   -14.974 1.00 0.00 ? 33  GLY A H    5  
ATOM 8197  H HA2  . GLY A 1 33  ? 4.057   -1.956  -15.819 1.00 0.00 ? 33  GLY A HA2  5  
ATOM 8198  H HA3  . GLY A 1 33  ? 5.147   -2.570  -14.591 1.00 0.00 ? 33  GLY A HA3  5  
ATOM 8199  N N    . ILE A 1 34  ? 2.072   -1.535  -13.924 1.00 0.00 ? 34  ILE A N    5  
ATOM 8200  C CA   . ILE A 1 34  ? 0.865   -1.846  -13.176 1.00 0.00 ? 34  ILE A CA   5  
ATOM 8201  C C    . ILE A 1 34  ? -0.149  -2.511  -14.108 1.00 0.00 ? 34  ILE A C    5  
ATOM 8202  O O    . ILE A 1 34  ? -0.513  -1.949  -15.140 1.00 0.00 ? 34  ILE A O    5  
ATOM 8203  C CB   . ILE A 1 34  ? 0.330   -0.594  -12.478 1.00 0.00 ? 34  ILE A CB   5  
ATOM 8204  C CG1  . ILE A 1 34  ? 1.474   0.246   -11.905 1.00 0.00 ? 34  ILE A CG1  5  
ATOM 8205  C CG2  . ILE A 1 34  ? -0.702  -0.961  -11.410 1.00 0.00 ? 34  ILE A CG2  5  
ATOM 8206  C CD1  . ILE A 1 34  ? 2.386   -0.603  -11.019 1.00 0.00 ? 34  ILE A CD1  5  
ATOM 8207  H H    . ILE A 1 34  ? 2.050   -0.666  -14.419 1.00 0.00 ? 34  ILE A H    5  
ATOM 8208  H HA   . ILE A 1 34  ? 1.138   -2.558  -12.397 1.00 0.00 ? 34  ILE A HA   5  
ATOM 8209  H HB   . ILE A 1 34  ? -0.180  0.020   -13.221 1.00 0.00 ? 34  ILE A HB   5  
ATOM 8210  H HG12 . ILE A 1 34  ? 2.053   0.681   -12.720 1.00 0.00 ? 34  ILE A HG12 5  
ATOM 8211  H HG13 . ILE A 1 34  ? 1.066   1.075   -11.326 1.00 0.00 ? 34  ILE A HG13 5  
ATOM 8212  H HG21 . ILE A 1 34  ? -0.645  -0.247  -10.589 1.00 0.00 ? 34  ILE A HG21 5  
ATOM 8213  H HG22 . ILE A 1 34  ? -1.701  -0.934  -11.846 1.00 0.00 ? 34  ILE A HG22 5  
ATOM 8214  H HG23 . ILE A 1 34  ? -0.497  -1.964  -11.035 1.00 0.00 ? 34  ILE A HG23 5  
ATOM 8215  H HD11 . ILE A 1 34  ? 1.924   -1.575  -10.846 1.00 0.00 ? 34  ILE A HD11 5  
ATOM 8216  H HD12 . ILE A 1 34  ? 3.348   -0.741  -11.514 1.00 0.00 ? 34  ILE A HD12 5  
ATOM 8217  H HD13 . ILE A 1 34  ? 2.538   -0.098  -10.065 1.00 0.00 ? 34  ILE A HD13 5  
ATOM 8218  N N    . LEU A 1 35  ? -0.578  -3.701  -13.711 1.00 0.00 ? 35  LEU A N    5  
ATOM 8219  C CA   . LEU A 1 35  ? -1.544  -4.449  -14.498 1.00 0.00 ? 35  LEU A CA   5  
ATOM 8220  C C    . LEU A 1 35  ? -2.431  -5.271  -13.561 1.00 0.00 ? 35  LEU A C    5  
ATOM 8221  O O    . LEU A 1 35  ? -2.000  -5.663  -12.478 1.00 0.00 ? 35  LEU A O    5  
ATOM 8222  C CB   . LEU A 1 35  ? -0.833  -5.286  -15.564 1.00 0.00 ? 35  LEU A CB   5  
ATOM 8223  C CG   . LEU A 1 35  ? -0.106  -4.502  -16.658 1.00 0.00 ? 35  LEU A CG   5  
ATOM 8224  C CD1  . LEU A 1 35  ? 0.686   -5.440  -17.571 1.00 0.00 ? 35  LEU A CD1  5  
ATOM 8225  C CD2  . LEU A 1 35  ? -1.083  -3.626  -17.446 1.00 0.00 ? 35  LEU A CD2  5  
ATOM 8226  H H    . LEU A 1 35  ? -0.277  -4.151  -12.871 1.00 0.00 ? 35  LEU A H    5  
ATOM 8227  H HA   . LEU A 1 35  ? -2.170  -3.726  -15.021 1.00 0.00 ? 35  LEU A HA   5  
ATOM 8228  H HB2  . LEU A 1 35  ? -0.110  -5.933  -15.067 1.00 0.00 ? 35  LEU A HB2  5  
ATOM 8229  H HB3  . LEU A 1 35  ? -1.569  -5.936  -16.037 1.00 0.00 ? 35  LEU A HB3  5  
ATOM 8230  H HG   . LEU A 1 35  ? 0.611   -3.834  -16.181 1.00 0.00 ? 35  LEU A HG   5  
ATOM 8231  H HD11 . LEU A 1 35  ? 0.221   -6.425  -17.571 1.00 0.00 ? 35  LEU A HD11 5  
ATOM 8232  H HD12 . LEU A 1 35  ? 0.693   -5.040  -18.585 1.00 0.00 ? 35  LEU A HD12 5  
ATOM 8233  H HD13 . LEU A 1 35  ? 1.710   -5.522  -17.206 1.00 0.00 ? 35  LEU A HD13 5  
ATOM 8234  H HD21 . LEU A 1 35  ? -1.616  -2.969  -16.759 1.00 0.00 ? 35  LEU A HD21 5  
ATOM 8235  H HD22 . LEU A 1 35  ? -0.531  -3.026  -18.169 1.00 0.00 ? 35  LEU A HD22 5  
ATOM 8236  H HD23 . LEU A 1 35  ? -1.798  -4.261  -17.970 1.00 0.00 ? 35  LEU A HD23 5  
ATOM 8237  N N    . PHE A 1 36  ? -3.654  -5.508  -14.013 1.00 0.00 ? 36  PHE A N    5  
ATOM 8238  C CA   . PHE A 1 36  ? -4.605  -6.276  -13.228 1.00 0.00 ? 36  PHE A CA   5  
ATOM 8239  C C    . PHE A 1 36  ? -4.954  -7.593  -13.925 1.00 0.00 ? 36  PHE A C    5  
ATOM 8240  O O    . PHE A 1 36  ? -5.882  -7.645  -14.732 1.00 0.00 ? 36  PHE A O    5  
ATOM 8241  C CB   . PHE A 1 36  ? -5.872  -5.427  -13.104 1.00 0.00 ? 36  PHE A CB   5  
ATOM 8242  C CG   . PHE A 1 36  ? -5.725  -4.223  -12.172 1.00 0.00 ? 36  PHE A CG   5  
ATOM 8243  C CD1  . PHE A 1 36  ? -5.941  -4.367  -10.837 1.00 0.00 ? 36  PHE A CD1  5  
ATOM 8244  C CD2  . PHE A 1 36  ? -5.379  -3.009  -12.678 1.00 0.00 ? 36  PHE A CD2  5  
ATOM 8245  C CE1  . PHE A 1 36  ? -5.805  -3.249  -9.971  1.00 0.00 ? 36  PHE A CE1  5  
ATOM 8246  C CE2  . PHE A 1 36  ? -5.242  -1.892  -11.812 1.00 0.00 ? 36  PHE A CE2  5  
ATOM 8247  C CZ   . PHE A 1 36  ? -5.458  -2.035  -10.477 1.00 0.00 ? 36  PHE A CZ   5  
ATOM 8248  H H    . PHE A 1 36  ? -3.996  -5.186  -14.895 1.00 0.00 ? 36  PHE A H    5  
ATOM 8249  H HA   . PHE A 1 36  ? -4.136  -6.489  -12.268 1.00 0.00 ? 36  PHE A HA   5  
ATOM 8250  H HB2  . PHE A 1 36  ? -6.158  -5.073  -14.095 1.00 0.00 ? 36  PHE A HB2  5  
ATOM 8251  H HB3  . PHE A 1 36  ? -6.685  -6.056  -12.743 1.00 0.00 ? 36  PHE A HB3  5  
ATOM 8252  H HD1  . PHE A 1 36  ? -6.219  -5.339  -10.431 1.00 0.00 ? 36  PHE A HD1  5  
ATOM 8253  H HD2  . PHE A 1 36  ? -5.206  -2.894  -13.748 1.00 0.00 ? 36  PHE A HD2  5  
ATOM 8254  H HE1  . PHE A 1 36  ? -5.978  -3.364  -8.901  1.00 0.00 ? 36  PHE A HE1  5  
ATOM 8255  H HE2  . PHE A 1 36  ? -4.965  -0.919  -12.218 1.00 0.00 ? 36  PHE A HE2  5  
ATOM 8256  H HZ   . PHE A 1 36  ? -5.354  -1.177  -9.813  1.00 0.00 ? 36  PHE A HZ   5  
ATOM 8257  N N    . PRO A 1 37  ? -4.173  -8.651  -13.580 1.00 0.00 ? 37  PRO A N    5  
ATOM 8258  C CA   . PRO A 1 37  ? -4.390  -9.963  -14.164 1.00 0.00 ? 37  PRO A CA   5  
ATOM 8259  C C    . PRO A 1 37  ? -5.625  -10.634 -13.560 1.00 0.00 ? 37  PRO A C    5  
ATOM 8260  O O    . PRO A 1 37  ? -6.483  -11.133 -14.287 1.00 0.00 ? 37  PRO A O    5  
ATOM 8261  C CB   . PRO A 1 37  ? -3.106  -10.731 -13.895 1.00 0.00 ? 37  PRO A CB   5  
ATOM 8262  C CG   . PRO A 1 37  ? -2.402  -9.985  -12.773 1.00 0.00 ? 37  PRO A CG   5  
ATOM 8263  C CD   . PRO A 1 37  ? -3.066  -8.625  -12.629 1.00 0.00 ? 37  PRO A CD   5  
ATOM 8264  H HA   . PRO A 1 37  ? -4.575  -9.882  -15.143 1.00 0.00 ? 37  PRO A HA   5  
ATOM 8265  H HB2  . PRO A 1 37  ? -3.319  -11.760 -13.606 1.00 0.00 ? 37  PRO A HB2  5  
ATOM 8266  H HB3  . PRO A 1 37  ? -2.482  -10.774 -14.787 1.00 0.00 ? 37  PRO A HB3  5  
ATOM 8267  H HG2  . PRO A 1 37  ? -2.471  -10.545 -11.840 1.00 0.00 ? 37  PRO A HG2  5  
ATOM 8268  H HG3  . PRO A 1 37  ? -1.341  -9.870  -12.998 1.00 0.00 ? 37  PRO A HG3  5  
ATOM 8269  H HD2  . PRO A 1 37  ? -3.422  -8.465  -11.611 1.00 0.00 ? 37  PRO A HD2  5  
ATOM 8270  H HD3  . PRO A 1 37  ? -2.369  -7.818  -12.853 1.00 0.00 ? 37  PRO A HD3  5  
ATOM 8271  N N    . GLU A 1 38  ? -5.677  -10.625 -12.236 1.00 0.00 ? 38  GLU A N    5  
ATOM 8272  C CA   . GLU A 1 38  ? -6.793  -11.227 -11.526 1.00 0.00 ? 38  GLU A CA   5  
ATOM 8273  C C    . GLU A 1 38  ? -7.601  -10.150 -10.799 1.00 0.00 ? 38  GLU A C    5  
ATOM 8274  O O    . GLU A 1 38  ? -7.084  -9.474  -9.911  1.00 0.00 ? 38  GLU A O    5  
ATOM 8275  C CB   . GLU A 1 38  ? -6.307  -12.301 -10.550 1.00 0.00 ? 38  GLU A CB   5  
ATOM 8276  C CG   . GLU A 1 38  ? -7.383  -12.624 -9.511  1.00 0.00 ? 38  GLU A CG   5  
ATOM 8277  C CD   . GLU A 1 38  ? -6.892  -13.689 -8.528  1.00 0.00 ? 38  GLU A CD   5  
ATOM 8278  O OE1  . GLU A 1 38  ? -6.170  -13.300 -7.585  1.00 0.00 ? 38  GLU A OE1  5  
ATOM 8279  O OE2  . GLU A 1 38  ? -7.251  -14.867 -8.742  1.00 0.00 ? 38  GLU A OE2  5  
ATOM 8280  H H    . GLU A 1 38  ? -4.975  -10.217 -11.652 1.00 0.00 ? 38  GLU A H    5  
ATOM 8281  H HA   . GLU A 1 38  ? -7.407  -11.695 -12.295 1.00 0.00 ? 38  GLU A HA   5  
ATOM 8282  H HB2  . GLU A 1 38  ? -6.044  -13.204 -11.100 1.00 0.00 ? 38  GLU A HB2  5  
ATOM 8283  H HB3  . GLU A 1 38  ? -5.402  -11.958 -10.048 1.00 0.00 ? 38  GLU A HB3  5  
ATOM 8284  H HG2  . GLU A 1 38  ? -7.652  -11.719 -8.968  1.00 0.00 ? 38  GLU A HG2  5  
ATOM 8285  H HG3  . GLU A 1 38  ? -8.284  -12.975 -10.013 1.00 0.00 ? 38  GLU A HG3  5  
ATOM 8286  N N    . VAL A 1 39  ? -8.857  -10.026 -11.202 1.00 0.00 ? 39  VAL A N    5  
ATOM 8287  C CA   . VAL A 1 39  ? -9.742  -9.043  -10.599 1.00 0.00 ? 39  VAL A CA   5  
ATOM 8288  C C    . VAL A 1 39  ? -11.141 -9.645  -10.454 1.00 0.00 ? 39  VAL A C    5  
ATOM 8289  O O    . VAL A 1 39  ? -11.735 -10.088 -11.436 1.00 0.00 ? 39  VAL A O    5  
ATOM 8290  C CB   . VAL A 1 39  ? -9.729  -7.753  -11.422 1.00 0.00 ? 39  VAL A CB   5  
ATOM 8291  C CG1  . VAL A 1 39  ? -10.808 -6.783  -10.937 1.00 0.00 ? 39  VAL A CG1  5  
ATOM 8292  C CG2  . VAL A 1 39  ? -8.347  -7.097  -11.389 1.00 0.00 ? 39  VAL A CG2  5  
ATOM 8293  H H    . VAL A 1 39  ? -9.270  -10.580 -11.924 1.00 0.00 ? 39  VAL A H    5  
ATOM 8294  H HA   . VAL A 1 39  ? -9.353  -8.815  -9.607  1.00 0.00 ? 39  VAL A HA   5  
ATOM 8295  H HB   . VAL A 1 39  ? -9.952  -8.013  -12.457 1.00 0.00 ? 39  VAL A HB   5  
ATOM 8296  H HG11 . VAL A 1 39  ? -11.667 -7.347  -10.575 1.00 0.00 ? 39  VAL A HG11 5  
ATOM 8297  H HG12 . VAL A 1 39  ? -10.409 -6.169  -10.130 1.00 0.00 ? 39  VAL A HG12 5  
ATOM 8298  H HG13 . VAL A 1 39  ? -11.117 -6.142  -11.763 1.00 0.00 ? 39  VAL A HG13 5  
ATOM 8299  H HG21 . VAL A 1 39  ? -7.990  -7.052  -10.361 1.00 0.00 ? 39  VAL A HG21 5  
ATOM 8300  H HG22 . VAL A 1 39  ? -7.652  -7.684  -11.990 1.00 0.00 ? 39  VAL A HG22 5  
ATOM 8301  H HG23 . VAL A 1 39  ? -8.415  -6.087  -11.795 1.00 0.00 ? 39  VAL A HG23 5  
ATOM 8302  N N    . ARG A 1 40  ? -11.627 -9.641  -9.221  1.00 0.00 ? 40  ARG A N    5  
ATOM 8303  C CA   . ARG A 1 40  ? -12.945 -10.181 -8.935  1.00 0.00 ? 40  ARG A CA   5  
ATOM 8304  C C    . ARG A 1 40  ? -13.886 -9.067  -8.469  1.00 0.00 ? 40  ARG A C    5  
ATOM 8305  O O    . ARG A 1 40  ? -13.552 -7.887  -8.566  1.00 0.00 ? 40  ARG A O    5  
ATOM 8306  C CB   . ARG A 1 40  ? -12.875 -11.263 -7.856  1.00 0.00 ? 40  ARG A CB   5  
ATOM 8307  C CG   . ARG A 1 40  ? -11.673 -12.184 -8.081  1.00 0.00 ? 40  ARG A CG   5  
ATOM 8308  C CD   . ARG A 1 40  ? -11.764 -12.882 -9.439  1.00 0.00 ? 40  ARG A CD   5  
ATOM 8309  N NE   . ARG A 1 40  ? -10.762 -13.968 -9.518  1.00 0.00 ? 40  ARG A NE   5  
ATOM 8310  C CZ   . ARG A 1 40  ? -10.808 -15.088 -8.784  1.00 0.00 ? 40  ARG A CZ   5  
ATOM 8311  N NH1  . ARG A 1 40  ? -11.807 -15.276 -7.911  1.00 0.00 ? 40  ARG A NH1  5  
ATOM 8312  N NH2  . ARG A 1 40  ? -9.855  -16.019 -8.922  1.00 0.00 ? 40  ARG A NH2  5  
ATOM 8313  H H    . ARG A 1 40  ? -11.138 -9.278  -8.428  1.00 0.00 ? 40  ARG A H    5  
ATOM 8314  H HA   . ARG A 1 40  ? -13.282 -10.609 -9.879  1.00 0.00 ? 40  ARG A HA   5  
ATOM 8315  H HB2  . ARG A 1 40  ? -12.802 -10.798 -6.873  1.00 0.00 ? 40  ARG A HB2  5  
ATOM 8316  H HB3  . ARG A 1 40  ? -13.793 -11.850 -7.864  1.00 0.00 ? 40  ARG A HB3  5  
ATOM 8317  H HG2  . ARG A 1 40  ? -10.752 -11.604 -8.027  1.00 0.00 ? 40  ARG A HG2  5  
ATOM 8318  H HG3  . ARG A 1 40  ? -11.628 -12.929 -7.287  1.00 0.00 ? 40  ARG A HG3  5  
ATOM 8319  H HD2  . ARG A 1 40  ? -12.765 -13.289 -9.582  1.00 0.00 ? 40  ARG A HD2  5  
ATOM 8320  H HD3  . ARG A 1 40  ? -11.596 -12.162 -10.240 1.00 0.00 ? 40  ARG A HD3  5  
ATOM 8321  H HE   . ARG A 1 40  ? -10.002 -13.859 -10.160 1.00 0.00 ? 40  ARG A HE   5  
ATOM 8322  H HH11 . ARG A 1 40  ? -12.519 -14.581 -7.808  1.00 0.00 ? 40  ARG A HH11 5  
ATOM 8323  H HH12 . ARG A 1 40  ? -11.842 -16.112 -7.363  1.00 0.00 ? 40  ARG A HH12 5  
ATOM 8324  H HH21 . ARG A 1 40  ? -9.109  -15.879 -9.573  1.00 0.00 ? 40  ARG A HH21 5  
ATOM 8325  H HH22 . ARG A 1 40  ? -9.889  -16.855 -8.374  1.00 0.00 ? 40  ARG A HH22 5  
ATOM 8326  N N    . THR A 1 41  ? -15.042 -9.481  -7.973  1.00 0.00 ? 41  THR A N    5  
ATOM 8327  C CA   . THR A 1 41  ? -16.033 -8.534  -7.492  1.00 0.00 ? 41  THR A CA   5  
ATOM 8328  C C    . THR A 1 41  ? -15.559 -7.881  -6.192  1.00 0.00 ? 41  THR A C    5  
ATOM 8329  O O    . THR A 1 41  ? -15.040 -6.765  -6.207  1.00 0.00 ? 41  THR A O    5  
ATOM 8330  C CB   . THR A 1 41  ? -17.365 -9.273  -7.351  1.00 0.00 ? 41  THR A CB   5  
ATOM 8331  O OG1  . THR A 1 41  ? -16.988 -10.616 -7.060  1.00 0.00 ? 41  THR A OG1  5  
ATOM 8332  C CG2  . THR A 1 41  ? -18.121 -9.376  -8.677  1.00 0.00 ? 41  THR A CG2  5  
ATOM 8333  H H    . THR A 1 41  ? -15.306 -10.443 -7.898  1.00 0.00 ? 41  THR A H    5  
ATOM 8334  H HA   . THR A 1 41  ? -16.135 -7.738  -8.231  1.00 0.00 ? 41  THR A HA   5  
ATOM 8335  H HB   . THR A 1 41  ? -17.986 -8.811  -6.583  1.00 0.00 ? 41  THR A HB   5  
ATOM 8336  H HG1  . THR A 1 41  ? -17.788 -11.214 -7.108  1.00 0.00 ? 41  THR A HG1  5  
ATOM 8337  H HG21 . THR A 1 41  ? -17.775 -10.253 -9.225  1.00 0.00 ? 41  THR A HG21 5  
ATOM 8338  H HG22 . THR A 1 41  ? -19.189 -9.469  -8.480  1.00 0.00 ? 41  THR A HG22 5  
ATOM 8339  H HG23 . THR A 1 41  ? -17.937 -8.481  -9.271  1.00 0.00 ? 41  THR A HG23 5  
ATOM 8340  N N    . THR A 1 42  ? -15.754 -8.604  -5.099  1.00 0.00 ? 42  THR A N    5  
ATOM 8341  C CA   . THR A 1 42  ? -15.353 -8.109  -3.793  1.00 0.00 ? 42  THR A CA   5  
ATOM 8342  C C    . THR A 1 42  ? -13.908 -8.509  -3.492  1.00 0.00 ? 42  THR A C    5  
ATOM 8343  O O    . THR A 1 42  ? -13.552 -8.743  -2.338  1.00 0.00 ? 42  THR A O    5  
ATOM 8344  C CB   . THR A 1 42  ? -16.356 -8.630  -2.762  1.00 0.00 ? 42  THR A CB   5  
ATOM 8345  O OG1  . THR A 1 42  ? -16.256 -10.048 -2.866  1.00 0.00 ? 42  THR A OG1  5  
ATOM 8346  C CG2  . THR A 1 42  ? -17.805 -8.329  -3.150  1.00 0.00 ? 42  THR A CG2  5  
ATOM 8347  H H    . THR A 1 42  ? -16.177 -9.510  -5.096  1.00 0.00 ? 42  THR A H    5  
ATOM 8348  H HA   . THR A 1 42  ? -15.386 -7.019  -3.814  1.00 0.00 ? 42  THR A HA   5  
ATOM 8349  H HB   . THR A 1 42  ? -16.130 -8.242  -1.769  1.00 0.00 ? 42  THR A HB   5  
ATOM 8350  H HG1  . THR A 1 42  ? -16.542 -10.475 -2.009  1.00 0.00 ? 42  THR A HG1  5  
ATOM 8351  H HG21 . THR A 1 42  ? -18.187 -7.519  -2.528  1.00 0.00 ? 42  THR A HG21 5  
ATOM 8352  H HG22 . THR A 1 42  ? -17.847 -8.033  -4.198  1.00 0.00 ? 42  THR A HG22 5  
ATOM 8353  H HG23 . THR A 1 42  ? -18.414 -9.221  -2.999  1.00 0.00 ? 42  THR A HG23 5  
ATOM 8354  N N    . SER A 1 43  ? -13.113 -8.576  -4.550  1.00 0.00 ? 43  SER A N    5  
ATOM 8355  C CA   . SER A 1 43  ? -11.714 -8.944  -4.413  1.00 0.00 ? 43  SER A CA   5  
ATOM 8356  C C    . SER A 1 43  ? -11.005 -8.817  -5.763  1.00 0.00 ? 43  SER A C    5  
ATOM 8357  O O    . SER A 1 43  ? -11.629 -8.969  -6.812  1.00 0.00 ? 43  SER A O    5  
ATOM 8358  C CB   . SER A 1 43  ? -11.570 -10.367 -3.869  1.00 0.00 ? 43  SER A CB   5  
ATOM 8359  O OG   . SER A 1 43  ? -12.228 -11.323 -4.695  1.00 0.00 ? 43  SER A OG   5  
ATOM 8360  H H    . SER A 1 43  ? -13.410 -8.384  -5.485  1.00 0.00 ? 43  SER A H    5  
ATOM 8361  H HA   . SER A 1 43  ? -11.299 -8.237  -3.695  1.00 0.00 ? 43  SER A HA   5  
ATOM 8362  H HB2  . SER A 1 43  ? -10.512 -10.620 -3.793  1.00 0.00 ? 43  SER A HB2  5  
ATOM 8363  H HB3  . SER A 1 43  ? -11.982 -10.413 -2.861  1.00 0.00 ? 43  SER A HB3  5  
ATOM 8364  H HG   . SER A 1 43  ? -13.136 -11.525 -4.329  1.00 0.00 ? 43  SER A HG   5  
ATOM 8365  N N    . VAL A 1 44  ? -9.712  -8.540  -5.692  1.00 0.00 ? 44  VAL A N    5  
ATOM 8366  C CA   . VAL A 1 44  ? -8.911  -8.391  -6.895  1.00 0.00 ? 44  VAL A CA   5  
ATOM 8367  C C    . VAL A 1 44  ? -7.453  -8.729  -6.578  1.00 0.00 ? 44  VAL A C    5  
ATOM 8368  O O    . VAL A 1 44  ? -7.117  -9.032  -5.434  1.00 0.00 ? 44  VAL A O    5  
ATOM 8369  C CB   . VAL A 1 44  ? -9.087  -6.984  -7.470  1.00 0.00 ? 44  VAL A CB   5  
ATOM 8370  C CG1  . VAL A 1 44  ? -10.569 -6.617  -7.579  1.00 0.00 ? 44  VAL A CG1  5  
ATOM 8371  C CG2  . VAL A 1 44  ? -8.327  -5.951  -6.635  1.00 0.00 ? 44  VAL A CG2  5  
ATOM 8372  H H    . VAL A 1 44  ? -9.212  -8.418  -4.834  1.00 0.00 ? 44  VAL A H    5  
ATOM 8373  H HA   . VAL A 1 44  ? -9.285  -9.104  -7.630  1.00 0.00 ? 44  VAL A HA   5  
ATOM 8374  H HB   . VAL A 1 44  ? -8.666  -6.977  -8.475  1.00 0.00 ? 44  VAL A HB   5  
ATOM 8375  H HG11 . VAL A 1 44  ? -10.667 -5.637  -8.045  1.00 0.00 ? 44  VAL A HG11 5  
ATOM 8376  H HG12 . VAL A 1 44  ? -11.083 -7.362  -8.187  1.00 0.00 ? 44  VAL A HG12 5  
ATOM 8377  H HG13 . VAL A 1 44  ? -11.011 -6.592  -6.583  1.00 0.00 ? 44  VAL A HG13 5  
ATOM 8378  H HG21 . VAL A 1 44  ? -7.674  -5.369  -7.284  1.00 0.00 ? 44  VAL A HG21 5  
ATOM 8379  H HG22 . VAL A 1 44  ? -9.038  -5.286  -6.144  1.00 0.00 ? 44  VAL A HG22 5  
ATOM 8380  H HG23 . VAL A 1 44  ? -7.729  -6.463  -5.881  1.00 0.00 ? 44  VAL A HG23 5  
ATOM 8381  N N    . ARG A 1 45  ? -6.626  -8.665  -7.611  1.00 0.00 ? 45  ARG A N    5  
ATOM 8382  C CA   . ARG A 1 45  ? -5.212  -8.961  -7.457  1.00 0.00 ? 45  ARG A CA   5  
ATOM 8383  C C    . ARG A 1 45  ? -4.413  -8.349  -8.610  1.00 0.00 ? 45  ARG A C    5  
ATOM 8384  O O    . ARG A 1 45  ? -4.425  -8.871  -9.723  1.00 0.00 ? 45  ARG A O    5  
ATOM 8385  C CB   . ARG A 1 45  ? -4.966  -10.470 -7.420  1.00 0.00 ? 45  ARG A CB   5  
ATOM 8386  C CG   . ARG A 1 45  ? -3.483  -10.779 -7.201  1.00 0.00 ? 45  ARG A CG   5  
ATOM 8387  C CD   . ARG A 1 45  ? -3.097  -12.106 -7.856  1.00 0.00 ? 45  ARG A CD   5  
ATOM 8388  N NE   . ARG A 1 45  ? -3.194  -13.205 -6.869  1.00 0.00 ? 45  ARG A NE   5  
ATOM 8389  C CZ   . ARG A 1 45  ? -2.270  -13.457 -5.932  1.00 0.00 ? 45  ARG A CZ   5  
ATOM 8390  N NH1  . ARG A 1 45  ? -1.174  -12.690 -5.848  1.00 0.00 ? 45  ARG A NH1  5  
ATOM 8391  N NH2  . ARG A 1 45  ? -2.441  -14.475 -5.078  1.00 0.00 ? 45  ARG A NH2  5  
ATOM 8392  H H    . ARG A 1 45  ? -6.907  -8.418  -8.538  1.00 0.00 ? 45  ARG A H    5  
ATOM 8393  H HA   . ARG A 1 45  ? -4.935  -8.509  -6.505  1.00 0.00 ? 45  ARG A HA   5  
ATOM 8394  H HB2  . ARG A 1 45  ? -5.556  -10.919 -6.621  1.00 0.00 ? 45  ARG A HB2  5  
ATOM 8395  H HB3  . ARG A 1 45  ? -5.300  -10.920 -8.354  1.00 0.00 ? 45  ARG A HB3  5  
ATOM 8396  H HG2  . ARG A 1 45  ? -2.876  -9.974  -7.615  1.00 0.00 ? 45  ARG A HG2  5  
ATOM 8397  H HG3  . ARG A 1 45  ? -3.271  -10.821 -6.132  1.00 0.00 ? 45  ARG A HG3  5  
ATOM 8398  H HD2  . ARG A 1 45  ? -3.753  -12.308 -8.703  1.00 0.00 ? 45  ARG A HD2  5  
ATOM 8399  H HD3  . ARG A 1 45  ? -2.081  -12.046 -8.247  1.00 0.00 ? 45  ARG A HD3  5  
ATOM 8400  H HE   . ARG A 1 45  ? -3.999  -13.796 -6.904  1.00 0.00 ? 45  ARG A HE   5  
ATOM 8401  H HH11 . ARG A 1 45  ? -1.046  -11.930 -6.485  1.00 0.00 ? 45  ARG A HH11 5  
ATOM 8402  H HH12 . ARG A 1 45  ? -0.484  -12.878 -5.149  1.00 0.00 ? 45  ARG A HH12 5  
ATOM 8403  H HH21 . ARG A 1 45  ? -3.259  -15.047 -5.140  1.00 0.00 ? 45  ARG A HH21 5  
ATOM 8404  H HH22 . ARG A 1 45  ? -1.752  -14.663 -4.379  1.00 0.00 ? 45  ARG A HH22 5  
ATOM 8405  N N    . LEU A 1 46  ? -3.738  -7.251  -8.302  1.00 0.00 ? 46  LEU A N    5  
ATOM 8406  C CA   . LEU A 1 46  ? -2.935  -6.563  -9.299  1.00 0.00 ? 46  LEU A CA   5  
ATOM 8407  C C    . LEU A 1 46  ? -1.455  -6.857  -9.047  1.00 0.00 ? 46  LEU A C    5  
ATOM 8408  O O    . LEU A 1 46  ? -1.099  -7.431  -8.019  1.00 0.00 ? 46  LEU A O    5  
ATOM 8409  C CB   . LEU A 1 46  ? -3.270  -5.070  -9.319  1.00 0.00 ? 46  LEU A CB   5  
ATOM 8410  C CG   . LEU A 1 46  ? -2.380  -4.171  -8.459  1.00 0.00 ? 46  LEU A CG   5  
ATOM 8411  C CD1  . LEU A 1 46  ? -2.414  -2.726  -8.960  1.00 0.00 ? 46  LEU A CD1  5  
ATOM 8412  C CD2  . LEU A 1 46  ? -2.762  -4.274  -6.981  1.00 0.00 ? 46  LEU A CD2  5  
ATOM 8413  H H    . LEU A 1 46  ? -3.734  -6.833  -7.394  1.00 0.00 ? 46  LEU A H    5  
ATOM 8414  H HA   . LEU A 1 46  ? -3.207  -6.968  -10.274 1.00 0.00 ? 46  LEU A HA   5  
ATOM 8415  H HB2  . LEU A 1 46  ? -3.218  -4.720  -10.350 1.00 0.00 ? 46  LEU A HB2  5  
ATOM 8416  H HB3  . LEU A 1 46  ? -4.303  -4.946  -8.993  1.00 0.00 ? 46  LEU A HB3  5  
ATOM 8417  H HG   . LEU A 1 46  ? -1.352  -4.520  -8.551  1.00 0.00 ? 46  LEU A HG   5  
ATOM 8418  H HD11 . LEU A 1 46  ? -3.018  -2.669  -9.865  1.00 0.00 ? 46  LEU A HD11 5  
ATOM 8419  H HD12 . LEU A 1 46  ? -2.849  -2.085  -8.192  1.00 0.00 ? 46  LEU A HD12 5  
ATOM 8420  H HD13 . LEU A 1 46  ? -1.399  -2.393  -9.178  1.00 0.00 ? 46  LEU A HD13 5  
ATOM 8421  H HD21 . LEU A 1 46  ? -2.105  -4.989  -6.485  1.00 0.00 ? 46  LEU A HD21 5  
ATOM 8422  H HD22 . LEU A 1 46  ? -2.657  -3.297  -6.509  1.00 0.00 ? 46  LEU A HD22 5  
ATOM 8423  H HD23 . LEU A 1 46  ? -3.795  -4.611  -6.895  1.00 0.00 ? 46  LEU A HD23 5  
ATOM 8424  N N    . ILE A 1 47  ? -0.632  -6.451  -10.003 1.00 0.00 ? 47  ILE A N    5  
ATOM 8425  C CA   . ILE A 1 47  ? 0.801   -6.663  -9.897  1.00 0.00 ? 47  ILE A CA   5  
ATOM 8426  C C    . ILE A 1 47  ? 1.535   -5.404  -10.361 1.00 0.00 ? 47  ILE A C    5  
ATOM 8427  O O    . ILE A 1 47  ? 1.023   -4.651  -11.188 1.00 0.00 ? 47  ILE A O    5  
ATOM 8428  C CB   . ILE A 1 47  ? 1.212   -7.928  -10.654 1.00 0.00 ? 47  ILE A CB   5  
ATOM 8429  C CG1  . ILE A 1 47  ? 1.369   -7.645  -12.150 1.00 0.00 ? 47  ILE A CG1  5  
ATOM 8430  C CG2  . ILE A 1 47  ? 0.230   -9.071  -10.387 1.00 0.00 ? 47  ILE A CG2  5  
ATOM 8431  C CD1  . ILE A 1 47  ? 0.023   -7.288  -12.784 1.00 0.00 ? 47  ILE A CD1  5  
ATOM 8432  H H    . ILE A 1 47  ? -0.930  -5.984  -10.836 1.00 0.00 ? 47  ILE A H    5  
ATOM 8433  H HA   . ILE A 1 47  ? 1.030   -6.829  -8.845  1.00 0.00 ? 47  ILE A HA   5  
ATOM 8434  H HB   . ILE A 1 47  ? 2.186   -8.247  -10.283 1.00 0.00 ? 47  ILE A HB   5  
ATOM 8435  H HG12 . ILE A 1 47  ? 2.073   -6.826  -12.297 1.00 0.00 ? 47  ILE A HG12 5  
ATOM 8436  H HG13 . ILE A 1 47  ? 1.788   -8.520  -12.647 1.00 0.00 ? 47  ILE A HG13 5  
ATOM 8437  H HG21 . ILE A 1 47  ? 0.414   -9.880  -11.093 1.00 0.00 ? 47  ILE A HG21 5  
ATOM 8438  H HG22 . ILE A 1 47  ? 0.368   -9.438  -9.370  1.00 0.00 ? 47  ILE A HG22 5  
ATOM 8439  H HG23 . ILE A 1 47  ? -0.791  -8.708  -10.507 1.00 0.00 ? 47  ILE A HG23 5  
ATOM 8440  H HD11 . ILE A 1 47  ? -0.773  -7.436  -12.055 1.00 0.00 ? 47  ILE A HD11 5  
ATOM 8441  H HD12 . ILE A 1 47  ? 0.037   -6.245  -13.101 1.00 0.00 ? 47  ILE A HD12 5  
ATOM 8442  H HD13 . ILE A 1 47  ? -0.152  -7.927  -13.649 1.00 0.00 ? 47  ILE A HD13 5  
ATOM 8443  N N    . TRP A 1 48  ? 2.723   -5.212  -9.807  1.00 0.00 ? 48  TRP A N    5  
ATOM 8444  C CA   . TRP A 1 48  ? 3.533   -4.056  -10.153 1.00 0.00 ? 48  TRP A CA   5  
ATOM 8445  C C    . TRP A 1 48  ? 4.999   -4.492  -10.166 1.00 0.00 ? 48  TRP A C    5  
ATOM 8446  O O    . TRP A 1 48  ? 5.300   -5.675  -10.009 1.00 0.00 ? 48  TRP A O    5  
ATOM 8447  C CB   . TRP A 1 48  ? 3.264   -2.892  -9.197  1.00 0.00 ? 48  TRP A CB   5  
ATOM 8448  C CG   . TRP A 1 48  ? 3.771   -3.127  -7.773  1.00 0.00 ? 48  TRP A CG   5  
ATOM 8449  C CD1  . TRP A 1 48  ? 4.904   -2.677  -7.216  1.00 0.00 ? 48  TRP A CD1  5  
ATOM 8450  C CD2  . TRP A 1 48  ? 3.113   -3.890  -6.740  1.00 0.00 ? 48  TRP A CD2  5  
ATOM 8451  N NE1  . TRP A 1 48  ? 5.025   -3.093  -5.906  1.00 0.00 ? 48  TRP A NE1  5  
ATOM 8452  C CE2  . TRP A 1 48  ? 3.901   -3.855  -5.607  1.00 0.00 ? 48  TRP A CE2  5  
ATOM 8453  C CE3  . TRP A 1 48  ? 1.893   -4.589  -6.762  1.00 0.00 ? 48  TRP A CE3  5  
ATOM 8454  C CZ2  . TRP A 1 48  ? 3.555   -4.498  -4.413  1.00 0.00 ? 48  TRP A CZ2  5  
ATOM 8455  C CZ3  . TRP A 1 48  ? 1.562   -5.226  -5.561  1.00 0.00 ? 48  TRP A CZ3  5  
ATOM 8456  C CH2  . TRP A 1 48  ? 2.344   -5.200  -4.412  1.00 0.00 ? 48  TRP A CH2  5  
ATOM 8457  H H    . TRP A 1 48  ? 3.133   -5.829  -9.134  1.00 0.00 ? 48  TRP A H    5  
ATOM 8458  H HA   . TRP A 1 48  ? 3.233   -3.726  -11.147 1.00 0.00 ? 48  TRP A HA   5  
ATOM 8459  H HB2  . TRP A 1 48  ? 3.732   -1.992  -9.595  1.00 0.00 ? 48  TRP A HB2  5  
ATOM 8460  H HB3  . TRP A 1 48  ? 2.191   -2.704  -9.163  1.00 0.00 ? 48  TRP A HB3  5  
ATOM 8461  H HD1  . TRP A 1 48  ? 5.639   -2.060  -7.734  1.00 0.00 ? 48  TRP A HD1  5  
ATOM 8462  H HE1  . TRP A 1 48  ? 5.849   -2.867  -5.230  1.00 0.00 ? 48  TRP A HE1  5  
ATOM 8463  H HE3  . TRP A 1 48  ? 1.254   -4.632  -7.644  1.00 0.00 ? 48  TRP A HE3  5  
ATOM 8464  H HZ2  . TRP A 1 48  ? 4.194   -4.455  -3.531  1.00 0.00 ? 48  TRP A HZ2  5  
ATOM 8465  H HZ3  . TRP A 1 48  ? 0.625   -5.782  -5.524  1.00 0.00 ? 48  TRP A HZ3  5  
ATOM 8466  H HH2  . TRP A 1 48  ? 2.015   -5.723  -3.514  1.00 0.00 ? 48  TRP A HH2  5  
ATOM 8467  N N    . GLN A 1 49  ? 5.873   -3.514  -10.353 1.00 0.00 ? 49  GLN A N    5  
ATOM 8468  C CA   . GLN A 1 49  ? 7.300   -3.783  -10.389 1.00 0.00 ? 49  GLN A CA   5  
ATOM 8469  C C    . GLN A 1 49  ? 8.067   -2.671  -9.669  1.00 0.00 ? 49  GLN A C    5  
ATOM 8470  O O    . GLN A 1 49  ? 7.538   -1.580  -9.463  1.00 0.00 ? 49  GLN A O    5  
ATOM 8471  C CB   . GLN A 1 49  ? 7.792   -3.945  -11.828 1.00 0.00 ? 49  GLN A CB   5  
ATOM 8472  C CG   . GLN A 1 49  ? 7.551   -5.369  -12.333 1.00 0.00 ? 49  GLN A CG   5  
ATOM 8473  C CD   . GLN A 1 49  ? 8.267   -5.608  -13.663 1.00 0.00 ? 49  GLN A CD   5  
ATOM 8474  O OE1  . GLN A 1 49  ? 9.478   -5.738  -13.731 1.00 0.00 ? 49  GLN A OE1  5  
ATOM 8475  N NE2  . GLN A 1 49  ? 7.454   -5.659  -14.715 1.00 0.00 ? 49  GLN A NE2  5  
ATOM 8476  H H    . GLN A 1 49  ? 5.620   -2.555  -10.480 1.00 0.00 ? 49  GLN A H    5  
ATOM 8477  H HA   . GLN A 1 49  ? 7.431   -4.726  -9.858  1.00 0.00 ? 49  GLN A HA   5  
ATOM 8478  H HB2  . GLN A 1 49  ? 7.278   -3.234  -12.475 1.00 0.00 ? 49  GLN A HB2  5  
ATOM 8479  H HB3  . GLN A 1 49  ? 8.856   -3.712  -11.881 1.00 0.00 ? 49  GLN A HB3  5  
ATOM 8480  H HG2  . GLN A 1 49  ? 7.903   -6.086  -11.592 1.00 0.00 ? 49  GLN A HG2  5  
ATOM 8481  H HG3  . GLN A 1 49  ? 6.481   -5.538  -12.456 1.00 0.00 ? 49  GLN A HG3  5  
ATOM 8482  H HE21 . GLN A 1 49  ? 6.468   -5.544  -14.590 1.00 0.00 ? 49  GLN A HE21 5  
ATOM 8483  H HE22 . GLN A 1 49  ? 7.828   -5.811  -15.629 1.00 0.00 ? 49  GLN A HE22 5  
ATOM 8484  N N    . PRO A 1 50  ? 9.335   -2.995  -9.297  1.00 0.00 ? 50  PRO A N    5  
ATOM 8485  C CA   . PRO A 1 50  ? 10.180  -2.037  -8.606  1.00 0.00 ? 50  PRO A CA   5  
ATOM 8486  C C    . PRO A 1 50  ? 10.699  -0.967  -9.569  1.00 0.00 ? 50  PRO A C    5  
ATOM 8487  O O    . PRO A 1 50  ? 10.871  -1.229  -10.758 1.00 0.00 ? 50  PRO A O    5  
ATOM 8488  C CB   . PRO A 1 50  ? 11.291  -2.868  -7.986  1.00 0.00 ? 50  PRO A CB   5  
ATOM 8489  C CG   . PRO A 1 50  ? 11.290  -4.190  -8.735  1.00 0.00 ? 50  PRO A CG   5  
ATOM 8490  C CD   . PRO A 1 50  ? 9.994   -4.277  -9.525  1.00 0.00 ? 50  PRO A CD   5  
ATOM 8491  H HA   . PRO A 1 50  ? 9.652   -1.547  -7.912  1.00 0.00 ? 50  PRO A HA   5  
ATOM 8492  H HB2  . PRO A 1 50  ? 12.254  -2.366  -8.082  1.00 0.00 ? 50  PRO A HB2  5  
ATOM 8493  H HB3  . PRO A 1 50  ? 11.117  -3.022  -6.921  1.00 0.00 ? 50  PRO A HB3  5  
ATOM 8494  H HG2  . PRO A 1 50  ? 12.149  -4.251  -9.403  1.00 0.00 ? 50  PRO A HG2  5  
ATOM 8495  H HG3  . PRO A 1 50  ? 11.369  -5.024  -8.038  1.00 0.00 ? 50  PRO A HG3  5  
ATOM 8496  H HD2  . PRO A 1 50  ? 10.187  -4.441  -10.585 1.00 0.00 ? 50  PRO A HD2  5  
ATOM 8497  H HD3  . PRO A 1 50  ? 9.377   -5.107  -9.182  1.00 0.00 ? 50  PRO A HD3  5  
ATOM 8498  N N    . PRO A 1 51  ? 10.939  0.247   -9.005  1.00 0.00 ? 51  PRO A N    5  
ATOM 8499  C CA   . PRO A 1 51  ? 11.435  1.357   -9.801  1.00 0.00 ? 51  PRO A CA   5  
ATOM 8500  C C    . PRO A 1 51  ? 12.918  1.177   -10.129 1.00 0.00 ? 51  PRO A C    5  
ATOM 8501  O O    . PRO A 1 51  ? 13.753  1.104   -9.228  1.00 0.00 ? 51  PRO A O    5  
ATOM 8502  C CB   . PRO A 1 51  ? 11.158  2.595   -8.964  1.00 0.00 ? 51  PRO A CB   5  
ATOM 8503  C CG   . PRO A 1 51  ? 10.945  2.099   -7.543  1.00 0.00 ? 51  PRO A CG   5  
ATOM 8504  C CD   . PRO A 1 51  ? 10.746  0.593   -7.600  1.00 0.00 ? 51  PRO A CD   5  
ATOM 8505  H HA   . PRO A 1 51  ? 10.962  1.391   -10.681 1.00 0.00 ? 51  PRO A HA   5  
ATOM 8506  H HB2  . PRO A 1 51  ? 11.992  3.294   -9.013  1.00 0.00 ? 51  PRO A HB2  5  
ATOM 8507  H HB3  . PRO A 1 51  ? 10.277  3.124   -9.329  1.00 0.00 ? 51  PRO A HB3  5  
ATOM 8508  H HG2  . PRO A 1 51  ? 11.803  2.348   -6.919  1.00 0.00 ? 51  PRO A HG2  5  
ATOM 8509  H HG3  . PRO A 1 51  ? 10.075  2.582   -7.096  1.00 0.00 ? 51  PRO A HG3  5  
ATOM 8510  H HD2  . PRO A 1 51  ? 11.463  0.075   -6.962  1.00 0.00 ? 51  PRO A HD2  5  
ATOM 8511  H HD3  . PRO A 1 51  ? 9.751   0.311   -7.255  1.00 0.00 ? 51  PRO A HD3  5  
ATOM 8512  N N    . ALA A 1 52  ? 13.202  1.109   -11.421 1.00 0.00 ? 52  ALA A N    5  
ATOM 8513  C CA   . ALA A 1 52  ? 14.570  0.939   -11.880 1.00 0.00 ? 52  ALA A CA   5  
ATOM 8514  C C    . ALA A 1 52  ? 15.493  1.847   -11.064 1.00 0.00 ? 52  ALA A C    5  
ATOM 8515  O O    . ALA A 1 52  ? 16.667  1.534   -10.873 1.00 0.00 ? 52  ALA A O    5  
ATOM 8516  C CB   . ALA A 1 52  ? 14.646  1.228   -13.380 1.00 0.00 ? 52  ALA A CB   5  
ATOM 8517  H H    . ALA A 1 52  ? 12.517  1.169   -12.148 1.00 0.00 ? 52  ALA A H    5  
ATOM 8518  H HA   . ALA A 1 52  ? 14.851  -0.100  -11.707 1.00 0.00 ? 52  ALA A HA   5  
ATOM 8519  H HB1  . ALA A 1 52  ? 15.280  2.097   -13.552 1.00 0.00 ? 52  ALA A HB1  5  
ATOM 8520  H HB2  . ALA A 1 52  ? 15.066  0.364   -13.895 1.00 0.00 ? 52  ALA A HB2  5  
ATOM 8521  H HB3  . ALA A 1 52  ? 13.644  1.426   -13.763 1.00 0.00 ? 52  ALA A HB3  5  
ATOM 8522  N N    . ALA A 1 53  ? 14.927  2.954   -10.605 1.00 0.00 ? 53  ALA A N    5  
ATOM 8523  C CA   . ALA A 1 53  ? 15.685  3.909   -9.815  1.00 0.00 ? 53  ALA A CA   5  
ATOM 8524  C C    . ALA A 1 53  ? 15.082  3.995   -8.411  1.00 0.00 ? 53  ALA A C    5  
ATOM 8525  O O    . ALA A 1 53  ? 14.249  4.859   -8.141  1.00 0.00 ? 53  ALA A O    5  
ATOM 8526  C CB   . ALA A 1 53  ? 15.700  5.263   -10.527 1.00 0.00 ? 53  ALA A CB   5  
ATOM 8527  H H    . ALA A 1 53  ? 13.971  3.201   -10.765 1.00 0.00 ? 53  ALA A H    5  
ATOM 8528  H HA   . ALA A 1 53  ? 16.708  3.540   -9.740  1.00 0.00 ? 53  ALA A HA   5  
ATOM 8529  H HB1  . ALA A 1 53  ? 14.828  5.843   -10.223 1.00 0.00 ? 53  ALA A HB1  5  
ATOM 8530  H HB2  . ALA A 1 53  ? 16.607  5.804   -10.259 1.00 0.00 ? 53  ALA A HB2  5  
ATOM 8531  H HB3  . ALA A 1 53  ? 15.674  5.107   -11.605 1.00 0.00 ? 53  ALA A HB3  5  
ATOM 8532  N N    . PRO A 1 54  ? 15.537  3.063   -7.532  1.00 0.00 ? 54  PRO A N    5  
ATOM 8533  C CA   . PRO A 1 54  ? 15.052  3.025   -6.163  1.00 0.00 ? 54  PRO A CA   5  
ATOM 8534  C C    . PRO A 1 54  ? 15.662  4.156   -5.333  1.00 0.00 ? 54  PRO A C    5  
ATOM 8535  O O    . PRO A 1 54  ? 14.998  4.725   -4.468  1.00 0.00 ? 54  PRO A O    5  
ATOM 8536  C CB   . PRO A 1 54  ? 15.426  1.644   -5.651  1.00 0.00 ? 54  PRO A CB   5  
ATOM 8537  C CG   . PRO A 1 54  ? 16.509  1.132   -6.586  1.00 0.00 ? 54  PRO A CG   5  
ATOM 8538  C CD   . PRO A 1 54  ? 16.522  2.024   -7.816  1.00 0.00 ? 54  PRO A CD   5  
ATOM 8539  H HA   . PRO A 1 54  ? 14.063  3.173   -6.141  1.00 0.00 ? 54  PRO A HA   5  
ATOM 8540  H HB2  . PRO A 1 54  ? 15.787  1.693   -4.623  1.00 0.00 ? 54  PRO A HB2  5  
ATOM 8541  H HB3  . PRO A 1 54  ? 14.562  0.979   -5.653  1.00 0.00 ? 54  PRO A HB3  5  
ATOM 8542  H HG2  . PRO A 1 54  ? 17.480  1.150   -6.091  1.00 0.00 ? 54  PRO A HG2  5  
ATOM 8543  H HG3  . PRO A 1 54  ? 16.314  0.097   -6.866  1.00 0.00 ? 54  PRO A HG3  5  
ATOM 8544  H HD2  . PRO A 1 54  ? 17.511  2.451   -7.986  1.00 0.00 ? 54  PRO A HD2  5  
ATOM 8545  H HD3  . PRO A 1 54  ? 16.259  1.464   -8.714  1.00 0.00 ? 54  PRO A HD3  5  
ATOM 8546  N N    . ASN A 1 55  ? 16.921  4.449   -5.626  1.00 0.00 ? 55  ASN A N    5  
ATOM 8547  C CA   . ASN A 1 55  ? 17.629  5.502   -4.918  1.00 0.00 ? 55  ASN A CA   5  
ATOM 8548  C C    . ASN A 1 55  ? 17.377  5.359   -3.416  1.00 0.00 ? 55  ASN A C    5  
ATOM 8549  O O    . ASN A 1 55  ? 17.118  6.346   -2.730  1.00 0.00 ? 55  ASN A O    5  
ATOM 8550  C CB   . ASN A 1 55  ? 17.136  6.884   -5.351  1.00 0.00 ? 55  ASN A CB   5  
ATOM 8551  C CG   . ASN A 1 55  ? 16.780  6.898   -6.839  1.00 0.00 ? 55  ASN A CG   5  
ATOM 8552  O OD1  . ASN A 1 55  ? 17.633  6.829   -7.708  1.00 0.00 ? 55  ASN A OD1  5  
ATOM 8553  N ND2  . ASN A 1 55  ? 15.476  6.993   -7.082  1.00 0.00 ? 55  ASN A ND2  5  
ATOM 8554  H H    . ASN A 1 55  ? 17.454  3.982   -6.332  1.00 0.00 ? 55  ASN A H    5  
ATOM 8555  H HA   . ASN A 1 55  ? 18.678  5.367   -5.180  1.00 0.00 ? 55  ASN A HA   5  
ATOM 8556  H HB2  . ASN A 1 55  ? 16.263  7.164   -4.762  1.00 0.00 ? 55  ASN A HB2  5  
ATOM 8557  H HB3  . ASN A 1 55  ? 17.907  7.628   -5.151  1.00 0.00 ? 55  ASN A HB3  5  
ATOM 8558  H HD21 . ASN A 1 55  ? 14.828  7.046   -6.322  1.00 0.00 ? 55  ASN A HD21 5  
ATOM 8559  H HD22 . ASN A 1 55  ? 15.143  7.009   -8.025  1.00 0.00 ? 55  ASN A HD22 5  
ATOM 8560  N N    . GLY A 1 56  ? 17.461  4.122   -2.949  1.00 0.00 ? 56  GLY A N    5  
ATOM 8561  C CA   . GLY A 1 56  ? 17.246  3.837   -1.541  1.00 0.00 ? 56  GLY A CA   5  
ATOM 8562  C C    . GLY A 1 56  ? 16.770  2.397   -1.339  1.00 0.00 ? 56  GLY A C    5  
ATOM 8563  O O    . GLY A 1 56  ? 15.808  1.963   -1.972  1.00 0.00 ? 56  GLY A O    5  
ATOM 8564  H H    . GLY A 1 56  ? 17.672  3.324   -3.514  1.00 0.00 ? 56  GLY A H    5  
ATOM 8565  H HA2  . GLY A 1 56  ? 18.171  3.999   -0.988  1.00 0.00 ? 56  GLY A HA2  5  
ATOM 8566  H HA3  . GLY A 1 56  ? 16.506  4.528   -1.135  1.00 0.00 ? 56  GLY A HA3  5  
ATOM 8567  N N    . ILE A 1 57  ? 17.466  1.696   -0.456  1.00 0.00 ? 57  ILE A N    5  
ATOM 8568  C CA   . ILE A 1 57  ? 17.126  0.314   -0.164  1.00 0.00 ? 57  ILE A CA   5  
ATOM 8569  C C    . ILE A 1 57  ? 15.663  0.234   0.275   1.00 0.00 ? 57  ILE A C    5  
ATOM 8570  O O    . ILE A 1 57  ? 15.306  0.718   1.348   1.00 0.00 ? 57  ILE A O    5  
ATOM 8571  C CB   . ILE A 1 57  ? 18.106  -0.275  0.854   1.00 0.00 ? 57  ILE A CB   5  
ATOM 8572  C CG1  . ILE A 1 57  ? 19.373  -0.785  0.164   1.00 0.00 ? 57  ILE A CG1  5  
ATOM 8573  C CG2  . ILE A 1 57  ? 17.435  -1.362  1.696   1.00 0.00 ? 57  ILE A CG2  5  
ATOM 8574  C CD1  . ILE A 1 57  ? 19.813  0.169   -0.949  1.00 0.00 ? 57  ILE A CD1  5  
ATOM 8575  H H    . ILE A 1 57  ? 18.247  2.056   0.054   1.00 0.00 ? 57  ILE A H    5  
ATOM 8576  H HA   . ILE A 1 57  ? 17.242  -0.254  -1.087  1.00 0.00 ? 57  ILE A HA   5  
ATOM 8577  H HB   . ILE A 1 57  ? 18.408  0.520   1.536   1.00 0.00 ? 57  ILE A HB   5  
ATOM 8578  H HG12 . ILE A 1 57  ? 20.173  -0.889  0.896   1.00 0.00 ? 57  ILE A HG12 5  
ATOM 8579  H HG13 . ILE A 1 57  ? 19.191  -1.775  -0.253  1.00 0.00 ? 57  ILE A HG13 5  
ATOM 8580  H HG21 . ILE A 1 57  ? 16.795  -1.972  1.059   1.00 0.00 ? 57  ILE A HG21 5  
ATOM 8581  H HG22 . ILE A 1 57  ? 18.199  -1.991  2.153   1.00 0.00 ? 57  ILE A HG22 5  
ATOM 8582  H HG23 . ILE A 1 57  ? 16.833  -0.897  2.476   1.00 0.00 ? 57  ILE A HG23 5  
ATOM 8583  H HD11 . ILE A 1 57  ? 19.085  0.142   -1.759  1.00 0.00 ? 57  ILE A HD11 5  
ATOM 8584  H HD12 . ILE A 1 57  ? 19.879  1.183   -0.553  1.00 0.00 ? 57  ILE A HD12 5  
ATOM 8585  H HD13 . ILE A 1 57  ? 20.788  -0.138  -1.326  1.00 0.00 ? 57  ILE A HD13 5  
ATOM 8586  N N    . ILE A 1 58  ? 14.855  -0.380  -0.577  1.00 0.00 ? 58  ILE A N    5  
ATOM 8587  C CA   . ILE A 1 58  ? 13.438  -0.529  -0.291  1.00 0.00 ? 58  ILE A CA   5  
ATOM 8588  C C    . ILE A 1 58  ? 13.266  -1.278  1.032   1.00 0.00 ? 58  ILE A C    5  
ATOM 8589  O O    . ILE A 1 58  ? 13.944  -2.274  1.278   1.00 0.00 ? 58  ILE A O    5  
ATOM 8590  C CB   . ILE A 1 58  ? 12.720  -1.189  -1.470  1.00 0.00 ? 58  ILE A CB   5  
ATOM 8591  C CG1  . ILE A 1 58  ? 12.954  -0.405  -2.763  1.00 0.00 ? 58  ILE A CG1  5  
ATOM 8592  C CG2  . ILE A 1 58  ? 11.231  -1.371  -1.172  1.00 0.00 ? 58  ILE A CG2  5  
ATOM 8593  C CD1  . ILE A 1 58  ? 12.384  1.011   -2.657  1.00 0.00 ? 58  ILE A CD1  5  
ATOM 8594  H H    . ILE A 1 58  ? 15.154  -0.770  -1.448  1.00 0.00 ? 58  ILE A H    5  
ATOM 8595  H HA   . ILE A 1 58  ? 13.021  0.472   -0.179  1.00 0.00 ? 58  ILE A HA   5  
ATOM 8596  H HB   . ILE A 1 58  ? 13.144  -2.183  -1.615  1.00 0.00 ? 58  ILE A HB   5  
ATOM 8597  H HG12 . ILE A 1 58  ? 14.022  -0.356  -2.975  1.00 0.00 ? 58  ILE A HG12 5  
ATOM 8598  H HG13 . ILE A 1 58  ? 12.487  -0.927  -3.598  1.00 0.00 ? 58  ILE A HG13 5  
ATOM 8599  H HG21 . ILE A 1 58  ? 11.008  -0.980  -0.179  1.00 0.00 ? 58  ILE A HG21 5  
ATOM 8600  H HG22 . ILE A 1 58  ? 10.643  -0.833  -1.915  1.00 0.00 ? 58  ILE A HG22 5  
ATOM 8601  H HG23 . ILE A 1 58  ? 10.980  -2.431  -1.209  1.00 0.00 ? 58  ILE A HG23 5  
ATOM 8602  H HD11 . ILE A 1 58  ? 11.903  1.280   -3.597  1.00 0.00 ? 58  ILE A HD11 5  
ATOM 8603  H HD12 . ILE A 1 58  ? 11.653  1.049   -1.850  1.00 0.00 ? 58  ILE A HD12 5  
ATOM 8604  H HD13 . ILE A 1 58  ? 13.192  1.713   -2.448  1.00 0.00 ? 58  ILE A HD13 5  
ATOM 8605  N N    . LEU A 1 59  ? 12.354  -0.770  1.848   1.00 0.00 ? 59  LEU A N    5  
ATOM 8606  C CA   . LEU A 1 59  ? 12.084  -1.379  3.139   1.00 0.00 ? 59  LEU A CA   5  
ATOM 8607  C C    . LEU A 1 59  ? 10.710  -2.051  3.104   1.00 0.00 ? 59  LEU A C    5  
ATOM 8608  O O    . LEU A 1 59  ? 10.449  -2.980  3.867   1.00 0.00 ? 59  LEU A O    5  
ATOM 8609  C CB   . LEU A 1 59  ? 12.235  -0.348  4.260   1.00 0.00 ? 59  LEU A CB   5  
ATOM 8610  C CG   . LEU A 1 59  ? 13.505  0.505   4.219   1.00 0.00 ? 59  LEU A CG   5  
ATOM 8611  C CD1  . LEU A 1 59  ? 13.498  1.551   5.336   1.00 0.00 ? 59  LEU A CD1  5  
ATOM 8612  C CD2  . LEU A 1 59  ? 14.757  -0.373  4.263   1.00 0.00 ? 59  LEU A CD2  5  
ATOM 8613  H H    . LEU A 1 59  ? 11.806  0.040   1.640   1.00 0.00 ? 59  LEU A H    5  
ATOM 8614  H HA   . LEU A 1 59  ? 12.840  -2.146  3.303   1.00 0.00 ? 59  LEU A HA   5  
ATOM 8615  H HB2  . LEU A 1 59  ? 11.373  0.318   4.233   1.00 0.00 ? 59  LEU A HB2  5  
ATOM 8616  H HB3  . LEU A 1 59  ? 12.203  -0.872  5.215   1.00 0.00 ? 59  LEU A HB3  5  
ATOM 8617  H HG   . LEU A 1 59  ? 13.523  1.045   3.273   1.00 0.00 ? 59  LEU A HG   5  
ATOM 8618  H HD11 . LEU A 1 59  ? 14.250  2.312   5.126   1.00 0.00 ? 59  LEU A HD11 5  
ATOM 8619  H HD12 . LEU A 1 59  ? 12.515  2.017   5.392   1.00 0.00 ? 59  LEU A HD12 5  
ATOM 8620  H HD13 . LEU A 1 59  ? 13.727  1.068   6.287   1.00 0.00 ? 59  LEU A HD13 5  
ATOM 8621  H HD21 . LEU A 1 59  ? 14.597  -1.200  4.955   1.00 0.00 ? 59  LEU A HD21 5  
ATOM 8622  H HD22 . LEU A 1 59  ? 14.960  -0.767  3.267   1.00 0.00 ? 59  LEU A HD22 5  
ATOM 8623  H HD23 . LEU A 1 59  ? 15.606  0.222   4.599   1.00 0.00 ? 59  LEU A HD23 5  
ATOM 8624  N N    . ALA A 1 60  ? 9.867   -1.556  2.210   1.00 0.00 ? 60  ALA A N    5  
ATOM 8625  C CA   . ALA A 1 60  ? 8.526   -2.097  2.065   1.00 0.00 ? 60  ALA A CA   5  
ATOM 8626  C C    . ALA A 1 60  ? 7.765   -1.287  1.014   1.00 0.00 ? 60  ALA A C    5  
ATOM 8627  O O    . ALA A 1 60  ? 8.366   -0.531  0.252   1.00 0.00 ? 60  ALA A O    5  
ATOM 8628  C CB   . ALA A 1 60  ? 7.824   -2.094  3.424   1.00 0.00 ? 60  ALA A CB   5  
ATOM 8629  H H    . ALA A 1 60  ? 10.087  -0.800  1.593   1.00 0.00 ? 60  ALA A H    5  
ATOM 8630  H HA   . ALA A 1 60  ? 8.620   -3.127  1.720   1.00 0.00 ? 60  ALA A HA   5  
ATOM 8631  H HB1  . ALA A 1 60  ? 8.446   -1.573  4.153   1.00 0.00 ? 60  ALA A HB1  5  
ATOM 8632  H HB2  . ALA A 1 60  ? 6.864   -1.586  3.336   1.00 0.00 ? 60  ALA A HB2  5  
ATOM 8633  H HB3  . ALA A 1 60  ? 7.663   -3.121  3.752   1.00 0.00 ? 60  ALA A HB3  5  
ATOM 8634  N N    . TYR A 1 61  ? 6.453   -1.472  1.006   1.00 0.00 ? 61  TYR A N    5  
ATOM 8635  C CA   . TYR A 1 61  ? 5.603   -0.768  0.061   1.00 0.00 ? 61  TYR A CA   5  
ATOM 8636  C C    . TYR A 1 61  ? 4.228   -0.483  0.667   1.00 0.00 ? 61  TYR A C    5  
ATOM 8637  O O    . TYR A 1 61  ? 3.928   -0.931  1.773   1.00 0.00 ? 61  TYR A O    5  
ATOM 8638  C CB   . TYR A 1 61  ? 5.435   -1.707  -1.136  1.00 0.00 ? 61  TYR A CB   5  
ATOM 8639  C CG   . TYR A 1 61  ? 6.536   -1.573  -2.191  1.00 0.00 ? 61  TYR A CG   5  
ATOM 8640  C CD1  . TYR A 1 61  ? 7.770   -2.150  -1.977  1.00 0.00 ? 61  TYR A CD1  5  
ATOM 8641  C CD2  . TYR A 1 61  ? 6.293   -0.874  -3.356  1.00 0.00 ? 61  TYR A CD2  5  
ATOM 8642  C CE1  . TYR A 1 61  ? 8.806   -2.025  -2.969  1.00 0.00 ? 61  TYR A CE1  5  
ATOM 8643  C CE2  . TYR A 1 61  ? 7.328   -0.749  -4.349  1.00 0.00 ? 61  TYR A CE2  5  
ATOM 8644  C CZ   . TYR A 1 61  ? 8.534   -1.330  -4.106  1.00 0.00 ? 61  TYR A CZ   5  
ATOM 8645  O OH   . TYR A 1 61  ? 9.512   -1.211  -5.044  1.00 0.00 ? 61  TYR A OH   5  
ATOM 8646  H H    . TYR A 1 61  ? 5.972   -2.089  1.629   1.00 0.00 ? 61  TYR A H    5  
ATOM 8647  H HA   . TYR A 1 61  ? 6.086   0.177   -0.186  1.00 0.00 ? 61  TYR A HA   5  
ATOM 8648  H HB2  . TYR A 1 61  ? 5.413   -2.736  -0.777  1.00 0.00 ? 61  TYR A HB2  5  
ATOM 8649  H HB3  . TYR A 1 61  ? 4.471   -1.512  -1.605  1.00 0.00 ? 61  TYR A HB3  5  
ATOM 8650  H HD1  . TYR A 1 61  ? 7.962   -2.702  -1.056  1.00 0.00 ? 61  TYR A HD1  5  
ATOM 8651  H HD2  . TYR A 1 61  ? 5.317   -0.418  -3.525  1.00 0.00 ? 61  TYR A HD2  5  
ATOM 8652  H HE1  . TYR A 1 61  ? 9.786   -2.476  -2.813  1.00 0.00 ? 61  TYR A HE1  5  
ATOM 8653  H HE2  . TYR A 1 61  ? 7.150   -0.200  -5.274  1.00 0.00 ? 61  TYR A HE2  5  
ATOM 8654  H HH   . TYR A 1 61  ? 10.196  -1.929  -4.918  1.00 0.00 ? 61  TYR A HH   5  
ATOM 8655  N N    . GLN A 1 62  ? 3.428   0.260   -0.083  1.00 0.00 ? 62  GLN A N    5  
ATOM 8656  C CA   . GLN A 1 62  ? 2.091   0.610   0.366   1.00 0.00 ? 62  GLN A CA   5  
ATOM 8657  C C    . GLN A 1 62  ? 1.101   0.526   -0.797  1.00 0.00 ? 62  GLN A C    5  
ATOM 8658  O O    . GLN A 1 62  ? 1.367   1.040   -1.882  1.00 0.00 ? 62  GLN A O    5  
ATOM 8659  C CB   . GLN A 1 62  ? 2.073   2.002   1.001   1.00 0.00 ? 62  GLN A CB   5  
ATOM 8660  C CG   . GLN A 1 62  ? 0.653   2.401   1.407   1.00 0.00 ? 62  GLN A CG   5  
ATOM 8661  C CD   . GLN A 1 62  ? 0.367   3.858   1.040   1.00 0.00 ? 62  GLN A CD   5  
ATOM 8662  O OE1  . GLN A 1 62  ? 0.596   4.302   -0.073  1.00 0.00 ? 62  GLN A OE1  5  
ATOM 8663  N NE2  . GLN A 1 62  ? -0.145  4.577   2.035   1.00 0.00 ? 62  GLN A NE2  5  
ATOM 8664  H H    . GLN A 1 62  ? 3.679   0.620   -0.982  1.00 0.00 ? 62  GLN A H    5  
ATOM 8665  H HA   . GLN A 1 62  ? 1.837   -0.131  1.123   1.00 0.00 ? 62  GLN A HA   5  
ATOM 8666  H HB2  . GLN A 1 62  ? 2.723   2.014   1.877   1.00 0.00 ? 62  GLN A HB2  5  
ATOM 8667  H HB3  . GLN A 1 62  ? 2.473   2.732   0.298   1.00 0.00 ? 62  GLN A HB3  5  
ATOM 8668  H HG2  . GLN A 1 62  ? -0.067  1.749   0.913   1.00 0.00 ? 62  GLN A HG2  5  
ATOM 8669  H HG3  . GLN A 1 62  ? 0.525   2.261   2.481   1.00 0.00 ? 62  GLN A HG3  5  
ATOM 8670  H HE21 . GLN A 1 62  ? -0.309  4.152   2.926   1.00 0.00 ? 62  GLN A HE21 5  
ATOM 8671  H HE22 . GLN A 1 62  ? -0.366  5.542   1.893   1.00 0.00 ? 62  GLN A HE22 5  
ATOM 8672  N N    . ILE A 1 63  ? -0.021  -0.128  -0.531  1.00 0.00 ? 63  ILE A N    5  
ATOM 8673  C CA   . ILE A 1 63  ? -1.052  -0.286  -1.542  1.00 0.00 ? 63  ILE A CA   5  
ATOM 8674  C C    . ILE A 1 63  ? -2.381  0.239   -0.995  1.00 0.00 ? 63  ILE A C    5  
ATOM 8675  O O    . ILE A 1 63  ? -3.040  -0.434  -0.203  1.00 0.00 ? 63  ILE A O    5  
ATOM 8676  C CB   . ILE A 1 63  ? -1.115  -1.738  -2.021  1.00 0.00 ? 63  ILE A CB   5  
ATOM 8677  C CG1  . ILE A 1 63  ? -0.487  -1.885  -3.408  1.00 0.00 ? 63  ILE A CG1  5  
ATOM 8678  C CG2  . ILE A 1 63  ? -2.550  -2.267  -1.982  1.00 0.00 ? 63  ILE A CG2  5  
ATOM 8679  C CD1  . ILE A 1 63  ? 0.306   -3.189  -3.516  1.00 0.00 ? 63  ILE A CD1  5  
ATOM 8680  H H    . ILE A 1 63  ? -0.229  -0.543  0.354   1.00 0.00 ? 63  ILE A H    5  
ATOM 8681  H HA   . ILE A 1 63  ? -0.766  0.324   -2.399  1.00 0.00 ? 63  ILE A HA   5  
ATOM 8682  H HB   . ILE A 1 63  ? -0.528  -2.349  -1.335  1.00 0.00 ? 63  ILE A HB   5  
ATOM 8683  H HG12 . ILE A 1 63  ? -1.268  -1.867  -4.169  1.00 0.00 ? 63  ILE A HG12 5  
ATOM 8684  H HG13 . ILE A 1 63  ? 0.170   -1.038  -3.606  1.00 0.00 ? 63  ILE A HG13 5  
ATOM 8685  H HG21 . ILE A 1 63  ? -2.622  -3.167  -2.593  1.00 0.00 ? 63  ILE A HG21 5  
ATOM 8686  H HG22 . ILE A 1 63  ? -2.822  -2.503  -0.953  1.00 0.00 ? 63  ILE A HG22 5  
ATOM 8687  H HG23 . ILE A 1 63  ? -3.228  -1.508  -2.372  1.00 0.00 ? 63  ILE A HG23 5  
ATOM 8688  H HD11 . ILE A 1 63  ? -0.210  -3.975  -2.964  1.00 0.00 ? 63  ILE A HD11 5  
ATOM 8689  H HD12 . ILE A 1 63  ? 0.392   -3.477  -4.564  1.00 0.00 ? 63  ILE A HD12 5  
ATOM 8690  H HD13 . ILE A 1 63  ? 1.302   -3.044  -3.096  1.00 0.00 ? 63  ILE A HD13 5  
ATOM 8691  N N    . THR A 1 64  ? -2.736  1.435   -1.440  1.00 0.00 ? 64  THR A N    5  
ATOM 8692  C CA   . THR A 1 64  ? -3.975  2.058   -1.005  1.00 0.00 ? 64  THR A CA   5  
ATOM 8693  C C    . THR A 1 64  ? -5.129  1.649   -1.923  1.00 0.00 ? 64  THR A C    5  
ATOM 8694  O O    . THR A 1 64  ? -5.083  1.889   -3.128  1.00 0.00 ? 64  THR A O    5  
ATOM 8695  C CB   . THR A 1 64  ? -3.750  3.570   -0.950  1.00 0.00 ? 64  THR A CB   5  
ATOM 8696  O OG1  . THR A 1 64  ? -3.608  3.950   -2.316  1.00 0.00 ? 64  THR A OG1  5  
ATOM 8697  C CG2  . THR A 1 64  ? -2.406  3.940   -0.318  1.00 0.00 ? 64  THR A CG2  5  
ATOM 8698  H H    . THR A 1 64  ? -2.195  1.976   -2.084  1.00 0.00 ? 64  THR A H    5  
ATOM 8699  H HA   . THR A 1 64  ? -4.213  1.689   -0.008  1.00 0.00 ? 64  THR A HA   5  
ATOM 8700  H HB   . THR A 1 64  ? -4.572  4.068   -0.435  1.00 0.00 ? 64  THR A HB   5  
ATOM 8701  H HG1  . THR A 1 64  ? -4.107  4.799   -2.489  1.00 0.00 ? 64  THR A HG1  5  
ATOM 8702  H HG21 . THR A 1 64  ? -1.682  3.150   -0.517  1.00 0.00 ? 64  THR A HG21 5  
ATOM 8703  H HG22 . THR A 1 64  ? -2.049  4.876   -0.746  1.00 0.00 ? 64  THR A HG22 5  
ATOM 8704  H HG23 . THR A 1 64  ? -2.530  4.056   0.758   1.00 0.00 ? 64  THR A HG23 5  
ATOM 8705  N N    . HIS A 1 65  ? -6.136  1.036   -1.317  1.00 0.00 ? 65  HIS A N    5  
ATOM 8706  C CA   . HIS A 1 65  ? -7.299  0.591   -2.065  1.00 0.00 ? 65  HIS A CA   5  
ATOM 8707  C C    . HIS A 1 65  ? -8.526  1.398   -1.634  1.00 0.00 ? 65  HIS A C    5  
ATOM 8708  O O    . HIS A 1 65  ? -8.778  1.562   -0.441  1.00 0.00 ? 65  HIS A O    5  
ATOM 8709  C CB   . HIS A 1 65  ? -7.499  -0.918  -1.912  1.00 0.00 ? 65  HIS A CB   5  
ATOM 8710  C CG   . HIS A 1 65  ? -7.197  -1.440  -0.527  1.00 0.00 ? 65  HIS A CG   5  
ATOM 8711  N ND1  . HIS A 1 65  ? -8.186  -1.762  0.385   1.00 0.00 ? 65  HIS A ND1  5  
ATOM 8712  C CD2  . HIS A 1 65  ? -6.007  -1.693  0.090   1.00 0.00 ? 65  HIS A CD2  5  
ATOM 8713  C CE1  . HIS A 1 65  ? -7.607  -2.188  1.498   1.00 0.00 ? 65  HIS A CE1  5  
ATOM 8714  N NE2  . HIS A 1 65  ? -6.256  -2.143  1.313   1.00 0.00 ? 65  HIS A NE2  5  
ATOM 8715  H H    . HIS A 1 65  ? -6.165  0.844   -0.336  1.00 0.00 ? 65  HIS A H    5  
ATOM 8716  H HA   . HIS A 1 65  ? -7.092  0.794   -3.116  1.00 0.00 ? 65  HIS A HA   5  
ATOM 8717  H HB2  . HIS A 1 65  ? -8.530  -1.165  -2.165  1.00 0.00 ? 65  HIS A HB2  5  
ATOM 8718  H HB3  . HIS A 1 65  ? -6.861  -1.433  -2.630  1.00 0.00 ? 65  HIS A HB3  5  
ATOM 8719  H HD1  . HIS A 1 65  ? -9.171  -1.687  0.231   1.00 0.00 ? 65  HIS A HD1  5  
ATOM 8720  H HD2  . HIS A 1 65  ? -5.019  -1.549  -0.348  1.00 0.00 ? 65  HIS A HD2  5  
ATOM 8721  H HE1  . HIS A 1 65  ? -8.119  -2.516  2.402   1.00 0.00 ? 65  HIS A HE1  5  
ATOM 8722  N N    . ARG A 1 66  ? -9.256  1.881   -2.629  1.00 0.00 ? 66  ARG A N    5  
ATOM 8723  C CA   . ARG A 1 66  ? -10.450 2.667   -2.368  1.00 0.00 ? 66  ARG A CA   5  
ATOM 8724  C C    . ARG A 1 66  ? -11.332 2.722   -3.617  1.00 0.00 ? 66  ARG A C    5  
ATOM 8725  O O    . ARG A 1 66  ? -11.039 2.071   -4.618  1.00 0.00 ? 66  ARG A O    5  
ATOM 8726  C CB   . ARG A 1 66  ? -10.089 4.092   -1.943  1.00 0.00 ? 66  ARG A CB   5  
ATOM 8727  C CG   . ARG A 1 66  ? -9.697  4.942   -3.153  1.00 0.00 ? 66  ARG A CG   5  
ATOM 8728  C CD   . ARG A 1 66  ? -8.802  6.110   -2.736  1.00 0.00 ? 66  ARG A CD   5  
ATOM 8729  N NE   . ARG A 1 66  ? -9.613  7.163   -2.085  1.00 0.00 ? 66  ARG A NE   5  
ATOM 8730  C CZ   . ARG A 1 66  ? -9.107  8.295   -1.577  1.00 0.00 ? 66  ARG A CZ   5  
ATOM 8731  N NH1  . ARG A 1 66  ? -7.789  8.528   -1.642  1.00 0.00 ? 66  ARG A NH1  5  
ATOM 8732  N NH2  . ARG A 1 66  ? -9.919  9.194   -1.004  1.00 0.00 ? 66  ARG A NH2  5  
ATOM 8733  H H    . ARG A 1 66  ? -9.044  1.743   -3.596  1.00 0.00 ? 66  ARG A H    5  
ATOM 8734  H HA   . ARG A 1 66  ? -10.954 2.146   -1.554  1.00 0.00 ? 66  ARG A HA   5  
ATOM 8735  H HB2  . ARG A 1 66  ? -10.937 4.549   -1.432  1.00 0.00 ? 66  ARG A HB2  5  
ATOM 8736  H HB3  . ARG A 1 66  ? -9.264  4.065   -1.231  1.00 0.00 ? 66  ARG A HB3  5  
ATOM 8737  H HG2  . ARG A 1 66  ? -9.177  4.323   -3.884  1.00 0.00 ? 66  ARG A HG2  5  
ATOM 8738  H HG3  . ARG A 1 66  ? -10.595 5.324   -3.640  1.00 0.00 ? 66  ARG A HG3  5  
ATOM 8739  H HD2  . ARG A 1 66  ? -8.029  5.760   -2.052  1.00 0.00 ? 66  ARG A HD2  5  
ATOM 8740  H HD3  . ARG A 1 66  ? -8.293  6.520   -3.609  1.00 0.00 ? 66  ARG A HD3  5  
ATOM 8741  H HE   . ARG A 1 66  ? -10.601 7.020   -2.019  1.00 0.00 ? 66  ARG A HE   5  
ATOM 8742  H HH11 . ARG A 1 66  ? -7.183  7.858   -2.069  1.00 0.00 ? 66  ARG A HH11 5  
ATOM 8743  H HH12 . ARG A 1 66  ? -7.412  9.373   -1.263  1.00 0.00 ? 66  ARG A HH12 5  
ATOM 8744  H HH21 . ARG A 1 66  ? -10.903 9.020   -0.956  1.00 0.00 ? 66  ARG A HH21 5  
ATOM 8745  H HH22 . ARG A 1 66  ? -9.542  10.039  -0.625  1.00 0.00 ? 66  ARG A HH22 5  
ATOM 8746  N N    . LEU A 1 67  ? -12.395 3.506   -3.516  1.00 0.00 ? 67  LEU A N    5  
ATOM 8747  C CA   . LEU A 1 67  ? -13.323 3.655   -4.625  1.00 0.00 ? 67  LEU A CA   5  
ATOM 8748  C C    . LEU A 1 67  ? -13.141 5.038   -5.254  1.00 0.00 ? 67  LEU A C    5  
ATOM 8749  O O    . LEU A 1 67  ? -12.813 6.001   -4.561  1.00 0.00 ? 67  LEU A O    5  
ATOM 8750  C CB   . LEU A 1 67  ? -14.755 3.370   -4.168  1.00 0.00 ? 67  LEU A CB   5  
ATOM 8751  C CG   . LEU A 1 67  ? -15.204 1.909   -4.242  1.00 0.00 ? 67  LEU A CG   5  
ATOM 8752  C CD1  . LEU A 1 67  ? -16.707 1.784   -3.986  1.00 0.00 ? 67  LEU A CD1  5  
ATOM 8753  C CD2  . LEU A 1 67  ? -14.795 1.277   -5.574  1.00 0.00 ? 67  LEU A CD2  5  
ATOM 8754  H H    . LEU A 1 67  ? -12.627 4.033   -2.698  1.00 0.00 ? 67  LEU A H    5  
ATOM 8755  H HA   . LEU A 1 67  ? -13.066 2.901   -5.369  1.00 0.00 ? 67  LEU A HA   5  
ATOM 8756  H HB2  . LEU A 1 67  ? -14.861 3.711   -3.138  1.00 0.00 ? 67  LEU A HB2  5  
ATOM 8757  H HB3  . LEU A 1 67  ? -15.434 3.969   -4.774  1.00 0.00 ? 67  LEU A HB3  5  
ATOM 8758  H HG   . LEU A 1 67  ? -14.695 1.355   -3.453  1.00 0.00 ? 67  LEU A HG   5  
ATOM 8759  H HD11 . LEU A 1 67  ? -16.953 0.746   -3.765  1.00 0.00 ? 67  LEU A HD11 5  
ATOM 8760  H HD12 . LEU A 1 67  ? -16.984 2.411   -3.138  1.00 0.00 ? 67  LEU A HD12 5  
ATOM 8761  H HD13 . LEU A 1 67  ? -17.255 2.107   -4.871  1.00 0.00 ? 67  LEU A HD13 5  
ATOM 8762  H HD21 . LEU A 1 67  ? -15.010 1.970   -6.387  1.00 0.00 ? 67  LEU A HD21 5  
ATOM 8763  H HD22 . LEU A 1 67  ? -13.728 1.055   -5.558  1.00 0.00 ? 67  LEU A HD22 5  
ATOM 8764  H HD23 . LEU A 1 67  ? -15.356 0.354   -5.725  1.00 0.00 ? 67  LEU A HD23 5  
ATOM 8765  N N    . ASN A 1 68  ? -13.363 5.094   -6.559  1.00 0.00 ? 68  ASN A N    5  
ATOM 8766  C CA   . ASN A 1 68  ? -13.229 6.343   -7.288  1.00 0.00 ? 68  ASN A CA   5  
ATOM 8767  C C    . ASN A 1 68  ? -14.564 7.090   -7.262  1.00 0.00 ? 68  ASN A C    5  
ATOM 8768  O O    . ASN A 1 68  ? -14.835 7.915   -8.134  1.00 0.00 ? 68  ASN A O    5  
ATOM 8769  C CB   . ASN A 1 68  ? -12.857 6.090   -8.750  1.00 0.00 ? 68  ASN A CB   5  
ATOM 8770  C CG   . ASN A 1 68  ? -11.880 7.153   -9.260  1.00 0.00 ? 68  ASN A CG   5  
ATOM 8771  O OD1  . ASN A 1 68  ? -10.948 7.551   -8.582  1.00 0.00 ? 68  ASN A OD1  5  
ATOM 8772  N ND2  . ASN A 1 68  ? -12.146 7.587   -10.488 1.00 0.00 ? 68  ASN A ND2  5  
ATOM 8773  H H    . ASN A 1 68  ? -13.630 4.307   -7.115  1.00 0.00 ? 68  ASN A H    5  
ATOM 8774  H HA   . ASN A 1 68  ? -12.436 6.889   -6.777  1.00 0.00 ? 68  ASN A HA   5  
ATOM 8775  H HB2  . ASN A 1 68  ? -12.409 5.102   -8.849  1.00 0.00 ? 68  ASN A HB2  5  
ATOM 8776  H HB3  . ASN A 1 68  ? -13.757 6.095   -9.365  1.00 0.00 ? 68  ASN A HB3  5  
ATOM 8777  H HD21 . ASN A 1 68  ? -12.928 7.218   -10.991 1.00 0.00 ? 68  ASN A HD21 5  
ATOM 8778  H HD22 . ASN A 1 68  ? -11.564 8.282   -10.910 1.00 0.00 ? 68  ASN A HD22 5  
ATOM 8779  N N    . THR A 1 69  ? -15.363 6.775   -6.254  1.00 0.00 ? 69  THR A N    5  
ATOM 8780  C CA   . THR A 1 69  ? -16.663 7.406   -6.103  1.00 0.00 ? 69  THR A CA   5  
ATOM 8781  C C    . THR A 1 69  ? -17.035 7.514   -4.623  1.00 0.00 ? 69  THR A C    5  
ATOM 8782  O O    . THR A 1 69  ? -16.182 7.800   -3.784  1.00 0.00 ? 69  THR A O    5  
ATOM 8783  C CB   . THR A 1 69  ? -17.675 6.606   -6.926  1.00 0.00 ? 69  THR A CB   5  
ATOM 8784  O OG1  . THR A 1 69  ? -17.963 5.471   -6.115  1.00 0.00 ? 69  THR A OG1  5  
ATOM 8785  C CG2  . THR A 1 69  ? -17.058 6.011   -8.194  1.00 0.00 ? 69  THR A CG2  5  
ATOM 8786  H H    . THR A 1 69  ? -15.135 6.103   -5.549  1.00 0.00 ? 69  THR A H    5  
ATOM 8787  H HA   . THR A 1 69  ? -16.599 8.422   -6.492  1.00 0.00 ? 69  THR A HA   5  
ATOM 8788  H HB   . THR A 1 69  ? -18.548 7.213   -7.166  1.00 0.00 ? 69  THR A HB   5  
ATOM 8789  H HG1  . THR A 1 69  ? -18.694 4.930   -6.531  1.00 0.00 ? 69  THR A HG1  5  
ATOM 8790  H HG21 . THR A 1 69  ? -16.186 5.414   -7.928  1.00 0.00 ? 69  THR A HG21 5  
ATOM 8791  H HG22 . THR A 1 69  ? -17.793 5.380   -8.694  1.00 0.00 ? 69  THR A HG22 5  
ATOM 8792  H HG23 . THR A 1 69  ? -16.756 6.817   -8.864  1.00 0.00 ? 69  THR A HG23 5  
ATOM 8793  N N    . THR A 1 70  ? -18.309 7.280   -4.347  1.00 0.00 ? 70  THR A N    5  
ATOM 8794  C CA   . THR A 1 70  ? -18.805 7.348   -2.983  1.00 0.00 ? 70  THR A CA   5  
ATOM 8795  C C    . THR A 1 70  ? -18.337 8.640   -2.309  1.00 0.00 ? 70  THR A C    5  
ATOM 8796  O O    . THR A 1 70  ? -18.063 9.632   -2.984  1.00 0.00 ? 70  THR A O    5  
ATOM 8797  C CB   . THR A 1 70  ? -18.351 6.083   -2.251  1.00 0.00 ? 70  THR A CB   5  
ATOM 8798  O OG1  . THR A 1 70  ? -17.079 6.432   -1.712  1.00 0.00 ? 70  THR A OG1  5  
ATOM 8799  C CG2  . THR A 1 70  ? -18.046 4.930   -3.210  1.00 0.00 ? 70  THR A CG2  5  
ATOM 8800  H H    . THR A 1 70  ? -18.997 7.048   -5.035  1.00 0.00 ? 70  THR A H    5  
ATOM 8801  H HA   . THR A 1 70  ? -19.894 7.380   -3.014  1.00 0.00 ? 70  THR A HA   5  
ATOM 8802  H HB   . THR A 1 70  ? -19.083 5.783   -1.502  1.00 0.00 ? 70  THR A HB   5  
ATOM 8803  H HG1  . THR A 1 70  ? -16.415 6.552   -2.451  1.00 0.00 ? 70  THR A HG1  5  
ATOM 8804  H HG21 . THR A 1 70  ? -17.040 5.049   -3.613  1.00 0.00 ? 70  THR A HG21 5  
ATOM 8805  H HG22 . THR A 1 70  ? -18.113 3.984   -2.673  1.00 0.00 ? 70  THR A HG22 5  
ATOM 8806  H HG23 . THR A 1 70  ? -18.768 4.936   -4.027  1.00 0.00 ? 70  THR A HG23 5  
ATOM 8807  N N    . THR A 1 71  ? -18.261 8.587   -0.988  1.00 0.00 ? 71  THR A N    5  
ATOM 8808  C CA   . THR A 1 71  ? -17.832 9.740   -0.216  1.00 0.00 ? 71  THR A CA   5  
ATOM 8809  C C    . THR A 1 71  ? -16.343 9.632   0.122   1.00 0.00 ? 71  THR A C    5  
ATOM 8810  O O    . THR A 1 71  ? -15.771 8.545   0.078   1.00 0.00 ? 71  THR A O    5  
ATOM 8811  C CB   . THR A 1 71  ? -18.729 9.843   1.019   1.00 0.00 ? 71  THR A CB   5  
ATOM 8812  O OG1  . THR A 1 71  ? -19.615 10.917  0.716   1.00 0.00 ? 71  THR A OG1  5  
ATOM 8813  C CG2  . THR A 1 71  ? -17.969 10.326  2.257   1.00 0.00 ? 71  THR A CG2  5  
ATOM 8814  H H    . THR A 1 71  ? -18.486 7.776   -0.447  1.00 0.00 ? 71  THR A H    5  
ATOM 8815  H HA   . THR A 1 71  ? -17.956 10.631  -0.831  1.00 0.00 ? 71  THR A HA   5  
ATOM 8816  H HB   . THR A 1 71  ? -19.231 8.896   1.215   1.00 0.00 ? 71  THR A HB   5  
ATOM 8817  H HG1  . THR A 1 71  ? -20.194 10.673  -0.062  1.00 0.00 ? 71  THR A HG1  5  
ATOM 8818  H HG21 . THR A 1 71  ? -17.151 9.638   2.472   1.00 0.00 ? 71  THR A HG21 5  
ATOM 8819  H HG22 . THR A 1 71  ? -17.566 11.321  2.070   1.00 0.00 ? 71  THR A HG22 5  
ATOM 8820  H HG23 . THR A 1 71  ? -18.648 10.362  3.109   1.00 0.00 ? 71  THR A HG23 5  
ATOM 8821  N N    . ALA A 1 72  ? -15.760 10.775  0.451   1.00 0.00 ? 72  ALA A N    5  
ATOM 8822  C CA   . ALA A 1 72  ? -14.349 10.823  0.796   1.00 0.00 ? 72  ALA A CA   5  
ATOM 8823  C C    . ALA A 1 72  ? -14.192 10.659  2.309   1.00 0.00 ? 72  ALA A C    5  
ATOM 8824  O O    . ALA A 1 72  ? -14.979 11.204  3.081   1.00 0.00 ? 72  ALA A O    5  
ATOM 8825  C CB   . ALA A 1 72  ? -13.742 12.131  0.285   1.00 0.00 ? 72  ALA A CB   5  
ATOM 8826  H H    . ALA A 1 72  ? -16.233 11.656  0.484   1.00 0.00 ? 72  ALA A H    5  
ATOM 8827  H HA   . ALA A 1 72  ? -13.856 9.989   0.295   1.00 0.00 ? 72  ALA A HA   5  
ATOM 8828  H HB1  . ALA A 1 72  ? -13.126 12.576  1.068   1.00 0.00 ? 72  ALA A HB1  5  
ATOM 8829  H HB2  . ALA A 1 72  ? -13.126 11.929  -0.591  1.00 0.00 ? 72  ALA A HB2  5  
ATOM 8830  H HB3  . ALA A 1 72  ? -14.541 12.821  0.016   1.00 0.00 ? 72  ALA A HB3  5  
ATOM 8831  N N    . ASN A 1 73  ? -13.171 9.904   2.688   1.00 0.00 ? 73  ASN A N    5  
ATOM 8832  C CA   . ASN A 1 73  ? -12.901 9.661   4.095   1.00 0.00 ? 73  ASN A CA   5  
ATOM 8833  C C    . ASN A 1 73  ? -11.765 8.644   4.224   1.00 0.00 ? 73  ASN A C    5  
ATOM 8834  O O    . ASN A 1 73  ? -11.984 7.518   4.667   1.00 0.00 ? 73  ASN A O    5  
ATOM 8835  C CB   . ASN A 1 73  ? -14.132 9.088   4.800   1.00 0.00 ? 73  ASN A CB   5  
ATOM 8836  C CG   . ASN A 1 73  ? -14.944 10.196  5.474   1.00 0.00 ? 73  ASN A CG   5  
ATOM 8837  O OD1  . ASN A 1 73  ? -16.075 10.478  5.115   1.00 0.00 ? 73  ASN A OD1  5  
ATOM 8838  N ND2  . ASN A 1 73  ? -14.305 10.808  6.467   1.00 0.00 ? 73  ASN A ND2  5  
ATOM 8839  H H    . ASN A 1 73  ? -12.536 9.464   2.053   1.00 0.00 ? 73  ASN A H    5  
ATOM 8840  H HA   . ASN A 1 73  ? -12.638 10.635  4.508   1.00 0.00 ? 73  ASN A HA   5  
ATOM 8841  H HB2  . ASN A 1 73  ? -14.757 8.561   4.079   1.00 0.00 ? 73  ASN A HB2  5  
ATOM 8842  H HB3  . ASN A 1 73  ? -13.820 8.357   5.546   1.00 0.00 ? 73  ASN A HB3  5  
ATOM 8843  H HD21 . ASN A 1 73  ? -13.376 10.529  6.711   1.00 0.00 ? 73  ASN A HD21 5  
ATOM 8844  H HD22 . ASN A 1 73  ? -14.753 11.547  6.969   1.00 0.00 ? 73  ASN A HD22 5  
ATOM 8845  N N    . THR A 1 74  ? -10.578 9.078   3.828   1.00 0.00 ? 74  THR A N    5  
ATOM 8846  C CA   . THR A 1 74  ? -9.407  8.219   3.894   1.00 0.00 ? 74  THR A CA   5  
ATOM 8847  C C    . THR A 1 74  ? -9.692  6.878   3.216   1.00 0.00 ? 74  THR A C    5  
ATOM 8848  O O    . THR A 1 74  ? -10.847 6.536   2.969   1.00 0.00 ? 74  THR A O    5  
ATOM 8849  C CB   . THR A 1 74  ? -9.002  8.084   5.363   1.00 0.00 ? 74  THR A CB   5  
ATOM 8850  O OG1  . THR A 1 74  ? -10.186 7.622   6.009   1.00 0.00 ? 74  THR A OG1  5  
ATOM 8851  C CG2  . THR A 1 74  ? -8.723  9.437   6.021   1.00 0.00 ? 74  THR A CG2  5  
ATOM 8852  H H    . THR A 1 74  ? -10.409 9.996   3.469   1.00 0.00 ? 74  THR A H    5  
ATOM 8853  H HA   . THR A 1 74  ? -8.601  8.695   3.337   1.00 0.00 ? 74  THR A HA   5  
ATOM 8854  H HB   . THR A 1 74  ? -8.149  7.415   5.472   1.00 0.00 ? 74  THR A HB   5  
ATOM 8855  H HG1  . THR A 1 74  ? -10.561 6.838   5.514   1.00 0.00 ? 74  THR A HG1  5  
ATOM 8856  H HG21 . THR A 1 74  ? -9.634  10.035  6.022   1.00 0.00 ? 74  THR A HG21 5  
ATOM 8857  H HG22 . THR A 1 74  ? -8.390  9.280   7.047   1.00 0.00 ? 74  THR A HG22 5  
ATOM 8858  H HG23 . THR A 1 74  ? -7.946  9.959   5.462   1.00 0.00 ? 74  THR A HG23 5  
ATOM 8859  N N    . ALA A 1 75  ? -8.618  6.154   2.934   1.00 0.00 ? 75  ALA A N    5  
ATOM 8860  C CA   . ALA A 1 75  ? -8.737  4.858   2.290   1.00 0.00 ? 75  ALA A CA   5  
ATOM 8861  C C    . ALA A 1 75  ? -7.925  3.826   3.075   1.00 0.00 ? 75  ALA A C    5  
ATOM 8862  O O    . ALA A 1 75  ? -6.889  4.154   3.651   1.00 0.00 ? 75  ALA A O    5  
ATOM 8863  C CB   . ALA A 1 75  ? -8.285  4.968   0.832   1.00 0.00 ? 75  ALA A CB   5  
ATOM 8864  H H    . ALA A 1 75  ? -7.682  6.440   3.139   1.00 0.00 ? 75  ALA A H    5  
ATOM 8865  H HA   . ALA A 1 75  ? -9.789  4.572   2.310   1.00 0.00 ? 75  ALA A HA   5  
ATOM 8866  H HB1  . ALA A 1 75  ? -9.091  5.393   0.233   1.00 0.00 ? 75  ALA A HB1  5  
ATOM 8867  H HB2  . ALA A 1 75  ? -7.409  5.614   0.772   1.00 0.00 ? 75  ALA A HB2  5  
ATOM 8868  H HB3  . ALA A 1 75  ? -8.034  3.978   0.454   1.00 0.00 ? 75  ALA A HB3  5  
ATOM 8869  N N    . THR A 1 76  ? -8.427  2.599   3.073   1.00 0.00 ? 76  THR A N    5  
ATOM 8870  C CA   . THR A 1 76  ? -7.761  1.517   3.778   1.00 0.00 ? 76  THR A CA   5  
ATOM 8871  C C    . THR A 1 76  ? -6.512  1.072   3.014   1.00 0.00 ? 76  THR A C    5  
ATOM 8872  O O    . THR A 1 76  ? -6.604  0.284   2.074   1.00 0.00 ? 76  THR A O    5  
ATOM 8873  C CB   . THR A 1 76  ? -8.778  0.394   3.988   1.00 0.00 ? 76  THR A CB   5  
ATOM 8874  O OG1  . THR A 1 76  ? -9.777  0.980   4.819   1.00 0.00 ? 76  THR A OG1  5  
ATOM 8875  C CG2  . THR A 1 76  ? -8.218  -0.753  4.833   1.00 0.00 ? 76  THR A CG2  5  
ATOM 8876  H H    . THR A 1 76  ? -9.270  2.341   2.602   1.00 0.00 ? 76  THR A H    5  
ATOM 8877  H HA   . THR A 1 76  ? -7.427  1.892   4.746   1.00 0.00 ? 76  THR A HA   5  
ATOM 8878  H HB   . THR A 1 76  ? -9.155  0.026   3.034   1.00 0.00 ? 76  THR A HB   5  
ATOM 8879  H HG1  . THR A 1 76  ? -10.517 1.348   4.256   1.00 0.00 ? 76  THR A HG1  5  
ATOM 8880  H HG21 . THR A 1 76  ? -8.835  -0.885  5.721   1.00 0.00 ? 76  THR A HG21 5  
ATOM 8881  H HG22 . THR A 1 76  ? -8.223  -1.672  4.246   1.00 0.00 ? 76  THR A HG22 5  
ATOM 8882  H HG23 . THR A 1 76  ? -7.196  -0.518  5.131   1.00 0.00 ? 76  THR A HG23 5  
ATOM 8883  N N    . VAL A 1 77  ? -5.375  1.595   3.447   1.00 0.00 ? 77  VAL A N    5  
ATOM 8884  C CA   . VAL A 1 77  ? -4.109  1.261   2.816   1.00 0.00 ? 77  VAL A CA   5  
ATOM 8885  C C    . VAL A 1 77  ? -3.441  0.126   3.593   1.00 0.00 ? 77  VAL A C    5  
ATOM 8886  O O    . VAL A 1 77  ? -3.753  -0.100  4.761   1.00 0.00 ? 77  VAL A O    5  
ATOM 8887  C CB   . VAL A 1 77  ? -3.232  2.510   2.709   1.00 0.00 ? 77  VAL A CB   5  
ATOM 8888  C CG1  . VAL A 1 77  ? -4.087  3.768   2.541   1.00 0.00 ? 77  VAL A CG1  5  
ATOM 8889  C CG2  . VAL A 1 77  ? -2.306  2.635   3.920   1.00 0.00 ? 77  VAL A CG2  5  
ATOM 8890  H H    . VAL A 1 77  ? -5.309  2.236   4.212   1.00 0.00 ? 77  VAL A H    5  
ATOM 8891  H HA   . VAL A 1 77  ? -4.327  0.915   1.805   1.00 0.00 ? 77  VAL A HA   5  
ATOM 8892  H HB   . VAL A 1 77  ? -2.609  2.407   1.820   1.00 0.00 ? 77  VAL A HB   5  
ATOM 8893  H HG11 . VAL A 1 77  ? -3.438  4.636   2.426   1.00 0.00 ? 77  VAL A HG11 5  
ATOM 8894  H HG12 . VAL A 1 77  ? -4.715  3.665   1.656   1.00 0.00 ? 77  VAL A HG12 5  
ATOM 8895  H HG13 . VAL A 1 77  ? -4.717  3.899   3.420   1.00 0.00 ? 77  VAL A HG13 5  
ATOM 8896  H HG21 . VAL A 1 77  ? -2.041  3.682   4.069   1.00 0.00 ? 77  VAL A HG21 5  
ATOM 8897  H HG22 . VAL A 1 77  ? -2.816  2.260   4.808   1.00 0.00 ? 77  VAL A HG22 5  
ATOM 8898  H HG23 . VAL A 1 77  ? -1.401  2.052   3.747   1.00 0.00 ? 77  VAL A HG23 5  
ATOM 8899  N N    . GLU A 1 78  ? -2.533  -0.560  2.913   1.00 0.00 ? 78  GLU A N    5  
ATOM 8900  C CA   . GLU A 1 78  ? -1.818  -1.666  3.525   1.00 0.00 ? 78  GLU A CA   5  
ATOM 8901  C C    . GLU A 1 78  ? -0.337  -1.617  3.143   1.00 0.00 ? 78  GLU A C    5  
ATOM 8902  O O    . GLU A 1 78  ? 0.001   -1.384  1.984   1.00 0.00 ? 78  GLU A O    5  
ATOM 8903  C CB   . GLU A 1 78  ? -2.442  -3.007  3.132   1.00 0.00 ? 78  GLU A CB   5  
ATOM 8904  C CG   . GLU A 1 78  ? -1.482  -4.163  3.419   1.00 0.00 ? 78  GLU A CG   5  
ATOM 8905  C CD   . GLU A 1 78  ? -2.207  -5.319  4.112   1.00 0.00 ? 78  GLU A CD   5  
ATOM 8906  O OE1  . GLU A 1 78  ? -3.107  -5.017  4.926   1.00 0.00 ? 78  GLU A OE1  5  
ATOM 8907  O OE2  . GLU A 1 78  ? -1.846  -6.477  3.812   1.00 0.00 ? 78  GLU A OE2  5  
ATOM 8908  H H    . GLU A 1 78  ? -2.285  -0.370  1.963   1.00 0.00 ? 78  GLU A H    5  
ATOM 8909  H HA   . GLU A 1 78  ? -1.928  -1.523  4.600   1.00 0.00 ? 78  GLU A HA   5  
ATOM 8910  H HB2  . GLU A 1 78  ? -3.371  -3.155  3.682   1.00 0.00 ? 78  GLU A HB2  5  
ATOM 8911  H HB3  . GLU A 1 78  ? -2.697  -2.996  2.072   1.00 0.00 ? 78  GLU A HB3  5  
ATOM 8912  H HG2  . GLU A 1 78  ? -1.040  -4.514  2.487   1.00 0.00 ? 78  GLU A HG2  5  
ATOM 8913  H HG3  . GLU A 1 78  ? -0.663  -3.814  4.048   1.00 0.00 ? 78  GLU A HG3  5  
ATOM 8914  N N    . VAL A 1 79  ? 0.506   -1.841  4.140   1.00 0.00 ? 79  VAL A N    5  
ATOM 8915  C CA   . VAL A 1 79  ? 1.943   -1.826  3.923   1.00 0.00 ? 79  VAL A CA   5  
ATOM 8916  C C    . VAL A 1 79  ? 2.402   -3.216  3.479   1.00 0.00 ? 79  VAL A C    5  
ATOM 8917  O O    . VAL A 1 79  ? 2.009   -4.221  4.068   1.00 0.00 ? 79  VAL A O    5  
ATOM 8918  C CB   . VAL A 1 79  ? 2.657   -1.334  5.184   1.00 0.00 ? 79  VAL A CB   5  
ATOM 8919  C CG1  . VAL A 1 79  ? 4.070   -1.915  5.275   1.00 0.00 ? 79  VAL A CG1  5  
ATOM 8920  C CG2  . VAL A 1 79  ? 2.689   0.194   5.236   1.00 0.00 ? 79  VAL A CG2  5  
ATOM 8921  H H    . VAL A 1 79  ? 0.223   -2.030  5.080   1.00 0.00 ? 79  VAL A H    5  
ATOM 8922  H HA   . VAL A 1 79  ? 2.147   -1.116  3.122   1.00 0.00 ? 79  VAL A HA   5  
ATOM 8923  H HB   . VAL A 1 79  ? 2.093   -1.687  6.048   1.00 0.00 ? 79  VAL A HB   5  
ATOM 8924  H HG11 . VAL A 1 79  ? 4.010   -2.995  5.413   1.00 0.00 ? 79  VAL A HG11 5  
ATOM 8925  H HG12 . VAL A 1 79  ? 4.613   -1.696  4.356   1.00 0.00 ? 79  VAL A HG12 5  
ATOM 8926  H HG13 . VAL A 1 79  ? 4.592   -1.469  6.121   1.00 0.00 ? 79  VAL A HG13 5  
ATOM 8927  H HG21 . VAL A 1 79  ? 3.312   0.573   4.426   1.00 0.00 ? 79  VAL A HG21 5  
ATOM 8928  H HG22 . VAL A 1 79  ? 1.676   0.582   5.126   1.00 0.00 ? 79  VAL A HG22 5  
ATOM 8929  H HG23 . VAL A 1 79  ? 3.100   0.517   6.192   1.00 0.00 ? 79  VAL A HG23 5  
ATOM 8930  N N    . LEU A 1 80  ? 3.228   -3.228  2.443   1.00 0.00 ? 80  LEU A N    5  
ATOM 8931  C CA   . LEU A 1 80  ? 3.746   -4.478  1.913   1.00 0.00 ? 80  LEU A CA   5  
ATOM 8932  C C    . LEU A 1 80  ? 5.258   -4.535  2.136   1.00 0.00 ? 80  LEU A C    5  
ATOM 8933  O O    . LEU A 1 80  ? 5.878   -3.527  2.472   1.00 0.00 ? 80  LEU A O    5  
ATOM 8934  C CB   . LEU A 1 80  ? 3.333   -4.651  0.450   1.00 0.00 ? 80  LEU A CB   5  
ATOM 8935  C CG   . LEU A 1 80  ? 1.859   -4.981  0.203   1.00 0.00 ? 80  LEU A CG   5  
ATOM 8936  C CD1  . LEU A 1 80  ? 1.314   -4.196  -0.992  1.00 0.00 ? 80  LEU A CD1  5  
ATOM 8937  C CD2  . LEU A 1 80  ? 1.655   -6.489  0.040   1.00 0.00 ? 80  LEU A CD2  5  
ATOM 8938  H H    . LEU A 1 80  ? 3.543   -2.405  1.969   1.00 0.00 ? 80  LEU A H    5  
ATOM 8939  H HA   . LEU A 1 80  ? 3.283   -5.288  2.476   1.00 0.00 ? 80  LEU A HA   5  
ATOM 8940  H HB2  . LEU A 1 80  ? 3.574   -3.733  -0.086  1.00 0.00 ? 80  LEU A HB2  5  
ATOM 8941  H HB3  . LEU A 1 80  ? 3.940   -5.443  0.013   1.00 0.00 ? 80  LEU A HB3  5  
ATOM 8942  H HG   . LEU A 1 80  ? 1.289   -4.672  1.079   1.00 0.00 ? 80  LEU A HG   5  
ATOM 8943  H HD11 . LEU A 1 80  ? 1.560   -3.141  -0.876  1.00 0.00 ? 80  LEU A HD11 5  
ATOM 8944  H HD12 . LEU A 1 80  ? 1.763   -4.575  -1.910  1.00 0.00 ? 80  LEU A HD12 5  
ATOM 8945  H HD13 . LEU A 1 80  ? 0.232   -4.315  -1.041  1.00 0.00 ? 80  LEU A HD13 5  
ATOM 8946  H HD21 . LEU A 1 80  ? 1.328   -6.703  -0.977  1.00 0.00 ? 80  LEU A HD21 5  
ATOM 8947  H HD22 . LEU A 1 80  ? 2.594   -7.006  0.236   1.00 0.00 ? 80  LEU A HD22 5  
ATOM 8948  H HD23 . LEU A 1 80  ? 0.898   -6.831  0.745   1.00 0.00 ? 80  LEU A HD23 5  
ATOM 8949  N N    . ALA A 1 81  ? 5.809   -5.724  1.940   1.00 0.00 ? 81  ALA A N    5  
ATOM 8950  C CA   . ALA A 1 81  ? 7.237   -5.925  2.116   1.00 0.00 ? 81  ALA A CA   5  
ATOM 8951  C C    . ALA A 1 81  ? 7.984   -5.315  0.928   1.00 0.00 ? 81  ALA A C    5  
ATOM 8952  O O    . ALA A 1 81  ? 7.373   -4.966  -0.081  1.00 0.00 ? 81  ALA A O    5  
ATOM 8953  C CB   . ALA A 1 81  ? 7.526   -7.418  2.281   1.00 0.00 ? 81  ALA A CB   5  
ATOM 8954  H H    . ALA A 1 81  ? 5.298   -6.538  1.667   1.00 0.00 ? 81  ALA A H    5  
ATOM 8955  H HA   . ALA A 1 81  ? 7.536   -5.406  3.027   1.00 0.00 ? 81  ALA A HA   5  
ATOM 8956  H HB1  . ALA A 1 81  ? 8.129   -7.575  3.176   1.00 0.00 ? 81  ALA A HB1  5  
ATOM 8957  H HB2  . ALA A 1 81  ? 6.586   -7.962  2.377   1.00 0.00 ? 81  ALA A HB2  5  
ATOM 8958  H HB3  . ALA A 1 81  ? 8.069   -7.782  1.409   1.00 0.00 ? 81  ALA A HB3  5  
ATOM 8959  N N    . PRO A 1 82  ? 9.329   -5.202  1.091   1.00 0.00 ? 82  PRO A N    5  
ATOM 8960  C CA   . PRO A 1 82  ? 10.165  -4.640  0.044   1.00 0.00 ? 82  PRO A CA   5  
ATOM 8961  C C    . PRO A 1 82  ? 10.354  -5.636  -1.101  1.00 0.00 ? 82  PRO A C    5  
ATOM 8962  O O    . PRO A 1 82  ? 10.977  -5.316  -2.112  1.00 0.00 ? 82  PRO A O    5  
ATOM 8963  C CB   . PRO A 1 82  ? 11.469  -4.276  0.735   1.00 0.00 ? 82  PRO A CB   5  
ATOM 8964  C CG   . PRO A 1 82  ? 11.489  -5.068  2.032   1.00 0.00 ? 82  PRO A CG   5  
ATOM 8965  C CD   . PRO A 1 82  ? 10.087  -5.604  2.272   1.00 0.00 ? 82  PRO A CD   5  
ATOM 8966  H HA   . PRO A 1 82  ? 9.724   -3.839  -0.360  1.00 0.00 ? 82  PRO A HA   5  
ATOM 8967  H HB2  . PRO A 1 82  ? 12.326  -4.528  0.110   1.00 0.00 ? 82  PRO A HB2  5  
ATOM 8968  H HB3  . PRO A 1 82  ? 11.522  -3.205  0.931   1.00 0.00 ? 82  PRO A HB3  5  
ATOM 8969  H HG2  . PRO A 1 82  ? 12.205  -5.887  1.969   1.00 0.00 ? 82  PRO A HG2  5  
ATOM 8970  H HG3  . PRO A 1 82  ? 11.802  -4.434  2.862   1.00 0.00 ? 82  PRO A HG3  5  
ATOM 8971  H HD2  . PRO A 1 82  ? 10.092  -6.687  2.390   1.00 0.00 ? 82  PRO A HD2  5  
ATOM 8972  H HD3  . PRO A 1 82  ? 9.654   -5.187  3.182   1.00 0.00 ? 82  PRO A HD3  5  
ATOM 8973  N N    . SER A 1 83  ? 9.803   -6.825  -0.905  1.00 0.00 ? 83  SER A N    5  
ATOM 8974  C CA   . SER A 1 83  ? 9.902   -7.871  -1.909  1.00 0.00 ? 83  SER A CA   5  
ATOM 8975  C C    . SER A 1 83  ? 8.506   -8.262  -2.398  1.00 0.00 ? 83  SER A C    5  
ATOM 8976  O O    . SER A 1 83  ? 8.254   -9.427  -2.701  1.00 0.00 ? 83  SER A O    5  
ATOM 8977  C CB   . SER A 1 83  ? 10.634  -9.096  -1.358  1.00 0.00 ? 83  SER A CB   5  
ATOM 8978  O OG   . SER A 1 83  ? 12.046  -8.989  -1.511  1.00 0.00 ? 83  SER A OG   5  
ATOM 8979  H H    . SER A 1 83  ? 9.297   -7.078  -0.080  1.00 0.00 ? 83  SER A H    5  
ATOM 8980  H HA   . SER A 1 83  ? 10.484  -7.437  -2.722  1.00 0.00 ? 83  SER A HA   5  
ATOM 8981  H HB2  . SER A 1 83  ? 10.392  -9.218  -0.302  1.00 0.00 ? 83  SER A HB2  5  
ATOM 8982  H HB3  . SER A 1 83  ? 10.280  -9.991  -1.870  1.00 0.00 ? 83  SER A HB3  5  
ATOM 8983  H HG   . SER A 1 83  ? 12.479  -9.871  -1.324  1.00 0.00 ? 83  SER A HG   5  
ATOM 8984  N N    . ALA A 1 84  ? 7.635   -7.265  -2.459  1.00 0.00 ? 84  ALA A N    5  
ATOM 8985  C CA   . ALA A 1 84  ? 6.271   -7.490  -2.906  1.00 0.00 ? 84  ALA A CA   5  
ATOM 8986  C C    . ALA A 1 84  ? 6.135   -7.041  -4.362  1.00 0.00 ? 84  ALA A C    5  
ATOM 8987  O O    . ALA A 1 84  ? 6.418   -5.890  -4.690  1.00 0.00 ? 84  ALA A O    5  
ATOM 8988  C CB   . ALA A 1 84  ? 5.302   -6.756  -1.977  1.00 0.00 ? 84  ALA A CB   5  
ATOM 8989  H H    . ALA A 1 84  ? 7.848   -6.320  -2.211  1.00 0.00 ? 84  ALA A H    5  
ATOM 8990  H HA   . ALA A 1 84  ? 6.074   -8.560  -2.845  1.00 0.00 ? 84  ALA A HA   5  
ATOM 8991  H HB1  . ALA A 1 84  ? 5.598   -5.710  -1.895  1.00 0.00 ? 84  ALA A HB1  5  
ATOM 8992  H HB2  . ALA A 1 84  ? 4.292   -6.817  -2.384  1.00 0.00 ? 84  ALA A HB2  5  
ATOM 8993  H HB3  . ALA A 1 84  ? 5.324   -7.218  -0.990  1.00 0.00 ? 84  ALA A HB3  5  
ATOM 8994  N N    . ARG A 1 85  ? 5.702   -7.974  -5.198  1.00 0.00 ? 85  ARG A N    5  
ATOM 8995  C CA   . ARG A 1 85  ? 5.525   -7.688  -6.611  1.00 0.00 ? 85  ARG A CA   5  
ATOM 8996  C C    . ARG A 1 85  ? 4.036   -7.588  -6.951  1.00 0.00 ? 85  ARG A C    5  
ATOM 8997  O O    . ARG A 1 85  ? 3.666   -7.000  -7.966  1.00 0.00 ? 85  ARG A O    5  
ATOM 8998  C CB   . ARG A 1 85  ? 6.166   -8.775  -7.477  1.00 0.00 ? 85  ARG A CB   5  
ATOM 8999  C CG   . ARG A 1 85  ? 7.692   -8.721  -7.383  1.00 0.00 ? 85  ARG A CG   5  
ATOM 9000  C CD   . ARG A 1 85  ? 8.292   -8.020  -8.603  1.00 0.00 ? 85  ARG A CD   5  
ATOM 9001  N NE   . ARG A 1 85  ? 8.181   -8.891  -9.794  1.00 0.00 ? 85  ARG A NE   5  
ATOM 9002  C CZ   . ARG A 1 85  ? 8.824   -8.671  -10.949 1.00 0.00 ? 85  ARG A CZ   5  
ATOM 9003  N NH1  . ARG A 1 85  ? 9.627   -7.606  -11.076 1.00 0.00 ? 85  ARG A NH1  5  
ATOM 9004  N NH2  . ARG A 1 85  ? 8.663   -9.516  -11.977 1.00 0.00 ? 85  ARG A NH2  5  
ATOM 9005  H H    . ARG A 1 85  ? 5.473   -8.908  -4.923  1.00 0.00 ? 85  ARG A H    5  
ATOM 9006  H HA   . ARG A 1 85  ? 6.028   -6.734  -6.768  1.00 0.00 ? 85  ARG A HA   5  
ATOM 9007  H HB2  . ARG A 1 85  ? 5.813   -9.755  -7.157  1.00 0.00 ? 85  ARG A HB2  5  
ATOM 9008  H HB3  . ARG A 1 85  ? 5.857   -8.648  -8.515  1.00 0.00 ? 85  ARG A HB3  5  
ATOM 9009  H HG2  . ARG A 1 85  ? 7.986   -8.195  -6.475  1.00 0.00 ? 85  ARG A HG2  5  
ATOM 9010  H HG3  . ARG A 1 85  ? 8.091   -9.733  -7.308  1.00 0.00 ? 85  ARG A HG3  5  
ATOM 9011  H HD2  . ARG A 1 85  ? 7.774   -7.078  -8.782  1.00 0.00 ? 85  ARG A HD2  5  
ATOM 9012  H HD3  . ARG A 1 85  ? 9.338   -7.778  -8.416  1.00 0.00 ? 85  ARG A HD3  5  
ATOM 9013  H HE   . ARG A 1 85  ? 7.589   -9.695  -9.733  1.00 0.00 ? 85  ARG A HE   5  
ATOM 9014  H HH11 . ARG A 1 85  ? 9.747   -6.976  -10.309 1.00 0.00 ? 85  ARG A HH11 5  
ATOM 9015  H HH12 . ARG A 1 85  ? 10.106  -7.441  -11.938 1.00 0.00 ? 85  ARG A HH12 5  
ATOM 9016  H HH21 . ARG A 1 85  ? 8.063   -10.310 -11.882 1.00 0.00 ? 85  ARG A HH21 5  
ATOM 9017  H HH22 . ARG A 1 85  ? 9.142   -9.351  -12.839 1.00 0.00 ? 85  ARG A HH22 5  
ATOM 9018  N N    . GLN A 1 86  ? 3.223   -8.171  -6.082  1.00 0.00 ? 86  GLN A N    5  
ATOM 9019  C CA   . GLN A 1 86  ? 1.784   -8.154  -6.276  1.00 0.00 ? 86  GLN A CA   5  
ATOM 9020  C C    . GLN A 1 86  ? 1.065   -8.172  -4.926  1.00 0.00 ? 86  GLN A C    5  
ATOM 9021  O O    . GLN A 1 86  ? 1.663   -8.507  -3.905  1.00 0.00 ? 86  GLN A O    5  
ATOM 9022  C CB   . GLN A 1 86  ? 1.335   -9.327  -7.151  1.00 0.00 ? 86  GLN A CB   5  
ATOM 9023  C CG   . GLN A 1 86  ? 1.562   -10.661 -6.438  1.00 0.00 ? 86  GLN A CG   5  
ATOM 9024  C CD   . GLN A 1 86  ? 1.737   -11.799 -7.446  1.00 0.00 ? 86  GLN A CD   5  
ATOM 9025  O OE1  . GLN A 1 86  ? 1.241   -11.758 -8.559  1.00 0.00 ? 86  GLN A OE1  5  
ATOM 9026  N NE2  . GLN A 1 86  ? 2.469   -12.814 -6.995  1.00 0.00 ? 86  GLN A NE2  5  
ATOM 9027  H H    . GLN A 1 86  ? 3.533   -8.647  -5.258  1.00 0.00 ? 86  GLN A H    5  
ATOM 9028  H HA   . GLN A 1 86  ? 1.572   -7.220  -6.796  1.00 0.00 ? 86  GLN A HA   5  
ATOM 9029  H HB2  . GLN A 1 86  ? 0.279   -9.218  -7.399  1.00 0.00 ? 86  GLN A HB2  5  
ATOM 9030  H HB3  . GLN A 1 86  ? 1.886   -9.315  -8.092  1.00 0.00 ? 86  GLN A HB3  5  
ATOM 9031  H HG2  . GLN A 1 86  ? 2.446   -10.593 -5.804  1.00 0.00 ? 86  GLN A HG2  5  
ATOM 9032  H HG3  . GLN A 1 86  ? 0.717   -10.877 -5.784  1.00 0.00 ? 86  GLN A HG3  5  
ATOM 9033  H HE21 . GLN A 1 86  ? 2.848   -12.784 -6.070  1.00 0.00 ? 86  GLN A HE21 5  
ATOM 9034  H HE22 . GLN A 1 86  ? 2.641   -13.606 -7.581  1.00 0.00 ? 86  GLN A HE22 5  
ATOM 9035  N N    . TYR A 1 87  ? -0.208  -7.806  -4.964  1.00 0.00 ? 87  TYR A N    5  
ATOM 9036  C CA   . TYR A 1 87  ? -1.014  -7.775  -3.755  1.00 0.00 ? 87  TYR A CA   5  
ATOM 9037  C C    . TYR A 1 87  ? -2.447  -8.231  -4.040  1.00 0.00 ? 87  TYR A C    5  
ATOM 9038  O O    . TYR A 1 87  ? -2.956  -8.035  -5.143  1.00 0.00 ? 87  TYR A O    5  
ATOM 9039  C CB   . TYR A 1 87  ? -1.037  -6.315  -3.301  1.00 0.00 ? 87  TYR A CB   5  
ATOM 9040  C CG   . TYR A 1 87  ? -2.035  -6.028  -2.177  1.00 0.00 ? 87  TYR A CG   5  
ATOM 9041  C CD1  . TYR A 1 87  ? -1.729  -6.376  -0.877  1.00 0.00 ? 87  TYR A CD1  5  
ATOM 9042  C CD2  . TYR A 1 87  ? -3.242  -5.423  -2.464  1.00 0.00 ? 87  TYR A CD2  5  
ATOM 9043  C CE1  . TYR A 1 87  ? -2.669  -6.106  0.180   1.00 0.00 ? 87  TYR A CE1  5  
ATOM 9044  C CE2  . TYR A 1 87  ? -4.181  -5.153  -1.406  1.00 0.00 ? 87  TYR A CE2  5  
ATOM 9045  C CZ   . TYR A 1 87  ? -3.848  -5.509  -0.136  1.00 0.00 ? 87  TYR A CZ   5  
ATOM 9046  O OH   . TYR A 1 87  ? -4.736  -5.254  0.863   1.00 0.00 ? 87  TYR A OH   5  
ATOM 9047  H H    . TYR A 1 87  ? -0.687  -7.534  -5.798  1.00 0.00 ? 87  TYR A H    5  
ATOM 9048  H HA   . TYR A 1 87  ? -0.562  -8.454  -3.032  1.00 0.00 ? 87  TYR A HA   5  
ATOM 9049  H HB2  . TYR A 1 87  ? -0.039  -6.033  -2.966  1.00 0.00 ? 87  TYR A HB2  5  
ATOM 9050  H HB3  . TYR A 1 87  ? -1.277  -5.682  -4.156  1.00 0.00 ? 87  TYR A HB3  5  
ATOM 9051  H HD1  . TYR A 1 87  ? -0.776  -6.854  -0.651  1.00 0.00 ? 87  TYR A HD1  5  
ATOM 9052  H HD2  . TYR A 1 87  ? -3.484  -5.148  -3.490  1.00 0.00 ? 87  TYR A HD2  5  
ATOM 9053  H HE1  . TYR A 1 87  ? -2.439  -6.376  1.211   1.00 0.00 ? 87  TYR A HE1  5  
ATOM 9054  H HE2  . TYR A 1 87  ? -5.138  -4.676  -1.618  1.00 0.00 ? 87  TYR A HE2  5  
ATOM 9055  H HH   . TYR A 1 87  ? -5.460  -5.944  0.861   1.00 0.00 ? 87  TYR A HH   5  
ATOM 9056  N N    . THR A 1 88  ? -3.055  -8.830  -3.028  1.00 0.00 ? 88  THR A N    5  
ATOM 9057  C CA   . THR A 1 88  ? -4.419  -9.316  -3.156  1.00 0.00 ? 88  THR A CA   5  
ATOM 9058  C C    . THR A 1 88  ? -5.368  -8.472  -2.301  1.00 0.00 ? 88  THR A C    5  
ATOM 9059  O O    . THR A 1 88  ? -5.130  -8.280  -1.110  1.00 0.00 ? 88  THR A O    5  
ATOM 9060  C CB   . THR A 1 88  ? -4.429  -10.801 -2.789  1.00 0.00 ? 88  THR A CB   5  
ATOM 9061  O OG1  . THR A 1 88  ? -3.456  -11.379 -3.655  1.00 0.00 ? 88  THR A OG1  5  
ATOM 9062  C CG2  . THR A 1 88  ? -5.736  -11.493 -3.181  1.00 0.00 ? 88  THR A CG2  5  
ATOM 9063  H H    . THR A 1 88  ? -2.634  -8.986  -2.135  1.00 0.00 ? 88  THR A H    5  
ATOM 9064  H HA   . THR A 1 88  ? -4.731  -9.195  -4.193  1.00 0.00 ? 88  THR A HA   5  
ATOM 9065  H HB   . THR A 1 88  ? -4.217  -10.941 -1.729  1.00 0.00 ? 88  THR A HB   5  
ATOM 9066  H HG1  . THR A 1 88  ? -3.457  -12.374 -3.555  1.00 0.00 ? 88  THR A HG1  5  
ATOM 9067  H HG21 . THR A 1 88  ? -6.400  -10.771 -3.658  1.00 0.00 ? 88  THR A HG21 5  
ATOM 9068  H HG22 . THR A 1 88  ? -5.523  -12.305 -3.876  1.00 0.00 ? 88  THR A HG22 5  
ATOM 9069  H HG23 . THR A 1 88  ? -6.216  -11.895 -2.289  1.00 0.00 ? 88  THR A HG23 5  
ATOM 9070  N N    . ALA A 1 89  ? -6.422  -7.992  -2.943  1.00 0.00 ? 89  ALA A N    5  
ATOM 9071  C CA   . ALA A 1 89  ? -7.407  -7.174  -2.257  1.00 0.00 ? 89  ALA A CA   5  
ATOM 9072  C C    . ALA A 1 89  ? -8.650  -8.017  -1.965  1.00 0.00 ? 89  ALA A C    5  
ATOM 9073  O O    . ALA A 1 89  ? -9.063  -8.829  -2.792  1.00 0.00 ? 89  ALA A O    5  
ATOM 9074  C CB   . ALA A 1 89  ? -7.726  -5.940  -3.104  1.00 0.00 ? 89  ALA A CB   5  
ATOM 9075  H H    . ALA A 1 89  ? -6.608  -8.153  -3.913  1.00 0.00 ? 89  ALA A H    5  
ATOM 9076  H HA   . ALA A 1 89  ? -6.969  -6.848  -1.314  1.00 0.00 ? 89  ALA A HA   5  
ATOM 9077  H HB1  . ALA A 1 89  ? -8.293  -6.242  -3.986  1.00 0.00 ? 89  ALA A HB1  5  
ATOM 9078  H HB2  . ALA A 1 89  ? -8.316  -5.238  -2.516  1.00 0.00 ? 89  ALA A HB2  5  
ATOM 9079  H HB3  . ALA A 1 89  ? -6.797  -5.463  -3.416  1.00 0.00 ? 89  ALA A HB3  5  
ATOM 9080  N N    . THR A 1 90  ? -9.211  -7.797  -0.785  1.00 0.00 ? 90  THR A N    5  
ATOM 9081  C CA   . THR A 1 90  ? -10.398 -8.527  -0.373  1.00 0.00 ? 90  THR A CA   5  
ATOM 9082  C C    . THR A 1 90  ? -11.354 -7.605  0.387   1.00 0.00 ? 90  THR A C    5  
ATOM 9083  O O    . THR A 1 90  ? -10.923 -6.802  1.213   1.00 0.00 ? 90  THR A O    5  
ATOM 9084  C CB   . THR A 1 90  ? -9.948  -9.740  0.443   1.00 0.00 ? 90  THR A CB   5  
ATOM 9085  O OG1  . THR A 1 90  ? -8.965  -9.215  1.332   1.00 0.00 ? 90  THR A OG1  5  
ATOM 9086  C CG2  . THR A 1 90  ? -9.181  -10.761 -0.400  1.00 0.00 ? 90  THR A CG2  5  
ATOM 9087  H H    . THR A 1 90  ? -8.869  -7.135  -0.118  1.00 0.00 ? 90  THR A H    5  
ATOM 9088  H HA   . THR A 1 90  ? -10.922 -8.863  -1.267  1.00 0.00 ? 90  THR A HA   5  
ATOM 9089  H HB   . THR A 1 90  ? -10.795 -10.208 0.945   1.00 0.00 ? 90  THR A HB   5  
ATOM 9090  H HG1  . THR A 1 90  ? -9.399  -8.620  2.008   1.00 0.00 ? 90  THR A HG1  5  
ATOM 9091  H HG21 . THR A 1 90  ? -8.214  -10.344 -0.684  1.00 0.00 ? 90  THR A HG21 5  
ATOM 9092  H HG22 . THR A 1 90  ? -9.028  -11.670 0.180   1.00 0.00 ? 90  THR A HG22 5  
ATOM 9093  H HG23 . THR A 1 90  ? -9.754  -10.994 -1.298  1.00 0.00 ? 90  THR A HG23 5  
ATOM 9094  N N    . GLY A 1 91  ? -12.635 -7.750  0.079   1.00 0.00 ? 91  GLY A N    5  
ATOM 9095  C CA   . GLY A 1 91  ? -13.656 -6.940  0.723   1.00 0.00 ? 91  GLY A CA   5  
ATOM 9096  C C    . GLY A 1 91  ? -13.898 -5.644  -0.054  1.00 0.00 ? 91  GLY A C    5  
ATOM 9097  O O    . GLY A 1 91  ? -13.812 -4.554  0.509   1.00 0.00 ? 91  GLY A O    5  
ATOM 9098  H H    . GLY A 1 91  ? -12.977 -8.405  -0.594  1.00 0.00 ? 91  GLY A H    5  
ATOM 9099  H HA2  . GLY A 1 91  ? -14.584 -7.507  0.791   1.00 0.00 ? 91  GLY A HA2  5  
ATOM 9100  H HA3  . GLY A 1 91  ? -13.350 -6.706  1.742   1.00 0.00 ? 91  GLY A HA3  5  
ATOM 9101  N N    . LEU A 1 92  ? -14.195 -5.806  -1.335  1.00 0.00 ? 92  LEU A N    5  
ATOM 9102  C CA   . LEU A 1 92  ? -14.450 -4.663  -2.194  1.00 0.00 ? 92  LEU A CA   5  
ATOM 9103  C C    . LEU A 1 92  ? -15.899 -4.709  -2.681  1.00 0.00 ? 92  LEU A C    5  
ATOM 9104  O O    . LEU A 1 92  ? -16.580 -5.721  -2.519  1.00 0.00 ? 92  LEU A O    5  
ATOM 9105  C CB   . LEU A 1 92  ? -13.422 -4.604  -3.327  1.00 0.00 ? 92  LEU A CB   5  
ATOM 9106  C CG   . LEU A 1 92  ? -11.972 -4.889  -2.932  1.00 0.00 ? 92  LEU A CG   5  
ATOM 9107  C CD1  . LEU A 1 92  ? -11.160 -5.368  -4.137  1.00 0.00 ? 92  LEU A CD1  5  
ATOM 9108  C CD2  . LEU A 1 92  ? -11.336 -3.670  -2.260  1.00 0.00 ? 92  LEU A CD2  5  
ATOM 9109  H H    . LEU A 1 92  ? -14.262 -6.697  -1.785  1.00 0.00 ? 92  LEU A H    5  
ATOM 9110  H HA   . LEU A 1 92  ? -14.316 -3.765  -1.591  1.00 0.00 ? 92  LEU A HA   5  
ATOM 9111  H HB2  . LEU A 1 92  ? -13.716 -5.320  -4.095  1.00 0.00 ? 92  LEU A HB2  5  
ATOM 9112  H HB3  . LEU A 1 92  ? -13.467 -3.614  -3.780  1.00 0.00 ? 92  LEU A HB3  5  
ATOM 9113  H HG   . LEU A 1 92  ? -11.969 -5.698  -2.201  1.00 0.00 ? 92  LEU A HG   5  
ATOM 9114  H HD11 . LEU A 1 92  ? -11.470 -6.378  -4.406  1.00 0.00 ? 92  LEU A HD11 5  
ATOM 9115  H HD12 . LEU A 1 92  ? -11.331 -4.699  -4.980  1.00 0.00 ? 92  LEU A HD12 5  
ATOM 9116  H HD13 . LEU A 1 92  ? -10.100 -5.369  -3.884  1.00 0.00 ? 92  LEU A HD13 5  
ATOM 9117  H HD21 . LEU A 1 92  ? -11.102 -3.908  -1.223  1.00 0.00 ? 92  LEU A HD21 5  
ATOM 9118  H HD22 . LEU A 1 92  ? -10.421 -3.401  -2.788  1.00 0.00 ? 92  LEU A HD22 5  
ATOM 9119  H HD23 . LEU A 1 92  ? -12.034 -2.833  -2.292  1.00 0.00 ? 92  LEU A HD23 5  
ATOM 9120  N N    . LYS A 1 93  ? -16.329 -3.602  -3.268  1.00 0.00 ? 93  LYS A N    5  
ATOM 9121  C CA   . LYS A 1 93  ? -17.685 -3.503  -3.779  1.00 0.00 ? 93  LYS A CA   5  
ATOM 9122  C C    . LYS A 1 93  ? -17.671 -3.716  -5.294  1.00 0.00 ? 93  LYS A C    5  
ATOM 9123  O O    . LYS A 1 93  ? -16.914 -3.062  -6.010  1.00 0.00 ? 93  LYS A O    5  
ATOM 9124  C CB   . LYS A 1 93  ? -18.325 -2.182  -3.350  1.00 0.00 ? 93  LYS A CB   5  
ATOM 9125  C CG   . LYS A 1 93  ? -19.697 -1.999  -4.003  1.00 0.00 ? 93  LYS A CG   5  
ATOM 9126  C CD   . LYS A 1 93  ? -19.757 -0.691  -4.794  1.00 0.00 ? 93  LYS A CD   5  
ATOM 9127  C CE   . LYS A 1 93  ? -19.605 0.518   -3.868  1.00 0.00 ? 93  LYS A CE   5  
ATOM 9128  N NZ   . LYS A 1 93  ? -20.906 0.867   -3.254  1.00 0.00 ? 93  LYS A NZ   5  
ATOM 9129  H H    . LYS A 1 93  ? -15.768 -2.783  -3.396  1.00 0.00 ? 93  LYS A H    5  
ATOM 9130  H HA   . LYS A 1 93  ? -18.265 -4.305  -3.323  1.00 0.00 ? 93  LYS A HA   5  
ATOM 9131  H HB2  . LYS A 1 93  ? -18.429 -2.158  -2.265  1.00 0.00 ? 93  LYS A HB2  5  
ATOM 9132  H HB3  . LYS A 1 93  ? -17.674 -1.352  -3.625  1.00 0.00 ? 93  LYS A HB3  5  
ATOM 9133  H HG2  . LYS A 1 93  ? -19.902 -2.839  -4.666  1.00 0.00 ? 93  LYS A HG2  5  
ATOM 9134  H HG3  . LYS A 1 93  ? -20.471 -2.001  -3.237  1.00 0.00 ? 93  LYS A HG3  5  
ATOM 9135  H HD2  . LYS A 1 93  ? -18.968 -0.679  -5.546  1.00 0.00 ? 93  LYS A HD2  5  
ATOM 9136  H HD3  . LYS A 1 93  ? -20.706 -0.628  -5.327  1.00 0.00 ? 93  LYS A HD3  5  
ATOM 9137  H HE2  . LYS A 1 93  ? -18.876 0.297   -3.089  1.00 0.00 ? 93  LYS A HE2  5  
ATOM 9138  H HE3  . LYS A 1 93  ? -19.222 1.369   -4.431  1.00 0.00 ? 93  LYS A HE3  5  
ATOM 9139  H HZ1  . LYS A 1 93  ? -20.865 0.700   -2.269  1.00 0.00 ? 93  LYS A HZ1  5  
ATOM 9140  H HZ2  . LYS A 1 93  ? -21.104 1.833   -3.420  1.00 0.00 ? 93  LYS A HZ2  5  
ATOM 9141  H HZ3  . LYS A 1 93  ? -21.627 0.304   -3.658  1.00 0.00 ? 93  LYS A HZ3  5  
ATOM 9142  N N    . PRO A 1 94  ? -18.540 -4.658  -5.751  1.00 0.00 ? 94  PRO A N    5  
ATOM 9143  C CA   . PRO A 1 94  ? -18.634 -4.966  -7.168  1.00 0.00 ? 94  PRO A CA   5  
ATOM 9144  C C    . PRO A 1 94  ? -19.382 -3.862  -7.919  1.00 0.00 ? 94  PRO A C    5  
ATOM 9145  O O    . PRO A 1 94  ? -20.171 -3.128  -7.327  1.00 0.00 ? 94  PRO A O    5  
ATOM 9146  C CB   . PRO A 1 94  ? -19.339 -6.311  -7.232  1.00 0.00 ? 94  PRO A CB   5  
ATOM 9147  C CG   . PRO A 1 94  ? -20.025 -6.487  -5.887  1.00 0.00 ? 94  PRO A CG   5  
ATOM 9148  C CD   . PRO A 1 94  ? -19.452 -5.452  -4.932  1.00 0.00 ? 94  PRO A CD   5  
ATOM 9149  H HA   . PRO A 1 94  ? -17.722 -5.005  -7.576  1.00 0.00 ? 94  PRO A HA   5  
ATOM 9150  H HB2  . PRO A 1 94  ? -20.064 -6.333  -8.046  1.00 0.00 ? 94  PRO A HB2  5  
ATOM 9151  H HB3  . PRO A 1 94  ? -18.628 -7.116  -7.416  1.00 0.00 ? 94  PRO A HB3  5  
ATOM 9152  H HG2  . PRO A 1 94  ? -21.103 -6.358  -5.988  1.00 0.00 ? 94  PRO A HG2  5  
ATOM 9153  H HG3  . PRO A 1 94  ? -19.859 -7.494  -5.503  1.00 0.00 ? 94  PRO A HG3  5  
ATOM 9154  H HD2  . PRO A 1 94  ? -20.238 -4.833  -4.501  1.00 0.00 ? 94  PRO A HD2  5  
ATOM 9155  H HD3  . PRO A 1 94  ? -18.928 -5.927  -4.102  1.00 0.00 ? 94  PRO A HD3  5  
ATOM 9156  N N    . GLU A 1 95  ? -19.106 -3.780  -9.213  1.00 0.00 ? 95  GLU A N    5  
ATOM 9157  C CA   . GLU A 1 95  ? -19.743 -2.779  -10.051 1.00 0.00 ? 95  GLU A CA   5  
ATOM 9158  C C    . GLU A 1 95  ? -19.259 -1.379  -9.667  1.00 0.00 ? 95  GLU A C    5  
ATOM 9159  O O    . GLU A 1 95  ? -20.056 -0.446  -9.577  1.00 0.00 ? 95  GLU A O    5  
ATOM 9160  C CB   . GLU A 1 95  ? -21.267 -2.877  -9.961  1.00 0.00 ? 95  GLU A CB   5  
ATOM 9161  C CG   . GLU A 1 95  ? -21.749 -4.280  -10.333 1.00 0.00 ? 95  GLU A CG   5  
ATOM 9162  C CD   . GLU A 1 95  ? -22.745 -4.229  -11.494 1.00 0.00 ? 95  GLU A CD   5  
ATOM 9163  O OE1  . GLU A 1 95  ? -23.747 -3.496  -11.349 1.00 0.00 ? 95  GLU A OE1  5  
ATOM 9164  O OE2  . GLU A 1 95  ? -22.481 -4.924  -12.499 1.00 0.00 ? 95  GLU A OE2  5  
ATOM 9165  H H    . GLU A 1 95  ? -18.463 -4.381  -9.686  1.00 0.00 ? 95  GLU A H    5  
ATOM 9166  H HA   . GLU A 1 95  ? -19.429 -3.012  -11.069 1.00 0.00 ? 95  GLU A HA   5  
ATOM 9167  H HB2  . GLU A 1 95  ? -21.592 -2.633  -8.950  1.00 0.00 ? 95  GLU A HB2  5  
ATOM 9168  H HB3  . GLU A 1 95  ? -21.722 -2.144  -10.628 1.00 0.00 ? 95  GLU A HB3  5  
ATOM 9169  H HG2  . GLU A 1 95  ? -20.896 -4.901  -10.608 1.00 0.00 ? 95  GLU A HG2  5  
ATOM 9170  H HG3  . GLU A 1 95  ? -22.218 -4.749  -9.467  1.00 0.00 ? 95  GLU A HG3  5  
ATOM 9171  N N    . SER A 1 96  ? -17.956 -1.277  -9.450  1.00 0.00 ? 96  SER A N    5  
ATOM 9172  C CA   . SER A 1 96  ? -17.358 -0.007  -9.077  1.00 0.00 ? 96  SER A CA   5  
ATOM 9173  C C    . SER A 1 96  ? -15.898 0.038   -9.534  1.00 0.00 ? 96  SER A C    5  
ATOM 9174  O O    . SER A 1 96  ? -15.345 -0.976  -9.957  1.00 0.00 ? 96  SER A O    5  
ATOM 9175  C CB   . SER A 1 96  ? -17.448 0.223   -7.567  1.00 0.00 ? 96  SER A CB   5  
ATOM 9176  O OG   . SER A 1 96  ? -18.653 0.888   -7.198  1.00 0.00 ? 96  SER A OG   5  
ATOM 9177  H H    . SER A 1 96  ? -17.315 -2.040  -9.525  1.00 0.00 ? 96  SER A H    5  
ATOM 9178  H HA   . SER A 1 96  ? -17.944 0.752   -9.594  1.00 0.00 ? 96  SER A HA   5  
ATOM 9179  H HB2  . SER A 1 96  ? -17.390 -0.736  -7.051  1.00 0.00 ? 96  SER A HB2  5  
ATOM 9180  H HB3  . SER A 1 96  ? -16.592 0.813   -7.238  1.00 0.00 ? 96  SER A HB3  5  
ATOM 9181  H HG   . SER A 1 96  ? -19.420 0.247   -7.226  1.00 0.00 ? 96  SER A HG   5  
ATOM 9182  N N    . VAL A 1 97  ? -15.317 1.225   -9.434  1.00 0.00 ? 97  VAL A N    5  
ATOM 9183  C CA   . VAL A 1 97  ? -13.932 1.415   -9.833  1.00 0.00 ? 97  VAL A CA   5  
ATOM 9184  C C    . VAL A 1 97  ? -13.083 1.700   -8.592  1.00 0.00 ? 97  VAL A C    5  
ATOM 9185  O O    . VAL A 1 97  ? -13.427 2.563   -7.786  1.00 0.00 ? 97  VAL A O    5  
ATOM 9186  C CB   . VAL A 1 97  ? -13.838 2.519   -10.888 1.00 0.00 ? 97  VAL A CB   5  
ATOM 9187  C CG1  . VAL A 1 97  ? -12.484 2.485   -11.599 1.00 0.00 ? 97  VAL A CG1  5  
ATOM 9188  C CG2  . VAL A 1 97  ? -14.988 2.417   -11.892 1.00 0.00 ? 97  VAL A CG2  5  
ATOM 9189  H H    . VAL A 1 97  ? -15.774 2.044   -9.090  1.00 0.00 ? 97  VAL A H    5  
ATOM 9190  H HA   . VAL A 1 97  ? -13.590 0.485   -10.287 1.00 0.00 ? 97  VAL A HA   5  
ATOM 9191  H HB   . VAL A 1 97  ? -13.924 3.479   -10.377 1.00 0.00 ? 97  VAL A HB   5  
ATOM 9192  H HG11 . VAL A 1 97  ? -11.696 2.298   -10.869 1.00 0.00 ? 97  VAL A HG11 5  
ATOM 9193  H HG12 . VAL A 1 97  ? -12.485 1.690   -12.344 1.00 0.00 ? 97  VAL A HG12 5  
ATOM 9194  H HG13 . VAL A 1 97  ? -12.306 3.442   -12.088 1.00 0.00 ? 97  VAL A HG13 5  
ATOM 9195  H HG21 . VAL A 1 97  ? -15.651 3.274   -11.774 1.00 0.00 ? 97  VAL A HG21 5  
ATOM 9196  H HG22 . VAL A 1 97  ? -14.585 2.406   -12.905 1.00 0.00 ? 97  VAL A HG22 5  
ATOM 9197  H HG23 . VAL A 1 97  ? -15.546 1.498   -11.714 1.00 0.00 ? 97  VAL A HG23 5  
ATOM 9198  N N    . TYR A 1 98  ? -11.992 0.958   -8.478  1.00 0.00 ? 98  TYR A N    5  
ATOM 9199  C CA   . TYR A 1 98  ? -11.091 1.119   -7.349  1.00 0.00 ? 98  TYR A CA   5  
ATOM 9200  C C    . TYR A 1 98  ? -9.732  1.654   -7.805  1.00 0.00 ? 98  TYR A C    5  
ATOM 9201  O O    . TYR A 1 98  ? -9.184  1.195   -8.806  1.00 0.00 ? 98  TYR A O    5  
ATOM 9202  C CB   . TYR A 1 98  ? -10.903 -0.278  -6.756  1.00 0.00 ? 98  TYR A CB   5  
ATOM 9203  C CG   . TYR A 1 98  ? -11.909 -0.628  -5.657  1.00 0.00 ? 98  TYR A CG   5  
ATOM 9204  C CD1  . TYR A 1 98  ? -13.142 -1.149  -5.991  1.00 0.00 ? 98  TYR A CD1  5  
ATOM 9205  C CD2  . TYR A 1 98  ? -11.582 -0.423  -4.332  1.00 0.00 ? 98  TYR A CD2  5  
ATOM 9206  C CE1  . TYR A 1 98  ? -14.089 -1.478  -4.957  1.00 0.00 ? 98  TYR A CE1  5  
ATOM 9207  C CE2  . TYR A 1 98  ? -12.529 -0.752  -3.298  1.00 0.00 ? 98  TYR A CE2  5  
ATOM 9208  C CZ   . TYR A 1 98  ? -13.735 -1.264  -3.662  1.00 0.00 ? 98  TYR A CZ   5  
ATOM 9209  O OH   . TYR A 1 98  ? -14.629 -1.575  -2.685  1.00 0.00 ? 98  TYR A OH   5  
ATOM 9210  H H    . TYR A 1 98  ? -11.720 0.258   -9.139  1.00 0.00 ? 98  TYR A H    5  
ATOM 9211  H HA   . TYR A 1 98  ? -11.542 1.833   -6.660  1.00 0.00 ? 98  TYR A HA   5  
ATOM 9212  H HB2  . TYR A 1 98  ? -10.983 -1.015  -7.556  1.00 0.00 ? 98  TYR A HB2  5  
ATOM 9213  H HB3  . TYR A 1 98  ? -9.895  -0.357  -6.350  1.00 0.00 ? 98  TYR A HB3  5  
ATOM 9214  H HD1  . TYR A 1 98  ? -13.400 -1.311  -7.038  1.00 0.00 ? 98  TYR A HD1  5  
ATOM 9215  H HD2  . TYR A 1 98  ? -10.608 -0.011  -4.069  1.00 0.00 ? 98  TYR A HD2  5  
ATOM 9216  H HE1  . TYR A 1 98  ? -15.066 -1.891  -5.207  1.00 0.00 ? 98  TYR A HE1  5  
ATOM 9217  H HE2  . TYR A 1 98  ? -12.284 -0.595  -2.248  1.00 0.00 ? 98  TYR A HE2  5  
ATOM 9218  H HH   . TYR A 1 98  ? -14.156 -1.683  -1.810  1.00 0.00 ? 98  TYR A HH   5  
ATOM 9219  N N    . LEU A 1 99  ? -9.227  2.617   -7.048  1.00 0.00 ? 99  LEU A N    5  
ATOM 9220  C CA   . LEU A 1 99  ? -7.942  3.219   -7.361  1.00 0.00 ? 99  LEU A CA   5  
ATOM 9221  C C    . LEU A 1 99  ? -6.858  2.576   -6.494  1.00 0.00 ? 99  LEU A C    5  
ATOM 9222  O O    . LEU A 1 99  ? -6.888  2.690   -5.269  1.00 0.00 ? 99  LEU A O    5  
ATOM 9223  C CB   . LEU A 1 99  ? -8.016  4.741   -7.224  1.00 0.00 ? 99  LEU A CB   5  
ATOM 9224  C CG   . LEU A 1 99  ? -6.695  5.495   -7.389  1.00 0.00 ? 99  LEU A CG   5  
ATOM 9225  C CD1  . LEU A 1 99  ? -5.922  5.540   -6.069  1.00 0.00 ? 99  LEU A CD1  5  
ATOM 9226  C CD2  . LEU A 1 99  ? -5.860  4.895   -8.522  1.00 0.00 ? 99  LEU A CD2  5  
ATOM 9227  H H    . LEU A 1 99  ? -9.679  2.985   -6.235  1.00 0.00 ? 99  LEU A H    5  
ATOM 9228  H HA   . LEU A 1 99  ? -7.724  2.999   -8.406  1.00 0.00 ? 99  LEU A HA   5  
ATOM 9229  H HB2  . LEU A 1 99  ? -8.722  5.119   -7.965  1.00 0.00 ? 99  LEU A HB2  5  
ATOM 9230  H HB3  . LEU A 1 99  ? -8.427  4.979   -6.243  1.00 0.00 ? 99  LEU A HB3  5  
ATOM 9231  H HG   . LEU A 1 99  ? -6.921  6.524   -7.665  1.00 0.00 ? 99  LEU A HG   5  
ATOM 9232  H HD11 . LEU A 1 99  ? -5.928  6.558   -5.680  1.00 0.00 ? 99  LEU A HD11 5  
ATOM 9233  H HD12 . LEU A 1 99  ? -6.393  4.872   -5.349  1.00 0.00 ? 99  LEU A HD12 5  
ATOM 9234  H HD13 . LEU A 1 99  ? -4.893  5.223   -6.240  1.00 0.00 ? 99  LEU A HD13 5  
ATOM 9235  H HD21 . LEU A 1 99  ? -6.268  5.213   -9.482  1.00 0.00 ? 99  LEU A HD21 5  
ATOM 9236  H HD22 . LEU A 1 99  ? -4.829  5.238   -8.434  1.00 0.00 ? 99  LEU A HD22 5  
ATOM 9237  H HD23 . LEU A 1 99  ? -5.888  3.808   -8.458  1.00 0.00 ? 99  LEU A HD23 5  
ATOM 9238  N N    . PHE A 1 100 ? -5.925  1.914   -7.163  1.00 0.00 ? 100 PHE A N    5  
ATOM 9239  C CA   . PHE A 1 100 ? -4.833  1.253   -6.469  1.00 0.00 ? 100 PHE A CA   5  
ATOM 9240  C C    . PHE A 1 100 ? -3.546  2.075   -6.562  1.00 0.00 ? 100 PHE A C    5  
ATOM 9241  O O    . PHE A 1 100 ? -2.980  2.228   -7.644  1.00 0.00 ? 100 PHE A O    5  
ATOM 9242  C CB   . PHE A 1 100 ? -4.615  -0.094  -7.160  1.00 0.00 ? 100 PHE A CB   5  
ATOM 9243  C CG   . PHE A 1 100 ? -5.501  -1.220  -6.623  1.00 0.00 ? 100 PHE A CG   5  
ATOM 9244  C CD1  . PHE A 1 100 ? -6.814  -1.277  -6.973  1.00 0.00 ? 100 PHE A CD1  5  
ATOM 9245  C CD2  . PHE A 1 100 ? -4.977  -2.163  -5.796  1.00 0.00 ? 100 PHE A CD2  5  
ATOM 9246  C CE1  . PHE A 1 100 ? -7.637  -2.321  -6.475  1.00 0.00 ? 100 PHE A CE1  5  
ATOM 9247  C CE2  . PHE A 1 100 ? -5.799  -3.208  -5.298  1.00 0.00 ? 100 PHE A CE2  5  
ATOM 9248  C CZ   . PHE A 1 100 ? -7.113  -3.265  -5.648  1.00 0.00 ? 100 PHE A CZ   5  
ATOM 9249  H H    . PHE A 1 100 ? -5.908  1.826   -8.159  1.00 0.00 ? 100 PHE A H    5  
ATOM 9250  H HA   . PHE A 1 100 ? -5.125  1.157   -5.423  1.00 0.00 ? 100 PHE A HA   5  
ATOM 9251  H HB2  . PHE A 1 100 ? -4.800  0.022   -8.228  1.00 0.00 ? 100 PHE A HB2  5  
ATOM 9252  H HB3  . PHE A 1 100 ? -3.570  -0.384  -7.047  1.00 0.00 ? 100 PHE A HB3  5  
ATOM 9253  H HD1  . PHE A 1 100 ? -7.235  -0.520  -7.636  1.00 0.00 ? 100 PHE A HD1  5  
ATOM 9254  H HD2  . PHE A 1 100 ? -3.924  -2.118  -5.516  1.00 0.00 ? 100 PHE A HD2  5  
ATOM 9255  H HE1  . PHE A 1 100 ? -8.690  -2.367  -6.756  1.00 0.00 ? 100 PHE A HE1  5  
ATOM 9256  H HE2  . PHE A 1 100 ? -5.379  -3.964  -4.636  1.00 0.00 ? 100 PHE A HE2  5  
ATOM 9257  H HZ   . PHE A 1 100 ? -7.744  -4.067  -5.266  1.00 0.00 ? 100 PHE A HZ   5  
ATOM 9258  N N    . ARG A 1 101 ? -3.121  2.583   -5.415  1.00 0.00 ? 101 ARG A N    5  
ATOM 9259  C CA   . ARG A 1 101 ? -1.912  3.386   -5.354  1.00 0.00 ? 101 ARG A CA   5  
ATOM 9260  C C    . ARG A 1 101 ? -0.774  2.583   -4.720  1.00 0.00 ? 101 ARG A C    5  
ATOM 9261  O O    . ARG A 1 101 ? -0.846  2.216   -3.548  1.00 0.00 ? 101 ARG A O    5  
ATOM 9262  C CB   . ARG A 1 101 ? -2.139  4.663   -4.543  1.00 0.00 ? 101 ARG A CB   5  
ATOM 9263  C CG   . ARG A 1 101 ? -1.337  5.830   -5.122  1.00 0.00 ? 101 ARG A CG   5  
ATOM 9264  C CD   . ARG A 1 101 ? -2.086  7.152   -4.943  1.00 0.00 ? 101 ARG A CD   5  
ATOM 9265  N NE   . ARG A 1 101 ? -1.234  8.280   -5.385  1.00 0.00 ? 101 ARG A NE   5  
ATOM 9266  C CZ   . ARG A 1 101 ? -0.322  8.881   -4.610  1.00 0.00 ? 101 ARG A CZ   5  
ATOM 9267  N NH1  . ARG A 1 101 ? -0.137  8.467   -3.349  1.00 0.00 ? 101 ARG A NH1  5  
ATOM 9268  N NH2  . ARG A 1 101 ? 0.405   9.897   -5.095  1.00 0.00 ? 101 ARG A NH2  5  
ATOM 9269  H H    . ARG A 1 101 ? -3.588  2.454   -4.539  1.00 0.00 ? 101 ARG A H    5  
ATOM 9270  H HA   . ARG A 1 101 ? -1.688  3.632   -6.391  1.00 0.00 ? 101 ARG A HA   5  
ATOM 9271  H HB2  . ARG A 1 101 ? -3.200  4.913   -4.540  1.00 0.00 ? 101 ARG A HB2  5  
ATOM 9272  H HB3  . ARG A 1 101 ? -1.848  4.497   -3.506  1.00 0.00 ? 101 ARG A HB3  5  
ATOM 9273  H HG2  . ARG A 1 101 ? -0.366  5.888   -4.630  1.00 0.00 ? 101 ARG A HG2  5  
ATOM 9274  H HG3  . ARG A 1 101 ? -1.147  5.656   -6.181  1.00 0.00 ? 101 ARG A HG3  5  
ATOM 9275  H HD2  . ARG A 1 101 ? -3.011  7.137   -5.519  1.00 0.00 ? 101 ARG A HD2  5  
ATOM 9276  H HD3  . ARG A 1 101 ? -2.364  7.284   -3.898  1.00 0.00 ? 101 ARG A HD3  5  
ATOM 9277  H HE   . ARG A 1 101 ? -1.347  8.614   -6.321  1.00 0.00 ? 101 ARG A HE   5  
ATOM 9278  H HH11 . ARG A 1 101 ? -0.680  7.709   -2.986  1.00 0.00 ? 101 ARG A HH11 5  
ATOM 9279  H HH12 . ARG A 1 101 ? 0.544   8.916   -2.770  1.00 0.00 ? 101 ARG A HH12 5  
ATOM 9280  H HH21 . ARG A 1 101 ? 0.267   10.206  -6.036  1.00 0.00 ? 101 ARG A HH21 5  
ATOM 9281  H HH22 . ARG A 1 101 ? 1.086   10.346  -4.516  1.00 0.00 ? 101 ARG A HH22 5  
ATOM 9282  N N    . ILE A 1 102 ? 0.251   2.334   -5.522  1.00 0.00 ? 102 ILE A N    5  
ATOM 9283  C CA   . ILE A 1 102 ? 1.402   1.582   -5.054  1.00 0.00 ? 102 ILE A CA   5  
ATOM 9284  C C    . ILE A 1 102 ? 2.530   2.553   -4.698  1.00 0.00 ? 102 ILE A C    5  
ATOM 9285  O O    . ILE A 1 102 ? 2.758   3.532   -5.407  1.00 0.00 ? 102 ILE A O    5  
ATOM 9286  C CB   . ILE A 1 102 ? 1.805   0.524   -6.083  1.00 0.00 ? 102 ILE A CB   5  
ATOM 9287  C CG1  . ILE A 1 102 ? 0.704   -0.525  -6.251  1.00 0.00 ? 102 ILE A CG1  5  
ATOM 9288  C CG2  . ILE A 1 102 ? 3.150   -0.110  -5.721  1.00 0.00 ? 102 ILE A CG2  5  
ATOM 9289  C CD1  . ILE A 1 102 ? 0.692   -1.085  -7.674  1.00 0.00 ? 102 ILE A CD1  5  
ATOM 9290  H H    . ILE A 1 102 ? 0.301   2.636   -6.474  1.00 0.00 ? 102 ILE A H    5  
ATOM 9291  H HA   . ILE A 1 102 ? 1.102   1.054   -4.150  1.00 0.00 ? 102 ILE A HA   5  
ATOM 9292  H HB   . ILE A 1 102 ? 1.930   1.015   -7.048  1.00 0.00 ? 102 ILE A HB   5  
ATOM 9293  H HG12 . ILE A 1 102 ? 0.857   -1.336  -5.538  1.00 0.00 ? 102 ILE A HG12 5  
ATOM 9294  H HG13 . ILE A 1 102 ? -0.265  -0.080  -6.023  1.00 0.00 ? 102 ILE A HG13 5  
ATOM 9295  H HG21 . ILE A 1 102 ? 3.798   0.644   -5.274  1.00 0.00 ? 102 ILE A HG21 5  
ATOM 9296  H HG22 . ILE A 1 102 ? 2.990   -0.920  -5.009  1.00 0.00 ? 102 ILE A HG22 5  
ATOM 9297  H HG23 . ILE A 1 102 ? 3.619   -0.505  -6.621  1.00 0.00 ? 102 ILE A HG23 5  
ATOM 9298  H HD11 . ILE A 1 102 ? -0.319  -1.027  -8.079  1.00 0.00 ? 102 ILE A HD11 5  
ATOM 9299  H HD12 . ILE A 1 102 ? 1.368   -0.503  -8.300  1.00 0.00 ? 102 ILE A HD12 5  
ATOM 9300  H HD13 . ILE A 1 102 ? 1.017   -2.126  -7.658  1.00 0.00 ? 102 ILE A HD13 5  
ATOM 9301  N N    . THR A 1 103 ? 3.204   2.248   -3.599  1.00 0.00 ? 103 THR A N    5  
ATOM 9302  C CA   . THR A 1 103 ? 4.302   3.082   -3.140  1.00 0.00 ? 103 THR A CA   5  
ATOM 9303  C C    . THR A 1 103 ? 5.359   2.231   -2.433  1.00 0.00 ? 103 THR A C    5  
ATOM 9304  O O    . THR A 1 103 ? 5.070   1.122   -1.985  1.00 0.00 ? 103 THR A O    5  
ATOM 9305  C CB   . THR A 1 103 ? 3.720   4.185   -2.254  1.00 0.00 ? 103 THR A CB   5  
ATOM 9306  O OG1  . THR A 1 103 ? 2.529   4.581   -2.930  1.00 0.00 ? 103 THR A OG1  5  
ATOM 9307  C CG2  . THR A 1 103 ? 4.583   5.449   -2.248  1.00 0.00 ? 103 THR A CG2  5  
ATOM 9308  H H    . THR A 1 103 ? 3.012   1.451   -3.028  1.00 0.00 ? 103 THR A H    5  
ATOM 9309  H HA   . THR A 1 103 ? 4.781   3.529   -4.010  1.00 0.00 ? 103 THR A HA   5  
ATOM 9310  H HB   . THR A 1 103 ? 3.553   3.823   -1.240  1.00 0.00 ? 103 THR A HB   5  
ATOM 9311  H HG1  . THR A 1 103 ? 2.017   5.231   -2.369  1.00 0.00 ? 103 THR A HG1  5  
ATOM 9312  H HG21 . THR A 1 103 ? 5.570   5.212   -1.851  1.00 0.00 ? 103 THR A HG21 5  
ATOM 9313  H HG22 . THR A 1 103 ? 4.681   5.826   -3.266  1.00 0.00 ? 103 THR A HG22 5  
ATOM 9314  H HG23 . THR A 1 103 ? 4.112   6.208   -1.623  1.00 0.00 ? 103 THR A HG23 5  
ATOM 9315  N N    . ALA A 1 104 ? 6.562   2.781   -2.356  1.00 0.00 ? 104 ALA A N    5  
ATOM 9316  C CA   . ALA A 1 104 ? 7.663   2.086   -1.712  1.00 0.00 ? 104 ALA A CA   5  
ATOM 9317  C C    . ALA A 1 104 ? 8.061   2.838   -0.441  1.00 0.00 ? 104 ALA A C    5  
ATOM 9318  O O    . ALA A 1 104 ? 7.748   4.018   -0.289  1.00 0.00 ? 104 ALA A O    5  
ATOM 9319  C CB   . ALA A 1 104 ? 8.826   1.949   -2.697  1.00 0.00 ? 104 ALA A CB   5  
ATOM 9320  H H    . ALA A 1 104 ? 6.788   3.683   -2.724  1.00 0.00 ? 104 ALA A H    5  
ATOM 9321  H HA   . ALA A 1 104 ? 7.314   1.090   -1.441  1.00 0.00 ? 104 ALA A HA   5  
ATOM 9322  H HB1  . ALA A 1 104 ? 9.742   1.729   -2.149  1.00 0.00 ? 104 ALA A HB1  5  
ATOM 9323  H HB2  . ALA A 1 104 ? 8.617   1.139   -3.396  1.00 0.00 ? 104 ALA A HB2  5  
ATOM 9324  H HB3  . ALA A 1 104 ? 8.947   2.881   -3.248  1.00 0.00 ? 104 ALA A HB3  5  
ATOM 9325  N N    . GLN A 1 105 ? 8.746   2.124   0.441   1.00 0.00 ? 105 GLN A N    5  
ATOM 9326  C CA   . GLN A 1 105 ? 9.191   2.710   1.694   1.00 0.00 ? 105 GLN A CA   5  
ATOM 9327  C C    . GLN A 1 105 ? 10.708  2.570   1.837   1.00 0.00 ? 105 GLN A C    5  
ATOM 9328  O O    . GLN A 1 105 ? 11.237  1.460   1.810   1.00 0.00 ? 105 GLN A O    5  
ATOM 9329  C CB   . GLN A 1 105 ? 8.467   2.074   2.883   1.00 0.00 ? 105 GLN A CB   5  
ATOM 9330  C CG   . GLN A 1 105 ? 8.963   2.663   4.205   1.00 0.00 ? 105 GLN A CG   5  
ATOM 9331  C CD   . GLN A 1 105 ? 8.609   1.748   5.379   1.00 0.00 ? 105 GLN A CD   5  
ATOM 9332  O OE1  . GLN A 1 105 ? 8.814   0.546   5.347   1.00 0.00 ? 105 GLN A OE1  5  
ATOM 9333  N NE2  . GLN A 1 105 ? 8.069   2.382   6.416   1.00 0.00 ? 105 GLN A NE2  5  
ATOM 9334  H H    . GLN A 1 105 ? 8.997   1.165   0.310   1.00 0.00 ? 105 GLN A H    5  
ATOM 9335  H HA   . GLN A 1 105 ? 8.920   3.764   1.634   1.00 0.00 ? 105 GLN A HA   5  
ATOM 9336  H HB2  . GLN A 1 105 ? 7.393   2.236   2.789   1.00 0.00 ? 105 GLN A HB2  5  
ATOM 9337  H HB3  . GLN A 1 105 ? 8.628   0.996   2.877   1.00 0.00 ? 105 GLN A HB3  5  
ATOM 9338  H HG2  . GLN A 1 105 ? 10.043  2.804   4.162   1.00 0.00 ? 105 GLN A HG2  5  
ATOM 9339  H HG3  . GLN A 1 105 ? 8.518   3.646   4.359   1.00 0.00 ? 105 GLN A HG3  5  
ATOM 9340  H HE21 . GLN A 1 105 ? 7.928   3.372   6.378   1.00 0.00 ? 105 GLN A HE21 5  
ATOM 9341  H HE22 . GLN A 1 105 ? 7.803   1.870   7.233   1.00 0.00 ? 105 GLN A HE22 5  
ATOM 9342  N N    . THR A 1 106 ? 11.364  3.711   1.986   1.00 0.00 ? 106 THR A N    5  
ATOM 9343  C CA   . THR A 1 106 ? 12.809  3.730   2.133   1.00 0.00 ? 106 THR A CA   5  
ATOM 9344  C C    . THR A 1 106 ? 13.204  4.444   3.427   1.00 0.00 ? 106 THR A C    5  
ATOM 9345  O O    . THR A 1 106 ? 12.357  4.707   4.279   1.00 0.00 ? 106 THR A O    5  
ATOM 9346  C CB   . THR A 1 106 ? 13.404  4.373   0.878   1.00 0.00 ? 106 THR A CB   5  
ATOM 9347  O OG1  . THR A 1 106 ? 12.542  5.476   0.611   1.00 0.00 ? 106 THR A OG1  5  
ATOM 9348  C CG2  . THR A 1 106 ? 13.264  3.482   -0.358  1.00 0.00 ? 106 THR A CG2  5  
ATOM 9349  H H    . THR A 1 106 ? 10.925  4.610   2.006   1.00 0.00 ? 106 THR A H    5  
ATOM 9350  H HA   . THR A 1 106 ? 13.159  2.701   2.216   1.00 0.00 ? 106 THR A HA   5  
ATOM 9351  H HB   . THR A 1 106 ? 14.444  4.653   1.040   1.00 0.00 ? 106 THR A HB   5  
ATOM 9352  H HG1  . THR A 1 106 ? 11.662  5.147   0.267   1.00 0.00 ? 106 THR A HG1  5  
ATOM 9353  H HG21 . THR A 1 106 ? 14.018  2.696   -0.327  1.00 0.00 ? 106 THR A HG21 5  
ATOM 9354  H HG22 . THR A 1 106 ? 12.271  3.033   -0.372  1.00 0.00 ? 106 THR A HG22 5  
ATOM 9355  H HG23 . THR A 1 106 ? 13.402  4.084   -1.257  1.00 0.00 ? 106 THR A HG23 5  
ATOM 9356  N N    . ARG A 1 107 ? 14.492  4.738   3.533   1.00 0.00 ? 107 ARG A N    5  
ATOM 9357  C CA   . ARG A 1 107 ? 15.009  5.417   4.709   1.00 0.00 ? 107 ARG A CA   5  
ATOM 9358  C C    . ARG A 1 107 ? 14.624  6.898   4.680   1.00 0.00 ? 107 ARG A C    5  
ATOM 9359  O O    . ARG A 1 107 ? 14.764  7.599   5.681   1.00 0.00 ? 107 ARG A O    5  
ATOM 9360  C CB   . ARG A 1 107 ? 16.532  5.295   4.790   1.00 0.00 ? 107 ARG A CB   5  
ATOM 9361  C CG   . ARG A 1 107 ? 17.206  6.091   3.670   1.00 0.00 ? 107 ARG A CG   5  
ATOM 9362  C CD   . ARG A 1 107 ? 18.720  5.867   3.673   1.00 0.00 ? 107 ARG A CD   5  
ATOM 9363  N NE   . ARG A 1 107 ? 19.424  7.169   3.676   1.00 0.00 ? 107 ARG A NE   5  
ATOM 9364  C CZ   . ARG A 1 107 ? 19.634  7.907   4.774   1.00 0.00 ? 107 ARG A CZ   5  
ATOM 9365  N NH1  . ARG A 1 107 ? 19.196  7.476   5.965   1.00 0.00 ? 107 ARG A NH1  5  
ATOM 9366  N NH2  . ARG A 1 107 ? 20.282  9.076   4.682   1.00 0.00 ? 107 ARG A NH2  5  
ATOM 9367  H H    . ARG A 1 107 ? 15.174  4.521   2.836   1.00 0.00 ? 107 ARG A H    5  
ATOM 9368  H HA   . ARG A 1 107 ? 14.544  4.907   5.553   1.00 0.00 ? 107 ARG A HA   5  
ATOM 9369  H HB2  . ARG A 1 107 ? 16.879  5.657   5.758   1.00 0.00 ? 107 ARG A HB2  5  
ATOM 9370  H HB3  . ARG A 1 107 ? 16.821  4.246   4.719   1.00 0.00 ? 107 ARG A HB3  5  
ATOM 9371  H HG2  . ARG A 1 107 ? 16.792  5.793   2.707   1.00 0.00 ? 107 ARG A HG2  5  
ATOM 9372  H HG3  . ARG A 1 107 ? 16.992  7.153   3.794   1.00 0.00 ? 107 ARG A HG3  5  
ATOM 9373  H HD2  . ARG A 1 107 ? 19.008  5.287   4.549   1.00 0.00 ? 107 ARG A HD2  5  
ATOM 9374  H HD3  . ARG A 1 107 ? 19.012  5.289   2.797   1.00 0.00 ? 107 ARG A HD3  5  
ATOM 9375  H HE   . ARG A 1 107 ? 19.764  7.520   2.803   1.00 0.00 ? 107 ARG A HE   5  
ATOM 9376  H HH11 . ARG A 1 107 ? 18.712  6.604   6.034   1.00 0.00 ? 107 ARG A HH11 5  
ATOM 9377  H HH12 . ARG A 1 107 ? 19.352  8.027   6.785   1.00 0.00 ? 107 ARG A HH12 5  
ATOM 9378  H HH21 . ARG A 1 107 ? 20.610  9.398   3.793   1.00 0.00 ? 107 ARG A HH21 5  
ATOM 9379  H HH22 . ARG A 1 107 ? 20.439  9.627   5.502   1.00 0.00 ? 107 ARG A HH22 5  
ATOM 9380  N N    . LYS A 1 108 ? 14.146  7.329   3.522   1.00 0.00 ? 108 LYS A N    5  
ATOM 9381  C CA   . LYS A 1 108 ? 13.740  8.714   3.350   1.00 0.00 ? 108 LYS A CA   5  
ATOM 9382  C C    . LYS A 1 108 ? 12.252  8.849   3.680   1.00 0.00 ? 108 LYS A C    5  
ATOM 9383  O O    . LYS A 1 108 ? 11.848  9.786   4.366   1.00 0.00 ? 108 LYS A O    5  
ATOM 9384  C CB   . LYS A 1 108 ? 14.106  9.209   1.949   1.00 0.00 ? 108 LYS A CB   5  
ATOM 9385  C CG   . LYS A 1 108 ? 15.546  8.832   1.593   1.00 0.00 ? 108 LYS A CG   5  
ATOM 9386  C CD   . LYS A 1 108 ? 16.536  9.458   2.577   1.00 0.00 ? 108 LYS A CD   5  
ATOM 9387  C CE   . LYS A 1 108 ? 16.536  10.983  2.458   1.00 0.00 ? 108 LYS A CE   5  
ATOM 9388  N NZ   . LYS A 1 108 ? 17.821  11.459  1.898   1.00 0.00 ? 108 LYS A NZ   5  
ATOM 9389  H H    . LYS A 1 108 ? 14.036  6.752   2.713   1.00 0.00 ? 108 LYS A H    5  
ATOM 9390  H HA   . LYS A 1 108 ? 14.308  9.312   4.062   1.00 0.00 ? 108 LYS A HA   5  
ATOM 9391  H HB2  . LYS A 1 108 ? 13.422  8.780   1.217   1.00 0.00 ? 108 LYS A HB2  5  
ATOM 9392  H HB3  . LYS A 1 108 ? 13.987  10.291  1.900   1.00 0.00 ? 108 LYS A HB3  5  
ATOM 9393  H HG2  . LYS A 1 108 ? 15.654  7.747   1.604   1.00 0.00 ? 108 LYS A HG2  5  
ATOM 9394  H HG3  . LYS A 1 108 ? 15.773  9.165   0.581   1.00 0.00 ? 108 LYS A HG3  5  
ATOM 9395  H HD2  . LYS A 1 108 ? 16.275  9.169   3.595   1.00 0.00 ? 108 LYS A HD2  5  
ATOM 9396  H HD3  . LYS A 1 108 ? 17.538  9.075   2.384   1.00 0.00 ? 108 LYS A HD3  5  
ATOM 9397  H HE2  . LYS A 1 108 ? 15.713  11.304  1.820   1.00 0.00 ? 108 LYS A HE2  5  
ATOM 9398  H HE3  . LYS A 1 108 ? 16.372  11.431  3.439   1.00 0.00 ? 108 LYS A HE3  5  
ATOM 9399  H HZ1  . LYS A 1 108 ? 18.059  12.338  2.311   1.00 0.00 ? 108 LYS A HZ1  5  
ATOM 9400  H HZ2  . LYS A 1 108 ? 18.539  10.792  2.096   1.00 0.00 ? 108 LYS A HZ2  5  
ATOM 9401  H HZ3  . LYS A 1 108 ? 17.732  11.570  0.908   1.00 0.00 ? 108 LYS A HZ3  5  
ATOM 9402  N N    . GLY A 1 109 ? 11.478  7.898   3.176   1.00 0.00 ? 109 GLY A N    5  
ATOM 9403  C CA   . GLY A 1 109 ? 10.044  7.900   3.409   1.00 0.00 ? 109 GLY A CA   5  
ATOM 9404  C C    . GLY A 1 109 ? 9.308   7.145   2.301   1.00 0.00 ? 109 GLY A C    5  
ATOM 9405  O O    . GLY A 1 109 ? 9.647   6.004   1.991   1.00 0.00 ? 109 GLY A O    5  
ATOM 9406  H H    . GLY A 1 109 ? 11.815  7.139   2.619   1.00 0.00 ? 109 GLY A H    5  
ATOM 9407  H HA2  . GLY A 1 109 ? 9.828   7.439   4.373   1.00 0.00 ? 109 GLY A HA2  5  
ATOM 9408  H HA3  . GLY A 1 109 ? 9.681   8.926   3.459   1.00 0.00 ? 109 GLY A HA3  5  
ATOM 9409  N N    . TRP A 1 110 ? 8.314   7.813   1.733   1.00 0.00 ? 110 TRP A N    5  
ATOM 9410  C CA   . TRP A 1 110 ? 7.527   7.219   0.666   1.00 0.00 ? 110 TRP A CA   5  
ATOM 9411  C C    . TRP A 1 110 ? 7.665   8.107   -0.573  1.00 0.00 ? 110 TRP A C    5  
ATOM 9412  O O    . TRP A 1 110 ? 7.210   9.250   -0.575  1.00 0.00 ? 110 TRP A O    5  
ATOM 9413  C CB   . TRP A 1 110 ? 6.073   7.022   1.101   1.00 0.00 ? 110 TRP A CB   5  
ATOM 9414  C CG   . TRP A 1 110 ? 5.897   6.025   2.248   1.00 0.00 ? 110 TRP A CG   5  
ATOM 9415  C CD1  . TRP A 1 110 ? 5.967   6.262   3.565   1.00 0.00 ? 110 TRP A CD1  5  
ATOM 9416  C CD2  . TRP A 1 110 ? 5.617   4.614   2.126   1.00 0.00 ? 110 TRP A CD2  5  
ATOM 9417  N NE1  . TRP A 1 110 ? 5.753   5.113   4.298   1.00 0.00 ? 110 TRP A NE1  5  
ATOM 9418  C CE2  . TRP A 1 110 ? 5.534   4.079   3.395   1.00 0.00 ? 110 TRP A CE2  5  
ATOM 9419  C CE3  . TRP A 1 110 ? 5.440   3.818   0.982   1.00 0.00 ? 110 TRP A CE3  5  
ATOM 9420  C CZ2  . TRP A 1 110 ? 5.272   2.725   3.641   1.00 0.00 ? 110 TRP A CZ2  5  
ATOM 9421  C CZ3  . TRP A 1 110 ? 5.179   2.467   1.244   1.00 0.00 ? 110 TRP A CZ3  5  
ATOM 9422  C CH2  . TRP A 1 110 ? 5.092   1.912   2.515   1.00 0.00 ? 110 TRP A CH2  5  
ATOM 9423  H H    . TRP A 1 110 ? 8.044   8.740   1.992   1.00 0.00 ? 110 TRP A H    5  
ATOM 9424  H HA   . TRP A 1 110 ? 7.934   6.229   0.462   1.00 0.00 ? 110 TRP A HA   5  
ATOM 9425  H HB2  . TRP A 1 110 ? 5.661   7.985   1.403   1.00 0.00 ? 110 TRP A HB2  5  
ATOM 9426  H HB3  . TRP A 1 110 ? 5.492   6.681   0.244   1.00 0.00 ? 110 TRP A HB3  5  
ATOM 9427  H HD1  . TRP A 1 110 ? 6.167   7.240   4.003   1.00 0.00 ? 110 TRP A HD1  5  
ATOM 9428  H HE1  . TRP A 1 110 ? 5.756   5.030   5.385   1.00 0.00 ? 110 TRP A HE1  5  
ATOM 9429  H HE3  . TRP A 1 110 ? 5.501   4.217   -0.031  1.00 0.00 ? 110 TRP A HE3  5  
ATOM 9430  H HZ2  . TRP A 1 110 ? 5.211   2.327   4.653   1.00 0.00 ? 110 TRP A HZ2  5  
ATOM 9431  H HZ3  . TRP A 1 110 ? 5.034   1.804   0.391   1.00 0.00 ? 110 TRP A HZ3  5  
ATOM 9432  H HH2  . TRP A 1 110 ? 4.885   0.849   2.635   1.00 0.00 ? 110 TRP A HH2  5  
ATOM 9433  N N    . GLY A 1 111 ? 8.294   7.547   -1.595  1.00 0.00 ? 111 GLY A N    5  
ATOM 9434  C CA   . GLY A 1 111 ? 8.497   8.274   -2.837  1.00 0.00 ? 111 GLY A CA   5  
ATOM 9435  C C    . GLY A 1 111 ? 7.220   8.290   -3.679  1.00 0.00 ? 111 GLY A C    5  
ATOM 9436  O O    . GLY A 1 111 ? 6.121   8.136   -3.148  1.00 0.00 ? 111 GLY A O    5  
ATOM 9437  H H    . GLY A 1 111 ? 8.661   6.617   -1.585  1.00 0.00 ? 111 GLY A H    5  
ATOM 9438  H HA2  . GLY A 1 111 ? 8.806   9.296   -2.618  1.00 0.00 ? 111 GLY A HA2  5  
ATOM 9439  H HA3  . GLY A 1 111 ? 9.305   7.812   -3.405  1.00 0.00 ? 111 GLY A HA3  5  
ATOM 9440  N N    . GLU A 1 112 ? 7.407   8.476   -4.977  1.00 0.00 ? 112 GLU A N    5  
ATOM 9441  C CA   . GLU A 1 112 ? 6.283   8.514   -5.897  1.00 0.00 ? 112 GLU A CA   5  
ATOM 9442  C C    . GLU A 1 112 ? 5.389   7.289   -5.694  1.00 0.00 ? 112 GLU A C    5  
ATOM 9443  O O    . GLU A 1 112 ? 5.806   6.307   -5.081  1.00 0.00 ? 112 GLU A O    5  
ATOM 9444  C CB   . GLU A 1 112 ? 6.764   8.608   -7.347  1.00 0.00 ? 112 GLU A CB   5  
ATOM 9445  C CG   . GLU A 1 112 ? 6.250   9.886   -8.013  1.00 0.00 ? 112 GLU A CG   5  
ATOM 9446  C CD   . GLU A 1 112 ? 7.371   10.916  -8.162  1.00 0.00 ? 112 GLU A CD   5  
ATOM 9447  O OE1  . GLU A 1 112 ? 7.553   11.699  -7.206  1.00 0.00 ? 112 GLU A OE1  5  
ATOM 9448  O OE2  . GLU A 1 112 ? 8.021   10.896  -9.230  1.00 0.00 ? 112 GLU A OE2  5  
ATOM 9449  H H    . GLU A 1 112 ? 8.304   8.600   -5.401  1.00 0.00 ? 112 GLU A H    5  
ATOM 9450  H HA   . GLU A 1 112 ? 5.732   9.420   -5.644  1.00 0.00 ? 112 GLU A HA   5  
ATOM 9451  H HB2  . GLU A 1 112 ? 7.853   8.593   -7.374  1.00 0.00 ? 112 GLU A HB2  5  
ATOM 9452  H HB3  . GLU A 1 112 ? 6.419   7.738   -7.905  1.00 0.00 ? 112 GLU A HB3  5  
ATOM 9453  H HG2  . GLU A 1 112 ? 5.837   9.648   -8.993  1.00 0.00 ? 112 GLU A HG2  5  
ATOM 9454  H HG3  . GLU A 1 112 ? 5.439   10.309  -7.420  1.00 0.00 ? 112 GLU A HG3  5  
ATOM 9455  N N    . ALA A 1 113 ? 4.178   7.386   -6.222  1.00 0.00 ? 113 ALA A N    5  
ATOM 9456  C CA   . ALA A 1 113 ? 3.222   6.298   -6.106  1.00 0.00 ? 113 ALA A CA   5  
ATOM 9457  C C    . ALA A 1 113 ? 2.533   6.084   -7.456  1.00 0.00 ? 113 ALA A C    5  
ATOM 9458  O O    . ALA A 1 113 ? 2.212   7.046   -8.151  1.00 0.00 ? 113 ALA A O    5  
ATOM 9459  C CB   . ALA A 1 113 ? 2.227   6.609   -4.986  1.00 0.00 ? 113 ALA A CB   5  
ATOM 9460  H H    . ALA A 1 113 ? 3.847   8.188   -6.719  1.00 0.00 ? 113 ALA A H    5  
ATOM 9461  H HA   . ALA A 1 113 ? 3.776   5.396   -5.844  1.00 0.00 ? 113 ALA A HA   5  
ATOM 9462  H HB1  . ALA A 1 113 ? 1.470   7.301   -5.355  1.00 0.00 ? 113 ALA A HB1  5  
ATOM 9463  H HB2  . ALA A 1 113 ? 1.747   5.686   -4.660  1.00 0.00 ? 113 ALA A HB2  5  
ATOM 9464  H HB3  . ALA A 1 113 ? 2.755   7.060   -4.146  1.00 0.00 ? 113 ALA A HB3  5  
ATOM 9465  N N    . ALA A 1 114 ? 2.327   4.818   -7.785  1.00 0.00 ? 114 ALA A N    5  
ATOM 9466  C CA   . ALA A 1 114 ? 1.682   4.466   -9.039  1.00 0.00 ? 114 ALA A CA   5  
ATOM 9467  C C    . ALA A 1 114 ? 0.186   4.257   -8.796  1.00 0.00 ? 114 ALA A C    5  
ATOM 9468  O O    . ALA A 1 114 ? -0.205  3.409   -7.996  1.00 0.00 ? 114 ALA A O    5  
ATOM 9469  C CB   . ALA A 1 114 ? 2.356   3.226   -9.629  1.00 0.00 ? 114 ALA A CB   5  
ATOM 9470  H H    . ALA A 1 114 ? 2.591   4.041   -7.213  1.00 0.00 ? 114 ALA A H    5  
ATOM 9471  H HA   . ALA A 1 114 ? 1.817   5.300   -9.727  1.00 0.00 ? 114 ALA A HA   5  
ATOM 9472  H HB1  . ALA A 1 114 ? 2.339   2.419   -8.896  1.00 0.00 ? 114 ALA A HB1  5  
ATOM 9473  H HB2  . ALA A 1 114 ? 1.820   2.913   -10.525 1.00 0.00 ? 114 ALA A HB2  5  
ATOM 9474  H HB3  . ALA A 1 114 ? 3.388   3.461   -9.887  1.00 0.00 ? 114 ALA A HB3  5  
ATOM 9475  N N    . GLU A 1 115 ? -0.611  5.045   -9.503  1.00 0.00 ? 115 GLU A N    5  
ATOM 9476  C CA   . GLU A 1 115 ? -2.056  4.957   -9.375  1.00 0.00 ? 115 GLU A CA   5  
ATOM 9477  C C    . GLU A 1 115 ? -2.642  4.137   -10.526 1.00 0.00 ? 115 GLU A C    5  
ATOM 9478  O O    . GLU A 1 115 ? -2.460  4.481   -11.693 1.00 0.00 ? 115 GLU A O    5  
ATOM 9479  C CB   . GLU A 1 115 ? -2.687  6.349   -9.317  1.00 0.00 ? 115 GLU A CB   5  
ATOM 9480  C CG   . GLU A 1 115 ? -2.969  6.763   -7.871  1.00 0.00 ? 115 GLU A CG   5  
ATOM 9481  C CD   . GLU A 1 115 ? -4.011  7.882   -7.815  1.00 0.00 ? 115 GLU A CD   5  
ATOM 9482  O OE1  . GLU A 1 115 ? -4.952  7.824   -8.636  1.00 0.00 ? 115 GLU A OE1  5  
ATOM 9483  O OE2  . GLU A 1 115 ? -3.843  8.771   -6.952  1.00 0.00 ? 115 GLU A OE2  5  
ATOM 9484  H H    . GLU A 1 115 ? -0.285  5.732   -10.152 1.00 0.00 ? 115 GLU A H    5  
ATOM 9485  H HA   . GLU A 1 115 ? -2.232  4.445   -8.429  1.00 0.00 ? 115 GLU A HA   5  
ATOM 9486  H HB2  . GLU A 1 115 ? -2.020  7.075   -9.783  1.00 0.00 ? 115 GLU A HB2  5  
ATOM 9487  H HB3  . GLU A 1 115 ? -3.615  6.356   -9.889  1.00 0.00 ? 115 GLU A HB3  5  
ATOM 9488  H HG2  . GLU A 1 115 ? -3.324  5.902   -7.305  1.00 0.00 ? 115 GLU A HG2  5  
ATOM 9489  H HG3  . GLU A 1 115 ? -2.046  7.097   -7.398  1.00 0.00 ? 115 GLU A HG3  5  
ATOM 9490  N N    . ALA A 1 116 ? -3.334  3.069   -10.158 1.00 0.00 ? 116 ALA A N    5  
ATOM 9491  C CA   . ALA A 1 116 ? -3.947  2.197   -11.146 1.00 0.00 ? 116 ALA A CA   5  
ATOM 9492  C C    . ALA A 1 116 ? -5.395  1.914   -10.740 1.00 0.00 ? 116 ALA A C    5  
ATOM 9493  O O    . ALA A 1 116 ? -5.657  1.493   -9.614  1.00 0.00 ? 116 ALA A O    5  
ATOM 9494  C CB   . ALA A 1 116 ? -3.119  0.918   -11.283 1.00 0.00 ? 116 ALA A CB   5  
ATOM 9495  H H    . ALA A 1 116 ? -3.477  2.796   -9.207  1.00 0.00 ? 116 ALA A H    5  
ATOM 9496  H HA   . ALA A 1 116 ? -3.943  2.723   -12.100 1.00 0.00 ? 116 ALA A HA   5  
ATOM 9497  H HB1  . ALA A 1 116 ? -3.022  0.660   -12.338 1.00 0.00 ? 116 ALA A HB1  5  
ATOM 9498  H HB2  . ALA A 1 116 ? -2.129  1.079   -10.856 1.00 0.00 ? 116 ALA A HB2  5  
ATOM 9499  H HB3  . ALA A 1 116 ? -3.616  0.105   -10.753 1.00 0.00 ? 116 ALA A HB3  5  
ATOM 9500  N N    . LEU A 1 117 ? -6.298  2.155   -11.679 1.00 0.00 ? 117 LEU A N    5  
ATOM 9501  C CA   . LEU A 1 117 ? -7.712  1.931   -11.433 1.00 0.00 ? 117 LEU A CA   5  
ATOM 9502  C C    . LEU A 1 117 ? -8.090  0.525   -11.903 1.00 0.00 ? 117 LEU A C    5  
ATOM 9503  O O    . LEU A 1 117 ? -7.505  0.005   -12.852 1.00 0.00 ? 117 LEU A O    5  
ATOM 9504  C CB   . LEU A 1 117 ? -8.549  3.040   -12.074 1.00 0.00 ? 117 LEU A CB   5  
ATOM 9505  C CG   . LEU A 1 117 ? -8.593  4.369   -11.318 1.00 0.00 ? 117 LEU A CG   5  
ATOM 9506  C CD1  . LEU A 1 117 ? -8.510  5.552   -12.284 1.00 0.00 ? 117 LEU A CD1  5  
ATOM 9507  C CD2  . LEU A 1 117 ? -9.829  4.449   -10.419 1.00 0.00 ? 117 LEU A CD2  5  
ATOM 9508  H H    . LEU A 1 117 ? -6.076  2.497   -12.592 1.00 0.00 ? 117 LEU A H    5  
ATOM 9509  H HA   . LEU A 1 117 ? -7.870  1.989   -10.356 1.00 0.00 ? 117 LEU A HA   5  
ATOM 9510  H HB2  . LEU A 1 117 ? -8.163  3.227   -13.076 1.00 0.00 ? 117 LEU A HB2  5  
ATOM 9511  H HB3  . LEU A 1 117 ? -9.571  2.676   -12.188 1.00 0.00 ? 117 LEU A HB3  5  
ATOM 9512  H HG   . LEU A 1 117 ? -7.719  4.422   -10.669 1.00 0.00 ? 117 LEU A HG   5  
ATOM 9513  H HD11 . LEU A 1 117 ? -7.528  5.566   -12.758 1.00 0.00 ? 117 LEU A HD11 5  
ATOM 9514  H HD12 . LEU A 1 117 ? -9.281  5.452   -13.049 1.00 0.00 ? 117 LEU A HD12 5  
ATOM 9515  H HD13 . LEU A 1 117 ? -8.661  6.482   -11.735 1.00 0.00 ? 117 LEU A HD13 5  
ATOM 9516  H HD21 . LEU A 1 117 ? -9.853  5.418   -9.920  1.00 0.00 ? 117 LEU A HD21 5  
ATOM 9517  H HD22 . LEU A 1 117 ? -10.727 4.330   -11.025 1.00 0.00 ? 117 LEU A HD22 5  
ATOM 9518  H HD23 . LEU A 1 117 ? -9.786  3.656   -9.672  1.00 0.00 ? 117 LEU A HD23 5  
ATOM 9519  N N    . VAL A 1 118 ? -9.067  -0.051  -11.217 1.00 0.00 ? 118 VAL A N    5  
ATOM 9520  C CA   . VAL A 1 118 ? -9.530  -1.387  -11.553 1.00 0.00 ? 118 VAL A CA   5  
ATOM 9521  C C    . VAL A 1 118 ? -10.991 -1.537  -11.125 1.00 0.00 ? 118 VAL A C    5  
ATOM 9522  O O    . VAL A 1 118 ? -11.332 -1.292  -9.969  1.00 0.00 ? 118 VAL A O    5  
ATOM 9523  C CB   . VAL A 1 118 ? -8.611  -2.433  -10.920 1.00 0.00 ? 118 VAL A CB   5  
ATOM 9524  C CG1  . VAL A 1 118 ? -8.536  -2.252  -9.403  1.00 0.00 ? 118 VAL A CG1  5  
ATOM 9525  C CG2  . VAL A 1 118 ? -9.063  -3.850  -11.282 1.00 0.00 ? 118 VAL A CG2  5  
ATOM 9526  H H    . VAL A 1 118 ? -9.538  0.379   -10.447 1.00 0.00 ? 118 VAL A H    5  
ATOM 9527  H HA   . VAL A 1 118 ? -9.469  -1.494  -12.636 1.00 0.00 ? 118 VAL A HA   5  
ATOM 9528  H HB   . VAL A 1 118 ? -7.609  -2.288  -11.324 1.00 0.00 ? 118 VAL A HB   5  
ATOM 9529  H HG11 . VAL A 1 118 ? -7.545  -1.892  -9.128  1.00 0.00 ? 118 VAL A HG11 5  
ATOM 9530  H HG12 . VAL A 1 118 ? -9.286  -1.528  -9.086  1.00 0.00 ? 118 VAL A HG12 5  
ATOM 9531  H HG13 . VAL A 1 118 ? -8.724  -3.208  -8.913  1.00 0.00 ? 118 VAL A HG13 5  
ATOM 9532  H HG21 . VAL A 1 118 ? -8.748  -4.542  -10.501 1.00 0.00 ? 118 VAL A HG21 5  
ATOM 9533  H HG22 . VAL A 1 118 ? -10.149 -3.873  -11.372 1.00 0.00 ? 118 VAL A HG22 5  
ATOM 9534  H HG23 . VAL A 1 118 ? -8.613  -4.144  -12.230 1.00 0.00 ? 118 VAL A HG23 5  
ATOM 9535  N N    . VAL A 1 119 ? -11.816 -1.940  -12.081 1.00 0.00 ? 119 VAL A N    5  
ATOM 9536  C CA   . VAL A 1 119 ? -13.232 -2.126  -11.817 1.00 0.00 ? 119 VAL A CA   5  
ATOM 9537  C C    . VAL A 1 119 ? -13.456 -3.512  -11.209 1.00 0.00 ? 119 VAL A C    5  
ATOM 9538  O O    . VAL A 1 119 ? -12.690 -4.439  -11.468 1.00 0.00 ? 119 VAL A O    5  
ATOM 9539  C CB   . VAL A 1 119 ? -14.037 -1.900  -13.099 1.00 0.00 ? 119 VAL A CB   5  
ATOM 9540  C CG1  . VAL A 1 119 ? -15.375 -2.640  -13.044 1.00 0.00 ? 119 VAL A CG1  5  
ATOM 9541  C CG2  . VAL A 1 119 ? -14.246 -0.407  -13.358 1.00 0.00 ? 119 VAL A CG2  5  
ATOM 9542  H H    . VAL A 1 119 ? -11.531 -2.138  -13.019 1.00 0.00 ? 119 VAL A H    5  
ATOM 9543  H HA   . VAL A 1 119 ? -13.534 -1.371  -11.092 1.00 0.00 ? 119 VAL A HA   5  
ATOM 9544  H HB   . VAL A 1 119 ? -13.463 -2.307  -13.931 1.00 0.00 ? 119 VAL A HB   5  
ATOM 9545  H HG11 . VAL A 1 119 ? -15.962 -2.394  -13.929 1.00 0.00 ? 119 VAL A HG11 5  
ATOM 9546  H HG12 . VAL A 1 119 ? -15.195 -3.714  -13.014 1.00 0.00 ? 119 VAL A HG12 5  
ATOM 9547  H HG13 . VAL A 1 119 ? -15.921 -2.337  -12.151 1.00 0.00 ? 119 VAL A HG13 5  
ATOM 9548  H HG21 . VAL A 1 119 ? -14.132 0.144   -12.424 1.00 0.00 ? 119 VAL A HG21 5  
ATOM 9549  H HG22 . VAL A 1 119 ? -13.507 -0.056  -14.079 1.00 0.00 ? 119 VAL A HG22 5  
ATOM 9550  H HG23 . VAL A 1 119 ? -15.248 -0.244  -13.756 1.00 0.00 ? 119 VAL A HG23 5  
ATOM 9551  N N    . THR A 1 120 ? -14.508 -3.610  -10.410 1.00 0.00 ? 120 THR A N    5  
ATOM 9552  C CA   . THR A 1 120 ? -14.842 -4.867  -9.762  1.00 0.00 ? 120 THR A CA   5  
ATOM 9553  C C    . THR A 1 120 ? -16.043 -5.519  -10.450 1.00 0.00 ? 120 THR A C    5  
ATOM 9554  O O    . THR A 1 120 ? -17.161 -5.012  -10.367 1.00 0.00 ? 120 THR A O    5  
ATOM 9555  C CB   . THR A 1 120 ? -15.071 -4.587  -8.276  1.00 0.00 ? 120 THR A CB   5  
ATOM 9556  O OG1  . THR A 1 120 ? -15.741 -3.329  -8.259  1.00 0.00 ? 120 THR A OG1  5  
ATOM 9557  C CG2  . THR A 1 120 ? -13.766 -4.323  -7.521  1.00 0.00 ? 120 THR A CG2  5  
ATOM 9558  H H    . THR A 1 120 ? -15.126 -2.851  -10.204 1.00 0.00 ? 120 THR A H    5  
ATOM 9559  H HA   . THR A 1 120 ? -13.999 -5.548  -9.878  1.00 0.00 ? 120 THR A HA   5  
ATOM 9560  H HB   . THR A 1 120 ? -15.634 -5.395  -7.809  1.00 0.00 ? 120 THR A HB   5  
ATOM 9561  H HG1  . THR A 1 120 ? -16.728 -3.466  -8.345  1.00 0.00 ? 120 THR A HG1  5  
ATOM 9562  H HG21 . THR A 1 120 ? -13.824 -4.770  -6.529  1.00 0.00 ? 120 THR A HG21 5  
ATOM 9563  H HG22 . THR A 1 120 ? -12.934 -4.764  -8.071  1.00 0.00 ? 120 THR A HG22 5  
ATOM 9564  H HG23 . THR A 1 120 ? -13.611 -3.248  -7.427  1.00 0.00 ? 120 THR A HG23 5  
ATOM 9565  N N    . THR A 1 121 ? -15.772 -6.634  -11.112 1.00 0.00 ? 121 THR A N    5  
ATOM 9566  C CA   . THR A 1 121 ? -16.817 -7.361  -11.813 1.00 0.00 ? 121 THR A CA   5  
ATOM 9567  C C    . THR A 1 121 ? -16.258 -8.654  -12.410 1.00 0.00 ? 121 THR A C    5  
ATOM 9568  O O    . THR A 1 121 ? -15.045 -8.857  -12.435 1.00 0.00 ? 121 THR A O    5  
ATOM 9569  C CB   . THR A 1 121 ? -17.425 -6.423  -12.858 1.00 0.00 ? 121 THR A CB   5  
ATOM 9570  O OG1  . THR A 1 121 ? -18.407 -7.222  -13.512 1.00 0.00 ? 121 THR A OG1  5  
ATOM 9571  C CG2  . THR A 1 121 ? -16.437 -6.063  -13.969 1.00 0.00 ? 121 THR A CG2  5  
ATOM 9572  H H    . THR A 1 121 ? -14.860 -7.040  -11.174 1.00 0.00 ? 121 THR A H    5  
ATOM 9573  H HA   . THR A 1 121 ? -17.581 -7.646  -11.091 1.00 0.00 ? 121 THR A HA   5  
ATOM 9574  H HB   . THR A 1 121 ? -17.827 -5.525  -12.388 1.00 0.00 ? 121 THR A HB   5  
ATOM 9575  H HG1  . THR A 1 121 ? -17.962 -7.893  -14.105 1.00 0.00 ? 121 THR A HG1  5  
ATOM 9576  H HG21 . THR A 1 121 ? -15.467 -5.828  -13.530 1.00 0.00 ? 121 THR A HG21 5  
ATOM 9577  H HG22 . THR A 1 121 ? -16.332 -6.909  -14.650 1.00 0.00 ? 121 THR A HG22 5  
ATOM 9578  H HG23 . THR A 1 121 ? -16.807 -5.198  -14.519 1.00 0.00 ? 121 THR A HG23 5  
ATOM 9579  N N    . GLU A 1 122 ? -17.170 -9.495  -12.876 1.00 0.00 ? 122 GLU A N    5  
ATOM 9580  C CA   . GLU A 1 122 ? -16.784 -10.763 -13.470 1.00 0.00 ? 122 GLU A CA   5  
ATOM 9581  C C    . GLU A 1 122 ? -16.536 -10.592 -14.970 1.00 0.00 ? 122 GLU A C    5  
ATOM 9582  O O    . GLU A 1 122 ? -15.552 -11.104 -15.503 1.00 0.00 ? 122 GLU A O    5  
ATOM 9583  C CB   . GLU A 1 122 ? -17.842 -11.837 -13.208 1.00 0.00 ? 122 GLU A CB   5  
ATOM 9584  C CG   . GLU A 1 122 ? -18.000 -12.096 -11.709 1.00 0.00 ? 122 GLU A CG   5  
ATOM 9585  C CD   . GLU A 1 122 ? -19.292 -12.862 -11.418 1.00 0.00 ? 122 GLU A CD   5  
ATOM 9586  O OE1  . GLU A 1 122 ? -20.284 -12.592 -12.129 1.00 0.00 ? 122 GLU A OE1  5  
ATOM 9587  O OE2  . GLU A 1 122 ? -19.260 -13.699 -10.491 1.00 0.00 ? 122 GLU A OE2  5  
ATOM 9588  H H    . GLU A 1 122 ? -18.155 -9.322  -12.851 1.00 0.00 ? 122 GLU A H    5  
ATOM 9589  H HA   . GLU A 1 122 ? -15.857 -11.047 -12.972 1.00 0.00 ? 122 GLU A HA   5  
ATOM 9590  H HB2  . GLU A 1 122 ? -18.797 -11.522 -13.629 1.00 0.00 ? 122 GLU A HB2  5  
ATOM 9591  H HB3  . GLU A 1 122 ? -17.561 -12.761 -13.713 1.00 0.00 ? 122 GLU A HB3  5  
ATOM 9592  H HG2  . GLU A 1 122 ? -17.145 -12.666 -11.343 1.00 0.00 ? 122 GLU A HG2  5  
ATOM 9593  H HG3  . GLU A 1 122 ? -18.005 -11.149 -11.170 1.00 0.00 ? 122 GLU A HG3  5  
ATOM 9594  N N    . LYS A 1 123 ? -17.445 -9.871  -15.610 1.00 0.00 ? 123 LYS A N    5  
ATOM 9595  C CA   . LYS A 1 123 ? -17.337 -9.626  -17.038 1.00 0.00 ? 123 LYS A CA   5  
ATOM 9596  C C    . LYS A 1 123 ? -15.993 -8.959  -17.337 1.00 0.00 ? 123 LYS A C    5  
ATOM 9597  O O    . LYS A 1 123 ? -15.331 -8.455  -16.431 1.00 0.00 ? 123 LYS A O    5  
ATOM 9598  C CB   . LYS A 1 123 ? -18.544 -8.829  -17.537 1.00 0.00 ? 123 LYS A CB   5  
ATOM 9599  C CG   . LYS A 1 123 ? -19.814 -9.681  -17.507 1.00 0.00 ? 123 LYS A CG   5  
ATOM 9600  C CD   . LYS A 1 123 ? -21.051 -8.813  -17.267 1.00 0.00 ? 123 LYS A CD   5  
ATOM 9601  C CE   . LYS A 1 123 ? -21.918 -9.392  -16.147 1.00 0.00 ? 123 LYS A CE   5  
ATOM 9602  N NZ   . LYS A 1 123 ? -22.713 -8.323  -15.502 1.00 0.00 ? 123 LYS A NZ   5  
ATOM 9603  H H    . LYS A 1 123 ? -18.242 -9.458  -15.169 1.00 0.00 ? 123 LYS A H    5  
ATOM 9604  H HA   . LYS A 1 123 ? -17.361 -10.594 -17.538 1.00 0.00 ? 123 LYS A HA   5  
ATOM 9605  H HB2  . LYS A 1 123 ? -18.682 -7.943  -16.917 1.00 0.00 ? 123 LYS A HB2  5  
ATOM 9606  H HB3  . LYS A 1 123 ? -18.359 -8.481  -18.553 1.00 0.00 ? 123 LYS A HB3  5  
ATOM 9607  H HG2  . LYS A 1 123 ? -19.919 -10.217 -18.451 1.00 0.00 ? 123 LYS A HG2  5  
ATOM 9608  H HG3  . LYS A 1 123 ? -19.735 -10.432 -16.721 1.00 0.00 ? 123 LYS A HG3  5  
ATOM 9609  H HD2  . LYS A 1 123 ? -20.744 -7.800  -17.008 1.00 0.00 ? 123 LYS A HD2  5  
ATOM 9610  H HD3  . LYS A 1 123 ? -21.635 -8.744  -18.185 1.00 0.00 ? 123 LYS A HD3  5  
ATOM 9611  H HE2  . LYS A 1 123 ? -22.584 -10.154 -16.551 1.00 0.00 ? 123 LYS A HE2  5  
ATOM 9612  H HE3  . LYS A 1 123 ? -21.286 -9.881  -15.406 1.00 0.00 ? 123 LYS A HE3  5  
ATOM 9613  H HZ1  . LYS A 1 123 ? -23.040 -8.641  -14.612 1.00 0.00 ? 123 LYS A HZ1  5  
ATOM 9614  H HZ2  . LYS A 1 123 ? -22.141 -7.512  -15.377 1.00 0.00 ? 123 LYS A HZ2  5  
ATOM 9615  H HZ3  . LYS A 1 123 ? -23.495 -8.093  -16.082 1.00 0.00 ? 123 LYS A HZ3  5  
ATOM 9616  N N    . ARG A 1 124 ? -15.630 -8.977  -18.611 1.00 0.00 ? 124 ARG A N    5  
ATOM 9617  C CA   . ARG A 1 124 ? -14.377 -8.380  -19.040 1.00 0.00 ? 124 ARG A CA   5  
ATOM 9618  C C    . ARG A 1 124 ? -14.523 -7.793  -20.445 1.00 0.00 ? 124 ARG A C    5  
ATOM 9619  O O    . ARG A 1 124 ? -15.218 -8.358  -21.289 1.00 0.00 ? 124 ARG A O    5  
ATOM 9620  C CB   . ARG A 1 124 ? -13.247 -9.412  -19.041 1.00 0.00 ? 124 ARG A CB   5  
ATOM 9621  C CG   . ARG A 1 124 ? -11.880 -8.728  -19.098 1.00 0.00 ? 124 ARG A CG   5  
ATOM 9622  C CD   . ARG A 1 124 ? -10.860 -9.468  -18.230 1.00 0.00 ? 124 ARG A CD   5  
ATOM 9623  N NE   . ARG A 1 124 ? -9.538  -9.475  -18.896 1.00 0.00 ? 124 ARG A NE   5  
ATOM 9624  C CZ   . ARG A 1 124 ? -9.208  -10.298 -19.900 1.00 0.00 ? 124 ARG A CZ   5  
ATOM 9625  N NH1  . ARG A 1 124 ? -10.100 -11.186 -20.360 1.00 0.00 ? 124 ARG A NH1  5  
ATOM 9626  N NH2  . ARG A 1 124 ? -7.985  -10.234 -20.445 1.00 0.00 ? 124 ARG A NH2  5  
ATOM 9627  H H    . ARG A 1 124 ? -16.174 -9.390  -19.341 1.00 0.00 ? 124 ARG A H    5  
ATOM 9628  H HA   . ARG A 1 124 ? -14.175 -7.599  -18.308 1.00 0.00 ? 124 ARG A HA   5  
ATOM 9629  H HB2  . ARG A 1 124 ? -13.312 -10.029 -18.144 1.00 0.00 ? 124 ARG A HB2  5  
ATOM 9630  H HB3  . ARG A 1 124 ? -13.359 -10.079 -19.895 1.00 0.00 ? 124 ARG A HB3  5  
ATOM 9631  H HG2  . ARG A 1 124 ? -11.528 -8.694  -20.129 1.00 0.00 ? 124 ARG A HG2  5  
ATOM 9632  H HG3  . ARG A 1 124 ? -11.971 -7.696  -18.758 1.00 0.00 ? 124 ARG A HG3  5  
ATOM 9633  H HD2  . ARG A 1 124 ? -10.782 -8.987  -17.255 1.00 0.00 ? 124 ARG A HD2  5  
ATOM 9634  H HD3  . ARG A 1 124 ? -11.193 -10.491 -18.055 1.00 0.00 ? 124 ARG A HD3  5  
ATOM 9635  H HE   . ARG A 1 124 ? -8.849  -8.824  -18.577 1.00 0.00 ? 124 ARG A HE   5  
ATOM 9636  H HH11 . ARG A 1 124 ? -11.012 -11.235 -19.954 1.00 0.00 ? 124 ARG A HH11 5  
ATOM 9637  H HH12 . ARG A 1 124 ? -9.853  -11.801 -21.109 1.00 0.00 ? 124 ARG A HH12 5  
ATOM 9638  H HH21 . ARG A 1 124 ? -7.319  -9.571  -20.102 1.00 0.00 ? 124 ARG A HH21 5  
ATOM 9639  H HH22 . ARG A 1 124 ? -7.738  -10.848 -21.194 1.00 0.00 ? 124 ARG A HH22 5  
ATOM 9640  N N    . SER A 1 125 ? -13.856 -6.668  -20.654 1.00 0.00 ? 125 SER A N    5  
ATOM 9641  C CA   . SER A 1 125 ? -13.903 -5.998  -21.943 1.00 0.00 ? 125 SER A CA   5  
ATOM 9642  C C    . SER A 1 125 ? -12.776 -4.967  -22.038 1.00 0.00 ? 125 SER A C    5  
ATOM 9643  O O    . SER A 1 125 ? -12.135 -4.649  -21.038 1.00 0.00 ? 125 SER A O    5  
ATOM 9644  C CB   . SER A 1 125 ? -15.258 -5.324  -22.164 1.00 0.00 ? 125 SER A CB   5  
ATOM 9645  O OG   . SER A 1 125 ? -15.629 -4.496  -21.066 1.00 0.00 ? 125 SER A OG   5  
ATOM 9646  H H    . SER A 1 125 ? -13.293 -6.215  -19.963 1.00 0.00 ? 125 SER A H    5  
ATOM 9647  H HA   . SER A 1 125 ? -13.764 -6.786  -22.683 1.00 0.00 ? 125 SER A HA   5  
ATOM 9648  H HB2  . SER A 1 125 ? -15.221 -4.725  -23.074 1.00 0.00 ? 125 SER A HB2  5  
ATOM 9649  H HB3  . SER A 1 125 ? -16.022 -6.087  -22.317 1.00 0.00 ? 125 SER A HB3  5  
ATOM 9650  H HG   . SER A 1 125 ? -16.529 -4.092  -21.230 1.00 0.00 ? 125 SER A HG   5  
ATOM 9651  N N    . GLY A 1 126 ? -12.569 -4.474  -23.250 1.00 0.00 ? 126 GLY A N    5  
ATOM 9652  C CA   . GLY A 1 126 ? -11.531 -3.486  -23.489 1.00 0.00 ? 126 GLY A CA   5  
ATOM 9653  C C    . GLY A 1 126 ? -12.138 -2.117  -23.799 1.00 0.00 ? 126 GLY A C    5  
ATOM 9654  O O    . GLY A 1 126 ? -12.619 -1.883  -24.907 1.00 0.00 ? 126 GLY A O    5  
ATOM 9655  H H    . GLY A 1 126 ? -13.095 -4.739  -24.059 1.00 0.00 ? 126 GLY A H    5  
ATOM 9656  H HA2  . GLY A 1 126 ? -10.886 -3.413  -22.614 1.00 0.00 ? 126 GLY A HA2  5  
ATOM 9657  H HA3  . GLY A 1 126 ? -10.904 -3.807  -24.321 1.00 0.00 ? 126 GLY A HA3  5  
ATOM 9658  N N    . PRO A 1 127 ? -12.095 -1.224  -22.774 1.00 0.00 ? 127 PRO A N    5  
ATOM 9659  C CA   . PRO A 1 127 ? -12.636 0.116   -22.926 1.00 0.00 ? 127 PRO A CA   5  
ATOM 9660  C C    . PRO A 1 127 ? -11.706 0.990   -23.771 1.00 0.00 ? 127 PRO A C    5  
ATOM 9661  O O    . PRO A 1 127 ? -10.506 0.731   -23.849 1.00 0.00 ? 127 PRO A O    5  
ATOM 9662  C CB   . PRO A 1 127 ? -12.809 0.634   -21.507 1.00 0.00 ? 127 PRO A CB   5  
ATOM 9663  C CG   . PRO A 1 127 ? -11.932 -0.247  -20.632 1.00 0.00 ? 127 PRO A CG   5  
ATOM 9664  C CD   . PRO A 1 127 ? -11.534 -1.466  -21.448 1.00 0.00 ? 127 PRO A CD   5  
ATOM 9665  H HA   . PRO A 1 127 ? -13.505 0.086   -23.419 1.00 0.00 ? 127 PRO A HA   5  
ATOM 9666  H HB2  . PRO A 1 127 ? -12.510 1.679   -21.433 1.00 0.00 ? 127 PRO A HB2  5  
ATOM 9667  H HB3  . PRO A 1 127 ? -13.852 0.578   -21.196 1.00 0.00 ? 127 PRO A HB3  5  
ATOM 9668  H HG2  . PRO A 1 127 ? -11.047 0.300   -20.306 1.00 0.00 ? 127 PRO A HG2  5  
ATOM 9669  H HG3  . PRO A 1 127 ? -12.470 -0.548  -19.733 1.00 0.00 ? 127 PRO A HG3  5  
ATOM 9670  H HD2  . PRO A 1 127 ? -10.450 -1.577  -21.492 1.00 0.00 ? 127 PRO A HD2  5  
ATOM 9671  H HD3  . PRO A 1 127 ? -11.930 -2.382  -21.011 1.00 0.00 ? 127 PRO A HD3  5  
ATOM 9672  N N    . SER A 1 128 ? -12.296 2.006   -24.383 1.00 0.00 ? 128 SER A N    5  
ATOM 9673  C CA   . SER A 1 128 ? -11.536 2.919   -25.220 1.00 0.00 ? 128 SER A CA   5  
ATOM 9674  C C    . SER A 1 128 ? -12.101 4.335   -25.097 1.00 0.00 ? 128 SER A C    5  
ATOM 9675  O O    . SER A 1 128 ? -13.234 4.519   -24.654 1.00 0.00 ? 128 SER A O    5  
ATOM 9676  C CB   . SER A 1 128 ? -11.549 2.467   -26.682 1.00 0.00 ? 128 SER A CB   5  
ATOM 9677  O OG   . SER A 1 128 ? -12.860 2.129   -27.124 1.00 0.00 ? 128 SER A OG   5  
ATOM 9678  H H    . SER A 1 128 ? -13.273 2.209   -24.315 1.00 0.00 ? 128 SER A H    5  
ATOM 9679  H HA   . SER A 1 128 ? -10.516 2.880   -24.837 1.00 0.00 ? 128 SER A HA   5  
ATOM 9680  H HB2  . SER A 1 128 ? -11.148 3.262   -27.311 1.00 0.00 ? 128 SER A HB2  5  
ATOM 9681  H HB3  . SER A 1 128 ? -10.893 1.605   -26.801 1.00 0.00 ? 128 SER A HB3  5  
ATOM 9682  H HG   . SER A 1 128 ? -12.890 1.169   -27.403 1.00 0.00 ? 128 SER A HG   5  
ATOM 9683  N N    . SER A 1 129 ? -11.287 5.300   -25.498 1.00 0.00 ? 129 SER A N    5  
ATOM 9684  C CA   . SER A 1 129 ? -11.692 6.694   -25.439 1.00 0.00 ? 129 SER A CA   5  
ATOM 9685  C C    . SER A 1 129 ? -10.683 7.565   -26.190 1.00 0.00 ? 129 SER A C    5  
ATOM 9686  O O    . SER A 1 129 ? -9.654  7.949   -25.636 1.00 0.00 ? 129 SER A O    5  
ATOM 9687  C CB   . SER A 1 129 ? -11.826 7.168   -23.990 1.00 0.00 ? 129 SER A CB   5  
ATOM 9688  O OG   . SER A 1 129 ? -13.180 7.150   -23.546 1.00 0.00 ? 129 SER A OG   5  
ATOM 9689  H H    . SER A 1 129 ? -10.367 5.142   -25.858 1.00 0.00 ? 129 SER A H    5  
ATOM 9690  H HA   . SER A 1 129 ? -12.667 6.733   -25.924 1.00 0.00 ? 129 SER A HA   5  
ATOM 9691  H HB2  . SER A 1 129 ? -11.224 6.529   -23.343 1.00 0.00 ? 129 SER A HB2  5  
ATOM 9692  H HB3  . SER A 1 129 ? -11.428 8.178   -23.900 1.00 0.00 ? 129 SER A HB3  5  
ATOM 9693  H HG   . SER A 1 129 ? -13.323 6.386   -22.917 1.00 0.00 ? 129 SER A HG   5  
ATOM 9694  N N    . GLY A 1 130 ? -11.013 7.851   -27.441 1.00 0.00 ? 130 GLY A N    5  
ATOM 9695  C CA   . GLY A 1 130 ? -10.148 8.670   -28.274 1.00 0.00 ? 130 GLY A CA   5  
ATOM 9696  C C    . GLY A 1 130 ? -10.725 8.818   -29.684 1.00 0.00 ? 130 GLY A C    5  
ATOM 9697  O O    . GLY A 1 130 ? -11.226 9.882   -30.044 1.00 0.00 ? 130 GLY A O    5  
ATOM 9698  H H    . GLY A 1 130 ? -11.851 7.535   -27.885 1.00 0.00 ? 130 GLY A H    5  
ATOM 9699  H HA2  . GLY A 1 130 ? -10.026 9.654   -27.822 1.00 0.00 ? 130 GLY A HA2  5  
ATOM 9700  H HA3  . GLY A 1 130 ? -9.157  8.219   -28.329 1.00 0.00 ? 130 GLY A HA3  5  
ATOM 9701  N N    . GLY A 1 1   ? 69.454  -41.705 14.284  1.00 0.00 ? 1   GLY A N    6  
ATOM 9702  C CA   . GLY A 1 1   ? 68.580  -41.310 13.192  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9703  C C    . GLY A 1 1   ? 67.670  -40.153 13.609  1.00 0.00 ? 1   GLY A C    6  
ATOM 9704  O O    . GLY A 1 1   ? 67.859  -39.562 14.671  1.00 0.00 ? 1   GLY A O    6  
ATOM 9705  H H1   . GLY A 1 1   ? 68.985  -42.017 15.109  1.00 0.00 ? 1   GLY A H1   6  
ATOM 9706  H HA2  . GLY A 1 1   ? 69.179  -41.015 12.331  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9707  H HA3  . GLY A 1 1   ? 67.973  -42.161 12.882  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9708  N N    . SER A 1 2   ? 66.703  -39.864 12.751  1.00 0.00 ? 2   SER A N    6  
ATOM 9709  C CA   . SER A 1 2   ? 65.763  -38.788 13.017  1.00 0.00 ? 2   SER A CA   6  
ATOM 9710  C C    . SER A 1 2   ? 64.745  -38.690 11.879  1.00 0.00 ? 2   SER A C    6  
ATOM 9711  O O    . SER A 1 2   ? 64.890  -39.351 10.852  1.00 0.00 ? 2   SER A O    6  
ATOM 9712  C CB   . SER A 1 2   ? 66.490  -37.454 13.195  1.00 0.00 ? 2   SER A CB   6  
ATOM 9713  O OG   . SER A 1 2   ? 66.005  -36.728 14.321  1.00 0.00 ? 2   SER A OG   6  
ATOM 9714  H H    . SER A 1 2   ? 66.557  -40.349 11.889  1.00 0.00 ? 2   SER A H    6  
ATOM 9715  H HA   . SER A 1 2   ? 65.270  -39.060 13.950  1.00 0.00 ? 2   SER A HA   6  
ATOM 9716  H HB2  . SER A 1 2   ? 67.558  -37.636 13.315  1.00 0.00 ? 2   SER A HB2  6  
ATOM 9717  H HB3  . SER A 1 2   ? 66.368  -36.851 12.295  1.00 0.00 ? 2   SER A HB3  6  
ATOM 9718  H HG   . SER A 1 2   ? 66.477  -35.849 14.391  1.00 0.00 ? 2   SER A HG   6  
ATOM 9719  N N    . SER A 1 3   ? 63.737  -37.859 12.101  1.00 0.00 ? 3   SER A N    6  
ATOM 9720  C CA   . SER A 1 3   ? 62.694  -37.666 11.107  1.00 0.00 ? 3   SER A CA   6  
ATOM 9721  C C    . SER A 1 3   ? 61.916  -36.384 11.408  1.00 0.00 ? 3   SER A C    6  
ATOM 9722  O O    . SER A 1 3   ? 62.079  -35.790 12.473  1.00 0.00 ? 3   SER A O    6  
ATOM 9723  C CB   . SER A 1 3   ? 61.745  -38.865 11.064  1.00 0.00 ? 3   SER A CB   6  
ATOM 9724  O OG   . SER A 1 3   ? 60.822  -38.855 12.150  1.00 0.00 ? 3   SER A OG   6  
ATOM 9725  H H    . SER A 1 3   ? 63.626  -37.325 12.939  1.00 0.00 ? 3   SER A H    6  
ATOM 9726  H HA   . SER A 1 3   ? 63.216  -37.582 10.154  1.00 0.00 ? 3   SER A HA   6  
ATOM 9727  H HB2  . SER A 1 3   ? 61.197  -38.860 10.122  1.00 0.00 ? 3   SER A HB2  6  
ATOM 9728  H HB3  . SER A 1 3   ? 62.325  -39.788 11.091  1.00 0.00 ? 3   SER A HB3  6  
ATOM 9729  H HG   . SER A 1 3   ? 59.920  -38.563 11.829  1.00 0.00 ? 3   SER A HG   6  
ATOM 9730  N N    . GLY A 1 4   ? 61.086  -35.995 10.451  1.00 0.00 ? 4   GLY A N    6  
ATOM 9731  C CA   . GLY A 1 4   ? 60.282  -34.794 10.601  1.00 0.00 ? 4   GLY A CA   6  
ATOM 9732  C C    . GLY A 1 4   ? 59.226  -34.701 9.498   1.00 0.00 ? 4   GLY A C    6  
ATOM 9733  O O    . GLY A 1 4   ? 59.035  -35.646 8.735   1.00 0.00 ? 4   GLY A O    6  
ATOM 9734  H H    . GLY A 1 4   ? 60.959  -36.483 9.588   1.00 0.00 ? 4   GLY A H    6  
ATOM 9735  H HA2  . GLY A 1 4   ? 59.796  -34.796 11.576  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9736  H HA3  . GLY A 1 4   ? 60.926  -33.914 10.568  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9737  N N    . SER A 1 5   ? 58.567  -33.552 9.449   1.00 0.00 ? 5   SER A N    6  
ATOM 9738  C CA   . SER A 1 5   ? 57.534  -33.323 8.453   1.00 0.00 ? 5   SER A CA   6  
ATOM 9739  C C    . SER A 1 5   ? 57.094  -31.858 8.483   1.00 0.00 ? 5   SER A C    6  
ATOM 9740  O O    . SER A 1 5   ? 57.242  -31.182 9.499   1.00 0.00 ? 5   SER A O    6  
ATOM 9741  C CB   . SER A 1 5   ? 56.334  -34.244 8.682   1.00 0.00 ? 5   SER A CB   6  
ATOM 9742  O OG   . SER A 1 5   ? 55.454  -33.735 9.680   1.00 0.00 ? 5   SER A OG   6  
ATOM 9743  H H    . SER A 1 5   ? 58.728  -32.788 10.074  1.00 0.00 ? 5   SER A H    6  
ATOM 9744  H HA   . SER A 1 5   ? 57.998  -33.564 7.496   1.00 0.00 ? 5   SER A HA   6  
ATOM 9745  H HB2  . SER A 1 5   ? 55.788  -34.367 7.746   1.00 0.00 ? 5   SER A HB2  6  
ATOM 9746  H HB3  . SER A 1 5   ? 56.686  -35.232 8.978   1.00 0.00 ? 5   SER A HB3  6  
ATOM 9747  H HG   . SER A 1 5   ? 54.504  -33.875 9.403   1.00 0.00 ? 5   SER A HG   6  
ATOM 9748  N N    . SER A 1 6   ? 56.560  -31.411 7.355   1.00 0.00 ? 6   SER A N    6  
ATOM 9749  C CA   . SER A 1 6   ? 56.096  -30.039 7.240   1.00 0.00 ? 6   SER A CA   6  
ATOM 9750  C C    . SER A 1 6   ? 55.705  -29.739 5.792   1.00 0.00 ? 6   SER A C    6  
ATOM 9751  O O    . SER A 1 6   ? 56.068  -30.481 4.880   1.00 0.00 ? 6   SER A O    6  
ATOM 9752  C CB   . SER A 1 6   ? 57.166  -29.054 7.716   1.00 0.00 ? 6   SER A CB   6  
ATOM 9753  O OG   . SER A 1 6   ? 56.728  -28.288 8.834   1.00 0.00 ? 6   SER A OG   6  
ATOM 9754  H H    . SER A 1 6   ? 56.442  -31.967 6.533   1.00 0.00 ? 6   SER A H    6  
ATOM 9755  H HA   . SER A 1 6   ? 55.226  -29.972 7.893   1.00 0.00 ? 6   SER A HA   6  
ATOM 9756  H HB2  . SER A 1 6   ? 58.070  -29.602 7.984   1.00 0.00 ? 6   SER A HB2  6  
ATOM 9757  H HB3  . SER A 1 6   ? 57.431  -28.384 6.898   1.00 0.00 ? 6   SER A HB3  6  
ATOM 9758  H HG   . SER A 1 6   ? 56.113  -27.560 8.530   1.00 0.00 ? 6   SER A HG   6  
ATOM 9759  N N    . GLY A 1 7   ? 54.970  -28.649 5.624   1.00 0.00 ? 7   GLY A N    6  
ATOM 9760  C CA   . GLY A 1 7   ? 54.526  -28.242 4.302   1.00 0.00 ? 7   GLY A CA   6  
ATOM 9761  C C    . GLY A 1 7   ? 53.283  -27.353 4.391   1.00 0.00 ? 7   GLY A C    6  
ATOM 9762  O O    . GLY A 1 7   ? 52.230  -27.796 4.846   1.00 0.00 ? 7   GLY A O    6  
ATOM 9763  H H    . GLY A 1 7   ? 54.679  -28.051 6.371   1.00 0.00 ? 7   GLY A H    6  
ATOM 9764  H HA2  . GLY A 1 7   ? 55.327  -27.704 3.795   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9765  H HA3  . GLY A 1 7   ? 54.304  -29.124 3.701   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9766  N N    . ARG A 1 8   ? 53.448  -26.115 3.948   1.00 0.00 ? 8   ARG A N    6  
ATOM 9767  C CA   . ARG A 1 8   ? 52.353  -25.160 3.972   1.00 0.00 ? 8   ARG A CA   6  
ATOM 9768  C C    . ARG A 1 8   ? 52.271  -24.414 2.639   1.00 0.00 ? 8   ARG A C    6  
ATOM 9769  O O    . ARG A 1 8   ? 53.293  -24.021 2.079   1.00 0.00 ? 8   ARG A O    6  
ATOM 9770  C CB   . ARG A 1 8   ? 52.530  -24.148 5.105   1.00 0.00 ? 8   ARG A CB   6  
ATOM 9771  C CG   . ARG A 1 8   ? 53.958  -23.597 5.131   1.00 0.00 ? 8   ARG A CG   6  
ATOM 9772  C CD   . ARG A 1 8   ? 54.877  -24.496 5.960   1.00 0.00 ? 8   ARG A CD   6  
ATOM 9773  N NE   . ARG A 1 8   ? 55.392  -23.752 7.131   1.00 0.00 ? 8   ARG A NE   6  
ATOM 9774  C CZ   . ARG A 1 8   ? 56.107  -22.622 7.047   1.00 0.00 ? 8   ARG A CZ   6  
ATOM 9775  N NH1  . ARG A 1 8   ? 56.398  -22.100 5.848   1.00 0.00 ? 8   ARG A NH1  6  
ATOM 9776  N NH2  . ARG A 1 8   ? 56.533  -22.014 8.163   1.00 0.00 ? 8   ARG A NH2  6  
ATOM 9777  H H    . ARG A 1 8   ? 54.308  -25.763 3.580   1.00 0.00 ? 8   ARG A H    6  
ATOM 9778  H HA   . ARG A 1 8   ? 51.461  -25.763 4.140   1.00 0.00 ? 8   ARG A HA   6  
ATOM 9779  H HB2  . ARG A 1 8   ? 51.823  -23.328 4.979   1.00 0.00 ? 8   ARG A HB2  6  
ATOM 9780  H HB3  . ARG A 1 8   ? 52.302  -24.621 6.060   1.00 0.00 ? 8   ARG A HB3  6  
ATOM 9781  H HG2  . ARG A 1 8   ? 54.340  -23.520 4.113   1.00 0.00 ? 8   ARG A HG2  6  
ATOM 9782  H HG3  . ARG A 1 8   ? 53.955  -22.590 5.548   1.00 0.00 ? 8   ARG A HG3  6  
ATOM 9783  H HD2  . ARG A 1 8   ? 54.332  -25.380 6.292   1.00 0.00 ? 8   ARG A HD2  6  
ATOM 9784  H HD3  . ARG A 1 8   ? 55.708  -24.845 5.347   1.00 0.00 ? 8   ARG A HD3  6  
ATOM 9785  H HE   . ARG A 1 8   ? 55.193  -24.114 8.042   1.00 0.00 ? 8   ARG A HE   6  
ATOM 9786  H HH11 . ARG A 1 8   ? 56.080  -22.554 5.015   1.00 0.00 ? 8   ARG A HH11 6  
ATOM 9787  H HH12 . ARG A 1 8   ? 56.932  -21.257 5.786   1.00 0.00 ? 8   ARG A HH12 6  
ATOM 9788  H HH21 . ARG A 1 8   ? 56.316  -22.404 9.059   1.00 0.00 ? 8   ARG A HH21 6  
ATOM 9789  H HH22 . ARG A 1 8   ? 57.067  -21.171 8.101   1.00 0.00 ? 8   ARG A HH22 6  
ATOM 9790  N N    . ILE A 1 9   ? 51.044  -24.241 2.169   1.00 0.00 ? 9   ILE A N    6  
ATOM 9791  C CA   . ILE A 1 9   ? 50.815  -23.549 0.912   1.00 0.00 ? 9   ILE A CA   6  
ATOM 9792  C C    . ILE A 1 9   ? 49.920  -22.333 1.160   1.00 0.00 ? 9   ILE A C    6  
ATOM 9793  O O    . ILE A 1 9   ? 49.435  -22.132 2.272   1.00 0.00 ? 9   ILE A O    6  
ATOM 9794  C CB   . ILE A 1 9   ? 50.263  -24.515 -0.139  1.00 0.00 ? 9   ILE A CB   6  
ATOM 9795  C CG1  . ILE A 1 9   ? 49.038  -25.262 0.393   1.00 0.00 ? 9   ILE A CG1  6  
ATOM 9796  C CG2  . ILE A 1 9   ? 51.351  -25.473 -0.627  1.00 0.00 ? 9   ILE A CG2  6  
ATOM 9797  C CD1  . ILE A 1 9   ? 48.026  -25.520 -0.725  1.00 0.00 ? 9   ILE A CD1  6  
ATOM 9798  H H    . ILE A 1 9   ? 50.218  -24.564 2.631   1.00 0.00 ? 9   ILE A H    6  
ATOM 9799  H HA   . ILE A 1 9   ? 51.782  -23.198 0.551   1.00 0.00 ? 9   ILE A HA   6  
ATOM 9800  H HB   . ILE A 1 9   ? 49.937  -23.932 -1.000  1.00 0.00 ? 9   ILE A HB   6  
ATOM 9801  H HG12 . ILE A 1 9   ? 49.348  -26.209 0.834   1.00 0.00 ? 9   ILE A HG12 6  
ATOM 9802  H HG13 . ILE A 1 9   ? 48.569  -24.680 1.186   1.00 0.00 ? 9   ILE A HG13 6  
ATOM 9803  H HG21 . ILE A 1 9   ? 50.917  -26.192 -1.323  1.00 0.00 ? 9   ILE A HG21 6  
ATOM 9804  H HG22 . ILE A 1 9   ? 52.134  -24.907 -1.132  1.00 0.00 ? 9   ILE A HG22 6  
ATOM 9805  H HG23 . ILE A 1 9   ? 51.778  -26.003 0.224   1.00 0.00 ? 9   ILE A HG23 6  
ATOM 9806  H HD11 . ILE A 1 9   ? 47.769  -24.577 -1.207  1.00 0.00 ? 9   ILE A HD11 6  
ATOM 9807  H HD12 . ILE A 1 9   ? 48.461  -26.197 -1.460  1.00 0.00 ? 9   ILE A HD12 6  
ATOM 9808  H HD13 . ILE A 1 9   ? 47.127  -25.970 -0.304  1.00 0.00 ? 9   ILE A HD13 6  
ATOM 9809  N N    . GLY A 1 10  ? 49.728  -21.555 0.105   1.00 0.00 ? 10  GLY A N    6  
ATOM 9810  C CA   . GLY A 1 10  ? 48.900  -20.364 0.195   1.00 0.00 ? 10  GLY A CA   6  
ATOM 9811  C C    . GLY A 1 10  ? 49.591  -19.276 1.020   1.00 0.00 ? 10  GLY A C    6  
ATOM 9812  O O    . GLY A 1 10  ? 50.092  -19.544 2.111   1.00 0.00 ? 10  GLY A O    6  
ATOM 9813  H H    . GLY A 1 10  ? 50.126  -21.726 -0.796  1.00 0.00 ? 10  GLY A H    6  
ATOM 9814  H HA2  . GLY A 1 10  ? 48.689  -19.988 -0.806  1.00 0.00 ? 10  GLY A HA2  6  
ATOM 9815  H HA3  . GLY A 1 10  ? 47.942  -20.617 0.649   1.00 0.00 ? 10  GLY A HA3  6  
ATOM 9816  N N    . ASP A 1 11  ? 49.595  -18.072 0.467   1.00 0.00 ? 11  ASP A N    6  
ATOM 9817  C CA   . ASP A 1 11  ? 50.216  -16.943 1.138   1.00 0.00 ? 11  ASP A CA   6  
ATOM 9818  C C    . ASP A 1 11  ? 50.316  -15.768 0.163   1.00 0.00 ? 11  ASP A C    6  
ATOM 9819  O O    . ASP A 1 11  ? 50.783  -15.930 -0.963  1.00 0.00 ? 11  ASP A O    6  
ATOM 9820  C CB   . ASP A 1 11  ? 51.630  -17.290 1.607   1.00 0.00 ? 11  ASP A CB   6  
ATOM 9821  C CG   . ASP A 1 11  ? 52.452  -18.123 0.621   1.00 0.00 ? 11  ASP A CG   6  
ATOM 9822  O OD1  . ASP A 1 11  ? 52.044  -18.170 -0.560  1.00 0.00 ? 11  ASP A OD1  6  
ATOM 9823  O OD2  . ASP A 1 11  ? 53.469  -18.693 1.070   1.00 0.00 ? 11  ASP A OD2  6  
ATOM 9824  H H    . ASP A 1 11  ? 49.185  -17.863 -0.421  1.00 0.00 ? 11  ASP A H    6  
ATOM 9825  H HA   . ASP A 1 11  ? 49.570  -16.725 1.989   1.00 0.00 ? 11  ASP A HA   6  
ATOM 9826  H HB2  . ASP A 1 11  ? 52.166  -16.364 1.812   1.00 0.00 ? 11  ASP A HB2  6  
ATOM 9827  H HB3  . ASP A 1 11  ? 51.561  -17.834 2.549   1.00 0.00 ? 11  ASP A HB3  6  
ATOM 9828  N N    . GLY A 1 12  ? 49.869  -14.612 0.631   1.00 0.00 ? 12  GLY A N    6  
ATOM 9829  C CA   . GLY A 1 12  ? 49.903  -13.410 -0.185  1.00 0.00 ? 12  GLY A CA   6  
ATOM 9830  C C    . GLY A 1 12  ? 48.640  -13.294 -1.042  1.00 0.00 ? 12  GLY A C    6  
ATOM 9831  O O    . GLY A 1 12  ? 48.592  -13.813 -2.156  1.00 0.00 ? 12  GLY A O    6  
ATOM 9832  H H    . GLY A 1 12  ? 49.491  -14.489 1.549   1.00 0.00 ? 12  GLY A H    6  
ATOM 9833  H HA2  . GLY A 1 12  ? 49.994  -12.533 0.456   1.00 0.00 ? 12  GLY A HA2  6  
ATOM 9834  H HA3  . GLY A 1 12  ? 50.783  -13.428 -0.828  1.00 0.00 ? 12  GLY A HA3  6  
ATOM 9835  N N    . SER A 1 13  ? 47.649  -12.611 -0.489  1.00 0.00 ? 13  SER A N    6  
ATOM 9836  C CA   . SER A 1 13  ? 46.390  -12.420 -1.188  1.00 0.00 ? 13  SER A CA   6  
ATOM 9837  C C    . SER A 1 13  ? 45.438  -11.581 -0.333  1.00 0.00 ? 13  SER A C    6  
ATOM 9838  O O    . SER A 1 13  ? 44.546  -12.120 0.320   1.00 0.00 ? 13  SER A O    6  
ATOM 9839  C CB   . SER A 1 13  ? 45.745  -13.763 -1.538  1.00 0.00 ? 13  SER A CB   6  
ATOM 9840  O OG   . SER A 1 13  ? 45.616  -14.606 -0.396  1.00 0.00 ? 13  SER A OG   6  
ATOM 9841  H H    . SER A 1 13  ? 47.696  -12.192 0.418   1.00 0.00 ? 13  SER A H    6  
ATOM 9842  H HA   . SER A 1 13  ? 46.647  -11.891 -2.106  1.00 0.00 ? 13  SER A HA   6  
ATOM 9843  H HB2  . SER A 1 13  ? 44.761  -13.590 -1.973  1.00 0.00 ? 13  SER A HB2  6  
ATOM 9844  H HB3  . SER A 1 13  ? 46.345  -14.267 -2.295  1.00 0.00 ? 13  SER A HB3  6  
ATOM 9845  H HG   . SER A 1 13  ? 46.420  -14.512 0.191   1.00 0.00 ? 13  SER A HG   6  
ATOM 9846  N N    . PRO A 1 14  ? 45.667  -10.241 -0.366  1.00 0.00 ? 14  PRO A N    6  
ATOM 9847  C CA   . PRO A 1 14  ? 44.841  -9.321  0.398   1.00 0.00 ? 14  PRO A CA   6  
ATOM 9848  C C    . PRO A 1 14  ? 43.471  -9.139  -0.260  1.00 0.00 ? 14  PRO A C    6  
ATOM 9849  O O    . PRO A 1 14  ? 42.443  -9.429  0.348   1.00 0.00 ? 14  PRO A O    6  
ATOM 9850  C CB   . PRO A 1 14  ? 45.644  -8.033  0.465   1.00 0.00 ? 14  PRO A CB   6  
ATOM 9851  C CG   . PRO A 1 14  ? 46.673  -8.125  -0.650  1.00 0.00 ? 14  PRO A CG   6  
ATOM 9852  C CD   . PRO A 1 14  ? 46.715  -9.567  -1.128  1.00 0.00 ? 14  PRO A CD   6  
ATOM 9853  H HA   . PRO A 1 14  ? 44.659  -9.693  1.308   1.00 0.00 ? 14  PRO A HA   6  
ATOM 9854  H HB2  . PRO A 1 14  ? 45.000  -7.164  0.331   1.00 0.00 ? 14  PRO A HB2  6  
ATOM 9855  H HB3  . PRO A 1 14  ? 46.128  -7.924  1.436   1.00 0.00 ? 14  PRO A HB3  6  
ATOM 9856  H HG2  . PRO A 1 14  ? 46.409  -7.458  -1.470  1.00 0.00 ? 14  PRO A HG2  6  
ATOM 9857  H HG3  . PRO A 1 14  ? 47.654  -7.814  -0.290  1.00 0.00 ? 14  PRO A HG3  6  
ATOM 9858  H HD2  . PRO A 1 14  ? 46.529  -9.634  -2.200  1.00 0.00 ? 14  PRO A HD2  6  
ATOM 9859  H HD3  . PRO A 1 14  ? 47.690  -10.018 -0.944  1.00 0.00 ? 14  PRO A HD3  6  
ATOM 9860  N N    . SER A 1 15  ? 43.503  -8.659  -1.495  1.00 0.00 ? 15  SER A N    6  
ATOM 9861  C CA   . SER A 1 15  ? 42.277  -8.434  -2.242  1.00 0.00 ? 15  SER A CA   6  
ATOM 9862  C C    . SER A 1 15  ? 41.196  -7.871  -1.318  1.00 0.00 ? 15  SER A C    6  
ATOM 9863  O O    . SER A 1 15  ? 40.429  -8.626  -0.722  1.00 0.00 ? 15  SER A O    6  
ATOM 9864  C CB   . SER A 1 15  ? 41.791  -9.726  -2.903  1.00 0.00 ? 15  SER A CB   6  
ATOM 9865  O OG   . SER A 1 15  ? 40.634  -9.511  -3.708  1.00 0.00 ? 15  SER A OG   6  
ATOM 9866  H H    . SER A 1 15  ? 44.344  -8.426  -1.983  1.00 0.00 ? 15  SER A H    6  
ATOM 9867  H HA   . SER A 1 15  ? 42.538  -7.709  -3.013  1.00 0.00 ? 15  SER A HA   6  
ATOM 9868  H HB2  . SER A 1 15  ? 42.589  -10.141 -3.518  1.00 0.00 ? 15  SER A HB2  6  
ATOM 9869  H HB3  . SER A 1 15  ? 41.565  -10.464 -2.133  1.00 0.00 ? 15  SER A HB3  6  
ATOM 9870  H HG   . SER A 1 15  ? 40.778  -8.726  -4.310  1.00 0.00 ? 15  SER A HG   6  
ATOM 9871  N N    . HIS A 1 16  ? 41.171  -6.550  -1.226  1.00 0.00 ? 16  HIS A N    6  
ATOM 9872  C CA   . HIS A 1 16  ? 40.197  -5.877  -0.384  1.00 0.00 ? 16  HIS A CA   6  
ATOM 9873  C C    . HIS A 1 16  ? 38.861  -5.777  -1.123  1.00 0.00 ? 16  HIS A C    6  
ATOM 9874  O O    . HIS A 1 16  ? 38.832  -5.628  -2.344  1.00 0.00 ? 16  HIS A O    6  
ATOM 9875  C CB   . HIS A 1 16  ? 40.723  -4.515  0.075   1.00 0.00 ? 16  HIS A CB   6  
ATOM 9876  C CG   . HIS A 1 16  ? 40.955  -3.536  -1.051  1.00 0.00 ? 16  HIS A CG   6  
ATOM 9877  N ND1  . HIS A 1 16  ? 40.035  -2.563  -1.399  1.00 0.00 ? 16  HIS A ND1  6  
ATOM 9878  C CD2  . HIS A 1 16  ? 42.012  -3.388  -1.901  1.00 0.00 ? 16  HIS A CD2  6  
ATOM 9879  C CE1  . HIS A 1 16  ? 40.525  -1.868  -2.415  1.00 0.00 ? 16  HIS A CE1  6  
ATOM 9880  N NE2  . HIS A 1 16  ? 41.750  -2.381  -2.725  1.00 0.00 ? 16  HIS A NE2  6  
ATOM 9881  H H    . HIS A 1 16  ? 41.799  -5.943  -1.713  1.00 0.00 ? 16  HIS A H    6  
ATOM 9882  H HA   . HIS A 1 16  ? 40.067  -6.498  0.502   1.00 0.00 ? 16  HIS A HA   6  
ATOM 9883  H HB2  . HIS A 1 16  ? 40.014  -4.082  0.780   1.00 0.00 ? 16  HIS A HB2  6  
ATOM 9884  H HB3  . HIS A 1 16  ? 41.659  -4.662  0.614   1.00 0.00 ? 16  HIS A HB3  6  
ATOM 9885  H HD1  . HIS A 1 16  ? 39.150  -2.410  -0.959  1.00 0.00 ? 16  HIS A HD1  6  
ATOM 9886  H HD2  . HIS A 1 16  ? 42.917  -3.995  -1.902  1.00 0.00 ? 16  HIS A HD2  6  
ATOM 9887  H HE1  . HIS A 1 16  ? 40.035  -1.032  -2.916  1.00 0.00 ? 16  HIS A HE1  6  
ATOM 9888  N N    . PRO A 1 17  ? 37.758  -5.866  -0.332  1.00 0.00 ? 17  PRO A N    6  
ATOM 9889  C CA   . PRO A 1 17  ? 36.423  -5.787  -0.898  1.00 0.00 ? 17  PRO A CA   6  
ATOM 9890  C C    . PRO A 1 17  ? 36.074  -4.348  -1.282  1.00 0.00 ? 17  PRO A C    6  
ATOM 9891  O O    . PRO A 1 17  ? 36.580  -3.401  -0.682  1.00 0.00 ? 17  PRO A O    6  
ATOM 9892  C CB   . PRO A 1 17  ? 35.507  -6.354  0.174   1.00 0.00 ? 17  PRO A CB   6  
ATOM 9893  C CG   . PRO A 1 17  ? 36.298  -6.298  1.471   1.00 0.00 ? 17  PRO A CG   6  
ATOM 9894  C CD   . PRO A 1 17  ? 37.754  -6.042  1.117   1.00 0.00 ? 17  PRO A CD   6  
ATOM 9895  H HA   . PRO A 1 17  ? 36.373  -6.316  -1.746  1.00 0.00 ? 17  PRO A HA   6  
ATOM 9896  H HB2  . PRO A 1 17  ? 34.588  -5.772  0.251   1.00 0.00 ? 17  PRO A HB2  6  
ATOM 9897  H HB3  . PRO A 1 17  ? 35.216  -7.378  -0.062  1.00 0.00 ? 17  PRO A HB3  6  
ATOM 9898  H HG2  . PRO A 1 17  ? 35.917  -5.506  2.116   1.00 0.00 ? 17  PRO A HG2  6  
ATOM 9899  H HG3  . PRO A 1 17  ? 36.197  -7.234  2.021   1.00 0.00 ? 17  PRO A HG3  6  
ATOM 9900  H HD2  . PRO A 1 17  ? 38.135  -5.156  1.625   1.00 0.00 ? 17  PRO A HD2  6  
ATOM 9901  H HD3  . PRO A 1 17  ? 38.387  -6.878  1.416   1.00 0.00 ? 17  PRO A HD3  6  
ATOM 9902  N N    . PRO A 1 18  ? 35.188  -4.225  -2.307  1.00 0.00 ? 18  PRO A N    6  
ATOM 9903  C CA   . PRO A 1 18  ? 34.766  -2.917  -2.779  1.00 0.00 ? 18  PRO A CA   6  
ATOM 9904  C C    . PRO A 1 18  ? 33.778  -2.276  -1.803  1.00 0.00 ? 18  PRO A C    6  
ATOM 9905  O O    . PRO A 1 18  ? 33.149  -2.969  -1.004  1.00 0.00 ? 18  PRO A O    6  
ATOM 9906  C CB   . PRO A 1 18  ? 34.165  -3.170  -4.152  1.00 0.00 ? 18  PRO A CB   6  
ATOM 9907  C CG   . PRO A 1 18  ? 33.850  -4.656  -4.203  1.00 0.00 ? 18  PRO A CG   6  
ATOM 9908  C CD   . PRO A 1 18  ? 34.568  -5.324  -3.042  1.00 0.00 ? 18  PRO A CD   6  
ATOM 9909  H HA   . PRO A 1 18  ? 35.547  -2.296  -2.825  1.00 0.00 ? 18  PRO A HA   6  
ATOM 9910  H HB2  . PRO A 1 18  ? 33.264  -2.575  -4.299  1.00 0.00 ? 18  PRO A HB2  6  
ATOM 9911  H HB3  . PRO A 1 18  ? 34.863  -2.891  -4.941  1.00 0.00 ? 18  PRO A HB3  6  
ATOM 9912  H HG2  . PRO A 1 18  ? 32.775  -4.821  -4.133  1.00 0.00 ? 18  PRO A HG2  6  
ATOM 9913  H HG3  . PRO A 1 18  ? 34.178  -5.083  -5.151  1.00 0.00 ? 18  PRO A HG3  6  
ATOM 9914  H HD2  . PRO A 1 18  ? 33.872  -5.878  -2.412  1.00 0.00 ? 18  PRO A HD2  6  
ATOM 9915  H HD3  . PRO A 1 18  ? 35.314  -6.036  -3.394  1.00 0.00 ? 18  PRO A HD3  6  
ATOM 9916  N N    . ILE A 1 19  ? 33.671  -0.958  -1.899  1.00 0.00 ? 19  ILE A N    6  
ATOM 9917  C CA   . ILE A 1 19  ? 32.770  -0.215  -1.035  1.00 0.00 ? 19  ILE A CA   6  
ATOM 9918  C C    . ILE A 1 19  ? 31.415  -0.925  -0.987  1.00 0.00 ? 19  ILE A C    6  
ATOM 9919  O O    . ILE A 1 19  ? 31.064  -1.662  -1.906  1.00 0.00 ? 19  ILE A O    6  
ATOM 9920  C CB   . ILE A 1 19  ? 32.684  1.246   -1.480  1.00 0.00 ? 19  ILE A CB   6  
ATOM 9921  C CG1  . ILE A 1 19  ? 33.965  2.004   -1.126  1.00 0.00 ? 19  ILE A CG1  6  
ATOM 9922  C CG2  . ILE A 1 19  ? 31.439  1.922   -0.903  1.00 0.00 ? 19  ILE A CG2  6  
ATOM 9923  C CD1  . ILE A 1 19  ? 34.430  2.871   -2.297  1.00 0.00 ? 19  ILE A CD1  6  
ATOM 9924  H H    . ILE A 1 19  ? 34.185  -0.402  -2.552  1.00 0.00 ? 19  ILE A H    6  
ATOM 9925  H HA   . ILE A 1 19  ? 33.199  -0.222  -0.033  1.00 0.00 ? 19  ILE A HA   6  
ATOM 9926  H HB   . ILE A 1 19  ? 32.587  1.267   -2.566  1.00 0.00 ? 19  ILE A HB   6  
ATOM 9927  H HG12 . ILE A 1 19  ? 33.790  2.630   -0.252  1.00 0.00 ? 19  ILE A HG12 6  
ATOM 9928  H HG13 . ILE A 1 19  ? 34.749  1.295   -0.859  1.00 0.00 ? 19  ILE A HG13 6  
ATOM 9929  H HG21 . ILE A 1 19  ? 31.422  1.790   0.179   1.00 0.00 ? 19  ILE A HG21 6  
ATOM 9930  H HG22 . ILE A 1 19  ? 31.462  2.987   -1.138  1.00 0.00 ? 19  ILE A HG22 6  
ATOM 9931  H HG23 . ILE A 1 19  ? 30.546  1.473   -1.338  1.00 0.00 ? 19  ILE A HG23 6  
ATOM 9932  H HD11 . ILE A 1 19  ? 33.990  3.865   -2.211  1.00 0.00 ? 19  ILE A HD11 6  
ATOM 9933  H HD12 . ILE A 1 19  ? 35.517  2.952   -2.280  1.00 0.00 ? 19  ILE A HD12 6  
ATOM 9934  H HD13 . ILE A 1 19  ? 34.115  2.414   -3.236  1.00 0.00 ? 19  ILE A HD13 6  
ATOM 9935  N N    . LEU A 1 20  ? 30.692  -0.677  0.095   1.00 0.00 ? 20  LEU A N    6  
ATOM 9936  C CA   . LEU A 1 20  ? 29.383  -1.283  0.275   1.00 0.00 ? 20  LEU A CA   6  
ATOM 9937  C C    . LEU A 1 20  ? 28.430  -0.756  -0.799  1.00 0.00 ? 20  LEU A C    6  
ATOM 9938  O O    . LEU A 1 20  ? 28.676  -0.929  -1.992  1.00 0.00 ? 20  LEU A O    6  
ATOM 9939  C CB   . LEU A 1 20  ? 28.882  -1.061  1.704   1.00 0.00 ? 20  LEU A CB   6  
ATOM 9940  C CG   . LEU A 1 20  ? 29.682  -1.752  2.810   1.00 0.00 ? 20  LEU A CG   6  
ATOM 9941  C CD1  . LEU A 1 20  ? 30.354  -3.024  2.288   1.00 0.00 ? 20  LEU A CD1  6  
ATOM 9942  C CD2  . LEU A 1 20  ? 30.690  -0.790  3.440   1.00 0.00 ? 20  LEU A CD2  6  
ATOM 9943  H H    . LEU A 1 20  ? 30.985  -0.076  0.838   1.00 0.00 ? 20  LEU A H    6  
ATOM 9944  H HA   . LEU A 1 20  ? 29.499  -2.358  0.137   1.00 0.00 ? 20  LEU A HA   6  
ATOM 9945  H HB2  . LEU A 1 20  ? 28.875  0.010   1.903   1.00 0.00 ? 20  LEU A HB2  6  
ATOM 9946  H HB3  . LEU A 1 20  ? 27.849  -1.403  1.762   1.00 0.00 ? 20  LEU A HB3  6  
ATOM 9947  H HG   . LEU A 1 20  ? 28.990  -2.053  3.596   1.00 0.00 ? 20  LEU A HG   6  
ATOM 9948  H HD11 . LEU A 1 20  ? 29.599  -3.683  1.859   1.00 0.00 ? 20  LEU A HD11 6  
ATOM 9949  H HD12 . LEU A 1 20  ? 31.084  -2.762  1.523   1.00 0.00 ? 20  LEU A HD12 6  
ATOM 9950  H HD13 . LEU A 1 20  ? 30.856  -3.534  3.110   1.00 0.00 ? 20  LEU A HD13 6  
ATOM 9951  H HD21 . LEU A 1 20  ? 31.094  -1.232  4.351   1.00 0.00 ? 20  LEU A HD21 6  
ATOM 9952  H HD22 . LEU A 1 20  ? 31.502  -0.601  2.737   1.00 0.00 ? 20  LEU A HD22 6  
ATOM 9953  H HD23 . LEU A 1 20  ? 30.193  0.150   3.682   1.00 0.00 ? 20  LEU A HD23 6  
ATOM 9954  N N    . GLU A 1 21  ? 27.361  -0.123  -0.338  1.00 0.00 ? 21  GLU A N    6  
ATOM 9955  C CA   . GLU A 1 21  ? 26.369  0.430   -1.245  1.00 0.00 ? 21  GLU A CA   6  
ATOM 9956  C C    . GLU A 1 21  ? 25.736  1.683   -0.638  1.00 0.00 ? 21  GLU A C    6  
ATOM 9957  O O    . GLU A 1 21  ? 25.236  1.649   0.485   1.00 0.00 ? 21  GLU A O    6  
ATOM 9958  C CB   . GLU A 1 21  ? 25.302  -0.611  -1.592  1.00 0.00 ? 21  GLU A CB   6  
ATOM 9959  C CG   . GLU A 1 21  ? 24.876  -1.394  -0.348  1.00 0.00 ? 21  GLU A CG   6  
ATOM 9960  C CD   . GLU A 1 21  ? 25.171  -2.886  -0.512  1.00 0.00 ? 21  GLU A CD   6  
ATOM 9961  O OE1  . GLU A 1 21  ? 24.436  -3.527  -1.294  1.00 0.00 ? 21  GLU A OE1  6  
ATOM 9962  O OE2  . GLU A 1 21  ? 26.124  -3.352  0.148   1.00 0.00 ? 21  GLU A OE2  6  
ATOM 9963  H H    . GLU A 1 21  ? 27.168  0.013   0.633   1.00 0.00 ? 21  GLU A H    6  
ATOM 9964  H HA   . GLU A 1 21  ? 26.918  0.693   -2.149  1.00 0.00 ? 21  GLU A HA   6  
ATOM 9965  H HB2  . GLU A 1 21  ? 24.435  -0.116  -2.029  1.00 0.00 ? 21  GLU A HB2  6  
ATOM 9966  H HB3  . GLU A 1 21  ? 25.690  -1.298  -2.343  1.00 0.00 ? 21  GLU A HB3  6  
ATOM 9967  H HG2  . GLU A 1 21  ? 25.401  -1.010  0.526   1.00 0.00 ? 21  GLU A HG2  6  
ATOM 9968  H HG3  . GLU A 1 21  ? 23.811  -1.247  -0.170  1.00 0.00 ? 21  GLU A HG3  6  
ATOM 9969  N N    . ARG A 1 22  ? 25.778  2.760   -1.408  1.00 0.00 ? 22  ARG A N    6  
ATOM 9970  C CA   . ARG A 1 22  ? 25.214  4.023   -0.961  1.00 0.00 ? 22  ARG A CA   6  
ATOM 9971  C C    . ARG A 1 22  ? 25.512  5.127   -1.977  1.00 0.00 ? 22  ARG A C    6  
ATOM 9972  O O    . ARG A 1 22  ? 26.440  5.912   -1.793  1.00 0.00 ? 22  ARG A O    6  
ATOM 9973  C CB   . ARG A 1 22  ? 25.781  4.427   0.401   1.00 0.00 ? 22  ARG A CB   6  
ATOM 9974  C CG   . ARG A 1 22  ? 24.690  4.416   1.474   1.00 0.00 ? 22  ARG A CG   6  
ATOM 9975  C CD   . ARG A 1 22  ? 25.012  5.409   2.593   1.00 0.00 ? 22  ARG A CD   6  
ATOM 9976  N NE   . ARG A 1 22  ? 23.805  6.195   2.933   1.00 0.00 ? 22  ARG A NE   6  
ATOM 9977  C CZ   . ARG A 1 22  ? 23.696  6.972   4.020   1.00 0.00 ? 22  ARG A CZ   6  
ATOM 9978  N NH1  . ARG A 1 22  ? 24.721  7.072   4.877   1.00 0.00 ? 22  ARG A NH1  6  
ATOM 9979  N NH2  . ARG A 1 22  ? 22.563  7.650   4.248   1.00 0.00 ? 22  ARG A NH2  6  
ATOM 9980  H H    . ARG A 1 22  ? 26.186  2.780   -2.321  1.00 0.00 ? 22  ARG A H    6  
ATOM 9981  H HA   . ARG A 1 22  ? 24.143  3.838   -0.885  1.00 0.00 ? 22  ARG A HA   6  
ATOM 9982  H HB2  . ARG A 1 22  ? 26.581  3.743   0.684   1.00 0.00 ? 22  ARG A HB2  6  
ATOM 9983  H HB3  . ARG A 1 22  ? 26.221  5.422   0.335   1.00 0.00 ? 22  ARG A HB3  6  
ATOM 9984  H HG2  . ARG A 1 22  ? 23.730  4.667   1.024   1.00 0.00 ? 22  ARG A HG2  6  
ATOM 9985  H HG3  . ARG A 1 22  ? 24.595  3.413   1.890   1.00 0.00 ? 22  ARG A HG3  6  
ATOM 9986  H HD2  . ARG A 1 22  ? 25.368  4.876   3.473   1.00 0.00 ? 22  ARG A HD2  6  
ATOM 9987  H HD3  . ARG A 1 22  ? 25.814  6.077   2.278   1.00 0.00 ? 22  ARG A HD3  6  
ATOM 9988  H HE   . ARG A 1 22  ? 23.021  6.143   2.314   1.00 0.00 ? 22  ARG A HE   6  
ATOM 9989  H HH11 . ARG A 1 22  ? 25.567  6.567   4.706   1.00 0.00 ? 22  ARG A HH11 6  
ATOM 9990  H HH12 . ARG A 1 22  ? 24.640  7.652   5.688   1.00 0.00 ? 22  ARG A HH12 6  
ATOM 9991  H HH21 . ARG A 1 22  ? 21.798  7.575   3.608   1.00 0.00 ? 22  ARG A HH21 6  
ATOM 9992  H HH22 . ARG A 1 22  ? 22.482  8.230   5.059   1.00 0.00 ? 22  ARG A HH22 6  
ATOM 9993  N N    . THR A 1 23  ? 24.706  5.152   -3.029  1.00 0.00 ? 23  THR A N    6  
ATOM 9994  C CA   . THR A 1 23  ? 24.871  6.147   -4.075  1.00 0.00 ? 23  THR A CA   6  
ATOM 9995  C C    . THR A 1 23  ? 24.356  7.508   -3.603  1.00 0.00 ? 23  THR A C    6  
ATOM 9996  O O    . THR A 1 23  ? 25.143  8.411   -3.325  1.00 0.00 ? 23  THR A O    6  
ATOM 9997  C CB   . THR A 1 23  ? 24.166  5.633   -5.332  1.00 0.00 ? 23  THR A CB   6  
ATOM 9998  O OG1  . THR A 1 23  ? 25.136  4.797   -5.957  1.00 0.00 ? 23  THR A OG1  6  
ATOM 9999  C CG2  . THR A 1 23  ? 23.914  6.741   -6.356  1.00 0.00 ? 23  THR A CG2  6  
ATOM 10000 H H    . THR A 1 23  ? 23.953  4.510   -3.172  1.00 0.00 ? 23  THR A H    6  
ATOM 10001 H HA   . THR A 1 23  ? 25.936  6.260   -4.276  1.00 0.00 ? 23  THR A HA   6  
ATOM 10002 H HB   . THR A 1 23  ? 23.239  5.121   -5.076  1.00 0.00 ? 23  THR A HB   6  
ATOM 10003 H HG1  . THR A 1 23  ? 24.878  3.837   -5.852  1.00 0.00 ? 23  THR A HG1  6  
ATOM 10004 H HG21 . THR A 1 23  ? 23.070  7.351   -6.032  1.00 0.00 ? 23  THR A HG21 6  
ATOM 10005 H HG22 . THR A 1 23  ? 24.803  7.366   -6.441  1.00 0.00 ? 23  THR A HG22 6  
ATOM 10006 H HG23 . THR A 1 23  ? 23.689  6.296   -7.325  1.00 0.00 ? 23  THR A HG23 6  
ATOM 10007 N N    . LEU A 1 24  ? 23.037  7.612   -3.526  1.00 0.00 ? 24  LEU A N    6  
ATOM 10008 C CA   . LEU A 1 24  ? 22.408  8.847   -3.093  1.00 0.00 ? 24  LEU A CA   6  
ATOM 10009 C C    . LEU A 1 24  ? 21.275  8.522   -2.116  1.00 0.00 ? 24  LEU A C    6  
ATOM 10010 O O    . LEU A 1 24  ? 20.745  7.412   -2.123  1.00 0.00 ? 24  LEU A O    6  
ATOM 10011 C CB   . LEU A 1 24  ? 21.960  9.673   -4.300  1.00 0.00 ? 24  LEU A CB   6  
ATOM 10012 C CG   . LEU A 1 24  ? 23.068  10.113  -5.260  1.00 0.00 ? 24  LEU A CG   6  
ATOM 10013 C CD1  . LEU A 1 24  ? 22.479  10.717  -6.536  1.00 0.00 ? 24  LEU A CD1  6  
ATOM 10014 C CD2  . LEU A 1 24  ? 24.043  11.069  -4.570  1.00 0.00 ? 24  LEU A CD2  6  
ATOM 10015 H H    . LEU A 1 24  ? 22.404  6.872   -3.754  1.00 0.00 ? 24  LEU A H    6  
ATOM 10016 H HA   . LEU A 1 24  ? 23.162  9.431   -2.565  1.00 0.00 ? 24  LEU A HA   6  
ATOM 10017 H HB2  . LEU A 1 24  ? 21.229  9.092   -4.862  1.00 0.00 ? 24  LEU A HB2  6  
ATOM 10018 H HB3  . LEU A 1 24  ? 21.447  10.563  -3.936  1.00 0.00 ? 24  LEU A HB3  6  
ATOM 10019 H HG   . LEU A 1 24  ? 23.636  9.230   -5.553  1.00 0.00 ? 24  LEU A HG   6  
ATOM 10020 H HD11 . LEU A 1 24  ? 22.875  10.188  -7.404  1.00 0.00 ? 24  LEU A HD11 6  
ATOM 10021 H HD12 . LEU A 1 24  ? 21.394  10.622  -6.517  1.00 0.00 ? 24  LEU A HD12 6  
ATOM 10022 H HD13 . LEU A 1 24  ? 22.750  11.771  -6.598  1.00 0.00 ? 24  LEU A HD13 6  
ATOM 10023 H HD21 . LEU A 1 24  ? 24.657  11.566  -5.321  1.00 0.00 ? 24  LEU A HD21 6  
ATOM 10024 H HD22 . LEU A 1 24  ? 23.483  11.816  -4.008  1.00 0.00 ? 24  LEU A HD22 6  
ATOM 10025 H HD23 . LEU A 1 24  ? 24.683  10.507  -3.890  1.00 0.00 ? 24  LEU A HD23 6  
ATOM 10026 N N    . ASP A 1 25  ? 20.939  9.510   -1.300  1.00 0.00 ? 25  ASP A N    6  
ATOM 10027 C CA   . ASP A 1 25  ? 19.879  9.343   -0.320  1.00 0.00 ? 25  ASP A CA   6  
ATOM 10028 C C    . ASP A 1 25  ? 18.626  10.078  -0.800  1.00 0.00 ? 25  ASP A C    6  
ATOM 10029 O O    . ASP A 1 25  ? 18.574  11.307  -0.772  1.00 0.00 ? 25  ASP A O    6  
ATOM 10030 C CB   . ASP A 1 25  ? 20.283  9.931   1.033   1.00 0.00 ? 25  ASP A CB   6  
ATOM 10031 C CG   . ASP A 1 25  ? 21.289  11.082  0.964   1.00 0.00 ? 25  ASP A CG   6  
ATOM 10032 O OD1  . ASP A 1 25  ? 21.398  11.675  -0.131  1.00 0.00 ? 25  ASP A OD1  6  
ATOM 10033 O OD2  . ASP A 1 25  ? 21.925  11.343  2.008   1.00 0.00 ? 25  ASP A OD2  6  
ATOM 10034 H H    . ASP A 1 25  ? 21.375  10.410  -1.302  1.00 0.00 ? 25  ASP A H    6  
ATOM 10035 H HA   . ASP A 1 25  ? 19.727  8.267   -0.243  1.00 0.00 ? 25  ASP A HA   6  
ATOM 10036 H HB2  . ASP A 1 25  ? 19.386  10.282  1.543   1.00 0.00 ? 25  ASP A HB2  6  
ATOM 10037 H HB3  . ASP A 1 25  ? 20.707  9.135   1.646   1.00 0.00 ? 25  ASP A HB3  6  
ATOM 10038 N N    . ASP A 1 26  ? 17.647  9.295   -1.228  1.00 0.00 ? 26  ASP A N    6  
ATOM 10039 C CA   . ASP A 1 26  ? 16.397  9.857   -1.713  1.00 0.00 ? 26  ASP A CA   6  
ATOM 10040 C C    . ASP A 1 26  ? 15.372  8.734   -1.887  1.00 0.00 ? 26  ASP A C    6  
ATOM 10041 O O    . ASP A 1 26  ? 15.741  7.578   -2.087  1.00 0.00 ? 26  ASP A O    6  
ATOM 10042 C CB   . ASP A 1 26  ? 16.589  10.537  -3.070  1.00 0.00 ? 26  ASP A CB   6  
ATOM 10043 C CG   . ASP A 1 26  ? 18.031  10.930  -3.398  1.00 0.00 ? 26  ASP A CG   6  
ATOM 10044 O OD1  . ASP A 1 26  ? 18.842  9.999   -3.595  1.00 0.00 ? 26  ASP A OD1  6  
ATOM 10045 O OD2  . ASP A 1 26  ? 18.289  12.152  -3.445  1.00 0.00 ? 26  ASP A OD2  6  
ATOM 10046 H H    . ASP A 1 26  ? 17.697  8.297   -1.247  1.00 0.00 ? 26  ASP A H    6  
ATOM 10047 H HA   . ASP A 1 26  ? 16.097  10.582  -0.957  1.00 0.00 ? 26  ASP A HA   6  
ATOM 10048 H HB2  . ASP A 1 26  ? 16.224  9.868   -3.849  1.00 0.00 ? 26  ASP A HB2  6  
ATOM 10049 H HB3  . ASP A 1 26  ? 15.968  11.432  -3.102  1.00 0.00 ? 26  ASP A HB3  6  
ATOM 10050 N N    . VAL A 1 27  ? 14.106  9.115   -1.805  1.00 0.00 ? 27  VAL A N    6  
ATOM 10051 C CA   . VAL A 1 27  ? 13.025  8.155   -1.951  1.00 0.00 ? 27  VAL A CA   6  
ATOM 10052 C C    . VAL A 1 27  ? 13.022  7.611   -3.381  1.00 0.00 ? 27  VAL A C    6  
ATOM 10053 O O    . VAL A 1 27  ? 13.585  8.227   -4.284  1.00 0.00 ? 27  VAL A O    6  
ATOM 10054 C CB   . VAL A 1 27  ? 11.696  8.799   -1.553  1.00 0.00 ? 27  VAL A CB   6  
ATOM 10055 C CG1  . VAL A 1 27  ? 11.559  8.881   -0.031  1.00 0.00 ? 27  VAL A CG1  6  
ATOM 10056 C CG2  . VAL A 1 27  ? 11.543  10.181  -2.193  1.00 0.00 ? 27  VAL A CG2  6  
ATOM 10057 H H    . VAL A 1 27  ? 13.815  10.058  -1.642  1.00 0.00 ? 27  VAL A H    6  
ATOM 10058 H HA   . VAL A 1 27  ? 13.221  7.332   -1.263  1.00 0.00 ? 27  VAL A HA   6  
ATOM 10059 H HB   . VAL A 1 27  ? 10.891  8.166   -1.928  1.00 0.00 ? 27  VAL A HB   6  
ATOM 10060 H HG11 . VAL A 1 27  ? 10.503  8.902   0.238   1.00 0.00 ? 27  VAL A HG11 6  
ATOM 10061 H HG12 . VAL A 1 27  ? 12.033  8.011   0.423   1.00 0.00 ? 27  VAL A HG12 6  
ATOM 10062 H HG13 . VAL A 1 27  ? 12.044  9.788   0.328   1.00 0.00 ? 27  VAL A HG13 6  
ATOM 10063 H HG21 . VAL A 1 27  ? 10.485  10.401  -2.334  1.00 0.00 ? 27  VAL A HG21 6  
ATOM 10064 H HG22 . VAL A 1 27  ? 11.987  10.933  -1.541  1.00 0.00 ? 27  VAL A HG22 6  
ATOM 10065 H HG23 . VAL A 1 27  ? 12.048  10.192  -3.158  1.00 0.00 ? 27  VAL A HG23 6  
ATOM 10066 N N    . PRO A 1 28  ? 12.365  6.432   -3.545  1.00 0.00 ? 28  PRO A N    6  
ATOM 10067 C CA   . PRO A 1 28  ? 12.281  5.798   -4.850  1.00 0.00 ? 28  PRO A CA   6  
ATOM 10068 C C    . PRO A 1 28  ? 11.277  6.523   -5.749  1.00 0.00 ? 28  PRO A C    6  
ATOM 10069 O O    . PRO A 1 28  ? 10.644  7.489   -5.325  1.00 0.00 ? 28  PRO A O    6  
ATOM 10070 C CB   . PRO A 1 28  ? 11.888  4.357   -4.563  1.00 0.00 ? 28  PRO A CB   6  
ATOM 10071 C CG   . PRO A 1 28  ? 11.316  4.354   -3.155  1.00 0.00 ? 28  PRO A CG   6  
ATOM 10072 C CD   . PRO A 1 28  ? 11.686  5.674   -2.498  1.00 0.00 ? 28  PRO A CD   6  
ATOM 10073 H HA   . PRO A 1 28  ? 13.161  5.855   -5.321  1.00 0.00 ? 28  PRO A HA   6  
ATOM 10074 H HB2  . PRO A 1 28  ? 11.153  4.001   -5.285  1.00 0.00 ? 28  PRO A HB2  6  
ATOM 10075 H HB3  . PRO A 1 28  ? 12.752  3.696   -4.636  1.00 0.00 ? 28  PRO A HB3  6  
ATOM 10076 H HG2  . PRO A 1 28  ? 10.233  4.232   -3.183  1.00 0.00 ? 28  PRO A HG2  6  
ATOM 10077 H HG3  . PRO A 1 28  ? 11.716  3.517   -2.582  1.00 0.00 ? 28  PRO A HG3  6  
ATOM 10078 H HD2  . PRO A 1 28  ? 10.801  6.199   -2.139  1.00 0.00 ? 28  PRO A HD2  6  
ATOM 10079 H HD3  . PRO A 1 28  ? 12.336  5.519   -1.637  1.00 0.00 ? 28  PRO A HD3  6  
ATOM 10080 N N    . GLY A 1 29  ? 11.162  6.029   -6.973  1.00 0.00 ? 29  GLY A N    6  
ATOM 10081 C CA   . GLY A 1 29  ? 10.246  6.618   -7.935  1.00 0.00 ? 29  GLY A CA   6  
ATOM 10082 C C    . GLY A 1 29  ? 8.914   5.866   -7.954  1.00 0.00 ? 29  GLY A C    6  
ATOM 10083 O O    . GLY A 1 29  ? 8.655   5.032   -7.088  1.00 0.00 ? 29  GLY A O    6  
ATOM 10084 H H    . GLY A 1 29  ? 11.681  5.243   -7.310  1.00 0.00 ? 29  GLY A H    6  
ATOM 10085 H HA2  . GLY A 1 29  ? 10.074  7.665   -7.684  1.00 0.00 ? 29  GLY A HA2  6  
ATOM 10086 H HA3  . GLY A 1 29  ? 10.694  6.598   -8.928  1.00 0.00 ? 29  GLY A HA3  6  
ATOM 10087 N N    . PRO A 1 30  ? 8.082   6.197   -8.978  1.00 0.00 ? 30  PRO A N    6  
ATOM 10088 C CA   . PRO A 1 30  ? 6.783   5.563   -9.121  1.00 0.00 ? 30  PRO A CA   6  
ATOM 10089 C C    . PRO A 1 30  ? 6.925   4.135   -9.653  1.00 0.00 ? 30  PRO A C    6  
ATOM 10090 O O    . PRO A 1 30  ? 7.710   3.885   -10.567 1.00 0.00 ? 30  PRO A O    6  
ATOM 10091 C CB   . PRO A 1 30  ? 6.003   6.471   -10.059 1.00 0.00 ? 30  PRO A CB   6  
ATOM 10092 C CG   . PRO A 1 30  ? 7.040   7.325   -10.770 1.00 0.00 ? 30  PRO A CG   6  
ATOM 10093 C CD   . PRO A 1 30  ? 8.355   7.180   -10.022 1.00 0.00 ? 30  PRO A CD   6  
ATOM 10094 H HA   . PRO A 1 30  ? 6.337   5.479   -8.230  1.00 0.00 ? 30  PRO A HA   6  
ATOM 10095 H HB2  . PRO A 1 30  ? 5.421   5.888   -10.773 1.00 0.00 ? 30  PRO A HB2  6  
ATOM 10096 H HB3  . PRO A 1 30  ? 5.299   7.092   -9.505  1.00 0.00 ? 30  PRO A HB3  6  
ATOM 10097 H HG2  . PRO A 1 30  ? 7.153   7.004   -11.806 1.00 0.00 ? 30  PRO A HG2  6  
ATOM 10098 H HG3  . PRO A 1 30  ? 6.726   8.368   -10.792 1.00 0.00 ? 30  PRO A HG3  6  
ATOM 10099 H HD2  . PRO A 1 30  ? 9.153   6.844   -10.684 1.00 0.00 ? 30  PRO A HD2  6  
ATOM 10100 H HD3  . PRO A 1 30  ? 8.675   8.132   -9.596  1.00 0.00 ? 30  PRO A HD3  6  
ATOM 10101 N N    . PRO A 1 31  ? 6.134   3.213   -9.042  1.00 0.00 ? 31  PRO A N    6  
ATOM 10102 C CA   . PRO A 1 31  ? 6.165   1.817   -9.445  1.00 0.00 ? 31  PRO A CA   6  
ATOM 10103 C C    . PRO A 1 31  ? 5.435   1.613   -10.774 1.00 0.00 ? 31  PRO A C    6  
ATOM 10104 O O    . PRO A 1 31  ? 4.213   1.739   -10.842 1.00 0.00 ? 31  PRO A O    6  
ATOM 10105 C CB   . PRO A 1 31  ? 5.522   1.062   -8.293  1.00 0.00 ? 31  PRO A CB   6  
ATOM 10106 C CG   . PRO A 1 31  ? 4.740   2.096   -7.501  1.00 0.00 ? 31  PRO A CG   6  
ATOM 10107 C CD   . PRO A 1 31  ? 5.193   3.474   -7.957  1.00 0.00 ? 31  PRO A CD   6  
ATOM 10108 H HA   . PRO A 1 31  ? 7.107   1.522   -9.602  1.00 0.00 ? 31  PRO A HA   6  
ATOM 10109 H HB2  . PRO A 1 31  ? 4.866   0.273   -8.661  1.00 0.00 ? 31  PRO A HB2  6  
ATOM 10110 H HB3  . PRO A 1 31  ? 6.278   0.582   -7.670  1.00 0.00 ? 31  PRO A HB3  6  
ATOM 10111 H HG2  . PRO A 1 31  ? 3.669   1.973   -7.665  1.00 0.00 ? 31  PRO A HG2  6  
ATOM 10112 H HG3  . PRO A 1 31  ? 4.915   1.971   -6.432  1.00 0.00 ? 31  PRO A HG3  6  
ATOM 10113 H HD2  . PRO A 1 31  ? 4.351   4.075   -8.299  1.00 0.00 ? 31  PRO A HD2  6  
ATOM 10114 H HD3  . PRO A 1 31  ? 5.668   4.023   -7.145  1.00 0.00 ? 31  PRO A HD3  6  
ATOM 10115 N N    . MET A 1 32  ? 6.215   1.303   -11.799 1.00 0.00 ? 32  MET A N    6  
ATOM 10116 C CA   . MET A 1 32  ? 5.659   1.080   -13.123 1.00 0.00 ? 32  MET A CA   6  
ATOM 10117 C C    . MET A 1 32  ? 5.323   -0.397  -13.335 1.00 0.00 ? 32  MET A C    6  
ATOM 10118 O O    . MET A 1 32  ? 5.823   -1.261  -12.616 1.00 0.00 ? 32  MET A O    6  
ATOM 10119 C CB   . MET A 1 32  ? 6.666   1.533   -14.182 1.00 0.00 ? 32  MET A CB   6  
ATOM 10120 C CG   . MET A 1 32  ? 8.001   0.805   -14.016 1.00 0.00 ? 32  MET A CG   6  
ATOM 10121 S SD   . MET A 1 32  ? 8.878   0.775   -15.570 1.00 0.00 ? 32  MET A SD   6  
ATOM 10122 C CE   . MET A 1 32  ? 10.556  0.631   -14.977 1.00 0.00 ? 32  MET A CE   6  
ATOM 10123 H H    . MET A 1 32  ? 7.208   1.202   -11.736 1.00 0.00 ? 32  MET A H    6  
ATOM 10124 H HA   . MET A 1 32  ? 4.747   1.677   -13.161 1.00 0.00 ? 32  MET A HA   6  
ATOM 10125 H HB2  . MET A 1 32  ? 6.264   1.339   -15.177 1.00 0.00 ? 32  MET A HB2  6  
ATOM 10126 H HB3  . MET A 1 32  ? 6.822   2.609   -14.105 1.00 0.00 ? 32  MET A HB3  6  
ATOM 10127 H HG2  . MET A 1 32  ? 8.605   1.304   -13.258 1.00 0.00 ? 32  MET A HG2  6  
ATOM 10128 H HG3  . MET A 1 32  ? 7.829   -0.213  -13.666 1.00 0.00 ? 32  MET A HG3  6  
ATOM 10129 H HE1  . MET A 1 32  ? 11.201  0.295   -15.788 1.00 0.00 ? 32  MET A HE1  6  
ATOM 10130 H HE2  . MET A 1 32  ? 10.899  1.601   -14.618 1.00 0.00 ? 32  MET A HE2  6  
ATOM 10131 H HE3  . MET A 1 32  ? 10.592  -0.092  -14.161 1.00 0.00 ? 32  MET A HE3  6  
ATOM 10132 N N    . GLY A 1 33  ? 4.477   -0.642  -14.325 1.00 0.00 ? 33  GLY A N    6  
ATOM 10133 C CA   . GLY A 1 33  ? 4.068   -2.000  -14.642 1.00 0.00 ? 33  GLY A CA   6  
ATOM 10134 C C    . GLY A 1 33  ? 2.866   -2.422  -13.794 1.00 0.00 ? 33  GLY A C    6  
ATOM 10135 O O    . GLY A 1 33  ? 2.819   -3.545  -13.294 1.00 0.00 ? 33  GLY A O    6  
ATOM 10136 H H    . GLY A 1 33  ? 4.075   0.066   -14.905 1.00 0.00 ? 33  GLY A H    6  
ATOM 10137 H HA2  . GLY A 1 33  ? 3.814   -2.070  -15.699 1.00 0.00 ? 33  GLY A HA2  6  
ATOM 10138 H HA3  . GLY A 1 33  ? 4.899   -2.684  -14.467 1.00 0.00 ? 33  GLY A HA3  6  
ATOM 10139 N N    . ILE A 1 34  ? 1.925   -1.500  -13.659 1.00 0.00 ? 34  ILE A N    6  
ATOM 10140 C CA   . ILE A 1 34  ? 0.726   -1.762  -12.881 1.00 0.00 ? 34  ILE A CA   6  
ATOM 10141 C C    . ILE A 1 34  ? -0.335  -2.394  -13.784 1.00 0.00 ? 34  ILE A C    6  
ATOM 10142 O O    . ILE A 1 34  ? -0.968  -1.703  -14.581 1.00 0.00 ? 34  ILE A O    6  
ATOM 10143 C CB   . ILE A 1 34  ? 0.255   -0.488  -12.176 1.00 0.00 ? 34  ILE A CB   6  
ATOM 10144 C CG1  . ILE A 1 34  ? 1.445   0.346   -11.697 1.00 0.00 ? 34  ILE A CG1  6  
ATOM 10145 C CG2  . ILE A 1 34  ? -0.711  -0.817  -11.036 1.00 0.00 ? 34  ILE A CG2  6  
ATOM 10146 C CD1  . ILE A 1 34  ? 2.362   -0.478  -10.790 1.00 0.00 ? 34  ILE A CD1  6  
ATOM 10147 H H    . ILE A 1 34  ? 1.971   -0.589  -14.069 1.00 0.00 ? 34  ILE A H    6  
ATOM 10148 H HA   . ILE A 1 34  ? 0.991   -2.480  -12.105 1.00 0.00 ? 34  ILE A HA   6  
ATOM 10149 H HB   . ILE A 1 34  ? -0.293  0.118   -12.898 1.00 0.00 ? 34  ILE A HB   6  
ATOM 10150 H HG12 . ILE A 1 34  ? 2.009   0.709   -12.556 1.00 0.00 ? 34  ILE A HG12 6  
ATOM 10151 H HG13 . ILE A 1 34  ? 1.086   1.222   -11.157 1.00 0.00 ? 34  ILE A HG13 6  
ATOM 10152 H HG21 . ILE A 1 34  ? -0.693  -0.012  -10.302 1.00 0.00 ? 34  ILE A HG21 6  
ATOM 10153 H HG22 . ILE A 1 34  ? -1.720  -0.923  -11.435 1.00 0.00 ? 34  ILE A HG22 6  
ATOM 10154 H HG23 . ILE A 1 34  ? -0.408  -1.750  -10.561 1.00 0.00 ? 34  ILE A HG23 6  
ATOM 10155 H HD11 . ILE A 1 34  ? 3.354   -0.542  -11.238 1.00 0.00 ? 34  ILE A HD11 6  
ATOM 10156 H HD12 . ILE A 1 34  ? 2.434   0.002   -9.814  1.00 0.00 ? 34  ILE A HD12 6  
ATOM 10157 H HD13 . ILE A 1 34  ? 1.951   -1.481  -10.673 1.00 0.00 ? 34  ILE A HD13 6  
ATOM 10158 N N    . LEU A 1 35  ? -0.497  -3.699  -13.628 1.00 0.00 ? 35  LEU A N    6  
ATOM 10159 C CA   . LEU A 1 35  ? -1.471  -4.432  -14.420 1.00 0.00 ? 35  LEU A CA   6  
ATOM 10160 C C    . LEU A 1 35  ? -2.348  -5.274  -13.491 1.00 0.00 ? 35  LEU A C    6  
ATOM 10161 O O    . LEU A 1 35  ? -1.952  -5.579  -12.366 1.00 0.00 ? 35  LEU A O    6  
ATOM 10162 C CB   . LEU A 1 35  ? -0.772  -5.246  -15.510 1.00 0.00 ? 35  LEU A CB   6  
ATOM 10163 C CG   . LEU A 1 35  ? 0.019   -4.442  -16.545 1.00 0.00 ? 35  LEU A CG   6  
ATOM 10164 C CD1  . LEU A 1 35  ? -0.899  -3.499  -17.324 1.00 0.00 ? 35  LEU A CD1  6  
ATOM 10165 C CD2  . LEU A 1 35  ? 1.182   -3.697  -15.887 1.00 0.00 ? 35  LEU A CD2  6  
ATOM 10166 H H    . LEU A 1 35  ? 0.021   -4.254  -12.977 1.00 0.00 ? 35  LEU A H    6  
ATOM 10167 H HA   . LEU A 1 35  ? -2.103  -3.699  -14.920 1.00 0.00 ? 35  LEU A HA   6  
ATOM 10168 H HB2  . LEU A 1 35  ? -0.092  -5.951  -15.031 1.00 0.00 ? 35  LEU A HB2  6  
ATOM 10169 H HB3  . LEU A 1 35  ? -1.524  -5.835  -16.035 1.00 0.00 ? 35  LEU A HB3  6  
ATOM 10170 H HG   . LEU A 1 35  ? 0.449   -5.140  -17.264 1.00 0.00 ? 35  LEU A HG   6  
ATOM 10171 H HD11 . LEU A 1 35  ? -0.831  -2.495  -16.903 1.00 0.00 ? 35  LEU A HD11 6  
ATOM 10172 H HD12 . LEU A 1 35  ? -0.594  -3.476  -18.370 1.00 0.00 ? 35  LEU A HD12 6  
ATOM 10173 H HD13 . LEU A 1 35  ? -1.928  -3.852  -17.254 1.00 0.00 ? 35  LEU A HD13 6  
ATOM 10174 H HD21 . LEU A 1 35  ? 0.933   -2.639  -15.801 1.00 0.00 ? 35  LEU A HD21 6  
ATOM 10175 H HD22 . LEU A 1 35  ? 1.364   -4.110  -14.895 1.00 0.00 ? 35  LEU A HD22 6  
ATOM 10176 H HD23 . LEU A 1 35  ? 2.078   -3.811  -16.498 1.00 0.00 ? 35  LEU A HD23 6  
ATOM 10177 N N    . PHE A 1 36  ? -3.521  -5.626  -13.994 1.00 0.00 ? 36  PHE A N    6  
ATOM 10178 C CA   . PHE A 1 36  ? -4.457  -6.426  -13.224 1.00 0.00 ? 36  PHE A CA   6  
ATOM 10179 C C    . PHE A 1 36  ? -4.784  -7.735  -13.946 1.00 0.00 ? 36  PHE A C    6  
ATOM 10180 O O    . PHE A 1 36  ? -5.685  -7.779  -14.781 1.00 0.00 ? 36  PHE A O    6  
ATOM 10181 C CB   . PHE A 1 36  ? -5.739  -5.603  -13.081 1.00 0.00 ? 36  PHE A CB   6  
ATOM 10182 C CG   . PHE A 1 36  ? -5.609  -4.408  -12.135 1.00 0.00 ? 36  PHE A CG   6  
ATOM 10183 C CD1  . PHE A 1 36  ? -5.188  -3.206  -12.612 1.00 0.00 ? 36  PHE A CD1  6  
ATOM 10184 C CD2  . PHE A 1 36  ? -5.914  -4.547  -10.817 1.00 0.00 ? 36  PHE A CD2  6  
ATOM 10185 C CE1  . PHE A 1 36  ? -5.067  -2.096  -11.734 1.00 0.00 ? 36  PHE A CE1  6  
ATOM 10186 C CE2  . PHE A 1 36  ? -5.793  -3.438  -9.939  1.00 0.00 ? 36  PHE A CE2  6  
ATOM 10187 C CZ   . PHE A 1 36  ? -5.372  -2.236  -10.416 1.00 0.00 ? 36  PHE A CZ   6  
ATOM 10188 H H    . PHE A 1 36  ? -3.835  -5.373  -14.910 1.00 0.00 ? 36  PHE A H    6  
ATOM 10189 H HA   . PHE A 1 36  ? -3.982  -6.649  -12.268 1.00 0.00 ? 36  PHE A HA   6  
ATOM 10190 H HB2  . PHE A 1 36  ? -6.039  -5.243  -14.065 1.00 0.00 ? 36  PHE A HB2  6  
ATOM 10191 H HB3  . PHE A 1 36  ? -6.538  -6.252  -12.722 1.00 0.00 ? 36  PHE A HB3  6  
ATOM 10192 H HD1  . PHE A 1 36  ? -4.943  -3.094  -13.668 1.00 0.00 ? 36  PHE A HD1  6  
ATOM 10193 H HD2  . PHE A 1 36  ? -6.251  -5.510  -10.435 1.00 0.00 ? 36  PHE A HD2  6  
ATOM 10194 H HE1  . PHE A 1 36  ? -4.730  -1.133  -12.116 1.00 0.00 ? 36  PHE A HE1  6  
ATOM 10195 H HE2  . PHE A 1 36  ? -6.038  -3.549  -8.883  1.00 0.00 ? 36  PHE A HE2  6  
ATOM 10196 H HZ   . PHE A 1 36  ? -5.279  -1.384  -9.742  1.00 0.00 ? 36  PHE A HZ   6  
ATOM 10197 N N    . PRO A 1 37  ? -4.012  -8.797  -13.588 1.00 0.00 ? 37  PRO A N    6  
ATOM 10198 C CA   . PRO A 1 37  ? -4.210  -10.103 -14.192 1.00 0.00 ? 37  PRO A CA   6  
ATOM 10199 C C    . PRO A 1 37  ? -5.463  -10.781 -13.634 1.00 0.00 ? 37  PRO A C    6  
ATOM 10200 O O    . PRO A 1 37  ? -6.306  -11.257 -14.393 1.00 0.00 ? 37  PRO A O    6  
ATOM 10201 C CB   . PRO A 1 37  ? -2.935  -10.873 -13.891 1.00 0.00 ? 37  PRO A CB   6  
ATOM 10202 C CG   . PRO A 1 37  ? -2.266  -10.139 -12.740 1.00 0.00 ? 37  PRO A CG   6  
ATOM 10203 C CD   . PRO A 1 37  ? -2.936  -8.781  -12.602 1.00 0.00 ? 37  PRO A CD   6  
ATOM 10204 H HA   . PRO A 1 37  ? -4.365  -10.011 -15.176 1.00 0.00 ? 37  PRO A HA   6  
ATOM 10205 H HB2  . PRO A 1 37  ? -3.156  -11.905 -13.620 1.00 0.00 ? 37  PRO A HB2  6  
ATOM 10206 H HB3  . PRO A 1 37  ? -2.283  -10.906 -14.765 1.00 0.00 ? 37  PRO A HB3  6  
ATOM 10207 H HG2  . PRO A 1 37  ? -2.364  -10.709 -11.816 1.00 0.00 ? 37  PRO A HG2  6  
ATOM 10208 H HG3  . PRO A 1 37  ? -1.199  -10.021 -12.931 1.00 0.00 ? 37  PRO A HG3  6  
ATOM 10209 H HD2  . PRO A 1 37  ? -3.323  -8.632  -11.594 1.00 0.00 ? 37  PRO A HD2  6  
ATOM 10210 H HD3  . PRO A 1 37  ? -2.232  -7.971  -12.796 1.00 0.00 ? 37  PRO A HD3  6  
ATOM 10211 N N    . GLU A 1 38  ? -5.546  -10.804 -12.312 1.00 0.00 ? 38  GLU A N    6  
ATOM 10212 C CA   . GLU A 1 38  ? -6.682  -11.416 -11.644 1.00 0.00 ? 38  GLU A CA   6  
ATOM 10213 C C    . GLU A 1 38  ? -7.426  -10.376 -10.803 1.00 0.00 ? 38  GLU A C    6  
ATOM 10214 O O    . GLU A 1 38  ? -6.901  -9.892  -9.801  1.00 0.00 ? 38  GLU A O    6  
ATOM 10215 C CB   . GLU A 1 38  ? -6.239  -12.601 -10.784 1.00 0.00 ? 38  GLU A CB   6  
ATOM 10216 C CG   . GLU A 1 38  ? -7.424  -13.200 -10.023 1.00 0.00 ? 38  GLU A CG   6  
ATOM 10217 C CD   . GLU A 1 38  ? -6.960  -14.295 -9.061  1.00 0.00 ? 38  GLU A CD   6  
ATOM 10218 O OE1  . GLU A 1 38  ? -6.039  -14.001 -8.268  1.00 0.00 ? 38  GLU A OE1  6  
ATOM 10219 O OE2  . GLU A 1 38  ? -7.537  -15.401 -9.140  1.00 0.00 ? 38  GLU A OE2  6  
ATOM 10220 H H    . GLU A 1 38  ? -4.856  -10.415 -11.702 1.00 0.00 ? 38  GLU A H    6  
ATOM 10221 H HA   . GLU A 1 38  ? -7.329  -11.776 -12.443 1.00 0.00 ? 38  GLU A HA   6  
ATOM 10222 H HB2  . GLU A 1 38  ? -5.786  -13.364 -11.417 1.00 0.00 ? 38  GLU A HB2  6  
ATOM 10223 H HB3  . GLU A 1 38  ? -5.474  -12.278 -10.078 1.00 0.00 ? 38  GLU A HB3  6  
ATOM 10224 H HG2  . GLU A 1 38  ? -7.937  -12.416 -9.467  1.00 0.00 ? 38  GLU A HG2  6  
ATOM 10225 H HG3  . GLU A 1 38  ? -8.143  -13.613 -10.730 1.00 0.00 ? 38  GLU A HG3  6  
ATOM 10226 N N    . VAL A 1 39  ? -8.637  -10.065 -11.240 1.00 0.00 ? 39  VAL A N    6  
ATOM 10227 C CA   . VAL A 1 39  ? -9.458  -9.092  -10.540 1.00 0.00 ? 39  VAL A CA   6  
ATOM 10228 C C    . VAL A 1 39  ? -10.909 -9.577  -10.518 1.00 0.00 ? 39  VAL A C    6  
ATOM 10229 O O    . VAL A 1 39  ? -11.521 -9.762  -11.569 1.00 0.00 ? 39  VAL A O    6  
ATOM 10230 C CB   . VAL A 1 39  ? -9.298  -7.713  -11.183 1.00 0.00 ? 39  VAL A CB   6  
ATOM 10231 C CG1  . VAL A 1 39  ? -8.853  -7.836  -12.642 1.00 0.00 ? 39  VAL A CG1  6  
ATOM 10232 C CG2  . VAL A 1 39  ? -10.591 -6.902  -11.071 1.00 0.00 ? 39  VAL A CG2  6  
ATOM 10233 H H    . VAL A 1 39  ? -9.057  -10.463 -12.055 1.00 0.00 ? 39  VAL A H    6  
ATOM 10234 H HA   . VAL A 1 39  ? -9.093  -9.031  -9.515  1.00 0.00 ? 39  VAL A HA   6  
ATOM 10235 H HB   . VAL A 1 39  ? -8.520  -7.178  -10.639 1.00 0.00 ? 39  VAL A HB   6  
ATOM 10236 H HG11 . VAL A 1 39  ? -8.929  -6.863  -13.128 1.00 0.00 ? 39  VAL A HG11 6  
ATOM 10237 H HG12 . VAL A 1 39  ? -7.820  -8.181  -12.678 1.00 0.00 ? 39  VAL A HG12 6  
ATOM 10238 H HG13 . VAL A 1 39  ? -9.494  -8.551  -13.158 1.00 0.00 ? 39  VAL A HG13 6  
ATOM 10239 H HG21 . VAL A 1 39  ? -10.349 -5.844  -10.970 1.00 0.00 ? 39  VAL A HG21 6  
ATOM 10240 H HG22 . VAL A 1 39  ? -11.194 -7.053  -11.967 1.00 0.00 ? 39  VAL A HG22 6  
ATOM 10241 H HG23 . VAL A 1 39  ? -11.152 -7.232  -10.196 1.00 0.00 ? 39  VAL A HG23 6  
ATOM 10242 N N    . ARG A 1 40  ? -11.417 -9.769  -9.310  1.00 0.00 ? 40  ARG A N    6  
ATOM 10243 C CA   . ARG A 1 40  ? -12.785 -10.229 -9.138  1.00 0.00 ? 40  ARG A CA   6  
ATOM 10244 C C    . ARG A 1 40  ? -13.669 -9.088  -8.631  1.00 0.00 ? 40  ARG A C    6  
ATOM 10245 O O    . ARG A 1 40  ? -13.305 -7.918  -8.744  1.00 0.00 ? 40  ARG A O    6  
ATOM 10246 C CB   . ARG A 1 40  ? -12.853 -11.395 -8.150  1.00 0.00 ? 40  ARG A CB   6  
ATOM 10247 C CG   . ARG A 1 40  ? -11.530 -12.163 -8.115  1.00 0.00 ? 40  ARG A CG   6  
ATOM 10248 C CD   . ARG A 1 40  ? -11.664 -13.450 -7.299  1.00 0.00 ? 40  ARG A CD   6  
ATOM 10249 N NE   . ARG A 1 40  ? -12.480 -14.437 -8.040  1.00 0.00 ? 40  ARG A NE   6  
ATOM 10250 C CZ   . ARG A 1 40  ? -12.648 -15.710 -7.659  1.00 0.00 ? 40  ARG A CZ   6  
ATOM 10251 N NH1  . ARG A 1 40  ? -12.059 -16.159 -6.543  1.00 0.00 ? 40  ARG A NH1  6  
ATOM 10252 N NH2  . ARG A 1 40  ? -13.407 -16.535 -8.394  1.00 0.00 ? 40  ARG A NH2  6  
ATOM 10253 H H    . ARG A 1 40  ? -10.913 -9.616  -8.460  1.00 0.00 ? 40  ARG A H    6  
ATOM 10254 H HA   . ARG A 1 40  ? -13.096 -10.555 -10.130 1.00 0.00 ? 40  ARG A HA   6  
ATOM 10255 H HB2  . ARG A 1 40  ? -13.086 -11.020 -7.154  1.00 0.00 ? 40  ARG A HB2  6  
ATOM 10256 H HB3  . ARG A 1 40  ? -13.662 -12.070 -8.434  1.00 0.00 ? 40  ARG A HB3  6  
ATOM 10257 H HG2  . ARG A 1 40  ? -11.218 -12.403 -9.132  1.00 0.00 ? 40  ARG A HG2  6  
ATOM 10258 H HG3  . ARG A 1 40  ? -10.752 -11.533 -7.684  1.00 0.00 ? 40  ARG A HG3  6  
ATOM 10259 H HD2  . ARG A 1 40  ? -10.677 -13.863 -7.092  1.00 0.00 ? 40  ARG A HD2  6  
ATOM 10260 H HD3  . ARG A 1 40  ? -12.127 -13.233 -6.336  1.00 0.00 ? 40  ARG A HD3  6  
ATOM 10261 H HE   . ARG A 1 40  ? -12.934 -14.135 -8.878  1.00 0.00 ? 40  ARG A HE   6  
ATOM 10262 H HH11 . ARG A 1 40  ? -11.493 -15.543 -5.994  1.00 0.00 ? 40  ARG A HH11 6  
ATOM 10263 H HH12 . ARG A 1 40  ? -12.184 -17.109 -6.258  1.00 0.00 ? 40  ARG A HH12 6  
ATOM 10264 H HH21 . ARG A 1 40  ? -13.847 -16.201 -9.227  1.00 0.00 ? 40  ARG A HH21 6  
ATOM 10265 H HH22 . ARG A 1 40  ? -13.532 -17.486 -8.109  1.00 0.00 ? 40  ARG A HH22 6  
ATOM 10266 N N    . THR A 1 41  ? -14.813 -9.468  -8.082  1.00 0.00 ? 41  THR A N    6  
ATOM 10267 C CA   . THR A 1 41  ? -15.752 -8.491  -7.557  1.00 0.00 ? 41  THR A CA   6  
ATOM 10268 C C    . THR A 1 41  ? -15.182 -7.823  -6.304  1.00 0.00 ? 41  THR A C    6  
ATOM 10269 O O    . THR A 1 41  ? -14.438 -6.847  -6.400  1.00 0.00 ? 41  THR A O    6  
ATOM 10270 C CB   . THR A 1 41  ? -17.086 -9.200  -7.313  1.00 0.00 ? 41  THR A CB   6  
ATOM 10271 O OG1  . THR A 1 41  ? -16.712 -10.520 -6.930  1.00 0.00 ? 41  THR A OG1  6  
ATOM 10272 C CG2  . THR A 1 41  ? -17.887 -9.398  -8.601  1.00 0.00 ? 41  THR A CG2  6  
ATOM 10273 H H    . THR A 1 41  ? -15.102 -10.421 -7.993  1.00 0.00 ? 41  THR A H    6  
ATOM 10274 H HA   . THR A 1 41  ? -15.887 -7.708  -8.303  1.00 0.00 ? 41  THR A HA   6  
ATOM 10275 H HB   . THR A 1 41  ? -17.676 -8.672  -6.565  1.00 0.00 ? 41  THR A HB   6  
ATOM 10276 H HG1  . THR A 1 41  ? -17.528 -11.088 -6.818  1.00 0.00 ? 41  THR A HG1  6  
ATOM 10277 H HG21 . THR A 1 41  ? -18.952 -9.413  -8.368  1.00 0.00 ? 41  THR A HG21 6  
ATOM 10278 H HG22 . THR A 1 41  ? -17.677 -8.579  -9.289  1.00 0.00 ? 41  THR A HG22 6  
ATOM 10279 H HG23 . THR A 1 41  ? -17.603 -10.343 -9.064  1.00 0.00 ? 41  THR A HG23 6  
ATOM 10280 N N    . THR A 1 42  ? -15.551 -8.374  -5.157  1.00 0.00 ? 42  THR A N    6  
ATOM 10281 C CA   . THR A 1 42  ? -15.086 -7.844  -3.887  1.00 0.00 ? 42  THR A CA   6  
ATOM 10282 C C    . THR A 1 42  ? -13.643 -8.278  -3.625  1.00 0.00 ? 42  THR A C    6  
ATOM 10283 O O    . THR A 1 42  ? -13.096 -8.014  -2.555  1.00 0.00 ? 42  THR A O    6  
ATOM 10284 C CB   . THR A 1 42  ? -16.063 -8.295  -2.800  1.00 0.00 ? 42  THR A CB   6  
ATOM 10285 O OG1  . THR A 1 42  ? -15.897 -9.709  -2.749  1.00 0.00 ? 42  THR A OG1  6  
ATOM 10286 C CG2  . THR A 1 42  ? -17.525 -8.106  -3.211  1.00 0.00 ? 42  THR A CG2  6  
ATOM 10287 H H    . THR A 1 42  ? -16.156 -9.167  -5.088  1.00 0.00 ? 42  THR A H    6  
ATOM 10288 H HA   . THR A 1 42  ? -15.087 -6.756  -3.948  1.00 0.00 ? 42  THR A HA   6  
ATOM 10289 H HB   . THR A 1 42  ? -15.856 -7.790  -1.856  1.00 0.00 ? 42  THR A HB   6  
ATOM 10290 H HG1  . THR A 1 42  ? -14.985 -9.934  -2.405  1.00 0.00 ? 42  THR A HG1  6  
ATOM 10291 H HG21 . THR A 1 42  ? -17.574 -7.478  -4.101  1.00 0.00 ? 42  THR A HG21 6  
ATOM 10292 H HG22 . THR A 1 42  ? -17.970 -9.078  -3.427  1.00 0.00 ? 42  THR A HG22 6  
ATOM 10293 H HG23 . THR A 1 42  ? -18.072 -7.629  -2.399  1.00 0.00 ? 42  THR A HG23 6  
ATOM 10294 N N    . SER A 1 43  ? -13.066 -8.936  -4.620  1.00 0.00 ? 43  SER A N    6  
ATOM 10295 C CA   . SER A 1 43  ? -11.697 -9.409  -4.511  1.00 0.00 ? 43  SER A CA   6  
ATOM 10296 C C    . SER A 1 43  ? -10.966 -9.210  -5.840  1.00 0.00 ? 43  SER A C    6  
ATOM 10297 O O    . SER A 1 43  ? -11.465 -9.608  -6.892  1.00 0.00 ? 43  SER A O    6  
ATOM 10298 C CB   . SER A 1 43  ? -11.654 -10.882 -4.097  1.00 0.00 ? 43  SER A CB   6  
ATOM 10299 O OG   . SER A 1 43  ? -12.866 -11.561 -4.415  1.00 0.00 ? 43  SER A OG   6  
ATOM 10300 H H    . SER A 1 43  ? -13.518 -9.146  -5.487  1.00 0.00 ? 43  SER A H    6  
ATOM 10301 H HA   . SER A 1 43  ? -11.242 -8.800  -3.729  1.00 0.00 ? 43  SER A HA   6  
ATOM 10302 H HB2  . SER A 1 43  ? -10.821 -11.375 -4.597  1.00 0.00 ? 43  SER A HB2  6  
ATOM 10303 H HB3  . SER A 1 43  ? -11.469 -10.952 -3.025  1.00 0.00 ? 43  SER A HB3  6  
ATOM 10304 H HG   . SER A 1 43  ? -13.595 -10.898 -4.583  1.00 0.00 ? 43  SER A HG   6  
ATOM 10305 N N    . VAL A 1 44  ? -9.796  -8.594  -5.749  1.00 0.00 ? 44  VAL A N    6  
ATOM 10306 C CA   . VAL A 1 44  ? -8.992  -8.338  -6.932  1.00 0.00 ? 44  VAL A CA   6  
ATOM 10307 C C    . VAL A 1 44  ? -7.519  -8.591  -6.607  1.00 0.00 ? 44  VAL A C    6  
ATOM 10308 O O    . VAL A 1 44  ? -7.140  -8.654  -5.438  1.00 0.00 ? 44  VAL A O    6  
ATOM 10309 C CB   . VAL A 1 44  ? -9.256  -6.921  -7.447  1.00 0.00 ? 44  VAL A CB   6  
ATOM 10310 C CG1  . VAL A 1 44  ? -10.749 -6.591  -7.403  1.00 0.00 ? 44  VAL A CG1  6  
ATOM 10311 C CG2  . VAL A 1 44  ? -8.444  -5.892  -6.659  1.00 0.00 ? 44  VAL A CG2  6  
ATOM 10312 H H    . VAL A 1 44  ? -9.398  -8.274  -4.890  1.00 0.00 ? 44  VAL A H    6  
ATOM 10313 H HA   . VAL A 1 44  ? -9.308  -9.041  -7.703  1.00 0.00 ? 44  VAL A HA   6  
ATOM 10314 H HB   . VAL A 1 44  ? -8.933  -6.877  -8.487  1.00 0.00 ? 44  VAL A HB   6  
ATOM 10315 H HG11 . VAL A 1 44  ? -10.904 -5.562  -7.728  1.00 0.00 ? 44  VAL A HG11 6  
ATOM 10316 H HG12 . VAL A 1 44  ? -11.290 -7.266  -8.067  1.00 0.00 ? 44  VAL A HG12 6  
ATOM 10317 H HG13 . VAL A 1 44  ? -11.118 -6.710  -6.385  1.00 0.00 ? 44  VAL A HG13 6  
ATOM 10318 H HG21 . VAL A 1 44  ? -7.671  -5.470  -7.301  1.00 0.00 ? 44  VAL A HG21 6  
ATOM 10319 H HG22 . VAL A 1 44  ? -9.103  -5.095  -6.313  1.00 0.00 ? 44  VAL A HG22 6  
ATOM 10320 H HG23 . VAL A 1 44  ? -7.978  -6.376  -5.800  1.00 0.00 ? 44  VAL A HG23 6  
ATOM 10321 N N    . ARG A 1 45  ? -6.729  -8.729  -7.661  1.00 0.00 ? 45  ARG A N    6  
ATOM 10322 C CA   . ARG A 1 45  ? -5.305  -8.974  -7.502  1.00 0.00 ? 45  ARG A CA   6  
ATOM 10323 C C    . ARG A 1 45  ? -4.524  -8.327  -8.647  1.00 0.00 ? 45  ARG A C    6  
ATOM 10324 O O    . ARG A 1 45  ? -4.671  -8.718  -9.804  1.00 0.00 ? 45  ARG A O    6  
ATOM 10325 C CB   . ARG A 1 45  ? -5.004  -10.474 -7.473  1.00 0.00 ? 45  ARG A CB   6  
ATOM 10326 C CG   . ARG A 1 45  ? -3.533  -10.732 -7.141  1.00 0.00 ? 45  ARG A CG   6  
ATOM 10327 C CD   . ARG A 1 45  ? -3.016  -11.973 -7.872  1.00 0.00 ? 45  ARG A CD   6  
ATOM 10328 N NE   . ARG A 1 45  ? -3.402  -13.194 -7.132  1.00 0.00 ? 45  ARG A NE   6  
ATOM 10329 C CZ   . ARG A 1 45  ? -3.099  -14.439 -7.525  1.00 0.00 ? 45  ARG A CZ   6  
ATOM 10330 N NH1  . ARG A 1 45  ? -2.404  -14.634 -8.654  1.00 0.00 ? 45  ARG A NH1  6  
ATOM 10331 N NH2  . ARG A 1 45  ? -3.491  -15.488 -6.790  1.00 0.00 ? 45  ARG A NH2  6  
ATOM 10332 H H    . ARG A 1 45  ? -7.045  -8.677  -8.608  1.00 0.00 ? 45  ARG A H    6  
ATOM 10333 H HA   . ARG A 1 45  ? -5.049  -8.519  -6.546  1.00 0.00 ? 45  ARG A HA   6  
ATOM 10334 H HB2  . ARG A 1 45  ? -5.639  -10.962 -6.733  1.00 0.00 ? 45  ARG A HB2  6  
ATOM 10335 H HB3  . ARG A 1 45  ? -5.246  -10.916 -8.440  1.00 0.00 ? 45  ARG A HB3  6  
ATOM 10336 H HG2  . ARG A 1 45  ? -2.936  -9.865  -7.422  1.00 0.00 ? 45  ARG A HG2  6  
ATOM 10337 H HG3  . ARG A 1 45  ? -3.417  -10.865 -6.066  1.00 0.00 ? 45  ARG A HG3  6  
ATOM 10338 H HD2  . ARG A 1 45  ? -3.423  -12.006 -8.883  1.00 0.00 ? 45  ARG A HD2  6  
ATOM 10339 H HD3  . ARG A 1 45  ? -1.931  -11.923 -7.967  1.00 0.00 ? 45  ARG A HD3  6  
ATOM 10340 H HE   . ARG A 1 45  ? -3.922  -13.084 -6.285  1.00 0.00 ? 45  ARG A HE   6  
ATOM 10341 H HH11 . ARG A 1 45  ? -2.111  -13.851 -9.203  1.00 0.00 ? 45  ARG A HH11 6  
ATOM 10342 H HH12 . ARG A 1 45  ? -2.177  -15.563 -8.948  1.00 0.00 ? 45  ARG A HH12 6  
ATOM 10343 H HH21 . ARG A 1 45  ? -4.010  -15.343 -5.948  1.00 0.00 ? 45  ARG A HH21 6  
ATOM 10344 H HH22 . ARG A 1 45  ? -3.265  -16.417 -7.084  1.00 0.00 ? 45  ARG A HH22 6  
ATOM 10345 N N    . LEU A 1 46  ? -3.710  -7.346  -8.285  1.00 0.00 ? 46  LEU A N    6  
ATOM 10346 C CA   . LEU A 1 46  ? -2.905  -6.640  -9.268  1.00 0.00 ? 46  LEU A CA   6  
ATOM 10347 C C    . LEU A 1 46  ? -1.423  -6.886  -8.978  1.00 0.00 ? 46  LEU A C    6  
ATOM 10348 O O    . LEU A 1 46  ? -1.073  -7.430  -7.932  1.00 0.00 ? 46  LEU A O    6  
ATOM 10349 C CB   . LEU A 1 46  ? -3.286  -5.159  -9.308  1.00 0.00 ? 46  LEU A CB   6  
ATOM 10350 C CG   . LEU A 1 46  ? -2.441  -4.225  -8.439  1.00 0.00 ? 46  LEU A CG   6  
ATOM 10351 C CD1  . LEU A 1 46  ? -2.528  -2.782  -8.939  1.00 0.00 ? 46  LEU A CD1  6  
ATOM 10352 C CD2  . LEU A 1 46  ? -2.831  -4.345  -6.964  1.00 0.00 ? 46  LEU A CD2  6  
ATOM 10353 H H    . LEU A 1 46  ? -3.596  -7.033  -7.342  1.00 0.00 ? 46  LEU A H    6  
ATOM 10354 H HA   . LEU A 1 46  ? -3.141  -7.060  -10.245 1.00 0.00 ? 46  LEU A HA   6  
ATOM 10355 H HB2  . LEU A 1 46  ? -3.225  -4.816  -10.341 1.00 0.00 ? 46  LEU A HB2  6  
ATOM 10356 H HB3  . LEU A 1 46  ? -4.328  -5.064  -9.001  1.00 0.00 ? 46  LEU A HB3  6  
ATOM 10357 H HG   . LEU A 1 46  ? -1.398  -4.532  -8.522  1.00 0.00 ? 46  LEU A HG   6  
ATOM 10358 H HD11 . LEU A 1 46  ? -3.000  -2.766  -9.922  1.00 0.00 ? 46  LEU A HD11 6  
ATOM 10359 H HD12 . LEU A 1 46  ? -3.121  -2.191  -8.242  1.00 0.00 ? 46  LEU A HD12 6  
ATOM 10360 H HD13 . LEU A 1 46  ? -1.525  -2.361  -9.011  1.00 0.00 ? 46  LEU A HD13 6  
ATOM 10361 H HD21 . LEU A 1 46  ? -2.054  -4.887  -6.425  1.00 0.00 ? 46  LEU A HD21 6  
ATOM 10362 H HD22 . LEU A 1 46  ? -2.943  -3.349  -6.536  1.00 0.00 ? 46  LEU A HD22 6  
ATOM 10363 H HD23 . LEU A 1 46  ? -3.775  -4.885  -6.881  1.00 0.00 ? 46  LEU A HD23 6  
ATOM 10364 N N    . ILE A 1 47  ? -0.592  -6.474  -9.925  1.00 0.00 ? 47  ILE A N    6  
ATOM 10365 C CA   . ILE A 1 47  ? 0.844   -6.643  -9.785  1.00 0.00 ? 47  ILE A CA   6  
ATOM 10366 C C    . ILE A 1 47  ? 1.547   -5.339  -10.168 1.00 0.00 ? 47  ILE A C    6  
ATOM 10367 O O    . ILE A 1 47  ? 0.922   -4.431  -10.714 1.00 0.00 ? 47  ILE A O    6  
ATOM 10368 C CB   . ILE A 1 47  ? 1.321   -7.857  -10.585 1.00 0.00 ? 47  ILE A CB   6  
ATOM 10369 C CG1  . ILE A 1 47  ? 1.463   -7.514  -12.069 1.00 0.00 ? 47  ILE A CG1  6  
ATOM 10370 C CG2  . ILE A 1 47  ? 0.402   -9.059  -10.359 1.00 0.00 ? 47  ILE A CG2  6  
ATOM 10371 C CD1  . ILE A 1 47  ? 0.093   -7.287  -12.712 1.00 0.00 ? 47  ILE A CD1  6  
ATOM 10372 H H    . ILE A 1 47  ? -0.885  -6.033  -10.773 1.00 0.00 ? 47  ILE A H    6  
ATOM 10373 H HA   . ILE A 1 47  ? 1.048   -6.849  -8.734  1.00 0.00 ? 47  ILE A HA   6  
ATOM 10374 H HB   . ILE A 1 47  ? 2.311   -8.137  -10.223 1.00 0.00 ? 47  ILE A HB   6  
ATOM 10375 H HG12 . ILE A 1 47  ? 2.075   -6.620  -12.183 1.00 0.00 ? 47  ILE A HG12 6  
ATOM 10376 H HG13 . ILE A 1 47  ? 1.981   -8.323  -12.585 1.00 0.00 ? 47  ILE A HG13 6  
ATOM 10377 H HG21 . ILE A 1 47  ? 0.486   -9.745  -11.202 1.00 0.00 ? 47  ILE A HG21 6  
ATOM 10378 H HG22 . ILE A 1 47  ? 0.692   -9.572  -9.442  1.00 0.00 ? 47  ILE A HG22 6  
ATOM 10379 H HG23 . ILE A 1 47  ? -0.629  -8.716  -10.272 1.00 0.00 ? 47  ILE A HG23 6  
ATOM 10380 H HD11 . ILE A 1 47  ? -0.689  -7.476  -11.977 1.00 0.00 ? 47  ILE A HD11 6  
ATOM 10381 H HD12 . ILE A 1 47  ? 0.022   -6.257  -13.062 1.00 0.00 ? 47  ILE A HD12 6  
ATOM 10382 H HD13 . ILE A 1 47  ? -0.029  -7.967  -13.556 1.00 0.00 ? 47  ILE A HD13 6  
ATOM 10383 N N    . TRP A 1 48  ? 2.836   -5.289  -9.868  1.00 0.00 ? 48  TRP A N    6  
ATOM 10384 C CA   . TRP A 1 48  ? 3.630   -4.111  -10.175 1.00 0.00 ? 48  TRP A CA   6  
ATOM 10385 C C    . TRP A 1 48  ? 5.105   -4.519  -10.166 1.00 0.00 ? 48  TRP A C    6  
ATOM 10386 O O    . TRP A 1 48  ? 5.426   -5.694  -9.991  1.00 0.00 ? 48  TRP A O    6  
ATOM 10387 C CB   . TRP A 1 48  ? 3.320   -2.972  -9.202  1.00 0.00 ? 48  TRP A CB   6  
ATOM 10388 C CG   . TRP A 1 48  ? 3.784   -3.235  -7.767  1.00 0.00 ? 48  TRP A CG   6  
ATOM 10389 C CD1  . TRP A 1 48  ? 4.928   -2.849  -7.186  1.00 0.00 ? 48  TRP A CD1  6  
ATOM 10390 C CD2  . TRP A 1 48  ? 3.062   -3.961  -6.750  1.00 0.00 ? 48  TRP A CD2  6  
ATOM 10391 N NE1  . TRP A 1 48  ? 4.997   -3.272  -5.875  1.00 0.00 ? 48  TRP A NE1  6  
ATOM 10392 C CE2  . TRP A 1 48  ? 3.826   -3.970  -5.601  1.00 0.00 ? 48  TRP A CE2  6  
ATOM 10393 C CE3  . TRP A 1 48  ? 1.806   -4.591  -6.799  1.00 0.00 ? 48  TRP A CE3  6  
ATOM 10394 C CZ2  . TRP A 1 48  ? 3.420   -4.594  -4.415  1.00 0.00 ? 48  TRP A CZ2  6  
ATOM 10395 C CZ3  . TRP A 1 48  ? 1.414   -5.209  -5.606  1.00 0.00 ? 48  TRP A CZ3  6  
ATOM 10396 C CH2  . TRP A 1 48  ? 2.172   -5.227  -4.441  1.00 0.00 ? 48  TRP A CH2  6  
ATOM 10397 H H    . TRP A 1 48  ? 3.337   -6.032  -9.424  1.00 0.00 ? 48  TRP A H    6  
ATOM 10398 H HA   . TRP A 1 48  ? 3.345   -3.766  -11.168 1.00 0.00 ? 48  TRP A HA   6  
ATOM 10399 H HB2  . TRP A 1 48  ? 3.793   -2.059  -9.564  1.00 0.00 ? 48  TRP A HB2  6  
ATOM 10400 H HB3  . TRP A 1 48  ? 2.245   -2.794  -9.198  1.00 0.00 ? 48  TRP A HB3  6  
ATOM 10401 H HD1  . TRP A 1 48  ? 5.706   -2.274  -7.687  1.00 0.00 ? 48  TRP A HD1  6  
ATOM 10402 H HE1  . TRP A 1 48  ? 5.818   -3.092  -5.181  1.00 0.00 ? 48  TRP A HE1  6  
ATOM 10403 H HE3  . TRP A 1 48  ? 1.184   -4.598  -7.694  1.00 0.00 ? 48  TRP A HE3  6  
ATOM 10404 H HZ2  . TRP A 1 48  ? 4.042   -4.587  -3.520  1.00 0.00 ? 48  TRP A HZ2  6  
ATOM 10405 H HZ3  . TRP A 1 48  ? 0.448   -5.713  -5.590  1.00 0.00 ? 48  TRP A HZ3  6  
ATOM 10406 H HH2  . TRP A 1 48  ? 1.796   -5.732  -3.551  1.00 0.00 ? 48  TRP A HH2  6  
ATOM 10407 N N    . GLN A 1 49  ? 5.962   -3.527  -10.357 1.00 0.00 ? 49  GLN A N    6  
ATOM 10408 C CA   . GLN A 1 49  ? 7.394   -3.769  -10.374 1.00 0.00 ? 49  GLN A CA   6  
ATOM 10409 C C    . GLN A 1 49  ? 8.134   -2.620  -9.684  1.00 0.00 ? 49  GLN A C    6  
ATOM 10410 O O    . GLN A 1 49  ? 7.575   -1.541  -9.498  1.00 0.00 ? 49  GLN A O    6  
ATOM 10411 C CB   . GLN A 1 49  ? 7.901   -3.967  -11.804 1.00 0.00 ? 49  GLN A CB   6  
ATOM 10412 C CG   . GLN A 1 49  ? 7.923   -5.451  -12.176 1.00 0.00 ? 49  GLN A CG   6  
ATOM 10413 C CD   . GLN A 1 49  ? 8.249   -5.639  -13.659 1.00 0.00 ? 49  GLN A CD   6  
ATOM 10414 O OE1  . GLN A 1 49  ? 9.138   -5.010  -14.211 1.00 0.00 ? 49  GLN A OE1  6  
ATOM 10415 N NE2  . GLN A 1 49  ? 7.484   -6.537  -14.272 1.00 0.00 ? 49  GLN A NE2  6  
ATOM 10416 H H    . GLN A 1 49  ? 5.692   -2.575  -10.498 1.00 0.00 ? 49  GLN A H    6  
ATOM 10417 H HA   . GLN A 1 49  ? 7.539   -4.692  -9.812  1.00 0.00 ? 49  GLN A HA   6  
ATOM 10418 H HB2  . GLN A 1 49  ? 7.260   -3.424  -12.499 1.00 0.00 ? 49  GLN A HB2  6  
ATOM 10419 H HB3  . GLN A 1 49  ? 8.903   -3.549  -11.900 1.00 0.00 ? 49  GLN A HB3  6  
ATOM 10420 H HG2  . GLN A 1 49  ? 8.664   -5.971  -11.569 1.00 0.00 ? 49  GLN A HG2  6  
ATOM 10421 H HG3  . GLN A 1 49  ? 6.956   -5.900  -11.953 1.00 0.00 ? 49  GLN A HG3  6  
ATOM 10422 H HE21 . GLN A 1 49  ? 6.772   -7.019  -13.761 1.00 0.00 ? 49  GLN A HE21 6  
ATOM 10423 H HE22 . GLN A 1 49  ? 7.620   -6.731  -15.244 1.00 0.00 ? 49  GLN A HE22 6  
ATOM 10424 N N    . PRO A 1 50  ? 9.413   -2.900  -9.316  1.00 0.00 ? 50  PRO A N    6  
ATOM 10425 C CA   . PRO A 1 50  ? 10.235  -1.903  -8.651  1.00 0.00 ? 50  PRO A CA   6  
ATOM 10426 C C    . PRO A 1 50  ? 10.716  -0.840  -9.642  1.00 0.00 ? 50  PRO A C    6  
ATOM 10427 O O    . PRO A 1 50  ? 10.828  -1.106  -10.837 1.00 0.00 ? 50  PRO A O    6  
ATOM 10428 C CB   . PRO A 1 50  ? 11.375  -2.688  -8.022  1.00 0.00 ? 50  PRO A CB   6  
ATOM 10429 C CG   . PRO A 1 50  ? 11.406  -4.026  -8.743  1.00 0.00 ? 50  PRO A CG   6  
ATOM 10430 C CD   . PRO A 1 50  ? 10.108  -4.167  -9.520  1.00 0.00 ? 50  PRO A CD   6  
ATOM 10431 H HA   . PRO A 1 50  ? 9.699   -1.413  -7.964  1.00 0.00 ? 50  PRO A HA   6  
ATOM 10432 H HB2  . PRO A 1 50  ? 12.322  -2.161  -8.136  1.00 0.00 ? 50  PRO A HB2  6  
ATOM 10433 H HB3  . PRO A 1 50  ? 11.212  -2.824  -6.953  1.00 0.00 ? 50  PRO A HB3  6  
ATOM 10434 H HG2  . PRO A 1 50  ? 12.262  -4.077  -9.416  1.00 0.00 ? 50  PRO A HG2  6  
ATOM 10435 H HG3  . PRO A 1 50  ? 11.514  -4.842  -8.028  1.00 0.00 ? 50  PRO A HG3  6  
ATOM 10436 H HD2  . PRO A 1 50  ? 10.297  -4.349  -10.578 1.00 0.00 ? 50  PRO A HD2  6  
ATOM 10437 H HD3  . PRO A 1 50  ? 9.516   -5.007  -9.154  1.00 0.00 ? 50  PRO A HD3  6  
ATOM 10438 N N    . PRO A 1 51  ? 10.996  0.372   -9.093  1.00 0.00 ? 51  PRO A N    6  
ATOM 10439 C CA   . PRO A 1 51  ? 11.463  1.476   -9.915  1.00 0.00 ? 51  PRO A CA   6  
ATOM 10440 C C    . PRO A 1 51  ? 12.926  1.280   -10.315 1.00 0.00 ? 51  PRO A C    6  
ATOM 10441 O O    . PRO A 1 51  ? 13.800  1.171   -9.456  1.00 0.00 ? 51  PRO A O    6  
ATOM 10442 C CB   . PRO A 1 51  ? 11.239  2.718   -9.069  1.00 0.00 ? 51  PRO A CB   6  
ATOM 10443 C CG   . PRO A 1 51  ? 11.091  2.227   -7.638  1.00 0.00 ? 51  PRO A CG   6  
ATOM 10444 C CD   . PRO A 1 51  ? 10.876  0.723   -7.681  1.00 0.00 ? 51  PRO A CD   6  
ATOM 10445 H HA   . PRO A 1 51  ? 10.948  1.513   -10.771 1.00 0.00 ? 51  PRO A HA   6  
ATOM 10446 H HB2  . PRO A 1 51  ? 12.077  3.409   -9.160  1.00 0.00 ? 51  PRO A HB2  6  
ATOM 10447 H HB3  . PRO A 1 51  ? 10.347  3.255   -9.391  1.00 0.00 ? 51  PRO A HB3  6  
ATOM 10448 H HG2  . PRO A 1 51  ? 11.982  2.469   -7.058  1.00 0.00 ? 51  PRO A HG2  6  
ATOM 10449 H HG3  . PRO A 1 51  ? 10.250  2.720   -7.150  1.00 0.00 ? 51  PRO A HG3  6  
ATOM 10450 H HD2  . PRO A 1 51  ? 11.618  0.200   -7.078  1.00 0.00 ? 51  PRO A HD2  6  
ATOM 10451 H HD3  . PRO A 1 51  ? 9.896   0.452   -7.287  1.00 0.00 ? 51  PRO A HD3  6  
ATOM 10452 N N    . ALA A 1 52  ? 13.150  1.243   -11.621 1.00 0.00 ? 52  ALA A N    6  
ATOM 10453 C CA   . ALA A 1 52  ? 14.493  1.063   -12.145 1.00 0.00 ? 52  ALA A CA   6  
ATOM 10454 C C    . ALA A 1 52  ? 15.468  1.932   -11.349 1.00 0.00 ? 52  ALA A C    6  
ATOM 10455 O O    . ALA A 1 52  ? 16.642  1.590   -11.214 1.00 0.00 ? 52  ALA A O    6  
ATOM 10456 C CB   . ALA A 1 52  ? 14.505  1.391   -13.640 1.00 0.00 ? 52  ALA A CB   6  
ATOM 10457 H H    . ALA A 1 52  ? 12.434  1.332   -12.313 1.00 0.00 ? 52  ALA A H    6  
ATOM 10458 H HA   . ALA A 1 52  ? 14.762  0.015   -12.014 1.00 0.00 ? 52  ALA A HA   6  
ATOM 10459 H HB1  . ALA A 1 52  ? 13.579  1.042   -14.097 1.00 0.00 ? 52  ALA A HB1  6  
ATOM 10460 H HB2  . ALA A 1 52  ? 14.593  2.470   -13.774 1.00 0.00 ? 52  ALA A HB2  6  
ATOM 10461 H HB3  . ALA A 1 52  ? 15.353  0.897   -14.113 1.00 0.00 ? 52  ALA A HB3  6  
ATOM 10462 N N    . ALA A 1 53  ? 14.945  3.039   -10.841 1.00 0.00 ? 53  ALA A N    6  
ATOM 10463 C CA   . ALA A 1 53  ? 15.755  3.959   -10.062 1.00 0.00 ? 53  ALA A CA   6  
ATOM 10464 C C    . ALA A 1 53  ? 15.211  4.025   -8.633  1.00 0.00 ? 53  ALA A C    6  
ATOM 10465 O O    . ALA A 1 53  ? 14.420  4.909   -8.306  1.00 0.00 ? 53  ALA A O    6  
ATOM 10466 C CB   . ALA A 1 53  ? 15.770  5.329   -10.743 1.00 0.00 ? 53  ALA A CB   6  
ATOM 10467 H H    . ALA A 1 53  ? 13.989  3.309   -10.956 1.00 0.00 ? 53  ALA A H    6  
ATOM 10468 H HA   . ALA A 1 53  ? 16.772  3.568   -10.037 1.00 0.00 ? 53  ALA A HA   6  
ATOM 10469 H HB1  . ALA A 1 53  ? 14.864  5.875   -10.483 1.00 0.00 ? 53  ALA A HB1  6  
ATOM 10470 H HB2  . ALA A 1 53  ? 16.642  5.891   -10.409 1.00 0.00 ? 53  ALA A HB2  6  
ATOM 10471 H HB3  . ALA A 1 53  ? 15.816  5.196   -11.824 1.00 0.00 ? 53  ALA A HB3  6  
ATOM 10472 N N    . PRO A 1 54  ? 15.669  3.054   -7.798  1.00 0.00 ? 54  PRO A N    6  
ATOM 10473 C CA   . PRO A 1 54  ? 15.238  2.994   -6.412  1.00 0.00 ? 54  PRO A CA   6  
ATOM 10474 C C    . PRO A 1 54  ? 15.919  4.081   -5.578  1.00 0.00 ? 54  PRO A C    6  
ATOM 10475 O O    . PRO A 1 54  ? 15.306  4.654   -4.679  1.00 0.00 ? 54  PRO A O    6  
ATOM 10476 C CB   . PRO A 1 54  ? 15.585  1.587   -5.953  1.00 0.00 ? 54  PRO A CB   6  
ATOM 10477 C CG   . PRO A 1 54  ? 16.613  1.067   -6.945  1.00 0.00 ? 54  PRO A CG   6  
ATOM 10478 C CD   . PRO A 1 54  ? 16.607  1.992   -8.151  1.00 0.00 ? 54  PRO A CD   6  
ATOM 10479 H HA   . PRO A 1 54  ? 14.256  3.174   -6.346  1.00 0.00 ? 54  PRO A HA   6  
ATOM 10480 H HB2  . PRO A 1 54  ? 15.989  1.595   -4.940  1.00 0.00 ? 54  PRO A HB2  6  
ATOM 10481 H HB3  . PRO A 1 54  ? 14.700  0.952   -5.938  1.00 0.00 ? 54  PRO A HB3  6  
ATOM 10482 H HG2  . PRO A 1 54  ? 17.602  1.039   -6.489  1.00 0.00 ? 54  PRO A HG2  6  
ATOM 10483 H HG3  . PRO A 1 54  ? 16.371  0.047   -7.245  1.00 0.00 ? 54  PRO A HG3  6  
ATOM 10484 H HD2  . PRO A 1 54  ? 17.602  2.391   -8.348  1.00 0.00 ? 54  PRO A HD2  6  
ATOM 10485 H HD3  . PRO A 1 54  ? 16.290  1.467   -9.051  1.00 0.00 ? 54  PRO A HD3  6  
ATOM 10486 N N    . ASN A 1 55  ? 17.178  4.331   -5.905  1.00 0.00 ? 55  ASN A N    6  
ATOM 10487 C CA   . ASN A 1 55  ? 17.949  5.338   -5.197  1.00 0.00 ? 55  ASN A CA   6  
ATOM 10488 C C    . ASN A 1 55  ? 17.667  5.230   -3.698  1.00 0.00 ? 55  ASN A C    6  
ATOM 10489 O O    . ASN A 1 55  ? 17.502  6.243   -3.019  1.00 0.00 ? 55  ASN A O    6  
ATOM 10490 C CB   . ASN A 1 55  ? 17.562  6.747   -5.651  1.00 0.00 ? 55  ASN A CB   6  
ATOM 10491 C CG   . ASN A 1 55  ? 17.041  6.737   -7.089  1.00 0.00 ? 55  ASN A CG   6  
ATOM 10492 O OD1  . ASN A 1 55  ? 17.786  6.607   -8.046  1.00 0.00 ? 55  ASN A OD1  6  
ATOM 10493 N ND2  . ASN A 1 55  ? 15.722  6.879   -7.187  1.00 0.00 ? 55  ASN A ND2  6  
ATOM 10494 H H    . ASN A 1 55  ? 17.670  3.860   -6.638  1.00 0.00 ? 55  ASN A H    6  
ATOM 10495 H HA   . ASN A 1 55  ? 18.990  5.127   -5.442  1.00 0.00 ? 55  ASN A HA   6  
ATOM 10496 H HB2  . ASN A 1 55  ? 16.798  7.150   -4.986  1.00 0.00 ? 55  ASN A HB2  6  
ATOM 10497 H HB3  . ASN A 1 55  ? 18.427  7.407   -5.579  1.00 0.00 ? 55  ASN A HB3  6  
ATOM 10498 H HD21 . ASN A 1 55  ? 15.167  6.981   -6.362  1.00 0.00 ? 55  ASN A HD21 6  
ATOM 10499 H HD22 . ASN A 1 55  ? 15.285  6.885   -8.087  1.00 0.00 ? 55  ASN A HD22 6  
ATOM 10500 N N    . GLY A 1 56  ? 17.619  3.993   -3.225  1.00 0.00 ? 56  GLY A N    6  
ATOM 10501 C CA   . GLY A 1 56  ? 17.360  3.740   -1.818  1.00 0.00 ? 56  GLY A CA   6  
ATOM 10502 C C    . GLY A 1 56  ? 16.753  2.350   -1.614  1.00 0.00 ? 56  GLY A C    6  
ATOM 10503 O O    . GLY A 1 56  ? 15.776  1.993   -2.270  1.00 0.00 ? 56  GLY A O    6  
ATOM 10504 H H    . GLY A 1 56  ? 17.754  3.175   -3.784  1.00 0.00 ? 56  GLY A H    6  
ATOM 10505 H HA2  . GLY A 1 56  ? 18.288  3.822   -1.252  1.00 0.00 ? 56  GLY A HA2  6  
ATOM 10506 H HA3  . GLY A 1 56  ? 16.681  4.498   -1.427  1.00 0.00 ? 56  GLY A HA3  6  
ATOM 10507 N N    . ILE A 1 57  ? 17.357  1.604   -0.701  1.00 0.00 ? 57  ILE A N    6  
ATOM 10508 C CA   . ILE A 1 57  ? 16.888  0.261   -0.403  1.00 0.00 ? 57  ILE A CA   6  
ATOM 10509 C C    . ILE A 1 57  ? 15.427  0.323   0.045   1.00 0.00 ? 57  ILE A C    6  
ATOM 10510 O O    . ILE A 1 57  ? 15.077  1.104   0.928   1.00 0.00 ? 57  ILE A O    6  
ATOM 10511 C CB   . ILE A 1 57  ? 17.813  -0.416  0.610   1.00 0.00 ? 57  ILE A CB   6  
ATOM 10512 C CG1  . ILE A 1 57  ? 19.037  -1.021  -0.082  1.00 0.00 ? 57  ILE A CG1  6  
ATOM 10513 C CG2  . ILE A 1 57  ? 17.053  -1.454  1.438   1.00 0.00 ? 57  ILE A CG2  6  
ATOM 10514 C CD1  . ILE A 1 57  ? 19.547  -0.102  -1.194  1.00 0.00 ? 57  ILE A CD1  6  
ATOM 10515 H H    . ILE A 1 57  ? 18.151  1.901   -0.172  1.00 0.00 ? 57  ILE A H    6  
ATOM 10516 H HA   . ILE A 1 57  ? 16.943  -0.317  -1.326  1.00 0.00 ? 57  ILE A HA   6  
ATOM 10517 H HB   . ILE A 1 57  ? 18.177  0.343   1.302   1.00 0.00 ? 57  ILE A HB   6  
ATOM 10518 H HG12 . ILE A 1 57  ? 19.828  -1.187  0.649   1.00 0.00 ? 57  ILE A HG12 6  
ATOM 10519 H HG13 . ILE A 1 57  ? 18.779  -1.994  -0.500  1.00 0.00 ? 57  ILE A HG13 6  
ATOM 10520 H HG21 . ILE A 1 57  ? 16.612  -2.197  0.774   1.00 0.00 ? 57  ILE A HG21 6  
ATOM 10521 H HG22 . ILE A 1 57  ? 17.741  -1.945  2.127   1.00 0.00 ? 57  ILE A HG22 6  
ATOM 10522 H HG23 . ILE A 1 57  ? 16.264  -0.960  2.005   1.00 0.00 ? 57  ILE A HG23 6  
ATOM 10523 H HD11 . ILE A 1 57  ? 19.697  0.902   -0.796  1.00 0.00 ? 57  ILE A HD11 6  
ATOM 10524 H HD12 . ILE A 1 57  ? 20.492  -0.485  -1.578  1.00 0.00 ? 57  ILE A HD12 6  
ATOM 10525 H HD13 . ILE A 1 57  ? 18.815  -0.066  -2.001  1.00 0.00 ? 57  ILE A HD13 6  
ATOM 10526 N N    . ILE A 1 58  ? 14.612  -0.509  -0.586  1.00 0.00 ? 58  ILE A N    6  
ATOM 10527 C CA   . ILE A 1 58  ? 13.196  -0.559  -0.264  1.00 0.00 ? 58  ILE A CA   6  
ATOM 10528 C C    . ILE A 1 58  ? 13.003  -1.312  1.053   1.00 0.00 ? 58  ILE A C    6  
ATOM 10529 O O    . ILE A 1 58  ? 13.596  -2.370  1.260   1.00 0.00 ? 58  ILE A O    6  
ATOM 10530 C CB   . ILE A 1 58  ? 12.401  -1.147  -1.431  1.00 0.00 ? 58  ILE A CB   6  
ATOM 10531 C CG1  . ILE A 1 58  ? 12.817  -0.506  -2.757  1.00 0.00 ? 58  ILE A CG1  6  
ATOM 10532 C CG2  . ILE A 1 58  ? 10.896  -1.029  -1.185  1.00 0.00 ? 58  ILE A CG2  6  
ATOM 10533 C CD1  . ILE A 1 58  ? 12.561  1.003   -2.740  1.00 0.00 ? 58  ILE A CD1  6  
ATOM 10534 H H    . ILE A 1 58  ? 14.904  -1.141  -1.304  1.00 0.00 ? 58  ILE A H    6  
ATOM 10535 H HA   . ILE A 1 58  ? 12.856  0.468   -0.128  1.00 0.00 ? 58  ILE A HA   6  
ATOM 10536 H HB   . ILE A 1 58  ? 12.633  -2.210  -1.501  1.00 0.00 ? 58  ILE A HB   6  
ATOM 10537 H HG12 . ILE A 1 58  ? 13.874  -0.697  -2.942  1.00 0.00 ? 58  ILE A HG12 6  
ATOM 10538 H HG13 . ILE A 1 58  ? 12.262  -0.963  -3.576  1.00 0.00 ? 58  ILE A HG13 6  
ATOM 10539 H HG21 . ILE A 1 58  ? 10.556  -1.882  -0.598  1.00 0.00 ? 58  ILE A HG21 6  
ATOM 10540 H HG22 . ILE A 1 58  ? 10.688  -0.108  -0.640  1.00 0.00 ? 58  ILE A HG22 6  
ATOM 10541 H HG23 . ILE A 1 58  ? 10.371  -1.013  -2.140  1.00 0.00 ? 58  ILE A HG23 6  
ATOM 10542 H HD11 . ILE A 1 58  ? 13.429  1.513   -2.322  1.00 0.00 ? 58  ILE A HD11 6  
ATOM 10543 H HD12 . ILE A 1 58  ? 12.389  1.354   -3.757  1.00 0.00 ? 58  ILE A HD12 6  
ATOM 10544 H HD13 . ILE A 1 58  ? 11.685  1.216   -2.128  1.00 0.00 ? 58  ILE A HD13 6  
ATOM 10545 N N    . LEU A 1 59  ? 12.171  -0.738  1.910   1.00 0.00 ? 59  LEU A N    6  
ATOM 10546 C CA   . LEU A 1 59  ? 11.893  -1.342  3.202   1.00 0.00 ? 59  LEU A CA   6  
ATOM 10547 C C    . LEU A 1 59  ? 10.527  -2.031  3.154   1.00 0.00 ? 59  LEU A C    6  
ATOM 10548 O O    . LEU A 1 59  ? 10.262  -2.947  3.931   1.00 0.00 ? 59  LEU A O    6  
ATOM 10549 C CB   . LEU A 1 59  ? 12.019  -0.303  4.318   1.00 0.00 ? 59  LEU A CB   6  
ATOM 10550 C CG   . LEU A 1 59  ? 13.434  0.206   4.602   1.00 0.00 ? 59  LEU A CG   6  
ATOM 10551 C CD1  . LEU A 1 59  ? 14.235  0.351   3.307   1.00 0.00 ? 59  LEU A CD1  6  
ATOM 10552 C CD2  . LEU A 1 59  ? 13.396  1.510   5.402   1.00 0.00 ? 59  LEU A CD2  6  
ATOM 10553 H H    . LEU A 1 59  ? 11.693  0.122   1.734   1.00 0.00 ? 59  LEU A H    6  
ATOM 10554 H HA   . LEU A 1 59  ? 12.656  -2.100  3.379   1.00 0.00 ? 59  LEU A HA   6  
ATOM 10555 H HB2  . LEU A 1 59  ? 11.391  0.551   4.065   1.00 0.00 ? 59  LEU A HB2  6  
ATOM 10556 H HB3  . LEU A 1 59  ? 11.618  -0.734  5.235   1.00 0.00 ? 59  LEU A HB3  6  
ATOM 10557 H HG   . LEU A 1 59  ? 13.946  -0.533  5.217   1.00 0.00 ? 59  LEU A HG   6  
ATOM 10558 H HD11 . LEU A 1 59  ? 13.642  0.894   2.571   1.00 0.00 ? 59  LEU A HD11 6  
ATOM 10559 H HD12 . LEU A 1 59  ? 15.155  0.900   3.509   1.00 0.00 ? 59  LEU A HD12 6  
ATOM 10560 H HD13 . LEU A 1 59  ? 14.480  -0.638  2.919   1.00 0.00 ? 59  LEU A HD13 6  
ATOM 10561 H HD21 . LEU A 1 59  ? 12.373  1.885   5.437   1.00 0.00 ? 59  LEU A HD21 6  
ATOM 10562 H HD22 . LEU A 1 59  ? 13.750  1.325   6.416   1.00 0.00 ? 59  LEU A HD22 6  
ATOM 10563 H HD23 . LEU A 1 59  ? 14.038  2.249   4.922   1.00 0.00 ? 59  LEU A HD23 6  
ATOM 10564 N N    . ALA A 1 60  ? 9.696   -1.563  2.235   1.00 0.00 ? 60  ALA A N    6  
ATOM 10565 C CA   . ALA A 1 60  ? 8.364   -2.121  2.076   1.00 0.00 ? 60  ALA A CA   6  
ATOM 10566 C C    . ALA A 1 60  ? 7.596   -1.309  1.031   1.00 0.00 ? 60  ALA A C    6  
ATOM 10567 O O    . ALA A 1 60  ? 8.169   -0.446  0.367   1.00 0.00 ? 60  ALA A O    6  
ATOM 10568 C CB   . ALA A 1 60  ? 7.656   -2.146  3.432   1.00 0.00 ? 60  ALA A CB   6  
ATOM 10569 H H    . ALA A 1 60  ? 9.919   -0.817  1.607   1.00 0.00 ? 60  ALA A H    6  
ATOM 10570 H HA   . ALA A 1 60  ? 8.474   -3.145  1.718   1.00 0.00 ? 60  ALA A HA   6  
ATOM 10571 H HB1  . ALA A 1 60  ? 8.249   -1.596  4.162   1.00 0.00 ? 60  ALA A HB1  6  
ATOM 10572 H HB2  . ALA A 1 60  ? 6.674   -1.683  3.337   1.00 0.00 ? 60  ALA A HB2  6  
ATOM 10573 H HB3  . ALA A 1 60  ? 7.540   -3.179  3.762   1.00 0.00 ? 60  ALA A HB3  6  
ATOM 10574 N N    . TYR A 1 61  ? 6.311   -1.613  0.919   1.00 0.00 ? 61  TYR A N    6  
ATOM 10575 C CA   . TYR A 1 61  ? 5.459   -0.921  -0.033  1.00 0.00 ? 61  TYR A CA   6  
ATOM 10576 C C    . TYR A 1 61  ? 4.100   -0.592  0.587   1.00 0.00 ? 61  TYR A C    6  
ATOM 10577 O O    . TYR A 1 61  ? 3.800   -1.022  1.700   1.00 0.00 ? 61  TYR A O    6  
ATOM 10578 C CB   . TYR A 1 61  ? 5.254   -1.892  -1.197  1.00 0.00 ? 61  TYR A CB   6  
ATOM 10579 C CG   . TYR A 1 61  ? 6.416   -1.926  -2.192  1.00 0.00 ? 61  TYR A CG   6  
ATOM 10580 C CD1  . TYR A 1 61  ? 7.588   -2.576  -1.863  1.00 0.00 ? 61  TYR A CD1  6  
ATOM 10581 C CD2  . TYR A 1 61  ? 6.292   -1.305  -3.419  1.00 0.00 ? 61  TYR A CD2  6  
ATOM 10582 C CE1  . TYR A 1 61  ? 8.681   -2.607  -2.799  1.00 0.00 ? 61  TYR A CE1  6  
ATOM 10583 C CE2  . TYR A 1 61  ? 7.386   -1.337  -4.355  1.00 0.00 ? 61  TYR A CE2  6  
ATOM 10584 C CZ   . TYR A 1 61  ? 8.526   -1.986  -3.999  1.00 0.00 ? 61  TYR A CZ   6  
ATOM 10585 O OH   . TYR A 1 61  ? 9.559   -2.016  -4.883  1.00 0.00 ? 61  TYR A OH   6  
ATOM 10586 H H    . TYR A 1 61  ? 5.854   -2.316  1.464   1.00 0.00 ? 61  TYR A H    6  
ATOM 10587 H HA   . TYR A 1 61  ? 5.955   0.007   -0.316  1.00 0.00 ? 61  TYR A HA   6  
ATOM 10588 H HB2  . TYR A 1 61  ? 5.101   -2.895  -0.798  1.00 0.00 ? 61  TYR A HB2  6  
ATOM 10589 H HB3  . TYR A 1 61  ? 4.342   -1.619  -1.728  1.00 0.00 ? 61  TYR A HB3  6  
ATOM 10590 H HD1  . TYR A 1 61  ? 7.685   -3.066  -0.894  1.00 0.00 ? 61  TYR A HD1  6  
ATOM 10591 H HD2  . TYR A 1 61  ? 5.366   -0.792  -3.679  1.00 0.00 ? 61  TYR A HD2  6  
ATOM 10592 H HE1  . TYR A 1 61  ? 9.612   -3.117  -2.552  1.00 0.00 ? 61  TYR A HE1  6  
ATOM 10593 H HE2  . TYR A 1 61  ? 7.301   -0.851  -5.327  1.00 0.00 ? 61  TYR A HE2  6  
ATOM 10594 H HH   . TYR A 1 61  ? 10.428  -2.080  -4.392  1.00 0.00 ? 61  TYR A HH   6  
ATOM 10595 N N    . GLN A 1 62  ? 3.313   0.168   -0.161  1.00 0.00 ? 62  GLN A N    6  
ATOM 10596 C CA   . GLN A 1 62  ? 1.992   0.560   0.301   1.00 0.00 ? 62  GLN A CA   6  
ATOM 10597 C C    . GLN A 1 62  ? 0.984   0.483   -0.847  1.00 0.00 ? 62  GLN A C    6  
ATOM 10598 O O    . GLN A 1 62  ? 1.243   0.985   -1.940  1.00 0.00 ? 62  GLN A O    6  
ATOM 10599 C CB   . GLN A 1 62  ? 2.019   1.961   0.914   1.00 0.00 ? 62  GLN A CB   6  
ATOM 10600 C CG   . GLN A 1 62  ? 0.617   2.402   1.338   1.00 0.00 ? 62  GLN A CG   6  
ATOM 10601 C CD   . GLN A 1 62  ? 0.289   3.792   0.788   1.00 0.00 ? 62  GLN A CD   6  
ATOM 10602 O OE1  . GLN A 1 62  ? 0.678   4.162   -0.307  1.00 0.00 ? 62  GLN A OE1  6  
ATOM 10603 N NE2  . GLN A 1 62  ? -0.445  4.539   1.608   1.00 0.00 ? 62  GLN A NE2  6  
ATOM 10604 H H    . GLN A 1 62  ? 3.564   0.513   -1.065  1.00 0.00 ? 62  GLN A H    6  
ATOM 10605 H HA   . GLN A 1 62  ? 1.729   -0.163  1.074   1.00 0.00 ? 62  GLN A HA   6  
ATOM 10606 H HB2  . GLN A 1 62  ? 2.684   1.972   1.778   1.00 0.00 ? 62  GLN A HB2  6  
ATOM 10607 H HB3  . GLN A 1 62  ? 2.425   2.670   0.192   1.00 0.00 ? 62  GLN A HB3  6  
ATOM 10608 H HG2  . GLN A 1 62  ? -0.118  1.682   0.978   1.00 0.00 ? 62  GLN A HG2  6  
ATOM 10609 H HG3  . GLN A 1 62  ? 0.548   2.412   2.426   1.00 0.00 ? 62  GLN A HG3  6  
ATOM 10610 H HE21 . GLN A 1 62  ? -0.731  4.174   2.495   1.00 0.00 ? 62  GLN A HE21 6  
ATOM 10611 H HE22 . GLN A 1 62  ? -0.711  5.464   1.338   1.00 0.00 ? 62  GLN A HE22 6  
ATOM 10612 N N    . ILE A 1 63  ? -0.145  -0.149  -0.560  1.00 0.00 ? 63  ILE A N    6  
ATOM 10613 C CA   . ILE A 1 63  ? -1.193  -0.297  -1.555  1.00 0.00 ? 63  ILE A CA   6  
ATOM 10614 C C    . ILE A 1 63  ? -2.506  0.250   -0.992  1.00 0.00 ? 63  ILE A C    6  
ATOM 10615 O O    . ILE A 1 63  ? -3.147  -0.395  -0.163  1.00 0.00 ? 63  ILE A O    6  
ATOM 10616 C CB   . ILE A 1 63  ? -1.284  -1.751  -2.025  1.00 0.00 ? 63  ILE A CB   6  
ATOM 10617 C CG1  . ILE A 1 63  ? -0.709  -1.908  -3.434  1.00 0.00 ? 63  ILE A CG1  6  
ATOM 10618 C CG2  . ILE A 1 63  ? -2.720  -2.269  -1.930  1.00 0.00 ? 63  ILE A CG2  6  
ATOM 10619 C CD1  . ILE A 1 63  ? 0.195   -3.139  -3.523  1.00 0.00 ? 63  ILE A CD1  6  
ATOM 10620 H H    . ILE A 1 63  ? -0.347  -0.554  0.331   1.00 0.00 ? 63  ILE A H    6  
ATOM 10621 H HA   . ILE A 1 63  ? -0.911  0.304   -2.419  1.00 0.00 ? 63  ILE A HA   6  
ATOM 10622 H HB   . ILE A 1 63  ? -0.676  -2.363  -1.359  1.00 0.00 ? 63  ILE A HB   6  
ATOM 10623 H HG12 . ILE A 1 63  ? -1.522  -1.997  -4.154  1.00 0.00 ? 63  ILE A HG12 6  
ATOM 10624 H HG13 . ILE A 1 63  ? -0.143  -1.016  -3.701  1.00 0.00 ? 63  ILE A HG13 6  
ATOM 10625 H HG21 . ILE A 1 63  ? -2.967  -2.468  -0.887  1.00 0.00 ? 63  ILE A HG21 6  
ATOM 10626 H HG22 . ILE A 1 63  ? -3.404  -1.520  -2.328  1.00 0.00 ? 63  ILE A HG22 6  
ATOM 10627 H HG23 . ILE A 1 63  ? -2.813  -3.189  -2.507  1.00 0.00 ? 63  ILE A HG23 6  
ATOM 10628 H HD11 . ILE A 1 63  ? 1.116   -2.954  -2.970  1.00 0.00 ? 63  ILE A HD11 6  
ATOM 10629 H HD12 . ILE A 1 63  ? -0.319  -4.000  -3.095  1.00 0.00 ? 63  ILE A HD12 6  
ATOM 10630 H HD13 . ILE A 1 63  ? 0.433   -3.341  -4.567  1.00 0.00 ? 63  ILE A HD13 6  
ATOM 10631 N N    . THR A 1 64  ? -2.868  1.433   -1.464  1.00 0.00 ? 64  THR A N    6  
ATOM 10632 C CA   . THR A 1 64  ? -4.093  2.074   -1.018  1.00 0.00 ? 64  THR A CA   6  
ATOM 10633 C C    . THR A 1 64  ? -5.249  1.729   -1.959  1.00 0.00 ? 64  THR A C    6  
ATOM 10634 O O    . THR A 1 64  ? -5.152  1.932   -3.169  1.00 0.00 ? 64  THR A O    6  
ATOM 10635 C CB   . THR A 1 64  ? -3.828  3.577   -0.908  1.00 0.00 ? 64  THR A CB   6  
ATOM 10636 O OG1  . THR A 1 64  ? -3.784  4.022   -2.261  1.00 0.00 ? 64  THR A OG1  6  
ATOM 10637 C CG2  . THR A 1 64  ? -2.430  3.887   -0.369  1.00 0.00 ? 64  THR A CG2  6  
ATOM 10638 H H    . THR A 1 64  ? -2.342  1.951   -2.139  1.00 0.00 ? 64  THR A H    6  
ATOM 10639 H HA   . THR A 1 64  ? -4.351  1.678   -0.037  1.00 0.00 ? 64  THR A HA   6  
ATOM 10640 H HB   . THR A 1 64  ? -4.594  4.065   -0.306  1.00 0.00 ? 64  THR A HB   6  
ATOM 10641 H HG1  . THR A 1 64  ? -4.431  4.773   -2.395  1.00 0.00 ? 64  THR A HG1  6  
ATOM 10642 H HG21 . THR A 1 64  ? -2.511  4.545   0.496   1.00 0.00 ? 64  THR A HG21 6  
ATOM 10643 H HG22 . THR A 1 64  ? -1.940  2.958   -0.074  1.00 0.00 ? 64  THR A HG22 6  
ATOM 10644 H HG23 . THR A 1 64  ? -1.841  4.377   -1.145  1.00 0.00 ? 64  THR A HG23 6  
ATOM 10645 N N    . HIS A 1 65  ? -6.317  1.214   -1.369  1.00 0.00 ? 65  HIS A N    6  
ATOM 10646 C CA   . HIS A 1 65  ? -7.491  0.838   -2.139  1.00 0.00 ? 65  HIS A CA   6  
ATOM 10647 C C    . HIS A 1 65  ? -8.683  1.696   -1.710  1.00 0.00 ? 65  HIS A C    6  
ATOM 10648 O O    . HIS A 1 65  ? -9.030  1.735   -0.530  1.00 0.00 ? 65  HIS A O    6  
ATOM 10649 C CB   . HIS A 1 65  ? -7.764  -0.662  -2.016  1.00 0.00 ? 65  HIS A CB   6  
ATOM 10650 C CG   . HIS A 1 65  ? -7.430  -1.238  -0.661  1.00 0.00 ? 65  HIS A CG   6  
ATOM 10651 N ND1  . HIS A 1 65  ? -8.397  -1.574  0.270   1.00 0.00 ? 65  HIS A ND1  6  
ATOM 10652 C CD2  . HIS A 1 65  ? -6.227  -1.535  -0.091  1.00 0.00 ? 65  HIS A CD2  6  
ATOM 10653 C CE1  . HIS A 1 65  ? -7.792  -2.049  1.349   1.00 0.00 ? 65  HIS A CE1  6  
ATOM 10654 N NE2  . HIS A 1 65  ? -6.447  -2.024  1.123   1.00 0.00 ? 65  HIS A NE2  6  
ATOM 10655 H H    . HIS A 1 65  ? -6.389  1.052   -0.385  1.00 0.00 ? 65  HIS A H    6  
ATOM 10656 H HA   . HIS A 1 65  ? -7.260  1.050   -3.183  1.00 0.00 ? 65  HIS A HA   6  
ATOM 10657 H HB2  . HIS A 1 65  ? -8.817  -0.848  -2.229  1.00 0.00 ? 65  HIS A HB2  6  
ATOM 10658 H HB3  . HIS A 1 65  ? -7.188  -1.189  -2.776  1.00 0.00 ? 65  HIS A HB3  6  
ATOM 10659 H HD1  . HIS A 1 65  ? -9.385  -1.474  0.149   1.00 0.00 ? 65  HIS A HD1  6  
ATOM 10660 H HD2  . HIS A 1 65  ? -5.250  -1.395  -0.555  1.00 0.00 ? 65  HIS A HD2  6  
ATOM 10661 H HE1  . HIS A 1 65  ? -8.283  -2.400  2.257   1.00 0.00 ? 65  HIS A HE1  6  
ATOM 10662 N N    . ARG A 1 66  ? -9.276  2.361   -2.690  1.00 0.00 ? 66  ARG A N    6  
ATOM 10663 C CA   . ARG A 1 66  ? -10.422 3.215   -2.428  1.00 0.00 ? 66  ARG A CA   6  
ATOM 10664 C C    . ARG A 1 66  ? -11.326 3.283   -3.660  1.00 0.00 ? 66  ARG A C    6  
ATOM 10665 O O    . ARG A 1 66  ? -10.860 3.114   -4.786  1.00 0.00 ? 66  ARG A O    6  
ATOM 10666 C CB   . ARG A 1 66  ? -9.980  4.629   -2.049  1.00 0.00 ? 66  ARG A CB   6  
ATOM 10667 C CG   . ARG A 1 66  ? -9.500  5.402   -3.279  1.00 0.00 ? 66  ARG A CG   6  
ATOM 10668 C CD   . ARG A 1 66  ? -9.154  6.848   -2.919  1.00 0.00 ? 66  ARG A CD   6  
ATOM 10669 N NE   . ARG A 1 66  ? -8.294  7.440   -3.967  1.00 0.00 ? 66  ARG A NE   6  
ATOM 10670 C CZ   . ARG A 1 66  ? -7.773  8.672   -3.905  1.00 0.00 ? 66  ARG A CZ   6  
ATOM 10671 N NH1  . ARG A 1 66  ? -8.022  9.452   -2.843  1.00 0.00 ? 66  ARG A NH1  6  
ATOM 10672 N NH2  . ARG A 1 66  ? -7.003  9.126   -4.903  1.00 0.00 ? 66  ARG A NH2  6  
ATOM 10673 H H    . ARG A 1 66  ? -8.988  2.323   -3.646  1.00 0.00 ? 66  ARG A H    6  
ATOM 10674 H HA   . ARG A 1 66  ? -10.936 2.742   -1.590  1.00 0.00 ? 66  ARG A HA   6  
ATOM 10675 H HB2  . ARG A 1 66  ? -10.809 5.161   -1.582  1.00 0.00 ? 66  ARG A HB2  6  
ATOM 10676 H HB3  . ARG A 1 66  ? -9.178  4.578   -1.312  1.00 0.00 ? 66  ARG A HB3  6  
ATOM 10677 H HG2  . ARG A 1 66  ? -8.624  4.910   -3.703  1.00 0.00 ? 66  ARG A HG2  6  
ATOM 10678 H HG3  . ARG A 1 66  ? -10.274 5.389   -4.046  1.00 0.00 ? 66  ARG A HG3  6  
ATOM 10679 H HD2  . ARG A 1 66  ? -10.068 7.433   -2.813  1.00 0.00 ? 66  ARG A HD2  6  
ATOM 10680 H HD3  . ARG A 1 66  ? -8.643  6.879   -1.957  1.00 0.00 ? 66  ARG A HD3  6  
ATOM 10681 H HE   . ARG A 1 66  ? -8.088  6.884   -4.773  1.00 0.00 ? 66  ARG A HE   6  
ATOM 10682 H HH11 . ARG A 1 66  ? -8.596  9.113   -2.098  1.00 0.00 ? 66  ARG A HH11 6  
ATOM 10683 H HH12 . ARG A 1 66  ? -7.633  10.372  -2.796  1.00 0.00 ? 66  ARG A HH12 6  
ATOM 10684 H HH21 . ARG A 1 66  ? -6.818  8.545   -5.695  1.00 0.00 ? 66  ARG A HH21 6  
ATOM 10685 H HH22 . ARG A 1 66  ? -6.614  10.046  -4.856  1.00 0.00 ? 66  ARG A HH22 6  
ATOM 10686 N N    . LEU A 1 67  ? -12.602 3.532   -3.406  1.00 0.00 ? 67  LEU A N    6  
ATOM 10687 C CA   . LEU A 1 67  ? -13.575 3.625   -4.481  1.00 0.00 ? 67  LEU A CA   6  
ATOM 10688 C C    . LEU A 1 67  ? -13.450 4.991   -5.160  1.00 0.00 ? 67  LEU A C    6  
ATOM 10689 O O    . LEU A 1 67  ? -13.514 6.025   -4.497  1.00 0.00 ? 67  LEU A O    6  
ATOM 10690 C CB   . LEU A 1 67  ? -14.982 3.326   -3.958  1.00 0.00 ? 67  LEU A CB   6  
ATOM 10691 C CG   . LEU A 1 67  ? -15.466 1.884   -4.125  1.00 0.00 ? 67  LEU A CG   6  
ATOM 10692 C CD1  . LEU A 1 67  ? -16.947 1.758   -3.763  1.00 0.00 ? 67  LEU A CD1  6  
ATOM 10693 C CD2  . LEU A 1 67  ? -15.176 1.368   -5.536  1.00 0.00 ? 67  LEU A CD2  6  
ATOM 10694 H H    . LEU A 1 67  ? -12.973 3.669   -2.487  1.00 0.00 ? 67  LEU A H    6  
ATOM 10695 H HA   . LEU A 1 67  ? -13.331 2.853   -5.210  1.00 0.00 ? 67  LEU A HA   6  
ATOM 10696 H HB2  . LEU A 1 67  ? -15.015 3.579   -2.898  1.00 0.00 ? 67  LEU A HB2  6  
ATOM 10697 H HB3  . LEU A 1 67  ? -15.685 3.986   -4.466  1.00 0.00 ? 67  LEU A HB3  6  
ATOM 10698 H HG   . LEU A 1 67  ? -14.910 1.254   -3.431  1.00 0.00 ? 67  LEU A HG   6  
ATOM 10699 H HD11 . LEU A 1 67  ? -17.091 0.892   -3.117  1.00 0.00 ? 67  LEU A HD11 6  
ATOM 10700 H HD12 . LEU A 1 67  ? -17.272 2.658   -3.241  1.00 0.00 ? 67  LEU A HD12 6  
ATOM 10701 H HD13 . LEU A 1 67  ? -17.535 1.634   -4.673  1.00 0.00 ? 67  LEU A HD13 6  
ATOM 10702 H HD21 . LEU A 1 67  ? -14.132 1.060   -5.603  1.00 0.00 ? 67  LEU A HD21 6  
ATOM 10703 H HD22 . LEU A 1 67  ? -15.820 0.516   -5.752  1.00 0.00 ? 67  LEU A HD22 6  
ATOM 10704 H HD23 . LEU A 1 67  ? -15.367 2.161   -6.260  1.00 0.00 ? 67  LEU A HD23 6  
ATOM 10705 N N    . ASN A 1 68  ? -13.273 4.950   -6.472  1.00 0.00 ? 68  ASN A N    6  
ATOM 10706 C CA   . ASN A 1 68  ? -13.138 6.171   -7.248  1.00 0.00 ? 68  ASN A CA   6  
ATOM 10707 C C    . ASN A 1 68  ? -14.480 6.905   -7.273  1.00 0.00 ? 68  ASN A C    6  
ATOM 10708 O O    . ASN A 1 68  ? -14.556 8.053   -7.708  1.00 0.00 ? 68  ASN A O    6  
ATOM 10709 C CB   . ASN A 1 68  ? -12.739 5.864   -8.693  1.00 0.00 ? 68  ASN A CB   6  
ATOM 10710 C CG   . ASN A 1 68  ? -11.662 6.833   -9.182  1.00 0.00 ? 68  ASN A CG   6  
ATOM 10711 O OD1  . ASN A 1 68  ? -11.051 7.561   -8.416  1.00 0.00 ? 68  ASN A OD1  6  
ATOM 10712 N ND2  . ASN A 1 68  ? -11.463 6.803   -10.496 1.00 0.00 ? 68  ASN A ND2  6  
ATOM 10713 H H    . ASN A 1 68  ? -13.222 4.104   -7.003  1.00 0.00 ? 68  ASN A H    6  
ATOM 10714 H HA   . ASN A 1 68  ? -12.359 6.744   -6.746  1.00 0.00 ? 68  ASN A HA   6  
ATOM 10715 H HB2  . ASN A 1 68  ? -12.372 4.840   -8.763  1.00 0.00 ? 68  ASN A HB2  6  
ATOM 10716 H HB3  . ASN A 1 68  ? -13.615 5.933   -9.338  1.00 0.00 ? 68  ASN A HB3  6  
ATOM 10717 H HD21 . ASN A 1 68  ? -11.999 6.182   -11.069 1.00 0.00 ? 68  ASN A HD21 6  
ATOM 10718 H HD22 . ASN A 1 68  ? -10.778 7.401   -10.913 1.00 0.00 ? 68  ASN A HD22 6  
ATOM 10719 N N    . THR A 1 69  ? -15.506 6.212   -6.802  1.00 0.00 ? 69  THR A N    6  
ATOM 10720 C CA   . THR A 1 69  ? -16.842 6.784   -6.765  1.00 0.00 ? 69  THR A CA   6  
ATOM 10721 C C    . THR A 1 69  ? -17.620 6.244   -5.563  1.00 0.00 ? 69  THR A C    6  
ATOM 10722 O O    . THR A 1 69  ? -18.367 5.275   -5.687  1.00 0.00 ? 69  THR A O    6  
ATOM 10723 C CB   . THR A 1 69  ? -17.517 6.494   -8.106  1.00 0.00 ? 69  THR A CB   6  
ATOM 10724 O OG1  . THR A 1 69  ? -17.869 5.115   -8.027  1.00 0.00 ? 69  THR A OG1  6  
ATOM 10725 C CG2  . THR A 1 69  ? -16.540 6.562   -9.281  1.00 0.00 ? 69  THR A CG2  6  
ATOM 10726 H H    . THR A 1 69  ? -15.436 5.279   -6.450  1.00 0.00 ? 69  THR A H    6  
ATOM 10727 H HA   . THR A 1 69  ? -16.750 7.861   -6.629  1.00 0.00 ? 69  THR A HA   6  
ATOM 10728 H HB   . THR A 1 69  ? -18.366 7.159   -8.266  1.00 0.00 ? 69  THR A HB   6  
ATOM 10729 H HG1  . THR A 1 69  ? -18.630 4.920   -8.645  1.00 0.00 ? 69  THR A HG1  6  
ATOM 10730 H HG21 . THR A 1 69  ? -15.697 5.898   -9.092  1.00 0.00 ? 69  THR A HG21 6  
ATOM 10731 H HG22 . THR A 1 69  ? -17.048 6.253   -10.195 1.00 0.00 ? 69  THR A HG22 6  
ATOM 10732 H HG23 . THR A 1 69  ? -16.179 7.584   -9.395  1.00 0.00 ? 69  THR A HG23 6  
ATOM 10733 N N    . THR A 1 70  ? -17.418 6.896   -4.427  1.00 0.00 ? 70  THR A N    6  
ATOM 10734 C CA   . THR A 1 70  ? -18.092 6.494   -3.204  1.00 0.00 ? 70  THR A CA   6  
ATOM 10735 C C    . THR A 1 70  ? -17.669 7.394   -2.041  1.00 0.00 ? 70  THR A C    6  
ATOM 10736 O O    . THR A 1 70  ? -18.487 7.740   -1.190  1.00 0.00 ? 70  THR A O    6  
ATOM 10737 C CB   . THR A 1 70  ? -17.793 5.012   -2.965  1.00 0.00 ? 70  THR A CB   6  
ATOM 10738 O OG1  . THR A 1 70  ? -19.005 4.497   -2.420  1.00 0.00 ? 70  THR A OG1  6  
ATOM 10739 C CG2  . THR A 1 70  ? -16.763 4.794   -1.855  1.00 0.00 ? 70  THR A CG2  6  
ATOM 10740 H H    . THR A 1 70  ? -16.809 7.683   -4.335  1.00 0.00 ? 70  THR A H    6  
ATOM 10741 H HA   . THR A 1 70  ? -19.164 6.631   -3.341  1.00 0.00 ? 70  THR A HA   6  
ATOM 10742 H HB   . THR A 1 70  ? -17.480 4.524   -3.888  1.00 0.00 ? 70  THR A HB   6  
ATOM 10743 H HG1  . THR A 1 70  ? -18.864 3.561   -2.098  1.00 0.00 ? 70  THR A HG1  6  
ATOM 10744 H HG21 . THR A 1 70  ? -17.126 5.240   -0.929  1.00 0.00 ? 70  THR A HG21 6  
ATOM 10745 H HG22 . THR A 1 70  ? -16.609 3.725   -1.707  1.00 0.00 ? 70  THR A HG22 6  
ATOM 10746 H HG23 . THR A 1 70  ? -15.820 5.262   -2.138  1.00 0.00 ? 70  THR A HG23 6  
ATOM 10747 N N    . THR A 1 71  ? -16.392 7.747   -2.043  1.00 0.00 ? 71  THR A N    6  
ATOM 10748 C CA   . THR A 1 71  ? -15.850 8.601   -0.999  1.00 0.00 ? 71  THR A CA   6  
ATOM 10749 C C    . THR A 1 71  ? -16.318 8.122   0.377   1.00 0.00 ? 71  THR A C    6  
ATOM 10750 O O    . THR A 1 71  ? -17.385 8.515   0.846   1.00 0.00 ? 71  THR A O    6  
ATOM 10751 C CB   . THR A 1 71  ? -16.255 10.043  -1.310  1.00 0.00 ? 71  THR A CB   6  
ATOM 10752 O OG1  . THR A 1 71  ? -17.668 9.978   -1.483  1.00 0.00 ? 71  THR A OG1  6  
ATOM 10753 C CG2  . THR A 1 71  ? -15.735 10.517  -2.669  1.00 0.00 ? 71  THR A CG2  6  
ATOM 10754 H H    . THR A 1 71  ? -15.733 7.461   -2.739  1.00 0.00 ? 71  THR A H    6  
ATOM 10755 H HA   . THR A 1 71  ? -14.764 8.516   -1.015  1.00 0.00 ? 71  THR A HA   6  
ATOM 10756 H HB   . THR A 1 71  ? -15.936 10.717  -0.515  1.00 0.00 ? 71  THR A HB   6  
ATOM 10757 H HG1  . THR A 1 71  ? -18.100 9.649   -0.643  1.00 0.00 ? 71  THR A HG1  6  
ATOM 10758 H HG21 . THR A 1 71  ? -14.646 10.556  -2.647  1.00 0.00 ? 71  THR A HG21 6  
ATOM 10759 H HG22 . THR A 1 71  ? -16.058 9.822   -3.444  1.00 0.00 ? 71  THR A HG22 6  
ATOM 10760 H HG23 . THR A 1 71  ? -16.130 11.510  -2.883  1.00 0.00 ? 71  THR A HG23 6  
ATOM 10761 N N    . ALA A 1 72  ? -15.496 7.280   0.986   1.00 0.00 ? 72  ALA A N    6  
ATOM 10762 C CA   . ALA A 1 72  ? -15.812 6.744   2.299   1.00 0.00 ? 72  ALA A CA   6  
ATOM 10763 C C    . ALA A 1 72  ? -14.985 7.477   3.357   1.00 0.00 ? 72  ALA A C    6  
ATOM 10764 O O    . ALA A 1 72  ? -14.206 8.372   3.031   1.00 0.00 ? 72  ALA A O    6  
ATOM 10765 C CB   . ALA A 1 72  ? -15.562 5.234   2.307   1.00 0.00 ? 72  ALA A CB   6  
ATOM 10766 H H    . ALA A 1 72  ? -14.630 6.965   0.598   1.00 0.00 ? 72  ALA A H    6  
ATOM 10767 H HA   . ALA A 1 72  ? -16.870 6.926   2.486   1.00 0.00 ? 72  ALA A HA   6  
ATOM 10768 H HB1  . ALA A 1 72  ? -15.122 4.933   1.357   1.00 0.00 ? 72  ALA A HB1  6  
ATOM 10769 H HB2  . ALA A 1 72  ? -14.880 4.983   3.119   1.00 0.00 ? 72  ALA A HB2  6  
ATOM 10770 H HB3  . ALA A 1 72  ? -16.507 4.710   2.452   1.00 0.00 ? 72  ALA A HB3  6  
ATOM 10771 N N    . ASN A 1 73  ? -15.183 7.071   4.603   1.00 0.00 ? 73  ASN A N    6  
ATOM 10772 C CA   . ASN A 1 73  ? -14.465 7.678   5.711   1.00 0.00 ? 73  ASN A CA   6  
ATOM 10773 C C    . ASN A 1 73  ? -13.005 7.896   5.309   1.00 0.00 ? 73  ASN A C    6  
ATOM 10774 O O    . ASN A 1 73  ? -12.484 9.004   5.426   1.00 0.00 ? 73  ASN A O    6  
ATOM 10775 C CB   . ASN A 1 73  ? -14.487 6.772   6.943   1.00 0.00 ? 73  ASN A CB   6  
ATOM 10776 C CG   . ASN A 1 73  ? -14.539 7.599   8.230   1.00 0.00 ? 73  ASN A CG   6  
ATOM 10777 O OD1  . ASN A 1 73  ? -15.546 8.195   8.575   1.00 0.00 ? 73  ASN A OD1  6  
ATOM 10778 N ND2  . ASN A 1 73  ? -13.401 7.600   8.918   1.00 0.00 ? 73  ASN A ND2  6  
ATOM 10779 H H    . ASN A 1 73  ? -15.818 6.342   4.859   1.00 0.00 ? 73  ASN A H    6  
ATOM 10780 H HA   . ASN A 1 73  ? -14.987 8.614   5.911   1.00 0.00 ? 73  ASN A HA   6  
ATOM 10781 H HB2  . ASN A 1 73  ? -15.351 6.110   6.897   1.00 0.00 ? 73  ASN A HB2  6  
ATOM 10782 H HB3  . ASN A 1 73  ? -13.600 6.139   6.949   1.00 0.00 ? 73  ASN A HB3  6  
ATOM 10783 H HD21 . ASN A 1 73  ? -12.611 7.090   8.579   1.00 0.00 ? 73  ASN A HD21 6  
ATOM 10784 H HD22 . ASN A 1 73  ? -13.335 8.112   9.775   1.00 0.00 ? 73  ASN A HD22 6  
ATOM 10785 N N    . THR A 1 74  ? -12.386 6.820   4.844   1.00 0.00 ? 74  THR A N    6  
ATOM 10786 C CA   . THR A 1 74  ? -10.996 6.879   4.425   1.00 0.00 ? 74  THR A CA   6  
ATOM 10787 C C    . THR A 1 74  ? -10.625 5.626   3.629   1.00 0.00 ? 74  THR A C    6  
ATOM 10788 O O    . THR A 1 74  ? -11.384 4.659   3.598   1.00 0.00 ? 74  THR A O    6  
ATOM 10789 C CB   . THR A 1 74  ? -10.134 7.084   5.672   1.00 0.00 ? 74  THR A CB   6  
ATOM 10790 O OG1  . THR A 1 74  ? -9.542  8.366   5.479   1.00 0.00 ? 74  THR A OG1  6  
ATOM 10791 C CG2  . THR A 1 74  ? -8.942  6.126   5.724   1.00 0.00 ? 74  THR A CG2  6  
ATOM 10792 H H    . THR A 1 74  ? -12.817 5.923   4.753   1.00 0.00 ? 74  THR A H    6  
ATOM 10793 H HA   . THR A 1 74  ? -10.875 7.731   3.755   1.00 0.00 ? 74  THR A HA   6  
ATOM 10794 H HB   . THR A 1 74  ? -10.735 7.006   6.578   1.00 0.00 ? 74  THR A HB   6  
ATOM 10795 H HG1  . THR A 1 74  ? -10.127 9.075   5.871   1.00 0.00 ? 74  THR A HG1  6  
ATOM 10796 H HG21 . THR A 1 74  ? -8.408  6.261   6.664   1.00 0.00 ? 74  THR A HG21 6  
ATOM 10797 H HG22 . THR A 1 74  ? -9.298  5.099   5.652   1.00 0.00 ? 74  THR A HG22 6  
ATOM 10798 H HG23 . THR A 1 74  ? -8.270  6.337   4.891   1.00 0.00 ? 74  THR A HG23 6  
ATOM 10799 N N    . ALA A 1 75  ? -9.458  5.685   3.004   1.00 0.00 ? 75  ALA A N    6  
ATOM 10800 C CA   . ALA A 1 75  ? -8.978  4.567   2.211   1.00 0.00 ? 75  ALA A CA   6  
ATOM 10801 C C    . ALA A 1 75  ? -8.009  3.730   3.049   1.00 0.00 ? 75  ALA A C    6  
ATOM 10802 O O    . ALA A 1 75  ? -6.924  4.193   3.397   1.00 0.00 ? 75  ALA A O    6  
ATOM 10803 C CB   . ALA A 1 75  ? -8.332  5.092   0.927   1.00 0.00 ? 75  ALA A CB   6  
ATOM 10804 H H    . ALA A 1 75  ? -8.847  6.476   3.035   1.00 0.00 ? 75  ALA A H    6  
ATOM 10805 H HA   . ALA A 1 75  ? -9.839  3.954   1.945   1.00 0.00 ? 75  ALA A HA   6  
ATOM 10806 H HB1  . ALA A 1 75  ? -8.020  4.252   0.307   1.00 0.00 ? 75  ALA A HB1  6  
ATOM 10807 H HB2  . ALA A 1 75  ? -9.054  5.699   0.380   1.00 0.00 ? 75  ALA A HB2  6  
ATOM 10808 H HB3  . ALA A 1 75  ? -7.464  5.700   1.179   1.00 0.00 ? 75  ALA A HB3  6  
ATOM 10809 N N    . THR A 1 76  ? -8.438  2.513   3.351   1.00 0.00 ? 76  THR A N    6  
ATOM 10810 C CA   . THR A 1 76  ? -7.622  1.607   4.142   1.00 0.00 ? 76  THR A CA   6  
ATOM 10811 C C    . THR A 1 76  ? -6.426  1.115   3.325   1.00 0.00 ? 76  THR A C    6  
ATOM 10812 O O    . THR A 1 76  ? -6.554  0.190   2.525   1.00 0.00 ? 76  THR A O    6  
ATOM 10813 C CB   . THR A 1 76  ? -8.522  0.476   4.644   1.00 0.00 ? 76  THR A CB   6  
ATOM 10814 O OG1  . THR A 1 76  ? -9.398  1.114   5.570   1.00 0.00 ? 76  THR A OG1  6  
ATOM 10815 C CG2  . THR A 1 76  ? -7.762  -0.545  5.492   1.00 0.00 ? 76  THR A CG2  6  
ATOM 10816 H H    . THR A 1 76  ? -9.322  2.144   3.064   1.00 0.00 ? 76  THR A H    6  
ATOM 10817 H HA   . THR A 1 76  ? -7.223  2.159   4.993   1.00 0.00 ? 76  THR A HA   6  
ATOM 10818 H HB   . THR A 1 76  ? -9.034  -0.011  3.814   1.00 0.00 ? 76  THR A HB   6  
ATOM 10819 H HG1  . THR A 1 76  ? -8.892  1.379   6.391   1.00 0.00 ? 76  THR A HG1  6  
ATOM 10820 H HG21 . THR A 1 76  ? -7.118  -0.022  6.200   1.00 0.00 ? 76  THR A HG21 6  
ATOM 10821 H HG22 . THR A 1 76  ? -8.473  -1.165  6.037   1.00 0.00 ? 76  THR A HG22 6  
ATOM 10822 H HG23 . THR A 1 76  ? -7.152  -1.174  4.843   1.00 0.00 ? 76  THR A HG23 6  
ATOM 10823 N N    . VAL A 1 77  ? -5.289  1.756   3.555   1.00 0.00 ? 77  VAL A N    6  
ATOM 10824 C CA   . VAL A 1 77  ? -4.071  1.395   2.851   1.00 0.00 ? 77  VAL A CA   6  
ATOM 10825 C C    . VAL A 1 77  ? -3.382  0.245   3.589   1.00 0.00 ? 77  VAL A C    6  
ATOM 10826 O O    . VAL A 1 77  ? -3.515  0.114   4.805   1.00 0.00 ? 77  VAL A O    6  
ATOM 10827 C CB   . VAL A 1 77  ? -3.174  2.625   2.691   1.00 0.00 ? 77  VAL A CB   6  
ATOM 10828 C CG1  . VAL A 1 77  ? -4.006  3.908   2.656   1.00 0.00 ? 77  VAL A CG1  6  
ATOM 10829 C CG2  . VAL A 1 77  ? -2.121  2.683   3.799   1.00 0.00 ? 77  VAL A CG2  6  
ATOM 10830 H H    . VAL A 1 77  ? -5.193  2.507   4.208   1.00 0.00 ? 77  VAL A H    6  
ATOM 10831 H HA   . VAL A 1 77  ? -4.355  1.053   1.856   1.00 0.00 ? 77  VAL A HA   6  
ATOM 10832 H HB   . VAL A 1 77  ? -2.653  2.538   1.738   1.00 0.00 ? 77  VAL A HB   6  
ATOM 10833 H HG11 . VAL A 1 77  ? -4.877  3.760   2.017   1.00 0.00 ? 77  VAL A HG11 6  
ATOM 10834 H HG12 . VAL A 1 77  ? -4.335  4.155   3.666   1.00 0.00 ? 77  VAL A HG12 6  
ATOM 10835 H HG13 . VAL A 1 77  ? -3.400  4.724   2.262   1.00 0.00 ? 77  VAL A HG13 6  
ATOM 10836 H HG21 . VAL A 1 77  ? -1.884  3.724   4.020   1.00 0.00 ? 77  VAL A HG21 6  
ATOM 10837 H HG22 . VAL A 1 77  ? -2.510  2.201   4.696   1.00 0.00 ? 77  VAL A HG22 6  
ATOM 10838 H HG23 . VAL A 1 77  ? -1.219  2.167   3.471   1.00 0.00 ? 77  VAL A HG23 6  
ATOM 10839 N N    . GLU A 1 78  ? -2.660  -0.559  2.822   1.00 0.00 ? 78  GLU A N    6  
ATOM 10840 C CA   . GLU A 1 78  ? -1.949  -1.694  3.388   1.00 0.00 ? 78  GLU A CA   6  
ATOM 10841 C C    . GLU A 1 78  ? -0.463  -1.621  3.031   1.00 0.00 ? 78  GLU A C    6  
ATOM 10842 O O    . GLU A 1 78  ? -0.109  -1.332  1.889   1.00 0.00 ? 78  GLU A O    6  
ATOM 10843 C CB   . GLU A 1 78  ? -2.563  -3.014  2.918   1.00 0.00 ? 78  GLU A CB   6  
ATOM 10844 C CG   . GLU A 1 78  ? -1.646  -4.193  3.249   1.00 0.00 ? 78  GLU A CG   6  
ATOM 10845 C CD   . GLU A 1 78  ? -2.414  -5.297  3.979   1.00 0.00 ? 78  GLU A CD   6  
ATOM 10846 O OE1  . GLU A 1 78  ? -2.573  -5.159  5.211   1.00 0.00 ? 78  GLU A OE1  6  
ATOM 10847 O OE2  . GLU A 1 78  ? -2.823  -6.255  3.288   1.00 0.00 ? 78  GLU A OE2  6  
ATOM 10848 H H    . GLU A 1 78  ? -2.556  -0.446  1.834   1.00 0.00 ? 78  GLU A H    6  
ATOM 10849 H HA   . GLU A 1 78  ? -2.076  -1.605  4.467   1.00 0.00 ? 78  GLU A HA   6  
ATOM 10850 H HB2  . GLU A 1 78  ? -3.533  -3.159  3.394   1.00 0.00 ? 78  GLU A HB2  6  
ATOM 10851 H HB3  . GLU A 1 78  ? -2.738  -2.976  1.843   1.00 0.00 ? 78  GLU A HB3  6  
ATOM 10852 H HG2  . GLU A 1 78  ? -1.213  -4.591  2.331   1.00 0.00 ? 78  GLU A HG2  6  
ATOM 10853 H HG3  . GLU A 1 78  ? -0.817  -3.851  3.870   1.00 0.00 ? 78  GLU A HG3  6  
ATOM 10854 N N    . VAL A 1 79  ? 0.366   -1.889  4.029   1.00 0.00 ? 79  VAL A N    6  
ATOM 10855 C CA   . VAL A 1 79  ? 1.805   -1.858  3.835   1.00 0.00 ? 79  VAL A CA   6  
ATOM 10856 C C    . VAL A 1 79  ? 2.297   -3.260  3.471   1.00 0.00 ? 79  VAL A C    6  
ATOM 10857 O O    . VAL A 1 79  ? 1.983   -4.230  4.160   1.00 0.00 ? 79  VAL A O    6  
ATOM 10858 C CB   . VAL A 1 79  ? 2.489   -1.289  5.080   1.00 0.00 ? 79  VAL A CB   6  
ATOM 10859 C CG1  . VAL A 1 79  ? 3.879   -1.900  5.270   1.00 0.00 ? 79  VAL A CG1  6  
ATOM 10860 C CG2  . VAL A 1 79  ? 2.567   0.238   5.013   1.00 0.00 ? 79  VAL A CG2  6  
ATOM 10861 H H    . VAL A 1 79  ? 0.069   -2.123  4.955   1.00 0.00 ? 79  VAL A H    6  
ATOM 10862 H HA   . VAL A 1 79  ? 2.010   -1.187  3.001   1.00 0.00 ? 79  VAL A HA   6  
ATOM 10863 H HB   . VAL A 1 79  ? 1.884   -1.555  5.946   1.00 0.00 ? 79  VAL A HB   6  
ATOM 10864 H HG11 . VAL A 1 79  ? 4.535   -1.171  5.745   1.00 0.00 ? 79  VAL A HG11 6  
ATOM 10865 H HG12 . VAL A 1 79  ? 3.803   -2.786  5.902   1.00 0.00 ? 79  VAL A HG12 6  
ATOM 10866 H HG13 . VAL A 1 79  ? 4.288   -2.181  4.300   1.00 0.00 ? 79  VAL A HG13 6  
ATOM 10867 H HG21 . VAL A 1 79  ? 1.582   0.642   4.778   1.00 0.00 ? 79  VAL A HG21 6  
ATOM 10868 H HG22 . VAL A 1 79  ? 2.899   0.627   5.975   1.00 0.00 ? 79  VAL A HG22 6  
ATOM 10869 H HG23 . VAL A 1 79  ? 3.275   0.532   4.238   1.00 0.00 ? 79  VAL A HG23 6  
ATOM 10870 N N    . LEU A 1 80  ? 3.060   -3.323  2.390   1.00 0.00 ? 80  LEU A N    6  
ATOM 10871 C CA   . LEU A 1 80  ? 3.598   -4.591  1.927   1.00 0.00 ? 80  LEU A CA   6  
ATOM 10872 C C    . LEU A 1 80  ? 5.101   -4.635  2.207   1.00 0.00 ? 80  LEU A C    6  
ATOM 10873 O O    . LEU A 1 80  ? 5.690   -3.635  2.614   1.00 0.00 ? 80  LEU A O    6  
ATOM 10874 C CB   . LEU A 1 80  ? 3.240   -4.820  0.457   1.00 0.00 ? 80  LEU A CB   6  
ATOM 10875 C CG   . LEU A 1 80  ? 1.773   -5.145  0.167   1.00 0.00 ? 80  LEU A CG   6  
ATOM 10876 C CD1  . LEU A 1 80  ? 1.277   -4.390  -1.067  1.00 0.00 ? 80  LEU A CD1  6  
ATOM 10877 C CD2  . LEU A 1 80  ? 1.561   -6.655  0.038   1.00 0.00 ? 80  LEU A CD2  6  
ATOM 10878 H H    . LEU A 1 80  ? 3.311   -2.530  1.835   1.00 0.00 ? 80  LEU A H    6  
ATOM 10879 H HA   . LEU A 1 80  ? 3.116   -5.381  2.503   1.00 0.00 ? 80  LEU A HA   6  
ATOM 10880 H HB2  . LEU A 1 80  ? 3.511   -3.927  -0.106  1.00 0.00 ? 80  LEU A HB2  6  
ATOM 10881 H HB3  . LEU A 1 80  ? 3.854   -5.636  0.077   1.00 0.00 ? 80  LEU A HB3  6  
ATOM 10882 H HG   . LEU A 1 80  ? 1.174   -4.808  1.013   1.00 0.00 ? 80  LEU A HG   6  
ATOM 10883 H HD11 . LEU A 1 80  ? 1.978   -4.538  -1.890  1.00 0.00 ? 80  LEU A HD11 6  
ATOM 10884 H HD12 . LEU A 1 80  ? 0.295   -4.766  -1.354  1.00 0.00 ? 80  LEU A HD12 6  
ATOM 10885 H HD13 . LEU A 1 80  ? 1.206   -3.326  -0.838  1.00 0.00 ? 80  LEU A HD13 6  
ATOM 10886 H HD21 . LEU A 1 80  ? 2.469   -7.177  0.342   1.00 0.00 ? 80  LEU A HD21 6  
ATOM 10887 H HD22 . LEU A 1 80  ? 0.734   -6.962  0.678   1.00 0.00 ? 80  LEU A HD22 6  
ATOM 10888 H HD23 . LEU A 1 80  ? 1.330   -6.902  -0.998  1.00 0.00 ? 80  LEU A HD23 6  
ATOM 10889 N N    . ALA A 1 81  ? 5.680   -5.805  1.978   1.00 0.00 ? 81  ALA A N    6  
ATOM 10890 C CA   . ALA A 1 81  ? 7.103   -5.993  2.201   1.00 0.00 ? 81  ALA A CA   6  
ATOM 10891 C C    . ALA A 1 81  ? 7.882   -5.385  1.033   1.00 0.00 ? 81  ALA A C    6  
ATOM 10892 O O    . ALA A 1 81  ? 7.302   -5.052  0.001   1.00 0.00 ? 81  ALA A O    6  
ATOM 10893 C CB   . ALA A 1 81  ? 7.399   -7.482  2.387   1.00 0.00 ? 81  ALA A CB   6  
ATOM 10894 H H    . ALA A 1 81  ? 5.194   -6.614  1.647   1.00 0.00 ? 81  ALA A H    6  
ATOM 10895 H HA   . ALA A 1 81  ? 7.368   -5.465  3.117   1.00 0.00 ? 81  ALA A HA   6  
ATOM 10896 H HB1  . ALA A 1 81  ? 6.461   -8.031  2.474   1.00 0.00 ? 81  ALA A HB1  6  
ATOM 10897 H HB2  . ALA A 1 81  ? 7.958   -7.852  1.527   1.00 0.00 ? 81  ALA A HB2  6  
ATOM 10898 H HB3  . ALA A 1 81  ? 7.989   -7.625  3.293   1.00 0.00 ? 81  ALA A HB3  6  
ATOM 10899 N N    . PRO A 1 82  ? 9.220   -5.255  1.240   1.00 0.00 ? 82  PRO A N    6  
ATOM 10900 C CA   . PRO A 1 82  ? 10.085  -4.693  0.217   1.00 0.00 ? 82  PRO A CA   6  
ATOM 10901 C C    . PRO A 1 82  ? 10.322  -5.698  -0.913  1.00 0.00 ? 82  PRO A C    6  
ATOM 10902 O O    . PRO A 1 82  ? 10.975  -5.379  -1.905  1.00 0.00 ? 82  PRO A O    6  
ATOM 10903 C CB   . PRO A 1 82  ? 11.361  -4.308  0.947   1.00 0.00 ? 82  PRO A CB   6  
ATOM 10904 C CG   . PRO A 1 82  ? 11.346  -5.088  2.252   1.00 0.00 ? 82  PRO A CG   6  
ATOM 10905 C CD   . PRO A 1 82  ? 9.942   -5.638  2.450   1.00 0.00 ? 82  PRO A CD   6  
ATOM 10906 H HA   . PRO A 1 82  ? 9.649   -3.901  -0.210  1.00 0.00 ? 82  PRO A HA   6  
ATOM 10907 H HB2  . PRO A 1 82  ? 12.241  -4.557  0.354   1.00 0.00 ? 82  PRO A HB2  6  
ATOM 10908 H HB3  . PRO A 1 82  ? 11.395  -3.235  1.134   1.00 0.00 ? 82  PRO A HB3  6  
ATOM 10909 H HG2  . PRO A 1 82  ? 12.073  -5.900  2.220   1.00 0.00 ? 82  PRO A HG2  6  
ATOM 10910 H HG3  . PRO A 1 82  ? 11.624  -4.443  3.085   1.00 0.00 ? 82  PRO A HG3  6  
ATOM 10911 H HD2  . PRO A 1 82  ? 9.955   -6.720  2.577   1.00 0.00 ? 82  PRO A HD2  6  
ATOM 10912 H HD3  . PRO A 1 82  ? 9.474   -5.218  3.340   1.00 0.00 ? 82  PRO A HD3  6  
ATOM 10913 N N    . SER A 1 83  ? 9.779   -6.891  -0.724  1.00 0.00 ? 83  SER A N    6  
ATOM 10914 C CA   . SER A 1 83  ? 9.924   -7.945  -1.714  1.00 0.00 ? 83  SER A CA   6  
ATOM 10915 C C    . SER A 1 83  ? 8.549   -8.359  -2.242  1.00 0.00 ? 83  SER A C    6  
ATOM 10916 O O    . SER A 1 83  ? 8.324   -9.528  -2.549  1.00 0.00 ? 83  SER A O    6  
ATOM 10917 C CB   . SER A 1 83  ? 10.654  -9.155  -1.128  1.00 0.00 ? 83  SER A CB   6  
ATOM 10918 O OG   . SER A 1 83  ? 9.980   -9.685  0.010   1.00 0.00 ? 83  SER A OG   6  
ATOM 10919 H H    . SER A 1 83  ? 9.249   -7.143  0.087   1.00 0.00 ? 83  SER A H    6  
ATOM 10920 H HA   . SER A 1 83  ? 10.525  -7.510  -2.512  1.00 0.00 ? 83  SER A HA   6  
ATOM 10921 H HB2  . SER A 1 83  ? 10.742  -9.929  -1.890  1.00 0.00 ? 83  SER A HB2  6  
ATOM 10922 H HB3  . SER A 1 83  ? 11.667  -8.867  -0.848  1.00 0.00 ? 83  SER A HB3  6  
ATOM 10923 H HG   . SER A 1 83  ? 9.644   -10.606 -0.189  1.00 0.00 ? 83  SER A HG   6  
ATOM 10924 N N    . ALA A 1 84  ? 7.664   -7.376  -2.331  1.00 0.00 ? 84  ALA A N    6  
ATOM 10925 C CA   . ALA A 1 84  ? 6.318   -7.624  -2.817  1.00 0.00 ? 84  ALA A CA   6  
ATOM 10926 C C    . ALA A 1 84  ? 6.226   -7.208  -4.287  1.00 0.00 ? 84  ALA A C    6  
ATOM 10927 O O    . ALA A 1 84  ? 6.670   -6.123  -4.658  1.00 0.00 ? 84  ALA A O    6  
ATOM 10928 C CB   . ALA A 1 84  ? 5.312   -6.879  -1.937  1.00 0.00 ? 84  ALA A CB   6  
ATOM 10929 H H    . ALA A 1 84  ? 7.855   -6.428  -2.080  1.00 0.00 ? 84  ALA A H    6  
ATOM 10930 H HA   . ALA A 1 84  ? 6.128   -8.694  -2.738  1.00 0.00 ? 84  ALA A HA   6  
ATOM 10931 H HB1  . ALA A 1 84  ? 5.449   -7.177  -0.897  1.00 0.00 ? 84  ALA A HB1  6  
ATOM 10932 H HB2  . ALA A 1 84  ? 5.473   -5.805  -2.031  1.00 0.00 ? 84  ALA A HB2  6  
ATOM 10933 H HB3  . ALA A 1 84  ? 4.299   -7.124  -2.255  1.00 0.00 ? 84  ALA A HB3  6  
ATOM 10934 N N    . ARG A 1 85  ? 5.646   -8.094  -5.084  1.00 0.00 ? 85  ARG A N    6  
ATOM 10935 C CA   . ARG A 1 85  ? 5.490   -7.833  -6.505  1.00 0.00 ? 85  ARG A CA   6  
ATOM 10936 C C    . ARG A 1 85  ? 4.009   -7.669  -6.855  1.00 0.00 ? 85  ARG A C    6  
ATOM 10937 O O    . ARG A 1 85  ? 3.670   -7.025  -7.847  1.00 0.00 ? 85  ARG A O    6  
ATOM 10938 C CB   . ARG A 1 85  ? 6.082   -8.968  -7.342  1.00 0.00 ? 85  ARG A CB   6  
ATOM 10939 C CG   . ARG A 1 85  ? 6.497   -8.469  -8.727  1.00 0.00 ? 85  ARG A CG   6  
ATOM 10940 C CD   . ARG A 1 85  ? 7.939   -7.958  -8.716  1.00 0.00 ? 85  ARG A CD   6  
ATOM 10941 N NE   . ARG A 1 85  ? 8.710   -8.593  -9.808  1.00 0.00 ? 85  ARG A NE   6  
ATOM 10942 C CZ   . ARG A 1 85  ? 9.172   -9.850  -9.768  1.00 0.00 ? 85  ARG A CZ   6  
ATOM 10943 N NH1  . ARG A 1 85  ? 8.945   -10.614 -8.691  1.00 0.00 ? 85  ARG A NH1  6  
ATOM 10944 N NH2  . ARG A 1 85  ? 9.862   -10.344 -10.806 1.00 0.00 ? 85  ARG A NH2  6  
ATOM 10945 H H    . ARG A 1 85  ? 5.287   -8.974  -4.774  1.00 0.00 ? 85  ARG A H    6  
ATOM 10946 H HA   . ARG A 1 85  ? 6.039   -6.908  -6.680  1.00 0.00 ? 85  ARG A HA   6  
ATOM 10947 H HB2  . ARG A 1 85  ? 6.947   -9.390  -6.829  1.00 0.00 ? 85  ARG A HB2  6  
ATOM 10948 H HB3  . ARG A 1 85  ? 5.350   -9.770  -7.444  1.00 0.00 ? 85  ARG A HB3  6  
ATOM 10949 H HG2  . ARG A 1 85  ? 6.399   -9.277  -9.453  1.00 0.00 ? 85  ARG A HG2  6  
ATOM 10950 H HG3  . ARG A 1 85  ? 5.827   -7.672  -9.046  1.00 0.00 ? 85  ARG A HG3  6  
ATOM 10951 H HD2  . ARG A 1 85  ? 7.950   -6.874  -8.835  1.00 0.00 ? 85  ARG A HD2  6  
ATOM 10952 H HD3  . ARG A 1 85  ? 8.404   -8.178  -7.756  1.00 0.00 ? 85  ARG A HD3  6  
ATOM 10953 H HE   . ARG A 1 85  ? 8.897   -8.051  -10.627 1.00 0.00 ? 85  ARG A HE   6  
ATOM 10954 H HH11 . ARG A 1 85  ? 8.430   -10.246 -7.917  1.00 0.00 ? 85  ARG A HH11 6  
ATOM 10955 H HH12 . ARG A 1 85  ? 9.290   -11.552 -8.661  1.00 0.00 ? 85  ARG A HH12 6  
ATOM 10956 H HH21 . ARG A 1 85  ? 10.032  -9.774  -11.610 1.00 0.00 ? 85  ARG A HH21 6  
ATOM 10957 H HH22 . ARG A 1 85  ? 10.207  -11.282 -10.776 1.00 0.00 ? 85  ARG A HH22 6  
ATOM 10958 N N    . GLN A 1 86  ? 3.168   -8.262  -6.021  1.00 0.00 ? 86  GLN A N    6  
ATOM 10959 C CA   . GLN A 1 86  ? 1.732   -8.189  -6.230  1.00 0.00 ? 86  GLN A CA   6  
ATOM 10960 C C    . GLN A 1 86  ? 1.001   -8.151  -4.887  1.00 0.00 ? 86  GLN A C    6  
ATOM 10961 O O    . GLN A 1 86  ? 1.592   -8.434  -3.846  1.00 0.00 ? 86  GLN A O    6  
ATOM 10962 C CB   . GLN A 1 86  ? 1.243   -9.359  -7.087  1.00 0.00 ? 86  GLN A CB   6  
ATOM 10963 C CG   . GLN A 1 86  ? 1.087   -10.627 -6.247  1.00 0.00 ? 86  GLN A CG   6  
ATOM 10964 C CD   . GLN A 1 86  ? 1.195   -11.880 -7.119  1.00 0.00 ? 86  GLN A CD   6  
ATOM 10965 O OE1  . GLN A 1 86  ? 0.524   -12.025 -8.127  1.00 0.00 ? 86  GLN A OE1  6  
ATOM 10966 N NE2  . GLN A 1 86  ? 2.075   -12.773 -6.675  1.00 0.00 ? 86  GLN A NE2  6  
ATOM 10967 H H    . GLN A 1 86  ? 3.452   -8.783  -5.216  1.00 0.00 ? 86  GLN A H    6  
ATOM 10968 H HA   . GLN A 1 86  ? 1.564   -7.257  -6.769  1.00 0.00 ? 86  GLN A HA   6  
ATOM 10969 H HB2  . GLN A 1 86  ? 0.288   -9.103  -7.547  1.00 0.00 ? 86  GLN A HB2  6  
ATOM 10970 H HB3  . GLN A 1 86  ? 1.948   -9.540  -7.898  1.00 0.00 ? 86  GLN A HB3  6  
ATOM 10971 H HG2  . GLN A 1 86  ? 1.854   -10.651 -5.472  1.00 0.00 ? 86  GLN A HG2  6  
ATOM 10972 H HG3  . GLN A 1 86  ? 0.122   -10.615 -5.739  1.00 0.00 ? 86  GLN A HG3  6  
ATOM 10973 H HE21 . GLN A 1 86  ? 2.594   -12.592 -5.840  1.00 0.00 ? 86  GLN A HE21 6  
ATOM 10974 H HE22 . GLN A 1 86  ? 2.218   -13.626 -7.177  1.00 0.00 ? 86  GLN A HE22 6  
ATOM 10975 N N    . TYR A 1 87  ? -0.275  -7.800  -4.953  1.00 0.00 ? 87  TYR A N    6  
ATOM 10976 C CA   . TYR A 1 87  ? -1.093  -7.721  -3.754  1.00 0.00 ? 87  TYR A CA   6  
ATOM 10977 C C    . TYR A 1 87  ? -2.544  -8.103  -4.055  1.00 0.00 ? 87  TYR A C    6  
ATOM 10978 O O    . TYR A 1 87  ? -3.098  -7.697  -5.075  1.00 0.00 ? 87  TYR A O    6  
ATOM 10979 C CB   . TYR A 1 87  ? -1.045  -6.259  -3.306  1.00 0.00 ? 87  TYR A CB   6  
ATOM 10980 C CG   . TYR A 1 87  ? -2.110  -5.890  -2.272  1.00 0.00 ? 87  TYR A CG   6  
ATOM 10981 C CD1  . TYR A 1 87  ? -3.369  -5.503  -2.685  1.00 0.00 ? 87  TYR A CD1  6  
ATOM 10982 C CD2  . TYR A 1 87  ? -1.812  -5.945  -0.925  1.00 0.00 ? 87  TYR A CD2  6  
ATOM 10983 C CE1  . TYR A 1 87  ? -4.371  -5.155  -1.711  1.00 0.00 ? 87  TYR A CE1  6  
ATOM 10984 C CE2  . TYR A 1 87  ? -2.815  -5.597  0.048   1.00 0.00 ? 87  TYR A CE2  6  
ATOM 10985 C CZ   . TYR A 1 87  ? -4.045  -5.220  -0.393  1.00 0.00 ? 87  TYR A CZ   6  
ATOM 10986 O OH   . TYR A 1 87  ? -4.991  -4.892  0.527   1.00 0.00 ? 87  TYR A OH   6  
ATOM 10987 H H    . TYR A 1 87  ? -0.749  -7.572  -5.803  1.00 0.00 ? 87  TYR A H    6  
ATOM 10988 H HA   . TYR A 1 87  ? -0.685  -8.419  -3.023  1.00 0.00 ? 87  TYR A HA   6  
ATOM 10989 H HB2  . TYR A 1 87  ? -0.060  -6.050  -2.889  1.00 0.00 ? 87  TYR A HB2  6  
ATOM 10990 H HB3  . TYR A 1 87  ? -1.164  -5.618  -4.180  1.00 0.00 ? 87  TYR A HB3  6  
ATOM 10991 H HD1  . TYR A 1 87  ? -3.604  -5.460  -3.749  1.00 0.00 ? 87  TYR A HD1  6  
ATOM 10992 H HD2  . TYR A 1 87  ? -0.818  -6.251  -0.599  1.00 0.00 ? 87  TYR A HD2  6  
ATOM 10993 H HE1  . TYR A 1 87  ? -5.369  -4.848  -2.024  1.00 0.00 ? 87  TYR A HE1  6  
ATOM 10994 H HE2  . TYR A 1 87  ? -2.593  -5.636  1.115   1.00 0.00 ? 87  TYR A HE2  6  
ATOM 10995 H HH   . TYR A 1 87  ? -4.808  -3.981  0.897   1.00 0.00 ? 87  TYR A HH   6  
ATOM 10996 N N    . THR A 1 88  ? -3.118  -8.879  -3.147  1.00 0.00 ? 88  THR A N    6  
ATOM 10997 C CA   . THR A 1 88  ? -4.493  -9.320  -3.302  1.00 0.00 ? 88  THR A CA   6  
ATOM 10998 C C    . THR A 1 88  ? -5.428  -8.462  -2.446  1.00 0.00 ? 88  THR A C    6  
ATOM 10999 O O    . THR A 1 88  ? -5.171  -8.249  -1.263  1.00 0.00 ? 88  THR A O    6  
ATOM 11000 C CB   . THR A 1 88  ? -4.554  -10.810 -2.960  1.00 0.00 ? 88  THR A CB   6  
ATOM 11001 O OG1  . THR A 1 88  ? -3.677  -11.419 -3.904  1.00 0.00 ? 88  THR A OG1  6  
ATOM 11002 C CG2  . THR A 1 88  ? -5.919  -11.427 -3.268  1.00 0.00 ? 88  THR A CG2  6  
ATOM 11003 H H    . THR A 1 88  ? -2.660  -9.205  -2.320  1.00 0.00 ? 88  THR A H    6  
ATOM 11004 H HA   . THR A 1 88  ? -4.786  -9.173  -4.341  1.00 0.00 ? 88  THR A HA   6  
ATOM 11005 H HB   . THR A 1 88  ? -4.274  -10.983 -1.921  1.00 0.00 ? 88  THR A HB   6  
ATOM 11006 H HG1  . THR A 1 88  ? -2.726  -11.275 -3.630  1.00 0.00 ? 88  THR A HG1  6  
ATOM 11007 H HG21 . THR A 1 88  ? -6.376  -11.780 -2.344  1.00 0.00 ? 88  THR A HG21 6  
ATOM 11008 H HG22 . THR A 1 88  ? -6.562  -10.676 -3.727  1.00 0.00 ? 88  THR A HG22 6  
ATOM 11009 H HG23 . THR A 1 88  ? -5.793  -12.265 -3.954  1.00 0.00 ? 88  THR A HG23 6  
ATOM 11010 N N    . ALA A 1 89  ? -6.493  -7.993  -3.079  1.00 0.00 ? 89  ALA A N    6  
ATOM 11011 C CA   . ALA A 1 89  ? -7.468  -7.164  -2.391  1.00 0.00 ? 89  ALA A CA   6  
ATOM 11012 C C    . ALA A 1 89  ? -8.726  -7.988  -2.111  1.00 0.00 ? 89  ALA A C    6  
ATOM 11013 O O    . ALA A 1 89  ? -9.104  -8.841  -2.911  1.00 0.00 ? 89  ALA A O    6  
ATOM 11014 C CB   . ALA A 1 89  ? -7.761  -5.918  -3.230  1.00 0.00 ? 89  ALA A CB   6  
ATOM 11015 H H    . ALA A 1 89  ? -6.695  -8.172  -4.042  1.00 0.00 ? 89  ALA A H    6  
ATOM 11016 H HA   . ALA A 1 89  ? -7.028  -6.853  -1.443  1.00 0.00 ? 89  ALA A HA   6  
ATOM 11017 H HB1  . ALA A 1 89  ? -8.593  -6.122  -3.904  1.00 0.00 ? 89  ALA A HB1  6  
ATOM 11018 H HB2  . ALA A 1 89  ? -8.022  -5.090  -2.571  1.00 0.00 ? 89  ALA A HB2  6  
ATOM 11019 H HB3  . ALA A 1 89  ? -6.878  -5.655  -3.811  1.00 0.00 ? 89  ALA A HB3  6  
ATOM 11020 N N    . THR A 1 90  ? -9.339  -7.704  -0.971  1.00 0.00 ? 90  THR A N    6  
ATOM 11021 C CA   . THR A 1 90  ? -10.547 -8.408  -0.575  1.00 0.00 ? 90  THR A CA   6  
ATOM 11022 C C    . THR A 1 90  ? -11.460 -7.487  0.237   1.00 0.00 ? 90  THR A C    6  
ATOM 11023 O O    . THR A 1 90  ? -10.981 -6.633  0.982   1.00 0.00 ? 90  THR A O    6  
ATOM 11024 C CB   . THR A 1 90  ? -10.131 -9.671  0.181   1.00 0.00 ? 90  THR A CB   6  
ATOM 11025 O OG1  . THR A 1 90  ? -9.171  -9.209  1.128   1.00 0.00 ? 90  THR A OG1  6  
ATOM 11026 C CG2  . THR A 1 90  ? -9.347  -10.648 -0.698  1.00 0.00 ? 90  THR A CG2  6  
ATOM 11027 H H    . THR A 1 90  ? -9.025  -7.008  -0.325  1.00 0.00 ? 90  THR A H    6  
ATOM 11028 H HA   . THR A 1 90  ? -11.093 -8.686  -1.476  1.00 0.00 ? 90  THR A HA   6  
ATOM 11029 H HB   . THR A 1 90  ? -10.996 -10.159 0.629   1.00 0.00 ? 90  THR A HB   6  
ATOM 11030 H HG1  . THR A 1 90  ? -8.490  -8.636  0.672   1.00 0.00 ? 90  THR A HG1  6  
ATOM 11031 H HG21 . THR A 1 90  ? -8.405  -10.190 -1.000  1.00 0.00 ? 90  THR A HG21 6  
ATOM 11032 H HG22 . THR A 1 90  ? -9.144  -11.560 -0.136  1.00 0.00 ? 90  THR A HG22 6  
ATOM 11033 H HG23 . THR A 1 90  ? -9.934  -10.891 -1.584  1.00 0.00 ? 90  THR A HG23 6  
ATOM 11034 N N    . GLY A 1 91  ? -12.757 -7.691  0.065   1.00 0.00 ? 91  GLY A N    6  
ATOM 11035 C CA   . GLY A 1 91  ? -13.741 -6.890  0.772   1.00 0.00 ? 91  GLY A CA   6  
ATOM 11036 C C    . GLY A 1 91  ? -14.019 -5.581  0.030   1.00 0.00 ? 91  GLY A C    6  
ATOM 11037 O O    . GLY A 1 91  ? -13.979 -4.505  0.625   1.00 0.00 ? 91  GLY A O    6  
ATOM 11038 H H    . GLY A 1 91  ? -13.138 -8.388  -0.543  1.00 0.00 ? 91  GLY A H    6  
ATOM 11039 H HA2  . GLY A 1 91  ? -14.667 -7.455  0.879   1.00 0.00 ? 91  GLY A HA2  6  
ATOM 11040 H HA3  . GLY A 1 91  ? -13.383 -6.672  1.778   1.00 0.00 ? 91  GLY A HA3  6  
ATOM 11041 N N    . LEU A 1 92  ? -14.293 -5.716  -1.259  1.00 0.00 ? 92  LEU A N    6  
ATOM 11042 C CA   . LEU A 1 92  ? -14.577 -4.557  -2.089  1.00 0.00 ? 92  LEU A CA   6  
ATOM 11043 C C    . LEU A 1 92  ? -15.997 -4.670  -2.647  1.00 0.00 ? 92  LEU A C    6  
ATOM 11044 O O    . LEU A 1 92  ? -16.581 -5.753  -2.655  1.00 0.00 ? 92  LEU A O    6  
ATOM 11045 C CB   . LEU A 1 92  ? -13.504 -4.395  -3.168  1.00 0.00 ? 92  LEU A CB   6  
ATOM 11046 C CG   . LEU A 1 92  ? -12.076 -4.756  -2.753  1.00 0.00 ? 92  LEU A CG   6  
ATOM 11047 C CD1  . LEU A 1 92  ? -11.250 -5.199  -3.962  1.00 0.00 ? 92  LEU A CD1  6  
ATOM 11048 C CD2  . LEU A 1 92  ? -11.416 -3.601  -1.999  1.00 0.00 ? 92  LEU A CD2  6  
ATOM 11049 H H    . LEU A 1 92  ? -14.324 -6.594  -1.736  1.00 0.00 ? 92  LEU A H    6  
ATOM 11050 H HA   . LEU A 1 92  ? -14.526 -3.677  -1.449  1.00 0.00 ? 92  LEU A HA   6  
ATOM 11051 H HB2  . LEU A 1 92  ? -13.780 -5.012  -4.023  1.00 0.00 ? 92  LEU A HB2  6  
ATOM 11052 H HB3  . LEU A 1 92  ? -13.512 -3.359  -3.507  1.00 0.00 ? 92  LEU A HB3  6  
ATOM 11053 H HG   . LEU A 1 92  ? -12.123 -5.603  -2.068  1.00 0.00 ? 92  LEU A HG   6  
ATOM 11054 H HD11 . LEU A 1 92  ? -11.348 -6.276  -4.095  1.00 0.00 ? 92  LEU A HD11 6  
ATOM 11055 H HD12 . LEU A 1 92  ? -11.611 -4.689  -4.855  1.00 0.00 ? 92  LEU A HD12 6  
ATOM 11056 H HD13 . LEU A 1 92  ? -10.202 -4.946  -3.798  1.00 0.00 ? 92  LEU A HD13 6  
ATOM 11057 H HD21 . LEU A 1 92  ? -10.927 -3.984  -1.103  1.00 0.00 ? 92  LEU A HD21 6  
ATOM 11058 H HD22 . LEU A 1 92  ? -10.675 -3.124  -2.641  1.00 0.00 ? 92  LEU A HD22 6  
ATOM 11059 H HD23 . LEU A 1 92  ? -12.174 -2.871  -1.715  1.00 0.00 ? 92  LEU A HD23 6  
ATOM 11060 N N    . LYS A 1 93  ? -16.513 -3.537  -3.099  1.00 0.00 ? 93  LYS A N    6  
ATOM 11061 C CA   . LYS A 1 93  ? -17.854 -3.495  -3.657  1.00 0.00 ? 93  LYS A CA   6  
ATOM 11062 C C    . LYS A 1 93  ? -17.778 -3.694  -5.173  1.00 0.00 ? 93  LYS A C    6  
ATOM 11063 O O    . LYS A 1 93  ? -17.011 -3.014  -5.853  1.00 0.00 ? 93  LYS A O    6  
ATOM 11064 C CB   . LYS A 1 93  ? -18.568 -2.208  -3.241  1.00 0.00 ? 93  LYS A CB   6  
ATOM 11065 C CG   . LYS A 1 93  ? -19.915 -2.072  -3.954  1.00 0.00 ? 93  LYS A CG   6  
ATOM 11066 C CD   . LYS A 1 93  ? -20.149 -0.632  -4.414  1.00 0.00 ? 93  LYS A CD   6  
ATOM 11067 C CE   . LYS A 1 93  ? -20.080 0.339   -3.233  1.00 0.00 ? 93  LYS A CE   6  
ATOM 11068 N NZ   . LYS A 1 93  ? -20.654 1.651   -3.606  1.00 0.00 ? 93  LYS A NZ   6  
ATOM 11069 H H    . LYS A 1 93  ? -16.032 -2.660  -3.089  1.00 0.00 ? 93  LYS A H    6  
ATOM 11070 H HA   . LYS A 1 93  ? -18.413 -4.327  -3.228  1.00 0.00 ? 93  LYS A HA   6  
ATOM 11071 H HB2  . LYS A 1 93  ? -18.722 -2.205  -2.162  1.00 0.00 ? 93  LYS A HB2  6  
ATOM 11072 H HB3  . LYS A 1 93  ? -17.940 -1.348  -3.475  1.00 0.00 ? 93  LYS A HB3  6  
ATOM 11073 H HG2  . LYS A 1 93  ? -19.944 -2.741  -4.814  1.00 0.00 ? 93  LYS A HG2  6  
ATOM 11074 H HG3  . LYS A 1 93  ? -20.718 -2.379  -3.284  1.00 0.00 ? 93  LYS A HG3  6  
ATOM 11075 H HD2  . LYS A 1 93  ? -19.402 -0.358  -5.159  1.00 0.00 ? 93  LYS A HD2  6  
ATOM 11076 H HD3  . LYS A 1 93  ? -21.123 -0.554  -4.896  1.00 0.00 ? 93  LYS A HD3  6  
ATOM 11077 H HE2  . LYS A 1 93  ? -20.622 -0.074  -2.383  1.00 0.00 ? 93  LYS A HE2  6  
ATOM 11078 H HE3  . LYS A 1 93  ? -19.044 0.465   -2.919  1.00 0.00 ? 93  LYS A HE3  6  
ATOM 11079 H HZ1  . LYS A 1 93  ? -21.488 1.812   -3.078  1.00 0.00 ? 93  LYS A HZ1  6  
ATOM 11080 H HZ2  . LYS A 1 93  ? -19.990 2.373   -3.411  1.00 0.00 ? 93  LYS A HZ2  6  
ATOM 11081 H HZ3  . LYS A 1 93  ? -20.872 1.654   -4.582  1.00 0.00 ? 93  LYS A HZ3  6  
ATOM 11082 N N    . PRO A 1 94  ? -18.605 -4.652  -5.669  1.00 0.00 ? 94  PRO A N    6  
ATOM 11083 C CA   . PRO A 1 94  ? -18.638 -4.949  -7.091  1.00 0.00 ? 94  PRO A CA   6  
ATOM 11084 C C    . PRO A 1 94  ? -19.384 -3.857  -7.861  1.00 0.00 ? 94  PRO A C    6  
ATOM 11085 O O    . PRO A 1 94  ? -20.132 -3.078  -7.273  1.00 0.00 ? 94  PRO A O    6  
ATOM 11086 C CB   . PRO A 1 94  ? -19.306 -6.310  -7.194  1.00 0.00 ? 94  PRO A CB   6  
ATOM 11087 C CG   . PRO A 1 94  ? -20.037 -6.516  -5.877  1.00 0.00 ? 94  PRO A CG   6  
ATOM 11088 C CD   . PRO A 1 94  ? -19.526 -5.477  -4.893  1.00 0.00 ? 94  PRO A CD   6  
ATOM 11089 H HA   . PRO A 1 94  ? -17.711 -4.961  -7.465  1.00 0.00 ? 94  PRO A HA   6  
ATOM 11090 H HB2  . PRO A 1 94  ? -19.999 -6.343  -8.035  1.00 0.00 ? 94  PRO A HB2  6  
ATOM 11091 H HB3  . PRO A 1 94  ? -18.568 -7.096  -7.358  1.00 0.00 ? 94  PRO A HB3  6  
ATOM 11092 H HG2  . PRO A 1 94  ? -21.113 -6.413  -6.018  1.00 0.00 ? 94  PRO A HG2  6  
ATOM 11093 H HG3  . PRO A 1 94  ? -19.861 -7.522  -5.496  1.00 0.00 ? 94  PRO A HG3  6  
ATOM 11094 H HD2  . PRO A 1 94  ? -20.344 -4.881  -4.486  1.00 0.00 ? 94  PRO A HD2  6  
ATOM 11095 H HD3  . PRO A 1 94  ? -19.023 -5.945  -4.048  1.00 0.00 ? 94  PRO A HD3  6  
ATOM 11096 N N    . GLU A 1 95  ? -19.154 -3.836  -9.166  1.00 0.00 ? 95  GLU A N    6  
ATOM 11097 C CA   . GLU A 1 95  ? -19.796 -2.853  -10.023 1.00 0.00 ? 95  GLU A CA   6  
ATOM 11098 C C    . GLU A 1 95  ? -19.335 -1.443  -9.649  1.00 0.00 ? 95  GLU A C    6  
ATOM 11099 O O    . GLU A 1 95  ? -20.152 -0.529  -9.535  1.00 0.00 ? 95  GLU A O    6  
ATOM 11100 C CB   . GLU A 1 95  ? -21.319 -2.971  -9.948  1.00 0.00 ? 95  GLU A CB   6  
ATOM 11101 C CG   . GLU A 1 95  ? -21.812 -4.203  -10.708 1.00 0.00 ? 95  GLU A CG   6  
ATOM 11102 C CD   . GLU A 1 95  ? -22.311 -5.280  -9.743  1.00 0.00 ? 95  GLU A CD   6  
ATOM 11103 O OE1  . GLU A 1 95  ? -23.321 -5.007  -9.060  1.00 0.00 ? 95  GLU A OE1  6  
ATOM 11104 O OE2  . GLU A 1 95  ? -21.670 -6.353  -9.709  1.00 0.00 ? 95  GLU A OE2  6  
ATOM 11105 H H    . GLU A 1 95  ? -18.544 -4.473  -9.637  1.00 0.00 ? 95  GLU A H    6  
ATOM 11106 H HA   . GLU A 1 95  ? -19.468 -3.093  -11.034 1.00 0.00 ? 95  GLU A HA   6  
ATOM 11107 H HB2  . GLU A 1 95  ? -21.632 -3.033  -8.905  1.00 0.00 ? 95  GLU A HB2  6  
ATOM 11108 H HB3  . GLU A 1 95  ? -21.778 -2.074  -10.365 1.00 0.00 ? 95  GLU A HB3  6  
ATOM 11109 H HG2  . GLU A 1 95  ? -22.616 -3.918  -11.387 1.00 0.00 ? 95  GLU A HG2  6  
ATOM 11110 H HG3  . GLU A 1 95  ? -21.005 -4.604  -11.321 1.00 0.00 ? 95  GLU A HG3  6  
ATOM 11111 N N    . SER A 1 96  ? -18.030 -1.309  -9.469  1.00 0.00 ? 96  SER A N    6  
ATOM 11112 C CA   . SER A 1 96  ? -17.451 -0.025  -9.111  1.00 0.00 ? 96  SER A CA   6  
ATOM 11113 C C    . SER A 1 96  ? -16.006 0.054   -9.606  1.00 0.00 ? 96  SER A C    6  
ATOM 11114 O O    . SER A 1 96  ? -15.527 -0.854  -10.284 1.00 0.00 ? 96  SER A O    6  
ATOM 11115 C CB   . SER A 1 96  ? -17.508 0.202   -7.599  1.00 0.00 ? 96  SER A CB   6  
ATOM 11116 O OG   . SER A 1 96  ? -18.841 0.407   -7.139  1.00 0.00 ? 96  SER A OG   6  
ATOM 11117 H H    . SER A 1 96  ? -17.373 -2.057  -9.564  1.00 0.00 ? 96  SER A H    6  
ATOM 11118 H HA   . SER A 1 96  ? -18.069 0.720   -9.613  1.00 0.00 ? 96  SER A HA   6  
ATOM 11119 H HB2  . SER A 1 96  ? -17.076 -0.659  -7.087  1.00 0.00 ? 96  SER A HB2  6  
ATOM 11120 H HB3  . SER A 1 96  ? -16.897 1.066   -7.339  1.00 0.00 ? 96  SER A HB3  6  
ATOM 11121 H HG   . SER A 1 96  ? -19.378 -0.426  -7.265  1.00 0.00 ? 96  SER A HG   6  
ATOM 11122 N N    . VAL A 1 97  ? -15.350 1.149   -9.248  1.00 0.00 ? 97  VAL A N    6  
ATOM 11123 C CA   . VAL A 1 97  ? -13.969 1.358   -9.647  1.00 0.00 ? 97  VAL A CA   6  
ATOM 11124 C C    . VAL A 1 97  ? -13.130 1.691   -8.412  1.00 0.00 ? 97  VAL A C    6  
ATOM 11125 O O    . VAL A 1 97  ? -13.518 2.531   -7.601  1.00 0.00 ? 97  VAL A O    6  
ATOM 11126 C CB   . VAL A 1 97  ? -13.895 2.438   -10.729 1.00 0.00 ? 97  VAL A CB   6  
ATOM 11127 C CG1  . VAL A 1 97  ? -12.502 2.488   -11.360 1.00 0.00 ? 97  VAL A CG1  6  
ATOM 11128 C CG2  . VAL A 1 97  ? -14.972 2.223   -11.794 1.00 0.00 ? 97  VAL A CG2  6  
ATOM 11129 H H    . VAL A 1 97  ? -15.747 1.883   -8.696  1.00 0.00 ? 97  VAL A H    6  
ATOM 11130 H HA   . VAL A 1 97  ? -13.606 0.425   -10.077 1.00 0.00 ? 97  VAL A HA   6  
ATOM 11131 H HB   . VAL A 1 97  ? -14.082 3.401   -10.254 1.00 0.00 ? 97  VAL A HB   6  
ATOM 11132 H HG11 . VAL A 1 97  ? -11.757 2.197   -10.619 1.00 0.00 ? 97  VAL A HG11 6  
ATOM 11133 H HG12 . VAL A 1 97  ? -12.461 1.801   -12.205 1.00 0.00 ? 97  VAL A HG12 6  
ATOM 11134 H HG13 . VAL A 1 97  ? -12.295 3.501   -11.705 1.00 0.00 ? 97  VAL A HG13 6  
ATOM 11135 H HG21 . VAL A 1 97  ? -15.744 2.985   -11.689 1.00 0.00 ? 97  VAL A HG21 6  
ATOM 11136 H HG22 . VAL A 1 97  ? -14.523 2.293   -12.784 1.00 0.00 ? 97  VAL A HG22 6  
ATOM 11137 H HG23 . VAL A 1 97  ? -15.417 1.236   -11.666 1.00 0.00 ? 97  VAL A HG23 6  
ATOM 11138 N N    . TYR A 1 98  ? -11.996 1.015   -8.307  1.00 0.00 ? 98  TYR A N    6  
ATOM 11139 C CA   . TYR A 1 98  ? -11.099 1.228   -7.184  1.00 0.00 ? 98  TYR A CA   6  
ATOM 11140 C C    . TYR A 1 98  ? -9.727  1.709   -7.661  1.00 0.00 ? 98  TYR A C    6  
ATOM 11141 O O    . TYR A 1 98  ? -9.163  1.153   -8.602  1.00 0.00 ? 98  TYR A O    6  
ATOM 11142 C CB   . TYR A 1 98  ? -10.941 -0.135  -6.506  1.00 0.00 ? 98  TYR A CB   6  
ATOM 11143 C CG   . TYR A 1 98  ? -12.041 -0.458  -5.494  1.00 0.00 ? 98  TYR A CG   6  
ATOM 11144 C CD1  . TYR A 1 98  ? -13.208 -1.065  -5.913  1.00 0.00 ? 98  TYR A CD1  6  
ATOM 11145 C CD2  . TYR A 1 98  ? -11.868 -0.142  -4.161  1.00 0.00 ? 98  TYR A CD2  6  
ATOM 11146 C CE1  . TYR A 1 98  ? -14.244 -1.369  -4.961  1.00 0.00 ? 98  TYR A CE1  6  
ATOM 11147 C CE2  . TYR A 1 98  ? -12.905 -0.447  -3.209  1.00 0.00 ? 98  TYR A CE2  6  
ATOM 11148 C CZ   . TYR A 1 98  ? -14.041 -1.045  -3.656  1.00 0.00 ? 98  TYR A CZ   6  
ATOM 11149 O OH   . TYR A 1 98  ? -15.020 -1.332  -2.756  1.00 0.00 ? 98  TYR A OH   6  
ATOM 11150 H H    . TYR A 1 98  ? -11.687 0.333   -8.970  1.00 0.00 ? 98  TYR A H    6  
ATOM 11151 H HA   . TYR A 1 98  ? -11.540 1.990   -6.541  1.00 0.00 ? 98  TYR A HA   6  
ATOM 11152 H HB2  . TYR A 1 98  ? -10.926 -0.910  -7.271  1.00 0.00 ? 98  TYR A HB2  6  
ATOM 11153 H HB3  . TYR A 1 98  ? -9.975  -0.168  -6.000  1.00 0.00 ? 98  TYR A HB3  6  
ATOM 11154 H HD1  . TYR A 1 98  ? -13.344 -1.314  -6.966  1.00 0.00 ? 98  TYR A HD1  6  
ATOM 11155 H HD2  . TYR A 1 98  ? -10.947 0.337   -3.830  1.00 0.00 ? 98  TYR A HD2  6  
ATOM 11156 H HE1  . TYR A 1 98  ? -15.170 -1.849  -5.278  1.00 0.00 ? 98  TYR A HE1  6  
ATOM 11157 H HE2  . TYR A 1 98  ? -12.781 -0.203  -2.154  1.00 0.00 ? 98  TYR A HE2  6  
ATOM 11158 H HH   . TYR A 1 98  ? -14.669 -1.231  -1.825  1.00 0.00 ? 98  TYR A HH   6  
ATOM 11159 N N    . LEU A 1 99  ? -9.230  2.738   -6.990  1.00 0.00 ? 99  LEU A N    6  
ATOM 11160 C CA   . LEU A 1 99  ? -7.935  3.300   -7.334  1.00 0.00 ? 99  LEU A CA   6  
ATOM 11161 C C    . LEU A 1 99  ? -6.858  2.667   -6.451  1.00 0.00 ? 99  LEU A C    6  
ATOM 11162 O O    . LEU A 1 99  ? -6.887  2.813   -5.230  1.00 0.00 ? 99  LEU A O    6  
ATOM 11163 C CB   . LEU A 1 99  ? -7.976  4.828   -7.254  1.00 0.00 ? 99  LEU A CB   6  
ATOM 11164 C CG   . LEU A 1 99  ? -6.629  5.542   -7.379  1.00 0.00 ? 99  LEU A CG   6  
ATOM 11165 C CD1  . LEU A 1 99  ? -5.876  5.528   -6.047  1.00 0.00 ? 99  LEU A CD1  6  
ATOM 11166 C CD2  . LEU A 1 99  ? -5.795  4.946   -8.515  1.00 0.00 ? 99  LEU A CD2  6  
ATOM 11167 H H    . LEU A 1 99  ? -9.695  3.184   -6.226  1.00 0.00 ? 99  LEU A H    6  
ATOM 11168 H HA   . LEU A 1 99  ? -7.730  3.037   -8.372  1.00 0.00 ? 99  LEU A HA   6  
ATOM 11169 H HB2  . LEU A 1 99  ? -8.634  5.195   -8.042  1.00 0.00 ? 99  LEU A HB2  6  
ATOM 11170 H HB3  . LEU A 1 99  ? -8.428  5.110   -6.303  1.00 0.00 ? 99  LEU A HB3  6  
ATOM 11171 H HG   . LEU A 1 99  ? -6.818  6.586   -7.631  1.00 0.00 ? 99  LEU A HG   6  
ATOM 11172 H HD11 . LEU A 1 99  ? -6.565  5.768   -5.237  1.00 0.00 ? 99  LEU A HD11 6  
ATOM 11173 H HD12 . LEU A 1 99  ? -5.450  4.539   -5.880  1.00 0.00 ? 99  LEU A HD12 6  
ATOM 11174 H HD13 . LEU A 1 99  ? -5.076  6.268   -6.074  1.00 0.00 ? 99  LEU A HD13 6  
ATOM 11175 H HD21 . LEU A 1 99  ? -4.747  5.209   -8.372  1.00 0.00 ? 99  LEU A HD21 6  
ATOM 11176 H HD22 . LEU A 1 99  ? -5.902  3.862   -8.513  1.00 0.00 ? 99  LEU A HD22 6  
ATOM 11177 H HD23 . LEU A 1 99  ? -6.143  5.345   -9.468  1.00 0.00 ? 99  LEU A HD23 6  
ATOM 11178 N N    . PHE A 1 100 ? -5.934  1.977   -7.103  1.00 0.00 ? 100 PHE A N    6  
ATOM 11179 C CA   . PHE A 1 100 ? -4.849  1.321   -6.393  1.00 0.00 ? 100 PHE A CA   6  
ATOM 11180 C C    . PHE A 1 100 ? -3.566  2.150   -6.465  1.00 0.00 ? 100 PHE A C    6  
ATOM 11181 O O    . PHE A 1 100 ? -2.981  2.303   -7.536  1.00 0.00 ? 100 PHE A O    6  
ATOM 11182 C CB   . PHE A 1 100 ? -4.613  -0.025  -7.081  1.00 0.00 ? 100 PHE A CB   6  
ATOM 11183 C CG   . PHE A 1 100 ? -5.516  -1.150  -6.574  1.00 0.00 ? 100 PHE A CG   6  
ATOM 11184 C CD1  . PHE A 1 100 ? -6.819  -1.203  -6.960  1.00 0.00 ? 100 PHE A CD1  6  
ATOM 11185 C CD2  . PHE A 1 100 ? -5.016  -2.099  -5.737  1.00 0.00 ? 100 PHE A CD2  6  
ATOM 11186 C CE1  . PHE A 1 100 ? -7.658  -2.248  -6.489  1.00 0.00 ? 100 PHE A CE1  6  
ATOM 11187 C CE2  . PHE A 1 100 ? -5.855  -3.144  -5.267  1.00 0.00 ? 100 PHE A CE2  6  
ATOM 11188 C CZ   . PHE A 1 100 ? -7.158  -3.196  -5.653  1.00 0.00 ? 100 PHE A CZ   6  
ATOM 11189 H H    . PHE A 1 100 ? -5.918  1.864   -8.097  1.00 0.00 ? 100 PHE A H    6  
ATOM 11190 H HA   . PHE A 1 100 ? -5.158  1.222   -5.352  1.00 0.00 ? 100 PHE A HA   6  
ATOM 11191 H HB2  . PHE A 1 100 ? -4.767  0.096   -8.154  1.00 0.00 ? 100 PHE A HB2  6  
ATOM 11192 H HB3  . PHE A 1 100 ? -3.572  -0.316  -6.939  1.00 0.00 ? 100 PHE A HB3  6  
ATOM 11193 H HD1  . PHE A 1 100 ? -7.220  -0.443  -7.631  1.00 0.00 ? 100 PHE A HD1  6  
ATOM 11194 H HD2  . PHE A 1 100 ? -3.972  -2.057  -5.428  1.00 0.00 ? 100 PHE A HD2  6  
ATOM 11195 H HE1  . PHE A 1 100 ? -8.702  -2.290  -6.799  1.00 0.00 ? 100 PHE A HE1  6  
ATOM 11196 H HE2  . PHE A 1 100 ? -5.454  -3.904  -4.596  1.00 0.00 ? 100 PHE A HE2  6  
ATOM 11197 H HZ   . PHE A 1 100 ? -7.801  -3.998  -5.291  1.00 0.00 ? 100 PHE A HZ   6  
ATOM 11198 N N    . ARG A 1 101 ? -3.165  2.664   -5.311  1.00 0.00 ? 101 ARG A N    6  
ATOM 11199 C CA   . ARG A 1 101 ? -1.961  3.473   -5.230  1.00 0.00 ? 101 ARG A CA   6  
ATOM 11200 C C    . ARG A 1 101 ? -0.812  2.658   -4.634  1.00 0.00 ? 101 ARG A C    6  
ATOM 11201 O O    . ARG A 1 101 ? -0.845  2.301   -3.457  1.00 0.00 ? 101 ARG A O    6  
ATOM 11202 C CB   . ARG A 1 101 ? -2.192  4.719   -4.373  1.00 0.00 ? 101 ARG A CB   6  
ATOM 11203 C CG   . ARG A 1 101 ? -1.354  5.896   -4.878  1.00 0.00 ? 101 ARG A CG   6  
ATOM 11204 C CD   . ARG A 1 101 ? -2.152  7.200   -4.822  1.00 0.00 ? 101 ARG A CD   6  
ATOM 11205 N NE   . ARG A 1 101 ? -2.511  7.514   -3.421  1.00 0.00 ? 101 ARG A NE   6  
ATOM 11206 C CZ   . ARG A 1 101 ? -3.280  8.550   -3.057  1.00 0.00 ? 101 ARG A CZ   6  
ATOM 11207 N NH1  . ARG A 1 101 ? -3.774  9.377   -3.987  1.00 0.00 ? 101 ARG A NH1  6  
ATOM 11208 N NH2  . ARG A 1 101 ? -3.554  8.757   -1.762  1.00 0.00 ? 101 ARG A NH2  6  
ATOM 11209 H H    . ARG A 1 101 ? -3.647  2.535   -4.445  1.00 0.00 ? 101 ARG A H    6  
ATOM 11210 H HA   . ARG A 1 101 ? -1.747  3.758   -6.261  1.00 0.00 ? 101 ARG A HA   6  
ATOM 11211 H HB2  . ARG A 1 101 ? -3.249  4.987   -4.390  1.00 0.00 ? 101 ARG A HB2  6  
ATOM 11212 H HB3  . ARG A 1 101 ? -1.935  4.504   -3.336  1.00 0.00 ? 101 ARG A HB3  6  
ATOM 11213 H HG2  . ARG A 1 101 ? -0.452  5.990   -4.274  1.00 0.00 ? 101 ARG A HG2  6  
ATOM 11214 H HG3  . ARG A 1 101 ? -1.034  5.705   -5.902  1.00 0.00 ? 101 ARG A HG3  6  
ATOM 11215 H HD2  . ARG A 1 101 ? -1.563  8.014   -5.246  1.00 0.00 ? 101 ARG A HD2  6  
ATOM 11216 H HD3  . ARG A 1 101 ? -3.054  7.111   -5.427  1.00 0.00 ? 101 ARG A HD3  6  
ATOM 11217 H HE   . ARG A 1 101 ? -2.158  6.916   -2.702  1.00 0.00 ? 101 ARG A HE   6  
ATOM 11218 H HH11 . ARG A 1 101 ? -3.569  9.222   -4.954  1.00 0.00 ? 101 ARG A HH11 6  
ATOM 11219 H HH12 . ARG A 1 101 ? -4.348  10.150  -3.715  1.00 0.00 ? 101 ARG A HH12 6  
ATOM 11220 H HH21 . ARG A 1 101 ? -3.185  8.140   -1.067  1.00 0.00 ? 101 ARG A HH21 6  
ATOM 11221 H HH22 . ARG A 1 101 ? -4.127  9.530   -1.490  1.00 0.00 ? 101 ARG A HH22 6  
ATOM 11222 N N    . ILE A 1 102 ? 0.177   2.387   -5.473  1.00 0.00 ? 102 ILE A N    6  
ATOM 11223 C CA   . ILE A 1 102 ? 1.334   1.620   -5.044  1.00 0.00 ? 102 ILE A CA   6  
ATOM 11224 C C    . ILE A 1 102 ? 2.477   2.578   -4.703  1.00 0.00 ? 102 ILE A C    6  
ATOM 11225 O O    . ILE A 1 102 ? 2.727   3.536   -5.433  1.00 0.00 ? 102 ILE A O    6  
ATOM 11226 C CB   . ILE A 1 102 ? 1.703   0.572   -6.096  1.00 0.00 ? 102 ILE A CB   6  
ATOM 11227 C CG1  . ILE A 1 102 ? 0.606   -0.487  -6.222  1.00 0.00 ? 102 ILE A CG1  6  
ATOM 11228 C CG2  . ILE A 1 102 ? 3.068   -0.049  -5.796  1.00 0.00 ? 102 ILE A CG2  6  
ATOM 11229 C CD1  . ILE A 1 102 ? 0.589   -1.095  -7.626  1.00 0.00 ? 102 ILE A CD1  6  
ATOM 11230 H H    . ILE A 1 102 ? 0.196   2.681   -6.429  1.00 0.00 ? 102 ILE A H    6  
ATOM 11231 H HA   . ILE A 1 102 ? 1.052   1.083   -4.139  1.00 0.00 ? 102 ILE A HA   6  
ATOM 11232 H HB   . ILE A 1 102 ? 1.781   1.071   -7.062  1.00 0.00 ? 102 ILE A HB   6  
ATOM 11233 H HG12 . ILE A 1 102 ? 0.768   -1.273  -5.484  1.00 0.00 ? 102 ILE A HG12 6  
ATOM 11234 H HG13 . ILE A 1 102 ? -0.364  -0.040  -6.004  1.00 0.00 ? 102 ILE A HG13 6  
ATOM 11235 H HG21 . ILE A 1 102 ? 3.483   -0.474  -6.710  1.00 0.00 ? 102 ILE A HG21 6  
ATOM 11236 H HG22 . ILE A 1 102 ? 3.741   0.719   -5.415  1.00 0.00 ? 102 ILE A HG22 6  
ATOM 11237 H HG23 . ILE A 1 102 ? 2.954   -0.835  -5.049  1.00 0.00 ? 102 ILE A HG23 6  
ATOM 11238 H HD11 . ILE A 1 102 ? 0.291   -0.334  -8.348  1.00 0.00 ? 102 ILE A HD11 6  
ATOM 11239 H HD12 . ILE A 1 102 ? 1.585   -1.461  -7.876  1.00 0.00 ? 102 ILE A HD12 6  
ATOM 11240 H HD13 . ILE A 1 102 ? -0.120  -1.921  -7.656  1.00 0.00 ? 102 ILE A HD13 6  
ATOM 11241 N N    . THR A 1 103 ? 3.141   2.286   -3.594  1.00 0.00 ? 103 THR A N    6  
ATOM 11242 C CA   . THR A 1 103 ? 4.252   3.109   -3.148  1.00 0.00 ? 103 THR A CA   6  
ATOM 11243 C C    . THR A 1 103 ? 5.292   2.254   -2.422  1.00 0.00 ? 103 THR A C    6  
ATOM 11244 O O    . THR A 1 103 ? 4.979   1.166   -1.939  1.00 0.00 ? 103 THR A O    6  
ATOM 11245 C CB   . THR A 1 103 ? 3.686   4.240   -2.286  1.00 0.00 ? 103 THR A CB   6  
ATOM 11246 O OG1  . THR A 1 103 ? 2.512   4.652   -2.981  1.00 0.00 ? 103 THR A OG1  6  
ATOM 11247 C CG2  . THR A 1 103 ? 4.578   5.483   -2.292  1.00 0.00 ? 103 THR A CG2  6  
ATOM 11248 H H    . THR A 1 103 ? 2.931   1.505   -3.007  1.00 0.00 ? 103 THR A H    6  
ATOM 11249 H HA   . THR A 1 103 ? 4.741   3.531   -4.026  1.00 0.00 ? 103 THR A HA   6  
ATOM 11250 H HB   . THR A 1 103 ? 3.501   3.898   -1.268  1.00 0.00 ? 103 THR A HB   6  
ATOM 11251 H HG1  . THR A 1 103 ? 1.723   4.624   -2.367  1.00 0.00 ? 103 THR A HG1  6  
ATOM 11252 H HG21 . THR A 1 103 ? 5.621   5.183   -2.191  1.00 0.00 ? 103 THR A HG21 6  
ATOM 11253 H HG22 . THR A 1 103 ? 4.444   6.022   -3.230  1.00 0.00 ? 103 THR A HG22 6  
ATOM 11254 H HG23 . THR A 1 103 ? 4.304   6.130   -1.459  1.00 0.00 ? 103 THR A HG23 6  
ATOM 11255 N N    . ALA A 1 104 ? 6.507   2.777   -2.366  1.00 0.00 ? 104 ALA A N    6  
ATOM 11256 C CA   . ALA A 1 104 ? 7.595   2.075   -1.707  1.00 0.00 ? 104 ALA A CA   6  
ATOM 11257 C C    . ALA A 1 104 ? 8.035   2.868   -0.475  1.00 0.00 ? 104 ALA A C    6  
ATOM 11258 O O    . ALA A 1 104 ? 7.811   4.075   -0.396  1.00 0.00 ? 104 ALA A O    6  
ATOM 11259 C CB   . ALA A 1 104 ? 8.739   1.859   -2.700  1.00 0.00 ? 104 ALA A CB   6  
ATOM 11260 H H    . ALA A 1 104 ? 6.754   3.663   -2.761  1.00 0.00 ? 104 ALA A H    6  
ATOM 11261 H HA   . ALA A 1 104 ? 7.218   1.103   -1.388  1.00 0.00 ? 104 ALA A HA   6  
ATOM 11262 H HB1  . ALA A 1 104 ? 8.848   2.743   -3.327  1.00 0.00 ? 104 ALA A HB1  6  
ATOM 11263 H HB2  . ALA A 1 104 ? 9.666   1.684   -2.153  1.00 0.00 ? 104 ALA A HB2  6  
ATOM 11264 H HB3  . ALA A 1 104 ? 8.518   0.994   -3.326  1.00 0.00 ? 104 ALA A HB3  6  
ATOM 11265 N N    . GLN A 1 105 ? 8.654   2.157   0.457   1.00 0.00 ? 105 GLN A N    6  
ATOM 11266 C CA   . GLN A 1 105 ? 9.127   2.779   1.682   1.00 0.00 ? 105 GLN A CA   6  
ATOM 11267 C C    . GLN A 1 105 ? 10.647  2.639   1.795   1.00 0.00 ? 105 GLN A C    6  
ATOM 11268 O O    . GLN A 1 105 ? 11.178  1.532   1.725   1.00 0.00 ? 105 GLN A O    6  
ATOM 11269 C CB   . GLN A 1 105 ? 8.429   2.183   2.905   1.00 0.00 ? 105 GLN A CB   6  
ATOM 11270 C CG   . GLN A 1 105 ? 8.721   3.007   4.160   1.00 0.00 ? 105 GLN A CG   6  
ATOM 11271 C CD   . GLN A 1 105 ? 8.829   2.109   5.394   1.00 0.00 ? 105 GLN A CD   6  
ATOM 11272 O OE1  . GLN A 1 105 ? 9.816   1.427   5.613   1.00 0.00 ? 105 GLN A OE1  6  
ATOM 11273 N NE2  . GLN A 1 105 ? 7.760   2.147   6.185   1.00 0.00 ? 105 GLN A NE2  6  
ATOM 11274 H H    . GLN A 1 105 ? 8.833   1.176   0.385   1.00 0.00 ? 105 GLN A H    6  
ATOM 11275 H HA   . GLN A 1 105 ? 8.858   3.832   1.595   1.00 0.00 ? 105 GLN A HA   6  
ATOM 11276 H HB2  . GLN A 1 105 ? 7.353   2.146   2.732   1.00 0.00 ? 105 GLN A HB2  6  
ATOM 11277 H HB3  . GLN A 1 105 ? 8.763   1.156   3.054   1.00 0.00 ? 105 GLN A HB3  6  
ATOM 11278 H HG2  . GLN A 1 105 ? 9.650   3.561   4.027   1.00 0.00 ? 105 GLN A HG2  6  
ATOM 11279 H HG3  . GLN A 1 105 ? 7.930   3.743   4.309   1.00 0.00 ? 105 GLN A HG3  6  
ATOM 11280 H HE21 . GLN A 1 105 ? 6.982   2.728   5.947   1.00 0.00 ? 105 GLN A HE21 6  
ATOM 11281 H HE22 . GLN A 1 105 ? 7.735   1.593   7.018   1.00 0.00 ? 105 GLN A HE22 6  
ATOM 11282 N N    . THR A 1 106 ? 11.303  3.777   1.968   1.00 0.00 ? 106 THR A N    6  
ATOM 11283 C CA   . THR A 1 106 ? 12.750  3.795   2.092   1.00 0.00 ? 106 THR A CA   6  
ATOM 11284 C C    . THR A 1 106 ? 13.165  4.475   3.399   1.00 0.00 ? 106 THR A C    6  
ATOM 11285 O O    . THR A 1 106 ? 12.329  4.723   4.266   1.00 0.00 ? 106 THR A O    6  
ATOM 11286 C CB   . THR A 1 106 ? 13.323  4.473   0.846   1.00 0.00 ? 106 THR A CB   6  
ATOM 11287 O OG1  . THR A 1 106 ? 12.382  5.500   0.546   1.00 0.00 ? 106 THR A OG1  6  
ATOM 11288 C CG2  . THR A 1 106 ? 13.287  3.563   -0.384  1.00 0.00 ? 106 THR A CG2  6  
ATOM 11289 H H    . THR A 1 106 ? 10.863  4.673   2.024   1.00 0.00 ? 106 THR A H    6  
ATOM 11290 H HA   . THR A 1 106 ? 13.104  2.765   2.142   1.00 0.00 ? 106 THR A HA   6  
ATOM 11291 H HB   . THR A 1 106 ? 14.333  4.837   1.031   1.00 0.00 ? 106 THR A HB   6  
ATOM 11292 H HG1  . THR A 1 106 ? 11.539  5.098   0.189   1.00 0.00 ? 106 THR A HG1  6  
ATOM 11293 H HG21 . THR A 1 106 ? 12.251  3.346   -0.645  1.00 0.00 ? 106 THR A HG21 6  
ATOM 11294 H HG22 . THR A 1 106 ? 13.775  4.063   -1.220  1.00 0.00 ? 106 THR A HG22 6  
ATOM 11295 H HG23 . THR A 1 106 ? 13.808  2.632   -0.163  1.00 0.00 ? 106 THR A HG23 6  
ATOM 11296 N N    . ARG A 1 107 ? 14.456  4.757   3.497   1.00 0.00 ? 107 ARG A N    6  
ATOM 11297 C CA   . ARG A 1 107 ? 14.992  5.404   4.683   1.00 0.00 ? 107 ARG A CA   6  
ATOM 11298 C C    . ARG A 1 107 ? 14.697  6.905   4.649   1.00 0.00 ? 107 ARG A C    6  
ATOM 11299 O O    . ARG A 1 107 ? 14.993  7.621   5.604   1.00 0.00 ? 107 ARG A O    6  
ATOM 11300 C CB   . ARG A 1 107 ? 16.503  5.190   4.791   1.00 0.00 ? 107 ARG A CB   6  
ATOM 11301 C CG   . ARG A 1 107 ? 17.242  5.925   3.671   1.00 0.00 ? 107 ARG A CG   6  
ATOM 11302 C CD   . ARG A 1 107 ? 18.755  5.892   3.898   1.00 0.00 ? 107 ARG A CD   6  
ATOM 11303 N NE   . ARG A 1 107 ? 19.464  6.171   2.630   1.00 0.00 ? 107 ARG A NE   6  
ATOM 11304 C CZ   . ARG A 1 107 ? 19.500  5.328   1.588   1.00 0.00 ? 107 ARG A CZ   6  
ATOM 11305 N NH1  . ARG A 1 107 ? 18.868  4.149   1.659   1.00 0.00 ? 107 ARG A NH1  6  
ATOM 11306 N NH2  . ARG A 1 107 ? 20.168  5.665   0.477   1.00 0.00 ? 107 ARG A NH2  6  
ATOM 11307 H H    . ARG A 1 107 ? 15.129  4.552   2.787   1.00 0.00 ? 107 ARG A H    6  
ATOM 11308 H HA   . ARG A 1 107 ? 14.482  4.923   5.518   1.00 0.00 ? 107 ARG A HA   6  
ATOM 11309 H HB2  . ARG A 1 107 ? 16.856  5.547   5.759   1.00 0.00 ? 107 ARG A HB2  6  
ATOM 11310 H HB3  . ARG A 1 107 ? 16.728  4.125   4.743   1.00 0.00 ? 107 ARG A HB3  6  
ATOM 11311 H HG2  . ARG A 1 107 ? 17.005  5.465   2.711   1.00 0.00 ? 107 ARG A HG2  6  
ATOM 11312 H HG3  . ARG A 1 107 ? 16.901  6.959   3.622   1.00 0.00 ? 107 ARG A HG3  6  
ATOM 11313 H HD2  . ARG A 1 107 ? 19.034  6.630   4.650   1.00 0.00 ? 107 ARG A HD2  6  
ATOM 11314 H HD3  . ARG A 1 107 ? 19.052  4.917   4.284   1.00 0.00 ? 107 ARG A HD3  6  
ATOM 11315 H HE   . ARG A 1 107 ? 19.946  7.043   2.544   1.00 0.00 ? 107 ARG A HE   6  
ATOM 11316 H HH11 . ARG A 1 107 ? 18.369  3.898   2.488   1.00 0.00 ? 107 ARG A HH11 6  
ATOM 11317 H HH12 . ARG A 1 107 ? 18.895  3.520   0.881   1.00 0.00 ? 107 ARG A HH12 6  
ATOM 11318 H HH21 . ARG A 1 107 ? 20.640  6.545   0.424   1.00 0.00 ? 107 ARG A HH21 6  
ATOM 11319 H HH22 . ARG A 1 107 ? 20.195  5.036   -0.301  1.00 0.00 ? 107 ARG A HH22 6  
ATOM 11320 N N    . LYS A 1 108 ? 14.118  7.336   3.538   1.00 0.00 ? 108 LYS A N    6  
ATOM 11321 C CA   . LYS A 1 108 ? 13.779  8.739   3.366   1.00 0.00 ? 108 LYS A CA   6  
ATOM 11322 C C    . LYS A 1 108 ? 12.274  8.924   3.567   1.00 0.00 ? 108 LYS A C    6  
ATOM 11323 O O    . LYS A 1 108 ? 11.829  9.982   4.010   1.00 0.00 ? 108 LYS A O    6  
ATOM 11324 C CB   . LYS A 1 108 ? 14.288  9.251   2.017   1.00 0.00 ? 108 LYS A CB   6  
ATOM 11325 C CG   . LYS A 1 108 ? 15.698  8.731   1.729   1.00 0.00 ? 108 LYS A CG   6  
ATOM 11326 C CD   . LYS A 1 108 ? 16.718  9.357   2.681   1.00 0.00 ? 108 LYS A CD   6  
ATOM 11327 C CE   . LYS A 1 108 ? 16.752  10.879  2.526   1.00 0.00 ? 108 LYS A CE   6  
ATOM 11328 N NZ   . LYS A 1 108 ? 16.317  11.537  3.778   1.00 0.00 ? 108 LYS A NZ   6  
ATOM 11329 H H    . LYS A 1 108 ? 13.880  6.747   2.766   1.00 0.00 ? 108 LYS A H    6  
ATOM 11330 H HA   . LYS A 1 108 ? 14.303  9.298   4.142   1.00 0.00 ? 108 LYS A HA   6  
ATOM 11331 H HB2  . LYS A 1 108 ? 13.610  8.935   1.224   1.00 0.00 ? 108 LYS A HB2  6  
ATOM 11332 H HB3  . LYS A 1 108 ? 14.291  10.341  2.016   1.00 0.00 ? 108 LYS A HB3  6  
ATOM 11333 H HG2  . LYS A 1 108 ? 15.717  7.646   1.832   1.00 0.00 ? 108 LYS A HG2  6  
ATOM 11334 H HG3  . LYS A 1 108 ? 15.969  8.958   0.698   1.00 0.00 ? 108 LYS A HG3  6  
ATOM 11335 H HD2  . LYS A 1 108 ? 16.468  9.098   3.710   1.00 0.00 ? 108 LYS A HD2  6  
ATOM 11336 H HD3  . LYS A 1 108 ? 17.708  8.946   2.481   1.00 0.00 ? 108 LYS A HD3  6  
ATOM 11337 H HE2  . LYS A 1 108 ? 17.760  11.202  2.270   1.00 0.00 ? 108 LYS A HE2  6  
ATOM 11338 H HE3  . LYS A 1 108 ? 16.102  11.181  1.705   1.00 0.00 ? 108 LYS A HE3  6  
ATOM 11339 H HZ1  . LYS A 1 108 ? 15.559  11.022  4.180   1.00 0.00 ? 108 LYS A HZ1  6  
ATOM 11340 H HZ2  . LYS A 1 108 ? 17.080  11.564  4.424   1.00 0.00 ? 108 LYS A HZ2  6  
ATOM 11341 H HZ3  . LYS A 1 108 ? 16.017  12.470  3.578   1.00 0.00 ? 108 LYS A HZ3  6  
ATOM 11342 N N    . GLY A 1 109 ? 11.531  7.880   3.231   1.00 0.00 ? 109 GLY A N    6  
ATOM 11343 C CA   . GLY A 1 109 ? 10.085  7.914   3.368   1.00 0.00 ? 109 GLY A CA   6  
ATOM 11344 C C    . GLY A 1 109 ? 9.406   7.202   2.196   1.00 0.00 ? 109 GLY A C    6  
ATOM 11345 O O    . GLY A 1 109 ? 9.905   6.190   1.706   1.00 0.00 ? 109 GLY A O    6  
ATOM 11346 H H    . GLY A 1 109 ? 11.901  7.023   2.871   1.00 0.00 ? 109 GLY A H    6  
ATOM 11347 H HA2  . GLY A 1 109 ? 9.794   7.439   4.305   1.00 0.00 ? 109 GLY A HA2  6  
ATOM 11348 H HA3  . GLY A 1 109 ? 9.746   8.948   3.416   1.00 0.00 ? 109 GLY A HA3  6  
ATOM 11349 N N    . TRP A 1 110 ? 8.278   7.759   1.781   1.00 0.00 ? 110 TRP A N    6  
ATOM 11350 C CA   . TRP A 1 110 ? 7.525   7.190   0.676   1.00 0.00 ? 110 TRP A CA   6  
ATOM 11351 C C    . TRP A 1 110 ? 7.670   8.126   -0.526  1.00 0.00 ? 110 TRP A C    6  
ATOM 11352 O O    . TRP A 1 110 ? 7.295   9.295   -0.455  1.00 0.00 ? 110 TRP A O    6  
ATOM 11353 C CB   . TRP A 1 110 ? 6.067   6.948   1.073   1.00 0.00 ? 110 TRP A CB   6  
ATOM 11354 C CG   . TRP A 1 110 ? 5.891   5.941   2.212   1.00 0.00 ? 110 TRP A CG   6  
ATOM 11355 C CD1  . TRP A 1 110 ? 5.991   6.161   3.530   1.00 0.00 ? 110 TRP A CD1  6  
ATOM 11356 C CD2  . TRP A 1 110 ? 5.579   4.539   2.079   1.00 0.00 ? 110 TRP A CD2  6  
ATOM 11357 N NE1  . TRP A 1 110 ? 5.767   5.008   4.254   1.00 0.00 ? 110 TRP A NE1  6  
ATOM 11358 C CE2  . TRP A 1 110 ? 5.508   3.990   3.343   1.00 0.00 ? 110 TRP A CE2  6  
ATOM 11359 C CE3  . TRP A 1 110 ? 5.363   3.760   0.929   1.00 0.00 ? 110 TRP A CE3  6  
ATOM 11360 C CZ2  . TRP A 1 110 ? 5.221   2.639   3.577   1.00 0.00 ? 110 TRP A CZ2  6  
ATOM 11361 C CZ3  . TRP A 1 110 ? 5.078   2.412   1.180   1.00 0.00 ? 110 TRP A CZ3  6  
ATOM 11362 C CH2  . TRP A 1 110 ? 5.003   1.844   2.446   1.00 0.00 ? 110 TRP A CH2  6  
ATOM 11363 H H    . TRP A 1 110 ? 7.879   8.582   2.185   1.00 0.00 ? 110 TRP A H    6  
ATOM 11364 H HA   . TRP A 1 110 ? 7.957   6.217   0.445   1.00 0.00 ? 110 TRP A HA   6  
ATOM 11365 H HB2  . TRP A 1 110 ? 5.619   7.897   1.368   1.00 0.00 ? 110 TRP A HB2  6  
ATOM 11366 H HB3  . TRP A 1 110 ? 5.518   6.594   0.201   1.00 0.00 ? 110 TRP A HB3  6  
ATOM 11367 H HD1  . TRP A 1 110 ? 6.221   7.129   3.975   1.00 0.00 ? 110 TRP A HD1  6  
ATOM 11368 H HE1  . TRP A 1 110 ? 5.789   4.912   5.339   1.00 0.00 ? 110 TRP A HE1  6  
ATOM 11369 H HE3  . TRP A 1 110 ? 5.413   4.170   -0.080  1.00 0.00 ? 110 TRP A HE3  6  
ATOM 11370 H HZ2  . TRP A 1 110 ? 5.171   2.230   4.586   1.00 0.00 ? 110 TRP A HZ2  6  
ATOM 11371 H HZ3  . TRP A 1 110 ? 4.902   1.763   0.322   1.00 0.00 ? 110 TRP A HZ3  6  
ATOM 11372 H HH2  . TRP A 1 110 ? 4.775   0.784   2.558   1.00 0.00 ? 110 TRP A HH2  6  
ATOM 11373 N N    . GLY A 1 111 ? 8.214   7.576   -1.601  1.00 0.00 ? 111 GLY A N    6  
ATOM 11374 C CA   . GLY A 1 111 ? 8.413   8.347   -2.817  1.00 0.00 ? 111 GLY A CA   6  
ATOM 11375 C C    . GLY A 1 111 ? 7.144   8.358   -3.672  1.00 0.00 ? 111 GLY A C    6  
ATOM 11376 O O    . GLY A 1 111 ? 6.038   8.226   -3.150  1.00 0.00 ? 111 GLY A O    6  
ATOM 11377 H H    . GLY A 1 111 ? 8.516   6.624   -1.650  1.00 0.00 ? 111 GLY A H    6  
ATOM 11378 H HA2  . GLY A 1 111 ? 8.693   9.369   -2.562  1.00 0.00 ? 111 GLY A HA2  6  
ATOM 11379 H HA3  . GLY A 1 111 ? 9.238   7.923   -3.389  1.00 0.00 ? 111 GLY A HA3  6  
ATOM 11380 N N    . GLU A 1 112 ? 7.347   8.518   -4.972  1.00 0.00 ? 112 GLU A N    6  
ATOM 11381 C CA   . GLU A 1 112 ? 6.233   8.548   -5.904  1.00 0.00 ? 112 GLU A CA   6  
ATOM 11382 C C    . GLU A 1 112 ? 5.320   7.341   -5.681  1.00 0.00 ? 112 GLU A C    6  
ATOM 11383 O O    . GLU A 1 112 ? 5.704   6.384   -5.011  1.00 0.00 ? 112 GLU A O    6  
ATOM 11384 C CB   . GLU A 1 112 ? 6.730   8.599   -7.351  1.00 0.00 ? 112 GLU A CB   6  
ATOM 11385 C CG   . GLU A 1 112 ? 6.327   9.913   -8.023  1.00 0.00 ? 112 GLU A CG   6  
ATOM 11386 C CD   . GLU A 1 112 ? 7.472   10.468  -8.873  1.00 0.00 ? 112 GLU A CD   6  
ATOM 11387 O OE1  . GLU A 1 112 ? 8.489   10.866  -8.264  1.00 0.00 ? 112 GLU A OE1  6  
ATOM 11388 O OE2  . GLU A 1 112 ? 7.305   10.481  -10.111 1.00 0.00 ? 112 GLU A OE2  6  
ATOM 11389 H H    . GLU A 1 112 ? 8.250   8.625   -5.388  1.00 0.00 ? 112 GLU A H    6  
ATOM 11390 H HA   . GLU A 1 112 ? 5.693   9.468   -5.680  1.00 0.00 ? 112 GLU A HA   6  
ATOM 11391 H HB2  . GLU A 1 112 ? 7.815   8.494   -7.370  1.00 0.00 ? 112 GLU A HB2  6  
ATOM 11392 H HB3  . GLU A 1 112 ? 6.319   7.759   -7.910  1.00 0.00 ? 112 GLU A HB3  6  
ATOM 11393 H HG2  . GLU A 1 112 ? 5.450   9.751   -8.650  1.00 0.00 ? 112 GLU A HG2  6  
ATOM 11394 H HG3  . GLU A 1 112 ? 6.046   10.643  -7.264  1.00 0.00 ? 112 GLU A HG3  6  
ATOM 11395 N N    . ALA A 1 113 ? 4.128   7.427   -6.254  1.00 0.00 ? 113 ALA A N    6  
ATOM 11396 C CA   . ALA A 1 113 ? 3.158   6.353   -6.125  1.00 0.00 ? 113 ALA A CA   6  
ATOM 11397 C C    . ALA A 1 113 ? 2.445   6.153   -7.464  1.00 0.00 ? 113 ALA A C    6  
ATOM 11398 O O    . ALA A 1 113 ? 2.090   7.122   -8.134  1.00 0.00 ? 113 ALA A O    6  
ATOM 11399 C CB   . ALA A 1 113 ? 2.185   6.678   -4.990  1.00 0.00 ? 113 ALA A CB   6  
ATOM 11400 H H    . ALA A 1 113 ? 3.824   8.209   -6.797  1.00 0.00 ? 113 ALA A H    6  
ATOM 11401 H HA   . ALA A 1 113 ? 3.701   5.443   -5.872  1.00 0.00 ? 113 ALA A HA   6  
ATOM 11402 H HB1  . ALA A 1 113 ? 1.473   7.432   -5.326  1.00 0.00 ? 113 ALA A HB1  6  
ATOM 11403 H HB2  . ALA A 1 113 ? 1.647   5.774   -4.702  1.00 0.00 ? 113 ALA A HB2  6  
ATOM 11404 H HB3  . ALA A 1 113 ? 2.740   7.059   -4.133  1.00 0.00 ? 113 ALA A HB3  6  
ATOM 11405 N N    . ALA A 1 114 ? 2.258   4.889   -7.815  1.00 0.00 ? 114 ALA A N    6  
ATOM 11406 C CA   . ALA A 1 114 ? 1.595   4.549   -9.062  1.00 0.00 ? 114 ALA A CA   6  
ATOM 11407 C C    . ALA A 1 114 ? 0.108   4.305   -8.794  1.00 0.00 ? 114 ALA A C    6  
ATOM 11408 O O    . ALA A 1 114 ? -0.248  3.441   -7.994  1.00 0.00 ? 114 ALA A O    6  
ATOM 11409 C CB   . ALA A 1 114 ? 2.281   3.335   -9.692  1.00 0.00 ? 114 ALA A CB   6  
ATOM 11410 H H    . ALA A 1 114 ? 2.550   4.107   -7.265  1.00 0.00 ? 114 ALA A H    6  
ATOM 11411 H HA   . ALA A 1 114 ? 1.699   5.399   -9.736  1.00 0.00 ? 114 ALA A HA   6  
ATOM 11412 H HB1  . ALA A 1 114 ? 3.313   3.586   -9.935  1.00 0.00 ? 114 ALA A HB1  6  
ATOM 11413 H HB2  . ALA A 1 114 ? 2.266   2.504   -8.986  1.00 0.00 ? 114 ALA A HB2  6  
ATOM 11414 H HB3  . ALA A 1 114 ? 1.752   3.049   -10.601 1.00 0.00 ? 114 ALA A HB3  6  
ATOM 11415 N N    . GLU A 1 115 ? -0.719  5.081   -9.479  1.00 0.00 ? 115 GLU A N    6  
ATOM 11416 C CA   . GLU A 1 115 ? -2.159  4.959   -9.325  1.00 0.00 ? 115 GLU A CA   6  
ATOM 11417 C C    . GLU A 1 115 ? -2.748  4.137   -10.472 1.00 0.00 ? 115 GLU A C    6  
ATOM 11418 O O    . GLU A 1 115 ? -2.566  4.476   -11.641 1.00 0.00 ? 115 GLU A O    6  
ATOM 11419 C CB   . GLU A 1 115 ? -2.819  6.337   -9.241  1.00 0.00 ? 115 GLU A CB   6  
ATOM 11420 C CG   . GLU A 1 115 ? -2.991  6.775   -7.786  1.00 0.00 ? 115 GLU A CG   6  
ATOM 11421 C CD   . GLU A 1 115 ? -4.000  7.920   -7.673  1.00 0.00 ? 115 GLU A CD   6  
ATOM 11422 O OE1  . GLU A 1 115 ? -4.903  7.968   -8.536  1.00 0.00 ? 115 GLU A OE1  6  
ATOM 11423 O OE2  . GLU A 1 115 ? -3.846  8.722   -6.727  1.00 0.00 ? 115 GLU A OE2  6  
ATOM 11424 H H    . GLU A 1 115 ? -0.421  5.780   -10.128 1.00 0.00 ? 115 GLU A H    6  
ATOM 11425 H HA   . GLU A 1 115 ? -2.306  4.435   -8.380  1.00 0.00 ? 115 GLU A HA   6  
ATOM 11426 H HB2  . GLU A 1 115 ? -2.213  7.068   -9.776  1.00 0.00 ? 115 GLU A HB2  6  
ATOM 11427 H HB3  . GLU A 1 115 ? -3.792  6.308   -9.733  1.00 0.00 ? 115 GLU A HB3  6  
ATOM 11428 H HG2  . GLU A 1 115 ? -3.326  5.930   -7.184  1.00 0.00 ? 115 GLU A HG2  6  
ATOM 11429 H HG3  . GLU A 1 115 ? -2.030  7.092   -7.382  1.00 0.00 ? 115 GLU A HG3  6  
ATOM 11430 N N    . ALA A 1 116 ? -3.443  3.072   -10.099 1.00 0.00 ? 116 ALA A N    6  
ATOM 11431 C CA   . ALA A 1 116 ? -4.060  2.199   -11.083 1.00 0.00 ? 116 ALA A CA   6  
ATOM 11432 C C    . ALA A 1 116 ? -5.504  1.910   -10.668 1.00 0.00 ? 116 ALA A C    6  
ATOM 11433 O O    . ALA A 1 116 ? -5.756  1.481   -9.543  1.00 0.00 ? 116 ALA A O    6  
ATOM 11434 C CB   . ALA A 1 116 ? -3.229  0.923   -11.227 1.00 0.00 ? 116 ALA A CB   6  
ATOM 11435 H H    . ALA A 1 116 ? -3.587  2.804   -9.147  1.00 0.00 ? 116 ALA A H    6  
ATOM 11436 H HA   . ALA A 1 116 ? -4.064  2.725   -12.038 1.00 0.00 ? 116 ALA A HA   6  
ATOM 11437 H HB1  . ALA A 1 116 ? -3.258  0.585   -12.263 1.00 0.00 ? 116 ALA A HB1  6  
ATOM 11438 H HB2  . ALA A 1 116 ? -2.197  1.127   -10.940 1.00 0.00 ? 116 ALA A HB2  6  
ATOM 11439 H HB3  . ALA A 1 116 ? -3.639  0.147   -10.580 1.00 0.00 ? 116 ALA A HB3  6  
ATOM 11440 N N    . LEU A 1 117 ? -6.415  2.157   -11.598 1.00 0.00 ? 117 LEU A N    6  
ATOM 11441 C CA   . LEU A 1 117 ? -7.827  1.929   -11.343 1.00 0.00 ? 117 LEU A CA   6  
ATOM 11442 C C    . LEU A 1 117 ? -8.213  0.537   -11.845 1.00 0.00 ? 117 LEU A C    6  
ATOM 11443 O O    . LEU A 1 117 ? -7.750  0.102   -12.898 1.00 0.00 ? 117 LEU A O    6  
ATOM 11444 C CB   . LEU A 1 117 ? -8.669  3.056   -11.945 1.00 0.00 ? 117 LEU A CB   6  
ATOM 11445 C CG   . LEU A 1 117 ? -8.686  4.372   -11.165 1.00 0.00 ? 117 LEU A CG   6  
ATOM 11446 C CD1  . LEU A 1 117 ? -8.557  5.570   -12.107 1.00 0.00 ? 117 LEU A CD1  6  
ATOM 11447 C CD2  . LEU A 1 117 ? -9.931  4.469   -10.281 1.00 0.00 ? 117 LEU A CD2  6  
ATOM 11448 H H    . LEU A 1 117 ? -6.201  2.506   -12.511 1.00 0.00 ? 117 LEU A H    6  
ATOM 11449 H HA   . LEU A 1 117 ? -7.973  1.960   -10.263 1.00 0.00 ? 117 LEU A HA   6  
ATOM 11450 H HB2  . LEU A 1 117 ? -8.303  3.258   -12.952 1.00 0.00 ? 117 LEU A HB2  6  
ATOM 11451 H HB3  . LEU A 1 117 ? -9.695  2.702   -12.045 1.00 0.00 ? 117 LEU A HB3  6  
ATOM 11452 H HG   . LEU A 1 117 ? -7.820  4.388   -10.503 1.00 0.00 ? 117 LEU A HG   6  
ATOM 11453 H HD11 . LEU A 1 117 ? -8.745  6.490   -11.553 1.00 0.00 ? 117 LEU A HD11 6  
ATOM 11454 H HD12 . LEU A 1 117 ? -7.551  5.596   -12.525 1.00 0.00 ? 117 LEU A HD12 6  
ATOM 11455 H HD13 . LEU A 1 117 ? -9.284  5.477   -12.915 1.00 0.00 ? 117 LEU A HD13 6  
ATOM 11456 H HD21 . LEU A 1 117 ? -10.022 3.564   -9.681  1.00 0.00 ? 117 LEU A HD21 6  
ATOM 11457 H HD22 . LEU A 1 117 ? -9.844  5.334   -9.624  1.00 0.00 ? 117 LEU A HD22 6  
ATOM 11458 H HD23 . LEU A 1 117 ? -10.815 4.578   -10.910 1.00 0.00 ? 117 LEU A HD23 6  
ATOM 11459 N N    . VAL A 1 118 ? -9.057  -0.125  -11.067 1.00 0.00 ? 118 VAL A N    6  
ATOM 11460 C CA   . VAL A 1 118 ? -9.511  -1.460  -11.419 1.00 0.00 ? 118 VAL A CA   6  
ATOM 11461 C C    . VAL A 1 118 ? -10.962 -1.636  -10.967 1.00 0.00 ? 118 VAL A C    6  
ATOM 11462 O O    . VAL A 1 118 ? -11.274 -1.465  -9.790  1.00 0.00 ? 118 VAL A O    6  
ATOM 11463 C CB   . VAL A 1 118 ? -8.568  -2.507  -10.824 1.00 0.00 ? 118 VAL A CB   6  
ATOM 11464 C CG1  . VAL A 1 118 ? -8.513  -2.393  -9.300  1.00 0.00 ? 118 VAL A CG1  6  
ATOM 11465 C CG2  . VAL A 1 118 ? -8.974  -3.918  -11.255 1.00 0.00 ? 118 VAL A CG2  6  
ATOM 11466 H H    . VAL A 1 118 ? -9.429  0.236   -10.211 1.00 0.00 ? 118 VAL A H    6  
ATOM 11467 H HA   . VAL A 1 118 ? -9.469  -1.545  -12.505 1.00 0.00 ? 118 VAL A HA   6  
ATOM 11468 H HB   . VAL A 1 118 ? -7.567  -2.314  -11.210 1.00 0.00 ? 118 VAL A HB   6  
ATOM 11469 H HG11 . VAL A 1 118 ? -9.193  -1.607  -8.970  1.00 0.00 ? 118 VAL A HG11 6  
ATOM 11470 H HG12 . VAL A 1 118 ? -8.812  -3.342  -8.853  1.00 0.00 ? 118 VAL A HG12 6  
ATOM 11471 H HG13 . VAL A 1 118 ? -7.497  -2.149  -8.989  1.00 0.00 ? 118 VAL A HG13 6  
ATOM 11472 H HG21 . VAL A 1 118 ? -10.044 -3.941  -11.461 1.00 0.00 ? 118 VAL A HG21 6  
ATOM 11473 H HG22 . VAL A 1 118 ? -8.424  -4.195  -12.155 1.00 0.00 ? 118 VAL A HG22 6  
ATOM 11474 H HG23 . VAL A 1 118 ? -8.742  -4.622  -10.456 1.00 0.00 ? 118 VAL A HG23 6  
ATOM 11475 N N    . VAL A 1 119 ? -11.810 -1.976  -11.927 1.00 0.00 ? 119 VAL A N    6  
ATOM 11476 C CA   . VAL A 1 119 ? -13.220 -2.178  -11.642 1.00 0.00 ? 119 VAL A CA   6  
ATOM 11477 C C    . VAL A 1 119 ? -13.422 -3.575  -11.052 1.00 0.00 ? 119 VAL A C    6  
ATOM 11478 O O    . VAL A 1 119 ? -12.625 -4.478  -11.299 1.00 0.00 ? 119 VAL A O    6  
ATOM 11479 C CB   . VAL A 1 119 ? -14.049 -1.937  -12.906 1.00 0.00 ? 119 VAL A CB   6  
ATOM 11480 C CG1  . VAL A 1 119 ? -15.384 -2.681  -12.836 1.00 0.00 ? 119 VAL A CG1  6  
ATOM 11481 C CG2  . VAL A 1 119 ? -14.267 -0.441  -13.142 1.00 0.00 ? 119 VAL A CG2  6  
ATOM 11482 H H    . VAL A 1 119 ? -11.548 -2.113  -12.882 1.00 0.00 ? 119 VAL A H    6  
ATOM 11483 H HA   . VAL A 1 119 ? -13.515 -1.437  -10.899 1.00 0.00 ? 119 VAL A HA   6  
ATOM 11484 H HB   . VAL A 1 119 ? -13.489 -2.332  -13.754 1.00 0.00 ? 119 VAL A HB   6  
ATOM 11485 H HG11 . VAL A 1 119 ? -15.956 -2.487  -13.744 1.00 0.00 ? 119 VAL A HG11 6  
ATOM 11486 H HG12 . VAL A 1 119 ? -15.199 -3.752  -12.746 1.00 0.00 ? 119 VAL A HG12 6  
ATOM 11487 H HG13 . VAL A 1 119 ? -15.948 -2.335  -11.970 1.00 0.00 ? 119 VAL A HG13 6  
ATOM 11488 H HG21 . VAL A 1 119 ? -13.881 0.121   -12.290 1.00 0.00 ? 119 VAL A HG21 6  
ATOM 11489 H HG22 . VAL A 1 119 ? -13.741 -0.136  -14.046 1.00 0.00 ? 119 VAL A HG22 6  
ATOM 11490 H HG23 . VAL A 1 119 ? -15.332 -0.242  -13.256 1.00 0.00 ? 119 VAL A HG23 6  
ATOM 11491 N N    . THR A 1 120 ? -14.494 -3.709  -10.284 1.00 0.00 ? 120 THR A N    6  
ATOM 11492 C CA   . THR A 1 120 ? -14.811 -4.981  -9.657  1.00 0.00 ? 120 THR A CA   6  
ATOM 11493 C C    . THR A 1 120 ? -15.950 -5.675  -10.406 1.00 0.00 ? 120 THR A C    6  
ATOM 11494 O O    . THR A 1 120 ? -17.090 -5.214  -10.375 1.00 0.00 ? 120 THR A O    6  
ATOM 11495 C CB   . THR A 1 120 ? -15.124 -4.717  -8.183  1.00 0.00 ? 120 THR A CB   6  
ATOM 11496 O OG1  . THR A 1 120 ? -15.922 -3.536  -8.205  1.00 0.00 ? 120 THR A OG1  6  
ATOM 11497 C CG2  . THR A 1 120 ? -13.883 -4.314  -7.384  1.00 0.00 ? 120 THR A CG2  6  
ATOM 11498 H H    . THR A 1 120 ? -15.137 -2.970  -10.089 1.00 0.00 ? 120 THR A H    6  
ATOM 11499 H HA   . THR A 1 120 ? -13.937 -5.629  -9.733  1.00 0.00 ? 120 THR A HA   6  
ATOM 11500 H HB   . THR A 1 120 ? -15.618 -5.576  -7.730  1.00 0.00 ? 120 THR A HB   6  
ATOM 11501 H HG1  . THR A 1 120 ? -16.755 -3.695  -8.733  1.00 0.00 ? 120 THR A HG1  6  
ATOM 11502 H HG21 . THR A 1 120 ? -13.007 -4.816  -7.795  1.00 0.00 ? 120 THR A HG21 6  
ATOM 11503 H HG22 . THR A 1 120 ? -13.746 -3.234  -7.445  1.00 0.00 ? 120 THR A HG22 6  
ATOM 11504 H HG23 . THR A 1 120 ? -14.013 -4.605  -6.341  1.00 0.00 ? 120 THR A HG23 6  
ATOM 11505 N N    . THR A 1 121 ? -15.602 -6.774  -11.061 1.00 0.00 ? 121 THR A N    6  
ATOM 11506 C CA   . THR A 1 121 ? -16.582 -7.536  -11.816 1.00 0.00 ? 121 THR A CA   6  
ATOM 11507 C C    . THR A 1 121 ? -15.938 -8.790  -12.410 1.00 0.00 ? 121 THR A C    6  
ATOM 11508 O O    . THR A 1 121 ? -14.723 -8.963  -12.337 1.00 0.00 ? 121 THR A O    6  
ATOM 11509 C CB   . THR A 1 121 ? -17.193 -6.609  -12.869 1.00 0.00 ? 121 THR A CB   6  
ATOM 11510 O OG1  . THR A 1 121 ? -17.988 -7.475  -13.675 1.00 0.00 ? 121 THR A OG1  6  
ATOM 11511 C CG2  . THR A 1 121 ? -16.147 -6.054  -13.838 1.00 0.00 ? 121 THR A CG2  6  
ATOM 11512 H H    . THR A 1 121 ? -14.673 -7.142  -11.080 1.00 0.00 ? 121 THR A H    6  
ATOM 11513 H HA   . THR A 1 121 ? -17.360 -7.871  -11.130 1.00 0.00 ? 121 THR A HA   6  
ATOM 11514 H HB   . THR A 1 121 ? -17.755 -5.803  -12.398 1.00 0.00 ? 121 THR A HB   6  
ATOM 11515 H HG1  . THR A 1 121 ? -18.879 -7.058  -13.849 1.00 0.00 ? 121 THR A HG1  6  
ATOM 11516 H HG21 . THR A 1 121 ? -16.058 -6.720  -14.696 1.00 0.00 ? 121 THR A HG21 6  
ATOM 11517 H HG22 . THR A 1 121 ? -16.454 -5.064  -14.176 1.00 0.00 ? 121 THR A HG22 6  
ATOM 11518 H HG23 . THR A 1 121 ? -15.184 -5.983  -13.332 1.00 0.00 ? 121 THR A HG23 6  
ATOM 11519 N N    . GLU A 1 122 ? -16.782 -9.634  -12.986 1.00 0.00 ? 122 GLU A N    6  
ATOM 11520 C CA   . GLU A 1 122 ? -16.311 -10.867 -13.593 1.00 0.00 ? 122 GLU A CA   6  
ATOM 11521 C C    . GLU A 1 122 ? -16.046 -10.657 -15.085 1.00 0.00 ? 122 GLU A C    6  
ATOM 11522 O O    . GLU A 1 122 ? -15.258 -11.383 -15.688 1.00 0.00 ? 122 GLU A O    6  
ATOM 11523 C CB   . GLU A 1 122 ? -17.309 -12.005 -13.368 1.00 0.00 ? 122 GLU A CB   6  
ATOM 11524 C CG   . GLU A 1 122 ? -17.566 -12.221 -11.876 1.00 0.00 ? 122 GLU A CG   6  
ATOM 11525 C CD   . GLU A 1 122 ? -18.888 -12.959 -11.648 1.00 0.00 ? 122 GLU A CD   6  
ATOM 11526 O OE1  . GLU A 1 122 ? -19.937 -12.344 -11.937 1.00 0.00 ? 122 GLU A OE1  6  
ATOM 11527 O OE2  . GLU A 1 122 ? -18.818 -14.120 -11.192 1.00 0.00 ? 122 GLU A OE2  6  
ATOM 11528 H H    . GLU A 1 122 ? -17.770 -9.486  -13.042 1.00 0.00 ? 122 GLU A H    6  
ATOM 11529 H HA   . GLU A 1 122 ? -15.378 -11.103 -13.081 1.00 0.00 ? 122 GLU A HA   6  
ATOM 11530 H HB2  . GLU A 1 122 ? -18.247 -11.776 -13.873 1.00 0.00 ? 122 GLU A HB2  6  
ATOM 11531 H HB3  . GLU A 1 122 ? -16.924 -12.924 -13.811 1.00 0.00 ? 122 GLU A HB3  6  
ATOM 11532 H HG2  . GLU A 1 122 ? -16.747 -12.793 -11.441 1.00 0.00 ? 122 GLU A HG2  6  
ATOM 11533 H HG3  . GLU A 1 122 ? -17.590 -11.259 -11.364 1.00 0.00 ? 122 GLU A HG3  6  
ATOM 11534 N N    . LYS A 1 123 ? -16.721 -9.659  -15.639 1.00 0.00 ? 123 LYS A N    6  
ATOM 11535 C CA   . LYS A 1 123 ? -16.568 -9.344  -17.049 1.00 0.00 ? 123 LYS A CA   6  
ATOM 11536 C C    . LYS A 1 123 ? -15.292 -8.524  -17.249 1.00 0.00 ? 123 LYS A C    6  
ATOM 11537 O O    . LYS A 1 123 ? -14.774 -7.935  -16.302 1.00 0.00 ? 123 LYS A O    6  
ATOM 11538 C CB   . LYS A 1 123 ? -17.828 -8.662  -17.585 1.00 0.00 ? 123 LYS A CB   6  
ATOM 11539 C CG   . LYS A 1 123 ? -18.986 -9.656  -17.695 1.00 0.00 ? 123 LYS A CG   6  
ATOM 11540 C CD   . LYS A 1 123 ? -20.144 -9.062  -18.498 1.00 0.00 ? 123 LYS A CD   6  
ATOM 11541 C CE   . LYS A 1 123 ? -21.477 -9.273  -17.776 1.00 0.00 ? 123 LYS A CE   6  
ATOM 11542 N NZ   . LYS A 1 123 ? -22.501 -8.339  -18.295 1.00 0.00 ? 123 LYS A NZ   6  
ATOM 11543 H H    . LYS A 1 123 ? -17.360 -9.073  -15.141 1.00 0.00 ? 123 LYS A H    6  
ATOM 11544 H HA   . LYS A 1 123 ? -16.460 -10.288 -17.584 1.00 0.00 ? 123 LYS A HA   6  
ATOM 11545 H HB2  . LYS A 1 123 ? -18.111 -7.841  -16.925 1.00 0.00 ? 123 LYS A HB2